#@P  H  H  }H  yHoHH  mH  aH  _H  aH  ]H  YH  UH  QH  MH  IH   ɡH "H H   H H   H H  H H H  H  H  H  H @H  H ! H " H # H $ H % H & H ' H ( H ) H * H + ݡH , ١H - աH . ѡH / ͡H 0 ɡH 1 šH 2 H 3 H 4 H 5 H 6 H 7 H 8 H 9 H : H ; H < H = H > H ? H @ H A H B H C }H D yH E uH F qH G mH H iH I eH J aH K ]H L YH M UH N QH O MH P IH Q EH R AH S =H T 9H U 5H V 1H W -H X )H Y %H Z !H [ H \ H ] H ^ H _ H ` H a H b H c H d H e H f H g H h H i H j H k ݡH l ١H m աH n ѡH o ͡H p ɡH q šH r H s H t H u H v H w H x H y H z H { H | H } H ~ H  H ҡH  H  H  }H  yH  uH  qH  mH H H  aH  ]H  YH  UH  QH  MH  IH  EH  AH  =H  9H  5H  1H  -H  )H  %H  !H  H  H  H  H  H  H  H  H  H  H  H  H  H  H  H  H  ݡH  ١H  աH  ѡH  ͡H  ɡH  šH  H  H  H  H  H  H  H  H  H  H  H  H  H  H  H  H  H  }H  yH  uH  qH  mH  iH  eH  aH  ]H  YH  UH  QH  MH  IH  EH  AH  =H  9H  5H  1H  -H  )H  %H  !H  H  H  H  H  H  H  H  H  H  H  H  H  H  H  H  H  ݡH  ١H  աH  ѡH  ͡H  ɡH  šH  H  H  H  H  H  H  H  H  H  H  H  H  H  H P áH  H  }H  yH oH H  mH  aH H  aH  ]H  YH  UH  QH  MH  IH   ɡH  "H  H   H  H   H  H  H  H  H  H  H  H  H  qH  H ! H " H #H $H %H &H 'H (H )H *H +ݡH ,١H -աH .ѡH /͡H 0ɡH 1šH 2H 3H 4H 5H 6H 7H 8H 9H :H ;H <H =H >H ?H @H AH BH C}H DyH EuH FqH GmH HiH IeH JaH K]H LYH MUH NQH OMH PIH QEH RAH S=H T9H U5H V1H W-H X)H Y%H Z!H [H \H ]H ^H _ H ` H aH bH cH dH eH fH gH hH iH jH kݡH l١H mաH nѡH o͡H pɡH qšH rH sH tH uH vH wH xH yH zH {H |H }H ~H HҡH H H }H yH uH qH mHHH aH ]H YH UH QH MH IH EH AH =H 9H 5H 1H -H )H %H !H H H H H  H  H H H H H H H H H H H ݡH ١H աH ѡH ͡H ɡH šH H H H H H H H H H H H H H H H H H }H yH uH qH mH iH eH aH ]H YH UH QH MH IH EH AH =H 9H 5H 1H -H )H %H !H H H H H  H  H H H H H H H H H H H ݡH ١H աH ѡH ͡H ɡH šH H H H H H H H H H H H H H H P H H }H yHoHH mH aH H aH ]H YH UH QH MH IH H H H H  H H H H H H H H H H H  H !H "H #H $H %H &H 'H (H )H *H +lH ,١H -աH .ѡH /͡H 0ɡH 1šH 2H 3H 4H 5H 6H 7H 8H 9H :H ;H <H =H >H ?H @H AH BH C}H DyH EuH FqH GmH HiH IeH JaH K]H LYH MUH NQH OMH PIH QEH RAH S=H T9H U5H V1H W-H X)H Y%H Z!H [H \H ]H ^H _ H ` H aH bH cH dH eH fH gH hH iH jH kݡH l١H mաH nѡH o͡H pɡH qšH rH sH tH uH vH wH xH yH zH {H |H }H ~H HҡH H H }H yH uH qH mHHH aH ]H YH UH QH MH IH EH AH =H 9H 5H 1H -H )H %H !H H H H H  H  H H H H H H H H H H H ݡH ١H աH ѡH ͡H ɡH šH H H H H H H H H H H H H H H H H H }H yH uH qH mH iH eH aH ]H YH UH QH MH IH EH AH =H 9H 5H 1H -H )H %H !H H H H H  H  H H H H H H H H H H H ݡH ١H աH ѡH ͡H ɡH šH H H H H H H H H H H H H H H >;;;;; ;(;0;8H )@`  >! !C >0>+0;"+4+ >``΁` 0΁1% !>&;8>>)@09`")@)@ >΁` 0΁1"; > 9`9`9`9`9` 9`(9`09`86`@!`xH )@` !!! P -@ @ @"P/>P-> %)> x %"+/>->+cP> #`"##t@> "d;x ;"`;" @i@Ҋ@@2 @ 0P -@ @ @"P/>P-> %)> x %"+/>->+cP> #`"##t@;x҂@ ;Ԃ@`;"s  ւ@ ؂@ " +> `* -` @hːt x ``-` @h tx ꁌ P -@ @ @"P/>P-> %)> x %"+/>->+cP> #`"##t@$;xԂ#҂;> ;%ւ&؃ ;`#h#l;;;;@T``htx ;`#h#l;;;;@Rš``htx )>% @)>%!< P -@ @ @"P/>P-> %)> x %"+/>->+cP ;`@;h#t;x;;;;;`@Pl;`htx; />->+cPۜP -@ @ @"P/>P-> %)> x %"+/>->+cP ;`@;h#t;x;;;`;;@T;`htx -> -@-P -@ @ @"/>/>/>6PP-> %)> x %"/>/>/>P;x> #`"#@;,/,;@ ;`,)>!;h %)> x  #p "`@ x  +?P`-@-?P- %0P -@ @ @"/>/>/>6PP-> %)> x %"/>/>/>P;x> #`"#@;,/,;@ ;`,)>!;h %)> x  #p "`@ @`xF P -@ @ @"/>/>/>6PP-> %)> x %"/>/>/>P> #`"#> * * ;`@;h09P -@ @ @"/>/>/>6PP-> %)> x %"/>/>/>P> #`"#> * * ;`@҂@ Ԃ@;h ւ@ ؂@@f`h > `* ρ P -@ @ @"/>/>/>6PP-> %)> x %"/>/>/>P> #`"#?p " ?P "  ;`@$Ԃ#҂;h> %ւ&؃@gm`h ?p "  @/> @̀-> $)> x %->+cP-> iP @ H ,@`#>`$` (08 @̀K)> 0/>+0;"+<++>`` `  05-) % >&w 8 >/>-@0=`"-@-@+>`` `  05-"T  ->%- +cP ;`@;h #t;x;`;;;;@N;`htx ->& 0ʦ! H,@` !`hpx (08@HPX @̀H,@`%> $ (08 @̀@ @̀  H ,@`#>`$` (08@̀026?@ @̀K'>0/>/0?"/`` `  05-)$>&' 8>/>-@0=`"-@-@+>`` `  05-" ?  H,@`#>` $` (08@̀ ->  @kP->"/> 4  ! H,@` ! (08@HPX @̀>x `?* `"" * `@">  * `@&* *  ֊@* "``(  `   c  mt@ >   >  @@   >  @@ #>%> '`@`@ !>#=%=@4 ,A '`@`@ !>#=%=@4 ,0, *H Ѐ(H+ `!Ђ* ր  Ԡ҂2`*`D4`@ D֠ 0 !Ђ* ҂2`*`D4`@ D>!ct@>" >" ( *>" ,!`>" 0H(  /  > ==>PH >" 4> y#> a@k"@!> $"؝H``> "b  !>" \!>#!$ $ @@6d#@+`;h;p;x;;;;;;;;;;;;;@L@P@ `hpx gP   > *>& >"@s'!copyinstr>@ * > >"@s"copyoutstr >"bl#  J@*@`  ?"@ 2"#   J*@`4  ?"@ 2">"@r"copystr> * > >@ *> >"#4@" >" >"   >4``6  >` >  !!`> @,> !`"!> #`"# >  >>!l`2$j0>#@r <>#@r F>#@r Sswitch rqswitch wchanswitch SRUN> >: H>l" (o!l`j> "> :">%"2J "2 J    "2 J  J " > a+  @ #@"   *@ * hH- > "! `!l"B"j > "l`""lj ` *@  ( !> !l` (08 2㿠@'>`` Ъ@@"Т@" H"  hG`>   >>#4" " " ?" ?> >>#@" " > >>#4" " > >>#4" " > ؀ >>#4" "" > >>#@" 2" > >>#4" 2" > >>#4" *" >>#c4" `2 `2`2" >>#c4" `2*`22`2"" @>#c@" Њ@" " @""@" "`""@ 6 :@ 6 `6:   6  J?*@``";" " J `*"J*@ `"" "R2@ `4"R2@ `"" ""@ `""@ `":@ `""@ `R2@J *`2J*@   6 " J"`*@`"(" " " J"`*@"" J"`*@"" "" R"` 2@"" R"`2@"" "`"@"" R"`2@2J?*H@ `*  @ : " : : : : : (: 0: 8: @: H: P: X: `: h: p: x 2@ *  @ 2* H@ `      ( 0 8 @ H P X ` h p x >``"!0>``"0 H > *H > +*?p` "@?p`"@@* ?P` <@ "@>% "2 J "2 J   "2 J  J a>` """"""""""""""""@2?# * 2  `c  @ `> ? >  "Ȁ @ 3 >!T c@  Њb@&""""  >ax@ @> b ``44: " longjmp botch@" `&"`㿠>&@o-!p6 0drivevectluntargetleveladdroffsetslotleam7990_config: weird memory size: address %s %s: %d receive buffers, %d transmit buffers am7990_config: can't establish shutdownhook㿘@  < & (>* & >*#d& >* 4& ? "6 X (@o@! @" @" >& @ @@" >&&! &!&!  &!&! &!&! &!@n"  !>&@I"H@o>&!"X!@o >+ @W & >&@n"&!( !&!,!*  !&!0* &!4*` * &!8㿘H o*@g@H 0h7 ɢ ȑ* @7 ː ( ʕ*@ 7 ͒ ̗* @7&!&!$!&! !,&!@7!2?* 7!!0@7!2?* 7!( ؟ ! 6! Ж !4, ! 7Е2/Ӕ /Ҕ:77!,  ؟ !f!  Ȗ !8, ! 7ȕ2//ʔ077!0  ؟ !f㿘   %s: card failed to initialize 㿘    d!  p!!(   , 2  4 u d   a" € !?2  € !  !B6 V X (`@ {@96 X >'"@n  `@%s: overflow %s: receive buffer error %s: dropping chained buffer %s: transmit buffer error %s: underflow %s: lost carrier %s: excessive collisions, tdr %d %s: memory error %s: receiver disabled %s: transmitter disabled 㿈 € `  @@ * 2 @@ x & x@h p & p>( @n; 0`  `>( @n3  p`" p d>( @n&  x`" x ~  > !#5>  !,-   ܟ  @   >'#@m  >( @m  p  >( (@m  p!4퀢%ۑ- *    >b@Cf  4 H /* ' 5H 0 $$  $  4  @ْ   ( @  `$ $  b'  x$ 쀢 & >b@C,  4 H /* ' 5H 0 $$  $ 4  @c ˢ l쀢 :9H /* '   @ $ > #̒" > }"ؓ2`  *  ?%  &H 0  "  $ ($ $ $  4   2($  @ $%쀤`2 l p  & p`& l`@  (@Δ /:77 ؟ ! " &!b"o !$ c! !0,  ܟ@ ꀊ 2X&! X ;6 Xꀊ @8 @>( H@>( h@l 0@ƀh" `>(@ x@l֒ @ | & | >(  @lƔ  | & | x & x   | " t | & | t & t! " !$? &!$&!@( (!$ "6 V %s: device timeout 㿘 >*` @l-  P`& Pmissing buffer, no_td = %d, last_td = %d 㿐 0 $@ @ >  7>  0-` ܟ "   0$6 0$>* @l_ p ` ` & & "` ?& `  /> >"-`8*  `  `  H /* 'T`*`@?2@H 0 ` "%T`H /* '`̒"@> }"ؓ2` ?* *   `"@`%ᰐ %H 0 T`* @@C2` ;   <" < 6 . / 077؟   H`@" $  `$$ 0$6 0$ 㿘H /* '  (@ G !@"" 0 ! @" 0;  !1@$ !2@! 0  6 0  @*m0"@  2 0 0 ?6 00 !1@@W (@ (`4 H 0㿘d㿘 0!2<"6`6`6`6@   *;n #  @b  &?    @23 <2@2*  @ * @6@   ܐ 0 = 6 0 0"6 0?6`6`6`6@㿐!'@㿐!'ݐ㿐!'@b㿘#> a   @@  > }aԗ*@a"  "   "  "   "   "   "}  "y  $ "u  ( "q  , "m  0 "i  4 "e  8 "a  < "]  @ "Y  D "U  H "Q  L "M  P "I  \ "E  ` "A  d "=  h "9  l "5  p "1  x "-  ")  "%  2&  &3>`, @? & 0`, @?  & X & & a `$a$  0@Ax  audio_hardware_detach: null hwpaudio_hardware_detach: invalid audio unit㿘 2 >,@i5!0> !@$> }>,@i-!P"ԑ*` "   2 $  0@AB  X@A? @A<   * "㿘    0   @@㿘    0   @@㿘  0 @ 㿘  0 @o 㿘 ```` 0   @@Y㿘  0 @ 㿘& & > ,@^& $@c & @ & & &㿘 > ,@^  (  P4 : & & audioaudio_open: hardware driver returned 0 for get_precision㿘 4 > }"ԓ*`@  `2 `   € `` ` ,` ` ,` 2,@(€ @ € @! €#@@€#@@0€  $`$`,@@ >-@g! @!> $!$`@p,@@&`!@]:`@$`@@bO $`> ,o$`L@@H /* %$`$`|$` $`$,`x,`y @N     @" `` ` ,` 4`l 4`D@0  ,` 4`D 4`l@H 0 㿘H /* %   .  t    H 0㿘H /* %&  &   . `t  H 0aud_dr㿘 ` $  $>.!>!P*`" * >-! & $@U! & $ ` >. 㿘 > }"Ա. &  H /* % y   ` $  l 2 Ð 2   `" @ @``  .   . H 0 aud hraud rd㿘 > }"Ա. ```( ` 6`, `(> ," `@ " $` 2 ` "}%>.H /* %`  7` >-! $`  ! @T 1$` ` H 0@ߔnH /* %` ?$`H 0`Y0H 0P #H 00HG #H /* % `x  @ϐ>."` >-! $`  ! @T= $` H 0 " ׀ X @`@Nc :$?$`6㿘H /* %  x?@" & @ `d@ `h@. x. y& @& 8& h& `&  0&  X& ,& (& T& PH 0㿘 `@>@a`(@`o#谒" `4@@a`,@&`@`:`%>,2`@:` 4 `8€, 4 㿘 `P@ .@`㿐  `P@ '`2 .  2 &?&   Ɣ "0u   $$ &`B >audio_alloc_auzero: malloc auzero_block failed㿘!> #  @=  @< $#>0@em @`P@  @#*`@`T >  aud wraudio_write: overwrite tp=%p towrite=%d ep=%p 㿘 > }"Ա. `P  "``  :`&` B>` #`  @>0!$>-! $$ ! @R y$$@쀎H /* % > ,"@ ? @@ $|H 0`@  >0! @e@@L%@L" 4`T H /* %   ?$ :$ $ y @H 0` 4v㿘  > }"Ա. a@ N @ 0!@" 0" "}@50!@" !@u!@z 0!@"`  !@I!@"A H !@"q "!@"6 pu !@So  "k&   "g& f  H /* %   y 2 @ `#` `@0C&A&H /* % | h  , ("> ,"@ ? @ &H 0&@@ @62``"@`x `&`|€㿘 > }"Ա. H /* %` `" 0 "8   `@ H 0   @uH 0 㿘  >2``x ,@  `0. x㿘 ` >2 P \ @    . y \ : X& P㿘 `@" `㿘 `  P "  l  P t & t>2\@  \: X h & P  & h`&  p & p> >2c\@ "   &  " 2 @4 $  $@RZ& $@u    "@G    @RG& @t   @Gܒ 㿘 , D  (   L 2& L 4 : 0 8 <  & 8>2 `x@ " @ @  & @ H. x & H$`  @R & @t   @G 㿀  `8 @?"@€  2@@] & ?`2i €  2Ͱ@@] &  ?`2S  €  2 &  ?`2A  €  2 &  ?"`2/ (€  2Q> "!& Ӑ,@&` @W:`& ݐ?"`2 (€  2o-> "!& ,@&` @W̓:`&  ?"`2 0€  2K > "!& ,@&` @W:`& ?"`2Ð0€  2'> "!& g,@&` @W:`& q ?`2 <€  2?`2D€  2 ?"@@' ' ' /€ 2ް?" 0H@' ' '/€ 2ɰ 0 " 06 l 0 2 0H /*%H 0 0 "`t6 D 0 2`tH /*%ƐH 0`t?1`2`t%`t` >  !> , 2  : 88€>`, 4 & &`t ,@&`@Vד:`& Đ`x" `| d@8&`x "`|`x& `|" ` d@8&`|`|& `" ` d2  : 8&``& `?`2`͐`   .   .  "LWL@ `" H /* %  I 0H 0 㿀 `8 j  @&@ @&`8 4@&`<&` ,@&`@&` $@&`  $@&`D H@&`L @@&``L '' ' €  &`H`' ' €  $` l,`0 D,0 p@ ,`1 H@ ,1 2  ,`6  ,6 h t" $`( @ L" $( |$` $ &`t &`x &`| &`  &` 4 > }ԇ(2 @?  㿘 > }"Ա. 0a@  @  00!@" !@  !@  x  €0  €  L@MSG_INMSG_OUTUNSPEC2UNSPEC1STATUSCOMMANDDATA_INDATA_OUT㿘 H @  *@$B H T @ @"= H @> T `   T ? 2+ H T 2  2$ H D*@ H`* T > X ` , `j  T ? ` H *2 H4 T H `*&㿘 H A  T @ @"=& @> T ` ?  T ? 2+& T 2  2$& D . H`* T > X ` , `  T ? ` H *2&4 T&㿘!" ? 6"  ` ""? 6""`  . . &#&  P *@ H* L* T* `  T *@ `@㿘! H * H* L* P *@ ` aȐ"㿘    `@@  @  @ݐ㿘 `" @   & # 2   H   ``*# &#@ϐ `@ncr5380_cmd_timeout: no scsi_xfer %s: cmd timeout, targ=%d, lun=%d 㿘H /* %  >6@_Đ"0     >6# @_   &  2`  `*`@*  "" @rH 0ncr5380: scsi data uio requested%s: polled request aborting %d/%d ncr5380_scsi_cmd: polled request, abort failedncr5380_scsi_cmd: poll didn't finish㿘 >`` ` 2`d>7@^T (H /* %`  ` >7`` P@_K >  >7@^8 x ` *` -  $   "` "`"`  "`$"`4` "`?"`   $  `2$" `@`   >7@^ H 0ncr5380_done: state=idlencr5380_done: current=0ncr5380_done: dma free did notncr5380_done: sense asked for sense %s: target %d, bad status=%d ncr5380_done: bad state㿘 2 >7@]Ð"` >7@]"` @ p@` " >7@]" ,  $,, 20 ` " `!  $ >7   $,`  >7@^"$,$`& & ``*`@*  '"">7`#`@^  $, 2& >7@]p#(>6#D``** @%"$@ ?&  `@d" & ncr5380_sched: not idlencr5380_sched: current set%s: reselected while polling (abort) %s: select found SCSI bus busy, resetting... %s: ptr but no data in/out flags? 㿘  ` @ " >8@]! "">8@]!(* `  " "* ` "``,,@b 2&"ఠ    `@0& @ `   z>8!H@] 4 ,@, ""&  &  `&  &# &#&#&#```"  % ,2 % ,>8!p@]Œ % ,& &  &#&#&#&#   # & `=&#; b# 3&#@  >8!@] &  "  l"    @& € "   t`" @   > @WaP@R#>6#D@$_@P "J ncr5380_reselect: current set%s: reselect, BSY stuck, bus=0x%x %s: selected as target, data=0x%x %s: bad reselect, data=0x%x %s: reselect, SEL stuck, bus=0x%x %s: reselect, no REQ %s: reselect, phase=%d %s: reselect, not identify, msg=%d %s: phantom reselect: target=%d, LUN=%d 㿐 " T>9@\  > @ X`>9줐  T ˀ @2원  D  >9!0    *2 $*  >9!X@\ 0!x @\ޔ H H *@ T >   X`>9j  T  H* T* `  T > T ` U  T ? >9!@\ U  T 2  >9 ! P * D />9!@\ > ,@* "0>9 &  &  & @&  &#&#&#&# L  L $*@   t`" @  0,! @\_!0$! @\X  H`&  *    &#&#@ P *@ T* `  T *@ ?& 㿘   P* H* L*H /* ' D *@ L *@ H  @  $ H뮐  H @?말  H @ 2  H *@랐  H " L H* L*H 0֐Q * T*H 0 ` *  D*@ H *@v  H *@q! T @#? $ `e  T H *@^ T @2 H P *@ H* L* T* `   T *@0 H `*   L L $*@ %s: unrecognized MESSAGE EXTENDED; sending REJECT %s: unrecognized MESSAGE; sending REJECT 㿘  P *@ H# ` #ؐ<0" ?&  #&# T @ @"  @> T `   T ? 2 T 2   2 X " # 2   H   ``*#  &#`&  2= H`$## 2   H   ``*#  &#`&& ` D&# @` *#Ѐ  (7#Ѐ 84#Ѐ`#А +`$  H#Ѐ 2 H#ѐ @"!# H* T > X ` ꋐ  T ? 2  H*"t T#Ѐ` <>;#D*`@lt|NL#  # H   ``*W#<# ") 8 H %  2%  &  -& #Ҁ  >; >; X@Z # 2  H   ``*,# # ` &  H   ``*# &# H* T > X `    T ? 2  H* %s: SEND_IDENTIFY while not connected; sending NOOP %s: unexpected MESSAGE OUT; sending NOOP %s: weird MESSAGE OUT; sending NOOP 㿘  P *@ H @  *@#   #̐#Ā@|<"## &#&###  &##*#&#@ # O&#><"l*@h8L\DT`2 ><! ``  `         ><!X@Yǒ  .# ><!cĐN&# @ @"R @> T ` L  T ? 2@  T 2   29 2 ## 2 #̤  H *@/# D&# * H* T > X `   T ? 2  H*2 `4 T# N   H *"㿐  P *@  /    + / ////   > @` $ , # ` &  H   ``*# &# %s: sense phase error %s: aborting, but phase=%s (reset) %s: data phase error %s: can not transfer more data 㿘  `>=)!  4 P +@> 0U  >= `>`0* "@X H 2   @>="8 4 >="P@XӒ $ "  P & P x@) `*   d   h   @ $ " $ # ` $  H   ``*?#  $#ncr5380_status: none? 㿐   P* ֔  >>& @X ( ncr5380_machine: state=idlencr5380_machine: no current cmdncr5380_machine: unexpected disconnect. %s: no REQ while aborting, reset %s: no REQ for next phase, abort ncr5380_machine: Unexpected phase 0x%x %s: parity error! %s: reset SCSI bus for TID=%d LUN=%d %s: %d extra bytes from %d:%d %s: Target %d LUN %d stuck busy, resetting... 㿘 `2 >>@W  >>@W  `u T @ @>>@X  А $,`` @>`  P?   L>>!(5 瑐 d T ? T 2   $>>#, @((<L||\lђ/u+='#F>>!P@W # ` &  H   ``*P# &#>>!@W `&#`") X   |@ "   &  @ ` `" X#    H   ``*# &# X >>!x@Ww #    H   ``*# &#`V`  `  & >>@WZ!``  `>>! @WJ &  r$(`0> T T @? >>Ԑ  T!@W0  H* L* P *@ T* ` ` T *@2& & & & &  &#&#&#&#㿘 ?. .   @LJ@.    *` * 㿘>`` `> y#̀ "`> y@ #> y cؖcؔ+cؔ    *  *@  ` *  cؒ@ `+cؔ    *  *@  ` *  cؒ@ `+cؔ    *  (*@  ` *  cؒ@ `+cؔ  +  *  (*@ ` @  *  `㿐> y"cȒc"`> z "` > z  > zb`  "`+?@?ސ> y#ؒY  6    㿐@?ʐ  . " 6? &      & c `*`;  *   `*`  *   * *  + 3  "   +@ " 3@ `@&     & c `*`;  *   `*`  *   * *  + 3  " ` &" @#@&@``"@&` &  4 : ` :``  & &    >`d `d?"`d@C 㿘> y> z#Ȓb\㿘> y> z#ȒcS!㿘> y#Ԁ`#Ԑ6 6 6 > z b>㿘> y#Ԁ`#> z?c 1#@> y#Ȑ> zb'` 8$``2` .`"@k$`i$`@D `  @D@    ?`*  " 2@ ? $@` `  $`  ?c `*`;`  *   `*`  *   * *  + 3  " ` @Dz   `?  * * `? @&@> zb`@L Xrndrd@`    .1> y` "@8 Ho o>A#(0   > y#̀ `ި #> d!  d>A# d@A > y#̒2 @8 > y#Ȑ> zbZ` 8$``2` ,"@k$`i$`@C `  @C@    ?`*  " 2@ ? $@` `  $`  ?c `*`;`  *   `*`  *   * *  + 3 @" ` @C   ? @* * ? @$@> zb@K3 XB,: ??:,  }?$~?00>```> y#̀ "`@@#؀> y##ؔ.#ؔ    +   *@ ` @  *  `,  #ؑH 0 @:"```  > ỳ@ 㾘@=BG > y#ؒ!㼘  2`y  t '> y` _"@8 *`2`@:P     * 2 `*> ,`2 @ > > y#Ȇ +`>*@  " 2@Ș ? $  `@c `*`;  *   `*`  *   * *  + 3  " "`   @<Ē > y#ؒ7!㾐"@"; "@"+ I "@ "@"  > > y#̒? 8@0k 2 - > y#   " "@0V  > y"# @0L  > y#̀ ? #@ y#ؒ!    |  D ("  @8 @ "8 "" 8   ` '@'`'?#@  8 |'  N >`a'' @''a'* @@ఒ<@x 2 @@? #>a'a' * @@@- -`*  %>a\'a\' * @@@ `  2>  >a'a' * @@ >@ @E`>  >a'a' * @@>a\'a\' * @@ఒ|#@`!P' `M =`?'` ?'`   ("$ , @$ , '̢ $ , :>”''?''* @@ఒ> cx` '̐ "` @ ,`'Ā ܀ " ,@ ,>”: ''?''* @@ఒ[ H   , * | ` @ z` 7ږ!s`!P H  2` ``?@^ M .ڀ L!` ڀ`ڐ@Q$ 0 rL! o`9 ,@ϔ! `  @: T* $ ,2. ,! ,  @(T* $ 0ږ 0@R`2  @Hf V̪  ,@$ , ,ZĀ`+ , E$ 0 :@>@܀ @?>>”''?''* @@ఒ H  $ ,`ܚ ' ($ , "`@`@@@`` ?̀` > cx` "`  ` ,$ (9>a'a'* @@ 0@ @ Ö@ @܀  >a\'a\'* @@0M`= :>a\'a\'* @@ఒ/@07  0  @@"#@@@ @ @܀  `> 2 >a'a'* @@#@`@@@ 㿐  |  @D`  ?`@@m "   ``H @# "@㿘>!h> } 9@7p> "c<㿘6` > } p @ > #<*` 2  @2 2   & @= > }  @ > }cd9660_ihashins: already locked㿘 >  > }`p2  <* `"`&& "  ">>F@Nѐ"!l "? 0& 4  &     "" cd9660_inactive: pushing active㿘 > P   |V  >F#@-$ V   ` @ cd9660_reclaim: pushing active㿘 > P   |V  >G @ @ " |@$  |@& :& | x'    6``  6`l`@   >``.  :''?'' * @@􀦠< H 26  @ `` 6``  2 `` 6``  2 `` 6``  2 `` 6`` @2 `` @6`` 2 ``!6``  * @&`d  * @&`h &`d``&`h!m6`` @+x'􀦠! `@  ``*  :>”''?'' * @@􀦠& H 2   =`H@  @ @`X  `H`L&`X&`\ @~`P  `X`\&`P&`T  @`X`X`\`X&`H&`L`\&`P&`T @㿘     l' &@&`@ `  ĕ* *" *@C*" *` , d:@C &  * @, ,`* * " < @C&?, * * "@*`@*`" * 0 d,"* * "@&@&`   * ( ?А㿐 ?/  /  /  / ޒ / ڒ / /   (*  (` (  @(2`   (*  @("d   (*  @("h (@2 l` "`RRIP without PX field? 㿘>H@M"@e ..RRIP with incorrect flags?㿘`$`0  `( h>H#Ԁ`  `,@>H` /, >H#( @ * $$$X$$`$$$$h$$$$$$$$t$$$$$$$$$$$$$$$$  $ `$   h@D@>  > ~ !h   >H@Ms#0`, `,@@8   `(&`$2&`0   0 &`0`(&``$ " `(&`$2@`  ?&`RRIP with incorrect NM flags? 㿘>H#(N ` 7 >I!̓*`@&x&t&P&&X&&&&&&&&&&&&&&&&&&&&&&&&&&&&`  >  > ~ !h   ?>I@M!x`, `(@2*``,2`@ ``( ?&`@`$""@`(&`$2`$ڳ`$&`$ `  ?&`㿘`$>H #(*#( * *N !    !  `$ `(@ `0`( `( 2@   (*  `(` ( `"`JC  `( x0"`㿘  *  2 " @@ `P  @C P  @ ڒ`H @ P T" H" L  /@̒`X0` 2  " @@ `P  @CW P  @ `H @ P T" H" L  @`X`@ P T" X" \` ?&` 㿘@4    (*`  ( (@( @(@2 ( * ` p "㿘 `? @`@&`!a   (*  ("` * +   *  ::`   (*  ("`$IEEE_1282IEEE_P1282RRIP_1991A㿘  2,    2&     >JcH@B 2   2` >JcX@B֔  >Jch@Bϔ  `" =&`㿐' `!`L! 2`   `*` *  !H*` "!X`!T  ?# ,&`  "`LJ2L J@ ` " € (` @: ` ,`) ``! :`8 B   ?+ @ `H`   @5  2 €  2 `''ܐ 'Đ>\h`'' 7''ܐ x'6> !`  ؐIJ` ?'Đ@`''6$7 ''ܐ 'Đ>.X SP`&aX ">Kc@A    &aX 1@Aڔ  2?'ܐ"'Đ> "?  G,R J`;( H ;D ?  Є 7+  (В  / ( ('# `  ` ##  $ ." ; ?# `$  =* `    * 2*. ; 2*;*`@ & 2cd9660cd9660_mountroot: can't setup bdevvp's/root_device > w>"> l@a  >L> y#!> @!( >L@H"@!  @w @@! >!$ $$'!(@ @  @!@  01> h$`$h 2`"h"> "!l$ >L"hh Yճ Z`h@@$ >L"p” Yէ`@@$ @2@@1    թ pa`@[ @   @O&$ @&(&&@&,C8 "<@:  > r#|@&@0 @@2  @,  @u h Y Z`h@@=$ ” Y`@@3$  @YCD001x < `'ܮ `   @X@7 > !(   @   >aP'''?'aP' * @@ఒ޺ (   @?@ܰ>Mܒa H @@  2   ܢ@@c 2  * @~?"@@2 !\ 9@J @?!\$  Q$ P " R+  +` S +  {$ * @* @ * @$H *` *  *` $L$ $   $* & 0`" 0@'&a&`<>L@"8&`@&`` &`$$$  <` "`l 2$l  `?H@@1+@ % H $Tl l ?&l 0`" 0@q'l ``$` $P $P#  ܀ `@[`  >a|'''?'a|' * @@@7 9&a㿘 @p($ D  ,`$ T($ < T$ 0@Aq8$ @@@ C>Ma H @?*  < 7 ``c$,` /  * @?"@$" (@>k  8@>g & .&. 6&@& !W&&< <&@>@&6 0@ " 0@ް 㿀 6`@ #a  <` ?"`> a|'' '?'a|'* @@@ @ 9$a`*@$`㿘!!$^!P @`? -㿘!6@ &`&` &` &`&`&` @ &` h`L0 Z ’`, Z `<@@= &`,  㿐!@d` 2   ` &`| `  &0'4'@@6 & F㿘 @. fhtovp: lbn exceed volume space %d fhtovp: crosses block boundary %d fhtovp: bread error %d fhtovp: directory crosses block boundary %d[off=%d/len=%d] p!ː &*  > @ǖ t& :@h @=֒ t"`|$`$`$` 2D'6@ &@>O" @! $  @>O"8@F F0/ ?@ @@>O"`@F0 H  @ ">O@>O"x @F Ͱ F$` @$` !6@`$`D@ >'؄  ?'''`* @@ذ@r0 H   *` *  *` $`<   *` *  *` $`@ `< $`D# 8P / "' "'*  :>”''?'' * @@#Ԁ " @D  "``@9``< @>#2` @`:"8>P"*`@CTCTCTBBCTCTBCT@3 -> a" `p@7"`<>a'a'* @@ |$ |> b\" |@" @E'$`ݐ`<H@@ "@ & | 2@"`D "`  㿘    |`d@h`   |`$ `$ ``4 `l4 `d$ `h$ `H$ $`L$ (`P$ ,`T$ 0`X$ 4`\$ 8`p$ D`@: < `@ 21$ @ < ( 2*$ @$ T@ '$'' 'Ę  ?'' ''А' ' @1' Д$  :< @q T$ @ $ <` $ `@: < H 8$ 㿀   *`| 6 @_ 0 %@9    "   @: @b   f `<a < > > ,'(  @* ( :`#\  @?!`   @*   '?#\@#`?@%` @$@ 8  H@+ِ@  2You did ioctl for isofs !! 㿘>Q@D#    㿘`@* `  ? 6`#0`@& &#@#D`"`#H `&#@?&#D"@#H?&#H`#0@+ 2>#8 㿘"" N" =`?  " !!? 2!@; ""!  # ! 2#.!   # ". "   ? 6""#(!"># "#(b:c ..p'`|#P` T @ ,!, ,",!, $#0 $#@$#D$#H @ <#(>''?''`* @@ذƒ T `@"#(  2 H >@ >#(b''?'b'`* @@ذ  H 8  #(:  Be<#( Đ  4j  ` ," !&d  ` $" T* $"#( B<#(!P >R"֖," 1#(+!4"! ,"L`!   `! ,","!P" " `  `?1 `,"!P #(" #(=e #,_  !P  ,"ϐ&  "#8@c#8>#@ T"@O㿐  |`!P  T  ` ? 3 + @ )`   H @ @     $ @ -    @ @ 0@   " & @ "@` "  "`@)@ 㿈 > `''`'* @@@  㿈 > `''`'* @@@  㿘  $@  locking against myselflockholder (%d) != 0locking by process 0 㿘 >!l&@0? !" x 2 |/    ` $ `0 4@2$ 8>T@Ae ?$ 8 4`$ 8>T@AZ ` ?`0 `>T@BZ 8`?`0$ 4   $ cd9660_unlock: unlocked inodecd9660_unlock NOT LOCKEDunlocker (%d) != lock holder (%d)㿘 |>` !l>T!X@ >T@A!x " 04@  $>T@A!"4 `" "@0C  cd9660_strategy: spec㿀` \8? |>T@@"h T P2# T>a'''' T'a'* @@ఒ"  T$ 4 0h" 0@l?2 T H@8 <$ @ T? < $ D>#* @@ @ tag VT_ISOFS, isofs vnode 㿘>T@A#  | `+>U(TTTT4ThT|TT`|P`   %   ` $  ` "  `     -㿘` `, @?2@ "!""!0"! @" @ @@z @`exec: a VTEXT vnode has writecount != 0 㿘`&`(``(&`,` &`0``  &`4`&`D` ` `  R` " ` @ d >U@@ !@ "@``@*`@P``` &`* @*`>X " ` $ `($ ` $ @` $  $ ``@*`@1````&`*` * "`$ `0$ ` $ @` ` $ $ ``@*`@`` &`* *>X`!"@ ` @ "``0` "`"` "`"`@㿘`&`(`(&`,@#@2` *` &`0 ` `&`4 &`D@ސ``` &`* @*`>X "  $ `($ ` $ @`  $  $ ``@*`@````&`*` * "$ `0$ ` $ @a`   $ $ > ,`0@?@9@:]`4@ $@```@*`@`` &`* *>X`a"  " " " " " @ 㿘`&`(`(&`, &`0 ` `&`4 &`D@b``` &`* @*`>X "   $ `($ ` $ @`  $  $ `0>`,@?@9b@9`4@ $@`$``@*`@.`` &`* *>X`a"  " " " " " > ,`4@99 @9Ւ, &`4@#!exec_script: copyinstr couldn't fail 㿐?`H? %`` !>Vc@6P  "` ߰  @8 @  @ J@ "*@`@ *J@ @  ǰ  L  J@ "` "` L %  J@  `J@  J@ "`$*@`J@ "` "`J@ " `$ `J@ *@`$`, `` ` ?"` "`H @&`H  ?@̔ $@`@6`  ?@” $``@5$ ?@ $ @$ "$>V@>#`&`  4>` a'a' * @@@ 2"``H  &`H @@ `H&`L`$ &`H`(2``$" $- `$*" " 4`H   &`H ?&`H`P@ & ` @` 4@ @  @ ?  @ ?@0`vmcmdset_extend: not necessary㿘   >W@=# " , & ? * @2*   ,  n* @ ?& 㿘   :&   " @   `&&  @ ?㿐 `` ` #\` #`@ޒ`㿀 ``@   `` ` `#\#`   #d#h@~#l >  `a` `8  @? 㿘 ``@} >  `a``8   @( 㿘=&`8>&`< ` 0`> !  *@ &`@``` &`* *>X`!"@ `<`@@ `8" " "``8"`"` "`"```@ `C```&`*` `* "@`@@"``<`@" "`"` "` "` swappercannot mount rootcannot find root vnodefork initfork pagerfork update㿀@5>> ">@0w"!l@>@=Ð @"@@4@a @d@> `$"` "$ > ah> x$ "ah" >X"Ӕ x "#`#`$<#``$@> #` "# "$( ,-,>tV$> "" @$ ? "@> "@> }2 L$>ap2 2  "L p"  " $;`;@  `> "  @>!l< ?@& @4$ :<   P< p>  > ! + ; < X< h@1 : < ` $ #> a$ $  @> !>8 @  @ $a>`  $P$ @+$$@,@@e@@@jm>#؀` #@   2H /*'@@iH 0@)  @) > y# > >X@;ܐ"h "h `0 "`0h #> }€cЀ !> }>X@;Ɛ#cР#L@$ >ac'a'* @@@$ > "> "ax" ax"`> "##"`#> ""`"" " "$@f$ @A >X@;#(@ >Z@b0 @3 >X@;#8@ >Z@c @% >X@;t#H@ >[@`0@%@+b@@/sbin/init.bak/sbin/oinit/sbin/init/dev/consolewarning: /dev/console does not exist warning: /dev/console error %d P'Ԑ @'ؐ '>Z!''@X `>Z>Z@<9!0@<6!@0@Xinit: couldn't allocate argument spaceexec %s: error %d init: not found no initp > " `Ȑ>  > " '@I " >Z@:!>ԨaaH" ؐ -/ؖ>   > "   s/ٖڤ  *"$@ @2 $@  ?' ?!?'''@ 7" >Z!@; 2 ->Z@;">Z@:"(pagedaemon㿘> "cp> ( al"& (>Z#n`@update㿘> "cp> ( al"& (>[ ([`@H @˒ K@ $''' @ '@h'ܰ;>a'a'* @@`8     @j% #> }b >\> " >\!@m b  > " @Q> ""$b@  > }@"b(> }"   Ȕ@ @7@7  'H /* * >   ؖ"@'  ܒ"@`''А"@@'H 0 @g7 ̒@'А"?'`'?/!'>@4aP>aT@/t " 7``` @/k 7`,`0 @:7  '  ' (  ?   "? l' / >'''' '* @@ #\ #`  Ж (#d#h  @#l㿘  . @3a #  6 `   #(.` 6 `.` @.`6 Accounting resumed Accounting suspended 㾘#> b`#!> }`8 2 `  ?@` I$b  >!@4L@. d @/ >\`b> }"&$b"`/`8 2 `  ?@; $$"  >!@4'@. d @ > ">\a$b$"@9>>!!>\aP@4!@ 㿘> z "#> z@"#> "T`> >!P ""@.> "at㿘> }"P` ` ?  "`  @`2` >!l`)>  @` >  >!T@,7 2 @  >  >!T@,& > @ > "T > @> >!T`> ! "> z  > #Ѐ@"  "@" > `> }"<"@">  "К"?@  ?/!@"Ȑ ">  "@  ?/!@" "/ > H 0!@4c>   *` E 0 㿘Ho o> }"P  #>  a  $P#$aH p@Ho oP 2 H 0timeout table full㿘$ Ho o> a` >]@7"(""> }"P"P#a  4& 2 "  "" #"H 0H> }P P> 2  2 "  $  !""#!2H 㿘H/` /> bȠ"(bbb>" *!T" *" *    * " @-0 >!P#c@-(4c@2H 0㿘 ( $ > `& (  "`> "T H /*.> !t> z"#> z"#> @!H 0㿘 ( " > `& (? "`> "TH /*.> z "#> z"#@u H 0㿘 @#> z>!l (  @;X > zc? h"c L Ғ`B < > aP` 0"`> aP +"aPc? Q"c>!l > @ >  `B < > aP`  "`  >  `B < > aP` "`aP` "`>  >  > z# > z"#;  "  ` \ $ `` $ \$ \ \  @'  Ѐ 1 , Ё㿀> "T>!T>!X''>!P> !'' ' @"w fd_unused: fd_lastfile inconsistent㿐 @ @.`   @\ @dup2: fdalloc㿐 @ @`,`   `   2* ` (& >!l@ @ 2 & @@! 2@">_@6* @t@[`@@ @,`@ "H `` C>_"H*`@~p~0DX,`   +  '>!l@!@הܰ@  &`  @  @ ?*@ T  ?&' ~  34 `  ̚@ 4   ` 'ذ b}   @`@'ذ2'۰ ~   2  0T   ( & `w &T `  "`(  @ 2   &`  `v` T   `w W W @ B ?W`->``" z " v  3>( $(bd'''Ȑ ''bd'Ԁ #>( $(bd'''Ȑ ''bd 'Ԑd'''''В @d'`* @@FT " @ `# 9W    0  @ B ? &W`  ?* 2  ` >d'''Ȑ '̠'В @d'`* @@`  *`*   (  2  4# " 㿘 .` 2 $ @ @$,@ @&$  @>_@4 H  .` "$ @㿘 @ @: ːfstat8 @`*@@ 2R # ``"   >a @u @IԒ @4X 2 @ 2'`n `fpathconf㿈 @`*@@ 2R ! ` `>a`  "&  >`b8'''b8'* @@@4!P㿘  >!l@  `8`  .  2  `4$``@$$`&4 &@`@- `1*` 2, '@ t `@*²@+ے$``©@+Ғ$` $$@@@  '$@$`> a$` "a >l   $"4 *` 2  file㿐 y > Bp>!l@>b@3 8 `"p ( &@  @+y ( `" > @ $@" "@ $ aa $a" "a$  @* "@ 4  $ @` 2@&@& 㿘`"  "` "@@ 6 > p"p@ V &㿘  ' @  @++  @(&  & @" 6  & p&  & & >!p& 6  0 㿘  ' @  ֔ @  " @  `6  & p&   `c *`@ 4`@: `c@ ,` '@ m && & ,`  ` ``  2` 㿘 ?4*  #`  "$@  &  @ Ē '@ "@@  'closef: count < 0h-`"$ `( "  T 2 7  ?? 7>d  @'''А 'Ԑ'd'* @@ ?4 * :  3 6 >c@2V (/*  @2 7  ?? 7>d  '''А 'Ԑ'd'* @@ ``€ h @`'`@*@"G R C -   7?? 7?>*@2d'''"     & 7   2>d'''А 'Ԑ'  0>d'''А 'Ԑ'ؒ d'`* @@Ȱ "X 㿘 .`  . @  =  29R "" 1   @*@  2  @4&& % "   @*@"  * @4&  &&  >_@1 H2  . "&  㿘 ` `  "`` $```(D% $% (@ &` 8  İ ° >`$a''''a'* @@ఒ2 4  2 2`$(("`$` 32`>a'' @''a'* @@ఒ2 4`$  I2 > aP''''aP'* @@ఒ2t 4`` #\#` #d#h  @,#lM>` ܠ "@>  &` > `>€  2`H`H > B  ` >`D@8 `, @ `4` 4   `$   `>a'a'* @@ @ 4@ 0 4@ @execve: argp == NULLexecve: no vmcmdsX> ~h @>  @6'l >  "`h@8"h`@ 'l'p'L ?@ 'H't@!> ~"h@'''H'''''>!t''ؐ"h'> #d@?>e@0: (؀   @ @J,J    @@H ?`@ @@ ?ؐ ?'``J  2`?%'А$ <Ԁ  Ζа ?`Ц`` ?%'А Ԁ а ?" 0`в` 4  0  " ` *  "  ?Ѐ@' '@ + @ !>%`> 0> (@ 2@ %`%`Đ 2 %`А 2 %`%`  >e@/ @@  @`€@@   ''ؒ>"  $ А!=#  2ʐ  #"@ 0 ܐ@=8 ',А* ?# @ 4@u@I($@`$(D @w$(@  @(*@$(쀊,"(@ "@쀊($"`쀊$"("`(! >$(@ "` > #d@(# |@ >|' '''|'`* @@@ ,€ a(((@ $@ ?V ;؀  ?' >|' '''|'`* @@@|@ђ > #d@@ɒ ?0. @ >耢 "|@ T|@ >|' '''|'`* @@@> #d@@ ?@} @z? 㿈'`` ` ' 2W , ' *` T  @ *  @'&@u  ? (쀢 7 @'? '[  % ? &`P   쀢  ?  '8 @?㿘@@ *` init died (signal %d, exit %d)㿘 0 'H>g"P`@->` (  H H @ &  ( w`& ( D w@& (?& & >" ` 2   @>  `# ` "&`` `|2``x  @8 @J` ` " &`@` "&`@&`&` @ (  ?u:` ` "`   > "dd & d "` "d&   4`. - 8"`8 8 4"@ P`" > @ ``" #> ```H@`((" 7&`(@D `2`` H H 36   @E`  @`H& d D@- @ D (@@" @ >"al? " @a *@ ѐwait㿐@ 2`   &@`?" P   @" L - 0 " L -   @2 HL - ^ 0&`    `(' 2` `"  T  H 2 T "4 @b2t$ T4   @ H @  @ 6 `"  "`   "@ H`" L L"`L L H"@  @? `? "` @ 2 @ * "@@ߒ )>aȰ ?D"aȀ 2  H (@ 2 Hh@ ` " H@  0$ (&`    `*'% 2q@2` 2&! >h@_ "[ P @ @T @   D  H L L L H `P" H`P H L"`P`P" L" D㿘  @㿘  @㿘 @@procppwait㿘 `    @2 @ 2 >!d >!Ȑ` >i >i@,N!pi #@"   : `p4  !`t@?R #! )@ > `"> !/@ d">"!>̀@9 !0"> " + > > 0 ̀@" 0     0@̀ 4"  @$ ̀ 4"  2 0 >>  dИ >aȠ  "aȐ , ->  > $ 0 $  "` "$ $ >  0$#> } * @ $ 4 0 * @ 4"`8 0# T @ *`"  0 p * @#x$ 8 Ē H $ $ ( $  (    *  (! ( @  @$ ($  .   "` @ 2@ $ @L` $ 6$ ,$  ` "$ @  $ ` "`     ` ( ` ( $ (2 < ( $ ( < $ < < <"`@& < <$ @@ $ D P $ H P H"`L& P P$ L$ P `  &   =@鬖 @ɒ`"> ``> 0 > 0a0  "a0a0` "`a0` "`H 0. > ""ؐ" "ܒ 4  @, -H o@ `?&  ( "  03>i ax@  (  0 && Ntempxform_datatdbpfilEXT2FS nodeadosfs bitmapafsIP queue entadosfs anodeadosfs nodeadosfs mountmiscfs nodemiscfs mountexecttysMSDOSFS nodeMSDOSFS fatMSDOSFS mountISOFS nodeISOFS mountmrtether_multiin_multiip_moptionsNFS daemonNFS uidNFS srvsockExport HostNQNFS HostNQNFS LeaseMFS nodeFFS nodeLFS nodeLFS segmentsubprocproclockffile descfileVM pgdataVM pagerVM pvmapVM pmapVM objhashVM objectVM mapentVM mapshmUFS mountUFS quotanamecachevnodesNFS nodeNFS mountNFS reqfhandlemountiovsessionpgrpcredmapmemioctlopsgprofnameisonamesooptsifaddrzombiefragtblhosttblroutetblpcbsocketdevbufmbuffreemalloc - bogus typemalloc: out of space in kmem_mapmalloc: allocation too large???%s %d of object %p size %ld %s %s (invalid addr %p) Data modified on freelist: wordprevious type%s %d of object %p size %ld %s %s (0x%x != 0x%x) malloc: wrong bucketmalloc: lost data㿈`U.`> #@>k@)c#(   5 3  @0 . "!) ' $$ "      @     ,>  @H /* '@ ?#>!Ѐ  4  .`@ @ *   $  2g> ,.` $ ?@#\@#  > !>`0+>`(@ : @<.@ 2 >k@(А# >  $ > #8`(&: * >`,2*`@ ?#@$2>k@(#$ 2   @#$ "7o"$ @@   * @6`"@&`&`  "$  $ * 2` T>!Г:`@>l P>l` :>l`@#`@)}#d8&@>k#  @֔ ?#\>k#>l`  >l`@@)c#`$?"` `  6`7o"  *   7o"2#\ *&@> > #8>`(&: * R@@>l@(+   ?>l@($ H 0 2 ?$  *@$  $  $`$$H 0free: unaligned addr %p, size %ld, type %s, mask %ld multiply freed item %p free: duplicated freefree: multiple frees㿘> #8> >&  (.`:@*` R  * > #+`>  @H /* '> , B >#$ @3`1`/`-`(`$&` $`,"`( `4`0`<`8@`D`@`L`H>#$+`@  >>m"x>Й.` @'j  ,* "!> (> !@I*  (* "$44  6@?$` ?Y$` 7o"@@` >m!>m 2`"@(=@'1"Ȁ`    7o""@`@ *"@5  4* `2  &`$`>m@'"`@$`` $`` $`"@ $@ 6@9?$@ 2`$@" % $`H 0minbucket too small/struct freelist too big㿘 #>`, @{@!@w%> @a- > "b!> `, #> @!Ѣc8  @֒> "a>  > ,-@@$ @T$  *` $   #>> #`,@!* @*` @= $ T physbuftodo < 0; minphys brokentodo > MAXPHYS; minphys brokenphysiodone < 0; strategy brokendone > todo; strategy broken㿘  `>!l  ` @,`@ @ `@  ΢``@&@`?@H /* %`0  # !>o  8`0 &`0@ `0 `0 &`0H 0&`D&`4&`,` @)>o@,`v  &`0`*2 @ : &`T &`<&`H`<6@>o@% @$>o@% ` $`H@ݡ@ʒ@H /* %`0"    @ `0"`0 &`0H 0@`H@݈ฐ?$`0("`<`4 " `<`@@>o@% $ >o@%  "@ $  $`; @ B ?`` " '`   ``@&@H /* % `0?# @&`0@C0 `0 @ 0 * " 0@H 0getphys㿘H /* %> #T  > #0# !>p  0 @& 0@1  $ > cT $"cTH 0㿘> #T#T& $"#T \`?@  @  * $ @l <@4" <㿘> ""!>!d> " d`#> }`:` )> @ ݔ!d$c`#> `:` )> @ Ҕ!d$cx`!> `:` )> @ ǔ$ 4chgproccnt: procs < 0chgproccnt: lost user㿘>  > `4 @* @ @2   ," 6>p@$ʐ"`""`  )"    >p @$" )E `"" $""" >l"   02 D 2 0 > > } @( "   0  4 2 0 > > x @( "     2  enterpgrp: setsid into non-empty pgrpenterpgrp: session leader attempted setpgrpenterpgrp: new pgrp and pid != pgidenterpgrp: mksession and p != curproc㿘" >q@$0  `  `>q@$'!O@  0" >q@$!0   `    $  $$ $     ِ  ( ?& (>!l $` >q@#!X  $` @ "@$`> $`#> x@*  $@ " #x@* "@@$`$`"% @W  @S  <` @"`@ @ <" ` 2& @# & ` & <` <"`@$``& @ 㿘 <` @"`@ @ <" ` 2& @ &  㿘  `"`x""`x`"  "` "@ @? "@   㿘 D 䀢@` ` 2 P` &`? &`@$ P  䀢@" H` 2 HN - " H` "`? "`@  H 2 㿘  L - 2 <  @ @  < 0 2L - 0"  D0 "  "  "  " ( ""    "  "㿘@  R  &R    ` ,  & 㿘  0  " ]   0  0 &㿘` 6@A ` 0@" * "5  2 .   ` 2(  (@" !    " `` 0&`@ "   `  @ `L 㿘 @ @ @ `@  @Ē "`@ @   @"& q?n & & @&"  ( !$ (㿘 @ @ @ @  @&"  ( !$ (㿘 @ @ @ `@  @q "`@ @f & & @&"  ( !$ (㿘 @ @ @ @H  @s&"  ( !$ (㿘 @3 @` @Z& `.` 2 2  ( !$ (R` `(@ :    *  2 ` @2@㿘 P 1 @ P 6㿘H /* '?6*    H 0㿘  F Pڐ 6㿘Ǡ9 P 6㿘`  &`  u 㿘       @` ?" 㿘@     "`L "'`H   2:N 9 `   .   * N Ҁ& < 2N   >   "`> "  `  2 N Ҁ&  2    & 㿘 @    "`R "-`N  < A`@C`;`  @ 1`  -``@-` < "` >   &`> " `  `@2  `@`  2 `` 㿘    `  4 &?N`Ҁ6 .`  .`@ 㿈`o  @@㿘`(  &  .` @  4  2 @8  4   2  @(  q "@4 @2   @( > ```  `"`@ & .` `4`` >``z>"T 4 >ʀ  > >"T >>"T 4 >ʀ 2 >"T >"X 4 >ʀ  > >"X >>"X 4 >ʀ 2  >"X >  @l 4  2  @(  "@ >" > !8  @  @   @y L!l:  4 >  > >!l: >>!l:  4 > 2/ *>%!l>!d:  4 >  > >!d: >>!d:  4 > 2  >!d: >< < 㿘@  *  @`=  㿐H /* .   H 0 D@B2 2  '`'@&` |&@' y'>!l @ b> ""Ȕ"   "@@ < 0(@(@c3`+  +`@ b 2`* @ *`B2*@*<`@ C@ @ Д @Җ@&@Д @@&`@@ Д @@'@Д @@ '`@@ Д @@'Д @@' 㿘@ `   U   H` H@"`Ж?  ""?/"` "`   "  "?/" `&"  `@"` 㿘  *  $  $ 㿘 ? & / *㿈@   $` ` `2`P ` =,` '  ''+ 2' 2 '  '  @'`2   (  '  2   $  *@ $ `ޔ 2`  ϔ "@  ( $H*`"` " ? "  (# ( ( "@  ( "  ( " ( "  >h*` 2 Ȁ` 8 #  Ȅ #    Ȇ8 #   # ̇H >h   " ``"` ȅ*" Ȓ``㿘 ̀ ! $>#h ] * 8 & ̑*  "  Ȑ &  & *$@ ̀ 2 ̐ $a $a$a$aĘ "H@"`? "` `Đ  "Ą("?"ćH  " pause㿘 $ #>x!$! $!?@" @& Đ!(ch@   㿈 $! 2`!  $! ``! (@ "    !  ! ?$!#@  ! $!$!$! $! 㿘`` L @ 5?2A  "#``  @ "` @   "` @"`` 2$ `  `  `` @    @     ` @㿘 A > "0 $3("2/",@  !``  `    `   `2  ` 2 ` @20F "  W 2 >  80 $0<("2,<@  !``  `    `   `2<  ` 2 <` @t<20@? 㿘  @ 㿘    ( " <@M < 㿐 ( $( 0*  ̀"-$a( Ā2)$a( `< "`<' .`@  ğ Ē` & a` ̐* & >#h .` Ȑ& ȑ.`$@$a(@ psignal signal number㿘``>z@!  (.`(>#h@*   Ȁ  Ā   ̀   N Ҁ 4. Ҁ    ~   *@&  *@&    & `jN - fHo oN -  "% (D> ( N(J`"/+ >2=  ( ? 6  D* & `(   @ې00h.` %`+ & "  h  . -+ &  h `@ 0!l >   "c0 Ѐ 2 2. @ H 0procfs debuggingProcess (pid %d) got signal %d issignal 㿘>#h   ( ,@  *  ? * ,@  Ȁ $  (("  ( ((2, $4  (@@" D>{@:  @b@ @.  ((("  " İ?  ė*@ 2  * $  $. @``. 7  0`>{ @  ((2    2 D2  D4 `(  ̒ @@ ~ 2   2  ((2 >{@ { Đ $ 㿘 . - (*  D@ & (postsigpostsig action㿐>!l  $>{@#@?  *@ * # .  @l0H>{ Ā @#HH/` /  ?".  Ē ` #    ̐*  # >#h .  Ȑ # ȑ. "H o@ `< "`<$"( "('  `  pid %d was killed: %s sorry, pid %d was killed: %s 㿘 >|` 0@>|  0@# 㿘 .` 6 >#h@  $@ "a$ "`3%s.corep``(!` t`  >`( *  `: `@  `D 8`>|$`a `Ӕ@$''ؐ '''ܐ"@!>U0Ȑa'P'''a' *` @> 8  T?@*@2>@x}  ?h>'''' ' * @@>b''''b' * @@`!`4`}d0`@Pe0' @6 '`$!$3>`(' `$-> a('$'( В*', Ԕ+'0 ؖ+@@ +@ @.'4I> .(  '( ( 0   #\#`#d#h@#l.>(0  ؒ  4 `(#\#`#d#h#l( >"*@>    #\#`#d#h#l@j>a'a' * @@ @A "㿘  N㿘@ && #& `>}"X*`@& & uiomove: modeuiomove proc㿘  >}@ې" P`>al J`>}@ΐ"Ѐ F` `&?8&8  " 2@@єƔ 0 2@@t @`@$@"$`&@#&@ B >`4ureadc: non-positive residureadc: non-positive iovcnt㿘` 4`>~@n X``4@>~@g x  2`@&` &@     Ԓ 6 *  $$ ` `&``B >`hashinit: bad cnt㿘 >~@1!x 4< , $, < ,   @ "`@ ?&㿘   2&   & > bb &b" "b& shutdownhook_disestablish: hook not established㿘> "     2>~@"p`"  "` "@㿘> ~"؀  > "   @  2 X  `  '   `  @ȕ*~Ȓ?`$>~#*`@ 4L@d(X>Ѐ` ! >"<>[ "> !h># >=#V -`  M` "%`@ > zA c( "> z c( $ @!  c( `$ > z `"c(`@````#\Ā``` @> z#(`"#("@u  ` `P 㿐` \  ? ?` >"$*`@ <Xt   04L`tL0  > y  > y    > y  > y @ǰ  >!h  >!d  >!l    !>  Ԙ@'  Ԁ`?6   6 0   > " Ԑ  > ~!h@!  ~> |" ؐ  > #@! q n> l"#h  !> "@'_$" ƒ Z  > x@K Q @{H L @G @T B  a                @  ꄒ   >#  >#  > @X -㿘`"K ?`F>"x*`@ P>> }@," > }>(+ >  > }> (" * >  @+ -㿘 @     `&@Ɣ   㿘'P` @     `&@P 㿘 @ B  @      &@ 2 v/㿘 @   @     &@`㿘 @ ` `&@E 6㿘` @   ` &@$㿘@  > #p ` *` *  (&@`!> "&@!   &&@ !  `' (   (&&@   ` `2i  > c > " `K >#PN`- "@`? %*  lHT`0` `( ")``  "#` l``  @2`(b@*! !! "Xb``2N`- >  d  $@& mH& 㿘&@  &` @&``&` `&`` &``&``&`  P@` N -  2 &a8&a@&aD&aH @龐&a8 А`&a@ Ԓ&aD ؔ <&aH D "&aX 0&aX  &a\  6a` ( ?` `?`l&ad`x " !1&ah`|&al&ad` @ &a   2 l`&a l`ap@  6a|&ax6a6a~a` @ ~`.a㿘>  "!> "#0>!P !>@|"Œ 㿘> > `"@*`> " d p -`? $ p t $ t d>@ c2  t L$ dH /* .>!P d   ` `* *  @ * @$ d \@ @ L Ґ $ ` $ \@ Ѐ`1>!l" L - 2  ( 2` ё2 @" @ ѐ@, 0 , БH 0  2 p@,> " > @#p>>aP#8F 㿘>   t* *  \& \`& t( t?  & t@ G@ 2 t 8 & \@tsleep㿘a>!lHo o> > x> # > x H 0 H 0  >L - >  >@!$ h$ l$ t, Б>  #> #@ @ "@ ""$> Ҕ`"  (  ` $ (( Ā@`f`  h  @ؐ , -      , -`@ @E"`@ > *"̑H 0 ( d$ ( {` $ () #> Ē`` `"   (( Ā@ !`  $ a* @?  㿘H/` / h N - @r (@w ($& (H 0sleep called with priority %d > PZERO, wchan: %p old sleepsleep㿘>` !l>!@A>@4!PHo o> > x> #  > x H 0 0* >L - >  >@!`$ h$ l$ t, Б: #> #@ @ "@ ""$  , -`@ @"`@ > *"̑H 0H h8>  2 `""`" hH wakeup㿘Ho o>  c> #@@ =   > -? >@#X h2($ h"@`"$`L - 2@ t ($ tD$ t  (`, -@ ( > > "˒"!> "#0@ 2 H 0㿐>!l@> "?`"̒"@ `" А"@@ "?@?/!@$`$``< + 2   %X      X   @4 @ X  @X`B <X> `   cL`Ҁ 2  ,`@k> c"c> @"ȁ >   setrunnable㿘Ho oN -` *`>"@<4>@ې" ((  ?  *@ &   (`. -@H 0 t ( (m ( & t> "0  > b̀ >  "!> "#0 \J ҇0(28 * > ̀>   > 0㿐H /* * > Ȕ"@'  "@`''А"@@'" # H 0!> xx "x@ І"?@# "x?/!@# > ȘȔ "Ȓ @# "?/!@# H 0@㿈@  @'*"@ *`@ *`'`K 㿈 t @ "  1   #@''| 㿐@   `  >!P'@"'` nanosleepx@ ~#@''@7 p H /* * #> bȤbȒ@'А"?'`'?/!'" H 0> z#8! >?"  #" ` 8H /* *bȠ ''ܑH 0" 'ؒ" `'ܐ'А"@@'؀ ''ؐ'*"@ *`@ *`'  2㿐@   @Ր@y  ``>!\o 㿈 옒 2$@ X  2` O  @ "`` >"a\a\"` 㿐 l 2O@.  H*"@ *`" *  * >c >!X*` * !X@I @@  & H /* *> > }""<"H 0 ` !@{"@'@!"@'`  㿈@R H /* *2  x' |' ' `' 0> Ȁ@ & ' Ȁ@''> "" " '"''А"@  *@`'`'`'`'H 0 ` 㿈@ 8t ` ~  2j`  &`  ] Y@耢 2T @ M H /* *@ 0 >"]>  > ""  'А"?'`'?/!'r& x& |&  &  * @ "`"`"`"`H 0 㿘͒  x   | & C& "??/!> ȑH /* *   x @  |&  &    & @ &  Ȁ@ @0Ȁ@ >bԨH 00H 00Ł}x@ ?`  2  " >T&"   6  "@@ " "  "   "  "" "  ` " Є@@ " "  㿘 ꤒ @Y@>  >  > "## >  "# mapply: no match function for '%s' device 㿘   @Β2  @ 2 ` >@ !  @  " &   "& ' & &   㿀?''쀦` `   @ '> #`-'@  "%` V " ?* 2  ( *`@: ` @ 2  V    ``2@㿘` `   @ > #4` ",`T "" ?* 2  ( *`: ` @ 2   @7 T   ڢ` 2㿀''''''>R#Ѐ`#>#V*   @@ 23V *  unsupported not configured 㿘M@M"  ƀ >` * @ :  root device %s not configured 㿘  >!@ # @$ 㿘?` .?@[  0.@ ` 4??`0.%s (root)%s at %s㿘     `  @ V @* "@V    6 6 &`> c&`c "`"c>"@ ϒ` > >"`@ Ȕ  > #%   " 2 V `@2 V  "6 V  2   6   뀢2config_make_softcconfig_attach: device name too longconfig_attach: memory allocation for device softc failedconfig_attach: %sing dev arrayexpandcreatconfig_attach: duplicate %s㿈@@ '`>@ L H@V`6?$ (@>@ ; ` ̔ 2@>@ 2 @5&& V` &   & $ / `,`  4$, $, $,    ,``> > > @  @$@*``̔ $ * @ > @  evcnt_attach㿘@ (&>@ ֐"@&> #&#"@"#> "  $2 2$ bad unit in detach_devices㿘> # Z # "P   ِ 2H   `"B @ 2= ƀ `@>@*` >@ #"  `  @ @ 2  `2 @Ꮢ $` ` $`$  "@  2   `? ` R`  R`   㿘>!,㿘&> c&c"> # `("c`   @ 2``@2`Ho o` €H 0``2` `""`> "#"@@`"   `  `  㿘>" $ 2  `"  "`> "#   "@ $2`@"`$B" $@7$"9"`$$@ @6`@$ @&,$2`T T&%$$2$"`$$2$"`$@ @&$`@&$2`T T&$$2$$"`$"$ (   @*`2 %s%d%c: %s %sing fsbn readwrit%d%d of %d-%d (%s%d bn %d; cn %d tn %d sn %d)㿘 G` `: ,`"@ a>@`>!>" 0@> Б, : > >   <" T> ` >!> <! T: @ `( , <`(@!,@!> !`8@l`8@Ő!>`,!(@]@>  > >   㿘>  > ! "   @  2  disk_attach: can't allocate storage for disklabel㿘! ? & `" :  ``& d 2 >@#x@! d@"H /* *> #& @# & DH 0 &> a$& a$> ""a$ "disk_detach: disk_count < 0㿘 `ߑ  dߎ `"  "`> "!$ "@> `? "`>@T `$"`$H(> "`H"`LHdisk_unbusy: %s: dk_busy < 0 㿈 $??& $> @/!H /* *> ## ?H 0  H"' L"''А"@' P T@& PА"? & T P T & P?/!@& T& H` & L 8>` B (> 8`B > ( 0`B > 0;@H(   : (: 8: 0H( > " @" DH " T" PH rootdev=0x%x rrootdev=0x%x rawdev=0x%x cannot open disk, 0x%x/0x%x, error %dcannot read disk label, 0x%x/0x%x, error %droot filesystem has size 0filesystem type %d not known.. assuming ffs +> yc   a@P" c4` .  `>#  @l )>. *> r!l>#c@Ne`e` !l@ > c@=!l  , 2 >@/ 0 2,>L "| ?>@, P>!"extent_create: name == NULLextent_create: extent `%s', start 0x%lx, end 0x%lx extent_create: end < startextent_create: fixed extent, bad storagesize 0x%xextent_create: storage provided for non-fixed㿘@ \>@א" >" @ؖ>@ː"X #>"x@Ò `> @"@ (?& & &   `?耢 "@" " "` &   * 2&  & && & & &  &    & extent_destroy: NULL extent㿘 2 >@q p " @`"`@@"    }㿘    2 '` @ 2'`9"'`'`   '@ " &  :'`  2+'` `2@'  @ "" ' @"``"`@@""'`@0 '`  '@" ''`extent_alloc_region: NULL extentextent_alloc_region: extent `%s', size 0x%lx extent_alloc_region: bad sizeextent_alloc_region: extent `%s', start 0x%lx, size 0x%lx extent_alloc_region: overflowextent_alloc_region: extent `%s' (0x%lx - 0x%lx) extent_alloc_region: start 0x%lx, end 0x%lx extent_alloc_region: region lies outside extentextent_alloc_region: can't allocate region descriptor extnt㿘 >@" @>"@ >@|":  >"@~>@q#8@ * @(> @o#X>#@j>@]#@2 >@_#0 `& `#`      & !>( " @ # `2`Қ extent_alloc_subregion: NULL extentextent_alloc_subregion: NULL result pointerextent_alloc_subregion: extent `%s', ex_start 0x%lx, ex_end 0x%lx extent_alloc_subregion: substart 0x%lx, subend 0x%lx extent_alloc_subregion: bad subregionextent_alloc_subregion: extent `%s', size 0x%lx extent_alloc_subregion: bad sizeextent_alloc_subregion: bad alignmentextent_alloc_subregion: extent `%s', size 0x%lx, boundary 0x%lx extent_alloc_subregion: bad boundaryextent_alloc_subregion: can't allocate region descriptor extent_alloc_subregion: extent `%s' (0x%lx - 0x%lx), alignment 0x%lx extent_alloc_subregion: overflow after alignment㿘\ `>@n!2 >@h"@ *  @  > @a"8>"@\>@O">&  >"@N>@A# `>@;#@ @: >#h@;>@.#@o >@/# `  `@ *       >   @>@ ` 8? ` @*( @#`?    8 6( : "L" I:   @   В? ` " ," )` `` ` `   & !>(| { @  #;$ extent_free: NULL extentextent_free: extent `%s', start 0x%lx, size 0x%lx extent_free: extent `%s', region not within extentextent_free: overflowextent_free: start 0x%lx, end 0x%lx extent_free: region not found㿘 >@F @ @  @@> `@@>@2 :  @> `@2>@% ЀJ *CB@2  2 `""`@"A  2)@   3@ @  (@ ( :@2  " " & `"" &"2 @> @ݔ>@А!&    &  " ?&  㿘  ,    `#``   & !>( 2   쀎` `"  "`  "@    `  & 㿘 `"- ` `  &`  &@ " &  &` ِ  &`  &@ " &  &`      & 0xextent_print: NULL extentextent `%s' (0x%lx - 0x%lx), flags = 0x%x 0x%lx - 0x%lx 㿘 2>@1!(  > @5!H   !>  @-!x 2 > a> x  "a0> } Da"  "" "  (  > > } 8 klog㿘 > x Ho o  @#%> } H 0D #!8>$8 "  H 001 @‎H 0> }c8 ?"c8  <`/" `@8@ Ȕ  $ /(`$ ` 4 㿘Ho o`> x   @ > }H 0  @Yc ! #> }#<@_? "!> }   Ӓ  !> } !> }3 !> }#8 > x #8 ?$#8 }@"/ @w@3> }4? ~@. v@"%)?H> x H&"> }8 88 8> } DD" panic: %: 㿘'H'L'P'T'X!7>  H !!> z#@@Ҕ&>"X@@kernel %sassertion "%s" failed: file "%s", line %d 㿘>"Θ%s: table is full 㿘> c@@f㿘'H'L'P>!l'T`(  'X`    @ΖH ("   "   㿘  ? &ׯ 㿘'L'P'T'X  @L      @   @L㿘'L'P'T'X @L㿘'L'P'T'XH` @  L@mH 0> !   @^㿘 < @  @.  @ N ? > @ 㿘'H'L'P'T'XHo o  H@0H 0> !   @! 㿘'H'L'P'T'X3>  `H@&`> # 2&`r&` (null)    `@_ %   xD >#d, @]H`T`T`T`T`T`T`T`T`T`T`T`T`T`T`T`T`T`T`T`T`T`T`T`T`T`T`T`T`T`T`T`T`T`T`T`T`|`T`T`T`T`T`T`T`T`T`T]h]p]p]p]p]p]p]p]p]p^`T`T`T`T`T`T`T`T`T`T`T`T`T`T`T`T`T`T`T`T`T`T`T`T`T`T`T`T`T`T`T`T`T`T`T`T`T`T`T]^_H`T`T`T`T`T`T`T]`T`T_t_`T`T^`T_`T`T_?N %2? Ȑ %u 0?N?Ѐ 8p ,* N?А?Ѐ ( c`  L@@$L`@L ; '|?-@|  < , @L@@`L@ '|L@ 4`L@ `|  r >o `2L@>"L@ `@]L@ `   -@N     0@@ x@< @||$$L@ - < @&< L@ @L@   %@` l@ @ 㿘> # > P""Ȁ`  `> P"Ȁ ```@!w  ```> PbȀ""bȀ`"   > x 耢 > x  a@@>& &*  /`&` > P"Ȁ  > @8 @ .*  @%` @x`>"\*@d@eeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeefeeeeeeeeeedtd|d|d|d|d|d|d|d|d|eeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeedeeeeeeeedeee8eXeedeeHeeepN@ %2@.`  n&p 0N@Ѐ 8k@`, *  N@?АЀ (`^@[  G*@ @.`  =?6  -.      0.  x.   @; $ $ J@? ??2.J@ .J@   %.  l. . &?㿘'L'P'T'XL0123456789abcdef㿘> {#@>"X @̒ @@d,2 > {#@$&㿘` @@`!  H /*.`"` "@"`["đH 0 z 㿘, `Ȁ@ '&@   `̖ @ * 2`@ 2 `Ė ` ڐ@? $`$`>  "c0 (  & (㿐 ( ,*  Ȁ@ %&@    ̖ @˔ * 2`@ 2  Ė       7 rminit %s㿘 `6& >L!/ && &  @"``@*"`rmalloc %s㿘` >.! @  `  @`$ ` "  $` `@ *` 2    K" "?# "#rmfree %srmfree: map '%s' loses space (%ld) 㿘`4 >"p $  "" $ h$f$ @ <   @$Q MJ$ >"p  $ "9"? À ` `" @ $   Ŗ " ?? "?2$ @ > "`""?" ?sshowquitLlinesllisthhelpffindqexiteenableddisablecchangebbaseaadd>㐀 >>> $>(R  ( R,4", R2R `*`>2 >>"( `>( (--- more --- 㿘!> 0 > 4@2,`>"8@}`$ 0>"H 0,`:  q`$ 0 Q %d0%o0x%x㿘` >"> " >4 > 2>>"""*FOUND***UNKNOWN*㿘. > >#  V `>#̓*`@oopop>V "0 >#h>#p>#xUnknown devno (max is %d) %3d at root%c disable ??? %s 㿘. > $>  >>w (0N H. >o >j P`V? >b XV?"T` %>`ZV V? |T`   4>> h> xD>`"*`R@ ?` %>>"а@ V* 3K V? >) 㿘  N -   N 02' N x  X2   А     ɠ  @  ` •`   &@?&@     `( K*  8K (8( (* :   Є ?K K " ( K?"@22 %s [] ? Unknown argument 㿐 %> H> @> (@~ (LHJ@ "`? (`J@  M > &@i 0   >change (y/n) ? changed 㿘> $  . ё: '>%>,`:  N",`H@{B, <  y Y n,`,`:  y Ye. >c   `  @"` ` " ` ` ``>",R ?  `* R ?2`,` Tΐ  ϔ>",R@ ?>"Р@ T* _ T?`  @,` %  T> Hܒ. < >Ր! S0>ϐ (Error unknown state already disabled 㿘> $ + . >#@R` "   "  >4> 2` 2` #`> H. ؑ:  >#x>#0> ( enabled 㿘> $ - . >#@R` "   "  > " >2` 2` g#`> Hc. :  >[#x>X h0>T (command args description [count] number of lines before moredev add a device8|10|16 base on large numbersdevno|dev %s devices %sthis messagelist configurationleave UKC[attr [val]] %sshow attributes (or devices with an attribute)don't know㿘>!P>`8J +>)>'>`8 @@@ >ސax  > < ?* : `'_*`>#d@|||||||||||||||||||||||,|@|P|`|p|||||||||||||>!3>>!.>>!)>!>"a@!>a0!>a !>a>b0>b@> bX>"h>b>bo>l `@J 㿘 >> "`0 K  ,` ґ:  `>?"`0%s 㿘 >>,"`0'>>"Т -  , 4p`, >?"`0㿘  >>`$ 1" 0>". : >#* R@? - @V`@@<` V? > $ ٦ >?"`0Unknown attribute 㿐? L@ "L@`L@  @ `L@L@ "`? (`,>`,:  4-`>"Б*: ,: @y @ "* >`,:  ,-`: ?2L@>" q 0p >g0 0Unknown routine /%c/ 㿘 / :`c>" 0>㐀 X.:   @- 2J `@왔 2B V  25 V.: @2/ V  2) ; ( d e c >0 f,`>ݐ  o  :   p$?   `,:  c>?"`0%s ? Not same device type 㿐 ?'%> >"@H@ (LHL " ? ( L 9ʒ 2!L> $@ *`> ( *`>c  `@  >Ӑ"H` ' ? q  C f ` Q> 0` `>No more space for new devices. Device not complete number or * is missing/nNo device of this type exists. Clone Device (DevNo, 'q' or '?')Insert before Device (DevNo, 'q' or '?')p@y > $ > (@>s#0.:  >>j#0#`   @ 2  `@닔 "    >>K 0Ґ 8 a8Ԁ?>#+ 'ؘ ' ' >'  `'  i' ' '77Ԁ> $ >>#?+ @ @"@"`"` "` "`"`?"` "`>Ԑ#ؓ+`"@ܒ@"`"`"` "` "`>#4"` "`  >#8R 62   >#Ԙ 6>Ԗ>#R 62   >? $>㐒` " $@t 2 `@ 2  V  2 V4  2>c c@Q 2 `@꽔 2  V  2 6  2WցUnknown command, try help Argument expected Dev expected 8|10|16 expected DevNo or Dev expected Unknown command 㿐 N N "  " N> N  `> 8,`@ J ?@ @2  @Y " J `NN " ? ( >M %>!  <,@ ?* : `'>"*`@L`pN 2>  >>" 4ؐ 0N 2>ѐ ۖ  >WW-ư  0N 2>!{ >   >>" ! 0N 2>!^ &   >WW c  0N 2>|!< u |  >WW̘ df a 0N 2>Z! S Z  >WW eD ? 0N 2>8! W1 8  >WW f"  0 0N > 0 0?N  0  >!0 UKC> User Kernel Config Continuing... 㿐> ## / / / / //>Ɛ#> !x@Ṓ ( h >#     N - p @` *@@`"/ ` 2`) '`'Ԑ'ؐ '`'''쀢 ' ``  ذ 耢 ?  #2&@ &@&8 @` *@@`"S ` 2`M * $E  ٔ 8  '`''''`~Q*'`   @`'`  `@`ذ 耢 ?  #2$ $&* p @` *@@"5  2`/ '`'Ԑ'ؐ '`'''쀢`'  `  ذ耢 ?  #  գ &@&8 @` *@@`"Y ` 2`S * $M  8 ?  '`'ܐ '''`}0'`   @`'`  ```ذ耢 ?  #  B $&Ȃ  @ *@ "Ӱ   2`Ͱ " ", @  ?*@  @   *@ >`,2      ƺ x `}6 `@   `$@ "|";@"{"ST e "} "~\@ 't    ?4   b~t[@ 't  @  ?4   b}tGT 't  ?" (` * 2 5  't  `vt)   ( !$@ `w@ $@  ``|`Ǣ select㾰@` 8&@@! 2 ,`,`-  T  @b'(','0',`'8@Q '(X',x'0''' ` (|X2(` ,|O2(` 0|F2(` /|< 2(z y H /* * > ""  'А"?''?/!'V"> 0< (>  Ȑ @%((@@}2I( 2E(H/` /` > b  bbȀ 2(@& (H 0%((`@>  Ȁ H 0(%(> ~"ܒ!>܇H 0 "((? ?%(  #"  (``" `{ 2``" ` { 2` ` { 2(8@ ƕ T㿐'   2 *   >   @6,4`* @~ ?@-, @`,   `   4  *  -  &` @ڑ4```ϲ@#  㿘 0@ "&@ɋ " &@ h> ~"܀@2&@` 6`㿘 4   > > ~Ȑ" "Ȓ :6 i"&Ho oh> ~"܀@2 (J-  0 0 @ ?"(H 0㿘  5 > @* @ ` "%``  6`>  T`@  "  ` ` @  4` `@Ѳ`'poll㿐 T` `*  @z`  2`` `?;@#'* "@*`@*`$ *`" *  * 'Đ v H /* * > ""  'А"?''?/!'"; 09 (> Ȕ@$(`` 2F(Ho o > b  b @(bȀ & (H 0%((`@>  Ȁ H 0Đ$(> ~"ܒ!>ҖH 0 (? ?$(  #" @z 2 Tptrace: impossiblep@  9`2@L @`#,>#*`@ 00@  (   @2"  0Ԓ 0 2&>  Ԁ?$&  (h  D L - @2&0&@`# >!*`@xx8HT8xxxxxxxxxxxxxxxxxxxxx ( D($ (`0 $ T `` ''О 'Ԑ'؆ '܀ `ؚ8?''@ '@q;'`     $  ( 2`@``" @t+ ?$ @ 2L - D T 0@" $ TW >  `s$ T (*@$ (L - ` 2 [ `X ЫT ?Q$  &`  ( D D($ (0@$ TL &`  @q'  `ؚ P  ?И'ؘ '?''@ '@p'# @p)   `ؚ!  ?И'ؘ '?''@ '@o'>z# 㿘    @# 㿘    @! 㿘# F  ":#"? B2 "~" "}"52 #"$.2  ! >3 >    P"3 ` t3 P   P =3   t3 P ?3 t)  0 $# ( (  " 2  " i r   @yX     @   @ݔ㿘 H /* !`  ```": ,0L" X0I 0 @@8  4V  0 $ ,02 T ` \" " 4  d        $  l t 6 t   @ H 0 s H P 6 PH 0 㿘@⋒ `06`    @ 㿘  @$ @@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@㿘H /* &&`l`p   &`p`@  `p =&`pH 0 㿘> PbȀ""bȐ@d & x& | & p 6 ށ 㿘`l* p`(`@a@oa >  `D`"  &`D>  `$`" &`$> }#``"#?6`.@@ 22` @&  `x! @@@23`p" !`@ ! "!@!  ( 퀌@`@"`p@9`p @h 2?h2``p@*@!&`pd=` 2  ``  ^@  @`p@ ג`p &`p ` ! @ `*@&`@ @ ``( "`@ w`&``6 2  ` 2 `@ @   `x 2   `@t @ `x ͑ `p( 2 " `p!2 !`n&`p*@ *`> r@ `€  "n`p  2q`  2``p2  `2`@2 `(2`a@@(+?`p( ( 7&`p ( ) ! '" `  ^" ~  | { } \2?(%&`p? ( 2  " ` "`p@C`@ `p20  ,`V``@2` 2`"`p@*`@ ` `p@ ޒ` @ ْ``"6`@`6``p>*@&`p 2G  CdA b@`  ?@ В0ǐ@ ˒`@?   @`p>`  @@ @ܐ`?     @@|``p 2  d" @ ;`p 2` d` `x} @2x`p@ t`p``( # V``H 6f`p @}a`p@< ]`p@=` Va @ p@ >N`p"6`   2`րd " `6`֐`@`(@ R `p`֐ 6`֑* :  2`p`6``p@*@&`p /@:V`@  2`p `"`pV`Ԓ "@8@$ `p @!?  `p! 2` @  ` * `p&` >&`p@r 㿘` 2 ` @2?@`H > ?`d`" &`d 6  3 `/ `   "@ H /*&> @7`H> & `d@"&`dH 0`Ԓ?6`Ԓ   2?  `  > !`H`d#!@g&`d " 6` ` 2 ` ? 8`Q?` M@`@I?`0>"*`@lt|  ' ! ^ ( ) \? "` \> !`H`d#!@&`d C` @ > V`Ԁ "8?> `d "`&`d` @>@`H &>  ?`V`> *`@Ȁ4 6`` " 6`  ?6`԰?/dev/console0  @0@ {@ z@% ^ ] r@    @*#   e@$  g@ #7   @  @. # ߐ  ʠ > b!>@ ]   | @  (`  x `   Ȁ  Ā"  @" = o@D ^@  @ @?0 a@N n@?0 s@"l H "@d @"b h? w@ h@" z?  b@"g "~@o   ] r@ "}@-?0c  @H  @"Y?  g@">    e@4  v@?0H  @    @?09H /* &   p  p ?@l$&H /* & p $$ p` ` @ J> P"Ȁ  " ' p ( (2' 'Ԑ @'ؐ '> ''@@V>a\'a\'* @@ >?!'''`* @@>a'a'* @@@H9 > P""> PbȀ""b @" 0sΔ , 6 6 6 6   |@2  ( 2  x 1   x "o m!1H /* & p n ;H /* &#@  @Ր  @2@   23  Ȁ€ p2    2 $ ߐ"$ p@-$ $$ ($ (   |   Y @3  @"C  ! @;`$ @4 @K ( ' ' ' ' ' ' ' ( ,$  0$  4$  8$  <$  @$ $ $ ($ ,$ 0$ 4$ 8$ < $ @*@$  $ h$  ( 7&      r$ 0>"  lְ  h Ұ H /* & *>(@`€.@€ h*`@€H 00W, hH /* & p!   @G  *@  p" ~@" p0<        >   |@~  ( 2 h0x h(*`@ `€o H /* & p! ! n$ p*@ *`> r@ `€ H 0O   `I `  | " 䀢 ?   $ | $ x  "  ( 2' ( `  |  ( `% 2` !   $ x@h @ێ   4 4 4   x4    㿘2  *@ *`> r@ `@H /* &` `"V 0@'   @ p   H  H 0   H 0 㿘 @" @t !  (    "  㿘 H /* & H 2   @ Ā`@ p>!  `& p@ H  H  p ည H 0 㿘ɐ@ 㿘H /* &`  (`" @  ( `"6 @  6 6 ؐ p>* @#& p` p n ~& p*@ *`> r@ `€ H`@  Hѭ Ha H 0㿘>  q7 㿘  ($   p ?& p!$  ( p @2 ( !"  ( % $"  "  @  H 2  p`@@2& p @@ ̀ €   p @& pttrstrt㿘 >"H /*& p @ " pH 0㿘 Ā`@ 㿘`L 0? 㿘 p ` @` & pސ3 20  n& p*@ *`> r@ `€ !  p ` & p  @2  | "   "Ə    `@F" p 㿘`" p p & p ` & p  @2  | "   "h    x *@&  p   & p' ' ' ' ' ' '& & & @ Ð؀ & pe0 *@& p㿐 >!l     H /* & ÐH 0` | @+`(' x#`Ȁ 2N `Ā 2J 2G   A  ŝ > b!>@Z " 1H /* &S      &O p0+  *  *  *  *   >  > " "  u > > "Ȯ "  ''> Ȕ"*"@ *`" *  * "@  #`V>!P@͐Вb? @_b@ ( F ( p    @   p  H 0  H 0 # >!>!!@ȘH 0  #  #" H 0 @ I 2  䀀$2  x Ӕ `8> b!>@ . 2 #Ò        H /* & p @)   % $" "  @ c H 2  p & p @@ ̀ €  p ?& pH 0ttckoutq㿘V ڑH /* &` >!l   HȀ@)@' H`>!l  >H 0 >aP#` > p& p~  HH 0 0  V ڢ `H /* & p!   @  H 0  H 0 # !> H 0>!l | @2`( "` x} @y 2x` 2s`Ā 2o`  o  ÷ > b!>@t `  @2&` H_`` d8 d5逤`>+ )>  >@ց ?@6  69 H 5 H1`06 ֐@  H$ Ԣ$@!  d@6 Ԕ%!& d  H`4 ֐` 4 `4 `?&` H?ƐH /* & H  H 00$ H!>  p `& p@H 02`0  H 0`&`@? #ttyrub: would panic c = %d, val = %d 㿐` h  *@`z&`V`ր +>  >  ?f> *@@@s m`` @"i`֐@j d`V``@@s0]H /* &``p V`Ԕ &`p`  `&`@ 6` @`@  ` *@&``p*@&`pH 0V`Ԡ$ 6`Ԡ ?,"`֐ ? `> P`ր`  `p 2  &`p \`@X`֐?6`ց㿘  y v s 㿐 " @: cH /* & (@ N  @( (@   @ ? @ @   p*@& pH 0 6 6 ց㿘`p@2`` *@&`` (  ( @   ?  ^   ^   @ ?㿘W  p   xܔ ̘ @2``@2@?㿘 @ 2: !4!  6 ܒ@ h `g h (  3@נ 4* @*`@*`6 ځload: %d.%02d not a controlling terminal no foreground process group empty foreground process group cmd: %s %d [%s] iowaitrunning%ld.%02ldu %ld.%02lds %d%% %ldk 㿈 >  d!> !ؑ* *  * $2 @҉@/ dq | 2 x>ia6 ր`2`>`b6 ր  >Wb(y6 ֐@x 2 < L-0 >"Hl >"`>"h: cФ"? '?/!'`') #!>@-"p '?/!'`'#!>@"d d* * " *  * $2 >@L-` `   @ >@]`,2  ߔ6 ց "Z  -(  `-((  "G "B  J -2 J -`\ \)87 0`0@?J`-`?") "$ `t"`0`t t8  (`( "`0 (2`0  04  㿘H /* &`p ( (  H 0? 2 daȐH 0 㿘 ޒɒ "V .`: @ ` >  >  "> " > b "btty_detach: tty_count < 0㿘> b? "b>ۄ `"  "`> "! "@㿘  > @s  $@  ($@  H$@{ 㿘@ @ (@ H{ >?㿘>" @[ *`" * > ! 2 $ p p  $"    0="$ pĐ #"$  $ %$ #$  !$ $ ϐ Ā  p $ p p >#>"`$ p !aG  p "> h(*`@ €@ 㿘 . "@*`> !@> h!(*€ʐ@֒ 㿘 . "*> a >!l   "d ` | @24 (`(`"0 (% x"+ (`Ȁ2a `Ā2]  ` U  ! > b!>ޘ G` | @2 (`(`2 x (  6 # (!>Ø "0* $ (@А ( &  ( 4` ( 2 (@ ( ( 0  > h(* @R 㿘 . "@*`> !@`Ā   `h*>a(   㿘 p o!*"@ *`> ! @`  ?"` *`@! 㿘 o`* "@*`> !@   ?"`*  `*`@ 㿘 o`* "@*`> !@ 1 P` * 㿘>" . ) "* > !  b$3 Ġ Ā  >!$ Đ> ha(* €   7$ $`,`,`㿘 . "@*`> !@> ha(* € $  p ?$ p 0 . "@*`> !@@ `p 3     " d  @" , ``,8 ,`, V "`H  " `HJ, G `p!"  < : #`P!>2 "`p0/  ؒ` 2T`ܴ`Hd8 d@ϒ W` 񀢠dT``H  `p  ?$`pd`H`0 . "@*`> !@@   `p w ` "8``( 2n`p` $' `(" `d8 d#" @  j`p R @`(` ޠ  `(@@xS `>!( -`d8 d A`p =  `( # ``!``p `h? *€ 4```Π   `@?  #`!> i "w`p`&`㿘 . "@*`> !@p&@` ``"'pU 8 Q H /* & H   H 0 9 H 0 p " ``  ' `       "(  ( #Ӏ`!    *  (> 㿘  `@ * "@*`> !@@#` "`p    @, `((" `    @, ` 7$` 6  * @*`> r#@>"Ȁ@~  i@"N w@"-`x _@"Sk  @G  f@",`  @"=`H  p@"S  @/  @",`HH   &       ?     ?$    ?$ ג  `H@`H  ` ǒ `x  w `@rin > `ha(+   @6`  !@2  `U, 6 G  `("`    @"  @ `  @2 `  @, `"  2  "   @ `     ,       ߖ, @$ 㿘 >w $ '?@ `:   >c $   >$ ?@ɒ$ $ $ $ $ $  $ 㿘  " Ւ >  "& ϒ >& & ?H($    ` `8 ("@82  "  " "" " H  㿘H /* &$  "  @ "  " 4 e+&@ "&@ @&  & 4 & & H 0$@ H(C `2     `: 7  a  0 , 8 ( "8 `       ` H H(@!"$       4 "@ "  "  "  " `4" " H putc: required clalloc 㿘H /* &@` 2` ` 2&` >֒#ؐ$  " `H 08?&` &`` *` `` "@!  :*"   * @ +  :*"   * *+ @`  &@``@&` `&` H 0 ` `8("@@**.(@` `8@ + "@:  +` "  (@ ( ((@    * @ * (@ @ (@ (@  &(@ b_to_q: required clalloc 㿘`S H /* &@ ;` 2& >"`$  /& (&@'  " " 4c  }" &@ &@@& & `4H 0 > {> { P> {P  P  " "" 8("8a"> { P  "@ "    8 ("8!"@ ?H(&  2 "   "  ` `8 ("@82" " H  xH /* &4 @ 7 `@2' ' ' ' ' ' '@&`& `& ` & `& `& `& &@&`&`&` &`&`&`H 0 0H 0 )?+0x(     %>a\'a\' * @@>aP'''?'aP' * @@>’'' *` @0 x``(  `   %>a\'a\' * @@>,''''?,' * @@>’'' *` @0 x``(  `   %>a\'a\' * @@>X''''?X' * @@>’'' *` @0 x (     &  a@   q@ >     ( ?' (b'''''?'b'* @@ذ㿀(    >b''' '?'b'* @@ 㿘>>ƒ`"`>Ɛ" " > #`""#"#"#` "```:` "`` 4* ``2`>  >Ð ">Ð#L  > <>  #`P>  d" #c>Ð"  > " "2 : R" 4  4*R   > "* "2  : R  R 2  4R2  42 4" 4 *R  㿘`-  ' > #"" *" 2 *@: *0P؀4`  4 *㿘> #```:` "` ` 4* ``2`㿘> #`>``:` ( "`` 4* (``2`>!P>Ó2 " :㿘> #`>``:` $ "`` 4* $``2`>!P !>@Q#L mbinit㿘H /* '>`,@; * @   >ÑH 00с#mb_map full 㿈> (`?> }"@Փ, 6>H /* *> "Ȑ" ''H 0 > {XX#@'#`''А"@@'耢 ;"X  >`p@> ! @  ,@H &':  @6> > > #`ᰀ@&" ( " > c` "`㿘 >  "b>  >  * a + `א ' @e>b.`  6 H /* '> `.`  2 H 0 &&  & 6 㿘 >  "b>  >  * `ʒ , ` ( @(>b.`  R6 H /* '> `.`  2 H 0 &&  &  6 㿘H /* '> # > `""``:` , "`` 4* ,``2`H 0> c` "`㿘>b.`  6 H /* '> `.`  2 H 0 &&  & 6 /㿘>b.`  ϔ6 H /* '> `.`  2 H 0 &&  &  6 @㿘>b.`  6 H /* '> `.`  2 H 0 &&  & 6 ؒ"  @ l㿘H /* '> S  *`@ ?2@ H 0   &>H /* ' > #̒"@> }"ؓ2` ?* *   >  "@ " #H 0 >S "*`@Ȑ 㿘 H>  %> >"H /* 'V *`@?2@H 0   "&V H /* ' > #̒"@> }"ؓ2` ?* *    "@ $ $H 0 V * 㿘>V *`@  "V  3 H /* '> V *`@  2@ H 0 ##  # 3 2  "# #  #   #3  #   ?6 #`c  d"  ?@& & m_copym㿐@ `>"P`  2 `>ƀ 2 "P@ $@ `􀦠w'沨">   >m>Ր"PV *`@  b"V  4 H /* 'V *`@ 2@H 0 $$  $ 4 H$ $  $   #4  $  "$ $   "$    $  > #̒"@> }"ؓ2`  *  $  $  $ $ $ 4  ]N  &  > a4> a4  "a4m_copydata㿘``>Q >ǀ 2 I @ &@ `#>ǀ 2 :`"8& ] 㿘 2`  2&  ` @  @*` &\  ` @ "& 2 P `&`$ 4 " "@" " `5"  1"     "    "  , 2 " 6 " "2 2" 㿘` `d``  `d@` `d` &@@ u>T`*`@  $ "T``6 H /* '> T`*`@  2@ H 0 &&  & 6 W J& ` " `& `& ` #6  & ` ?4`   ?&> #<@ 8`  8  `\  &@& ` $" $` `$`K``> ` &>> a   "a 㿘@    $  ` K"@>T`*`@  "T``6 H /* '> T`*`@  2@ H 0 &&  &  6 "x `& `"& $`  Kd d&  b&ې^ 2 d>VT *`@  E"T  6 H /* '> T *`@  2@ H 0 &&  & 6 xΐ l"  ?@&   "   6  &  &  $& $ > #̒"@> }"ؓ2`  *  $ $&  [A& $ &$㿐' >b  6H /* '> c` 2`H 0 &&& 6 W 2&  & d`& > #+>  ' >b  6H /* ' 4H 0 &&&6  ΐ l& $@   (@ H /* 'a   h a&> #̒" > }"ؓ2`  *  ?$ %aH 0 " &(&$&  6 8( &  6  2 & > # 4&  & Zn%&@`munix㿘>!l  "2 +  2V, + ' )  @g 4`  2` 4 `@   $ $  @2 &@ `@Y2 㿘H o*@a    @ H p@㿘H /* !      @ "  H 0 `  6 >#@>>#>#@&6 H 0 sofree dq㿘      @  2 & @  2& >ѐ"@ Ð T@X soclose: NOFDREF㿘H /* !    @V    @N     5  # 2 @2   "   !!"   " #> "!V ac2    "        @ "  " >h#P6 {H 0㿘     @ soaccept: !NOFDREF㿘H /* !   ><!( ?6     @ H p@㿘  ( -H /* !     2 8@0   8    @ H 0㿘H o*@a    @ H p@㿘H /* !    9   %     @ H 0㿐' 'P  >!l  P `     2`  ``4  "`4  t  ` > @ T > @ > 5 t> #H /* !   $ 퀊2 X   2 X 9`2 X0􀠠 ' X T ` \"" 4 `  (@   (H 0G t'%2   d ! # t ? 5 t ?5 th t@ TH 0 )P tH 0P$P`ܦ P ) >b  6H /* ' 5H 0 &&& 6    d&%&>bq  6H /* ' 5H 0 &&&6   lTS@H /* '>   1 > &> #̒" > }"ؓ2`  *  ?%  H 0 " &(&$&  6 (P (>  P$@ @8  &(@8 $@@8 $P  6  d" ?@&k& %@P` D"` ` `` 2`*P`  5 H /* ! `   P @H 0`   ?5  'P  P󀦠~ t ? 5 t ?5 t6 tP  R Mreceive 1receive 1areceive 3x''' `'&@ 2'` @ ?+ Z   @   @   Ҕʐ` 2 2& $" P     @  P   @ 0  6 P H /* ! D  m 0@ :i  @@ @"c  48_   Z X  2  $ 0 " $>R"Ȁ  G쀌6 $   < P "6 D  "0 D 2T   2   " 9 " P ! # P ? 6 P ?6 PV P@x 0H 0" P} s T  >"'􀠠    ^ 0 "  8& 0& 8   $"@& 8􀠠 & DF$H /* '> T  *`@ ?2@ H 0   "&H /* ' > #̒"@> }"ؓ2` ?* *   >  "@ ?" #?H 0 >& DT b*   D T    >     { 'g 0 "@ 8& 0?& 8    $"@& 8 `" '   2'@'& DD$H /* 'T *`@?2@H 0   "&H /* ' > #̒"@> }"ؓ2` ?* *   >  "@ " $H 0 >& DT b*  < D  ' T    "$ T '    >  T  䀠   ?* 2  ( >ߐ" , ?6 `"@@8 "@42H 0 H /* !  "& "@@i  2" 0s  "  8& 0& 8   $"@& 8&& DE&H /* 'T *`@?2@H 0   "&H /* ' > #̒"@> }"ؓ2` ?* *   >  "@ " %H 0 >& DT b*  r D 2$  , : &  $ "@$  0"& 0 , 2 @"  & ,  @B6 @@ <@0" 0   , @x 0" D P ? 6 P ?6 PH PH 0u 2 @     " $   "T     2@ 02 "& D "     @ ܀``  ` P ? 6 P ?6 P PH 0 P`" P@'@ P ? 6 P ?6 PԐ PH 0㿘`` @`      @ p P 0  @ 6 P@ߐ0 6 PH /* '@  ? 4 ?4  ' ' ' ' ' ' ' ' '@G $H 0`  ` `@@#Ё㿘'P?#@  " * `  @P *"3"8 21 *, @( *$} *    *m * 4i *B"v  2r  6 "l  (h   O6 *L6 "[  ' " "=` &:` 0 T@ 0`> 7*& d'& @"6  80 >aP@ >aT@8 # !  "6 R`6 v`   ` @P 㿘?#  " * ` @ߒ  K&` 4 "FV @"AV "!P@`"@@'>@zaT`"` *& 㿘 (  2 0  )  ԧ H 2 㿘   ;  6 @ǒ @ @' 0 |  ̐ "0ɐ "@ 0 |  @ T㿘  " `86 @ T@ 0 |  㿘  " `06 @ T@ 0 |  㿘T T @ T @* @H   Ҕ .@> 6  ?6  6   6  &  "6 " (& ( &  X 4@א@'     @  @:4  `@ 0 |  > " 6 "` 2 "`  0 2 "`  "  `" ``2 "2  "2    㿘 `2 @B T㿘  0 @96  |  㿘 !  @6  >R "o㿘   4 @! >\ "       4 㿘c`` ? 6` ?6`  " (  Β 0   - 㿘 T@# " 7 0@  @ 2 d & @ d 2 d(& d d X 8& d @ 7㿘` ># (@, @(&   .`@8   & &  㿘@ɐ& & 㿘@  2 "@ 0 @@㿘@, "  2   &`&  $@& "& " "  ?2 2@ 㿘@0  `"R`  @2     &`&  "$@& ""` "  ?2` 2`@ܐsbappendaddr㿘 @ >v X "   `    " " 4 4Y @ l( >b$  4`H /* '> c`" 2`"H 0 $@$``$`4`  2@- `$` @O "$$@` @ & &   " $@&  2  " &    2 $  sbappendcontrol㿘2>"`   `@ @"  @   " " 4 @ $##  @ & &  "$@& 2  " &    2 #  semi-panic: sbcompress 㿘 `U `` ` 1@ 2R  R V`@#$   ` @ @VV`@`NR  `  & ` @ &ò"& &` @ & & ` `$@&  ?6& >6U#sbflushsbflush 2㿘 " ><!H@  2 >  >,!Psbdrop㿘    `d >  >"2  `>!R`" " &&   &@  $"@& H /* 'S *`@?2@H 0   "&S H /* ' > #̒"@> }"ؓ2` ?* *   >  "@ " $H 0 S *  ` ^  `Z >  >""  &&    $"@& H /* 'S *`@?2@H 0   "&S H /* ' > #̒"@> }"ؓ2` ?* *   >  "@ " &H 0 S *  "&  `" " & &  #  # # "&㿘  W>   >"&  "@ &?&    $"@& H /* 'S *`@?2@H 0   "&S H /* ' > #̒"@> }"ؓ2` ?* *   >  "@ " $H 0 S *  2㿈 ^ 2` 2` > "`@``[찒*`" 0" &㿐 @@f``@@ ~ 㿐 @@O ` accept㿈`  `J @@3H /* !     H 0o  !T  2' $H 0` # 54 $  $ %>   "!; ET   $ "  $ 84 $찒1&  j 2 ><#Ȓ  2  2>"" `  4'`JD`J> yH 0㿐 @@R   !!2`J %`@y Cΐ27   !!N5 $H /* !    $  3> "!c      $  "  $4 $H 0  4 ?" x@```+찒O@``#谒E<ܔ  '3 3 ># # $22 "" '`  }찒 I )* "@#* "@p`'`'ܐ' ''`'`'@` @38`I] &䀢  #! (*  Ȕ 䀢IG* '@`@ > h @԰c '   '' ''?'  @`#'  ` @i "0<'`"' . @Y )* ̖   耢 ?  #    &@'Ѐ p` H  "`0'`'ؐ' '`'`''` '@`@=8`H 0䀢  #+ (*    `''H*@ؔ @ '`H} x h'' @԰ '   ''''?'  @``'   'Ԁ` И̖ BȀ@ ?  #  IȒ"@' ""`'Ѐ 2  'Ȁ@ 4' HȰ-Ȁ &ȒH  "  '̀`2` 'Ȁ &'  &G &Ѐ ""̀ 㿐 @@P `# 㿐  @@A"` l `  + 2`  7 G`"`ꥐ0 $ `` X㿈 '@@7`  `G "`0+'`` 찒`   4' ` Gs`Gl 쀢 \㿀    ?   6- & 3 3 ># # 22 "" @l& * "@* "@:8㿐 @@.`G &`  ̒  7    @ ` 4'``F`F #㿐 @@W3  $2`+ 9Fɔ $ 鑒  7    @ ` 4'`FF 㿘l  2$  7 F鈐0$@ *  @*`2P   &" uipc 1uipc 2uipc 3uipc 4piusrreq㿘  >` !lX -`     B - ``2< `6.`>ܐ!@r$r@rPrhrrtrssuvuqhqv(vLrvv  8@+@W @~     @@Q "   2  & >c(G  '@耧 V  2>>А!  ۀ   8``"@  &`` 8 $  0`X" @ " X 0 TI$ ŀ !( @Œ V < 2t>܀  8@  2  9 ``>#(`0 `|     7 @}   " v  >b!0 `0_ 2  `0O `8  `"@ " & ` `8"`  `0  X"@ " & X `0`0"`|  B 2!8@ 5<  X&@V  ? "?`0@&@?&   > !"!$  *&  "&  &   "&   "&  &   F  >!@ PKunp_attach㿘 X "V 4  $V  " >>>#8>#<#@>#D} Ő"" $  R " 7@ $$&  㿘  " " <@ &  "  @* @e 6  2 8"  > !   @ Ȕ ` H't'x'T`'P'|  2s ` `l`J k i * @P 2c` >'@td'H'D`* @@@d@0@a@}F 0@ ' 8 !7>d'(','0'4 '8* @@(>'(`'0t'4d'8',`* @@( 2` $ <&  & >a'(a', * @@( 8` D''ؐ '`''`` ` @N`  (0H* @C 8 = &>a'' ''a' * @@* <`"& =T@V@@! )`  ` r 2` =   沔箖 &`@ @unp_connect2㿘V@V@  )`" V  >""  " ߐ #Ёunp_disconnect㿘 (& R``  2 $ >߀ 2 c h@"  $ & ` ?2`$ 㿘R    㿘4 $   $ H R unp_externalize㿐 >!l` @2`b  6* (@E $ ! (6 '>   ">! က*" $တ?3 $     ` ?26   / 0@  `@(` @ & @  > `@(@ "  2 !2 #! 㿘> }b܀  "b> !> }  "#4?#  4  2 ?##> }%> ! 5c4T "- @c4 @4 ? $c4@2 T "@4 T 2 " >"Ԁ@2  "D>@Pb 2T c4 2>  &>  #p * > a T `T @2    2  $@`  4  2T @ `?<@ @ ?`A &> }""܁㿘>@c,㿘 .?# &R 2 (`2` 2@ ?2 ` @ @`&@ 2R    > }4 4  2 㿘 > န2 "; bremfree: lost tail㿘   > "0` @: >  ` "> `@ *`> "P@2 >#`  ""`  "@㿘> "#Ȑ#" > "0   ""*"  !> x>  G > > x`"p ܐ@@ĒG1> }!P#!'> ἢ  t x@h?$ D$ h$ l$ >  , $ H> , > ,@_$ 8 8$ 0`> "@> "H $  "` ""$ ἀ $" $$ > x ܤâ`x㿐 @   0"2#' 0 & 0 > h?2 6& h>'' \`* @@>!l `, "`,'@㿐\ `@֘ `0"2#$@?`0 &`0 >`h?2 4&`h>''`\`* @@>!l `, "`,$@ <#>² @ 20 @@ 0""?0  "0 ch?2c 4"hc''\c`* @@>!l `, "`,@ ʲ`@$㿐'P'T\PT #\#`㿐 02   ? \      @@ri  0a 0 & 0 `"  "`> "#  "@H /* %  "> \@= \!l `0 "`0 \`4 "`4H 0@ 0> & 0'' \`* @@ "" @H /* %  \@ 0>!l `0 "`0H 0@)㿘 㿘> "Ȑ  0`(& & > c̖c& c̢" "c!>#`{>aP*" zŕ* 0>al & 0``0 "`0 \@Ő F*`" * > r`   @0  0 ?& 0 0b" 0@㿐 0>Ð & 0'' \`* @@dirtyp!>#`#> cz-> /> H /* %Ȁ  z >aP@" zh >I 5Ȁ@4 0  ` "`&   "@$ $ ̒ "%̐ $  0 $ 0H 0H /* % Ȁ 2 H 0> !l!l?@ +>> ")>`E`@C 2A` @ ?$`` "3` b 'b ' * @@耢 2 $@  #l'''''`'*`" *  * #l' *` @@ $ 2 ` @@(" > !h@2`0K㿘> }` ` "` 0 @ 0 * & 0H /* % 0   0 7& 0 0"@ 0 & 0 0@" 8 0*@& 0 0 @Qڐ 8 $ \ 0@0 \ @j 0  `"  "`> "#  "@ 0 8 ?& 0`> > "H"@ &  "` ""&  0@>  "0 0 > "@> "8& & " " 0?ߒc & 0H 02> > p( "  P 2  \ 2 0 2 P getblk㿘> 4> c  p* @@ G P2? \2;H /* % 0   0  " 0>ʖH p@ ذ 0E 0@ 0`0& 0H 0 H 0 2 P $@ޒ"@@ &@" $@& & P& TH /* % @hH 0@3㿘 @   0 & 0> aa &a" "a& @allocbuf: buffer larger than MAXBSIZE requestedallocbuf: negative bufsize㿘> ,@@v@( 8>] h"r& <:; 8'> ἐ @q  `0 $`0ἀ $@" $$` 8`8$ `H  H"@@  8& 8`8"`< $`8$`<`8 >& T 8 ͐  8(4& "H`  H 0 & <J`0 $`0H 0`H H 8@" 8"@" 8& 8 0" <@ " 0& <getnewbuf㿘H /* %> "@ "@? > }0 "  >`H 0V  0@ 0*@& 0 0 & 0H 00 0 & 0 0 " \H 0 0`" 0܀ @wH 0 & 0?& D& P& T& X& 4& @& <& d& `& t h?& p& h l?"& l`"  "` "@biowait㿘H /* % 0"  1>  /  0"H 0 0$ 0  ;$ 00  0(  4 " biodone already㿘 0">*! 0"& 0 0@@ 0 @  0 X " 0€4 0 ?0 0 * " 0G> 0  㿘>#H 2   > a`  "`*@&>  > a< Б* @  2  @2L 2 @ !   2  2 > a`  s"`@2 > a` C"` 2  @`:&> a` "` `W  "`   "@$ > a $ a " I"a  @> a`  "` aА "a `"  "`   "@$ > a $ a " "a  ?(&@ `"  "` > "!   "@` "` "$ > aa $ a "`  "> "!!$  cache_enter: name too long㿘 $>>4!`#H Z#> a`>ah  >  @  @( @a` $a`! E! ` "` "  "@ ` ` 2"  "@$ `$ ` $ $  $  !, *<˕:$ > a $ a " "a >  > !<@ @Г*`  $ " " $ 㿘> "!!" >!h>  <> "bЁ> ἄ ἀ" > <> Ѕ(@ *> "  2  :> ἄ " > `4`",`""`&``"``  ` # ` ` ` @2 `@ "`"`` `# ""` 2`cluster_read: size = 0cluster_read: DONE bph \>T Ȫ  6 $`0 5 T @   `0>al&`0``,  "`, >#P " & T ` `& T& X`@*: Ȗ € `>'''''' * @@ت`?$ X@4  T T:  :& T    ` *` 8 & T & T T 4']@d``@&`T: pk`{ f`>'''''' * @@تS`?N$ X@4  T T:  :& T    ` *` 8 & T & T T 4' #\#`@x#d J  0$ 0$ T   >!l `, "`,` `0">>E ''`\`* @@ت ` 0" > 0?c $ 0Y '' \`* @@؀ "  ` <@ P@& X`cluster_rbuild: size %ld != filesize %ld cluster_rbuild: too much memory㿐`\ $ d>"P@`: 2 x   0& T& 00l#\@g 0"`.  +F $$ $  $ > @  L@$ ;& L)@ c 0  ~ `8`@`H@$>" 0@ " 0@  @/&`T``0@&`0 @`$  *`" @`2   + 0& L & 0& X@l㿘@  6  0"\& T\@TԐ>!& X 0& T @& 0cluster_callback: too little memory㿘 0(  4 L H& L @ H@̔$ < 8`$ 8 0$ 4($ 0ݐ 8"& 8  ??$  8"& <6 H>!$ @ @"@$ @& <& X  + 0 0 0 * " 0h P` \$ D$ H$ P$ L P "  D@2   < L T;`  "I H  $@b@? P` ' H  D <# @t  <`@: "!>''''Ԑ T'ؒ' * @@Ȁ  T? ߐ$ P T$ L$ H$ D $ P`$ HҐ$ D$ H @   @6$ P$ Hx$ D T$ Lcluster_wbuild: size %ld != filesize %ld Clustered Block: %d addr %x bufsize: %ld Child Block: %d addr: %x Clustered write to wrong blocks㿘  $ > /    ?` r0Ő  h  0 2<?2Ԑ8@?Qː/   + <$8 $$ $L$$L>!0$XH`@$0v> #Ȑ n`i`  `0 2 W   $ 8T`T: @>P!`P>`T!H>!h`H@U<8$<@$8`8`0"` $`8```"`%``"@?`0! @$`0`0 $`0H /*%`\@ {`\`4 "`4H 0@-  "    +0$L $0$X?"'㿘 +D H "* ڦ&  & H`,   ?`<  , "  &  -operation %s not listed in %s. vfs_op_descsvfs_opv_init: bad operation㿘`2'  !>  4 *  4@ *`" `2> @" >!>>!  * $@ 2vfs_opv_init: operation vector without default routine.㿘> *` 2> >ʐ" 4   @ `* "@ `㿘>c c  >c  c  >㨀  2> > 8 4 8`4  "`4㿘@^> @# >>cX*   " , * *㿘 \  7`O W` J  "@E @ B&> ` 2 `` 2`?? ( DB? ( (~ < < $ $ ` 4 $ $ $4    0@@*@x$ (0! ( lf_setlock: lost lock㿐V  $   ('>@"n'  @ ( # $T$ $". @"* `h$ `l2!>#>#ؐ  @ @"` @2`hْ (Ұ "`l >?*  @2 &  6 @ 6 & @Iq    $ 2 $   >|" ( > ܐ @+ `*`\t`z"v& V   R` @D   (k2d V R@2` (Y  @  @ " & `B :@@V   R` 2 $@ ` $$@& $`  "  '&  "@% ( ' & "   B@: `"&  B: @ 㿐  2'0KG >#` @?@? 9* t "@~ݒ (0) @   @Ր @j "`  "@ ~Ē (ː B? : ' `B : 㿘@)#  6`6` >@ ?2   ?2   >` @ b `B >` @?  0&`&`6` 㿐 '  @ "  V  R` 2` lf_findoverlap: default㿘 ' `` `@> "  `@6    ?   @ $   2  2    4   8  & '  2  2    2   "   4$   2 "  4  2|  (x  ?2   ?2 n  4"  @2 "^  @  ? @ 4  @ 2Q   8 K  4  2  @(  4  29  @(5  ?2  ?2 +   > 2 > @ 4 @    > ?>  >X!@  `  $2$" $$2$ $㿘 `@2   ` @2 ``B > '&` `@ ( `@  (` B?> &`  ({ 3 (``B < $ $` B?> $ &` & 㿘 $  & $ $" $?" namei: bad cred/procnamei: nameiop contaminated with flagsnamei: flags contaminated with nameiopsX ,   $ & 0 ,`2 $>ѐ"?" (>ː" $>Ő"`$ {S & 4  $ 41 $ 41    "  " `|ǒ & `|’  >`(& `@J? /2& ` @$` ` `@J? /2 & & `@* `8`&  & > }#& '>¨$@r`$`J /2& @`$` ?& `J@ /` @\& @@`@8``*  "& 8 !`"`  2 ` ''`* @@` @= `@W `|J } @d`|A t $`q "   2   ''`* @@ ``i&    $z `'''А 'Ԙ  ?'''' >` `'''`'* @@   ('`{ "` % #  ?{  ?( ` 2`{ $`*  @@& F `{Ӓ @ @ & lookup: SAVESTARTleaf should be emptyx($$ `   `@ @`>$` *@$`\$'\' *` @$` ` $``/" ``@$`J  `"`$`w ?$" $`@$`J 2 ``2`*@$`` 2``J` .2 `J@ .2`` *@$`J 2``   *@$``J 2'` 8 < @ 8 "$$@ $` 2 `>a'a' * @@`@! >#@)1> > }#Ѐ2$$@ "$`!2$' @` @!\'!\' * @@ $>`'''`' * @@ఒ":`   >#? ?   ' @` @>a\'a\' * @@$?    `@ $@  `$'` $``  $` "@$$` @ @" 7  8 < €ܰ2o`@{$ 8 2  8 <" 8`!" 8 2``@@J /2@@$`d J@ /2@$`J@ / ` $`?$`J /"`@c$` ?  .    )" `   "` ``@@$2`@?` & >a'a' * @@ ` J  >a'a'* @@@@$relookup: lookup on dot-dotrelookup: symlink found. 㿀 `@>’* &\'\' *` @ J 2$ 8    "0 2 &@>a'a' * @@&@@ >#@>>"ؐ`'''`' * @@ఒ"@@ ?>#][    V@U @uQ  8 2  @">c"? +    &" `  0@@N2@s # >a'a' * @@    @@ >a'a'`* @@@Q@1&@> } HH > h h vfslock㿘  " %#> &  b ޖ    &  vfs_unlock: not locked㿘 @*@>"@& *@& vfsbusy㿘  " % #> &   b   @@2 @&  vfs_unbusy: not busy㿘 @*@># @& *@&  > hh" @ < 2 @` 2 < 㿐> r& @#|> {` * `& <`2` `*  '> !h!h@' ͐ c` '`6c`& <J  * *`8J "??: : H?" <" @" 8" 4" 0" ," (" $" D" " " " " ?2 2 " Xvnodefree vnodefree vnode isn'tcleaned vnodecleaned vnode isn'tClean vnode has pending I/O's㿘> }!H !H>!h> ~b* @  > ~">!h@   v @ > ~b N"b 2T >,!&R  "  >!@n>!` "` "  "@z"$  8 $ @@L | >!@R>ǐ!ؑH /* % 4 >!H 0 $$ $ T$ X$ D$ L$ H$ P$ <$ 8$ x$ @ & 4 $ |   ` $" ( ( ( ( $ ` " `" $` $ ("``" (vwakeup: neg numoutput㿘 0@*@ \& 0``4? "`4>h p@  "@`4vinvalbuf: dirty bufsvinvalbufvinvalbuf: flush failed㿀`>c''' 'c' * @@ఒ 0 ">1   ,` ` ``P ```2`P`` 0` ` ``P ```2`P`Q `P &9H /* %0    0 @ " 0> ΔH 0 " ,060"0H 00 `>Ð  0@ " 0€` ,''\`* @@ ,`   0 > , >! vflushbuf: not dirtyvflushbufvflushbuf: dirty㿘H /* % 0&  0 0 >#0 "0H 0\`ϐ 0 0Ք@`2  4H 00  4#>  &8c 4  4H 0 0 >#@Ғ0bgetvp: not free㿘`\ >;!P@&`\ 8? 8? < &`D , &` ,`"` & , ,&` brelvp: NULL㿘 \ 2 >!!P#!@  `"  "`   "@&  \@k& \reassignbuf: NULL㿘`2 >"X0!P#!@  `"  "`   "@&  0 "`,`0@ & @ "` &@& 㿘@  㿘@ 㿐?  > \ &@ $ 8@  '@Ő&@ 㿐 8? >`d @ @ ?* > `h @ '  < @2 < 8 8@2    t $ <"  <" <@"` <"  < " $@($h@k" a'a' * @@@  &  x& x$ 8vget㿐 V  z "ۀ@2 V &> h !  2  `"  "` > }"!L  "@ `  6 >a\'a\' * @@ vref used where vget required㿘V  >"X`6 㿐>a'a' * @@@vrele: null vpvrele: bad ref countvrele: ref cnt㿐 2 >̐"?6 *    " & >"@F>#> }aL& aL" "aL>a'a' * @@ " holdrele: holdcnt㿘  4?>#& vflush: not busy㿘 @ >   8 - $ 2'" T T  "  8 2T   "` 8? @א @ > b\ "  2 `  vclean: deadlockvclean: cannot reclaimxV  >9>a\'a\' * @@!"!>#!P` & ?  Κ >a'a' * @@ `>a|''ܐ '?'a|' * @@>a'a' * @@>a0'a0' * @@؀  >!h>  > "$& x&  ~b& |&vgoneall㿘(4! >"& 0 0+!(#& <"< < ` 2<8 8@2 < "<@  2<(2 < >&@vgonemissing bdevmissing alias㿘! "& >(X 0~> ے  8? 8MV  <@2 `"  "``" <2<2>U 0("+ < <@ ` < 2 <8 8@2< < 2<>1 @2 7" 7& <sK & }aHaH  ""`"   "> }aHaH & aH "`  "> }"!H!H&  & 8: ?> h(" < 2 <8@2<" 2< 㿘(2 <"V P @ ` < @  8 8@2  R  2< VBADVFIFOVSOCKVLNKVCHRVBLKVDIRVREGVNON%s: type %s, usecount %d, writecount %d, refcount %ld,|VROOT|VTEXT|VSYSTEM|VXLOCK|VXWANT|VBWAIT|VALIASED flags (%s) P"`8>}#`8>V``XV`*  `>r#/@ >@S` @ >@L`(@ >@E`0@!>@>`@@">@7`H@$>@0`P@(>@)`XO > h9`| >>2 x0 / >a'a'`* @@kinfo: vp changed 㿐 > ~" ` *` * E&@$&@A > !h!h@ 7  2-$  > | >" @ܐ'  2 & " $ '2$&@  <" " `" `< 2 `<`8 82`<2 `<`2`< 㿘\  "u `4 P(a$`0 4`4  "g$ .  €@C.  1d  p @yX`\&M `\ 4,`d" \`&{< d 4, .  > #`. @2`` 2`$``2@.   7  @`4   P'$`0 4`4 qD 1㿘  q9 1 㿘 %> " ` (q( & `` 㿘@"  <& ! P " !&  㿘 !  *  ` `€ 2  "2㿘` /   @!2 `@v  @2 2 2   2 2 2 * `  unmount of %s failed with error %d WARNING: some file systems would not unmount 㿘> !l!l? +> )> @tb" Xc h >Y syncing disks... %d giving up done 㿘H o@>?!8> #  > @uA > " @ > " @  )> }  > x ܑ*`"  t* @  > } t0  "   ">>!P (' @ݢ@ >!X>!h㿘`  2 ->  Ԁ  > T㿐 \ -#\ ْ >   v I'd D'h'D`@'@'l=@`@>P@ 2`1 @  2`& -`@  @  $  D@ uԒ  ">`!7 &`>a'8a'<`* @@8`>a' '$'(',a'0`* @@ @ u   `! MѰ &`   `8 "@9  # >c >#X   " @     >#*`<  !    m @! >#X- $ {`0 "`0$`<$  $ D` "   `@$ ? #  $  ` ~ @ $ `@ ` @ @@ @ $   @*@B$ @$  2, > h$`$ h 2`"h"> "!l@2>a' a'$`* @@     - " <>#X@0"0n |mount: lost mount㿐V  7 < `€ "> >T "`!> }` 2  xL$  2 `nB$ ``2`!> }#Ѐ_3$#;P'Ԑ D''@'>'ܰ& `D@  td"`0`@  `@ unmount: dangling vnode㿘  T  @@ & 2L  @r& 5  @    @* &  "Ɛ# "` > h@"h"@`" Ґ$`< `0"`0  ">"m 㿘> !l!l?@ &  `` 2`` ?$`  @  "`` @$``@2` P'Ԑ @''@'y'܀    `` ` @P'Ԑ @''@'_'܀ # f    4  s|  #!''Т`"=!㾐 @@  "    `  4  sR  #Д!''`"!㾘 @> !h!h` 72  -6, @2'`      2 4  s #!''!ڔ! Ѐ$&&& h @@ V >a\'a\'`* @@`8 .  >a''Ԑ @''a'`* @@>@ @" )   `€̰ >m̀ "`<>a'a'`* @@Ѐ x`$` sP` D'''@'@3'܀ `  $ P  rz 2'Ԑ D''@'@'܀  " ?= $  $ 㿀"'  8  `>a'' @''a' * @@>a'a' * @@ `A`` @'''+ @ ''Ė8 @ $X"$X`r  ?X aژb?"B A`0 `ϒ 4 4 > $ G$ 7  ?` ? 77`  0>a'a'`* @@>bd'p't'x '|'bd'`* @@p>T  @ ~`* "@a\'pa\'t`* @@p  4 >a'pa't`* @@p &ؠ  q     't 'x'T@P'PI'|``) ѐ `` /* 7`'`< @ @8@   @ @ 2  '' '  H> >d'8'<'@'D 'H* @@8!>'8t'@ d'D'<`* @@8 >'8d'@'<`* @@8d0/>$'8`'@t'Dd'H$'<`* @@8'8td'@'<`* @@8d͐``Đ -('Ԑ @''@''ܰ[ 'Ԑ ''`''ܰL >'''`* @@@ m  0.!># ''''#'`* @@''''#'`* @@>''''`* @@XȢ$ h @$ Z 't 'x'T`P'P/'|M` >'@td'H'D`* @@@`@$ ` ` .` 8 !7`>d'(','0'4 '8* @@(>T'(`'0t'4'8d'<T',`* @@(i ( ' ''@''ܰS >@2 >'''`* @@@   0 >Đ?'''`* @@>''''`* @@ >'''`* @@lā( 'Ԑ ''@'o'܀ M@ >'''`* @@Ād0CA0 @ni !>#''''#'`* @@ ''''#'`* @@>d'Đ'd''* @@  @ @*@ 2T R 2O  8  H ``? " `  2`; >7 2   ` B.  `a''''a'* @@ `` B @ B  < 2``  `<   >8`?@: `  $  $ 'Ԑ D''@''ܰ2&$ ``*`` !``2`@`>@c>a''''a'`* @@n$ $ 't D'x'T@P'Po'|`@ \U`  n 2'`Y `'t 'x'T@P'PI'|`@ 6/`  nk 2'`3 `@'Ԑ D''@'$'ܰ>`8?'8'`* @@' ''@'', 8 " `'`  ''А '?'''`'`>`'x'|'`' * @@x̐`" &ؤ't @'x'T@P'P'|8>`'8'<'@'D 'H`* @@8>a\'8a\'<`* @@8`   8`'>b'8'<'@'Db'H`* @@8@@WA >'x'|'' '`* @@x>a\'xa\'|`* @@x`   `'>b'x'|''b'`* @@x>a'xa'|`* @@xؤ't @'x'T@P'P;'|9>`'8'<'@'D 'H`* @@8>a\'8a\'<`* @@8`   ` /7>b'8'<'@'Db'H`* @@8@@ƔB >'x'|'' '`* @@x>a\'xa\'|`* @@x`   e` /7>b'x'|''b'`* @@x>a'xa'|`* @@xئ't @'x'T@P'P'|`>`'8'<'@'D 'H* @@8>a\'8a\'<* @@8  ? l 2> T ?>a'8'<'@'Da'H* @@8 ?Ð*@ ?`'`'7>b'8'<'@'Db'H* @@88ئ't'x'T@P'P<'|`>`'8'<'@'D 'H* @@8>a\'8a\'<* @@8  ? lI 2> T ?>a'8'<'@'Da'H* @@8 ?Ð*@ ?턐`'`'7>b'8'<'@'Db'H* @@8ː@@j >'x'|'' '* @@x>a\'xa\'|* @@x  @ kߒ 2> T ?>a'x'|''a'* @@x">?Ð*@ ?`'`'7>b'x'|''b'* @@x>a'xa'|* @@x`  X " 'd0X@w'' ''d @'h'D@@'@G'lE> P'(','0'4 '8`* @@(>a\'(a\',`* @@(`  $ '*`" *  * ''*`" *  * ' >b'(','0'4b'8`* @@(쎐`   "  0\@wI'' ' @@N  >'h'l'p't 'x`* @@h>a\'ha\'l`* @@h`  $ '*`" *  * ''*`" *  * ' >b'h'l'p'tb'x`* @@h>a'ha'l`* @@hؤ't @'x'T@P'P'|M>`'8'<'@'D 'H`* @@8>a\'8a\'<`* @@8`8 - @9(>a'8'< '@'Da'H`* @@8`?>b'8'<'@'Db'H`* @@8+@@J` 2D ` >'x'|'' '`* @@x>a\'xa\'|`* @@x`8  @ݐ> 떐`? >b'x'|''b'`* @@x>a'xa'|`* @@xp`@@( >a\'a\' * @@ >'''ؐ '' * @@а>a'a' * @@Ё ' ''@''ܠ ǰ' ,''l`h'h'>'X'`'\`* @@Xx`|8  `8 "8   `8  " "? J>!> # '@'D'H'L#'P`* @@@Ā@` '@'D'H'L#'P`* @@@`> '@'D'H'L#'P`* @@@>#'@'L'X|x'D'H'P#'T* @@@-'@|'H'D`* @@@@``>>'@'H'D`* @@@pb  "b 8` Ȣ 't 'x'T@P'P'|M` >'@td'H'D`* @@@dǐ01 A '``` !* 7`>d?('0'4'8`* @@(>'(`'0t'4d'8',`* @@(s`8 'Ԑ ''@'u'ܰY`8   2@  2  1>!># ''''#'`* @@''''#'`* @@>('Đ'(''* @@'''`* @@Ā.0  (@@̀ '` 2`  '8  `'`'Ԑ'ؐ ''''`>'a\'a\'* @@`?`>'''''''*` @'':`>a'a'* @@ C`@ > `̐ؒ????@  &`@  ` ` v'̐  " :`  `'"@ & "@ 0ؠ't @'x'T@P'Pj'|2``8? +  >a'8'<'@'Da'H`* @@8 @ gy  V` @(NE @*`2P   "  `,b[ $`$ h$`( L$`(` +> 虐'7>` '''''* @@>``''`'`$'`'* @@{*```$'''* @@``@ܐ $`뺐 $`h`  }$`$ D$`(㽐``8 b -1d`>a''!''a'`* @@mdd`8 f @ha>a'' ''a'`* @@Qd9>a'a'`* @@>c'''' 'c`*` @>a\'a\'`* @@  ?>b''''b'`* @@>aP''''aP'`* @@` ` 4`!㿘   " 8`> "p*`@666666666   " @e+   㿀` ?4 >a|''''a|' * @@P\`dh  l>a\'a\'`* @@Ȑ'ؐ '?'?''  '>b,'''' b,>bX''''bX'`* @@ %耢  "   >a'a'`* @@㿀 >`'''' '`* @@>a\'a\'`* @@ >`>` ,'''*` `','`* @@` $ < @ C > >’''`*` @㿀  8    2   2`>`'''' ' * @@>a\'a\' * @@ `>`>bX''''bX' * @@` ``$:  @ B > >a'a' * @@ >a''''a' * @@ "Q&@&` 8?`$>#H*`@;d;p;|;;;;  ( 0% 6`6` &` &`&`>`0&`&`&` &`$&`(&`,&`@&`D&`H "@z>`8 `  8?`0> *`@<<=4=4=,=,=4"@2>a''''a' * @@4` "@ /&!@ * ( >T`b'`'d'h'l'p'tb'x * @@` a@   "\ -"`㿀V  > b'''''b'* @@㿘 V  &defaultvop_lookupvop_createvop_mknodvop_openvop_closevop_accessvop_getattrvop_setattrvop_readvop_writevop_ioctlvop_selectvop_mmapvop_fsyncvop_seekvop_removevop_linkvop_renamevop_mkdirvop_rmdirvop_symlinkvop_readdirvop_readlinkvop_abortopvop_inactivevop_reclaimvop_lockvop_unlockvop_bmapvop_printvop_islockedvop_pathconfvop_advlockvop_blkatoffvop_vallocvop_reallocblksvop_vfreevop_truncatevop_updatevop_leasevop_whiteoutvop_strategyvop_bwrite    dead_read: lock㿘@  " >H! @? dead_write: lock㿘@  >4!h 㿘@{   > "`* @@  㿐  \ " @b  > `0("`0    ?`\`* @@㿘@G   > !\`* @@ 㿀@5  >     a''?'a'* @@ tag VT_NON, dead vnode 㿘>ϐ#0  dead_badop called㿘>#h㿘!   "&sl !"fdesc㿐 @@ 5 - @Ӗ 2.  [$ #>cؐ "8`"#&! @ !&  h YG Zh@|v"@  @|r ZB   㿘 !@  > L   T   ’ 2 x!\i &! 㿐!@>a\'a\' * @@&@  -㿘` 8` @   @*` "`@ `6@ "&`&` &` &`&`&` @&` <` ה  h`LӔ Z ’`ϔ Z `<@@{    - - -㿘> w" 6> }> r#>#X  @ "> } `(> }*"`l >  l> "bԁ㿘 > "> bԐ@* @@ > { 2 `2  o 2@ =& 2 > {ch  ch "ch rZ @ "ch > Xz> {  TZ "`|$ $ ?$ $ $ @ $@" $@$ > {hh `"h "hr fdttystdinfd/0stdoutfd/1stderrfd/2..㿈      L .2  %@M>a\'a\' |   ` ɐ 2 >`@{f  2   a쀢 2%@>%@\d"`8  2# >`@{K  2  ( "        ;쀢 2%@>%@=    $ >`@{!   >  >`@{  >   >`@{    >!  B 쀢 2V%@`|>" %@ "`8\'\'`* @@D  2 >a@zߔ  2 b3  @*`*: @Ѐ@  А ,`L @   ,`@   `쀢 2 %@`| " %@%@㿘 | `> *`@M<M<MM<M|    "`X> } l    fdesc attr `6e @. @2R ] "&   >Q>Q M> a''''a'* @@?@ ;?`# @66`1ὐ &@6`6`&`&` &`&`>`&` &`$&`(&`,&`0&`4&`8&`<&`@&`DЖ @v2 >`Hݐ!Hfdesc_getattr㿘 `|  `a >#H*`@O\O\PO\O\@yƒ `r`| $ `| ``!!m!m4  $$ D 4 `|@yr  < 4 $ 4 > } l  <  $ D4  $$ D 4  "< $ $ ` <$ "$ > !x  $ $$ ($ <$ @ $< H ($ , ,$ 0 0$ 4 $ 8`|   .>m#$`8fdesc setattr㿀   | ` ` - `*@@`2R` ! `   >b''''b' * @@  > >* ذ%d㾐    |   2  `    @y   7  | S , * >Òc > 6 2`( "/` `   2'`  :"` *@ "` ' `/ `` @h/O ? %@``   C >?=   6 4  '/>!q `*? /, @ " '>av// h  ?%@``ʠ < <㿘 `8 "`| ` 2  -`@x% hw㿘  |  -> } l   㿘  |  -> } l   㿘  |   -> } l     㿘  |  -> } l     8 㿘  |`""`"@ |X' T& | `%>(VWWWWVVWW `   ` "  `    `    tag VT_NON, fdesc vnode 㿘>Ґ#   㿈 > `''`'* @@  㿈 > `''`'* @@  㿘  $W   -fdesc: bad op㿘> (kernfs_get_rrootdev: no raw root device 㿘> $ > y㘀?"> wb >'>Ģ  c,  ` @#,$c   &, >Ē?" >\ Xkernfs㿐 @@ 7 -> + 2/  @U͔ #>a0 "8`"#&! @ & ޞ h Y  Zh@w"@  @w Z    㿘 !@  > L   T   j 2  j!W @&! 㿐!>a\'a\' * @@&@  -㿘6@>  &` > }#&`&`  "@&`&`>!h> ~b&`" &` @  <`    h`L  Z ’`  Z `<@@vE    - - -versionusermemtimerrootdevrootdevposixphysmempagesizeosrevosreleaseostypencpumsgbufmodelmachineloadavghzdomainnamehostnamecopyrightbyteorderboottime...%ld %ld %d %d %d %d %ld %u 㿐 /"C>  Y "$    0r"! o  Y [ 5G> f O _/> ` @h>`0K@>EaE&oL> x o8p /" "8` =& ؐ> ~ !h #h> #-  Ԕ *@* `(# `( > ےa0 > }#>>  a" @u&& 㿘 / _2! J? "!> # .> "#h J? "!> ~!h .> " ذ 㿐   %@? Y   >L .>%@L  h>a 6 `?2 @u    ` / -  ` G `?$  ` m %@"  2  > @    TS "`|" `  "`8%@ 㿘 @ 2!m`|    { 㾈  ` @u2ސ$ $ ` <  $ < "@g$ $ $   4*`" *  * $ ($ 4$ <$ @$ D 8< H $$ 8 ($ ,$ 0@   $!m4  4 $  "< `| `  $`4  4 >Đ h$@:  $ '! > <   㾐 `8   -`|' w!d  㾘 `8  ' -`| ` "   8 d” "  2  *?@t_Ò㾈    8  P  4J    @t|  7,`>Đ h`6>!耤@0 G` ?"!  b쀢 " `' /   ( dh/ ?`%@`  Т`<`<  8 㿘  | TN T& | `%>(f$fdfdfxfxf<fPfxfd `   ` "  `    `    tag VT_KERNFS, kernfs vnode 㿘>|"  㿈 > `''`'* @@  㿈 > `''`'* @@  㿘  $Sߒ   -kernfs: bad op㿘>{#㾐!$ @  `  &``(  @3  @( c2` 2 `N`-  @( `  ?&`> (2   h'> `/>  `?` >@ > ! *@"@`"@8 `    @' @8 @D  @9@  ؒؔc  @;@    @8@ ` 4y` 㿘`  e H P$ @  `  &``(  @2ː  @' bŔ2` 2 `N`-  @'`  ?&`> (2      㿈`<` ` `  `8`> *`@ooonPloooo> w"  ?1,  ,>  Ԁ  , * > rc  $ t >  Ԁ , @? G  R` w \@ W , * > r# $ >@ $@a'a'`* @@>a\'a\'`* @@0.> r#|* >  Ԁ  ?  , "* > r`    *, "*> r   spec_read modespec_read procspec_read typep   >y# 2 >!l">y# 28 ' >>a'a'* @@<  *@ *`> r〒@ ` >a\'a\'* @@0 ( '<> r#| `")` *" * > r`  `  `h@   `  ` " ``"@ti' ( 2@n@n= ( @n+>  &@8  '?#\#`2  ?ܰ$ @"@ 8  Ha+9܀    `0x#0+ spec_write modespec_write procspec_write type㿀     >x"  2 8>!l"8>x֐" ( 2>>a'a'* @@<  *@ *`> r〒@ `  >a\'a\'* @@  2  6< > rc|( " ) *" * > r`  `  `h@   `  ` " ``"@s ( 2@n @m> < @mM(   $@8   : '?%@$@8` H`ZŌ`A䀥`2   x#"Q spec_ioctl㿘  <`  8  ` .>+` *  > r c     +` @ +`" * > r`   @ " *  > r `    @w!㿘 `8 2 `< *@ *`> r @ `  spec_fsync: not dirtyspec_fsync: dirty㿘 `8 LH /* %`0   0   0 >w#H 0 $ 0H 00ޠ@ `4@ fH$@`4 `4`0  H 0>#`0H 0 㿘  F*"@ *`> r@ `@    ``    spec_close: not special㿘  < 8`- `I>]      Y   " H 4`!4` * @*`> r#@`#     2+ 4`!4` * "@*`> r @`v!@  tag VT_NON, dev %d, %d 㿘  < > w" `%>,({P{{{{{h{|{{ `   ` "  `    `    㿐      <#\  P  spec_badop called㿘>v# D"@ @6   @ " @  * ((,  ,   % "  " @  @ * ((   * ((   * ((  "  "@ @6   "   2" "   * H  ذ?? `>"*`@4<l,<<<<\<<<<<<<<<<<<d,<<<<<<<,<<<l<<\<<<<<<<<<x<<<<<<<$<<<@<<p<<<<<<<<<<<<<DX<< <<<<<<<<<<<<<<<<<<<<<<<<<<$<<4<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<   `?2 Ŕ`4  `H2 & @ Y2 ` @   "@  @ 6    ` 2ڰ @ @ *  **`    ` 2 @ @ `* @ @ 2 ` @   "@  @ 6 J @  @ 2 ` @   "@  @ 6  @ *    * ? * ? *  "? *  "?-  () '  *# !  2   "  (  *    2  "  * fdb"  0 X VT*R2 O L"  @ow G  @nӰ A =  : 7* 422 0 .  4*`2  6*  6% 928 4   Ҕ*``?㿘> "` > ` ""```2`@  㿘> %> `"  6 ,> 耢@  >  + " + Jt`  4 K $ @k 5@(   , $ JU @kÒ,`$ ,`%`,,`) ,4`& 4,`(> > a*  "?$` >#!H$` `$ $` `"``& &  $`$@$`,?* 㿘> 䀢 2& > """" &  & > bb & b "` "> """& v㿘> 䀢 2& > """" &  & & > b& b" "b]㿘> " - "&  ` @2   "  @@kr  0 "    "   @kd    2  2  㿘> " " 0 "  "   `@2   `"   @@k;    2  2 0 㿘      > 䀦 > > !.  :?> "`5` "-` `2$  "   ` @  `* "  @ "   2``2` >  "     22  㿘  < ` "8 `2/ `  @j "(``"   @j 2  ` @  @ `*   2㿘 ,`@ ( `$`   `@R` ?@# &`@2`&`@    4 >#!H㿘 0 ?  6 0   2@ @)㿘 0`@)2 0㿘Y && & 㿘H /* '> "  T . " ?4 .*  2   `" @  2T .H 0>#>aP"9 㿘> " "   @i     㿘0!@0!$@@ݐ  !1@"w  !@  !@"dz 0!@"`0 !2@"`m 0!@"`<f q6o&O i`0 " 2H /*'?H 0 "`0`0 2`0H /*'<H 0`0?"R` ! @ -4`0( Ow "$`<On `   - @ x@ `> I"؀ E Ȕ  9@h  25@.` - `  ؒ ` " ؒ 2  `  @ ր @"&@ %s: can't handle af%d 㿈  0 A AE 2> "Ƞ& p"  8& t 4  @!E  6?4 6 4 " 4 t "  0 4  @! 0@!, $ t2 4 A " X`> "Ȁ : A @ "  vz>$" 0v>$@- 2` ! ( 0( 沔0 (c7ۀ`  ׀`  Ғ    0(? < 沔 "5`` 2  `?" 8 `?"  `` ?$``$`   `` `` $` ` ࠒ `7  7#В pڤ /}``@` 2  `?" 8 `?"  `` ?&``&`  W ` ` `` &`I 7` p l ࠒh H /* '  @    & H 0& 7 \` & \&` 2" &  &  & `"" 0 d & d 0$ |@H 0`㿘 0  > "& p"  X& t  & X@  >Ő @gm  !"6#"`  ` & ``  $   > 7  50 01 `h">  >  *  > }Ӑ > }{# > @ Q">  >  *  > >d <@.Ր0\ Y @ T  ` P*@"@K@ ˒"   && ?`&` ?" 8 ?"   ?&`&  S    &7@2@`2``2``2``2`` 2` ` e2` 0#H /* ' @ `"0 & 2" "" "H 0> {p >Ŕ : `0 `(   (((> {#p㿘 . 4. 5 . 6%& 8 >$#耢`& x @"`  2 `* 5 *`  5 & `2@& 㿈H /* '   "  0(     >Ő!ڔ >Ő!Ք // ^/  `/ /  / H 0^ / 耊 2 `H 0P  @f  2   @e          $ H 0.  7DB  H 0  7y  u $  $ ` $ ` "`&``$ ` &`H 0 4㿈H /* '   "  0( G    >Ő!= >Ő!8 `// ^/  `/ /  '/ `H 0C / @ew  2   @ep      2  H 0$ ?  $ H 0  `"  "`   7E2"`?&`H 0 4lo%d㿘 ? >)!H>(#0> " >(bhp$ $ 84 0$ $ x , 4, 6, 5[`` looutput: no header mbuf%s: can't handle af%d 㿘` 2> >(lǐ""& p" & t&`4 @" L42c ` 3^ A L \ & L`@& \ >(#m L /> }#  H /* ' @ `"H 00 7&` 2" ## " `">  *@ ">  >  * `  D0  D X & D`@& XH 0 ` "`P 1@ @  @" 0  2@ 00 >)0 "" /  /sl%d㿘 >  ? >-#>*"`$?`>)oa$@!($?4? ,?$?$?Ȑ 2$? $/osl%d: can't allocate buffer 㿘 8 H /* '1> !   _ !> #̒" > }"ؓ2`  * > c` ?"` &!H 0 >) l" 0 ? 4 0$   ?$ @%.$  㿘>!l`I`[`h > U   `H ?Ԁ 2I/ "H 7&`$?`$?\H /* &`p $ &`pH 0В H /* &`L"Q $`` @ $ #xv  H 00$ $H 0 / 㿘H /* ' . h`1 $`& БH /* '> #`("@> }"ؓ2` ?* *   `> "x> `c` "ᰐ "` H 0 $`$`$``䀢   HI``H 0X@ ?ࠐ "%s: af%d not supported 㿐 >*"k5l / &l`2`p*| 2  ` @20p A0@ ` 2 c 4  2H /* '܀"  H 2 > "p"Ȕ"  't"@`''А"@@' $ `@6&  @ `& H 0P 7  &P&`  2" & &  & > "&p" &t`H &@ H 0 㿘 Ъ H>   H   ğ@ H 4 L H" "QH /* 'ऀ "  $$% ଐ?$଀ "d $d    $$% ?$H 0    > 0@  @#   @*> b$pb`$t H   \ HD$\|  4  ` `?*  $͔ H \$\     ݐ  "\\0 $\H /* 'U *`@?2@H 0   &H /* ' > #̒"@> }"ؓ2` ?* *   >  "@ " %H 0 >R b* A 2  Ò " \  T $TL $\` $L㿘 >b?ٔ  6 H /* '> c` 2`H 0 &&  &  6  J `cO (G`đH /* '!> !    !& > #̒" > }"ؓ2`  * > c` ?"`  $!H 0  "  & (& $ &  6   2  `Đ($`& `Đ 8&  & & & 㿘> }c`А  "c?2  `p 2  X` @2 X Ȑ $ Ȕ  0 `'$ X2!$  Ԁ >  bȐ @6$  > Ȑ @>  Ԑ  $ $  Ԁ > O0> "$ Ѐ ܀"   2  ̀ 2   ̀ 2  $ ̀  ?$   Ē" `$ @'p 2 0 O* 01 @#n 쒒$q H0kp2j H`'f Ĕ p@#^ 쒒$a H 04 0"Y H D $ D> "$ p" $ tH /* '> }#(#(@  " H  h$ H`u$ h0 #  2" "> } " > ""`Y#">  >  *  0Ő H 0   @`$ *@ $  Ȑ $  H $ H $ ̐8$ $ H( @ @  @"   1@ 2@ 2 /0 20" /  /Hppp%d㿘 >  ? >0">1! 2`$?Ԕ`>.kv`$@%$?l4?d ,?h ,?j$?$?$?$ $ ($ !a㿘 >   ``! >   ```!`$& $ "& %6 & !@_O . =ڔ  &!P@ Ē?&!,&!4 "!$? 6"!$&!!&!> "&!<&!8㿘&  0& ?6 0 "  & & " Ȑ?& Ȁ" u  "  & & " ܐ?& ܀" b  Ԁ"! & & " ?& " !O   J&!!2 @& @&!,!D &!4> &!D&!@!L "!P> &!L&!H!P > &!P%s: comp_alloc failed %s: decomp_alloc failed %s: no compressor for [%x %x %x], %x x  Q@@% S@"   N@"@"A ? Z@">  V@"6 ? J@F?0  G@"X  Y@"'   R@"G ?  F@"E?  M@"j   K0 L@"t?q&o&m&D h H /* ! @ @@_Ho o <?# @@$ Dx B> $@(;4 : 7& Dg 1!P "- H /* ! @0 DP  0$ DG   ـ >! `o! @ 2e`` . H /* !!, !( @ @$!(@`؟€  $!, @@ 7>.#hf  7Ho o ,H /* !!4 !0 @ @$!0@`؟€  $!4 @@>.#f  7Ho o *@$ H 00@  @@i>.ؐ#ْ fn  ! 0 L@2 !$w&C r!$"m H /* !$!$  @ @0H /* !> "!8"@&!< "@&H 0C "*   ; 0=3 0-Ð   =) #    G@!H!@ H /* ' && H 0 =    㿘>!lH /* '  !2@I @ !@"5 ! @"-  !@  !1@2v 0!~@"( 8 !@"i 0!z@P0!{@"^  0 @Z ?X6 0  BNK$ 8I&"F /  B@ /@\ 8!&! &!&!&!& !&$!P . &(!P &,!P &0!P &4!P &8!P &<!P &@!P $&D@\T 8!, "!4!(`€!4 !0`4€,H 0%s: af%d not supported %s output: 㿘 " 2 0 @. 2` 2ٰ 2`?Ȓ*@6`>1 `   ! !$@6` *  !e  / 2" ` 2  `?"  `?" 4 `  2&`  7?&`4 `*@`*@`*@*`` ` &`  @ @>1!dĒ @  `*@!D  텖 2!La !L y "`> "$!8`*H /* ! !"&``.$!`@   @&&` "&` "H 0 P 7!`$ P "$! 2" "" " @> "& p"  L& t` \& L& \H 0 㿘!?!  *`@`! !$"-,#$"@   @& " " P! & P`&! 2" "" "$h 2&!㿘H /* '  > * &  @ B">  >  * ݒ 0 H 0㿐Ho o 耦    $ $ &  ?$      $ $ &  ?$ 2 !H 0  $!  ` ` @*  ! `  -/0 +0!P' ` 0  ` 0 2@,  p "  ,` / -,@,`,`,`@Ҕ 0 !4  "1 !, , @( '    !( !, 8   `@`   `  2 2  0 !"     & &   2 ` @,`,`   & & H 0㿘>  БH /* !  '`?܀?Ā  H /* '$?ܑH 0 ?@H /* '?  $?$?"?$H 0 @R 0!aH 0if_ppp/ccp: not enough data in mbuf (%p+%x > %p+%x) 㿐` 4`@`` `` `  ` `*  @  @ @>3#b 0 @?`>4 ē*`@@X H /* ' ?#m  @om ` h2!4!, b` !(@  WH /* '  D H`!0 @ #\$ ;H /* '  @&0 `*2!4!,$@!!( @ 0@!0 (@ Ho o *@& H 0 㿘!,"!4!( @ &!,!4!0 @ &!4㿘H /* ' ` 6`&` Ā 2" & & Đ  > `& @  ">  >  *  0f H 0%s: got %d bytes %s: decompress failed %d %s: VJ uncompress failed on type comp %s: VJ uncompress failed on type uncomp %s: input queue full 㿀'!   &! @ `  >5 8aU@`` @ `% ` `*  ?А*6`H /* '  (& H 0  B!4@8  : !0,2 t p` ` `* 8 @@>5 Pa H /* '  (& @ @& H 0    @ !0`0€   >  `   ( -!P  @ܔ H /* '  7& H 0  - / !P ` ` #\@   @@>5 p>b6!  4 H /* '> c` 2`H 0 $$  $  4   $   dS$H /* '#> a   ܒ a$ > #̒" > }"ؓ2`  * > c` ?"`  $aH 0  "  $ ($ $ $  4  쀊 `  $  @  "@@     ?$ : u0k  !,@,`,`,`` $ ``@` &`?"&`    !  $  @  "@ $ `Z$   ?$4R$`  `   `  $ H /* '> V` *`@ ?2@ H 0 ` "&@H /* '`> #̒"@> }"ؓ2` ?* *   > `"@`?" #?H 0 @>$V`b*  6""!d !P ` p` #\@ƒ 6  ! @@>5 _~0ː !,`d86&`` 1 >b4  4 H /* '> c` 2`H 0 $$  $  4  k    &` &` &`` *!D  !L  "`> "&!<`* !, 0 !$ "`n0l` ` &`&`> &` ` V">  >  *  > } > }#  Ԡ H /* ' @&&` "H 0  @@>5 ^ؒh #$h 2" "" "H 0 DX $D@$X> "$p"  $t @0  H! & H`&!%s  *p>Ś!@  @  2  *@ `  *@` @  |*@ *@ ޒ`  >*@`*@>7#^sp㿘>!l ; NH /* &`h   `Ѐ  4 02  H 0. `"6!@6!&!|!T@U8 ?&!T&!`&!t& >:"|& >;#& >8"& &!x@Đ 0`@6 0  & @zu" БH 0 㿘H /* & z`  Ѐ  . h&  @ ʐH 0 㿘H /* &!x  A&!x!| " :&!| $>< $ ;& H 0㿘 Ѐ` r H /* & ` h " `ԑH 0Z - p2  p  @2 p  p  H 0= # !>ʘ "`H 0,Ӑ (`Ԁ    $`$`& `ܐ?$`ܑH 0 `   Dx2`㿀 p     @2 h  h  " ਀ 8` @` ` ( 7> #)>  >b2  4 H /* ' 4H 0 $$  $ 4   $@$ `#$5 H /* '!   m !$ > #̒" > }"ؓ2`  *  ?$  %!H 0  "  $ ($ $ $  4       $ @  "@  ?$`4 Cʔ$ ` /  u``  "`"` e 㿘 Ѐ``p? P@[ @  U@0 X@"!aTS  W@"   T@" F  O@" ?9 EB$aT@&9 :7$atat4&9 .H /*&aT $aXa\*@$a\a` $a`H 00aT 0 v  R@@>ŖX(0 @0( `(2 㿐 `H!0  `H>  !x2! 2`H! % 2  ~!`H?&!? ǐ#6!> b& pb`& t `F 2 *`@ aT/@*  `H$%@!@'&!`"H /* &  }   *H 0! &!``?"% d!8 :*`@ aT/@ }/ /H 0߀/!8:  :*`@ aT/@ },@` ,@,@` ~,@`H /* &  `H "    `H?0* H 0!$@&!"5%H /* 'U*`@?2@H 0  &H /* '> #̒"@> }"ؓ2` ?* *   > "@" &H 0 >R b* 1  ! 6!&!x`H!$!xH /* & @.`  $ >< !  $& H 0㿘H /*&  `(|7H 0㿘 Ā` П@ H c p    @  z 㿘 H o*@f {& H 0㿘H /* &   `o!|> #'>  2\  >b/ٔ  4 H /* ' 4H 0 $$  $  4  L B&H /* 'ᰀ    ᰀ$ > #̒" > }"ؓ2`  *  ?$  $ᰑH 0  "  $ ($ $ $  4     $$@"`H 0%s: bad char %x %s: bad fcs %x %s: too short (%d) %s: no input mbufs! %s: garbage received: 0x%x (need 0xFF) %s: missing UI (0x3), got 0x%x %s: bad protocol %x %s: packet too big %s: too few input mbufs! 㿘`Ѐ` `@> }@䀎a`"  $a`@@><W#`"( `2` "``p!!`n&`p*@ *`> r@ `€ 0逦  `p`Đ >`&`p@0ۑH /* &  ``@ $`> >ŒcX*   * @`` $`H 0`@@ ~2`aa 4a@?`0  '<a @# H /* & @ $`@@><#aY ``Ha $`H`t$a0*@p$` 4a p@`@><#(`X`Ha $`H`$a`X` ?  "` a|a 2$aa` ?"` aa|@a$a|"`! `H /* & *$`H 0P0*@@$@'0  at*@H /* & ` @2*@ }@$`$` H 0a A a| 2a|a| 2 a|`@@><#@$ a| `` "  $ $a  $a?4a``@@><#Xa`$a?*@a`$a *@a 4a  $ a 2a  @`@><#`X9`a 2a "aa`$a*@aa 4a`  "` a 2a 2a`@@f><aJ#`*X^`` 4a* 2 ` @`@P><)#a      $ @  "@`$ +   ?$ 4$  2} 2 `@@(><#Wؒ`$`$a  $     $ $a  $ a`$a*@>aaX*2 *  2 $4a` H /* &`H a` $`H`$a $`H 0@ H 0 %s input: 㿘`! &!*!! `  >? hWt !@!&!%s p >>Ŕ#x @ **@`2  *@`   *@`*@`*@>? WHp R` ` "``R`6`   R` `  "`  "``R`6`  @  @    ` "J2#  ` @ *J@@ `J@`  "  J   `?㿘@  ` @= 2  @; `    2 `  ``> {  @8@    @  ` 㿘@ V`  ` ` `  "``V` 6` ` 2 `   KJ@2@  ` `` 2Z  :  4#,`8 `` V`4 `A ;``2` `@ .@  "` T4" ' 8        2  Y    2 @2` 2 ` 8*""(:`"$?2" " *#* 㿘@ `    LJ  *L 6&& $ *`:` ` ``V`8`   @  $ $ &` &   2& & &  rn_addmask: mask impossibly already in tree㿐 > !0@ " @& > {#> {c e`!> {#$@_@#@ %> {L? "?%> {$@4 !>>c6"c> !u ,# 6$#@Lk"@$#> *a%@`  @L 2 Y`W %> 0 *ސ 0M 0 0@LD`0> {#> a5`  >@TҒc,N 0/       * "$L` :  >L#L@2 $ $* 86   .  @ 2  :  @ `  * @ Mask for route not entered 㿘> cT  "cT  *^   >AThb @KÒ  6 .  " & & & $Non-unique normal route, mask not entered㿐   `   2 ڰ  8 =  ,:  @뀦``"V [  x   2 2`&  ` . `&  2$ $  & $`& ?6  . ` &  6   @.  <``8 `T  6  .*`:   " T &  2  H $  2 ` *`: V 6$@2V$@$`G-T`:  $ 0@  & <& T`@2*,: V&!4# "  `  >ASxc0֐  ђ 22V$rn_delete: inconsistent annotation rn_delete: couldn't find our annotation rn_delete: couldn't find us %s %p at %p rn_delete: Orphaned Mask㿘Q  @4 @ "@J@ 2 ` Ҕ"  "  2  `"P K     >BRcڰ   >BRc4 "@> cT"""cT ? (" V V`8 4" `V`2  " 2   >BRc 2  2  < 2 &`2&`&``  ` 2``  "`>BRc # q  & & & $&  (& ,& `2"`"`" Y" ````2"`"`&@"0 V > 2@"@ & ? " T""T@ >C`>CR> @"  &@ &` &` $&`  (&` ,`&`"``"  `2"`"`  # `. . #㿘V  6  ` `2  "   V  6     @   2  "  㿘  t9  'Δ "3 @I: t&> {# , \" "   * * 82$ \$ `$ d $ h $ l> {c$ p$ h>Ac$ >C`,$ >?c$ >?b$ >D`$ ($rn_init: radix functions require max_keylen be set rn_initrn_init 2㿘> #` !> > `(04"0``2`(!> !0`*` >DQ}b`0)  'f #> { $c>DPː"!0*@H̒@ c!0 > {"#> { "#?* **> !q >DP"㿘  > 7#>#S "$   > 4 4 a8a8 $a8" "a8$  㿘 " `"  "` "( 㿘   >  8㿀'H'L'P'T'X> !8 H  @@2@ `" `@28  "  @H 2.  ` @Hx 2$` 沔1 `0   `|    2 ``0  `|  0a raw_usrreq㿘 `  ~ -    o -]`h.`>E"@8`tt|t(0H  N J "G 98D "? 9B0!9  "0 8$ "+ 9 € " $ #0   2   2   9Y& >EO{"א㿘> #  "  $* €  2 㿘m>  H㿘`  `<  `4  @ &h>   H'̓*`@H /* !  0 € "*> ` 2&>  `' 4!    @@̢" 6'̐ 4 6  4"  ` 6 4 6> c` 2`` А@F $'Ԑ @H 0́rtfreertfree 2rtfree: %p not freed (neg refs) 㿘 2 6>FNӐ"Ȑ?6 6*  ( 4 $ "> >FN"#V 6"#>F"O’0 @R` ?@  2` &ϒ &̒ ifafree㿘 2V >FN#؀ ?& 06 p  ۛ2U 3D @  0@F 2   @ " 2 A`. "  " 4 (  4  2 "  @x > #> # 4  @S4 4  A  ``'@]`> c 2c 4А@F) $'''' @ -㿘    ڹ  2  `6`@? 2`6  `@ Y"rtrequest delete㿘H /* !> `H` *   2   T0?`02`   >GM" 4 t ?`4 4 T 6 ?Ő4 6$ t @` > `  > c` "c'@T 6  4 60" @ 2 @}  0 4 D >*  :   S xk 3 x # b 7@E] x 4 4@b %r S 7 @   2` t " W  %P %M 0. 4`$ @` $ <@`L$ L`P$ P`T$ T`X$ X`\$ \``$ ``d$ d`h$ h`l$ l`p$ p`` @`'@ 6 4 6H 0㿘@ ?    ?    0 "  ?  8  (    #] 2$ )  @$ 0ۗۑ$ڒ  t " 4T 6 ?Ґ4 6$ t 4 ] $ t 㿘@ .@ ` .@  `  .@ `@ *@ @D"rtinit: wrong ifa (%p) was (%p) 㿐 ' `)    {    6 @?@ 4 6|^` 3^ A  _ |L````   @T 6 ` 4 6D`28`25 "1 6 @?%4 6>I M @    @R` ?X $ @2`$ @ $ <   6   @㿘`    "m & @Cْ `    > c?"c > c`?"`> c`?"`> c` ?"` H /* !  `/ ,` # 0%  > c "c > c`  "`>> c` "`>Ő#$ >  `"   @6 H 0route_output`'H'L'P'T'X  'İ     } 2  7  2 >JKG K(' 'P  !͔ 'G 7 |ז >'< +al L0&@'Ԁ   t  @CI 2! 7 '?`>J"h*`@**+(+(...+(؀ܐ İĀ$ @;L 62 6" Dؐ İ뀦 6 &7 6> `H*   ڰ / ܸ2 6Ұ  7 6 "   ]ƀ" € ' 0' ' D' 0 <`"'` ' @'`0 "' @ '`,6'Д @   ! JS" Д@ W 4& L&$ P&( T&, X&0 \&4 `&8 d&< h&@ l&D p&Hl&   b a E "V  ` "ײ "W 42  W 4 ش#$ $ @ "  @  ؟ @R` ?s ' @2`' @ 6' <$ @] L @ "   ؟ 2' D  L* ' L $ ' L - "& @& "`` @ > # 4 `! z10!  @^! 26Ԁ`> `#2 >Œc>Ŕ>M㨀 6  `" `" @`" `" ` "  `" `"` " 㿘@A  : " "  ? @ 㿘H ` @ T`yI  3 l@ 8 " $@@` @4&@$&` "8 &`@ @ T`xɐ    l@8" $@@` `&$`rt_msg1㿘 x֒ ?`  ` ` T L  L`d(& >LI!& &   @A" @*@&@ ?   }@  5- - y9 㿘 &@    T L  L2 "` @*@&@ ?    ׂ``*&`%  $      "     $ $    $  ,,4㿘> # `M@"`"`@ "` ># 2`2` >Œc>>Ŕ㨁p> # А@@J $ ' 4` , D4 V 0  $ $ >Œc2`>Ŕ>ǖ㨁p > # c`  +>ŨcȐ@@" $  ` " `    @' '` '`'"<` ,2` ` "``"`"`  ` `"%`' '0'ؠ"` ,2`V4` "`"`"` "5  5 c>>Ŕ`㨢``Ёp@   V 4`@X @? $ ' 0' ' D' < "  ' @' < 0   @ ' Д ``1`".V 4" 8" L"$ P"( T", X"0 \"4 `"8 d"< h"@ l"D p"H < ,2"""А " `ԉ"`&`&`p@?] $> ""h `` ,@2\   @p''``G` "D` ,44 T0 D$ А" `O 2>.` @ 2*` @'` '`B'````"``  ,2` `"`` "`"```# "`&```Ѐ '''2` x  c `^  @> '' ' ' 'ܑH /* !% 0 >  H   "` 2 `>Mcl (آ `` 0MH 0  @ '"&䀢   0 *` * " @y'@'h'@@>u`.`"* * ?*` "@.`"* * $, & . .  6 㿈@ `?@  ',@ `  "S @ &` `@2``@2  `@ *  @/@ &` `@@ ``@ @ `@ *  @ @ 2& &` 2 ,2@&"$@", ` @@2 ` ,``@``@<  @ 2  ``?@> * ` 2  `@>* א ` "``* 2  `2 ,, , 2 ,   @`" * 2  2 , , , ,  `@?#,2  4, , , ,  `@?#*2  2, , , ,   1>P - @A$AAAAAAAApAABAHAAB`` _@"`\2`` "2 ` ` "2` `` "@*2   2 ,, , 2,   ` 2 ``耦$ `@ " `@. @.@ ` ," @.@ 4  "& @& , ,Β     & `Ŕ `.` ` p.㿈` @#\@    &  ? ?$  ӗ$@㿘p\"4   ` `8 / *`" *  * 'h? # @7   @ * `+` @ 2 * @`l݀@۠ b6   ' '@$ '  @ @ `  "  $? ' $ ` ? # @7  ``/   *`" *  * 'h *  * `@ 2   *   "    "@ "S @"@ N"  *  2 2  * @2   *  `2   * @ 2  @2  `2   *  @"   "  `2   *  @"   " " `2     * @ 6   @ 6 & @ 6 `"6 @`?# 3  3  8 6'@ $ ? `7  ' 㿘H /* !>>  0!>QaP@>#  > #`#> ` X@bȀ8@ `2`H 0arp_rtrequest: bad gateway valuearp_rtrequest: malloc failed 㿘`0>X `H > Ȁ "XȐ ">Q>aP# F `4` "  `0"+ `02 `4` ?a6`4`4a>` Ah`<`0 4,``< ,4`> "y&`X@" `` `< `` @o@ `   @  >RC`0``< 4,``< , Y4`   &`H >RC`0L>  c> } #c@:# $ `4> $6`4cc $c" "c$ ` `@ `D- &`X`< ,` ` `Ѫ@ > T > "&`<> c?"c " "@`4&`H ;6`4 "sԒ 㿈 rg 0 $ $  H@:$>Ő q (7 4 H(4 J , L , M4 N Pb  V^  `Z / / x arpresolve: can't allocate llinfoarpresolve: unresolved and rt_expire == 0 㿘!>Ő = " //  ^/  / /  m/ `"`H @ 2  `2 `X >SBْ`rU ``0> "Ȁ@(  2     0> "$ rt$ `X  >SC > "&`X`X "+ `4 ?6`4  > `XbȀ " > "&`X > P $ `@@ =`  `4`X> 8`6`4&`X$  arpintr㿘>`< L `S 2 >SA#     *   h@@2 >q >`< arp: ether address is broadcast for IP address %s! duplicate IP address %s sent from ethernet address %s arp info overwritten for %s by %s x`` `0``, > # ` ` 2 `8  D `8`2` z`" D`D` @9k  o>Œ`@9d   !>T X@'ܔ AĒ0\'ܐ!>T@ Ҳ AH' @ @`?A =09  `@9, !>T @'ܢ҈ A ,`  `ϴ X > ">`4 $X4 ?44 `%   x% q!0;  ``ϐ   @_ `` ς 0   z``v r  5`(5`` i(7/ / x arptfree㿘 2R6>U@x `  0`  `   *`& 4 ?24    arplookup: unable to enter address for %s 㿐> { *cc , $ @ 4 26 ?264  `0  ` '!>U@   @Β H -㿘`D p >R `&`a6`㿘      *   h@@0pV㿘   /  >0) '0% `  >  d@#>`\ > { `@8    > {cΣ  > {cΞ  $`\> {.#p㿈 ov / $ $  H@7$>Ő ΀   57 4 H(4 J , L , M 4 N  Pn  Zj / / x revarp㿘> \ >- " d>Ɛ "`` > {# >V>PX2 -E: #>Ơ??>`\` " `> {#0 ,   3㿐Ȕ> (> { 㿘> {#  2  $    2  8    > {"c"" "c$ 㿘> {#    2  8  & > {c&& "c㿈'H'L'P > a'T  "a'X a`oK&0  `  q1 &  & " @&  > `o'"0  "& @&      > 0&> 0!`  &` 0  2Q " " 8 @"'K``'> #   ' p 8`' `[ `2` 2@8 ? " &`@8F 2 &`> ""(``'  ` p 8`' `2`0-< 8 " '``n&`0#`'> #  2  ' p 8`' ` 8 >W"  `2+@8 @"% 2`? * ^ ^0^0^T^0`()&`@7 &`> ""( &```'  ` p 8`' `2`0> ! "0 < 8  2e2a ?@> # `` ``8`2` `> `,& > # ` ` ``8`2` `2`p `>  @ ```2@`{> &`a` "`` "` p n l&`  "g e ! "0 ^< 8  2" `m"0O?@> # `` ``8`2` `> `,& > # ` ` ``8`2` `2`p `$>  @ ```2@`> &`! `" `?`>X!*`@aaaaa &`@#㿘H /* ! & 8 ?    0 2& ϐ@ %& @6ܒ 2 & > ""(& H 0㿘    8 ?   0     @ 㿐> ( TH /* !"('> #   '   p 8 ' ' 3#>   ? $   2     @H $  $b(  '   p 8 '  2 H 0H(> {   2   " "  2 H@ >b   4`H /* '> c`  2` H 0 $@$``$`4` kb 9>  `$` c$` $`` *`2`2` *` "` "``` `$``$` ,,  $ @4 4    " "   ' //@ > a`  "` >> `" `(`$ " `8`2`( > `"  `0`, " `8`2`0 <  8  ?      *H" * :Hin_control㿈 > #    "  8 2  !@"0 ` !@"F  !  !@{ !@"9  0!"@"w  !@0!!0!#@i0!%@f i  `   ! 2 8 D`@  8 2  !@2  "} 1  A >Y;D#B  t Ҕ i 7@3< t$ 8> c$$ <c$" 8"c$$ $ " & @$ P$  `$  , `0  , P , Q$ $ p0  > bȐ  "b   8   3 1 !@" !@"P0 ! @ !@y !@"` 0!"@"$0  !@0!!@" @0!#@0!%@" `퀦$ D$ H$ L$0    P$ T$ X$ \$$ d$ h$ l$ װ  P' T' X' \'$ P$ T$ X$ \ $ P$ T$ X$ \  $    P$    0 2 $ P$ T$ X$ \@ $ d$ 0   A  ` 2 ` @$` D$` H$` L $` D@" `0 @q`0$ ``4$ d`8$ h`<  d$ l$ 00 " ` `! 2 `@[` $ P`$$ T`($ X`, $ \ ` 20"0`@[ 0 = `! 9` $ P`$$ T`($ X`,0$ \@0 ` "`&  "@ 8`" < <"`<> "#$ < 8"T  ?A  4   - 㿘`  0     R`?# @6`㿀H /* '`@'`D'`H'`L'&`@&`D&`H  &`L   a H 0&`@&`D&`H^&`LH 0&@`@&@ 0?  ??&`(`0``(&`0&`d &`(`(```0 &`$ &`, <&`  0  `0`,`(2`$&`T2 &`4 @` &``Q  ` ɔ2T 0` 6`T 0 @8 '@/?! "% `0"! ` `" @2``T" `4" `,"  `$2` `2@ xH /* !> #      8 2 2 p  $    2  $  R&  6] B&&  & > #   82 2& ( 6p & p "`"pp&  / /'`  a1؀  `"  "`   6"H 0  XH 0xH /* !  ? & m `"  "`  "@ /'   a2s 6H 0㿘&&  ! & 6 㿘 ` ɔ W 7@03 `> ", \> "$ , ]> "$ , ^H /* &@$ $ ` &`@" &@    `  `* @  $    `  `* @"     `  `* "@    `  `* @$ H 0 &  㿐  > #    > !l. b  2   2 b `  `` `\` ` <`8   `6`S  Ӱ 1  2" 9#8  `` 2°   > } '` @\' "    @2 0 > } '`@G' " ` R 2` 0`& 26   <  > > >`` #y  "X   > , 2 -`2 @5 , K@1$@$, 2 "4  S 1?4* 2 4 > } ' @' ߐ36 , @0ϒ&@, 2 &@4  ! 1 4* 2  4 > } ' @' ߐ6 @ 㿐`  `  ` "` / > # `" ` ? `D2  `  0 " `T$`  2o` (  ( 0`@2R6   "  R6 ?結 $26$   2 "  < 2  ,  , ` $ ```< 0 "`@`2``I4`2 4`m4`> # `"H 1`< 8 2`@ X "`@`> # ` ` ``8`2` ``@( 1`@`'  " ' ` @ "  0 2 `  2 C  & `& `@22  㿘& 6 @*   @㿘 k"  T " (f ( @ XH /* &  " "  @ "`"`   @ "@"`H 0   㿘 &` ` @- ,  , 4  $ 㿘 &` ` @- ,  , 4  $ 㿘` +\``'#.2 / 2  2  "  2  2    ` @2 㿘` `` 2    p (`& (@-M $ ,'`0 '` 'T`4Β`4   ` + `0; `Z 0W㿘 ( N& (㿘 @ @9/ 0.0`2.``  ` 2%``2!```"` `2``" `6``@2``H(@ `" `@ ``` ( "@``` ( ``` ( ``` ("`H in_pcbhashlookup: faddr=%08x fport=%d laddr=%08x lport=%d 㿐.2 / 2 @'@ @ @ *` ,  @2# 2 2  2@ ` "` "@ &@" #@&  2   >  >a *+ 25K3 interneticmp_erroricmp len㿘  ` * > ` "`?؀@ 2& `" @*   `      > `` c"` #_ c Z  8 `$` ` d"@`  $`>a3!>  .```"+ $ ` $ ,   `2 , 2,  ",  84 ,  ™  4 `?`@:$`>a3!`  ``$` $` ‚$`` 4  , * @@ $@<, c㿐'H'L'T 'P 'X> ``\ $"`\$ $ @ 6  eϐ2 > ``\ "`\  "& & @e > ``` "``  & "@&  >  |*`" `>b!H*`@<(($DȀ[>b!*@          <>  7>  2>  # >  *` `8> ``d "`d<8  >ƚ"<#`> # @*` *  * >ƒ`   w  0r> ``X m"`X2.O @:.& *&>"8 ^ \ `2> >""P >+"LL .`d&  > `  0 2`T " `T' >  7 h "h * `@2" 0.> # ` *` `!>> ``d "`d"<>Ƙ"\  # >bL"` $ ܖ  ``@0bŐ㿐   `*`'   ?  " b % > # `>`D>`  0 "`8`T>`8`2`D>Ɛ"L`"  2`D> # `D` % a- @   aג  $ "@9`#  2   8  D 2 $@ ͒  $ $@` ` ` ?@ `4   `*@ ` $  "5 *@@ %  "`&  "& `    @ 2 aА㿘   , & " & 4`@՟"@4`   "" "  @+ 㿐@ T@'a#*& .  . @'- 㿘`    *>"8%d.%d.%d.%d㿐>d'`1> {#5Qip_init㿘  ^ >>d1P # *"@ *`" *  *  * " * ":> #В *@@6*@>" "  &> #>Ɔ >ƚ  $S@#*"@ *`" *  *  * " * ":*$ 4 `4> "#t> "# # " > "> 2">"> }"#,ipintr no HDR㿘> " `TH /* '> } `  ` " "$`?"H 0 `j` 2> >d0̐"x# \> #,`"#,` ` #,c 2`  $ `<  > c,`X >"`X2 <`c,` 5"`` @ b2`> c,` "`@Ԋ4 *  > c,` "`@6`> c,` "` > c,` "` >` $` $`be"@ >ƀ`""@s n> # (>"D` "  `@28  0 "8T"Q4"M,"I$"E82D<8  &> # ` `` ``8`2` `2`p ` @ ```2@`2 > >"  > ,(``Y"(0@H 0?@"k`  b; 2`> c,`  "` > #t "  2  @2  @2 @" 2  "2 4*` `" > c,`` C"``* 4*    > c,  E% 1  2*  d *% d" @,  @  % @ > @1> "4> c,`4 "`4> # @*@ *`@ *`>Ɣ@ ` €0~_͐0{㿘 ` ? *@  $" /$  ^ > `> ctct &@ct" "ct&` <.`  .`   6` &`   &`   Z&`2 `2` a/ ?P``       ` 2 `: ` `` " `0 @> a  `2` `"2`   @ `" @ "@_R `"  "`  E " 2 `2 @` &` " &` `  &  &@" %@&  `    `i`  ` a `  ?c *   > ,h`@R"hN ?$`z’ E   E `l 6 `& `& @`"``"``@^" * @$   `*`" $  @ $`,`^" E 㿘 " ^ ?`"  "` "i E@2 `"  "` ?^P"㿘H /* !> #t > #, ?* 2`  $`  2 H 0㿘> ct  > #, `#t`$`#t 2`attempted source route from %s to %s x   * ?쀥7>>ƪ"` Ӏ 2     D Dn D "K % 2% `ܐk%` 2 %̲ ?@ @'%>" `y  2 `   @'  D⨔ b$  ,< @8s@ `?@8m%L "?   D⨐@'  D=   U, $| x  ?2    *  k$>% `  ?```&0]Z V%` "#% D   E А? "%  ,'ܐ `   ` ,`%-@W 5 3  '@$ǐ!>g "' -      $   `+`# 4 > c,`P  "`P㿘> "?` > ` R`6 4? > 2`6> ""А ,  ,$ > X"> "Ѐ   @save_rte: olen %d 㿘@>"  >h#-`+ !> {#͒d>Ɛ2 "b$?㿈 / /' 77 ": T`6 ?ݘ`44`6`4  * `0  %> " ! " `0  @2    ` @$  "    2  2  ip_srcroute: nhops %d mlen %d hops %x %x %x 㿘!>"  [ "E %>Ƒ*`  & >i-!" '> {* ̢`" >i- ! ,̐ ,   Ӓ`  @  '>i " "@,@$@ > {#>" $>i,!㿘  @` *@"   "`&  "& @* @@$@forward: src %x dst %x ttl %x redirect (%d) to %x 㿐  >"  ` `>i `,#x ! > `' 2 `> ,(`["(0     ?,`> "  `@"  T 6 ?ܘ> 4 6> ""А , ,!> `"$"Ѐ   Ƙ `D4 D \M  <  2 4 0/>  `)>" %`$> > @"0` , > 4 "` 0  >"  >i# ,%>"  > "Ж ! @  > c,`( "`(> #,`$ "`$m[\0i`, "`,dAJ >j"*@ Ħ   > "Ѐ   <> c,`L "`L  `㿘`N ?` H>k p*`@t,@T>0">+">&">  Ԁ $ >">"> >  > >Ƙ  -㿘 d>#@?1 ?`,>k!̓*`@ 0@`P@ΐ@@@l@ @@g - Z㿘>#@  Y  j& k -0@A@U Y㿘0!30!4 0@U0@H( > }h h22  2 2 > H> (    2  2 L" 2  > }h H   ? 4" 8"  <""" " @>,* (>   "`$"`("` , "` ip_mrouter_init: so_type = %d, pr_protocol = %dip_mrouter_init㿘!>#  V >lR)`V 2; - R  `4 -"2 ` (. ` >' c ""c! 0! 8> H> "c> !@!!!>!P> |" >q#4 :#  >l)a ip_mrouter_done㿘H /* !>#,  > ! , 2 * @*`@`  @  >Ƒ* c,2  , > "x@ ݒ/>2#,> |" >q#4  #> c. @ " @  c> # 8>"#0>"#H 0>#  >l)ObX  #  "  "  8  > | @  > |  "  Source routed tunnels not supported.mdecap%dadd_vif #%d, lcladdr %x, %s %x, thresh %x, rate %drmtaddrmaskp "  (  `*`  * > a    > 0 #4"  2 w 1`` >m(`Pm -  8ʔ @ 8 `>m, `x 0@ 0 >Ɛ "c0 T`0 @ R -/ /' a1`؀ CH /* !$ $ $  , ,  $  $ $  $ $ $ $$ ($ ,H 0 >, `2,># "    >m >m >m    #\ #`(v x    8> {c"c> { "#/ /'  a2 ؐ@ Ddel_vif %d, numvifs %d㿘 "U  %> ,@ *`I  * > a  > 1H /* !   x* "*> "x@~,>Ɣ*2 ?* @*`@ ` *  *>2#,H 0>#  >mc*'2  >#,2`*0@ * (#,2  *"`@"`L㿘 L`" @W`O 82@`"  "`  8@"add_mfc update o %x g %x p %xadd_mfc %s o %x g %x p %x dbx %pmultiple kernel entriesadd_mfc o %x g %x p %x dbg %padd_mfc no upcall o %x g %x p %x㿐   +8  H /* !> }bh "bh  3 3   2 2  > `H > c* @   2   @2L " 2> }bh` "`>#   >n 'Eb@ > a ?- H0 22   2 2  > `H > #- @J > !2@  2;L"7*    >nb(>n P'#\>#     >nL&bh@ "L ?-L`"@``@ϔV@e 82@2, 3>#   >n &Βb P 8 2 H 0! 7$ $ $4$8$<$H$D> -  $ " "  $H 0 del_mfc origin %x mcastgrp %x㿘 "i  +>c #   >o &bH /* !> }bh "bh  3`3`   2 2  > `H > c* @   2   @2L " 2 > }bh` "` 2 H 0 1`"  "`   8"H 0 㿘  0d  d |   Uʐ?ip_mforward: src %x, dst %x, ifp %pip_mforward: received source-routed packet from %xip_mforward: no rte s %x g %xip_mforward: ip_mrouter socket queue full㿘>#    >p `%Ә  $   2 >D# @q"D C   >p%a<  88 ? 2 H /* !> }bh "bh  3 3   2 2  > `H > c* @   2  @2L " 2 > }bh` "` > }H 0@Mh >c `"   >p%Ya8  8C  沔U 2 s22   2 2  > `H > #-`@   2  @2 L   2    P 8   * 8T0; Ub `  `  V`>Ɛ 8 4"` ** > }"h`>#$` 6  >p$aX`0 8$`0YTLT 8H 0O 7> $ a$ $ 4$ 8$ < $ @ @ >Ɛ -@ , @ ? * ,`@ ?4 > -` $ " "  $ $ L> }h 8"T 0 L   L ` "$$$H 0 expire_upcalls: expiring (%x %x)㿘H /* !  > }"h> ! @ "'> #,@ "  @ ? $ @ @?,@ >#` %   >q $Cch2 @֢`H 0>!P>q#4 z:wrong if: ifp %p vifi %d vififp %p㿐 >#, `, * > a  "` >#  >r`h, *> !  #> }h> |` "<` &<  " `0 , * > a 2 @ `@ *`HD""  q **А"@"@"@ *`" *  *  q"p T     UOZ 7&D>&H4 * *  * >#g"H @2  $, "$@",( " @"(> ! 4 8 &4@>#, *&8 ,,2  `"`D ` (`D@ &@&@ @;`D@`D>Ƒ* c,2  ۠ D 㿘 沔  S+ `  `  Tؒ` ` 2`@s0 @㿘   >b 4 H /* '> c` 2`H 0 $$  $  4  Qs S $ $  沔 1> #  S;$  $R0?# d" @4T5> #&# &  &  &  > & 6 6  `2 & `?& . 6   $   `@*`6  ?$ `  @0 @ip_mforward: no tunnel with %x㿐'H'L'P'T>#0'X  @:0w < 8  > }h`R4"0h > {c 2> >#, *` *   "D @ D * > {> }h`R "># = >s "Hb07"# > {"#> {# > } & "@ & "& # & H /* ' @ `Q"0 &  2" ## " "H 0㿘@  !  "& @Q0+ # > }h,`Q",0@>u : 0@  > }h(`Q"(0@@1>  "("** :H( >  "x((* ( "` " " H 㿈> a & *`" *  *  : H /* !   *" * > "x@@' ' ' @ " & @ @ɐ  2@H 0tbf_dequeue: vif# %d qlen %d㿘 `> a & ?*`" *  *  : > "x+ "@ *`@* *  """ ? > x*@ *`+ " * @@ " "@ "  >c?`& >t> ! &* "**  cX!:㿘># @h  >u T 㿘H /* !@   1> ! &* "@*`@> }"h, * , : * "@*`@ > "x@`@@(?P`oH 0 $   % $ߢH 0 phyint_send on vif %d err %d@H /* !     0 @ 0$     ' `/ @~/>c` >ub >  & *" * * : { H 0㿐H /* !@ = #*$ ,  @b,    @Đ$&  2 @&   #@8& H 0port %x prio %d㿘` " 2@ * @`0  @  <@ @ F 2 7 2># >u c` ip_output no HDRH'H'L'P'T'X  ` '>v\ `@``<@> ܐ*@ $@4`` @4`@* = * @$@> c,`82ܐ "`8 @ * 2@/ 4 "R6`@" R6 ?? &26&   - -`%`"2  :>   ,` 2Ϟ`2`8> c,`T+ A`@ "`84 `<0`< 8 2e` ` " 7` ,` 2U 0 ,`U 0 @2 ` > c,`T 3 ]"`T$` > # `` "`D`8`2` > # ` ` ``8`2` `2`p ` `@ ```2@`   @ `  0 "(`Nِ D$` I' "` 0  1` 2`  8@8 (`! >7`` 8 4`4` `@E4`4`  xΰ`@> c,`L ( "`L" ?  'ϰ (> c,`< 7 "`<`'`   >b   7`H /* '> c`  3` H 0 '@'``'` 7` M > &`#'`@'` $ `$ ` `$ ` $ @ * < * @''` $:``?Ȑ*@4 ` @ 4 ` "@'  4  N4  '@'` "  4 @4 4 > c,`H "`H`  ` O$ %`4`4` ` @4`4`  '` xM@2` > c,`D "`D``R`6 ?΍ 02`6M㿘`  ?? #@ @a`@ 2$     " @> >b Ӕ  3 H /* '> c`  2` H 0 ##  # 3  LE - @#    & `& # ` > & @ & `&     & =& ` В `& 4 㿘  * ?쀤``  2  ,   4 "$@$@`?" ,   㿘  `  `  2`>x#Г*`@(<<<<<,崐`T@ܒذ`"a ` 2\ ``W>y *`@J.`AH.`H `< B&`< ??&`< `< 9&`< ?6&`< `< 0&`< ?-&`<`X@'`"% ` 2  ` "`<  "`< " `<  ? &`< ?ߐ  &`< ? &`<  *`tL@p`j>y"*`@XX(((((@瀐 K '`T "G$`  `$` `T @ K ' `.$` >y"ܓ*`@ !`A`H`< `<2 `<2  `X@ K[ ' $` `<  2  `"`" *㿘 `K`&`  `L KH C``   = &` ` Ғ`@ $+` ` % 2  `%@# `  2$`` &` ,`D $ڦ` ,& Kt 㿀@  X 5 2&@$ 7$ ,,4?`>z!*`@4`0"  2 > $# ` `D ``8`2`D` ` ` T`0@" 1$"۰  2װ  ,"а  2̰  8ǰ ,"°  2 < 8 2 > ' / /˅' " 1 <`# ` `D ``8`2`D` ` `v T`0@r  `2 @@"   p 0l ;ᢒ, @ "`c 7 _4"\  2X < 8 "N >  # ` `D ``8`2`D` ` `"6 1 ` 2  @"  ,  1  6 , ` "``?4 -  @@@@L 5&@㿘 I   & 6 # ( 1 - "` ``@`> # `"!"` ``8`2` `""`D"" "` ` ` `"` ``` *@  -㿘    `d  ` 5㿘 沔JÖ ` 4  4  4  `@*`4  㿘> #Pi 㿘 > #P#P   >A"#L I`" @25`" @2-` @2%  沔J{ >Ƣ0cHX Iѐ  W|   2 I0>ƒcHXؖ I0W|  0 I> #, 0 4`" 0" 4㿈'H'L'P'T`'X` `<`>  ?#`@=  2   ?" 8  ?"    ?& `&  I  "    "   &  *2`I*  2`" " +* ?#@$ IK( (  "`T  $I:  > > "ܒ2"2> c,`\ "`\`T`(`XW㿘 ` C  ?Hɞ쀢" 5k3d1 0' `" ` 8`   <  ?&< H\ H ' " <`  "@  - H rip_attachrip_detachrip_usrreq㿘 `  ܯ```2 `.`>}!@@8lll dlltl`" >}3 > #X>#\Vݐx> cPq n,`I  "i 9U`>} _ > " "U 1? 8O 1 "K$` "F 1C$` = > " 2 `6 1? (`/ /U3$`+V!'    8`2 9    - >} ȀH 㿘> P`"P d*` *  * > ~#@"P$@4 4 $  8c  8@  $ $ $  $ $ $ $ $$ ( $ ,$$ 0@s (4 4㿘 `   E 2 > |`G"|  `  "  2 1>   ` " `$(> ` @>  "` @ G"O E  "" 2  I  6$ I` `"6` @&`> `` "`` `  !"` ` ` " $$  ؒ  G\`"  "`  E"@2 $  $ $" & $ $" $$V  $=  "9    D@23    D & D  !`  $` "  " G U 0ђ E@    D@" U1 0 |  㿘 (H /* &> !D !!D .`2  > $`" @"  R` 2  2햂> !D!D$`"  @"  R` 2 @ Ԑ 0 2$H 0X'H'L'P'T'X    '7'Į >   h' $ h` X  ' H{ (2   ;$ @# 6 @ 6$*  > ``t "`t 2 * $> ``x "`x/6   :HJ2 > `` "`   ( $!J4 2!(@B @2!! 2 ! ','0 '! '> !D'92`$>   ̐ $  ' '2`$ А $ Ѐ`V `2""x*@`   N > "``"`"` "` "`"`"`"` "` $7"`$  1S, 2 ߐS# n '&`6`7&`T`$ z 6?# 4* .z ( 4V 6`>#6 `V  #\@RV 2 `7 2 䀢|@, D2 " <2 (T@2 " " 4   @< >  0&&| Y$"@ $ T"@ 4 X<@ >Vc` 6 >   ` " >  0ܐ"@  `Vb  Td"  @o T> $ഢ# "ഒ@"UE&$$T@2V6 2 t6 t S= T Tr $@2C  2?  4 0 < 8" " 4 43 > Ȑ " D 0 &Dlp "l  "p` ` "`"St"` S |  !  6 ~6 @ & ?"&  4 0 < 8" " 4 & PD"@ * V &@ |`䀏`@```: #6< 8 . C ) $   * *  "@ !2``&`K &`D' D#@ &@ ` 7'Ā` #\@> &8!&8#> >ab@  8&L&,&T&(&$ `6>cd6L6 `&D&P> ``$a Q"` `8" `T" ``@  =``" 6( &$&(6`&L`&D&P $6$8" > `P"  ` `6{z.x.y  Vb`" @ 6  &@@"@Eo > @6 `""?&0&&H  `2D|` <D>  0" Ҁ 4&|>  "  "` "D" 8` `&`&6&ߠ? >  6 @"  ">    `" " E &"@&6 "6&6&  " V $  "  @s> `"D@@  "@ 9>  ` "` '`` "`V 2@D" }@@J@ `D@`> `Ȑ 6` "``"`D  "6 䀢 `" ` ` >  `@ `>  0&&|`#`?* : `> d*`@    dd d = 67 $6>  `/" `@Ȓ 6@`eV "$% $`%" /`T"@ *`> `O"  ` `6{z.x.y Ҕ ?&0$" 4OV 26<26>   `" V "6$@26>c` 6* :  &<X ( 2 @ { ( @ &\66b&(@&X@ V\@($@ &X&(X@ @}&X怦>c` &6X\ 8&X6T# > `` "`> $#  "@  ">  0ܐ"@  `Vb" d"  @MT@2V6 'Ԁ 2X6X\@  @  x?#* 8&X T@   T<"@ &< TR^   tRZ< "&< t P T( &$&(V "    ,` % x&`$`   N> #6  6 6@T x6 N `  `@= 6 `0@, @4@,  @$` < `  2&<4@2 &<<> `` "`&<<p&0 &4&p 'Ԁ` ":D&"6DV 42D 0>c  (6&-H@ " $&D&H 0"  ? ' ,  @7 Nt ?.t& @  !2 @H H"@ 4&H 2V`BV >D@1 -2+!   6 > DȐ &Dl 0!p`"l ` O"pO# |`  ``6@ߐ`"2 V -  NŐD 6`&DV        x 6  6 6@[ x6 M 6     Δ> И (:`Ԁ P@ː0L`2@`@2 0A`' ##< 8 ` ` `  6 `  ` @Ā      Δ> И (J:`@PĀE㿐U\@ Q 2`  J "    =&" 9&27&! "3&` @*&2(&! "$&  @6 ` 8 . {2& '`} `y ! " & !6 @>  0& |& &@tcp_pulloutofband㿘`&? > 4  # 6 >u 8 $ @ *u t@  *t `" A ?& >   h*(8 2 h( 2 h(&  j(8"@2 j(4 2 b (2 h(2 j2 b h2 R j(882 *8 2 2 v㿐 `(`(`   ,`- ,`,` $`0`(2<>#x#x@8 `@8 ` *  `"/$X``" X@ @ @ >c @ 8 Mn T4\`" 4@($X@@ >c @ 8 MX 0$Xd`.  * $\tcphdr too bigtcp_outputp T $  `?  T `T @& < $ X < ( X  $ "@  T >L ch 24 T@*  4 T% "6    4  $4 T  $ (@k  4  0<8" " 4  Z2T  "L T P L  L  p2 H ( T@ C ? y#*  P D"  "*` 6/ 4*  6*  2& 2#  , $" 4 "  ( " T  T  T  4 @  " ( 8 `$ ( /ؐ /ِ 7֐֒      @"    z@#@'  ` 2 2   a" ؒ@B ">  0`"@ |` "` "  > # d> m "o L   2  (> ``X "`X ( T@ >   L P`" L " P  D H`" D" H >b ڔ  6 H /* '> c`  2` H 0 &&  & 6    #& @  d" "& h>  &=*  7 h> & T@ "NM&  > ``T "`T``d "`d , $" > ``\ "`\``` "`` >b o  6 H /* '> c`  2` H 0 &&  & 6  ; >  c&  & &    >   (     ( T@$ (2  (2 (T  " T ($` D`$`ؒ`(a` <* `2 * @$` ,`!42 6 y & y?#* 4 P D"@ & 2 = 4`" , ("@`$ $ `!4`& ,`!$ , @4` @J4`$L  T  25 ( ($ ( (  $ (`4  ( T"@ $ (T b  $ T 4 b$ d> `` "`T  2 ( $@" T ` 4 4 4  T@"@ 4$ T  T ] & 4` H,` A ,` `(`T쇖 > 7 A @W #  2T  4 v``@   "`@ D P@"@ 4$ P D` $ ?# @p4  tcp_output REXMT㿘V  h *`V j:`@:`> #X>V c*  @ 6 * :   x  x6 V   6 tcp_init㿘>  "a> >cH!D> c< ' ("c<> # ( d> } 㿘     ;  (" &  @n  ,  4 `$ ` & *@<* `6 `@6 & & & . !6 "6 $6 &㿘     4 0 < 8" " 4   (# : X> # &@" `"``"`` "` `"``"``"``"`` "` `$ "`$ ;u&& (& ``  `&``&` 6`6` 6`  (& &&@ &`&` ` * <*@ &` .`! y<@6`"6`"6`&6`$@6`$6`>b   .`p㿘  h , @Ғ && 6 h >#x6 l>6 #>c|` 6 *` h6 jV j* :  :  6 6   6 & X& \>"$ $, H㿘 V `  6 0> ``  "` > `` "``<24 $V v 24 $@㿘  8 X T* @@ <n( "j   "e L @ V h*"@ *`" *   h`* @ 2 $ h$ h L  V j*"@ *`" *   l`* @ 2 $ l$ l L 2  ` \" ` d 2  `2 :( *`2`2`@(  @5`( d`@ 2 $ d$ d`"  "` "@:q 2 E 2  ": ?% $$G> `` "` 㿘 $R`   `A!`3`@ 4 2`vR` $2`vR`v "2`v6 $ "He 0 |  H[ T㿈> .">Ɛ".  @> ? >`! `0 >  ' * `!D #\0!D (  $ X㿘H /* !> !D !D ?#>  Ȥ  $"  "    2`  `$`  2 $H 0㿘H /* !> >> # D* "cJD : $ 1T  ". T` "?4`*  2    @ 2 `2 2` ` T b4 ``  4 b2$(#> >ab@ܠ > `0$a "`0H 0 060㿘`q> ``" 0`V   > V `c >#6 T 6 * :  >  6 ``$ "`$V v  <``(>Ɛ "`(V  h*`@ * V j:  @: 6 *  l:   6  6  V ` 6 M  h j* : @6 j6 h < $6 b X@ & (  2`@ ( & X @6 & \0\  , $ ,V  >V `#@6 h>cV j* :  @y: @ 0 <<$ 0 . 7. >  4 "4V `%    `>#> #V `@ 8  "8   $ D?>#6 ># 6 > < <"<tcp_usrreq㿘 `  gV  8i J 0H /* !  ` H 0` `. 8H*   $T`.`>#@7X7778$:9P9`999;$99:l::9H;$;  8@񀤠 " T 2 >!P*`" * 4 $T c%פʒҰ    ɀ 4  ϵ о $o 7 4 z ?#4* ,z (4D> `Ȑ "`Ȑ 4>#d#> a4 s$8>ab@' $a8$,$T$($$z -@2vE@Op0 ϐkTF/b 5]X&@H 0e , 2 @"K !2G  t  A  = #& u7*@ t 3,tXT`\" " 4 T7S# 7E$T@ $, |,,* .@>ϐ!耤    H 0㿘 H /* !`  H 0 a 6 ]6dؘK 3 $ E$ *"!  (  "`` 6`?# @6`"  `$ `@4 6`6| 0 5 ' " "   *` "@`"@H 0㿘`X >`4 2 >#>#D > aD `N "`2    ?4` ` 74`㿘 V `    T  `  CF 0@ 㿘V `>"̓*`@>>>>>?6 ^  6  V    Cl V  > #6 㿘`   >  *>##d㿘> >cd#@h'H'L'P'T'X'> ~b`b "bٽ   `   7ސ2   5$ @ `@ 4> ~> ~b`  "` 7q& @'`'`'` '`'  @g  @X7` 4 *  > ~`"`<8   >' $Ԁ w>#2 ` "   &  & > #@#@ K > ~"   @2@  `" `@28  ` ` @20  @2+ " 沔6  >ƴ0cܔD 5a`  $`C|   " 2 0> ~b` "`>ƒcܔD\ |> ~Cf|p ж` '> `#@' 73>> ~" &` '` ' ύ > & # H&'@ `'` @'` '`  '`\7`0<#2 ` "  <   `@1 'Ȳ` > cȐ"& " & &  C 0 > ~ B 0  |  0 b` "`4Ȁ 4㿘 3ޒ   `  & $$ $  㿘 2 $ Bƒ 0  |   B T㿈> )!>Ɛ". @? >`! `0 >  ' * `#@ b#\0#@ ΍ 㿀'H'L'P'T'X  4N` ` 8H /* ! " H 00w 2 s 9 2   ?" 8  ?"    ?' `'  4\        ' `; 7?#( A ( @ . `6 `& `&`>#6`  66 6@{6*  "6`6`H> ~.`Ab.`  "` ` `T`X`( 0U&`H 003udp_usrrequdp control data unexpectedly retained 㿘 ` `ǐɰ ``2 `.`>!@JLJLPKLPKtKLXKLL`LHLXLPL L4LPLPLPLPLP  H /* ! > ϒc@H 0  >#>#Aw `>br* HH /* !   H 0^   Y 8H /* !  H 0 E @A   : 9H /* ! ̡$ H 0` ?%4`@" (@4@& Β  ڒ    - ->! >!(2ِ2Ԑ㿘H o*@agH 0㿘`    *>하#ذ㿐a"@  o.61Ӓ !' "` `  """"  o2  @9  `   4s  '  7  62w bind failed krpc_call: sosend: %d RPC timeout for server 0x%x rpc denied, error=%d rpc denied, status=%d h ` 0 /  'А Ԕ 6d   1t '̐ " #?c #=#  ` 1] '̐ " "@Ԓc= 뀥  1 '  " $ , ,$Ԣ6i4 0, 2 "81̀ >" ǀ  1'  !> % d 1F  <$ <$ @# >"#& & & & &  &  & & 4& 8  ' @ '$$  沔2T g'Ԓ  7 ``'`>M"H@Ѐ "1'̀ 3@1'''ԒД̘ؖ 9MȰ # &?P&@`! `  `  >c   > "h` >"  `   3D   ' 7>"0 `  @` ? 2ْ̀`''@'Ѐ 1/1*Ѐ 1$6ԁ㿘` ? hL  0F `l?H /* '!> !   /( !& > #̒" > }"ؓ2`  * > c` ?"`  $!H 0  "  & (& $ &  6   2& 0  &  "@E`㿘 4  2 2     ?   12L.@&㿘 /ؒ  "   "" " "  "㿘  2 2   @ " ` &@.@ ` .` `.` `.`2 nfs_read modenfs: bioread, not dir NQNFSNONCACHE: type %x unexpected nfsbioread nfsbioread: type %x unexpected   |  ` a '|>"` 2`߰ |ڰ @" @b`|@3–|@!Z`8`V! &``>" @. @ј %>a''''a'* @@0)>a''''a'* @@@|8 @.i @ 0wM0t%|@!R> "@$<8!  @658 @X!" W @28$@28 2 8 + 8 2&8 @.# @T 3 =   @. @@  2 8 "8  8 "8 " 8 "  8@Gv@F'>"88    > 8 "8b` #``@=  @:` >` 't`K|` F@D  @Ғ:  88 3@:` Mq !|@"  0" 0` $ 0@  | 0@ " 0L|``MG `0@  @@ @_"n `0" 't`0 $`0@o`%8` " & t`8 $7$ `p`t $/$  @*"9 `0 `d$`0``0 >>*"`''`\`* @@  LI$ `t "&۠ ڀ  $> b`0 @#`0" `0"2`@`0 $`0@z`@$`" 8   `!> b`8 #`8` $@ c $@"ΰ `0"E>ɐ`0 $`0@9>K #0 @, @̘  $@" `0"2 `0 $`0@" K  "Հ > B|` $?$`   * : @  @ /$ +$ '$ L)  $$@I$ 0" 0` $ 0@  0@ " 0Ks$`@"`" 8  >?"p  `"`H@K8 "  8 2 8  `0 $`0>"p K; `  |nfs_write modenfs_write proc    `|``!>"p` 2 8>!l@"8>ܐ" Ű   ?4" @b`@0`"&`  $ @ט `>$a''''a'* @@>`` 6`  ` ``; ` B 4  2`` m J0i 0h" 0J9>@ٱ!6> "@$ !  @ @2' @ U!" @ @ $@   @_ * < > ` b '||@Fxx`@+0b`$ "`$`@V= %`    @:` @"  l?2 5$ l4`=  B 8 2 d(  d= `@ C <@Ӓ  d @4$ , `@ 6$ , '' \ `* @@  !;> "@$ !  @ @* @ !" & @ $@ IŐ @ x < H㤐 d $$ ` `@$ ` d@ * $ d@$ d t "  ` ` & ` p d@  ` d $ p 8  t d@ $ p $ t 0 ?$ 0 2$ ,`"$ , '' \ `* @@(  @Q "`0! $ , 0 " 0@p`H.`   㿘 ! @!I 2#> @V  aP I+  "   IԘ nfsvinval㿘 ! @ | >!P!*   4   >訖 "  "   @ 28     4  @  ? 4 ?4 ސ   [J 䀧  ? 4 ?4 Ȑ  㿘> >> > }   ". 0@ h?2& "& @ 6@& h 0@  l& 02 & "& @ 6@& l& & ̐ "@ ""E `L$ 0D @:  0 "&  `"  "`> "#  "@& > c& c̔ "> "c"Ȓc̐ & !>#`H>aP*"  * 0 \& 0\Jܐ Process killed due to text file modification nfs_doio: type %x unexpected h  \' !|'''' 0@- <'' H' T ; 2`* @ *` ? 0@ '> " @B:# ɢ''> ,Ț`@D , 0@" d <'' H''8 >  " 8 "k8 T :3`+  +` > " ?@B# #& p耠" < T ; 2`* @ *`  <"@ "@  @8  H@s@& t& tl` h`!> "@$!  @6  @>$@ >!J`T@E`>"P  :&  ?> " 4@@T# 4-<"< P ; 2`* @ *` ?@@@e #@@*@%@@ `@a”>"`"` 0& 4(& 0` `" '' T82`* *`  `: @ C ? H ` '> b`(' "`(  0  @` ''̘̐ 0@@& 0@C ̀  0  0 ?& 0` 0@*@& 0`G 0 C` 0 "&  `"  "`> "#  "@& > c& c̔ "> "c"Ȓc̐ & !>#`>aP*" s* 0 & 0 0 Zv``"` 0$& 0`" & d 0(& 0$& 4 4& d& ``Ȁ`& @@'@I&nfs_boot: no suitable interfacenfs_boot: using network interface '%s' nfs_boot: socreate, error=%dnfs_boot: GIFFLAGS, error=%dnfs_boot: SIFFLAGS, error=%drevarp failed, error=%dnfs_boot: client_addr=0x%x nfs_boot: set if addr, error=%dnfs_boot: bootparam whoami, error=%dnfs_boot: server_addr=0x%x nfs_boot: hostname=%s X> }" "> 4"   0    2 0 2 >ߐ! ؒ >!@ Ĕ ,O ">̐!h0a" >!aĘ 7蒒>!d">>!!@禍  / / a '쒒>",ĠȐ@ //ɐ?'> !"`ؐ@w">|" >"H>"h> ~~ahI  nfs_boot: bootparam get %s: %dnfs_boot: mountd %s, error=%dnfs_boot: portmap NFS/v2, error=%d㻘@> D@j> :ab > / @ :. O  i: . @.`J@  .nfs_boot: bootparam_whoami: bad reply 㿐 & ' " ab$ $ $ 'ab"  $  o6  >`  )5  %' (ڒ >  "> ~ ah6  f&  '> "h> c]h ' '>Đ" H "' 'nfs_boot: bootparam_getfile: bad reply 㿈>  > ~ސ!h  '@_֐ "@4 ab   ) Y' 'C쒒'#' 耢  '@m  . .&>h#& 㿐#ab  0@ '& b  J `  H` #   (~ $ '   0 H&㿘>!h>  D> }"`     㿐> cD> } * @@    2T 2 @# 2  X  2@2& 2  >  U %&! ` @Β!& |$ @ $@" $@@$  TM $  $  4 & nfs_inactive: pushing active㿘>!l > P `|R` >[#  8  `$`    @JǐX ͡ ` 4` nfs_reclaim: pushing active㿘 >`P``|` !T` > Z` "` "!"`8 ` @ & "`   @ & "``8 2T  " T [ T T @ Q TGe`|L $`| nfslck㿘 !" x!>"& ! !" x@?   㿘  $  Nqnfs server, too many leases nqsrvnumlnfs_nqlease.c: Phoney lpp\ 8 `  d`E @> @8&@>a'`'d'h'la'p * @@`.<@H /* !  @> baD "aD9  `<'x`@'|  `(€ H 00> #> @ԓ*`  x @2| $@2  (@추 "' 8 x0$ @ |  _   @_  T"B   2> J@O  D       @; /  2@    2@ݐ   T 0ʽ $@@+ T@ @0 `@7 @O@@א2 @@   %@%@ $7 H 0f H 0] %> #>`@>"9> 1>" "Ỗ `@" < /i @ג <  $7  @K' 8x' |' $ (2>" '" $' $ @H /* ! @@TH 0 %@> "< @@"<"@ x'  ?  #\#` #d 㿘> !$6!@ > ~ A6`& `6  L@2  沔$] & `6& (6`D &`D> Ȕ> @ >  " "  > b"b" ">   $>  2 >  2 ""  "  >  ""   2 " 㿐? !)@ > !> ~ L2  @   `0 2` `  2'' @!Sbuild > MLENmbuf siz=%d Bad nfs svc reply'''``   > #  "l4#2j @3> b$9  4 H /* '" 6"H 0 $$  $ 4  !p   * $  *"> !2  > ~ L  `0 "* `  U 4    @@\ @``<'`@'` `(€` ``$`` @  "@`  2``  ?&@ ) >bĔ  2H /* ' 6H 0 """2   $@ `$` '`   $` ` ' "@ڒ`@   !@( #\>#( >#8#`#d#h#l#p#   @" / 2  ?" 4  ?"    ?"`"  "k "   " ? "  0  @@! @ $ @  "@< @"EH /* '> T *`@?2@H 0   &>H /* ' > #̒"@> }"ؓ2` ?* *   >  "@  "  H 0 >T b*  j2 "   2~nqexp㿘> " @$      # `  > ` 6  > @ 2 "   `2h  $> `b` @##``| 'R`  ?   $  @  "@  f`|   ?$4^`|  $ @  "@   9  ?"1 >bU  2H /* '> c` 2`H 0 """2   l>#"'" '` "` `|R '#?"?`|`R`[ `R`@  $ @  "@`  5  ?" . >b  2H /* '> c` 2`H 0 """2 % "'" '  '` #ଚ##\> @#`"? .  @"@`| ' @% > "Ȁ''ؘ#\@'ԐԒ@  ! >0   D>  b` @#` |`'R`  ? ``$`` @  "@  d |``  ?$@4\ |  $ @  "@   9  ?"1 >b(  2H /* '> c` 2`H 0 """2 ]  l>n#"'" ' "  |@R '"@` ? "? |~0R`R`@"0\       #\#`#d#h#l#p@v T`/  2   ?" 4  ?"    ?$ `$    "      $    ? "''\ @ s P`@p\ @ 㼐'L'P'L'P'` @    P`d'L 'P3 l 7``  "  ` 'PLP @P @   H&T#\ #`#d  H@ `   LL  HLh L  P@"@  ` 'PLP @g  }W L L  P@"@  PL@ǔ  ː09'PƐ  \.` (``"` 2`   `` $ " `  `$ "  ""  2 $ " $ Q` cld kerbnqnfstimr@@;  @27@>!!   Ā4 Ѐ@4{& Ȁ 2 { 2 &  & &  @& @ .&  Q & @2  +> )>a>  @ 2  P "  0  ''''@w bȀI P  2h &  @_@ & "`  @& "`ྀ M& " 8 8 @?֐  ྒ 604`2#''''#' * @@ྐ ?#6bȐ 6.ྐ ` @2  0 P/  2 &  @  Z  >P&  " @" @2  zd& S & @2 @">!P@ג  Ȓ!>2 W3 @=a 䀢` "`  "@`"`&   3$"2 #" #X` X ` " `  `"  ``@2``߄ 2`"`:`    ` $ 2 2 "`"`  2 "  " "`"`  2 " nfs㿘>` "`H /* !> "" " 2H 0 > !h!h  X>c@$  2!!"@" `"``@ 2` Xnqlc㿘  " !> 6  !%     ?#` @6 㿘 ?# @`6 qnfsconnfscon sotype㿘 T X `% P    PN P R % \  2D >b$£  4 H /* '> c`" 2`"H 0 $$  $ 4  ؒ  $ #  , ,$4  0* 2 "847  " ` \ < 90!H /* !  >>Pّ* $ 2 `" `<@  $ "$ 4$H 0 A>!P*` 4R4v4R4v T     @ ! a    !@ *  at* " >f! 1 >b(  4 H /* '> c`$ 2`$H 0 $$  $ 4  ' ?c  #@ '"  R  22  >b(  4 H /* '> c`$ 2`$H 0 $$  $ 4      # &"   !* a*`) %> P!8t@4P@>4t% % % % % !P@% * % |% x% t% p% l% |%   ?4H 0@/㿘%>  #>@'  ?  aؓ >  @` `2@`$ @"`$@`2` 㿘 P & P& אnfs send error %d for server %s nfsd send error %d 㿘$`"ݐ C  P  `@&$Ӑ 9 &$`\ R    "R   @?  `  >`$  @ &$>`@ ? # 2 short receive (%d/%d) from nfs server %s %s (%d) from nfs server %s impossible packet lengthEgad!! receive error %d from nfs server %s `>!l&"@  T"  P@{1  $`" @ %  P``@%> " 沔  ``&` ``X" $  ?" @~ 0 @ @x o}x'В 'Ԑ''''  ?'' @'Ȑ ؖ  !њȰ #   # $  #"'Ȁ 耢  >a "     6 € s  *@ ! '̐ >a>  # ' @'Ȑ ؖ !Ȱ #"'Ȁ "'Ȁ?"'Ȁ K耢G >̒a   "  = !''''Ȑ ؖ!oĀ` #   # $ I #"'Ȁ   Ā 2'Ȁ  >2"  " " '̀ D B?A u  &  >b鯖 @7" ' `2`*   А"@''''Ȑؖ ! Ȱ # $ 쀦 #"'" '̀ "4&@ے nfsreply nil㿀> "+> > !@ @  @  ? #\ P2 $ "  ' @"@ ' ' @g䀢 > a !  "$!( %!(!(`%!(>  @`>ǰ ` 2@` 2@$` $`>! T$`a̓* @*`"@`4*`"@`4*  @d  *  h` x:`@` :` h` x:`@`"" "`4* *  h"`4* *  x"`<"`@" > b"$b`"(`$ "`8"@"a̒`  ?"@%a4`$< @ @ݝ $$`$ ?$`$?$`$ ""$`4`* `8* h:`"@ "h `4* `* x:`"@ "x$`2e` ` @!$`%!$ $2 $   >簐#8$  is alive againnqnfstry(''     @ ' $`$`$`<  $`4  ''$(  'Ԧ @| ` Ԑܖ@ #\#`ܘ@ 00W @ *`*  'Ԑ#\#`#d#h#l@ #p܀` \ TT 0  2   ?" 4  ?"    ?$ `$  Ô  "      $    ? "$`$`   eh$`($`,$`8> (`@  $`$$`$$` > ba "aH /* !$@> `D$``D""`DP> "Ȁ`>T  (@1H 0 \ @7  沔 P`*\`@Y  `$ @ !$`$  $`$H 0 ?$`8  ĐH /* !@ `"`> " D`@"@H 0 `$  ?$`$?$ 2 ``$ >`<@p``` ` '('``  "    'ĐȒĔ @'2 > `  > "䀣@2 -$> #@2 `2 PА"@` '  $`#\@İ0`` Đ "  ?   @TĖo '  Ē@"@    'ĐȒĔ @ ƘZ    Ē@"@    'ĐȒĔ @ B  @"' #$ F> Ȱ ȶ@>+> )> b #Ӊ Ȁ&b>ǐ -@@೐ F27Ӑ" '@\ @ `] @0Y!F  Ē@"@    'ĐȒĔ @ U .   @"@ |   'ĐȒĔ @ ;Ͱ  > "Ȁ  ''#\O'@\ @` @`Y    +`O build > MLEN㿈>"\` d  4H /* '> c` 2`H 0 $$$ 4    8H /* '#> a   m a$ > #̒" > }"ؓ2`  * > c` ?"`  $aH 0  " $ ($ $ $  4  > `P $  $ I`X &> ! & > >  &  > #&.&  ?E$ > "&  "&`L @} `@] *  L"u&`@2`<    @ 2"Z&l?'p> #'&  &&       $ @  "@`   3   ?$ 4,  >bӔ  2H /* '> c` 2`H 0 """2  $ $    $ ` & && &J JKHa a LY [ & &      $ @  "@`  3   ?$ 4,  >bp  2H /* '> c` 2`H 0 """2  $ $    $ `L ` &Z&  & U& S&Q&N&      $ @  "@`  3  ?$ , >b  2H /* '> c` 2`H 0 """2 N $ $  `  $ @i&&`L  S      $ @  "@`  3   ?$ 4,  >bŔ  2H /* '> c` 2`H 0 """2  $ $    $ `L & &`\ &@ &``F&      $ @  "@`  3  ?$ , >bt  2H /* '> c` 2`H 0 """2  $ $   ` $ &$% %@> ba "a not responding㿘H /* !>  @ ܨ > "   $ 2 <@ܒ 2T $ 8 7 $ 8@(2`d> 4`*   `d * @ h` x:`@` :`@ h` x:`@```>ǐ *`@@f  8 $` 4 $ $` $  ,`@ >` <@Q` $ $ $ , (@& `T  $  $ r$ $ ` dl$ , di$ ,`P"f?$ 8XT`\" " 4   &V@(2   $ 2 ``@6I  沔 "@@       ``@  ",?") #"&`\ "!4$  $  ? ,$ $  d$ , d$ ,`:  $`!$`ਐ $ਐ $ $`!$`$ 8 2+ H 0>> a8# `"`$" @  ` Ȅ*@(` nfsndlck㿘 `  ``<*  !$  ˔  >@ $F!2>!P * @@2` @ $nfs sndunlock㿘@@*@>H!@&*@&nfsrcvlk㿘 *  a    <  `>x $a>!P * @2   $nfs rcvunlock㿘@*@>"8@&*@&7㿘 x `2   "m     ?  6  $ " ?@&  &  &     $ "&? @4;: $2`  ? 4   $   $   $  "  ?$ @8os$@$` %`     Ȁ  $  2$ 0 2 Bad kerb verifier Not fullname kerb verifier Kerb nickname short Kerb nick verifier bad P 0  @ ,''``  " '  ( ' (@'2C $ X > #@ 0 ``  "    ' @ 2& $ T$ L> a   I> !,@> "@א J   ͐ K` K$ T `2 $ L$ D`  ` L2 L`4$ T L 2 L` L L 2 > D!*`@$ D   L> c8 ? $ L ``  "  ?   @ '  @"@    ' @  @ס P 4 $  $  g``  " *     '@a}  @`4 " `@ 4 4 T `$ @  3&``  "  ?  '@G > #܀   y&`  ? ' &`5 H  ?'ؐ ''`'А! 'Ԑ@^   @"@    ' @2 > c܀   ">    @"@  ` ' @ܰ   >ސ   am  &a L @$ L` &`>ʐ    @"@    ' @2 > c܀   ">ߤ ]   @"@    ' @h '  @Q'` *   L 9 2  <      @ ߒ     2  > b? h && h l 4 & h    p $ & h  @   L  $ L $ T $ DD ;  D 6  @"@    ' @  L $ L  @"@   ' @ a0  $ \ $ 0$ @nfs server %s: %s 㿘" C>b[K build > MLEN㿘 >bf  6 H /* '> c` 2`H 0 &&  & 6    (8& H /* '5>     ' & > #̒" > }"ؓ2`  * > c` ?"`  &H 0  " & & (& $ &  6 &   !@!>  |   2 >ǐ .`@Ȑ  >ǐ .`@`"   @   `I      $ @  "@`  3   ?& 4,  >bƔ  2H /* '> c` 2`H 0 """2   & &     & "@` F"`     $ @  "@`  3   ?& ,  >b  2H /* '> c` 2`H 0 """2   & &      & "@&㿐>  ` "'pG  4`H /* '> c` 2`H 0 $@$``$` 4`    ( 8 cH /* '!> !     !$`> #̒" > }"ؓ2`  * > c` ?"` `$!H 0` "$` $`($`$`$`   4` <`" @$`` D$`$` `  ```$ "   1%@ , >bǔ  4 H /* '> c` 2`H 0 $$  $ 4    $@$` ` ` )>! ` $` '> %!  $ %>a "a>!a%$> # $> ! $ % I$   a"$b   $b $>ǐ".@$ $$ f``  ```$` @  "@   7`  ?$@/ >b7  4 H /* '> c` 2`H 0 $$  $ 4   l  l($@>}"$` ` ? ?` @ $` $ $  $  $ $ ` @ $  `> #)> `  ```$` @  @`  ?@2_` >bԔ  4 H /* ' 4H 0 $$  $ 4    (5$@H /* '!     !$ > #̒" > }"ؓ2`  *  ?$  %!H 0  " $@$ ($ $ $  4 $@$` ``  ```$` @  "@`  ?$@   i@&` v$`   ?"$` @6` ,`@` $` `  ```$` @  "@`  3`  ?$@ , >b1  4 H /* '> c` 2`H 0 $$  $ 4   f $@$` ` `  $`  $\$ \> #)> `  ```$` @  @`  ?@2_` >b  4 H /* ' 4H 0 $$  $ 4    (5$@H /* '!    !$ > #̒" > }"ؓ2`  *  ?$  %!H 0  " $@$ ($ $ $  4 $@$` ``  ```$` @  "@`  ?$@   h&` v$` \  ?"  @6` ,`@` $` $$ d$@h (%`l%`#㿘   " ?R"` $_ @`2`Y @@@$,@"M H "@` ha$@f$@$@`<  B>```"&`@`8 @`@?&``&@"@@`""`&4`&&6 @&nfsm_uiotombuf: iovcnt != 1㿘  >;!@m@`? ?"> #3>        $ @  "@  ?$ n >b  4 H /* '` 5`H 0 $$  $ 4  ڒ "5$ H /* 'a   g a$ > #̒" > }"ؓ2`  * ` ?%`  &aH 0  " $ $ ($ $ $  4 $ %     $  @  "@   ?$     gu $ e $ $  <` B>  "a& @"@&`"M"`$N       $ @  "@   0   ?$( >b  4 H /* '> c` 2`H 0 $$  $ 4  & $ %   @*@` $ '  ''@ nfs S too big㿘 & &@&@'@` d] H( >!>b  4 H /* '> c` 2`H 0 $$  $ 4  ǒ & $ $" $  '@f "! H @  f $@ @$ "$ ``怤 $ & &@   "   H &" "@㿘       $  @  "@   ?% ? @ "@ `  % fL& % > #/>  >b  4H /* '` 5`H 0 $$$4 / l(5H /* 'ᰀ    ᰀ$> #̒" > }"ؓ2`  * ` ?%` %ᰑH 0 " $($$$  4 2(  l d$ %  "@`   ?$  6   ?"@eĔ@$ &~&  &@ struct nfsnode bloated (> %dbytes) Try reducing NFS_SMALLFH struct nfsmount bloated (> %dbytes) Try reducing NFS_MUIDHASHSIZ struct nfssvc_sock bloated (> %dbytes) Try reducing NFS_UIDHASHSIZ struct nfsuid bloated (> %dbytes) Try unionizing the nu_nickname and nu_flag fields 㿘> "!>  "a> "#>  "!> " > ""> ""> "#> "#8>  "c> a""a,> % I"b> "!d> " > ?"b>!P @  d!> $!8$!8>` 2> > b"b" > ax>` ! > />  #`> > "c> " @ @"  㿘> }   L"@> " Ȑ " 㿈@!``   Db"  T 쀢  >!+ `*`@D''* H &'>a` *  ` < >#2` @4'8*`" *  * ''`28" 8"|`$8 - > c48$|$ |> b\$|8$:8&`&&`&`( o6`,&`l&`T&`X  <`(!&`86`. &`0&`4&`@&`D"&`H&`p &`t8&`<<&`L@&`PL&`\P  &``&`h+>`x6`. &`0&`4 >`@&`H *  :>`p(&`<,&`L0*`" *  * &`P&`P$ @<$ 4$ 8@  $ << P ` 2 `@>  2 `  8 `2  ` @( `<  >``@1> >`> "Ȁ&`d  ``$!"`&$`&(`" `&,`&0 㿘> "Ȣ``"  a@ʼ  8`!!!!` @@   㿘 |> "`"``"   @ʚ#  8`` 2      > b`  B"`b "b`@` `(`D`@`( 2`@`  8 `2  ``D@( `< `@<``@<`c ``$!"`&`$`&`(`" `&`,`&`0 㿈\`d h $$4@ @ $ "  $@"| H "K  /n `  ` $  @,@ `,@'@ ?"& &2P   $@ $ $ 0#\#`@I2> `8 7] 4 7/ $`$ # !$ $ 02   @@`  7757  $@d$        1"   + ( 0$ , " "    (  #2" 㿘\@`J@      $ @  "@`  3   ?$ ,  >b%  2H /* '> c` 2`H 0 """2 Z $ $     > ` $ X"      $ @  "@`  3   ?$ -  >bݔ  2H /* '> c` 2`H 0 """2  $ $    > !d`$ ""","0"4"8 "$@'@@㿘`J`  ```$` @  "@`  3`  ?&@ , >bx  2H /* '> c` 2`H 0 """2  &@ &` ` ` > ` &` M#@`  ```$` @  "@`W  3`  ?&@ W, >b0  2H /* '> c` 2`H 0 """2 e &@ &` ` X`` > !dX&` @#@&'㿘V`&`& ` & L )>@a<*  &` /&`&`&`H&`L& `F&$`G&(&,`&0&4`&8`$&<`(&@`,&D`0&H`4&L`8E&P>@!*`@&@`2>`>`8@ (`*`@ &`&` &@ 2`D?& "@4`H& `&$`&(`$&,`(?"&0@ǯ#&0`,&4`0?"&8@Ǧ#&8`4&<`8?"&@@ǝ#&@㿈\`1K&  ^ F `$ T`   R h h )0"416  d&&R  @66   `4 6 `"S @6   $@$@` >a'a'* @@     @`?nfs getcookie add at 0㿘 $@Ƨ@2  "1>>c F 耦`4?:! T &` &@ " $  "&` ?ဦ2@` 4@6$ @! T˔ "`@ "@@" &@"` 4@`  &`.  @H( 2 0` $`0``0"`02H L`Q D?>Ȅ(R   P " P  R# @ >DŽo @    @*:* *  `㿘@ȱ P 6@ &` &` 6` V  @6 V` `"V @V` ʐ`0 ݒ '' D''@'+'ؐ@{  `<'`@'  `(€3y `] nfsd init0``X> }c耊 "@ %> 1>ŐȒ  #  !$##耊 @ !@C74`]P 5 D''''+I'*@ " `!3. @"@ @  $@``@ N ? nfsidl㿘 ? > |   @ "  `> "  ` "`>  Ȁ >  > } ,$! >Ŕ > `Ȁ` "$>  Ȁ`g    ```"`%``"@`0@"`\ hն J`ȓH o*@ e 0    0    H 0 & 0 " `"    "` 0 $ 00> "#  "@? 0 \ $ 01k \`4 "`4 lp 2`\`Ȁ`2` }> > | ,"@>`?"`nfsauth1nfsauth2㿘 @\@$  >>P8*`<텒E@! T + $&$ Ȑ!$ $ @$  T$ @` `;>5> Ē PaH*`<W@  `  *@$ P "   T*@$` ' Д ]$@*@ @$*@$ nfs_getnickauth verf too small㿈`4`>ξ#8 C@Ȑ*  쀧`> ````2``> `hbȀ 6@@ ``"`& `@"@'@  '`  T"& $  "`t "& &'> ȸ `l  Ȁ 2 `p`p@ '`l'`p '`p`l'`p '' '' x '@ \}'``  "    ' ,ܖ2} '> "' '' a,m > @6  `&  | 3 `"  "`  "@`"`& "@&`&> "Ȑg&hx&l &p\&t& & "& `@В C*  쀢  &`@ǒ C*  "` `@ǿ C* " `@ǹ C*  & ``  "  ?   ') ,''@nfsbuild > MLENh'  Lװ " ` 5 @`@`> b`  "` D ｖ`'| R `  ?   $  @  "@  c|   ?$4[|  $ @  "@   9  ?"1 >b  2H /* '> c` 2`H 0 """2 "  l(>3#`"'" '` "` |R '"? "?|`R`V `R`P0      $ @  "@`  5  ?$ . >b  2H /* '> c` 2`H 0 """2  "'" '  " ` |' [#\#` 谒"` .`'  '@"@   ' ܖ   ؒi y ؀ 耢 t`` ` " 3`  `4''  4FܖL 6@6`  8 `%&`"&`?Д "@l&`  ?Д "@d&`?Д "@\&`c &`$  &`&`&`  &`&`&`&`@ `LhZ Z’`Z Z`<@@ò u/A|p  D> b` +#``| 'R`  ?   $  @  "@  e`|   ?$4]`|  $ @  "@   9  ?"1 >b]  2H /* '> c` 2`H 0 """2   l>ˣ#`"'" '` "` `|R '"? "?`|`R`Zd  `R`#\#` ֚찒"x .  '@"@   ' ?^   ܒ' P M  @"@ /0  ' 07 `@a >$` ` $`$``@a >$`` $`$``@c <$`` $`$`@ $@\root/root on %s nfs_mountroot: vfs_locknfs_mountroot: getattr for rootnfs_mountroot: can't setup swap vpswap on device 0x%x swap/swapswap on %s nfs_mountroot: getattr for swap> >`;!l <"ȠА@»!(Һ>ʒb[>ʒb @l>ʐ"ˬ) > >ʚ"h$`$ h 2`"h"> "!l$ )P#>a p@> l'P'T'X'\a'`*` @#!( >r"@qH 0&> w> ",a "> y>_"##>b#0 >ʒc l>ʒc( @Dl>ʐ#0P|l "`8"@$  'P'T'X'\a'``* @@P >.#@ *2 @ 2 $nfs_mountroot: malloc mount for %snfs_mountroot: mget soname for %snfs_mountroot: mount %s failed: %d@!   >ː!@! >Ȑ $ $ @ X'  ' ' j' ' w'䴒>ː"ݒ X& @>ː"(̒nfs_args: retrying connect nfscon㿘H /* !`  @ ?+?  &H 0 `  `,`>!P> @Aa8@ĥ @: @& d& d, "* @4& d` " ``0  d& h d& h`""`  ` " `  > & "&   @  4&  @ 4& ` " `$  > & "&   @  4&  @ 4& `@" ``(  <# & $` "  &  4& ` "``4 (& `@"``8 (& `@"``< :(& `@"``@ (& `@" ``H`?#@$6!6!`@" !`L`?#@$6!6!!! 86!`@" `P`?#@$6!6!`@" !`T`?#@$6!6!!! 86! P  T 3>#> !>ː܁  ɭcHb #h{ 0U ^  U H ? Q KU X *@ F'@@ ;   '2 U}+@ YU'" Z@ @U$@  YU @I$@   '@`@@"   @'"&a$  $ >'#X'$  ! &`>!P> a8@$ $ d $ h$ $ $  $  $  $  $  $ $   $ L4! <4!4!4!   Vƒ6```X@@ `V Z`hV Z$ ` $ T  T`$ X۪ !&`$ LÖ> '@>!l ?x'''`* @@x  ϒ  nfsdism㿐6`` Lѕ A T` $*8   ` $'> 1>͐⠒ #]  ⠐*" **@$e @$**+ސ `% }  㿐! LJ  `8   "`8 "@&@ x   0'>%>  ' ' * @@ 2 $ 0 " $)  ''''' * @@؀ 2* $ 2  -    -㿀   #\#` L .Ebuild > MLENp` "  `8    `F `@  H> b`P #`P|`'R`  ? ``$`` @  "@  e|``  ?$@4]|  $ @  "@   9  ?"1 >b  2H /* '> c` 2`H 0 """2 I  l>Z""'" '` "` |R '"? "?|`R`U  `R`0  $ @  "@`  5  ?" . >b  2H /* '> c` 2`H 0 """2  "'" '`  "` ' a8@  `2 `@2  "2 `@2 "  #\-#`"I .  '@"@  ' 햘" 0.  ܒ} 쀦   @"@   ' q 2 0@;ؐopen eacces vtyp=%d   | 8 ` !>А pt  !4> "`@$ !  @6  M !" 2y` `@ `$`@` f   X  c @r` Y<`` )   G  "R @a$` 8 2   <` > a''''a' * @@ 5- > a''''a' * @@ "`Ā@" 8   <`       @$`!"$` 㿘  `8 $`|`!      @8   4    И $   ?4   x|!c "d2 ` > b`D  "`D D 氖`'| R `  ?   $  @  "@  b|   ?$4Z|  $ @  "@   9  ?"1 >b  2H /* '> c` 2`H 0 """2   l(>&""'" ' " |@R '"@`? "?|VR`R`vP0l      $ @  "@`  5  ?$ . >b  2H /* '> c` 2`H 0 """2  "'" '  " ` |' R  #\#` .  'v 㿘`` @  ?| - ?2 ?2 $?2  ,?2  ?#@"     ?28 ?"M ,8?`(>Ґ *`@I IIIxIIe  ,? $?? #@  ? ?P ??7<   G      `  `  `F 4 <@<@ ` ?28 $?"` 8  `  `+  2`  ` `@ ?2<@ ?<@<@p> b! `H  "`H D<  '|`R `  ? ``$`` @  "@  c|``  ?$@4[|  $ @  "@   9  ?"1 >b3  2H /* '> c` 2`H 0 """2 h  l(>y""'" '` "` |R '"? "?|`R`V `R`ȒP0`  ```$` @  "@`  5`  ?$@ . >bє  2H /* '> c` 2`H 0 """2  "'" '  " ` |' P?`#@P  $ @  "@`  5  ?" . >b|  2H /* '> c` 2`H 0 """2  "'" '' > !d`" "`M"  $ @  "@`  5  ?" . >b.  2H /* '> c` 2`H 0 """2 c "'" '' >  `" "`?P  $ @  "@`  5  ?" . >bߔ  2H /* '> c` 2`H 0 """2  "'" '' > !d`" "`M"  $ @  "@`  5  ?" . >b  2H /* '> c` 2`H 0 """2 ƒ "'" '' >  `" "` ?P  $ @  "@`  5  ?" . >bB  2H /* '> c` 2`H 0 """2 w "'" '' > !d`" "` M"  $ @  "@`  5  ?" . >b  2H /* '> c` 2`H 0 """2 ) "'" '' >  `" "`?`?"S  $ @  "@`   5  ?" . >b  2H /* '> c` 2`H 0 """2 ֒ "'" ' ' > !d` " "`"`L"  $ @  "@`  5  ?" . >bQ  2H /* '> c` 2`H 0 """2  "'" '' >  `" "`$> "Ȁ@R  $ @  "@`   5  ?" . >b  2H /* '> c` 2`H 0 """2 3 "'" '  ' "  "`,"`0"  $ @  "@`  5  ?" . >b  2H /* '> c` 2`H 0 """2  "'" ' ' "  L"  $ @  "@`  5  ?" . >bb  2H /* '> c` 2`H 0 """2 헒 "'" ' ' " "`,> "Ȁ@R  $ @  "@`   5  ?" . >b  2H /* '> c` 2`H 0 """2 F "'" '  ' "  "`,"`0"  $ @  "@`  5  ?" . >b  2H /* '> c` 2`H 0 """2  "'" ' ' "  L"  $ @  "@`  5  ?" . >bu  2H /* '> c` 2`H 0 """2 쪒 "'" ' ' " "  $ @  "@`  5  ?" . >b+  2H /* '> c` 2`H 0 """2 ` "'" '' >  `" "  $ @  "@`  5  ?" . >bޔ  2H /* '> c` 2`H 0 """2  "'" '  ' " ?`#28>  "`2>> 8 (*`@ $`?2$ > "$ ` ?2$ > "$ `$ `$$ `(?"$ @#$ `,$ `0?"$ @#$ #\#` <찒"i .W  @"@   ' 䤘N > ad   @"@  ' 䉘3   '@"@   ' r  ܒZ  'ؐؒO      ! @ % "  "8? c 8 _ | T'`E ` C> F   23%,>  a''''a'* @@ | @> " `"   @  (%  E7%>   L`"  "L ` ? H $ |'x| R `  ?   $  @  "@  xc|   ?$4[|x  $ @  "@   9x  ?"1 >bK  2H /* '> c` 2`H 0 """2 ꀒ  l(x>""'x" '|x` |"` |R '|# ? "?|`R`V `R`x|P0V      $ @  "@`  5x  ?$ .x >b  2H /* '> c` 2`H 0 """2  x"'x" '|x | " ` |'| I`` ?x ?` $ @  "@  xbx  ?"Zxx  $ @  "@   9|  ?"1 >b{  2H /* '> c` 2`H 0 """2 鰒  lx>""'x" '||x '|" # ? "? I  |  p l t#\#`".p} . (p  'dl@"@    'l _ht` h ZdplG tR Od l  @"@    'l 8ht9 h  @pt/ H p`` l "   ?  @  'lplht h }``z @xR`2 `@W 2zt# `x`M p  '\l@"@    'lpl ܘhtݰ h  \plĖ tϰ \p  'Xl@"@    'lpl ᶘht h Xpl㞖 t 'TTpl㓖 t T%t  R`2 `@ 2 Ù``t0 Np  'Pl@"@    'lpl chtd h  PplK tV Pp  'Ll@"@    'lpl =ht> h Lpl% t0 L'HHpl t# H  @"  (%  @"%  @2 %` \ # %tz ""A  2 @ 2   ?   @ (% 㿘  8 2     㿘 8 2     p`> !b`T  "`T D  '`| R `  ?   $  @  "@  c`|   ?$4[`|  $ @  "@   9  ?"1 >b  2H /* '> c` 2`H 0 """2 S  l(>d""'" '` "` `|R '"? "?`|`R`V `R`೒P0      $ @  "@`  5  ?$ . >b  2H /* '> c` 2`H 0 """2  "'" '  " ` `|' F `#\K#`"X .&  '@"@   ' ߲<   ܒᚖ . +  @"@   ' ߋ  H ߖ䖒 p ` ``< B!  "Ѱ 0Ұ H0ΰ 0ŀ> #> " X`" X , P }'`| R `  ?   $  @  "@  a`|   ?$4Y`|  $ @  "@   7  ?"/ >b  2H /* '` 5`H 0 """2   l(>""'" '` "` `|R '"? "?`|`R`V `R`DQ40+      $ @  "@`  3  ?$ , >bK  2H /* '` 5`H 0 """2 傒 "'" '  " ` `|' E`  $ @  "@`   3  ?" , >b  2H /* '` 5`H 0 """2 6 "'" '  ' " `"` ""` """ `#\Ί#`" .;  '@"@   '   ܒۖ ܀   @"@   ' Ϙ~ 'ؐؒ߹ q  @"@   ' ݯ^S  䖒O$ 2     E> X'''İ  ! @'``=  B " {  r  ǹ j> #> " \`" \` ? X 4 ב'|`R `  ? ``$`` @  "@  a|``  ?$@4Y|  $ @  "@   7  ?"/ >b  2H /* ' 5H 0 """2   l(> ""'" '` "` |R '$ ?"?|`R`W`R`XRH`  ```$` @  "@`  3`  ?$@ , >b^  2H /* ' 5H 0 """2 㕒 "'" '  " ` |' CsS  $ @  "@`  3  ?" , >b  2H /* ' 5H 0 """2 G "'" '  ' " `$` $  $ N$  $ @  "@`  3  ?" , >b  2H /* ' 5H 0 """2  "'" '`  "`  ` '$ $ $$ ڲg` Ԛ#\I#`" .   @"@     ' ۯE> ad   @"@    ' ۖ, |   `?  '@"@    ' x  ܒc ܀ a  @"@    ' R` @6@@$ " "@@ `;  "`` @ b `>` &` 2@ " @# `B @%@`Ԓ@q   Ē  B 'ؐؒ ؀|`T"`|% > ̀  &`X  !` "D >`''`'* @@ -> "> " l`" l   ? T 0  <   '|`R `  ? ``$`` @  "@  c|``  ?$@4[|  $ @  "@   9  ?"1 >b3  2H /* '> c` 2`H 0 """2 h  l(>y""'" '` "` |R '"? "?|`R`V `R`Ȓ䰒P0-`  ```$` @  "@`  5`  ?$@ . >bє  2H /* '> c` 2`H 0 """2  "'" '  " ` |' @  f۰ ? ?` $ @  "@  c  ?"4[  $ @  "@   9  ?"1 >bb  2H /* '> c` 2`H 0 """2   l>""'" '` "` '?" "?@k  䰒_   $ @  "@`/  4  ?" /, >b  2H /* '> c` 2`H 0 """2 5 "'" '` 0 0"` >a<*  '"> !d"> ` /""" " "$"("" ,"$0"(?   $ @  "@`  5  ?" . >b  2H /* '> c` 2`H 0 """2 ˒ "'" ' ' " F"Gp"  $ @  "@`  5  ?" . >bI  2H /* '> c` 2`H 0 """2 ~ "'" ' ` "  `'>`8@> (*`@ $> "$ $ $ $$ (?"$ @#$ ,$ 0?"$ @ #$   #\ȷ#`+ .    Ԓ@"@   'Ԑ Ж   `G !  Ԓ@"@   'ԐؒԔ Ж   @ H `` Ԑ "   ?  @  'ԐؒݘЖͰ ̖ð  2  Ԓ@"@   'ԐؒԔ ׹Ж Ѐ`"   Ԓ@"@ S Tؒ T 'Ԁ`'Ȓؔه  Ȁ` "ѐ  @]İ  h  Ԓ@"@    'ԐؒԔ cЖS > ad "  Ԓ@"@   'ԐؒԔ GЖ7 Ѐ` |  `?  'Ԓ@"@   'ԐؒԔ &Ж   ؔ  `ߋ "R @ߔ&@: |`` 2`|" :㿐   -h``` ' !  @  b`ؖڰ> " ``" `  ? L ( <  '|`R `  ? ``$`` @  "@  c|``  ?$@4[|  $ @  "@   9  ?"1 >b)  2H /* '> c` 2`H 0 """2 ^  l(>o""'" '` "` |R '"? "?|`R`V `R`־P0`  ```$` @  "@`  5`  ?$@ . >bǔ  2H /* '> c` 2`H 0 """2  "'" '  " ` |' <  \Ͱ ? ?` $ @  "@  c  ?"4[  $ @  "@   9  ?"1 >bX  2H /* '> c` 2`H 0 """2 ܍  l>""'" '` "` '?" "?b  2H /* '> c` 2`H 0 """2 * "'" ' ' " "  $ @  "@`+  4  ?" +, >b  2H /* '> c` 2`H 0 """2  "'" ' > !d`," " > ` /""" " " $" (""  ,"$, 0'p"(  $ @  "@`  5  ?" . >bM  2H /* '> c` 2`H 0 """2 ۂ "'" ' ` "  `' >`8@> ( *`@ $> "$ $ $  $$  (?"$ @#$  ,$  0?"$ @#$   #\Ļ#`+ .   @"@   ' !   `G!  @"@   '    @ H ``  "   ?  @  'Ͱ ܖð  2  @"@   ' ӽ `"   @"@ S T T '䀤`'ؒՋ  ؀``"Ր  @a԰ h  @"@    ' gS > ad "  @"@   ' K7  |  `?  '@"@   ' *   В  Ѐۏ ` V 2 @`"< |` 2`|" <    T` `| 1>  a''''a'`* @@ 2W $!          @# "     2 @4  $  㿘   @ p`> !b`p  "`p ? H $ Ȗ'`| R `  ?   $  @  "@  c`|   ?$4[`|  $ @  "@   9  ?"1 >b  2H /* '> c` 2`H 0 """2 -  l(>>""'" '` "` `|@R '#@`? "?`|`R`V `R`ҍP0J      $ @  "@`  5  ?$ . >b  2H /* '> c` 2`H 0 """2 ˒ "'" '  " ` `|' 8, ? ?` $ @  "@  b  ?"Z  $ @  "@   9  ?"1 >b(  2H /* '> c` 2`H 0 """2 ]  l>n""'" '@ '@# #@`?@ "82  ѿ~#\#` 찒"6q`| .h  @"@   ` '  S @> ad "  @"@  ` ' 7  `|`  `?  '@"@  ` ' Θ @  ܒҶ  ܀3`|` 2``|" 㿐      @  "!  @ 4 " T  $  | 2  8  @  2  ̐   `` `#\`#`@6 8`   8         " 㿐``` #\` #`@p `> !b`x  "`x ?` ?  H@ l'`| R `  ?   $  @  "@  c`|   ?$4[`|  $ @  "@   9  ?"1 >b~  2H /* '> c` 2`H 0 """2 ђ  l(>""'" '` "` `|@R '#@`? "?`|`R`W `R`1Q0      $ @  "@`  5  ?$ . >b~:  2H /* '> c` 2`H 0 """2 o "'" '`  "`  `|'`  6LM ?` $ @  "@  b  ?"Z  $ @  "@   9  ?"1 >b}ϔ  2H /* '> c` 2`H 0 """2   l>""'" '@ '@# #@`?@ "5ْ  f4|R   ?` $ @  "@  c|  ?"4[|  $ @  "@   9  ?"1 >b}Q  2H /* '> c` 2`H 0 """2 Ն  l(>""'" '` "` |@R '#@`? "?|`R`W `R`Q0  $ @  "@`  5  ?" . >b|  2H /* '> c` 2`H 0 """2 $ "'" '`  "`  |'`  5``ք` ? ?` $ @  "@  b  ?"Z  $ @  "@   9  ?"1 >b|  2H /* '> c` 2`H 0 """2 Ե  l>Ɛ""'" '@ '@# #@`?@ "4  #\#`` \찒"6`| .  @"@   ` ' c @> ad "  @"@  ` ' G  `|`  `?  '@"@  ` ' &} @` ܒ o ܀  @"@   ` ' S @> ad "  @"@  ` ' 7   |`  `?  '@"@  ` ' ̿ @` ؒΧ  ؀ $`|` 2`|` 2``|" |" X     @  b |Œ ʐ   > c''' 'c'* @@> b`| "`| `  ?  D Ɲܠ`'| R `  ?   $  @  "@  b|   ?$4Z|  $ @  "@   9  ?"1 >bz͔  2H /* '> c` 2`H 0 """2   l(>""'" '` ܐ"` |R '"? "?|`VR``R`cܰP0@      $ @  "@`  5  ?$ .ؐ >bzl  2H /* '> c` 2`H 0 """2 ҡ "'" '` ܐ "`  |'` 2 `|R   ?` $ @  "@  b|  ?"4Z|  $ @  "@   9  ?"1 >bz  2H /* '> c` 2`H 0 """2 5  l(>F""'" '` ܐ"` |R '"? "?|`VR``R`˖ܰP0s  $ @  "@`  5  ?" .ؐ >by  2H /* '> c` 2`H 0 """2 Ԓ "'" '` ܐ "`  |'` 1    4! ?ؐ ?` $ @  "@  c   ?"4[   $ @  "@   9  ?"1 >by0  2H /* '> c` 2`H 0 """2 e  l>v""'" '` ܐ"` ' ?" "?  19   ƒܰ   #\#`"`6  .`  '̒@"@   '̐ Ȗz  ĒД ԰ k   ̒@"@    '̐В̔ ȖS > ad "  ̒@"@   '̐В̔ ϘȖ7 Ȁ |  `?  '̒@"@   '̐В̔ ɮȖ   Д˖   yԒ |` 2`|" |"  " h```  > !b`h  "`h`@R   ?`  L (@`<`  Ý'| R `  ?   $  @  "@  c|   ?$4[|  $ @  "@   9  ?"1 >bw͔  2H /* '> c` 2`H 0 """2   l(>""'" '` "` |R '# ? "?|`R`V `R`bP05      $ @  "@`  5  ?$ . >bwk  2H /* '> c` 2`H 0 """2 Ϡ "'" '  " ` |' /~  ߐ  ?` $ @  "@  c   ?"4[   $ @  "@   9  ?"1 >bw  2H /* '> c` 2`H 0 """2 5  l>F""'" '` "` ' ?#  "?  /    Ȗk_  $ @  "@`+  4  ?" +, >bv  2H /* '> c` 2`H 0 """2 Ӓ "'" ' > !d`," "`> ` /""" " "`$"`("" `,"$,`0'"(# ? ?` $ @  "@  b  ?"Z  $ @  "@   9  ?"1 >bv  2H /* '> c` 2`H 0 """2 T  l>e""'" ' '" # ? "?`.)  `Ƕj  $ @  "@`  5  ?" . >bu  2H /* '> c` 2`H 0 """2  "'" '`  "` `> <@ > "&& & & `$&  `(' @#& & `,& `0?"& @#&    #\2#`" .   @"@    ' Ɨ `G!  @"@    ' {ٰ   @ϰ H ``  "   ?  @  'Y jܖ  2  @"@    ' 5 `"   @"@ S Tƒ Ty '䀤` 'ؒ k   @"@     ' S > ad "  @"@    ' ٘7 ` |   `?  '@"@    ' Ÿ   ԒǠ  Ԁ`"  uْ |`` 2`|" ِ " h'   > !b `d "`d` ? H $` <  `'|`R `  ? ``$`` @  "@  c|``  ?$@4[|  $ @  "@   9  ?"1 >bsݔ  2H /* '> c` 2`H 0 """2   l(>#""'" '` "` |R '# ? "?|`R`V `R`rP0`  ```$` @  "@`  5`  ?$@ . >bs{  2H /* '> c` 2`H 0 """2 ˰ "'" '  " ` |' +``g ? ?` $ @  "@  b  ?"Z  $ @  "@   9  ?"1 >bs   2H /* '> c` 2`H 0 """2 B  l>S""'" ' '" # ? "?+  `Ĥ``  $ @  "@`+  4  ?" +, >br  2H /* '> c` 2`H 0 """2  "'" ' > !d`," "> ` /""" " "$"("" ,"$,0'h"(  $ @  "@`  5  ?" . >brM  2H /* '> c` 2`H 0 """2 ʂ "'" '`  "` > 0@ > "$$ $ $ $$  (' @##$ $ ,$ 0?"$ @#$   #\#`6| . `  @"@    ' (  G`!  @"@    '  ۰   @Ѱ H ``  "   ?  @  ' ܖ  `2  @"@    ' Ę "   @"@ S T! T{ '䀥 'ؒĒ m ؀`h  @"@     ' ‚S > ad "  @"@    ' f7  |   `?  '@"@    ' E   Ԓ-  Ԁʪ|` 2`|"   "c  @ а  8 2   " L"r; Cp   `! @ "42r%  > " t`" t   ? H $  '`| R `  ?   $  @  "@  c`|   ?$4[`|  $ @  "@   9  ?"1 >bpF  2H /* '> c` 2`H 0 """2 {  l(>""'" '` "` `|R '"? "?`|`R`V `R`ےP0L      $ @  "@`  5  ?$ . >bo  2H /* '> c` 2`H 0 """2  "'" '  " ` `|' '  y ? ?` $ @  "@  c  ?"4[  $ @  "@   9  ?"1 >bou  2H /* '> c` 2`H 0 """2 Ǫ  l>""'" '` "` '?" "?'~   ~  #\#`" 6q . h  @"@    ' WS > ad "  @"@   ' ;7 ` `|  `?  '@"@   '    ܒ  ܀`p@ `|`` 2``|" LJ<: " nfs_readdir: lost in space   8  |  4  R N @4I@2 @A = !!"  |> "@$@+ྀ '> b`  2"`> a''''a' * @@ Ā@ > b`  "`   2G  > b`  "` :"@27`"3    >r"X"@:`   @ E# `@ "@$ "@"""EEK! readdirrpc resid > 0 `  ` `| ` !  ſ&> #''􀥠瀤> b`  "` D" ='`| R `  ?   $  @  "@  a`|   ?$4Y`|  $ @  "@   7  ?"/ >bmm  2H /* ' 5H 0 """2 Ť  l(>""'" '` "` `|R '# ? "?`|`R`W `R`찒R0      $ @  "@`  3  ?$ , >bm   2H /* ' 5H 0 """2 B "'" '`  "`  `|'`  %T  $ @  "@`  3  ?" , >bl  2H /* ' 5H 0 """2  "'" '`  "`  '# # # J#  $ @  "@`  3  ?" , >blj  2H /* ' 5H 0 """2 ġ "'" '`  "`  '#   #`#\#`" .?  'ܒ@"@    'ܐ cؖd  ԒN YԀ   ܒ@"@    'ܐܔ BؖC& &Ÿ0N  ܒ@"@   'ܐܔ &ؖ'〤  ܒ@"@    'ܐܔ  ؖ ' '  ܒ@"@    'ܐܔ ؖ: ?  `" "" @   4@@ "@@`; " "`` @ B `>`" &``@8 =@4$,", ```B >`@&`@ "@@``? "`ܖ@*@@$"@@`""``< @ B `>`"&`  ܒ@"@   ܖ|'܀  ܒ@"@   'ܐ   ܒ@"@    'ܐܔ TؖU؀ '  '"       ܒ@"@    'ܐܔ +ؖ,`?ģ䀤  ""@ 4@ "@ " "`;  B`>`" &`" ``> H0{ 0 >!H`   ""EEK! readdirplusrpc resid > 0 't    '\  'l!|'d'`  wJ> ''T'\  \> b` #`| 'R`  ?   $  @  "@  e|   ?$4]|  $ @  "@   9  ?"1 >bj-  2H /* '>  0H 0 """2 b  l>s""'" '` "` |R '# ? "?|`R`"4  `R`  $ @  "@`  5  ?" . >biʔ  2H /* '>  0H 0 """2  "'" ' "  '# #` #` #dघ ## `tT #\M#`"H .  '@"@    'T       @"@    ' '` '`  \  @"@    ' v '  '@"""`@   5@@ "@@`; " "`` @ B `>`" &``@8'\\A@5%-"- ```B >`@&`@ "@@`?"`@& &@,@@$@"@@`""``<`@ B `>`"&`  @"@   p_'  @"@    ' I\" ' '  ``  "S  T< T+'  @"@    ' K  @"@    ' ``@  @"@ ` ?    '|W`2`@ɔ 2 '|||  ^x'x 'I'>''| (`(*   x2 -l@  & @j` @@& 3l,  @"@    '   @"@ ` ?   }l'I   @"@    ' P [\   @"@    ' Ϙ6`?G \ ""@ 5@ "@ " "`;  B`>`" &`\"``$?`#! H  >"P`  6 ""̐.nfsAxxxx4.4㿐ΐ  `| g!'o" &@&`> 0` X  &` >ɒ` , .`<   .`<   4 .` .``` @@' `@@ " ` .`* :  z u`n@hf h`|`> !b`L  "`L ? H $ Q'`| R `  ?   $  @  "@  c`|   ?$4[`|  $ @  "@   9  ?"1 >bf  2H /* '> c` 2`H 0 """2   l(>ǐ""'" '` "` `|@R '#@`? "?`|`R`V `R`P0      $ @  "@`  5  ?$ . >bf  2H /* '> c` 2`H 0 """2 T "'" '  " ` `|' 2P ? ?` $ @  "@  b  ?"Z  $ @  "@   9  ?"1 >be  2H /* '> c` 2`H 0 """2   l>""'" '@ '@# #@`?@ "  HՐ#\#` .찒"`Ȁ` . 쀤!  @"@  ` '  @``@ H ``  " ` ?    'o @`"%U R` @ '܀`@4 `f T`R @ ܀`@ Te "`ܐ`> 2 2 ` @ 2`Z Kܰ0V 4  '@"@  ` ' + @  ؒ  ؀ @ xD! 'ԐԒ  e`@  &0'@h ?!@@ l   D> b` #` |'R`  ? $ @  "@  e |  ?&4] |  $ @  "@   9  ?"1 >bd5  2H /* '> c` 2`H 0 """2 j  l>{""'" '` "`  |@R '&@`?"? |`R`< `R`Ȓߐ  $ @  "@`   5  ?" . >bcє  2H /* '> c` 2`H 0 """2  "'" ' ` ' &@&`&`#\#``䰒" .  ܒ@"@ `  'ܐ ʘؖj @> ad   ܒ@"@  'ܐܔ ؖO   'ܒ@"@  ` 'ܐܔ ؖ8 @  Ԓ * '  ܒ@"@  ` 'ܐܔ qؖ ش`Ԑ@  X !1㿘  "  ``$ @z:` $ nfs physio/async㿘  0`  > T  0  >!l 0@" l h 0 ? J 㿘    @ nfsfsyncnfs_fsync: not dirty''' 't??  'd @ !'l |'|'*  ! !"a `^H /* % 0 L @ G  0 2?/d`2 l l@-?'d- 0% 0 " T ; 2`* @ *`  `:  @ 2 d( d d `" :  @   H 0pd d'@' @# -`? T l :`2*  *  ` d :"@  :`@2`@-`!1 V  @5?#> #?!-`? 0 % 0" 4ى ` & 4 0 % 0 0 " % d ` "`$`  "@% d% ` 0 % 0=` @Ց-`H /* % 0 h @ +> 0 , `2Zl`2V>  0 t " 0xH 0`|Z J>!P * 't 0 l> !Ȁ`` 0 2"*l`` 0  0% 0H 0`'' \``* @@0 H 0l`"'l3 `) 4> t$x&" 4| 逥2 4>!P * 't 4  4 0 `Z`  ?`0` 㿐     |  #\" tag VT_NFS, fileid %ld fsid 0x%lx 㿘  |<> 8j > g ȁ  - - - - -㿘 @  bwrite: buffer is not busy???㿐 0  0>`!l> 8!@ 0 ` `"  "`> "#  "@` 0?! @& 0` \ @@`0 "`0@  \ @4 `4"4 T \ :`2*   `*  d@ ` :` 0 @  l#  ,@ & 0 0@*@& 0 & d& ` 0 & 0ڲ !1  \  `> 0@ & 0>'' \`* @@`2 \` \뻐0`0 "`0ߐ       "   8    2   > a''''a' * @@ 2   㿘 `|ྒa2> b"਒b`*"@ *`@ *`">b,> \*` @㿘 `|ྒb2> b"ఒb`*"@ *`@ *`">bX> \*` @  `| #"0>$4 T` *>`  %> !" ' ' ""  ' ' > b''''b'`* @@>!|> b\* @@dev = 0x%x, bsize = %d, size = %d, fs = %s ffs_alloc: bad sizeffs_alloc: missing credential file system full %s: write failed, file system is full 㿘'@` 0  %@> @ 2> ` ?> "X` 0̘ > " > "2  Ā 6  " $ <  ( ` ̡, @ @~O d$ $ $6 2 `@  @~=>@#  `Г>  `$`Вa$` '@ > @ z> " ԰ dev = 0x%x, bsize = %d, osize = %d, nsize = %d, fs = %s ffs_realloccg: bad sizeffs_realloccg: missing credential dev = 0x%x, bsize = %d, bprev = %d, fs = %s ffs_realloccg: bad bprevbad blockno%s: optimization changed from SPACE to TIME %s: optimization changed from TIME to SPACE dev = 0x%x, optim = %d, fs = %s ffs_realloccg: bad optim㿐\%`0 e@> @ 2> `2>  ?  @ 2> ` >  `0`>  2`>  .``<``(```̡, @ @} d$ .` 2 > ! `0Ҙ`> Ő!H?ӛ"`0@}a@!`dT,@" > !h"@Z< `$6 `'> `<`*@`(@}7 `̀@# > ax+`$``<`(@@}& d`̀@`0 > a`Ԑ  $`!w`> j">@#,`d,"`T@d@: `T&? @1 "@Е<  $Д$0H"0@? %d`> @ -> "o`԰ ffs_reallocblks: non-clusterffs_reallocblk: start == endffs_reallocblks: alloc mismatch `|$ ޴      P@@?> ,`@ P@@"`Ѐ@&  d@ T@|:- @T:@| 2 Ȕ@͖ 2 @Ŗ 2  * @*`@ @ ?0Ҕ   H@O` *` * ?  ?* @*`  2?>!" 0?f U H@|,>@"E,` @>@" ,`@ Td: ""d"`8@"i!% ` @ d,` T0@&:  d`@,"`T8@ a [ mode = 0%o, inum = %d, fs = %s ffs_valloc: dup allocfree inode %s/%d had %d blocks out of inodes %s: create/symlink failed, no inodes free 㿈   " |`Ȁ a < @ 2@f``,@: @W-`2>@!4C    >c'''c' * @@7  | h`"  >! `>!>"`&  Ԁ & ̐  & /&  Ԑ   &    >`@ (>"8Ғ`԰ 㿘 , @{/  @  l p8:*  "ؓ*` 6   &  : @u 㿘 `\@{ .? 2X`8`   @``@Z x`8.?   @`@z@z` `,@{`@zՒ`l`p8: *  "ؓ*`   6,$bԔ:  C `l`p8: *  "ؓ*`   6$bԔ: / `X +& ``* *  " `@0 `@ `8`@ `8 @`D@``|*"@ *`@ @z*`?@z|@㿘  0`, 6 @@6&@  .`,&@ `, @z  ۲``,@"  㿐 plT>@* .@ "ؓ*` " :@4:8? 4°  @ @}.@  ? d <, H@ "U@  > #Ԁ  >  } "$ @zT> @"U@ ,` :`c ` @ @ ` "@: ٘ 蒃@ 8" !@"U @ ,` :`c ` @ @ ` "@: "T 璃@ T>#*  4" 4#*`@`4 "`4T>3 @"U@ ,` :` ` @   "   * ** $?$ $̘ p$̑>@* l"ؒ.@ *`  ?"  ,㿐 pl>@* .@ "ؓ*`   202  @~ @~.@ ?  d , f  H@ "U@ " #Ԁ   > 0w> "$ 02 T@ؔy08>  .`4 28`@ `8@O  R@@y8"@"U  ,`  :`c `  ` ` ?"@ +@*8撆 8 $"@ $ $p@ $̑>@* l"ؒ.@ *`   "  ,Е*4`"40T@Ė .J 6! $@"U  ,`  :`c `  ` ` ?"@ +*@* $"$ $p"@$̑>@* l"ؒ.@ *` ,` @""  ,`4?"`4$@*`@`4 "`4@}Ɛpos = %d, i = %d, fs = %s ffs_alloccgblk: cyl groups corruptedffs_alloccgblk: can't find blk in cyl㿘  @x7` " 8`( @x֐@`"U@c``@ `@ > @#X ѐ%P ͐ |@}y@x @`"U@-``T@`T@  @`"U@"`X-` @%P@}Y@*  |@}T@x  @w@}L @x@}F @x%P@}?@w @ ,`R 4%P`@ %P@,` @ ,` R@ ,``@`,`U $j#X@xX @}%@ | `@w* %L,#\ %T%P@}* R?2 %L># >ߐ#Ȁ?,`,#\ %T%P@|* R@"U`c``@@ : 2* `%L?2%Xe`  >  `: >ߢ # ># 8@]6&`(v ,@`"U `> c``@@ 3@?`?&` Đ?& `  p l:* * "ؓ*` ?" |@|~ @w@w @w @|p @w@|j @w%P@|c@v @bU* ` -` Ԑ@ `X@|P@* ?4@`"U@-` T@`T@ @?"@ . ` @|5 ffs_clusteralloc: lost block㿐 T.` &  @| @|.@   d , ז?  H@"U@ Ԁ h.$   @ ``@ $@$@h`.?  @@ `4@T.`Y"@@vm"8  @w`: l:`* &  *  p@     "p ` *  `@  p@ @{$@ ``. @*@  3>"8xa@@̓0Ο cg = %d, irotor = %d, fs = %s ffs_nodealloccg: map corruptedfs = %s ffs_nodealloccg: block not in map㿐 pl>@* .@ "ؓ*`   2  @{K @{E.@ ?  d ,   H@ "U@" #Ԁ > E "Ȁ$ @v_ :`b \   &: W 0` `" : :` @"U@b \ @wE@` @"U@ " \ @w42 @>  0ʖ> "  @"U@ \ *  " $ 0*>!>! @"U@:b \  &   * @* ?$ p$ȑ>@* l"ؒ.@ *` < @ ?" ,  $ p`$>@* l"ؒ.@ *`  " j@zgdev = 0x%x, bsize = %d, size = %ld, fs = %s blkfree: bad sizebad block %d, ino %d bad blockdev = 0x%x, block = %d, fs = %s blkfree: freeing free blockblkfree: freeing free frag㿐  0 >%@> @ >`"  !   0 >!P@t $@ >!h > @0͐@z   @y, ?     d ʸ, 0H@"U@  > Ԁ >  0"$ @u 0 } `>@@"U@`@ + " >!  >~!@"U@"`ؒ@ u@  $  p`% đ<*  l"ؒ, *`  " |@y @t'@t͒ @t@y @tÒ@y @t%P@yx@t @bU*  -` Ԑ X@ye*  4@"U@-`T 8?.@  @"U@:c`   4? $ :@  8 #  :@ @ @  T >@ 6>$@"U@,`:`c`   :`*#;@ " >!   >}!؀"`    ?# `@   @*@ +@$$$ ̖ p@% ̑<*  l"ؒ, *`  "  @"U@:c`   4  $ :@  8 #  :@ @{ @  `<@"U@`@  "v $ 8" $$ ̐ 8 8"  p%  l< *, ؗ*@ `  #@#`  $  p`% đ<*  l"ؒ, *`  " |@x @s@s @s @xq @s@xk @s%P@xd@r @bU*  -` Ԑ X@xQ*  4@"U@-` TT @ "@ - 7ifree: range: dev = 0x%x, ino = %d, fs = %s dev = 0x%x, ino = %d, fs = %s ifree: freeing free inode㿐   |``,@x >!|`@wg`@x`` @w-  ?` `   `dȹ,  0wH@ "U@  > #Ԁ >  0i"$ `@v@ "U@4b \ : 2 >"}`L`Ҁ 2 >|"0@"U@4b \   * *@* 0*$ 0  $ ``p`$`ȑ=* `l"ؒ- *`  " <  2  ?$ ``p$`=* `l"ؒ- *` ?"  ,`s start = %d, len = %d, fs = %s ffs_alloccg: map corruptedbno = %d, fs = %s ffs_alloccg: block not in map㿘@r  `, & :  `,`: "`@"U@@``@> 8"h *@ ?" ?  * @s ,`@"U@ c``@> 8"h *@ ?" ?  * @sj 2 > | >{!" *  8&`,@"U>ɂ .>ɴ D  `:`c@``@    & :   8 "@ : "  *  (  +` 8Ԁ >!0| >{!H 㿘e$ l h>`.`&  ()> . &  (.@)e$ p@@6`8 ` ('@(  (@ ` &e$@,?`8  ('@( 8@ ?'@@e$4. ` &.` &+ &e$( @? 4@ cT( uid %d on %s: %s 㿘> bH {ffs_balloc: ufs_bmaparray returned indirect block 8'``'ְ `P`p@o PN` 40 *: `p8 `p20`t8`p08@ L 01` -S`0#\0@u : <`p@W d, T:@ " ``!$` `  `  .` `0@u: `p8 `t ?JO[ ")0`p8@ L   ?0H03`#\2702@uO`: `p8 @2 0`t(0@L ɖ`I  'd`* "TH@r<" @d.`T:@ " ` !$` @`4>y"*   3'  0Ė 0Ƚ Hd'<* @q"TT" @00* " `!$`  Đ@?0Ŋ`H*  >` ` ΐ   5 0m@ 0m Hd'<, @q"T" @U `* $| 5.* `0|5 05 'd`,"`T`H@qG`<" @``* $'F#a`0?T00M0 0 d', " T 㿘@㿐` `|  >%   !!# ?%  !# p "  % x % | !"   %    (% `B = (   > "% " *`" *  * %    >% e, 4   5 l5 n `@s*`@sĒ`` @s,@ ` @r{ @s`x ```0 *  ?`ds, "`x0 @rd h  H* _ Ŕ  ffs_truncate: partial truncate of symlinkitrunc: newspaceitrunc1itrunc2itrunc3Ш    > "|" 'P*`" *  * 'T8 2$p p:` `t`2pЀ 2p>"tx. @p1  O!$cl'8'<P'@'DclH'H@Up2Fe8(Ce8e0ð e4E e8`P@m[     4 34> !$l'8'<P'@'Dl'H* @@8 2`PB," @?> !$l'8'<P'@'Dl'H* @@8X <  <v  `T: b < @ >@vq Ȣ`` >`@vb Т`` 2Ѐ2 0 >, >vN !l `, "`,0< 8$0 $$T>u!h>''\`* @@Ǝv "H T0Lw 0'- t@"@@mۓ*`   @ [2 t?@pӐ?!&@, @" ??dx. 2̒0?@ @k, @ ?dT. 2M T ܐ 0@ " 0èܰ 㿐  | `P @jϔ 4`0*:  p8  p2`0 t8 p`0e8e@ `L  ?" $" t0 e8 H @    "@㿘>8h(` .`-(>ɔ >ɒD `` @:"8  @2 /`/@(&/`8 (8 ܰ Disk overlap start %d, end %d overlap start %d, end %ld Disk buffer overlapx> } t T> x ܢ *`" * @ <@: E?+> `<@"<`x?@27`x `"3`xa?'''a'`* @@؀ 2$`x` @2`x "`x 4`x: $`x> ("> " ;  u?> t"Ȁ@   xffs_isblock㿘 8"" >!2>!@ * >* >@*@   `?>@ *` @ `?t^ 8ffs_clrblock㿘 8">">>!>!.@>*` *` @ * * .@ @* * .@t0!ffs_setblock㿘 8">">>!>! .@>* * @ * @ .@ @*  .@t!ffsffs_mountroot: can't setup bdevvp'sroot_device㿐> w>"> la  >!> y#!> !( >!sې"x!  Jk @kْ! >ɐ"$ $!(@ ҷ  @K 01> h$`$h 2`"h"> "!l$  "`@k /,`Ԑhz Z>!"” Y Z@k"@ @CҠ@\`  %s: file system not clean; please fsck(8)   l%@@"&$ NҀ 2*`&@  ҈  @@   р  .ѐ@\ ҕ  .@0@NҀ B@?   2>a\'a\' * @@ >a'h'l!'p'ta'x * @@h >a'ha'l * @@h0a'ha'l * @@h.ђ .Б* . 2&$@ @&(&&&, 8 " <  > r#|@& ~   "0 !!>a\'ha\'l * @@h >a'h'l'p'ta'x * @@h>ն0Ta'ha'l * @@h@@2@Z  ո ճ03!d Kd"Ԑ@jz"@ hJ Z’ Y;d Z@jj"@ NЀ  р .> "& >" Hs_@  ffs_reload: dirty1ffs_reload: dirty2h       >>#r-!0b''  h'ؐ'ܐ '?'b'* @@Ѐ " ( @gK<`  ?̰ HF%\!T@@ 0@eg8 & 0"  |Ő"#T"#T h h#@ 0@ " 0 %(@&   4?@gx 6'%$ 8 0 4@lԐ$?  d@*@ | `< *` H@b 8%$ $ ,  #T%$ "@ ,``"Y U` `$MK    4 "`|>#qy!H @k @l   @l{,@   @k8 @k x? ` 0+@  d 1, a x@k$̒h  H*` vU``2U` P<  ?nGM > !(>   К 4`   >aP'''?''aP*` @>b''  h''Đ ''b'* @@ " ('  @f<`   HF\!T@Ͱ 0@@egL?!X   GR @h!X hGK %` h Hh#@ 0@ " 0'` , ђ ,Б* ,4@f? $`,* @ G  (804@k%d@O*@ i HF`< *`@"b8'$ $&a$T, 6 &a$ "@,`&a&`< >! 2&`@>!"p&`@(&`` &`%@%`%`t%` d%`$8`%`(>ɐ"%aP"`@ 6"`<`@?"0=aH0   @dj; 0B? 8 <0- 4 )<0& H,  1  >a|''''a|'* @@` ` H H  &a㿘  *  `&  %L?&  &%P%, %  0 :* * :>%0   t  @d; %0 B >%0 H8  ;  L>%88  ; >%@ 㿀6` `@E@a` L Ҁ 2`@  2 ` р  , ѐ@ ` <` ?"`L Ҁ   >`a|'''?'a|'* @@ҟ`"G G G $a`*@$`㿘> L  ʒ ffs_statfs㿘! F\!T@"6@>&oD! 4&`0&`(&` @jL8̢@ &`( d<@jB"@ @dؒ d$"&`,@j:?&` Ȁ@ &` h`L Z ’` Z `<@@f  fs = %s update: rofs modxa JЀ  JҀ " *>&" p>&n"0> bȐ@:" ` 7>)>'> " '" ' * @@ 2" $ | !# 0 " $ђ  ސ''''' * @@؀ 2͐ $ 2 >c''''c'* @@؀ 2㿐`@ &  > ~}"`}& x  - . E @f " |$` $$@$ @h @i   @i|,@   @h9 @h x`  `? 0+   d1, " xb=&@hh  H*` q > ~b@"`G$&7$ Ԁ 2%,H$Ԑ   $   2%, $%, ln$$ &㿘!`  `,@i`   F@ ؚ | 2@"`Ԑ "`㿘  T d @cM"      h Ș `H h%L ?`H"P%, 4!H8H H"@#@!H`:0K㿘  Œئ 4 @cS )804@h%  d@*@ }  Hg@ `ݐ8ސ2%s: modeffs_read%s: short symlink%s: type %d㿀   `|>( >(m\``8``p@ 2``Ѐ 2`>( >(mG` (`>( >(m?`%0@ 2 %4@(0 w 0`p@ b q`p  @b P  ' P*@: `p8 `p2 0`t8`p 0%8%@  L %8 0 @ #&<2 P@( P P* : `p 2`t  ? `p#\v? &` @$6HHTސ  ' "`` %`ffs_write%s: nonsync dir write%s: type`     |>( >(lc8 ""  #>( "$ >("p=  @"  p@  t@" 02  >(#>(lec#>(lac -  e0:  B  28e48  `6  `:   B 4   6  Q ܰ 6 p  `? @a`Pe8`0 @  #  $` &j <p B 8t < @ C   c@''?А''c@'* @@ '@  : %  b"=  @>l'Ȑ''Ԑ '> "'̐" '*`" *  * l'*` @Ȱx  ` ̰`?> "Ȑ" '*`" *  * ' >  l''ܐ''`?l'* @@؁㿘 @ " !  x -  | .C@ & | 㿘 `  | "@      @  ufs_bmaparray: invalid argumentsufs_bmaparry: indirect block not in cache``|`  >*` >*jא"p`'@$@`y@?"Ѐ "̐@`,'̑.` $* &`" `` 4 @6 .`( ` ` '@& Đ0 '`*  r />¤`G h d   $ $X  0"2$`2$>*jd",@$ T 0 $ 0'' \`* @@>!l ,`", H̓*$ `"" `"  @: @6  H.`(@ ?  @  '@ `@@ & H ̶ ? '̀ "$D$,@`&?& 㿘 !& ` ` ?  `";  @e@`&@%@ ""@& "&& `   `@dF@_x@c&$$  @dג`"@2& 㿘>!h>  R~> "a|> ؄ > |(2  @22㿘> "ؒ @ > !|*` 2  @2 2  "& X< >   8 > ufs_ihashins: already locked㿘 >  > "ؒ@ @|*`  " && "   ">>,iN !l "? 0& 4  &     "" 㿘>a  x"affs_inactive: pushing activeffs_inactive: locked inodeh > P   |T  >,!Κ`h 2 >!| ̓x b 'b ' * @ @耢 ">>,h!!l "? 0$`4`T`j `,$`   2(`>c@''̘  ?'ؐ?'c@' * @@Ȱ`h$``>`4`h!$`c'''c' * @@`!#>l''̐''> "'ؐ" '*`" *  * l' *` @>a'a' * @@T  `h  ufs_reclaim: pushing active㿘> P "  |V  >- 8 |5 ˝$  mangled entryi_size too small('  ' ''' Ԩ?<'|`h  '< >a'' @''a'* @@ఒ)6x  &? #>a'a' * @@Ғ -*  %>a\'a\' * @@ʺ   2>  >a'a' * @@ >@Ұ >  >a'a' * @@>a\'a\' * @@ఒ|  '̴  2  "  ?'! $?'`D  : `p  2 `D`t(`D $`H, "$`H :>”''?''* @@ఒ> 0e $`P  `H@ " > a`  "` "`H `paB @[u'ě2`* @ *`  `H`'`܀ "`Ho`H>”: '?'''* @@ఒ" `܀2 H?  H   >! @3 `>-`H@ ""@`H  S$`H`"' *  2   ?"@`$̀@` `H22?@ `H̀@2 `H " "`H 2`H@_   2`H  $  Y $`L $`P` $`H '` `H&j`ܺ `D\$`H  2`   2X "TT`j O>a'' ''a'* @@ఒq``p "aB @Z2`* @ *` $`H`H$`< $`H! $`<%$`<$`<, >`$`@a$`( %>a'a'* @@6?@( 2 > a` "`   ?@`p    `t >-`H@     `<`p$` `H >$`D2N I>a'' ''a'* @@ఒ`H!$`<"$`<``L 2ې    ذ`h"`"`؀@ | ؀ ɐ  ؀4 ?: 7>a'' ''a'* @@ఒ``L 2   ذ| (%s >a'a'* @@g 4>a'a'* @@`L  ذ >a\'a\'* @@0F6 3>a\'a\'* @@ఒ(L00``L 28   ذ > 2 >a'a'* @@ @Ҕ %s: bad dir ino %d at offset %d: %s bad dir㿘>0"H ` e h  >0d"pFirst bad Second bad 㿘` `""  >0 ?  $@>0"  @  @ J   `@ @ J    >0"e direnter: missing name㾐(2 >0d#'/v`  $/ h2 / @ufs_direnter2: newblkufs_direnter2: frag sizeufs_direnter2: compact1ufs_direnter2: compact20``|  ? <`C  H >1db 8:?ؐ"6`''''А ''''>bX''' 'bX'`* @@`a@` a>1d; P  p "aB @XR2`* @ *`  = p %  H :  p8 H2  H t H < : = p H>”␒: ''?'Ȓ'`* @@w ``  ?  < "@@ @4`@   "   <&@@  ``@\ `  : 6`>1cʐ p66`>1cŐ 4`@>Ð''`\`* @@  !$%  @  :  p 8  @ t  @>”@: ''? ''@'`* @@x`@ |`H>”␒: ''?'' * @@؀ U >"@ ?*``<2 `H`H>”␒: ''?'' * @@؀ 5>"?`\#"  :>”''?'' * @@؀ `P 2>Ð''`\`* @@`a&`x H>” : ''?'' * @@؀ `"@   >`h2 *`''`\`* @@ a$ ` p  2D (A     #\ #`#d#h#l 2/ ܀ 2+   "'  `4 M  .2 `"  M .2 "   @ D4ʐ Ő  checkpath: .. not a directory ``` @'>  `: 486 4'#\ #`#d#h#l ܔ  ڟ $ 2! ?  2  @߀@ g   ܰ 8 ѐ   2>3cK ܀ L 㿐     &@ -㿐!B`@2 !  ` &|`h ``@"& & F0 '4'@㿘  >`(*    @ 1 㿘  >@`(`*     @ !  |`!"``D?2"`" 8E$ `|̄ ` `? P!|` "`> "`x`> `("`@:`(`> "``"` ufs_access: not locked㿐  >`|b 'b '`* @@  !>4 0aq  ̐ @" h   h  ܗ, Ȧ2 |`  "`> "`x`> `("`@:`(`> "``"``"`"`h2`j2`"`" `"D`p:`x"$`|"(`",`"0`"4`"8`"@`"<8(2@$" `Б* : :H8"`( :Px     |T ?2Ӱ  ?2ϰ  ?2˰  ?2ǰ  D?2ð  H2   Ԁ   @$`@ ? @ $` @?# @ $`` $` @ @ ` @   ?  @r ?28 ?" $8 >d  c@''?''c@'* @@ذS $?| ,?"A `؀@> " $ X =>a''ܐ ''a'* @@ذ- $?" ,` $` ,?>`!$`l''ܐ $' ,' l'* @@ذ  ?#@ @㿘 | ؀@ >p ", " h 8 b"   O >H 2 hd" h < @o@ 4 h $  "   h"2 @=+ 㿘 | ؀"  ؀@@   ܀> 2  ܐ># " "  & ܀@& ؀@  & @   h 76 h"   "  h ;6 h     㿘 8  ! | ̐ @2 `| ̒` "` !!P € @ j ?4 j`$ @£0‚€ufs_link: no nameh  $ >6_^ 8 2`>`'''`ؐ`*`  @ >`'''`ؐ`*`  @>a\'a\'* @@ఒ >`''`'`* @j| j#>`'''`ؐ`*` @ L@  @>`'''`ؐ`*` @ 9@4 j > $ l'Ȑ''Ԑ '> "'̐" '*`" *  * l'*` @Ȱ `!aP"  j ?4 j`$ 6 @ >a'a'* @ȟ@ːufs_whiteout: missing nameufs_whiteout: old format filesystem㾐   ` ```"`@ "+`<   $  > - (2`>6^#  4'>6^}# /  N /    4 >6^e#*@& `!!P@€ $"  6x   ;& ufs_rename: no nameufs_rename: lost from startdirufs_rename: lost to startdirrename: EXDEVrename: same filerename: linked directoryrename: lost dir entryrename: mangled dir'|        |' 'Ā$ $2`>7^!8@  0@",>`''`'* @@ >>`''`'`* @@Ā  | ̒` ϰ | ̒` >9>8 > `''`'* @@ϐ ? %>7]!P %>d'''d'`* @@a\'a\'* @@Ȱ>|̐ @`|  @"h>a''a*` @ d><  Y#> a  ''''a'* @@   ''''a'* @@>a'Đa'*` @ ,> J .  >@2> @" @>a'Đa'*` @  >$ ( | |j>Đ 4j`$l''' '> "'" 'ؑ*`" *  * l' *` @>a'a'* @@` > ? '''`* @@>a'a'* @@ @2) ' }`" !!P`u @2>7\!pg | |`2Q` @>7\n!  j#@E `4 j>   $ l''''l'* @@/`!aP! > j ?4 j`$ l'''' l'* @@ ` @>7@>7\!`@2 h>7\!""`h  `" `h ؀@"`h`؀  `h<  `  !!P   Ұ BT`j ΀̰ % ư   !aP `  j ?4 j`$ ސ`j?4`j?4`j*  >>7[! @   ?? ''@'`* @@``$` ? %>7[!PĔĀ  | `||>7[! @W >7[!> <   j  4 j`$ Ą #\#`   #d#hӚ#l 2%`  ?  " ' >7Y`  Ą #\#`   #d#hw#l}`!!P@€2 ``j`?4`j`$`` ?$` `;`|6|$`.`, > ?$a\'a\'* @@Ȁ  j4j`$0-ufs_mkdir: no nameufs_mkdir: blksize@` `$`>:Z"|`j#@  !>''''Ē'* @@2 | % ` % ܐ!% 5 h "8 5 j@#> ̐ % ̦cl'''>  "''ؐ" '*`" *  * cl'*` @`j` 5`j`%`''''cl'* @@N  >!>ʒ!@'`'`'` '`'`' '` 'Ԙ  #\ #`  #d#h#lҎ 2`j! !4 >:ZN" "= p % !aP"``j`?5`j`%` " ` 5 jԒ`@% "@2M 7x   |`| I)U Tj J B  !!P   2 < B @7  @"`0`!!P@€'` j 4 j`!$ j>?4j   c@''? ''c@' * @@ذ `֐Ԑ㿀     (@) @Qz`@  |  <` < p$   #\ #`  #d#h  #lufs_readdir: lost in space㿀  !2b $"` > ,'''','*` @#@27 `"3   "><YS @??"@"  @ D#@`??"42 8"@<$  |p @  @2 t @8& &㿀  | t @ 2  Ѐ 2 A$  > b,''''b,' * @@㿘  $1   locking against myselflockholder (%d) != 0locking by process 0 㿘 >!l&G !" x 2 |/   "` $ `0 4@2$ 8><X"ؐ?$ 8 4`$ 8><X"` ?`0 `><Y#`?`0$ 4   $ ufs_unlock: unlocked inodeufs_unlock NOT LOCKEDunlocker (%d) != lock holder (%d)㿘 |>` !l>= ( >=Xk H " 04 ? >!c"! 0>=4XU `"4 b" }"G   |@ ufs_strategy: spec㿀` \8? |>=X0!h T P2# T>a'''' T'a'* @@ఒ"  T$ 4 0h" 0l?2 T H@P <$ @ T? < $ D>#* @@ ɐ tag VT_UFS, ino %d, on dev %d, %d%s (LOCKED) owner pid %d waiting pid %d 㿘  |  >= Xې"  >=">=">="Xϐ  4`>=Xɐ" 8`">=>=X">=X# 㿘 `|`">b,> \*` @㿘 `|a">bX> \*` @㿘 R `$ | 2!>!"> "> ""x!> "("`B :( " >> "" >">!|> b\* @@`)>>(<Th| `   `    ` $  ` "  `    㿐     | p #\ϐ 0㿐 |`h< >c2  `6$ 8>>"<*`@``$ `R"!`>a'a' * @@ |& |> b\$ |$ a$`}` -` 2`( $`(> #<`(#  *` * " *  * " * <`(&ufs_makeinode: no namep$`|>>V#`'<@& @> ''''ܒ'`* @@а. m|$   $ 4 h @ 2` !$ >#@"8  hd4 j 4 2  4͒ " h ;4 h@> ̐ $ ̐l'А''>  "''" 'ԑ*`" *  * l'*` @а2`!aP2@.` J  &.X B 4 j`$ ;>  >   dev_pager_alloc calleddev_pager_setup: bad object㿘24`>?V ! * @*`> r#@` m>#Ȁh>#d> ! a @ > a* 2  1> ?P > !@-];  $,f >  %,` 2& - $4 >ʐ!&  & & & &&@ &@" @"Y @-2  -͒ %-ʒ $> & &  " $ @"F  >?U" 㿘`"  "`> "! "@  `"`$  @"2- %- $dev_pager_getpage: cannot handle multiple pagesdev_pager_getpage: no map functiondev_pager_getpage: map function returns error㿘" >@U@ @*` * > r`c`   , >#Ȁ>@>#2 >@U$  @+?>@U! @;"  $   " @'"`@&ה?`"# @` 6`"?#ߐ @6`"D9>  @ 8& dev_pager_putpage called㿘 >@ T" 㿘> !  %!>  +g  @OB (> > &$& $`""$ (> ! `!  "` " "@#6 "& $ 6 dev_pager_putfake: bad page㿘 "!2&>@T#> !$& !$"@"!$㿘@L & & & & ?& & " thrd_sleep㿘>!l  耢@2%   X& " `$ `$    " `        &  >A@ `  >ʐ  & +`" `$ `$  2  " `       "   &  >A@ S`  >  >ʁ㿘  ? &   ?&   "& &  & CB㿘>!l  耢@"4 * " `$ `$  2  " `       "   & >A @ `  >  >  & 㿘 >al?$  `耢 2    4$     - $ B(  `#$ >"  ? $   `? `       $ >A @ `  >ʰ 㿘   `& &   "& &  & B>l`耠2`` "`  `` "` >l`耠" ``  `` "`㿘>!l  耢@2     $  $     $ ? $  1>A$  @ > `  2$  lock_set_recursive: don't have write lock㿘  2>>BR"H!l & lock_clear_recursive: wrong thread㿘>!l  耢@" >BRݐ" ?& >>ʄ( >  >  @">  >   > >  "?Ē` "" ᄀ@ >  ؀> } >," ؀8 @&" > }` > >,"` > > ؇2 &* ` 0 4 > }> 8 ("" ( # x *`(`` *`  swap_pager_alloc: bad object㿘> "@) @  d>CRX   $`?( W  %(ޔ%> > !`8`8@ ` * @($@ @$@6` $` @L?$`*  %(   $` *I %*F $) `@J!*`$`4` 4`&> b& b"@"b@ @ & 4`&& & >ʐ"(& &  & & swpgdealloc㿘 ` `"  "`> "" "@` ?4`H /* %T`  !>C `"4`? T` 2H 0@' ` ` '> " V` `` )͒ %)ʒ %)ǒ $swap_pager_getpage: page is already faulting㿘 6 >C `"  Qc2`" @s  7# `" 2`"㿘 @̐   @?@T 㿘  *` @KĒ  @*`   @K> a2    >  swap_pager_cluster: bad offset㿘  > } x*` 4@J&@ >DQ!@ 8 &&swpgiobufswpgio㿐@  `* `,`@Kp B 6P @Jǣ*  1> !5:@`"<  @G > " 20 H /* % @5H 0  > "U  $ 6@' "  H /* %> #T  > #0' 3>D b0 0 $ 0>s $ > cT`$"cTH 0' &`0> "&`,#> &`H5 a@ &`Ta&`\`8 !> `< &`D @K~`0@,&`<&`` @Kva&`d`4 "`4H /* %   6 H 0?,> !85 , @%, @& $  23>> "`""`""@ "" """">F!`0&`X`@&`0H /* %"> a"a ""aH 0>''`\`* @@  P H /* %`0"  !>D "@=– `0"?ο ?6 ?ο`0"2 `0  @&`0> cTcT&`$"cT`\ ?  @  * $ > > `"`$l`€5`"H 0@&%s: clean of page %lx failed swap_pager_clean㿘/> ?#H /* %` ` " @@``"`%`@"@`2`H 0 `P ``0 ?#߀> !`,@&ɐ@`  >E#>E $P^c "  4 " " $> l`€4 " "   4 " @4 ">~`׀?4*    @?*@4>j`@&l`$`$@> "$`""@""ā㿘H /* %> !   "2  ?`" 0(`"" `?2``  ?2`>1?ο 0" @& 0> cTcT& $"cT \ ?Ő  @" >   * $ >> >!ȑH 0㿘 @:W      *` @I. @G @H> a2@I6@Hx2  *?@ ,`"@"% ` "`@2@?* @@g*@@ @`&@> " S`&``` @․@ހ "% 㿘   A *` @H֒  7@Ijޝ> ` @Ic?+@H#> !@H4@H?*@ , 2* ? ـ" ?2`    2  vm_object_paging_beginthrd_sleepvm_fault: active, inactive or !busy after main loopvm_fault: active or inactive before copy object handlingvm_fault: active or inactive before retrying lookupvm_fault: active or inactive before pmap_enterX'D'̺> c` "`#\#`#dD̔@찒0v@ @`%@?`"a`$ > cl@4`"`"   " 7"@ >GM"2 ' #?#?#7> 㤐@ܒ"z (`" > 4`"@`? ?4 *     4 <"  4" 4"<@ ?`?2`*   ` 2`< D@H %H@V "`"@`"``"`> "#`@"@?`"# @4`"L?"`"L`" "`"@`"``"`> ""`@"@?`"# @4`"`?"``" 4`"   䀢 24 (@2. ( ?4 *     4 <)"  4" 4"<@`?2`*  耦` 2`ސ p 䀢 lD@) 8>!l`%8 t "t (@#7    C`"  4`" 4`";@ ?4 *     4 ;А"  4" 4";Ð@e`?2`*   ` 2`; D@@r& `"  4`" 4`";@> " 4 0 "@  ?4 *  2   4 ;@ Y``  "``?`"! @ 4`" " ?4 *  2   4 ;`  7"@>GL"4 `"  ">GL "8Y`P@ ,?"a @4"> c$`$€ ?`"# @` 4`"?#ߐ @4`";* ?4 *     @?*@4 ;> c`$ "`$ ?4 *     @?*@4 ;@   7"@>GK"4 `" ?'`4`"`" ">GK"p $ 3``" ?'*`4`$" @@ X " S 6 "@`?`"?# @` 4`"?#ߐ @4`":@^?$ ?4 *     @?*@4 :$"?# @` 4"?#ߐ @4":@6?2*    @?*@2: D@0  @̒2Z(`"?# @` 4`"?#ߐ @4`":d@ ?$ ?4 *     @?*@4 :P!?"# @` 4"?#ߐ @4":@@?2*    @?*@2 :-D@T@> :#!>  > c4 >G@ (耢 7D@= ,(@!o@ 0@   "?# @` 6 "?#ߐ @6 "9@@   "?# @` 6 "?#ߐ @6 "9@ 2$@Ē? "! @6 "> c$$€ ? "c @q6 "? "# @` 6 "?#ߐ @6 "9?$?`"# @4`"`" >GJo"#\#`#dD̔@9ذL?`"# @` 4`"?#ߐ @4`"9@5 ?4 *     @?*@4 9$"?# @` 4"?#ߐ @4"9n@?2*    @?*@29Z D@@0@ 쀢@N`"?# @` 4`"?#ߐ @4`"9;@ ?4 *     @?*@4 9*$"?# @` 4"?#ߐ @4"9@?2*    @?*@29 D@,@Ԓ `" ' '耊 ?`"# @4`"`" "`$>GI"D> ~a`@̀  䀢 @ϐ `"@ `"@t`"?# @` 4`"?#ߐ @4`"8 ?4 *     @?*@4 8$"?# @` 4"?#ߐ @4"8@B?2*    @?*@28 D@ @M 㿘@ @o %>  _ "   @0  unwire: page not in pmap㿘@"%> > b€2>LI !@! @> a" *` * @u@>  @@ > @$ vm_fault_copy_wired: page missing㿘  @"@& &?,)> '> @f 8 !Ȑ> c4 >G@(@@ >LH"@ݒ> ~!`$@ @?"# @` 6"?#ߐ @6"7ݐ>    Ǣ@㿘  > !> 8  @ @ #@  >b\` >   > x ܑ* @* `?㿘  >!l> ! 8   @   `?㿘>!l> ! 8   @C 㿘>!l> ! 8   @4 vm_fork: no more kernel virtual memory㿘@ # &` !> #@2>MH!@ #@ &`cP&`b &`$ $!0@@ c  H @(J  :`0  88  @:`  8(>  > *@   : P㿘>   #@ߔ@ H /* .N -  @ ( & (H 0& p> c`( "`(schedulerthrd_sleep㿘 > "  K - 2  ( 2  p tK Ґ *`" $    2K -@ > > " >MX5s ښ > !2 @ Κ Ho o> 6!Ȑ> c4 >M@hH o@ 㿘    > " / "-> (  2$  2  L -   p( &  4  tx@ @@%(    2 (> > !> a* 2   " @㿘>   #@@  @EH /* . ( ?& (N -  @SH 0& p> c`, "`,>l thrd_block㿘Ho o>!l 耢 >N 4 H 0㿘Ho o>!l "  4 H 0 %:㿘'L'P'T>"` 'X7>N〴 >N7>N㈴>N#L㿐@A@^@2@@@@@D㿐>  , a'@   @.@  thrd_sleep㿐> ! @ .@    @8& 3> ;<  b@L@ b@y+#?#@Ӓ> 5v!>  > c4 >O\@G`" 6`">  * @@@ 㿘> !@8  @ @ kmem_suballoc: bad status return of %d. kmem_suballockmem_suballoc: cannot create submapkmem_suballoc: unable to change range to submap㿘 >  , &@ . @ "@>OFڐ"@>OE͐"p&@ ^@@t2@>OE"@s >OE"kern_malloc_alloc: map != {kmem,mb}_mapkmem_malloc: entry not found or misaligned㿐> !̀ > }""> >OE#> !  ,@ *@  '   @^& 9> ! ,#> }`d@t" `d@  P @a@]􀦀)#> d@2?" ` d& @@1` @@ * 0?"# @2"`  d@  >O @>O4 " >OE"#ȴ "4%> }#> ~d@p $ a` @@>   d @ }㿐> ! @.@}   @&  0 ," ΐ  Ȑ  @  㿘 T>  @a& 8  @ @| 4㿘> }">@i  7> "#   > " @ܘ㿘> !@ > "#ؐ"(`"(> > !"c  8@?:$ ` 8$ 㿘   @< Ȑ@D @E& & 㿘 ? &    , 0@& @  vm_map_create: out of maps㿘> !̀  > c؀ 2 (>QDD!"cؐ  Ҕ @&㿘 $& $& (& \& ` & h& d& ,& 0& |& x& p&   vm_map_entry_create: out of map entries㿘 |  8   > c  "c >QD!㿘 |  0> c &`"c   h" h㿘  h? & h`   , 0@& @ 㿐`,*} `0 u @t o  `$@`` e`6`$3 /`d +  '  # 0  (  ,  4     ' @:&    ``'  $``/$ e"" """"" "$`d  "0 "(","4`\ $`\" ""`" ``" @`x$`` @:$`x p$"(@  "  ( ( @  " "p2  ""p㿐 ,@ *  0@@   x $2    0Ĕ   0 $@ : @ " & p` :& p  & 㿘 n ` $  "Ð   㿘@"`"`"` " `"`"`"`"` " `$"$`("(`,",`0"0`4"4" ``&@&`&` \ & \@"@ ""`"` ` 0@ 㿘q@"`"`"` " `"`"`"`"` " `$"$`("(`,",`0"0`4"4&` "`& " \ & \"`""`"` ` _0@ J㿐Ȑ    , @ &   08@8  `@ ^ '` `` ` `  `  "`"`"`  㿐~   , @ &   08@8 `@  Ð   ' $@"`:` 2 `,`@ 2` $@n> !`i` ) `(&`, &`(&`(`( "R`` "@` `` "```J` `` $`"@ & `:"``  ` " ` ` " `(  @ ` $@'`J `` `   @` $@2`4  㿐4A <    , @ &   08@8   @ X $  $  $ 0 2   㿐 섐   , @ &   08@8 А G @ $  4  @:    }  y  2 Ő  $  * 4? $ 4   2  0 $"X :S 4 2   2  $ "   (    @ "  $ $    @ K"@$ $  @  4  @$ 4     $   4?$ 4 2 4 M  2 > }"䀢@ &  @쾐 @ 4? 2   "  4 ?$ 4  $2 > }"䀢@또   & *      㿐  ,@* 08@8   ː f ǐ b `: $` ` (`` "  @"` 뭰 0H`*``=`&@` @ ` "` 뮐^ "*$ 낤 `(``(  @ ;  @ @`` Dz@f  㿘`` `&`4㿘`4  \?& \`@"@@`"`` ` `"@ " & `` ` n`@ X`Q㿐    @n& p x  ; $7& x8     4  > "@> } d@2  d $@@  2  $@ @ @ $2  㿘 s  , @ &   08@8㿐 @  $@" `@*  `( 2 ` @ ` vm_map_copy_entry: copying over permanent data! 㿐 p l " 4  24>V?#4 `d "@@'  4 " @ h@ 4 C$ 2 d  h `?  >  (!   " @ )@  #@ @ _  &$  &$&$& & @L@ @e" 0Wp'\'쀦 @  @  顐`` `&`   & 镐  ``& ` &``d !' d '   `    '   '``@~@܀:`d` 4` -` ``" `  "` ``" `  ` 2 ` ` 2 ` A` ```" ```ꇐ`` ``&&  N#\`g #\& @p @2` k`` ` ``d  d @͐|  d   @@͔܀ޔ@ `@" vm_map_fork: encountered a submapvm_map_fork: copy in share_map region failed 㿐膐  , 0  |z&  Ȓє  $ (@Ƥ` "`0>X<! s4` 2`` 5 ``  $ d@"`" `" ` " `" `" `" `" ` " `$" $`(" (`," ,`0" 0" 4 \ $`$ \" $`" "` "@ $``$`$`@$`$ `$ ` $ `$ `$ `$ `$ ` $ `$$ $`($ (`,$ ,`0 $ 0$ 4\$ $\$$ $ "` "` ` @" G`a@$`$ `$ ` $ `$ `$ `$ `$ ` $ `$$ $`($ (`,$ ,`0$ 0$ 4$ $ \$ $\$$ $ "  "` `  ` #\ "  >X=E" `` $@2?` ` $`㿐`%``p`$ & @  @*  Ȕ 5&    &0 (" 4`f @ % ( `?   &@  2Ð`B  $      @V" $ $I  ?  2  皐`0  @"@$ $ /  %@ '@ 'h `?\#d #㿘` `u s 㿐   & 6 ` $[ W d S O K  G  C0 0@>( (@9, ,@44 4@/  @*$ $@% @ " @@  x "& x \& p?& \`@"@`"` " @*`# 㿘>@L%s map 0x%lx: pmap=0x%lx,ref=%d,nentries=%d,version=%d TaskSharemap entry 0x%lx: start=0x%lx, end=0x%lx, donate_copynonecopyshareprot=%x/%x/%s, wired, share=0x%lx, offset=0x%lx object=0x%lx, offset=0x%lx, copy (%s)neededdone 㿐 d >Z" >Z"X>Z"` h \#\ #``>>"` }` $ (  r"`>ʨ"h  >Z#>Z bh  d "  0 (*  ,>Zƀ" 4 >Zƀ"     >Z ƀ"@ b`` " ` @"7 b` Q$b`,b`>Z ƀ"  >Z $ ">Z>Z#(#0ƀ>Zƀ#8@" ` 2` @"  b` @ ]$b`b`?$b` >b`?"b`㿘> "@0  2>> @ >"x> 2  |: @|)[?㿘> " J- &  2  Ѐ 8t 82J->ʪ"|  @5("@@5*` 4 & `=#`'(   >    - -("  @ 0Ę %㿘@1 0> !X ?# 22> "k>\ >"x("2aJ- 7*  q| p p p4 p4( "t Ѐ 8t  6 : t  6 :t  6 t:8 ( "  6 6 J- "(  ( $  2 2`" ` 2` @  2 "  6 2(> !X=> !> !   2 @&  &  "    2 @&  &  $  $ 2 @&  & $ "   ( 2 @&  & (2>  & , - -㿈`` `@> ! `' $@@ 8 `@  "@  '@>@@ Z     *';?+ @`2V` B 2? `  8  28  8 2 ` <@c `  `#  "  ` 2 `  2     #\#`@&㿐@> !` @ $@ * @  )  a?`  "@  P `" ``      㿘@> !` $   >@  H '    ( 㿘@> !`` @ #@    @       㿘@> !` # `  @       - -㿘@> ! `$@@ * >  !>  6@ >"@ @(  # Z`  㿘@> ! `$@@ * :   K`  h\ `# > !@ 2 `2@@  *  &@   @Ք@?  8  <  @ F   @@T@ #\@(Y@ GȀ 8 `#\@@  #\@7@ ~ @z ⏐   & @  @  @ ( 0 @ ΐ  @q @  '#\ @P`@ԐY ` 4`@ #\?`# @4`' @#\#`#d@i@@ (    @ @ @ @  `  @0@@@ܔ             㿘> "#ؐ#" > "!X!X" > "!Ȓ > """ `` > > }`""@> }!> ~"p" d> ,@+@1I @㿘 L   @"@"` "`"` "` 2`2`"`$"`("`,"`0"`4"`@"`> \"` \> ` \> "> d2  d  " 㿘'D 9 1> #> D`? "` .`@ * D &@9DD  D` "`8#"`<#"D` 8&#ܒ`@^$`@x,@`(D 0Ð@ D 'Dvospgw㿘   `6 # !>_   #x6    0 @  $"$ $  2    @= ` > #@n  \ $ \` ( " @  `"  "` > "!\  > "Ȓ  "ȁvm_object_paging_begin%s: pager_put error vm_object_page_clean㿘      ( 2 @ ( ?   @ ,  @  ( 2 °   !>_#    #xR6    > #?#@"  " * :  "!2   > `X@ $ ? "# @4 "  " 4>  "  `"  "`> "" "@? "# @4 "` ?$` `"  "`> "# "@? "# @4 "`??$`> c$ $€  " 2K  4 "  7"@2>`4 6  (@ =  >` >`5` "  4 " ?6 *     @ ?*@6 #ѐ 2 ""  "@n "@ "   N4 "?#ߐ @4 "#G  \@㿘   "  @2 "vm_object_deactivate: I'm sooo confused.㿘> >@'> )>a  @ (4A @ В b@؁㿘  !>  @8  :  #$ $€  " 6 "  2 㿘  !>  @8  : #$ $€   2 vm_object_copy: copy/shadow inconsistency㿘 2 (&e' "     `& @`@8 `:``" 2`"``2`&' E'@@ $``  `( ` "`&0'  $``0>a`4 >a3"` @%@!&4& $` `8 `:``" 2`"``2`&&@''@vm_object_shadow: attempt to shadow null objectvm_object_shadow: no object for shadowing㿘 >b3l @:2>b3d p@ޒ ?$ @&4&@&" (" ,㿘@-& * > b `!> #> ` (2@  2  8` <"`<" < 8"@?"  & `2` 㿘  @,   !, >    "  `6 " "  "@$ 㿘@,ے * > b   (2`"`"  ! "02vm_object_cache_clear: I'm sooo confused.㿘> #؀ %>b (2ΐ@ ] c؀ 㿘`(  @ې @ @$`(vm_object_overlay: busy or fake page in backing_objectthrd_sleepvm_object_overlay: pager returned %dvm_object_overlay: backing_object->pager remainsvm_object_overlay: we collapsed a copy-object!vm_object_overlay: backing_object still referenced㿐 0 4 ``( `4`  `@ :`` "`% !>_` `#xr4`` ` " @ D'%> ?#  """@>b2-#@ @} 2 `( ( ""@ " (`(   M@ @@    A@ `" 2`"@@ ' ( `( " & (`,& ,$`(> !&!>  > c4 >b `  > #?#?#`(@` v$@  f ( "@a ]@R'`" 2`"` 7"@2>`1 4`8 $8 `(@ `?4`*   ` @ ?*@4` ϐ   `"  2`" 2`"  @bV >c 1w@@$@'?"! @ @` 2" 2"  `!>    `(``( "`0@ 2`(@Z`($`(`( "`0>c1E (@ 4`4  0` & 4`$ "`>c15 `` >>c1. b  "b`?# @4`㿘 0 B 4`""(` " :`@d " ( """ ` ( "E @ "@ ``2`( ( 0 $@ @C " ( "">  ( "$ @ >  >  (@ @@ ݀@0@H 44 & 4$"$$>b  "b㿘@ vm_object_collapse: collapsing unreferenced object㿘`2&@>" 8 6 0 2  - 0 "  $ %   $ >d0# `]`    0 &@u`" 0㿘  #>  @  :  $c$€ @7 2 㿘`2" "   4  ( 2  0 2  $   @Ȕ @8&  㿘>@?Object 0x%p: size=0x%lx, res=%d, ref=%d, pager=0x%p+0x%lx, shadow=(0x%p)+0x%lx shadowers=(%s0x%p, ) cache: next=0x%p, prev=0x%p memory:= ...,(off=0x%lx,page=0x%lx)㿘 [ >e a & ( , 0>e 4ƀ" >eƀ"H>e @  "X%>e#>e`ƀ D bh>eƀ"p 8>e <ƀ"x`1>b`   !"b`  >eb 2 >e>eƀ">eb ƀ" >e $ƀ"    >eƀ">b`?"b` 0 !`  D" H H H H D `"" 0``@"`" D`@ D H"`@`@" H" 0vm_set_page_size: page size not a power of two㿘> ` ` "` ` >  "a>f/D >  "! a "a* a㿘> ~""А"" > """" > "##" !> > !b *@@C$!> "a@@' !!>" > @w @  $"b*  "b!>"> ?"`@&* > "b""  2"#> }c!> @a!c> ! 8 !$cԐ $!&!&@pmap_steal_memory㿐!> }%> #԰ ? #@-#> ! 8 $#Ԑ $#> !$#Ԑ * '>f%> ~@8 > }."` @ >   pmap_startup: can't get first pagepmap_startup: bad i=0x%x㿐@  >  @)@( (!> $!* @*`%> !@ $7o"  (@&}`" $> !@  (@ 2>f.g#@ > "a> ,`@ *` "2 "" 2 @9" $@Ґ > }@> a> a" @ *> >g .C#&> !&@vm_page_insert: already inserted㿘 " @"& >g.*!& > > !> b`6@ * @H /* '& `& `" "`H 0 & `& `" &` " @6 "`  &` vm_page_remove: page is faulting㿘 "@`@>g-"<>  !> 2 > b` ⨑* @H /* '   "  "  "@H 0  `"  "` "`  "@ ` ?"` ? "# @6 " > > "2> `(H(@ 2 2 H 2H 㿘 =㿘H /* '> ~"И  "БH 0 4 ` "`" "@> c`x?"`xH 0 "`6 " 6 & 6 >   @ > @  @> `!ȁ㿘, "  `"  "`> "" "@? "# @6 "> c`?"` " " "`"  "`> "# "@? "# @6 "> c`?"` "!H /* '&> ~> & Ԓc"`x"Ԑ "`xH 0  2<  ""   >   >  ? "2 " "> "   >   >  ? "2 "> | | 2 ` 2` (> "@"> "`" "" `"2`"| |㿘 "  `"  "`> "" "@? "# @6 "> c`?"`)&> c& c""c>  "c 6 "` "`> `@ $> `X@ $ ? "# @6 " "`?# @`6 "vm_page_activate: already active㿘 " " `"  "`> "# "@? "# @6 "> c`?"`  " "&>i+!> b& b""b>  "c 6 "` "`㿘?c "> !(  $6 " 㿘?`"# @> #6`"`$€ $㿘> #`P $`PH /* '`xH 0 `p> G@> # N `xH /* '>  H 0 9> a $ $@ " "q L %$Ԁ  > c$ $€ a X $ " < `$@4` `"  > # >  ( ( "@`" ` %>  `vm_object_paging_beginpageout㿘> c$ $€  " 6 "` 7"@2>j+*!X6`> e `( ? ` @    @   5>j"X, @ p p > c`D "`D? "# @6 "? "c $ > cl@6 "> > !>P!>jp > > c`L "`L> `@ $ ? "# @ @` 6 "?#ߐ 6 "`?6`*    `@?*@6`thrd_sleep㿘H / )>     @% % ?!>"@% $"!>"@%$"%   8% !>    ` @$* $  ` `$ !>" 2`@$ $"> !> c4>j 㔖   @$Ր  p $ `$  x p@   @@>  > no default pager㿘> > }> bdl#U > "`>>b* >ʤ  " * *>" >k*!P㿘?>ʐ". @>"`2` vm_pager_deallocate: null pager㿘 2 >k)"x @vm_pager_remove: null pager㿘>k)ې" vm_pager_next: null pager㿘2 >k)ǐ#` €vm_pager_count: null pager㿘 2 >k)#h $@㿘2  @ `0   vm_pager_put_pages: null pager㿘 >l)  㿘'HH ɖ㿘'HH vm_pager_has_page: null pager㿘2 >l)Z `€㿘>>b*  `  `    * *vm_pager_cluster: null pager㿘 >l)&! vm_pager_nullcluster called㿘>l)!pager_map㿐>  @$!>  ТԆ` `%>  "` В ؖ   ؐ 2  $,Ґ  >l( Ö  e  `  5>  вԻ %> ~#> В ` $@ ` 㿘> ` @#ʐ3> `Р@N`0 `В ]" >  , "```ԃ vm_pager_atop㿘>  > b€ >m( @9> a> " * .   2  㿘 ` "   6 ?# @6 f swapinitswapvpWARNING: no swap space found WARNING: primary swap device not configured swfree errno %d swapinit swfree 0㿘> }""4> }""> y##> !> ""4 > }b` ""4#b ?> } > }'> }4  >m(! #> }b> }` ?@@#$b!> }"@#4> y$"`  "> }>m'!> }" >m(!> @2 ``>m(!8 > "> >m(!h>m'Ӑ!"#T> x ؔ ? 6 !P#! x$$ @ $l$h$ $l$h!P#!$$$swstrategy㿐 }" ) > }"4> } @ @;@@4@"& T ,> y#@  2 @  & 4 0h" 0xF䀢? & D  8 >m'k#  0@2 \ \`" `4@? "`4 4 "@`4 `4 "`4 \ " , >& \'' \`* @@㿘>m#>p !ɚ㿘>m#>p  !P p E @'''@'2'ܰ:`8 "`<72 > r#| ` ` -( )$ %0 > y##   2 "@" @0:`  ?` swfreeswapswfree miniroot sizeswfree miniroot savePreserved %d blocks of miniroot leaving %d pages of swap 㿀.`> y#@ > !(> aP'' ''aP' * @@ " İ   3$  * "@*`> r @``@> }> !(> a|'' ''a|' * @@ # "> }@ b44$ 2 > !(> a|'' ''a|' * @@  ?r$ 6E> /> }+> ->$ @!I> }b4@!D> }b >n&*# 4  b0>`(> #Ĕ : * $ >n*(  b0>`( : * $  + Ĥ$> !(2( !$> >n%#0#>"%`0!> (@:@ *@ *% `0 (@:@ *@ ">n>n%ِ#H#`$ &ޕ:  sbrk: grow failed, return = %d sbrk: shrink failed, return = %d 㿐@> ! @ *@ '" ` :6 2 `$@:  3>`(*> a  * " '@ߖ ">>o#( 0`(  ԓ:@  6  @>o#H%  > 0`(  ԓ:@ " $ ԰ 㿘 䀦@:) > (>+ @ >  0@"2 " :   :` 0@ B @ 4  2؀@  ذ $؁ p  d y ((  $n ->  2d 2` " ( ( "( "T( "P=#I 8`䀠 >` (*@> !% *@8    ( * H?#' #\#`#d#h#l!   @ D #\#`#d#h#l @ D&$2㿘  " >  ,!*@"> !   +@ ᬚ㿘   > !@8  @ 喔  㿘\g > @*@&@  *@ > #``  "`:  ? ` "` ?` 4`#`> @4`> !d6 " "d@̐ $  @@e 0Z   '0 – > ((  >`)!l`< L  $   % > a''''a'`* @@    %  $) > !@ *  ~ ؐ$$$&> c,& c,""c,&  & & >ʐ"& & $`<h㿘   "" < "`"  "`> "#,  %"’ $㿘 @  㿘   @ 7> @`" 2`"@l $@`2@p > a\'a\'* @@ @ > a'a'* @@(    $@Ð>’''''ܐ'' * @@>’ ''*` @ 2 86 vnode_pager_cluster: bad offset㿘  @ @>r#!> !@  * 8&&㿘  8  <   @祖  @ :$ $ 㿐> #(`$'>%>`@   \'\' * @@@'' * @@`2`㿐 < & h> `'' *` $  @9 >a\'a\' * @@ vnode_pager_io: cannot handle multiple pagesP>!l>s" @  `,  n>u  a\'a\'* @@ @ > a'a'* @@Ȑ X >  @  "''Ԑ''ܒ ?'''耧 '`> b,'''' b,`> bX''''bX'* @@> a'a'* @@`蔦>      @ "@ I`  obiovmelvmes㿘>    `@ `?[%s at %s] addr %p vec 0x%x㿘  >s"& ">s>s "Ր">s 4"ѐ">   >s"Ɛ"  ϸ ϰ Ϡinterruptauxiocountereeprom unsupported could not find %s amongst obio devices namezs㽈>    4>s>s"#>u" @v>    >s>s"}#0}"z#"  >s@Ibp 2'" ''!4% 0!% 4@ >sccN&@ʒ2>s#"T!H@ " @'  '>s  N :+> r>t@`>scc@  @ >t@` 2`T %`T@&ђ '>s @̐㿘>  >s` >s>s!#0!#!> }#쀢  >u$ To $#@ݒ$>u"@ݔ@㿘>  >s` >s>s!̐#0!ɐ#!> }#쀢  >u$ TJ $#@$>u"`@ indirect devices not supported 㽈2  >  2 ` >  "><@2w >  ""  ` <@"l    >t!#b ?'` ''  `'ؐ @G '`  `'`  ?' '` '  >s@*b  >s@!bx  2'>s@bp 2' '''@ "' `@'>s& 㿘o 㿘g 㿘_ vme: spurious interruptvme: spurious interrupt 㿘>   >u">ʐ#h. @*`8 @ݐ@> }>u ߐ" #*@ "`" @   2vmeintr_establish: not supported on cpu-type %dvmeintr_establish: uninitialized vec vme_addirq㿘> `?>u#p2> }>u##. @ 2"@  2 & > x .`@  >u"   2  T  2>uq#@t >u"&& @Ĥ㿘> x!+ @? > (`2```" >"  >> 0%@> ,@ ? # ?#҃@@ " @ @2@ @ " @@  @㿘!>> x!.` 0> ~@ !`. > } "?@@  0?@㿘> }>`,"?@@⠔ audio|QEB;632*+,%#"""-+2LCBCA;;=43422$1*{*+#+,B.#%$+$#""A"#"3J!2,b2q"4R#z5& *c  # 3   > L!|"3"B2'"R:31,#"bQB;32*,%#"!  C3@DA1U BA` Br!" 㿘>   `@J `?: expected 1 interrupt, got %d pri %d, softpri %d intraudio: could not attach to audio pseudo-device driver 㿘4`>wL 09>w  E `2  N0  @%  N.`t&` .`v.`w.`x .`y@  > `"c>7@ڒa>y"&`4&`8 @S`4>wa5`>ː  >w! !* *  E** *  C*  * >̐  * 2@     @ D |  㿘@@ސ& @@@ `  #@@@ `  #@MU-Law@  >wx"`x2` *`  "`` `   ` `   ` `    `4 `& * y  y `   >v `vn `x`H `w( * 2`h(((0 ` 2`n>vn(2`l2`j>wn2`l( 2`j `y -*-H( i* ,*  c* *  0*  f*&* &0*  d*"* "0*  e*$* $0*  j* -* H   D2 "   !( ( " D" " " @ "   D2 " |  !( ( " D" |" " @ "    !( (" D   !( (" D   㿘>ʐc 0  `2 `2 @ 6 ` " `   " `  * v* w* x `2 `2 @ 6 w" v  " x *` *` *`  micvolumespeakerheadphonesmonitorInputsOutputs@j>yd( | 弄 "` "`?"` "`$>y-"` "` "`?"` "`$>y"` "` "`?"` "`$>y"`"`2`  *` "` "`?"`$"` >y("`("` "`<>y"`(2`, *`."` "`?"`$"` >y0"`02`*` "` "`?"`$"` >y8"`8"`  㿘  H /* %  @(`  |`"` H 0  @ H /* % ` `@ ` H 0  @ 0H 0 auxregauxiliary-ioauxioauxregmatch㿘>  "    >y" >y>y#>y#@`?#  㿘0?8 @Ɲ > ~?8 "bl>y#H?8  * (Hoclockeepromclocktimer㿘>   > ?߀ > @Q "   8@  delay constant %d%s [TOO SMALL?] oclock: calibration failing; clamped at %d 㿘>ˠ " Đ0  >  @5 $`> !   *`*@ * @ @ > ">"ax>z ش `А *`А *`     # `А *` x`>z>z !0 x 4>ː &x!x>z!㿘>   V` > ?߀ >!@ "  m 8@  㿘>z#0  @Ė%>"`>" 㿘>  > ?݀ >!@@ "  A 8@  >z@ P`?mk48t02modelno prop: %s (eeprom) mk48t08㿘>  `>z#А  >z@cؠ2>z>z##>z@\c `00  @h!> }" #> `̟   `̟   @@O(> }"> ̔  >  > > ?݀ a>" >ː "`  * *` *   > "b> " 8counter-timercounter㿘>  > ?݀ >z@ `    8@  >{!"` >{!@`?delay calibration delay constant %d 㿐 '>  ?  +` *  @Ԑ0?  @Ζ > }?" > ? "bp"   ?0 @ļ ? ? > } " h>"x# '$@\ d@`6> >{"p :` d@6>x $x!x>{"㿘Ho o  > | ``" `` @? > |``?"```?H 0  > > }>`,> 8  ̐" > 8>> ** * * * * cannot get %d Hz clock; using 100 Hz cannot get %d Hz statclock; using 100 Hz 㿘> Ā > d"!P> "!@ސ"@>"aT !>  В * А *`   А *`0k%>Ц"@P@m  >|! d$P@ d>"aT#> bT bTP$bTbT@U >|!8 d$bTbT> @"2: >  d@ $ !> `:  "`!>   >!T> }` * "@> bp* "@   >!T? * "`* "` > >  : "`"   㿐Ho o> Ā  >   'xp 0> ``> } '`? 'H 0ߦ> "Ā @  >   t 0E  oldclk statintr㿐> Ā ">>}d   >> "p> } h ' >"" > }   "`0$  ? ')> ?>> `Ā @ > "p* "@ ?* "`  ;Zx0N8`((`:`(( `:(( :(( ; (( ;`(( `D`E?  F+   2!m!n >}‡+ P?  4 * ( ("* * ( (*` (㿘Ta> "Ȧ E@ i@  @ `  @, & & &  `? >}!Ė  R 6   &&  & ,R %`& 4& T@ ђa@ $.& @ ʒ.@  <& @ Ò <&@   @ , &  @  @ , &   @  @ , &   @  @ , &   @  @ , &   @ ݐ @ , & WARNING: preposterous time in file system WARNING: bad date in battery clockWARNING: clock %s %d dayslostgained -- CHECK AND RESET THE DATE! 㿘>  8`?Y!  >~! ư!@ > Ā @> I   @-  `-:> "b!> "Ȁ  >~ϐ!$"Ȁ2$>~@& >~"Ȓ, `"@"Ȁ>~">~"8>~"@ T@ Ma>~"Hx> Ā  > bȀ ->  Ѐ )b@2> "Ȁ !>  8   ' ,',',',',',',',' ' `,'㿈@@㿈'@B@"> ЇH  *` @( `> Є (H > ЇH  *`*@ `> Є (H 㿘#Ta@ @ ]a@ ..`@ V.@  <.`@ O <.` @ K .`'!lP2>>!l!mP.`>>ː "a>˒!x`  `& >˒ "!.` .` ? ;  7 ' 2mn 8   >˘x    * (* (* ("@㿘> Ā 0?Ho o> "&" & H 0 > | d  d > |4> |d>ᬒ@&d@А"?@ &   &?/!@& > |"`d `d"`㿘>   B ` > `%"8@v31> %%  바 2` #    , `d& ` @   @^㿘>  6 , > #F  @N* :  ,@>!P>@ z 2 >zP @N* :  ۢ` >  㿘>`  #>ˤ  $` >z!P  $` 2$`>ː "`㿘>"`> `"͐ power㿘>   >@ ^ @`? 㿘0  @g > "bh>x > h(cpu㿘`@ > `?noSUN-4/100 series (%s FPU)SUN-4/200 series (%s FPU)SUN-4/300 series (%s FPU)SUN-4/400 series (%s FPU): %s clock-frequency%s (%s @ %s MHz, %s FPU)name%s @ %s MHz, %s FPUcache-physical?icache-line-sizebad icache line size %dicache-nlinesicache-associativitydcache-line-sizebad dcache line size %ddcache-nlinesdcache-associativityecache-line-sizebad ecache line size %decache-nlinesecache-associativityWarning, guessing on HyperSPARC cache... bad cache line size %dwarning: couldn't identify cache vac-sizevac_hwflushvac-hwflushvac-linesizebuserr-type%s: cache chip bug; trap page uncached %s: %d byte write-%s, %d bytes/line, %cw flush throughback %s: physical%s%dK instruction (%d b/l), %s%dK data (%d b/l)%s%dK external (%d b/l)%s: physical %dK combined cache (%d bytes/line) @'pp :  H2`:` >  "c@ϖ>!>  W!>  >  "$# " # !> }D>" $1> }>>> } >a!$#> """" " /"  >a(> "bb"` "`   > } >aH $#> "bb"` "`   >ah> "bb"` "`  "`>!> }`%>? t>a@  @K@  >a#> }`!>@f!@@>>a#> }`!>@M!Ȥ@Ԑ>!> }`>  !> " $`>@Ւa> `?> "   !> >>!> " $ >a@& $ $@    `*  * !> >"o!> "$ (>b @ @>b0@ @ n@ l$ >bH@ $ 4    `*  * !> >"`<!> "$ 8>bx@Ҕ >b@̔ @ ;@ 9$ ,>b@ $ D    `*  * )> >" )> "$H>b@ >b@ @ @ (8@ $< $4$,$  `%">"$` Ҁ@"$"> "`"o:` "   `* &` * > >#(8""Ð#@> 3"""$`>ch@M@$">cx@G >c@A $`>c@: $`   `* &` * > >#(""> "#>c@  `?` > 4@} >#}`> "U"` %>> #` >#> > > " s`" h]06` * > (T`` > 8`$K: > X> #  > ``4?: > X> #> x`D3: 1 0 > `` ': @'W8601/8701 or MB86903MN10501TMS390S10TMS390Z50 v1TMS390Z50 v0 or TMS390Z55B5010RT620RT611RT601 or L64811 v2RT601 or L64811 v1MB86900/1A or L64801MB86904IU impl 0x%x vers 0x%x㿘> "`" ? 2 ? 2  ?     >bаB5010 or B5110/20 or B5210RT602 or WTL3171TMS390C602AL64814L64812 or ACT8847L64804on-chipWTL3170/2L64802 or ACT8847MB86911 or WTL1164/5MB86910 or WTL1164/5version %x㿘> "x`"x? 2? 2?    >W`Hmemregmemory-error㿘>  2    ` > @(`?memregattach 㿘>   > "d 2& >2!X 5>  0  @ &d>.!hmem err: ser=%b sva=%x WRITEINVALPROTTIMEOUTSBUSERRMEMERRSZERRWATCHDOGparity error register = %b ERRMULTITESTENABLEBYTE0BYTE1BYTE2BYTE3mem err: ser=? sva=? parity error register not mapped yet! memory error%ssync mem err: ser=%b sva=%x aer=%b ava=%x aWBINVALTIMEOUTDVMAERR㿐>  (   1> 0C? 0@"d  >!> >"@"d>@` >>">">"Ѐ >">#>#># #\#` >> "d`" >>"@@>`>"В @E mem err: sfsr=%b sfaddr=%xCSERRPARITYSYSERR UNCORR TIMEOUT BUSERRFAVOWasync (HS) mem err: afsr=%b afaddr=%x physaddr=%x%xSYSERR UNCORR TIMEOUT BUSERRAFOUnknown mem err: if sync, fsr=%b fva=%x; if async, fsr=%b fa=%x pa=%x%x㿈   2#\`> >*`> > `3   `2 #`#d>!@> >aHyperSPARC async cache memory failure at phys 0x%x%x. Ignoring. store buffer copy-back failure at 0x%x. Retrying... warning: got data fault with no faulting address. Ignoring. ERROR: got NMI with sfsr=0x%b, sfva=0x%x, afsr=0x%b, afaddr=0x%x. Retrying... memerr4m: unknown fatal memory error. type=%d, sfsr=%b, sfva=%x, afsr=%b, afaddr=%x㿐>"(6 >#( >>#,? j>ː?"c0>"#(>ː^"c, + >"p>#0 +>#(>ː M>ː +"c0>"#( Ѐ$Р0? ` >|"7>0 23&0 2-&0>#\>">>da>#0 >#(>ː >"#0>"#(!#\#`>#8>ਘ<zs㿘.3>` ֐ ` ϐ 㿘.3>` Đ .`  slave㿘` @ "$ >   >>>   >>b  @?V`  `? ,  s& 48@ zsattach: expected 1 interrupt, got %d pri %d, softpri %d broken zs interrupt schemeintr㿘> |` - @ܐ$ 2 a0 "a0> "耦>"0>#` > |`p > |"`p" t>@ђc` >@͒cl  t"> #0>cP`,&`(- `D`&`D&`H&`&`P> Ƞ&`@'"&`&`L@۔ 1l"`l> "`>#"`Ȁ`& >ah<>" " #@:"  .7 @"1 &\*` ה &``d& @&<&@ 1l"`l> "`>#"`Ȁ`&$"`"`#"` >ah>@ @"1t &\*` 㡔 &`zsconsole㿘`> "H>`> | *>ˀ`"#|@ &> |`"|`"|>>#"`>"#x>"p&> |" x㿘> |  | Ho o>   H 0,  #>` ]  `, >  Q H 0inputoutput%s%c: console %s i/o㿘> | x >#x >#>#| >#`2 n 2 n* `*  & l>#& <& & #/$& > & Ā`>#`  a >  _  .:.8㿘  * @ 㿘@h . (& p㿘*@ "#& p㿘 >c\:c\*@  * @*`@*``D L`: "` H /* & p  )  #"$  $ #$ %$ `<$ $ @ . $    H 0U @ `>` `t 2 pL`6 ` p $ p`'  @# p "$ p >!/ א p  @m  p }.?" pH 00H 0  > h(*`@ €@L 㿘. >˔  . * cL* @  D@ > `h!(*€`@`p "  @&  >>P6  H /*, )    . ) !. H 0!/ 㿘. >˔  . * cL@ *   T> ha(* 㿘. >˔  . * cL@ *   T> ha(*  * >˒ a * (L (T㿘>  Ȁ`o ``\ 8.` `X  @   ``* "@ @ܒ   ``* "@ @   ``* "@$`X. `l ` `d@c   `đ* "@ `d@   `đ* "@ `d@ђ   `đ* "@$` "`d``8? "`8`d`2` "/ > ? >@ /%> c "cH 0&> }#܀ ?8 *  * @>   Y  )  㿘> ` "L 7 L 7  > |` *`J`  *`  ,  M . L   @, , .   0.@!> `Ð  8.@  ".  .   0.@!>   8  8.@     㿘 @ ? (.@1>   8  8.@      D& @`& D @1>.`   8  8.@   w  㿘!> @  k  .@   8c  8.@  `[ `"   @@`   `  . z `",`N 8 >` @     0 @  @ 0,` stopping on keyboard abort 㿘> | x@Bzs%d%c: %s overrun 㿘@> Ȁ@ >`> &@   aringfifozs%d%c: bad ZRING_TYPE (%x) 㿘>  ȀǶ 9>\TX" % > h!(*` @L>Ĕ%?,$T `* @ ` 0   "<` "u 5 ` P> `@<`@`@ڐv?@p? €k? 4 "<pH /* ,  @ ` `$ ' ,'$ @ÒH 0H`,4p!2pD$@`$D @.`  vY 0rp `$p $pDPH2ʒ"  @?<`@  4`  € 2,5@U ,5>a(= a ,?b C$T2?\㿘. >˘ ! . ((#L> a( TD h( @ 6! & ]@"YN 6 y@"А x@ΐ۰  z@6 {@ а   k@"˰   j@  \@"=    l@  m@" H /* , )    . ). 0H /* , )     . )  #@ 2`  2`&< "~  x t H /* , N :   3. 6   # . 3 . #  3. 6  #. 3. #   $   3  # . 3 . # '    . ' w.  @  3  # . 3 k. # '    . ' b.  @*@$ H 0 @>  @:    f &@2 `   㿘 l>˕*` `*` *  L* @  D@H /* & pF V  H 4  H & p H3  H1  $ p & p PH 0, %   , %,  *`>     $ D$ @H 0, %    , % , H 0l>ˑ( !((cL(DH(p" @p"pH 㿘`(> l *` `*` *  L* @  D@`$ 2  ,@ { @],  q @T`& & & H /* ,,`0< ,`1 ,`%c! !"      @     @  `@@ ` 2 >  ",`' ,`'?,`)d D L@" @2 ,`( ,`-,`. P,`/ ,`2 `4`,`3` p  `@,`4$`H $`@`$`! `@;H 0 㿘` ? ?}H /* , )  4 `. )  p   @. 4& H & @    . H 0㿘 0.!>                 `Œ `  `  `  ` `  `  `  `  ` ` ` ` fdc360KB/x720KB/x720KB360KB/PC360KB/AT1.2MB1.44MBfdSUNW,fdtwo㿘>  & >   >  >  >  >@@]#耢      ?   drive %d㿘`>o  㿘@1  @  " d@" @ o@@ [version cmd] CFGLOCK: unexpected responseintr pri %d, softpri %d: chip 8207%c 㿈 08 @ &`@$ \$ |$ T T$ X>̒ p"T `> $ ``@ΐ> $ ($ , @G ( @ @ @ $ p`$ t$ x    7 * x " 2`72 @ ` $ `$ x @$ p $ t@   X@  X   X># " X>ސ!X X$ lo `  @ @r >͐!h>a >! –' (>  >>##@ 2'  "  '   8'  @2'  @"''>ˢ#!>' =   ' @V fdprobe: %d stati: %x 㿘$ `f   x *@* 辒  & @' @$  ## p Ѐ 2 a"@  >@  > >ˠ >#  > 3  >#>` `)&`>#    `? `   x*@ h : %s, %d cyl, %d head, %d sec : density unknown 㿘   0  >"`?>"?&`&`&`,`" D`&`0>̐!@&``((2&> <@w> 쵒&`@Ȓ `p:```   *` ( (>ˆx fdstrategy: b_blkno %d b_bcount %ld blkno %d cylin %ld fdstrategy: controller inactive 㿘 D>< :  #<* @ "  T &  <2 N,  $:`  $ `@& @6*`  8& 4& <  T@`># & @ T <> d#H /* % Ȓ > w! 2 $@0  \ >H#@H 00 0(& 0T㿘 $T &!& X& X`" "X@ 㿘  $ Đ  &  `&  "` $ X  "`$ " &!&  X&  X" $ X &`@& `$S& >>aP * $ \fdc reset 㿘 `   x*@  p * p*># >ڐ"ȁ㿘 `   T      D " ` "`+ `` x*0  D "` 2 ``     㿘H /*% ?&  $H 0㿘 $H /* % ?& T \ @ H 0fdcresult: overrun fdcresult: timeout 㿘a"  p Ѐ  $ 2  >`? t  *`2 p >ے`?$ ? pa ⠀ $? t (㿘 >a<:a<*@  p: ``  *` *  * >˒cx  `2 ,  "$  "$ # ? $  <` $ @  * " 4  8 8 $ 8 $ 4 8 4  $ <2 >, `"` ("`4 `8`8("`8("`4`8`4 "`<㿘> >p !9㿘> >p  !-fdcstart: not idle 㿘 \ > (0@$%s: %s: state %d (st0 %b cyl %d) invldabnrmlseek_cmpltequ_chckdrive_notrdytop_head (st0 %b st1 %b st2 %b cyl %d head %d sec %d) end_of_cylbad_crcdata_overrunsec_not_fndwrite_protectno_amctrl_mrkbad_crcwrong_cylscn_eqscn_not_fndbad_cylno_dam fdcstatus: weird size: %d 㿈> $ p \  / >  >#>" > 0 > 0> > X#\  #` >#d #h>!0!timeout㿘 TH /* % >  쀢 "& \ \ & \@}H 0㿘H o*@e@jH 0fdc: spurious interrupt: state %d, istate=%d fdcintr: spurious interrupt can't be clearedfdcintr: block %d != blkno %d fdcintr: %s drive %d track %d head %d sec %d nblks %d readwriteseek failedread failedwrite failedblkno %d nblks %d tc %d fdc: %d -> threshold soft errorrecalibrate failedstray interruptfdcintr: impossible㿐 | > \b#p \? ;& |>P# T`2`& \ `2 \``$``"``& X``"@$a`>!*`@ U _ V Z _ [ X [ [ ^ ^\ _ ^t ^ _ _<& d$`> `<$``TA$``   i& \-` *  D " ` * ?$ ``*$`  ``& \>!P> dݕ:A ` ?$` ` "``@E$``@@A  2' `     & |    `  ``@@`( ` ? Z& \$` & \& `X`(BN<`X>>aP"Ǎ* ` `@` $!: 8> , !: 8$`, $`@@`% @{ @x`@ >j#`H``0 & ` p&  ,*@>#   >#> (> 0 ``J#\ & \ & |  &  怢  :  ŀ 3`,@  ` ,  ` %   `      ې   Ր    ϐ  & \`(>>aP"*H >"  ``& \>!P 2!>@# ϒ3 `(  > 2 >``@ (@א @ >#  >8%$`  Z   X0>"Ւ`<`@`(w"  > >?@=># " `0@">> H X_ ``>  h   l `4 h  @># & l> u & h h  & h & \ d >`#>  !?;  >W & d h??& h l`  @># & l> @ Ӑ& h``` `$``@ `$`" $```@`B%`@ TL d0&  & | & \>>aP"2 :` >", & \ & |& Ȓ    `  & \>>aP"*ٔ = >"   ``& \>!P !>@{# Ē(   > >?  >#  >@g T$`` " `  >{Ȱ hard error㿈 T d`쀢  & h 6 "  ``    `   .& \,& \*& \>#> #!?; + >  > > X#\ #` >#d !m#h $ 4 0"`0@ d & d? fdioctl: impossible㿘6 >̐  ,`m@ (@   p@=e e@9  !@"/V  q@. ,  e g@%  !  @? 2   @Ք " > @ `   @] floppy diskfictitious%s: %s 㿘6 >a, @!@@""$ ( $ 8 $ 0 $ ,> b @k$ 4 4  >b@d !,4 H 4$ 8$ < 4 J $ X@$ $ ,  4  !W$$ <4 >` @>"㿘  D   Insert filesystem floppy and press return.㿘!>> @   />̮H=%/> 㰬%/>T 4$ 4   -'   @2 $ J$ *@  , ,2 @$ $ -> ~l - ?$ $ -- $ 0& @-a! Ѐ2 @ , ?$ $ @-a Ѐ 2 @`  ,` @$ $ $ />M-/>̮H@̀iommu%s at %s㿘@>  "H 㿘>   `@ `? unsupported cache-coherence?page-sizebad iommu range: %d : version %x/%x, page-size %d, range %dMB name㽈  > `" `>ː"008 0@ &`(>@b&`<> "ah#>>`,@Ib`(&`,@ 2 @*@`(&`0 `,> !*@ &`8`,@ * @љH@  Ѓ@('> @ @У@'>,@* `8?@`0@* ? #? ,`8&@}: `( 0"`Є&`8? @&`0?`0&`4? * >"M Ho o`(" `(+  ?  > }``"`(2` |" `(" H 0 `,`(>`0#@3 2 `/2  >@b@ 2' ''@>@c0@ '>Tﻖ @> 2@> h*`> ``4> "08( ( 0 > `> 48"0 ( 4 8"0 (ؠ( 0 ,@sbus%s at %s slot %d offset 0x%x㿘@""> #h">" #x 㿘>   `@} `? unsupported clock-frequency: clock = %s MHz burst-sizesname㽈 > 0F>`_^@@$(!>@ (w>`@@ $8  >@@c` 2' ''4$0@$4>@ܒ`P@  @ '> @ 42&`0`4= 0"b?(@"b "b  `0>`"b( @4"`4` 4`  4`@ 0( `4"b`@""b   4 `0  0 2  4 4 # 4 0 # 0``@` sbus_establish: can't find sbus parent for %s㿘`$>"   > >#Đc`@r  "& $ ,& $ ,reset %s: %s㿘>!. >@#  , #> `"  @c   2 getxscannot allocate scsi xs 㿘H /* %   1>`:   4 Q  ` ?, > "쀦 `"  "` "@H 0`H 0 h ``@>O   H 0 & 㿘 > ?&  &" "&  ``  *`?# 2`\ 0`  €`could not get size p@  %/" #\#`h#d  @S   . * *`  @K>"  㿀@ / ##\#`#d   @+ x@В  @/ /a"#\#`#d   @ 㿀@  / ,/ ##\#`#d  ,@ 㿀@  //##\#`#d   @ 㿀@  ///`!0 ##\#`#d   @ʚ 㿘   @[/ 0@  睐09@ 2 0@ "    ' 0 0& ,  `" $ 4 0$ 4 <($ 0$ @ ($ @  `@  Hscsi_execute_xs: NOSLEEP and POLLscsi_scsi_cmdscsi_execute_xs: invalid return codescsi_execute_xs: impossible㿘 & , $ ?& & (  @ "=   " 8>"' 04>  $>!H /* %  !> "寖   H 0 0 ?@_ ?" & ,"scsi_scsi_cmd: buffer without nosleep㿘\`d2>#2$`  `Yi$`$`$` $`$$`$`$`0  `  *` *    w?=0 scbusyunknown error category from scsi driver 㿘 ,`7*`>!@ y( y0 y y y yL0 @?" *  ?   "@   > ">   ?? $ $ , ? ? $ @ >,  unknown error keyverify miscomparevolume overflowsearch returned equalcommand abortedcopy abortedvendor uniqueno data foundreadonly deviceunit attentionillegal requestnon-media hardware failuremedium errornot readysoft error (corrected) DELAYED ERROR, key = 0x%x %s, requested size: %d (decimal), retrying, cmd 0x%x, info 0x%x, info = %d (decimal), data = %02x error code %d at block no. %d (decimal)㿘  `4@? @  p q@ `># ` @   ` ` `* *` * `  `  ` ]> *`@ | | } ~ ~ } } } ~ ~ ~ ~ ~ ~($@"?$(D `?# @4 @  "  2"@?  ( !   `?# @4`~? z` x     ?   i@o>̐!, @>#8 @ "+ `?` ">"*`@  ~ ~    ~ ~ ~ ~>#@ >#`>#p @ `># ` >ߐ# ` 6 >%>@ Ր ` @>͐#0@!> @#Œ ` @ " > `> `# `*`*@ @ ># %s(%s:%d:%d): probe㿘> `#`>#    㿘! T @팒!H /* %> pp &p" "p& H 0 㿘H /* %  " "@H 0 y TH(> p   @  HUser command with no buf User command with no ioctl host adapter code inconsistency unknown error category from host adapter code 㿘 0`i >!0@2*a^ >!05 X*a ,`%a>"*@ 0 ( $ (" $ $, [ , Y 4 X ( 7 > !    . >" , [Euser_strat: No ioctl physio split the request.. cannot proceed cmdlen too big scistr㿈 W2 <>#`U `Ȁ a >#xJ ``2 `D  ( ` >#: 2(  ` H #\#`#dĚ 2& 4H /* % 0"  !> #4  0"H 00& 4 0h" 0Escsi_do_ioctl: impossible㿈! " !"{ !   !"f  !D w0!2r `ߔ `& >#  &&& &&>& &&   ͂* &8&P&D&L&47< `m0;& ?# @6  6   6   @6 "$   6  @' #\#`"#d      @"  " "  "scsibusscsibus at %s㿘@> @  : %d targets scsibusattach: can't allocate target linksscsibusattach: can't allocate lun links㿘`.&`( 2`( .`(> ` x].`2 `2 *  &`,>H `2  #> Ҕ `,."@ `, 4`@7`2&ѐ `?@D?㿘`   2   " " 㿘?>" !>̢" " .  "`@` "  @㿘  >bb. @ 2 (;     ?`&1  @6-    !  @4 @"`4`@ 0: "``@뀦@  @ "`"`   ""$ \ @_\* @ 00* @ 800* @ 0*2** * `*V1.9SuperVista S-12 UMAX AT3 1.60 ULTIMA 02.2Model 3200 01.7Model 2600 02.4Model 1300 WangDAT 5150ES SCSI5099ES SCSIWANGTEK VIPER 150 21247ARCHIVE TDC 3600 TANDBERGSDT-5200 3.SDT-5000 2.09SDT-2000 EXB-8200 EXABYTE TK50 TZ30 CP150 CALIPER FC-1TEACG0661467IBMZIP 100IOMEGAjaz 1GBiomega6027MK538FB TOSHIBA ST296N ST296 ST157N ST125N SEAGATE RO3000S RODIME PD210S SUN0207PD1225S P105S 910-10-94xLPS525S QUANTUM 0307D3847 SnapLink MST LXT-200S LXT-213S SUN0207LXT-213S XT-8760SXT-4170S MXT-1240S XT-4380S XT-3280 MAXTOR 0663HIBM 0662SIBMRAID A00MD21/S2 ESDIEMULEX RZ55 (C) DECDEC 3.30MOS321 DELTIS 0800M2513AFUJITSU3.08OMD-5010 EPSON 1.04CD-ROM DM-3x1SShinaKen1.10CD-ROM DM-XX24 KTEXEL 1.0BCD-ROM CD-56S 1.06CD-ROM TEAC CD-ROM CDU-8012 CD-ROM CDU-8003ACD-ROM CDU-55S CD-ROM CDU-541 SONY 1.01CD-ROM DR-124X PIONEER CD-ROM DRIVE:8411.0CD-ROM DRIVE:210CD-ROM DRIVE:84 CD-ROM DRIVE:83 CD-ROM DRIVE:55 NEC 1.3CDR-H93MV MEDIAVIS1.0bCD-ROM CR-5XX MATSHITA2.06CDD521/10 IMS VDRD-25X DENON CD-ROM CDS-535 CD-ROM CDS-525 Chinon CD-ROM CDS-431 CHINON %s offlinescsibusprint: impossible qualifiervendor-uniquedirectsequentialprinterprocessorcdromwormscanneropticalchangercommunicationscsibusprint: impossible device typeunknown targ %d lun %d: <%s, %s, %s> SCSI%d %d/%s %s%sremovablefixed@>א!  ` `  @2 @ `  >> > >> !!>𢡄"!>"0`OВ `H>#*`@ | >""@>"H>"X>"`>"p>"x>"> "> ">">[">"ФА  p   ` #\#`#d>">#>##h#l = DECTZ30TK50 not configured 㿈 ,.`@.@ ̐  Ů  (@$@`$``$`` $` `$``$``!$`,`,`>̔$` ,` > | @ ,A  2   *$* > |> |  *$*> | ` ` ?  А >a@m  > a > | >a@b  >a@] > | >̒b, F @j쀢` ` ` ,`   > | ` 2> | ,` > | ` ,@   0*@6 0 ,` " ` 4` @9 @ `  "  `.` ` > |    '> | '>!ܒs > ,.`@  .m#@ 0  >`!x 㿘  '72 @@2.@`2*@@` `@q 2 @` @  ` @f 2@`@ `@[ 2 @$@'@β@cd㿐>Β`   㿘> &`"` ` "` *`>ΐ &``&`0`(@@  2>` &`>"`cdlck㿘 1> $ !"۫ "       $ 㿘 `& & 㿘 >`:`*@ 2 x Ȑs < ` ( g !b !\ `!4`2H <` 2  4`@ 6 @   !&  `6) . @ !     8  8*@$ 8 4*@$ 4 8 4@ " < `?# @4` <   !`?# @4`o㿘  > ԓ:`*`*`& C "5    8  8**@$ 8 4**@$ 4 8 4 $ <  \!@ ?# @2 `!   d  ? b 2 ' 㿘 G  : >  <,@` (@槐  ,& 4`   $& 4%,$  ` @ݔ@ $     2z 㿘  0` `<`@ (ʒ" 㿘 G: >`ԑ* @ "  ( <* "@ 4& <  @㿘>"> "j㿘>">  "^cdioctl: impossible : >`ԑ* @ ` p"`?#"ѐ#"# "# "y #"ߐ0?#"  # #" # ƒ   q" / #"# "#ې e eJ  # " #    m"   !"kV #" #d   h! y` e g")  e f# k 0#0#"u`  yٔ!i   `&` "@*   @Z&X S     @̪$    " 0Dؒ@ٔ > @/氒5@A-@ &ƒ @/ư@@#\@   @/@ ,@\*   8(  x@j ېx yG7x԰ "hͰ @T`h?8lwwH@N /\/^/`f/b(@= =.?.A.C .@-  // ///!B/#@ } / //3/Ȓ@  p /ܐ //&/@ b////²@ V /// /h@ J /|/~//@@  @9  C 2 " -  ` !'2`      @ #ϐ 2` @m` ` !"@ 2  SCSI diskfictitious%s: %s 㿘`!@ፐ`@ኒ" ` d$ ($ 0$ ,`@ d  0$ 4 ,@䇐 $ 8$ 8 >`@  4  >` @ ` ($ <!,4 H 4 J$ X$  <@k2` $ ,  4  !W$$ ڐ4  6  *  a >b`@ʜ> 0G`p@:  %/` h  #\#`#d ! * *` *  ~&8($`* *` *    c"$`㿀@ @  // /    #\#`(#dA 㿀@  / /   /.@  #\#`#d% x@ʒ  E/6`/6`/6`//6// Ô@   #\#`#d x@૒  /6`/6`/6`//6/6/6//     #\#`#d x@  H/////     #\#`#dʔ x\@n  G///////'Ж    #\#`#d x@T  K// 'Ж   #\#`#d 㿈 'Д    #\#`"#d x@0  B`/ / @///7`//  #\#` #di x@  C`/ //7 //  #\#`(#dJ 㿘@? ? ch02009000SPECTRA㿐>Βa8   %s: waiting %d seconds for changer to settle... %s: offline %s: %d slot%s, %d drive%s, %d picker%s, %d portal%s s㿈>#@>aL&`(" " *@`\>#H蜒``\*"@ *`" *  x0* @}  >#芒`.`0`D>#`>">#`L >>"#`@#\`@ 2>>"##``H#d`H 2>>"##h]`0&`,㿘>a4 a4. @ 2 ( `   2` (U  @(   (? c 2  >$* (? 2  㿘 >Α* $c@ @ # #@  _  #@"Q#@"?,#@"+,H( #@"(@A( #@" #@4( #@-(@1 -@{ )@ %0" !"?@$0   ,0" "@"D"H" L "@x@4I ``4E *`@`?4= *`@` ? 3  P: , `0 0@w@  /, 4 /,`4`/4  ,4`///2 ``/ / (a   #\#`#d x@4g ``4c `4_ *@`?4W *`@` ?4O * @`?@ E  T:  T: 9 0 0 0@@  /, 4 /,`4`/,4/4 4` ,4////2`` / /`  / (a   #\#`#d= x@ * . `@`?% `0 @Ѡ  +/, 4 / ,4 //2 ``/ / (a   #\#`#d %s: warning, READ ELEMENT STATUS avail != count 㿘.`@`@  S $ $ `0 @J$<``@ ` ` *  @     `0`@@0"` ` ``@*  >#k  ` , `@rq`m h x@A  /6`//6//7 /7 // (a #\#`#d| %s: could not sense element address page %s: could not sense capabilities page h@  ؐ@  / / /   p / (h#\#`D#d>E!ސߒ * $ 0* $ @* $ 4* $ D* $ 8* $ H+  $ <* @$ L@ܽ / //   / ( #\#`#d>"嫒 0 P@ܢ  T@ܟ   *`P *`T (`  2`㿐& \>Βa\  0` & \sd㿐>Βa   %s: drive offline %ldMB, %d cyl, %d head, %d sec, %d bytes/sec 㿘&` ` .a >ΐ!"` ` "` *`>ΐ!&``&`0`(܎@;  2>` &`>8 > 4` `    똔!  >@  > 0!> @ٶ@}    sdlck㿘 1> $ !"hϖ "       $ 㿘 `& & 㿘 >a:a*@ 2 | Ȑw < ` , k Ԓ!f `  #!\ `!4`2H <` 2  4`@x 6 @   !&  `6) . @ !     8  8*@$ 8 4*@$ 4 8 4@ " < `?# @4` <   굔!`?# @4`k㿘  >!:`*`*`& ? "5    8  8**@$ 8 4**@$ 4 8 4 $ <  |!@ ?# @2 `!   ꄔ  ? b 2 # 㿘 G  : >! <,@` (@ǐ  ,& 4`   $& 4%,$  ` @@ $ # .  2y 㿘  0` `<`@ (" 㿘 G: >a* @ "  ( <* "@ 4& <  @㿘>"d> "(㿘>"d>  "(zsdioctl: impossible㿘 ` : >!*@ `   q@"x e e@"- p@"y` ` !@x  m@U { ` !@"aV  h@" n ` e f@ e g@ c ` pe!o  &*"*   @e& b ]     @:$ 2  e g@2 `4` *  a  > @fbd  x" 0:9     ?$ /  詒@ ( " # ` !2` 2 @{` ` !"@     SCSI opticalSCSI diskfictitious%s: %s 㿘`!@`@ "`$ (`$ 0` 0$ ,` ,@ $ 4 $ 8 d$ 8a  >a>b@؇  4  >b@؀ ` ($ <.4 H 4 J$ X$  <@2` $ ,  4  !W$$ Y4  6  *  a >bd`@>"(ƒ`x@غ @ض  // /6`/6`/6`//   #\#`#d 㿀@ؗ ,@ؓ  // / p  , #\#`#dՔ P"& h3 @q  / ?/ / p , #\#`h#d貔  ˑ* *`  && @. . @T& @ڳ6 %s: mode sense (%d) returned nonsense%s: could not mode sense (4/5); using fictitious geometry h!  ?  c 2  Ȓ s2* .  *  6 Ҁӓ*`* @@ @&  <`2 "&  ے  @& @RL.  C2# . ݑ*  6 ӓ*`* @@  &  @. @ϒ  &  2( "$&  2 `2 >>! ౔>!଒ >੐! 搒 @, ,4 4"$$  㿘   ? : >Ε* a* @ "`* @ ` ?` # ?㿈'> |( 2l  $(  >a:*&#a*@ (@ N @ٳ.` @.  ``@ @ < : > |4 @+  */6`/6`/6`//6//@ h ` & &  &  & &  @& & (& ,& 0& & $ @  $( ????5150ES SCSI FA1501 AT4000s HP 263HEXB-8200 EXABYTE Model 1300 WangDAT 5525ES SCSI REV75150ES SCSI5099ES SCSIWANGTEK VIPER 150 21247DMT780 ANRITSU CP525 SANKYO VIPER 2525 25462ARCHIVE TDC 3800 TDC 3600 TANDBERG st㿐>ϒbh   %s: %srogue, drive empty density code 0x%x, %d-bytevariable blocks, write-%s protectedenabled㿘>"X&`@$ $  , @C>D `L` > > > 07 H  >@ >>( &a`X# `T`>>!`(!`( >!>!0>!@  &a&``&`㿐>Βb  L菱` & L& \& ,@" 8㿘 `  L h  @ߒ  * \ " ?$  *  ,@  * `  %s: already open 㿘 >bT:bT*@ 2 @? `  : >#ޥ 3   䱐#` 4`#  <2`2 (@ɒ  ((`@Q$ <`    (  $ (@ `?# @4`㿘6 >bD <@ ( !   @ϔ   " @   ? ?     ?  @? @c  2  %s: cannot set selected mode 㿘 > >bD* @>  ( ( @b  @$ (,`* `  \  @$ ,Q%  , @АF@A A@j < ,`*  h X, 4 ( ?$ (  ,`@J 0!*  d $ 0 ( $ (@ > '!@ ( ?($ (  4!Ē 㿐 (( @ @T @ @ @ !@` @g @ ( 7& (? # @4  D" 4 H2 4 ( D" (F" 0%>p( L L L L ( T" ("" 0"" 0`" ( ,  T2 ( T (" ( T" 0 (" 0" ( 4 4  (& ( ( (" ( %s: bad request, must be multiple of %d %s: bad request, must be between %d and %d 㿘 G>bD <: * =@`(  `0@\ >!`  `D >`H   >!`H` & 4H /*%& $`& (`"@ $@" H 00 0(& 0 <," @%s: not queued 㿀 @ `  ``?# @4`0  $` ("`(&  (" (h`  `?`c 4` 0" 44`"" ( 0@2 <  @ " ($ 4 0 <h" 0,U" @S `$ 4 0$ @ w$ 0 (   <$ 4 0$ @h$ 0 ( ,<& (: `@k  0@   / (% > & (/( (   / <@ 02  <2 /2 //  Ha <b#\#`#d㒚 " `>#0<  ` 2l`㿘>2>D `< "@  㿘>2>D `< "@   㿐 !@ :>bD* @  0: 4 @ !@!@ 0 !@"T@ @ 8 4@ 0$` 4$` d$` p$` |$`  $`$ h$`( t$`, $`0 $`4``>#|*`@   L d t `  툐@   @F &@ @  @5  @rɒ 0 @A @;~ @v  ϖ (*@9$ ( ( 4$ (@Nb`2 D ( ?`@  H  @ S  H@$ (M  ( $ ( ($ 0 $ (`EB  , 4  <  @撔6@ے >!+ , 4$ 0 ( %$ ( ( ?!$ (   T@   ,0,*  0" d `  *  4* h ` *` 㿀1 @  / (  / 0`@χ: 2`/2`//6/6// @a #\#`#d x`@  % @Ѷ  /##\#`h#d    *`@$`D * *`  $`H0 8  @@ь  //##\#`h#d К  "$* *`  & P*`* @@ & T. X " 8 ( & ( 8h-   40 , 8 @ ` 9 @G  //@A / `/ 4/ (@// ( "  8 02 /2 // 8 g##\#`@#d h 㿀@   `/  / @   #\#`#dM 㿀"$ ( "9 (B` ("0=`3 =8`     " (H (""& ? =  `4 ?߀`6 ( ?& ( (  ?& ( ("` =& ( `   ?& ("  ?& (`@Ш  //6`/6`//   @  #\#`#d  㿀`( `  (!"! ?& ( ( =ϐ =& (@w  /6`/6`// @a   #\#`#dด 㿘 ( %$"  %  & &` 2  N x`  ٖ " , , 2 @+  //   @$# #\#`#dp x   (  @ & ( //` @#$##\#`#d   I %s: block wrong size, %d blocks residual %s: %d-byte record too big 㿘  4 0 4    7 8 9* *` * :   $  p2? ( "L $ 0@ː& (  @ ` ( $ ( ($`@  ` ( $ ( ($`@   ` ( $ ( ($`@ "  ,  2 ,>" ؘ , "  (  2 ( 0>$ 0 ( $@&.  ( 2G  &`2?$`@@ & (  @2;  `6 0`< `  2+ >" $ b"# & ($`@   2? , "  (  2 ( 0>$ 0&2 ?"$ ( $`& ($`@ ?㿘$ T 6  #$$ 0 02 ( (    ?$ (Œ    % T0 ` 0@4 0 T  rdramdisk: multiple attach calls? ramdisk: malloc for attach failed! rd%d㿘> |bĀ >ِ"0.֐"0+ $  4 "b>ϒ""`> |bȢ @""    I ">@ε $$  >cڛ @ `@㿘`@ `>ϐ"&``&`0`( > |Ć 6 > |ȇ(" " 2 㿘  > |"ĕ:`6 > |"ȓ*@ *&    @  2   .  ` `8> |ȑ(("@ ࠁ 㿘>!>p !Ԛ㿘>!>p  !Ț㿘 G:`> |"ȓ*`@ 2  2/ < & $#  $ 0T 0, < T& @ *   0@ 0"@ 8 0    H Hdϔ @" & @ <& @  0& 4(& 0&  : > |"ȓ+ @  m@"R` "@Se e@"`s  e f@"` "@O+ f  e g@"`_  \ @gd!S O`L  @bC e g@? 6  *  ? @>a@/ +@?( + " # `&`&` &"  `    0  @h@t RAM diskfictitious%s: %s 㽘%> |0@J!@F""$ ( $ 0`2 $ ,$ 4 $ 8 d$ 8 >a@ʔ  4  >a(@Ô .4 H 4 J$ X$  ,,  ($ <@-2` $  4  !W$0$ ̝4 6  *  ? @>a@]>!8` 㿘`> # " & &  &  㿘@`@=# :&   `&  @ & & & & rd_idle㿘)> '>"0¡ >  $$ <$ $ T$ @*   0 @? "@ @8 0    Ha Ha  @"$ @  0$ 4($ 0%Xrd%d: fixed, %d blocks 㿘 >ϐ"&@ &`>"> `&`v  > Ⰴ Ⰱdmaledma[%s at %s] slot 0x%x offset 0x%x㿘@""> U ">" P! espdma㿘`@   >@!` "   > ,  b& 48@  cable-selectiontpeauiburst-sizes : rev 011+2unknown nameesp㽈 0, 2  08 @~ߔ &  >&`<@Ò` #>>@qma>@˸b >@˲b 2 `<`<*@"`<@ "dh" >  4>>b@qU??&`L 8 " &`L`<*@"`L  `<@"@>"`< >@wa` 2 `L`<@ ">>ԕ" >Ԓ"@`<< @$@&`D@( @" >>@ `2 >> "H "P>"X>"`"hn>k"p` > O@"@2>>!Ȑ"&`p>Ð!&`h>Ð!&`l>"&`d>Ð!&`t>Đ h&`x>  J&`H 2`(g >@a` >@ `耢 >@` 2' ''@p`H">@pbx@l  ڒ '> Ǿ @p0>@ڒ`耢  `>@tf" &`4" xCSR = %lx DMAWAITDMAWAIT1㿘! ? <$ c ? 4 < 2  D <>א">ʐ"'#@ <! @? @"@ <  c_ ? 4 < 2  <>Ӷ">ҩ" <! @? ="@ <  cC ? 4 < 2  < <>Ӛ">ҍ"@ Ȕ"@c.! ? <  c$ ? 4 < 2  < <>{">n"@ ?"@ <@ "@ D @(& @ <@ "& @ <  < %s: start %d@%p,%d dma_setup: dmasize = %d dma: cannot allocate DVMA address㿘! ? <$ bԐ ? 4 < 2  D <>+">"'#@ <! @? @"@ <  b ? 4 < 2  <> ">"Р! ? <  b ? 4 < 2  <>">" <! @? "@ <  b ? 4 < 2 & \ <>֐">ɐ"& `!> O"  >Ð!0  \Ř@  \?*@@"@ 8 & X'" > XҲ!H>  2 \ X   \ X@& T& P>є!h <"  < \ <"` <" ~a <`"  <  " @%s: intr: addr %p, csr %b INTERRDR1DR2IEN WRITEENCNTTCDMAON%s: error: csr=%b dmaintr: DMA wasn't activedmaintr: discarded %d bytes (tcl=%d, tcm=%d) dmaintr: empty esp FIFO of %d %s: xfer (%d) > req (%d) dmaintr: tcl=%d, tcm=%d, tch=%d; trans=%d, resid=%d 㿘 <> O"  >Đ  >$ >Đ  <  # <>@ਘ #@0 @ 2> ! ? <$ a ? 4 < 2  D <>">"'#@ <! @? @"@ <  a ? 4 < 2  <>֐">ɐ"Р! ? <  ag ? 4 < 2  <>Ѿ">б" <! @? "@ <  aK ? 4 <   <>ѣ">Ж" }" X & @> O" "  4 t > ! *`  шz   4 t  !> O" >Đ!@v"!>Đ!`o  4 *" 4 t*  4 ` 2 X`t `} `@*  8* @@ `2  X X@@2 X 4 } @"  X > O>Đ!p @ X> O"  4 } t`@ > ! 8 *> \@s\>  2  ` P " ` T@ X `@""@ \@ "@Lance DMA error, see your doctor! 㿘 < >"h <>@ਐ ="@ <> ؒ` "  esp%s: scsibus 㿘@>ݐ" 㿘`@ǫ     > ,  ^M&88@  dma: expected 1 interrupt, got %d pri %dinitiator-idclock-frequencyespattach: no dma found: ESP100: ESP100A: ESP200 %dMhz, target %d intr㿘 >Œc@6 4`?`>І#0>#Ѐ&c( 2 &`t08 @z` &`t$#    >Œc@l $#,# >Œc@l?$#$$#,["$#$#$  $ ($#$#$@b@`$#$$ x& 4 >@p# $ x" 4>8#ؐ , } #,, ~ , | } t* , t , ?_ >0#   , } t* ,, ~ t* 0 , ~ t* 0 t 0 " }>   , ~ @, } t* 0>  $#0#$@ī##0`$#4```"@#$"@#$$#8 $#4@$#8@ $#4$#8#$ @Č ,  2#$ , #$*"@ *`" *  * @z*` , ,"   @, #$>#,ΐ >ǐ!$ 0 2 >р` ( $>ѐ"$ 4$ 8#(@s 4>ƒ`8̔ @$ p> O#$$ l> O#4$ d #,, ^, \  (>@sb #   @0 >@_b  ?   @ @fL  X>Ŕ%  @fC %s: unknown revision code, assuming ESP100 㿘 x d@!> O"!>ǐ T  ." t*` "!".">ǐ H ." t* ^!#0 " }  " | > > ~ t* 0 } t* , | +  | t*   t* $ t*   t* esp: resetting SCSI bus 㿘 x <>" }" > O"!>ǐ   ." t* [ESP_INIT(%d)] 㿘> O" >ǐ"" % &  & &  & &  & &  @ْ!`  $ " "& @ ? "@`, ,"@Œ 0"."  ."  @",&     @"`, 2 O!&"&" "#4  `  ; @? ; !*``#4*`*`"` ." ."> O"!>ǐ   ." t* 0 ."@regs[intr=%02x,stat=%02x,step=%02x] 㿘 t  t. `  t. ` .   !&"> O" >   M ȁ㿘#$@N@ @& 㿘.`"* #$@ӑ* [espselect(t%d,l%d,cmd:%x)] 㿘`*`" * "#> Ob >Ȑ! ."b!>ǐ   ." t*  t*     t *   t*` *  t*    t*    > O"!>ǐ  C C   " t* &> O"!>ǐ ϒ B B." t* [esp_scsi_cmd] [0x%x, %d]->%d TRY_AGAIN_LATERSUCCESSFULLY_QUEUED㿘 !> O" `>ͮ#p" "     `>ͣ# H /* %` @``"`$`@"@` ?$` H 0`2 $`> O" >z#G   [C` $` $`  $$`$,`(H /* %$@$` "$` ? $` !> >aP@\ @#; @H 0 @  > O"  >4# [esp_poll] [esp_poll: rescheduling] esp_poll: timeout㿘``*` *  * > O"  >!Ѐ "  x l@ "`@`  \ " 2 ?> O" >!@3?2 x  > O" >"@ e [esp_sched] esp_sched: not IDLE (state=%d)esp: busy entry on ready listesp: message queue not empty: %x! %d:%d busy 㿘> O" "">̷#"`"">˦# Q M  ` `,"*  ": 5> O  b>ˉ#@` "`&  "@ ?$ & ."!&" &" $&" ` * @2"`>r#`."." ` C 0 " >ɐ#b 2 [esp_done(error:%x)] requesting sense %s: esp_sched: floating ecb %perr=0x%02x sense=%2x; esp_done: resid=%d esp_done: error=%d %s: floating ecb%s: dequeue: busy ecb on free list%s: dequeue: unknown queue %d㿘  ``*`" * "@%> O > , !(>֐ ' , 2d    \$ , X$ , ( > 2R $  >!@ $$ ( ( @, X .  .  &  4&   & $ & `"`>ʐ!X`Ô &`" $`$``&  ? & `  *@ *  5  %  >aP!>@ŷ @M#` $`,b0$ ( > Ob `$ > ,˕!x , 2 ( 4>ˍ! (`> O , > O"  `" ,>|! ,`>v!  "=>  " `9> ""3>ʀ"$`>ʐ!S` ,b `  *@ * 5 &`` "`$` "@` "`$` "@ `  * *@ 5 !)`" `$ ` &`" $`$``&  & `ѥ%[esp_msgin(curmsglen:%d)] %s: msgin: no msg byte available esp_sched_msgout %d gotmsg(%x)cmdcomplete esp: %d extra bytes from %d:%d %s: our msg rejected by target MSG_MESSAGE_REJECT>>noop disconnect save datapointer restore datapointer %s: no DATAPOINTERs to restore %s:target%d: MSG_PARITY_ERROR extended(%x) SDTR period %d, offset %d %s:%d: async renegotiated max sync rate %d.%02dMb/s ident unknown %s: unimplemented message: %d searching esp: invalid reselect (idbit=0x%2x) ... found ecb%s: bogus reselect (no IDENTIFY) %0x2x %s: unexpected message in; will send DEV_RESET 㿘#> Ob >#Z"0 t  2">ː"PQ 0̀ " t"&# ." t b >ː"x@#*# " b!>ǐ 3  ." t*` b!>ǐ (  ." t* ># c "0#  b >ː" b!>ǐ    ." t* " ."" #."  &## `  '!> O`$!> O#`# ` > O# > O#  @!> O> O"!>ǐ ג  ." t* 0O!> O""># ʐ""   #   *`" * "h>̐#ē*@ 3 6 5 5 5X 9D 9D 4` 54 6|> O"""">ɢ""耣 6 " `> `"ɖ &""$$"`(" ."!> O""">ː#Ʉ  >~# " " ",," ."  ," > O" >ː"g "!" >ǐ _  ." t*` "Ő > O"">Q#8> O> O"">H#@ $" ." > O> O"">5#P"$$"$ !> O"">(#h2 " >ː" "!>ǐ   ." t* " .">ː#  y> O&"$t&"` > `# l> O#> Ob">### b">####,#,#4 `2 ` > `#>ؒb," }." |! ` > `#>Ȓb,b >ː" @b!>ǐ ȹ  ." t*` " @[."@N!@I,`**W" b, " /   ,>Ȍ  t*  t*  #4 &,   ,!> O" >ː"v @"!>ǐ o  ." t*` " @ ."."  t*  t*   ,>̐ X  ,!> O"">M 0# > O" >C 8>̐ H# > "!>ǐ 7  ." t* > O># z " >% h#  "    ` 2 `"+@2`"`& "@ ?" 22 `!> O" >ː" "!>ǐ   ." t* " .">" xQ> O&  &"$&" ` `*`" *  "*@  2"+ " * "    t * {  t*`> O*  t* > O" >Ƕ  !.">̐ "Ǯ " ǩ " >ː"Ǣ "!>ǐ Ǜ  ." t*` " ."> O"!>ǐ nj  ." t*` " ."&#[esp_msgout(priq:%x, prevphase:%x)]esp at line %d: no nexus㿐> O" >""f " "#"  ." "`?&#>ϐ!L*`@ > ?$ ?T ?, ?T ?T ?T ?L ?T ?T ?T ?T ?T ?T ?T ?D ?T ?T ?T ?T ?T ?T ?T ?T ?T ?T ?T ?T ?T ?T ?T > ?T ?T ?T ?T ?T ?T ?T ?T ?T ?T ?T ?T ?T ?T ?T ?T ?T ?T ?T ?T ?T ?T ?T ?T ?T ?T ?T ?T ?T ?T ?T >L ` *`" * " ." ."." ." ." 1&#" " >ϐ $ ` "  "."  ."` *`" * "   *   "." ."   .""&###8 8 '## x  t@ t* t2 *` } @ t* 8!> O"!>ǐ ƪ  ." t*` "!  > ؒ ƚ   ."    t*  x x@[espintr]%s: SCSI bus reset %s: nexus in reset state%s: illegal command: 0x%x (state %d, phase %x, prevphase %x) %s: !TC [intr %x, stat %x, step %d] prevphase %x, resid %x %s: SCSI bus parity error sync nego not completed! disconnect withoutwarning %s: DISCONNECT in IDLE state! NO nexus: target put in SYNC mode %s: waiting for SCSI Bus Reset to happen %s: target didn't identify <>[[esp: BUMMER]]backoff selector %s: RESELECT: %d bytes in FIFO! selid=0x%2x %s: identify failed esp: not nexus at sc->sc_nexus%s: select timeout/no disconnect %s: step 1 & !NEG %s: !MSGOUT (%s:%d:%d): selection failed; %d left in FIFO [intr %x, stat %x, step %d] %s: unexpected status after select: [intr %x, stat %x, step %x] %s: stray interrupt %s: ICCS: : [intr %x, stat %x, step %x] %s: ICCS: expected 2, got %d : [intr %x, stat %x, step %x] %s: STATUS_PHASE: msg %d %s: invalid state: %desp no nexusMESSAGE_OUT_PHASE MESSAGE_IN_PHASE %s: MSGIN: unexpected FC bit: [intr %x, stat %x, step %x] %s: MSGIN: weird bits: [intr %x, stat %x, step %x] COMMAND_PHASE 0x%02x (%d) DATA_OUT_PHASE [%d] DATA_IN_PHASE STATUS_PHASE esp: bogus bus phase esp: should not get here..㿈!> O" > x  )>Ǯ  x l@ 9@  L  '& L t   !"."  ." t* T " >А  ْ  " >А ֒ ." 0@?  @@ t  !  ɒ  ." t* T` "     ",>""" "į  t  !"  Ĥ  ." t* T;   x@ "# p@  x @ ""  2  2 `> !  " `$?#\v 0>А!@o "  >ː"e !"  ^  ." t*` "  >ː"Q ! K  ." t*` " ." `  > !`9  t  !  .  ." t* SŐ ! " D D." t*` " V>" `">`h >!" ."` *`" * *"` *`" *  " `*"."" ."" 2 ``D >!` "`,  $@ " & &  $`` ? $` &  ."" `*"  0 0!Ò " 2+""쀢 "'"" @2"" 2"` *`" *  "``*"` >>ß!>Ü!""*@.".""?`>Ӑ `*`@ L RT L L Q RT L|>А"  "쀢 >g"H>w"hm"" @" >n" ^ " ,  >`"   *`" * ""  "` &   &  "` ` ? "`  -@*@4 &  "쀢`.">""H t `   > `" *  `#,."-@*@." >"" =>А"   0< 2> `2`>"  *`" * "n>Ӑ"ē*@ N N P0 O` PX>А#   2">А#@  >А#Xْ #4 @,  , "." A." t ` =    `> #h  #\ »#`! µ  ." t* " ." >ː"§ ! ¡  ." t*` "  ."! “  ." t* ." ."!&"` &"`$&"  -@@w4 #  { !"  t  ." t*` R  @" ` >ѐ c  " @T  .">ѐ   S  t `  >  ` H  E ! ?  ." t* @ie  `,`( t  @>ѐ +  >"" ."`$`$" (  !   ." t* 8>ѐ " " >р`2"> Ѐ    " @^ @  @> !  >! >р @>ސ n&" @" >Ӑ  ! ʒ  ." t* " ."!   ." t*  >" 2 ">ѐ!   " `D." !P    &"` `>`! t  !    ." t* Q  `    t *``& ! o  ." t*`  &">"c!! ]  ." t* #8"耢 8 '"" x  t@"&">F!#0 2 "! <  ." t* "#8 8 '"" x  t@&" t* t2 *` } @ t* 8!   ." t*` !       ."    t*  x x@ 0% @>!" @."!   ." t*  &""  ."ѐ!#$@v 2Pr x㿘 @"  3> O" ."b >ː" b!>ǐ   ." t*` " ." %s: timed out [ecb %p (flags 0x%x, dleft %x, stat %x)], DMA active AGAIN xH /* %   ʦ   $ b (#\`#`b#db#hb#l b#p b#t`x @` >#> p>֐ #x R  >>K Q 0-E  $, n&   >>aP *0!@`x l@ "   O ?2`x " H 0bwtwo㿘>  V` 26 `@  2/ ` &` 2 & Mx ? >  2  2 @E<  E"`4 @" `4  ?䀢  `@ &` bwtwo/p4model: %s, %d x %d (console) cgfourcgeightunknown%s: %s overlay plane 㿘  > O#p `4` &`X&`\ &`8`@@ &``0  @i &`d &`Ȑ0 @i~ &`&`d &`   6. >30,/0  %@  ,@  0>2  EcP2   E @ E &` &`&` &`ܪ >"H>@[ےc`0&`4 &`8$&`#&`ؘ $ @C  @F$ $ > #h 7>  >>  , * J  > P"̀@ > ?  > #0 > P"̀@   $ 0`ܒ @h$ @ђ " >>#x@D`#``( ,@@>`   >>>###>֐#ے`>  > #0 ,@@`  @Bd> Ol l*    㿘 > O. c\"@@@"@ 0 "@" 8&<&@&D& H&L &@: &@Q   㿘@H bwtwommap㿘> O#\ > 0. @@>_ L@?> ܀`А@* > xؒa*   㿘>  2  ؀ 2  `@@@C 4@6  6  㿘>  ` ؀ ` `@@ 4@C0`Њ@ Ъ@0 Њ@ ?Ъ@0  ` @ ` *`cgtwo㿘` &`  `@   >  V` 4 Ð Ko 8@ cgtwoattach: impossible bustype: %s, %d x %d (console) 㿘> O#&`L&`P ` &`,`&`T  >"X>" &`8`( $#@A!&`<> A`,!@N@&`@>`4#`0>  20> "> PJ   > P"̀@ 0&`4&`8&`&`  &`D`0  @gj &`D0  $@gb &`̐  @@g[#` &`>k#(@Bt`(> >d#8> #0>  `(@@> O㬐 *    㿘 > O. c"@/@@ "@H"@",P  "@"9  "@"<C  "@( < &0&4&8& <&@/&,&&,&0& 4&8&<&@&& ,?&$&(,&H&L@@l   &  `  *   (㼘@` !G   Б,  @@  *  ,  А" @@  *~  ,  А$ @@  *} `H ` H " `H  㼘@` a$`G @H 2@` @H 28`@Hz . Б,  @  ?2@ `,  А" @  >2@ `* А$ @  =2@ ` cgtwommap㿘> O# > 0. @@>!@@?>  @* > x! @ cgthree㿘`` &``@    > ,  I|&88@  model: %s, %d x %d (console) 㿘 > O#&`X` &`\  &`` &`8   6  >  "      >"X>ڒb@X@ &`D`4 $#@?`<@`T>`,?@F@!&`H&`L>ڐ"`@`< > #0 > P"̀@   &`P`0  @eo&`P0 @eh &`0&`4&`8 &``&`$ "``@  $ s$  $ $ `" >>Z"@@c`4T"`(s> #0`4@>> O *    㿘 > O. cܐ"@/@@ "@R"@" 8U  "@": "@"EH  "@(A & <& @& D&  H& L4& 8&& 8& <&  @& D& H& L&&  8?&$&( 8&H&L @! @9! "@%  @&@   㿘@ ` @( 2  :`((ܖ@ :*  Ԓ " " cgthreemmap㿘> O#ܰ > 0. @@> 0#@? @#@?@ L@?> ̀  @@* > xؒa*   cgfour㿘`@/   `>` `&`  G̒ ?"  @? @  `@ &`%s: ignoring; not a pfour : cgfour/p4, %d x %d 㿘> P 0&`L&`P ` &`, &`T `(@@0>ܐ!`0Q   @c &`X&`8 $#@>G !&`<&`@`4>`0!>   > "> PJ  0> P"̀@ 0 ?@cΖ &`0&`4&`8&` `&`"2 *`"""?">Ɛ!@=c> P, ,*    㿘 > P. `"@/@@ "@R"@" ,U  "@": "@"EH  "@(A & 0& 4& 8&  <& @4& ,&& ,& 0&  4& 8& <& @&&  ,?&$&( ,&H&L @! @! "@e  @V&@W  cgfourmap㿘> P  > 0. @@>)!#@ 3? 4@1 0@&&@#@#@   4@  0 @ ?@>  @ * > x ̒a*  @ 㿘@  㿘@>i (㿘 (@>h:`((Ж@ :*  Ȓ *`" " (" (" (" <cgsix㿘`@  ) ` &``>     `4 F, ?"  @= `  `@ &`cgsix/p4modelcgsix on mainbus? : %s, %d x %d, rev %d (console) 㿘 > P p&`X&`\ &`8`  ` &``00&`4&`8 &`&`@bN &`ؐ  @bF &`ܐ  @b?*&` @b8 &` `/`4>ސ!*`@ z y y y y  ,@@ > 0>ݢ#`>  2$ 0  > #`>ޒ`@@T> H0z$ 0 $  $#@  ` >  > > ,@   "> PJ   > P"̀@ > ? 8 `> #0 > P"̀@ `>@ p:` `6`@~%  2 *b`h$"h">> 0  @a&`P@<`4` ``(Ғ>  > #0`4@;B> Pl l*   㿘 > P \. @5 㿐 > P.  `\"@@@"@"5 8 "@d"@  "@0 "@"X   "@"=  "@ "@8  "@0 "@N  & <& @& D&  H& L& 8&& 8& <&  @& D& H& L&&  8?&$&( 8&H&L"@B!İ"@s! 2@ V & "V @0 2   6 h ;"h 6 6 6 6 6 6  $6  `6"V !|*B 2 (B 2   !@  x v&  q&V   !'" @' 2d   8] "* 2` :`U $m5 (m/  F   6  6 6 6  6 @S &!@&" &  6 "6 V"!@p*(D@!|$D<@K  6  66 @(2  66 ??    R 耠4   ܀@@"@ " " R`쀠`R`R`R`"R`*  ???"R ?28    "i!|"i` :`((@ :*  ؒ *`" " (" (" (" < @ ! *` *`  *` " *` R ꀠ 2  cgsixmmap㿘> P \ > 0. @@>#`> P ` %>  > x!@* `&@`L : `̐@`* `ԑ* @   ?cgeight㿘`@_   `>` `&`  B ?"  @: E  `@ &`%s: ignoring; not a pfour : cgeight/p4, %d x %d 㿘> P!&`L&`P ` &`,`&`T `(@@0> D`0R   @_( &`X &`8 $#@9v !&`<&`@`4>`0+!>   > "> PJ  0> P"̀@ 0 ?@^ &`0&`4&`8 &``&`"@`" "@ s"` "@ "`>!(`(@8> P  *    㿘 > P. `"@/@@ "@R"@" ,U  "@": "@"EH  "@(A & 0& 4& 8&  <& @4& ,&& ,& 0&  4& 8& <& @&&  ,?&$&( ,&H&L @! @! "@  @}&@~  cgeightmap㿘> P  > 0. @@>Y #@3? 4@a 0* @@ &@ :@#@4@#@ -@ 4@H 0* @@@ !@#@  @ >3? ,@ @*` @ @ !@@&@ "   ?>  @ * > x ̒a*  @ 㿘@  㿘@9q (㿘 (@9p:`((Ж@ :*  Ȓ " " 㿘@ @( + j\  jV  jP ,`  @` @*@  *@   `*@   㿘@ @( + j&  j   j ,`  @@`  .@ *  `*`@  㿘!X`< E d !T00!T0㿘>  !X` X" `<@ " "`<*@"BԐ" 㿘`@       @ 8@ sbus: expected 1 interrupt, got %d pri %dif_le: Lance buffer crosses 16MB boundary㿘 >b@ 4`?`>"0>"80  @\ٖ &aT 6aa@͔ ?,@ @*&a>Ӑ"@&a d`>+b&`>+"<&`&`&`>+"d&`>!$&`>!&`>!8&`Bΐ 2>' `&aD&aXa< &aX& 8a<aX?< "  )> @{ $>(   @ >( `@>($   > @_ >(` @"$ >(!>``&aH> &aH&aL@VaHaX  h@Unknown3e/vmeonboardmultibus/vmeie㿘`@0   `>   ` ?Β 8@ ?Ȓ ?  㿘 @ 4(@A֐ d4(@ @(@2(@(@?Ȅ(2(@ @@0@㿘 @ d,A , @ (( @(ie_mapie kmem_allocunaligned dvmamalloc breaksie pmap_extractunknown : RAM CONFIG FAILED! pri %d address %s, type %s 㿘`D  "p&a>&a>"&`>",&`>"P&`>$!&a>"x&a@&`<0  @[ &`@> }"!?`< l`> "#L>"h`<j= &`8>"p> (`< @2 '>,`8  @ "`8>"`<a€&`4`8`8`8&a> €&a>z"  > a> ~a`8 @ `8?,&a`<@ &a " P&a$>!&`>!&`>!&`>A#T&a>A"&a@&`<0  @[B(H&`@`<  4?(@ `+` @[2"&`8&`4 ?(D !4(D@ 4 `c 4'`8a€`<`8`8#&a`8&a`8 &ad`<&a <&a$#"0V`@ `>"0J`> $@>"$`|>"$`>#|$`? "4`0<A!>A"ؔ> Pa!@*   >#&`(&`,@U`( 4 >#&`(&`,.`(  >@a ` @"$ %s: device timeout 㿘 >ch[  `@" %s: parity error (ctrl %x @ %02x%04x) %s: receiver not ready 㿘!!` @(@" >#(D (D(F (D!4(D! @ `@ `P`@``@` >#y  `@& !` 㿘%> P!!,`!( ` :` x & `-$x  2* * 2 2 *` * 2   2`* @*`2`   2 *` * 2  @ & 4  4  4 $ $x4 @Ē  $@% 8!("@*`2 *` 2!( 8" *2* 4  @{ 0 @M`ietint: command still busy! %s: send aborted %s: no carrier %s: lost CTS %s: DMA underrun %s: too many collisions 㿘6 r t", 6 t*`@"@  >Ɛ"     & 4  @'& >" > "Ѐ >"  >"   &  >#    & `& !  ",*`@"@@&! " &$ D ", `& 2 " @x& %s: receive descriptors out of sync at %d x.`@a(%2a(`' 2`# * !(`?# @2@ !!&@  &"   *% @ *% 2* @j@  ǒ?>` @C?"*`@#@ !!"" #!",  `~  䀢@  倢@  怢@  瀢@   耢@  逢@"  ]@  䀢@  倢@  怢@  瀢@   耢@  逢@   2< 耊`7   2 "0 ` @ @ ` ` `  `@ `      ޖ     @9 ??&  >b ' 2H /* '> c` 2`H 0 """ 2 a '䀢  0ݕ@? D$ d$ $'ܨ> #/> ܀ ' >b  4H /* '` 4`H 0 $$$4  ɐ l$ (= H /* 'ᰀ   r ᰀ$> #̒" > }"ؓ2`  * ` ?$` %ᰑH 0 " $($$$  4 ($ 6 ܀ 2 $ > # 4$  $$  $% ܒ"W #   "- @@2 *` ! ""@ $!@ 3@ $!@ @$ !@ - @e2e` 2`@ &* %ت ?# @2 @ &-  `  & 䀢  !> |# " Dܙ$# D<㿘"  "*%@ @  >`Ô @V0 @` 2`* %2 @_ &*`@e?# @2@Q  &%s: tbuf overflow 㿐 0`@"$@ dU6 0"( `Ѐ I   $`$`& `ؐ?$`؀ = @"*`@@, 2  %  :   >"`,2 @* @"2@**@ 2@@?$@`2`@ ?"@@ $@"$@ _" @ Yb,@ * @ 2@@ * ?2 @ "`4*`@@@ "@ * '***@ "*  2 @ *  $2`@ *  2@ `8*" *2`* @ 2@  a*  `8 #@ +`3 +` 0@ $@ 4`r㿐H /* & ! !€! !€! !€, 4$@',, ,  ,@ 8$, 2 , 4` 8 4" ',`,`,` @ @; d @  ! @i `H 0  H 0 %s: reset %s: abort commands timed out %s: disable commands timed out 㿘H /* &># æ  D%  t @6 t` @& ># ` @ >#0 t @6 tH 0 "㿐'!` 4   @> !> H!P@* rc> > Hr0@   %s: TDR command failed %s: transceiver problem %s: TDR detected an open %d clocks away %s: TDR detected a short %d clocks away %s: TDR returned unknown status %x 㿘6@%6`?6`  8 !&@ +`3 +` 06` 23@@ 2`3@! @  ``&@@>!`@>!( 0` >!H ?@ `>!x ?@ >! ie: bogus buffer calc 㿐! !$!€ ?#< !$3@o &>#!,!,& " `* & "  ?         "a( ?  `    6  , !( @ސ* !( 8"@*`2 *` 4`,    * !$b 2"  ?         "eؐ ?  `    6  , %ؠ @* % 8"@*`2 *` 4`,    * %Ԓb 2"  ?  ",&"(&" &"$ &    #  "2  4ؐ$'* * ?* !&"&  a?&   !( 8?& "@ *`2 *`! 2% 8!("@*`2 *` 2%s: multicast address setup command failed 㿘6@#6`?6`"0!  `* !* * *2*  6` 8!&@ + 2+  3` >@ 2 >#(  %s: configure command failed %s: individual address setup command failed 㿘  ! ? 8 @!$ + 2+  4`4"4 4 ! ,  , ,  ., ,  `, ,  , @ , , ,  ,  >  > (Q 0H 8 $ *2* 4`4!4 4 !   > > H! @  `J t !( 8 @6 t#@+`3 +`! 0 ! @  ` `@ 㿘  s 㿘 H /* & !@# @ ! @" 0F  !1@/ !2@, ;  6 0  N Dg0- 0 #$! 0@  2 0 0 ?6 0  @10 !1@9 D: D`4@  H 0㿘   &   "- "0   D @    D a t }6 t  *@ *`@6=   &  2 &! xdcxdxddummystrat㿘 <""> |>G! # H6" 0"& 0 0 ?& 0%s: %s %s: WARNING: no `pcyl' in disk label. %s: WARNING: guessing pcyl=%d (ncyl+acyl) 㿘> |"#`""`(`>`a0`* @n >!`/ `6"@>4`!` ``4>`D! 4`*2` 4`4``D`4``0`,` ``,,`@ `4` `""`(㿘`@   >     5Z ? . а"@  ?7g     pri %dxdc malloc: couldn't read controller params : %s: : doesn't identify as a 753/7053 : Xylogics 753/7053, PROM=%x.%02x.%02x %s: controller config error: %s intrx0  @Qr & $`L>h*` >$``#z$`d` " P? 6" P#`l@T $`p$`l@f#&L  `l |$`p $`h>S#@V&L  = `l*`h "@ @ * `l@ ` 4 *``l * `l`d * $`l ,a*,a+,a,,a/,a.,a-$`$``$`#\ 0#`    @˚ 2`l>$#0Ǔ,  S+,* `h* @` " >!>@#В > # a-``,a-8a- a* ,a** `h"  a* *a*0>   a-``,a-a- a* ,a** ,* `h* @"` a* 2#\a*#\#`    @j 2 a- ``,a-a-,@*`@`h*` a*  ,a**`h "  a*  ݐa*  !>@A (`0A>!$`($`,`(>`P`4"@q ' 0' ' "' ?2 ' `@2' @=H ' !   '"@i @=6 >>aP#*mI `  `?xdattach%s at %s drive %d: off-line : ERROR 0x%02x (%s) drive %d: ready %s: write format parameters failed: %s %s: read drive parameters failed: %s %s: write drive parameters failed: %s %s: reading disk label failed: %s %s: <%s>, pcyl %d, hw_spt %d %s: %dMB, %d cyl, %d head, %d sec, %d bytes/sec %s: write real drive parameters failed: %s %s: reading bad144 failed: %s %s: warning: invalid bad144 sector! 㿐 `(@ϒ h> P!&``&`0  6`6`&`&` * " P ! H /* %`  !>` !X ` `>!h`` 6`    ` #\@3#` 2!- ``.!-!-, @*`@ h*`!*  .!** h " !* `B!*`B`>j!x6` !>@!_6`>Y!   ` #\@#` 2!- ``.!-y!-, @*`@ h*`!*  .!** h " !* `c!*`!>J!   ` #\@#` ,  l  2!- ``.!-B!-, @*`@ h*`!*  .!** h " !* `,!*`!>! 6`6`6` .`.`6` ?2 2   }    ` #\@w#` 2!- ``.!-!-, @*`@ h*`!*  .!** h " !* `!*`!>Ѡ"  `  #\@E#` 2!- ``.!-ΐ!-, @*`@ h*`!*  .!** h " !* `!*`!>"8 .``(J 26`>"```k``@m`@i&"#\>": U   ` #\@#` 2!- ``.!-u!-, @*`@ h*`!*  .!** h " !* `_!*`"`!>E"`` ` @!?@@  `  #\@#` 2!- ``.!-0!-, @*`@ h*`!*  .!** h " !* `!*` !>"@ }ڒ`G6` ?#  2 " `@ ~ `2  `  ~  } ~>#``1z"  @:v  >!@t `(` @"$ `(@6`  `H 0  8> Pἑ(("   `8 `8(("`8`4(("`4`8`4 "`<%s%c: crash dump not supported (yet) 㿘  > Pa̙: a>!+ & +  a?` 㿘  > Pa̕:a*@` e  f@"O  m@"Xe e@"4`   h@"2`   n@" e g@M{ 0 e@"l t r H /*%`0"H 0_ 0!Z  &*"* ` @P& ``@ G` C A4`?  "`` 4`?# @4`2`. `@m '` 2`< 4``<  $`<4  *  a `>`@b`8`4@  $`<ڒ @㿀  > Pa̕:5a*@"H  *&" @M'' ''"@]  )  `6! . @     8 8*@$84*@$484  $<㿘>">p !z㿘>">p  !z㿘   ? : > P* a* @ "`* @ ` ?` o ?㿀 G> Pa̕:a*@  T    <@`( " j& 4 2" @'' ''"@ "  " < G` ` !"@  @& 4 < ?@  $9   >  # * 0u* 0s 0.`   `.`  ?*` `*` *`   ?2`   ?*` 0Y 0.`   `.` * *  *  * "2 * *0A` .`  0   `` `  .` $6`   2 6` .` ` .`  (@Y.`   @@Q .`   @6`  ( ` &` $ =`* @@@8 .`xdnfreexdsubwaitxdcmd nfree㿘` \ 02g !* 23!* @}  2\ !* &!* %> #>  2K !* !* !- ` 2> !- !-!* 2 2!*!* 2?>!.!* J  h, * * @@. P "`"` "` "`"`"`"`"` "`$"`,"`("`0  Ɩ@xdc_startbuf freexdc_startbuf bp%s: warning: out of DVMA space 㿘 !* 2?>̐",!* J 쀦 h,`* * @@ 2$>"耢`("`($ ("G: *  PG` ` !"@`T`*`   H<@}{ 2"<>"  !* ,!** ,`*  h* @"` !* 2&$!*&$ &(  "$%$ `&a& &  &  & & & & & :` & $& ,& (& 0 0@2 - `(@  xdc_submit_iorq addingxdc_submit_iorq wrap upxdc_submit_iorq㿘 L  h .`* * ,P2!/` *! !/ @y .!/!,  .!, 0N >"C >ђ  @= !8 * L2 *` L2 *` L2 *` L =*`  L *` !+  .!+ 0 >P>   @  @ ΐ!P㿘!, ; L! B ?.f   `  ? @Ԙ G ``.`: ?  @Ø 2!,3 @!+ 8!,( @w !, B!+ B.`:`*` *   h* !*@`    2!* 2 %s: off-line: %s xdc_resetx l,4  l@]  l @  *@ l`  `  * p Lb@* L2 *` L2 *` L2 *` L =*`  L *`  L  ?-א  4 L  l "! L l!> @ʠ Ȕ' Р"@ L *`  L  ?-  4 L 4>  *`  l+ڔ %s: soft reset %s: diag: xdc_reset miscount (%d should be %d)! %s: diag: lots of done jobs (%d) RESET DONE 㿘 `!*>"p в"@ L *`  L  `-q `4 L` ? `   h` 0  2i !+?.!+"U!.&` l/   * 2` *`  *  h  7 0 "`0F "1!-B  "`4`0`0("`0`$`0* "`@`0`,H@| < h 0`< `@ (E" A`0!*`.!*@*` h" !* 2 !* !- .!-` ? @ &` ? .!. *! !, .!,   4@, 2 !,!* "!,z!*!,!+!*!-   ` >" 6  > >"- >*"xdc_start㿘`"!, J @b .!.!,.!,̔ P ">! !,  L "!.%s: fatal error 0x%02x: %s %s: soft reset failed! xdc_remove_iorq: controller DEAD㿘 L ` @ ` #>b@z Ք ? >"ɒ>" `  *`    h` Ɛ @Õ-  l @ !+?.!+ 2  ` $`$` @  " `  ` @ ` Q2P`? 8L``$` ?$`$``($` `"$`( `$ <$`,$`$` , *` `  ,`$$`4`` @`4 ` `` @@, ` ` a >"@, `( $!. ? .!. *! !, .!,I ` ` "5 ?`0`= 5 ?9  `0  0$ 4($ 0`$* $ @$ @`, H@z <` < @ (ޒ" !*`.!*@*` h" !* <!*̐  @$`!-`1.!-  @$`!- .!-  4`4 %s%c: %s %d/%d/%d: readwrite [still trying, new error=%s] [recovered in %d tries] 㿘> "؀` `  Ő  0` > `G"  a" `a@  @  @  >">"># ` ` ` !>@7"ؒ!> @.#   2> >#(>#H㿘` ``?`  ?@&`!-?.!-`&`!-?.!-? X` V `$@" `"@ ` &`$ &` `(*  &`(``  @ @@ @ @~ ?-` &` .2`*`  .2  . 6``` ?6 `   "@. ` @]. !. /?-   `` 3 `&`@2( ` 4$  &` .2`*`  .2  .&`!. ? .!. *!  !, *!, %s: diag: IOPB miscount (got w/f/r/d %d/%d/%d/%d, wanted %d) FREE: %d WAIT: MARK: running %d: mode %d done %d errs %d errno 0x%x ttl %d buf %p %s: watchdog timeout 0  H /* %!, !+! !*!-(c  (_ H 0 ] #\>#@ {@s >u#`>->  ?j ?߀`*?>b#>)># ?X  ?  @*`>K#H   ? 2` h> l,` @# @@ ` 2#\ h 03 .#``` 40 >" "H /* %    h `  @" `` ?"`  h  " ``4 >#  ?  H 0>>aP#*`Ԕ 㿈'`  >#,*`@ T    2  2  2  2 r 2  }* t  2  2  2ܰ  2ذ   6?`!a> @*`@ p p 2 @6 2 , @2  " &6 "  2 @ 2  "~  2z @  2t  2n  @w ``   %:S  H /*%  #\#``,`. *  h* @`. h . !-``,!-)!- !* ,!**  h"  !* 2!*   $H 0 @vSoftware fatal errorSuccessful completionIllegal cylinder addressIllegal head addressIllgal sector addressCount zeroUnimplemented commandIllegal field length 1Illegal field length 2Illegal field length 3Illegal field length 4Illegal field length 5Illegal field length 6Illegal field length 7Illegal scatter/gather lengthNot enough sectors per trackNext IOPB address alignment errorScatter/gather address alignment errorScatter/gather with auto-ECCSoft ECC correctedECC ignoredAuto-seek retry recoveredSoft retry recoveredHard data ECCHeader not foundDrive not readyOperation timeoutVMEDMA timeoutDisk sequencer errorHeader ECC errorRead verifyFatail VMEDMA errorVMEbus errorDrive faultedHeader error/cylinerHeader error/headDrive not on-cylinderSeek errorIllegal sector sizeSoft ECCWrite-protect errorIRAM self test failureMaintenance test 3 failure (DSKCEL RAM)Maintenance test 4 failure (header shift reg)Maintenance test 5 failure (VMEDMA regs)Maintenance test 6 failure (REGCEL chip)Maintenance test 7 failure (buffer parity)Maintenance test 8 failure (disk FIFO)IOPB checksum miscompareIOPB DMA fatalIOPB address alignment errorFirmware errorIllegal maintenance mode test numberACFAIL assertedUnknown error >(*  4                @ L X d p |                             $ 0             < H T ` l x                                                                                                                                                               , 8 D P \        h t              (>#h>#>#>#>#>#>#> > (> @> X> p> >| >y >v >s >p! >m!H>j!h>g!>d!>a!>^!>[!>X!>U">R">O"(>L"@>I"X>F"h>C">@">=">:">7">4">1">.#>+# >(#8>%#P>"#x>#>#> > 8> `> >  >  > > > xycxyxydummystrat㿘 <""> |>## H#p" 0"& 0 0 ?& 0%s: %s %s: WARNING: no `pcyl' in disk label. %s: WARNING: guessing pcyl=%d (ncyl+acyl) 㿘> |"#`""`(`>`c`* @u > 0m`/ `6"@>4` 8`]``4>`D ` 4`*R2` 4`4``D`4``0`,` ``,,`@J `4` `""`(㿘`@    >     "?@b@    pri %d%s: can't alloc IOPB mem in 64K xyc malloc: %s: : doesn't identify as a 450/451 : Xylogics 450/451 [OLS disabled] %s: error: %s %s: 24 bit addressing turned off please set hardware jumpers JM1-JM2=in, JM3-JM4=out to enable 24 bit mode and this driver intrp0  @> & $`L>h*` >$`X"$`\$``" P? 6" P Hܒ@r '?  H @'ؐ H@r  H@rؒ  H @>" `0@ H$`d$`h  j  $``>u"H@x    "x`d`` "@ `d @  *@ `d @  *@ `d @  *@ `d@ ` *``d`@ `` @*``d 4@ `  *`$"x$`t    `` 0`dh$`l`0$`p#\#`@6 `p ` 2  `l"``lh` !>@ H"X(>%"`0f>!"` ">>">"  !>@ ." `0N`L   >>"`>">#(0> $`($`,sG`(>cP `4"@qє ''' "' ?2 ' `@2' @* '    '"@q˔ @* > >aP!p*Z `  `?xyattach%s at %s drive %d: off-line : ERROR 0x%02x (%s) drive %d: ready %s: reading disk label failed: %s (drive type %d) %s: <%s>, pcyl %d %s: %dMB, %d cyl, %d head, %d sec, %d bytes/sec %s: %s and %s must be the same size! xy drive size mismatch%s: write drive size failed: %s %s: reading bad144 failed: %s %s: warning: invalid bad144 sector! 㿐`(@> h> P"(&``&`0  6`6`&`&`&`Ԑ`&`*` *   `* @&`&` * " P ! H /* %`  !>` # a` `>#`` 6`    ` #\@#`` l"` l"```>#46`" !>@  ڒ(6`>Ր 6`6`6` .`.`6` ?2!22!0  } &`  `  #\@#` l"` l````  &``!> 8> `` .``( 26`> x````@`@&"#\> : y P"" " `@2 ` ੀ@ >`ऀ@>` ਀@  > Ȓ `V>I ۔``@R`@ @J @H   ` #\@.#` l"` ld``"`!>+!`` ` @&?@#@  `  #\@#` l"` l9`` !>!0@ `G6` ?#  2 " `@ ~ `2  `  ~  } ~>!PВ`a("  @(  >#@ `(` @"$ `(@q6`  `H 0  8> P(("   `8 `8(("`8`4(("`4`8`4 "`<%s%c: crash dump not supported (yet) 㿘  > Pb$: b$> + & +  a_` 㿘  > Pb$:b$*@` e  f@"O  m@"Xe e@"4`   h@"2`   n@" e g@M{ 0 e@"l t r H /*%a(ݔ"H 0_ Ҕ!Z  &*"* ` @P& ``@q G` C A4`?  "`` 4`?# @4`2`. `@q '` 2`< 4``<  $`<4  *  a `>`@qbd`8`4@  $`<m @㿀  > Pb$:5b$*@"H  *&" @nm'' '';"@n}  )  `6! . @     8 8*@$84*@$484  $<㿘>"d>p !hҚ㿘>"d>p  !hƚ㿘   ? : > P* b* @ "`* @ ` ?` p ?㿀 G> Pb$:b$*@  T    <@`( " K& 4 2" @m'' ''"@mڔ "  " < G` ` !"@  !& 4 <  @pؔ  $ H{͖ ` +    "@$ >"P . P $ $  $ $ $ $ $ $ $ $$ ,$ ($ 0P@ xyc_startbuf null buf%s: warning: out of DVMA space 㿘`>#pG` ` !"@`T`*`   H<@lz 2<># ! `&a$ $  $  $ $ $ $ $ :` $ $$ ,$ ($ 0 0@2  `( xyc_submit_iorq: stuck xyc%s: stole controller xyc_submit_iorq addingxyc_submit_iorq: xyc_chain failed! xyc_submit_iorq wrap upxyc_submit_iorq㿘 L ` -P f  0_ > >0{ @  Q` ` b@ >> Ȑ  !@>2 $P"4 >!@ L *` L2 *` L2 *` L2 *@ L *` 0 >P> { @   `@bӐ!@㿘 x@Ғ ` ``x 0 ` d 3 "`h`  & x@ ` *`<@ t  @ & t, *` `*   2 d*`  2$`x  *"  x`t ` *`2```   @Ӓ Ӡ` @㿘@  4  LBSa     ? @ '   ?  @ 2@ @2@  2@@@  " L`@ %s: off-line: %s xyc_reset㿀 p  p  *  2`  *  ` *` ߐ * p ` *` p `  *` p`"@  `  * p L * L2 *` L2 *` L2 *@ L *` L    ? 4 L  p  " L p!> @!  L b@ 2> ѐ! *` p %s: soft reset 㿘` > #Hǒ  L b@  ?     `` 0  2J 4"E 4&` d@ ` *` ` `2  *`` - 0 "`0- 4"'`) 4 "`4`0`0("`0`$`0* "`@`0`,H@k<`0` $"` ` 0`< `@ (7" 3`0&`z` ? @&` 4`` @ 㿘`  P`"``Ԁ" ``  2```  P%s: DOUBLE ERROR! %s: soft reset failed! xyc_remove_iorq: controller DEAD㿘 L ` > !  ? I > !> ! ` @ @*` `  *` -  x`` "  @" @  "   2  ` $`$` @ " `  ` @ ` E2D`? 8@``$` ?$`$``($` `"$`( `$ 0$`,$`$`  ,  ` *`  ,`$$`4 `` @B`4` `` @<@,` ` a >"@,`( 4 2  49 ` ` "+ ?`0`- ( ?)  `0  0$ 4($ 0`$* $ @$ @`, H@i <` $"`` < @ ()" $`$   @$`y  @$`  P-  %s%c: %s %d/%d/%d: readwrite [still trying, new error=%s] [recovered in %d tries]㿘>  !`` `  %  0` > `G!h  a" `a`  `  `  > !p> !> ! ```!> @!`!>  @ !   2> > !>"㿘`@W` ?`` ?`@&`&` R` P  `$@" `"@ ` &`$ &` `(*  &`(``  @P @K@ @!(@m?'` &` .2`  . . 6 ``` ?6`   "@.` @Ð.'  `` = `&`@ `   &` .2`  . . &`%s: watchdog timeout 㿘 H /* %    ` `  @" ` ?"`  `  " 4  > !X!  ? N H 0> >aP!p*P 㿈' - 6 2v  2r  2n  2j  2f  "`  ]  Y*  U 2O  @g `  9 H /*% #\#` 2 l  . l . l" w l  H 0`@gSoftware fatal errorDOUBLE ERRORSuccessful completionInterrupt pendingBusy conflictOperation timeoutHeader not foundHard ECC errorIllegal cylinder addressIllegal sector addressLast sector too smallSlave ACK error (non-existent memory)Cylinder and head/header errorAuto-seek retry successfulWrite-protect errorUnimplemented commandDrive not readySector count zeroDrive faultedIllegal sector sizeSelf test ASelf test BSelf test CSoft ECC errorSoft ECC error recoveredIllegal headDisk sequencer errorSeek errorUnknown error [>  *  ;8 ;D

 U x> R > O > L > I > F > C > @!> =! > :!@> 7!X> 4!p> 1!> .!> +!> (!> %"> ""> "0> "@> "X> "h> "x> ">  ">  "> "> "> " "<   "7   "2 40 @ - 0+ ( "' 04% " @    ! " `4   @  ! %   0    @ ` sisw%s: scsibus 㿘@>7! 㿘`@~  B>  2> ?2 &  22 >@}a 2+ >  "2 $ >@}ߒa 2 >  "2    ?>` @}̒a 2    s(?   si_attach: impossible bus type 0x%xsi: dma handle malloc failed pri %d %s: options=%b RESELECTDMA_INTRDMAsi: Set TheSoftC=%p TheRegs=%p 㿘 > P"<> P"8&c , c  $c@0 ($ @ , ,> PbD$ <> PbT$ 4$ D$ H$ L$ P$ T$ X$ \$ `>5"|$ d>5#$ h>"l$ l>#$ p> $ |``'>>!$ t>"$ x>!t$ $ c >!h$ >!$ > 8$ t> $ x>"$ $ >#$ > $ I"$ c  $ c    $  $ $cܐ!@  [$c쀢 $c>-#  c􀢠" `$c$c>#$c$c  " >@*Oc >ejc !@$c>#8c>#H >X> P"0 >#p> P"4 0@ @4 0%%@| ?  @ @  (>y  @ si_minphys len = %x. 㿘 P"0 >#P& <_si_intr: DMA conflict si_intr: DMA bus error si_intr: spurious from SBC 㿘 # #``"@>#`@>#Ȁ` #  & !# %V>x#si_reset_adapter 㿘> P"0 #>g #쀤``2 `4   4  4 4 4 4 4 #4 4  `$  $ $ $    $  ` si_dma_alloc: already have DMA handlesi_dma_alloc: misaligned. si_dma_alloc: xlen=0x%x si_dma_alloc: excessive xlen=0x%x si: no free DMA handles.si_dma_alloc: can't remap %p/%x, doing PIO 㿘  >!# F  >!0:!8>! >! &  #  ``>̐"  &  $ $ $  @  &  @b  $  > "@&$ si_dma_free: no DMA handlesi_dma_free: free while in progress㿘 ` 2 ># ">#؀ " $`   @c $ $$` %s: DMA timeout (while polling) si_dma_poll: done, csr=0x%x 㿘   '##0#P쀢 @@? > d hX   % > P"0 > M㿘@#  4 #? 0#? 2  2 ? 2   2 2 2 2 2 2 2 si_dma_start: bad pa=0x%lxsi_dma_start: dh=%p, pa=0x%lx, xlen=%d si_dma_start: Fifo_count=0x%x, xlen=0x%x si_dma_start: started, flags=0x%x 㿘   @#>" > P"0  &#>"0? # @4   4    4  ?# @4   4 4 ?#ߒ @4 44 4 <`4 4 4 4  >"X  " P P* `  H *@ L @ *@  X *@ `  H* L @ *@ `* > Pb0 4  ` & >"si_dma_stop: dma not running si: DMA error, csr=0x%x, reset si_dma_stop: resid=0x%x ntrans=0x%x si: fifo count: 0x%x si_dma_stop: excess transfersi_dma_stop: ntrans=0x%x si: Got Left-over bytes! 㿘  #ܤ  >= 0 ?& ?`# @4``@ >`-  "`, `&  o``  '> P#& '> P0 "@> ؒ 4  >!  M& $ >! & "@0 & >!8 7` 3> !X` `%?` "? @0?`c 2 ,?`,?` 2 ,?`# @2`,?`,?`?# @2`,?4`4` 4` 4`4` 4` L `* H*㿘@ #  $ # #   si_dma_start: adjusted up %d bytes %s: bad outgoing adj, %d != %d %s: bad incoming adj, %d != %d 㿘  ` @#>"^ > P"0 &#>"0[@     ?%   > P"0  > XE <$`% $% @   P* `!. > * `  H *@ L @ *@ X P *@ `!a>   `  H* L @ *@ `* > Pb0 %  ` & >"sw: DMA error, csr=0x%x, reset sw: short transfer 㿘  #ܢ  >ې 0 ?&   ?$  @ > ͐" "`, `W&  X> P b0`$>!8`4  >"  D& @$ >! & "@&  5     !> P0'&> P 2 * ?2 * c 2 *> Pb "b 2 * > P2 *b  "b > P2 *b "bb "b$ $  L @ *@ H*> P"0 >!8[> }!Pstdin-pathconsinit: increase buffer size and recompile consinit: bogus stdin path %s. keyboarddevice_typeserialstdout-pathconsinit: bogus stdout path %s. displayunknown console input source %d; using rom unknown console output sink %d; using rom > r>!0"c> }!P%l !%%>#> b%` ?`@P?>a@`€ `>!P0Ax` `@ " >`@>!ђ0*>`€a " >@Ja>@wa Ox? `J@ 2`J@ :  ` *`: ?@>a`€ >!PK x` @ " >@>!0>a@>@wOb  > &"#0@>@wCa Ox? `J@ 2`J@ :? `  *`: ?`HJ`LJ    > 0>    r-  @   "">"/ > P>>   > |r  0""> %> |>  "8 >"%> |>#"c screen-#rowsscreen-#columns㿘> P"Ѐ > }d!P $  ($  H$ <> ? 9> ~#>@bb K   * * *:` K?Ѐ` > P*2 "b> ~#>@Fb K   * * *:` K?Ѐ` > P*2 "b>  > P>  > P Q* : 2 "b P> P* : 2 "b> P"" p  $%>  " h%  #"$  $ %$ #$  ($ p ȟ€ > P"> P"4 4 > h(*`@ €㿘!> }!P> ha(* €9 㿘> }!P> ha(* 㿘> P"Ȁ`> }`p ( (> }!P `h *>a(  㿘  b@> }1> P"Ȁ  > } \d 2 &" !P> h!(+`@ `@ &   㿘6  * 㿐 H /* & p!3 > " `$  T  ' HH/` /` / 0 H 0& H  p  ?& pl H H 0㿘> |c € 㿘H /* & p% V  H   & pl Hr  H   p  & pH 0!@%0>!DE] H 0H( p a`" pH 㿘H /* & p " ? ?& pH 0 . h& pH 0  H P ?   *> "   H`€ H/ h  * >a(  @0h㿐> P"܀  > "      > PX> P ""ܰ 㿘H /* *> Pbܐ?"bܑH 0 ,> }!P c"2>@@ > J@   > J@  > h(*`@ ` € 㿐>    Ho o "  "ؑH 0$H/` /1>  > r H $ * P `> r H $*H 0 " 㿐  Ho o> "  / 0T@H 0㿘&   &R & @t#㿘 T= firm_event㿘` c (H /* & @  %>;, !iҖ ; @󀎠  ! " H 0` 2 4.$@ * c@ ``#$`  0H 0 #H 00 4 .c˔$㿘H /* &` ` 0 @ H 0  g H 0 㿘> |#0$@(%s: /dev/fb already full %s: forcefully replacing %s %s: replacing %s %s: attached to /dev/fb 㿘> |c,  > |#0 > (H "c, , `3> |c0> ( (`|E&c0> | "#(> |,"#,3> |c0> ( (`|2&c0> | "c(> |c(  > |#0 > ( "c(3> |c0> ( (`|&c0> |#0>`( | `㿘> |#0 $ 㿘> |c0$㿘> |0$ @㿘> |#0 $ ?widthheightlinebytesfb_setsize: inappropriate bustype㿐```">> `x`& &  (i `2f > ,@ A  0 "\ '2  E"U 2  E"O 2  E2  `"D 2  `=> *`@ l l l l m| m$& -#*$%& '$&@& #%"& ! " J  "$   $   %  & #&@& %%& &  @uG & : & >@ʒcP& >cX@Ĕ&  >@u1`&@:& >z#pJ   * J(JЁ㿘   @ screen-#columnsscreen-#rows㿘> l"&   4 & D & @ & 4& 8 >  & <> `2J`P P& L "& LJ`Q& H1>  !> ~>#@Ub P$`>#@Nb "$`  " $`$` @(`$ ">$`$$` >"p$`@e>>"D"`@#``#dd"@@d`?"@0 d0E Ed0# 02   0#dd` 0 #>   "! mouse input parity or framing error (0x%x) ms_rint㿘!> !   >y`А?4!Ȑ (4!!Ȑ * : `-*`>!@ t8 q q q q r 68 .    6* : @&  6* : @& ?6* : @& >y! N  4N   *@'@> > !> "Ȕ  ?""UJ* @  3@ # "# `#    4 @   "   ?"!#3 # > "# " #    4 &     ?"#3 # > "# " #   & . &  $N 0 "N 1. 0gӐ N 1  ,]j 㿘> a  a"a[??@? &?  㿘!> !$ X  @ $ , 㿘> !V - ~@0  @" }@"$  v@ @" > Ȇ@ (1>  @  " ` 㿘> !> } keyboard-click?true㿘> }#$ $ >  $ > ~#>@a耢 >@oa  , #kbdattach㿘>!P @m> "c@m > > }"᠀`@  & >wߐ"h@Unknown keyboard type %d 㿘 2  g > q"&> q#p& &   " N   ".  " N   2.  " .  @C . >x#. kbd_translate㿘``(6   @ $ ?`*`> @@ x xT x\ xp xd .`  .` 6` .` .`>wz#V` "@`&`?"?N`   2 6  ?  >( 㿘H /* & H   D ` I>> a ?6H 0keyboard input parity or framing error (0x%x) keyboard event queue overflow 㿘#> }c H >$ H ?D>!x   $  , $, %4  \    ğ@L?, $P, & 8 K, $  O Bc`? $ H$ D>> c >ђ021 , @*  ? ("   >wla00 6   # > "# " # $ , 0L < "L =, <e (L =  8[ 㿘> ~`, `,6 ?"`, ??П@ H /* &?䀢   "ğ@?ܒ!>>Pd[H #" H 0 > ~> ~G  " ,㿘!> }#& I (# 2& 8 @ & 8 㿘> ~ C -㿘 "~@ > }]#@ &# @" % Z#@#@K ð  Z#@"| %#@"s &  "}@"   v@" 8 #@"X #@"  # @"O 0#@" # @" 0# @"&  ~ -| &y vv - .  > ql > q"#p?#b _*@  > qX > q"#p @ N6@V J  G$  D& ", ' H /* & H x  > " > cz H 0 . 6 , '.: & &  @ '  . @ , = ` @ 㿘> ~ Ɣ㿘> }# #D  " `! 4<  &9 `" `!3     *` "+ *`' `H /* & H x  > " > c  H 0   ğ@ fpu_cleanup 1fpu ieee trap, but no exceptionfpu_cleanup 2fpu sequence errorfpu hardware error (%s[%d]) %s[%d]: fpu hardware error fsr=%x fpu errorbogus fpu queuefpu_cleanup 3 ` : A`> #*@  $ h h > tҐ!2'> t̐" > r > r0Y[('` 2$'> t"(> t"8 > bP  0uV> "p 0t' ? Y<O&`> "u > t"` 6C&`> r > r ,`0   > ~ h@j@> t~"'@+ " '  "`> " '> `   *   X`tZ" Ȣ`&`㿈>!@! 2 ! <  42L@ `8 @ ?& &   2  >!!, @ x  \ t t , , @, *@- $  $ @@ @  ,@ @  ,@ 0`& 0@b @ٖ  ,@Ԗ0K @Ζ  ,@ɖ@lI @  ,@  @  ,@ @    @p*@ $J bF$`B  @  ,@`@  @ @u  :`   p*@ > q#J $*@$`-  $ `"""  fpu_add㿘  ,@,``2   @@` 2    z&   v&  r $L   L$T$X6  $T  @" $X $`  2   $`  $`  $`  @#@$`@ ` 9$`        e#   2$`$@`?$`  @>"` >"r!$` e $`$`$`#$`@㿘   , ,` & ; 2"6 2- 2* &4"  c    "    ( & 㿘  ,`  , ` ,@8 `2  @2@ 0  ,`& & `2  & |&   $ ( < @ D Hc@     4   4?" &  C@ c@ &0@ 0$  C@ c@ &0@ 0$  C@ c@ &0@ 0$  C@ c@ &0@ 0@ $  $ 㿘`  & `&  & & & & @ 㿘6`?.@2`*?  & & & & & @  2 ?2&  & & &  ?& & & & &  㿘?.@2*6`6@g.<  & & & & & @U '2 <2&  & & &  ?& & & & &  㿘?#@*6`#6@.6.7 @ / ?#  & & & & & @ @  ?2&  & & &  ? @& @& & & &  fpu_explode㿘.@3`&`&` @" >$"`>$5 D `k  ``  p"2 &@` 2&@ &` & ?&@㿘````6/`7`/ 7 .` @26  0+& "``!` ` &`  &``2&`  @F&`&`&`&` &`&`&`&`  0"     `?㿘@ ` "`  4  r@"@ "`  $ ` $@`2 0 1#@ ? $ fpu_ftos㿘@``* @Ғ [L `D`2`K  Z@’"@Z  `@2`8 ``@$``+@ Y`@2>%oߐ!8 @`@"   s"  "1 1 4. `?*@㿘`@`* @u >L'``@2`&I  =@a"@  `@2 &5@   @& ! @F <ޒ `@"'  "  ?&1@&1  4@`1?&, `@*@㿘`@`* @ V#``@2`& &&V#@ ! @"@  @`@2 & &&=@   @& $ z `@" #  "  ?& &&1@& &&1 4@`&`, &`@ & ?`#@fpu_implode㿘 >&>&& &&n&nǐ"㿘   ,@ ,   ` @ 2 @`  `  &   ` ` ` `  3 +`@3`(@0(@ 0@@   2    3 +`@3`(@0(@ 0@@       3 +`@3`(@0(@ 0@@     3 +`@3`(@0(@ 0@@*  `#  3 +`@3`(@0(@0`  & & & & & & & 㿘 ` `"  `@`"   $   ( B : & " B @  " *`@ B 2``@ $   b   ` B  b   *` B 2`` $   b     B  b   *` B 2`` $   b B &   @ b   *`@ B 2``@ $  $ fpu_rightshift 1fpu_rightshift 2㿘`>(  >(m6!8   `r @  2& >(m(!P& & &  & 2 `_       `?     `$`    ` "( 0+ 3* 2+@@3@& & & & & 㿘 ` ?    ?`8#  ? 7 @  6`@ )1(@0@// @ .`@ & 0@@(@1)7@/@##### " ?" L" P" \" h" d" ` LWARNING: matchbyname not valid on sun4!%s 㿘>   >)`@dU  `?m{ @` >)mv h  9 Ff  (  9F<("@bootstrap: sun4 machine type %2x unknown! mmu-npmgmmu-nctx/obio/interruptinterruptbootstrap: could not get interrupt node from prombootstrap: could not get interrupt propertiesbootstrap: less than 2 interrupt regs. availablebootstrap: cannot support capability of > 4 CPUsbootstrap: PROM has invalid mapping for processor interrupt register %dbootstrap: PROM has invalid mapping for system interrupt register/obio/countercounterbootstrap: could not find counter in OPENPROMbootstrap: could not find counter properties㽐  >  Z !> ~ X!> x  @c# > r H($ H,$ L$ T\$ `$ X$ P$ `$ d$ l$! $ $ t> `"">A!"@!> !( >`"" `"`#`!" ">  `$" $> !  !  @!>  "` !>)la!H@ ''>  @>)ax@ >)a@   >H2 "`>Є2  "` # @!@&^> x >  u">)@ 7! @>)@ܒa2>)k!>)@a 2>)k!  >)k"  >)j"X?, ~ 0Ԃ`  ", >)"j?P@@ ?`, = 0Ԃ`  "?p>)jא"@ ?p" >)@#  @/>)@c02>)j#8>)@c0 >)j#h> "bp* => }" kernel not compiled with KGDB 㿘!> !@b!#> b` ` @@Ab   xL -t#> 0P` 9'> L /4 L" ** L`@ `/ *L @? L , : L :2 `  L?$` $@`  Ȁ  $,> @!> "   `)L - #>  L b"b d  a b  sb  $b $b>*k!#  $btwas brillig.. vmelvmesx%cc%c%cobiosiswespbootpath_fake: unknown cpumod %dfdsbuslecdx>  2'>+j"00''N` (>`pJ@ ,>`hJ@ ,>``>  N@ x> iN` d2>+>+"@&"@"H&"H > . ?& & & cȰ  "cȢ>+N`mbP@ap?& !> & & #Ȱ `$#N@>+N`mbX@a]#&  $#& %&  l2&N@N` e2"N@>+"`?&"` !> . & & & #Ȱ `$#N@>+N`mWbX@a3& & #&  $#Ȁ sN` d t r>  "">+ # !" >+O>3 $K>>+?"H> &"H >+. & & & bh 6bh?"`> &"` >+. & & & bp 6bp ` ". & & & Ȱ   ">+"`?&"` > . & & &  >+"x`"&& `"& &   >+h"> r H LJ 1:  :  N@>+N`lҒbX@`& v&  f2N@N` d2N@>+"6" . & > &  "d&  l2#N@N` e2N@>+?"> &" >+. & & & b 6b ` ". & & &  @"Ȁ s=N` d t r5>+"?&" > . & & &  >+"x`"&& `"& & N`r >+leb>+N@l^bX@`9& & > c&  "cȁbootpath: /%s%x/%s@%x,%x:%c 㿘>-iV N >- ? >->-!?iH!?iB`>-! i;`a N  >-i3!(> | 8 8WARNING: %s map is bogus, using default 㿘>  . > "  ) > ~#@">-@_  >-!i  "?` @&@&`  L ?Ѐ "``0 "?sd-targets㿘!> r L  > |>-> |#c< $ L> |#<. @st-targets㿘!> r P  > |>-> |#Xc\ $ P> |#\. @configure: no memreg found!configure: ROM hasn't mapped memreg!device_typecpuPROM root device type = %s (need CPU) mainbusmainbus not configuredx> ~"">  L  >˞#> <># '# ?`"`">ʘ#R@  *   " `ٔ 2 >-gC#' > ,''GՔ > "bd>-g2#>  >@>-@c>.@_` >>. g  >.@|>. 8> ؒ>.x"'['쀢 >.g @H / @@>" PROM sync command㿘>.f"%d㿘@\##> ||>.@\Ȕj˒@])#耢  #@^j .,%s at %s %saddr 0x%xio㿘@>. g#P 4  0 >.#`>.#p>.#x g 4 no PROM root device㿘> |# 2 "#@G 2> |>.f#"#name㿘 " !>/@ @@^^ @- property lengthreghierarchical%s "reg" %s = %d (need multiple of %d) warning: %s "reg" %s %d > %d, excess ignored address%s "address" %s = %d (need multiple of 4) intr%s "intr" %s = %d (need multiple of 8) WARNING: %s interrupt %d has nonzero vector ranges㾘@^+!>/`@!?>-c@I  @>/@]` " @_ޒ >/ Ȓ>/g  p >/!gV>  >/ >/f & &@`Z &  ,>/a  @F ? &   >/!(>/fז < & (>/aX @. @?"  >/!`>/f < &!0? > , ` ?` "`>  2&!>/a!4@ Ƞ?" @` &! 㿘`@]g `? @ H (  x virtual-memorypackagesoptionsopenprommemoryinterrupt-enablealiasesauxiliary-iocounter-timereeprommemory-error ` x x h eccmemctlSUNW,sx: %sobio missingNone of the CPUs found fbno options in OPENPROMcould not find %s in OPENPROM audiozs㽈#>` 2 >->/`@!>0@!f>-f!(` 7 @]">. '%>.|Y @\"> !''>+"`'Y 2>0>0d! \ ߴ \''c|Y  2'0>0>0!8 h>  @n%>-!>.@M@\  `@i`2'>0d!'>. '''ؐ>.|YZ > "   >0a@3 > "c0@;>0`> ~ "c>0d!> !'2'>0!edvI  >.|Y$ 2deL 2V>-#'> r>  @  @ޒ>.@\*` <>/@Ԓ`@ @\    % >0@\a>0@\a T $TT $ 'H 0+'>.|XȖ @>>   findzs: unknown zs device %dfindzs: no obio nodeslavefindzs: zs%d not mapped by PROMfindzs: cannot find zs%d㿈>  &!> "<  <@ >18>1 '''"pcÒ '>`, DW' !>: ? 2>1@W ` >+b`>1c"@I>0a>1b@2? >/a @+ 2>1"c@7>1"c~pre_panic: makememarrmakememarrmakememarr: hope version %d PROM is like version 2 makememarr: limited to %d makememarr: cannot find "memory" nodeavailablemakememarr: no memory foundmakememarr: WARNING: lost some memory 8>   > r >2> r H$  H$ $ d+ s > "  " & %>2 "`0$" >2 c `N P>2`$` $ @` A >2 c`>2 c Ȳ L@>0Z`ؔ>2bې!">/>2>2!( bΐ  @3)`@]:    >2 $ $   >2b!8c!XWARNING: getprop not valid on sun4! %s node %x property %s length %d > %d 㿘>  >2#c > " `€>2` 0#c 㿘> |cԖ ?" *㿈Ȗ  㿘> "  @㿘> " @search_prom: null nodeiommu㿘 >-c!>/  @Z  Ԑ>/>3b$!X @>-#@Y #@I >/@Y`  >3@Yap ƒ 2ې WARNING: opennode not valid on sun4! %s 㿘!> "` >3"b `@" @  㿘> " `€8@ 㿘> "  8 |@Y |€0@' line# >body >user %lx ! ' column# >body >user %lx !stdout @ is my-self addr line# %lx ! addr column# %lx !romgetcursor prom version0> "` `  @>3c>3cek&@&@@2`">4aj   @  PROM exit failed㿘> ? > " x"> " tPROM boot failed㿘> ? > " x"> " d@>4a2!H㿘> " l㿘> y#&#> r ` `*`" *  `@@?" >`@$>$> (: * $`@? @ erdstxdsdxy㿘  '> r@X@@X ``?use one of: %s[a-h] %s㿘@( >4aϐ#> # >-5>43>4  a  2 c(a   2>-a!(parsedisk㿘`< N ` ? 4> .,&> # "(,  @Xb  2  >4`x#Г* *@& 2  @XK  ڐ?  2,no memory for mountroot_hook㿘  6 2>5`N @XQ $ $ > ~bȔbȀ $b" "b$ root device (default %s%c): swap device root on %s%c can't figure root, hope your kernel is right ?> #Ȁ  'p* > !@   > y#  > `"> b "b> " >5!x>5`!x` >5@ ` a `>5`!@  `@W`@W J? *?*?x tt t>5 @ A>5!`>6 ,>5`!` >5@   b`>5`!x@ x`"@ *  ؔ ؔ D ، ؔ ؔvw*  a  p>5@ > y?'p> y?"`t> y"#p> y"#'"> y# o> ~u> y`,,  @" `> y2` `*` ! @"> y?"c'p> yp?"`"@  !>5> y>ʐ#`"c> }`M"b> y> > yc"2` `` `: , "@>5!``,a ?`(!02#"#"@> y##  `: > y?2 ? > yc> ~> y#"c> ~"Ȁ` `"` @`2` %c㿘 )>-H "*  @   "  0 @  #    _Ő!(,>6?_"0԰ _!(0π@>6 >6>6_"0Ő"_,config_attach: device name too longx> #>.bȔbx@VM@VJ >7^z @VH@Vg @VP؀     *`:`J   㿐/> r%/> 㰬%/>  %    ,%+> `-`   ,% +> `-`/> rก@̀cache_enable: can't handle 4M with hw-flush cachecache enabled cache NOT enabled for %x/%x cpu/mmu combination Unknown MMU architecture...cache disabled. 㿘> ">`"쀢`o Ҁ> "   />T>7H P>7@> }"c> }|"c> }"b  @  ڢA@ @  Ѐ%Р> " " >   J"c>7]!  ` @> }>7"0^ 0?"#> }""  ڠ ڠ ģF ģFЃ@#У@ "$*" ģFڠЀ#Р "$ "^"h> "> }> 0*@"> }"" # @ ڢ@@@ @ Ј@ Ш@>  "b>7^v" > X > b b>(>: , ֢ 0`8 `> ֢`֢ > #X >" *`*`8> "8 "> ԢB@Ԣ@@> #X >" **`*8*`> 耠>(?>: , ֢@@ 0? 8  > ֢B ֢A@ > cX> ""cX" ֢0>, 8  > ֢֢㿘>   > >   ֣0_> # [> 0> @> (cX2`>  "`>`,@RB6#  .? > ֢@?@07%,? 2 >    آB?֢A?@ 0#c @ 2  ?6 6 R `?0c @ 2   >  >   6 02 > w┄ $   2 > w┄  `? 2 > w␒@6 ?> w*`( ?2 > r| ? > w @ "(v`?㿘  ?`` "@ =&@6   . `,+?%  $(,048< @?܀        "6 . ` k``?6 . ?6 8&stray interrupt ipl %x pc=%x npc=%x psr=%b EC EFSPSETcrazy interrupts㿘 >: !  >:\>aP> > |㰐"  > |c   "c>:[$!`> | "c"㰁㿘> "Ā  >  > :>  ,J #> Ho o> """H 0 * )> > Jc "*c intr_establish: level %d interrupt tied to fast vectorintr_establish(%d, %p) %x %x %x != %x %x %x㿈Ho o> |#:  >:"Z  >>  7. > >`4 . !@>!|>!" : ?.)@  >: `@>:`(R@>:#(?@*@ `)`#\  #`(R#dZv. > x @@2"@&`H 0 intr_fasttrap: already handling level %d interruptsintr_fasttrap(%d, %p) %x %x %x != %x %x %x㿈>. !6` `4c@Ho o> |#:  >;> x . @ >; Z(>  2>>!|!": #)  >; @>;(R>;!(?*@)#\ #`(RY#d!> }" #> `̟  @$  q8 $$ `̟ > | *@"H 0setrunqueue㿘  `2 >;Yǐ# + > !&>  ἑ* @"& ""remrunqueue㿘 > a2 ; 2>;Y# "` "@& *> !@@  * +#areal mem = %d startup: no room for tablesstartup: table size inconsistencystartup: cannot allocate buffersunable to create DVMA mapunable to allocate from DVMA mapdvmamapavail mem = %ld using %d buffers containing %d bytes of memory 㿐> y>`# > ZO"b> }c><>`( ZG* @ > !%> @ ˒*@ ><Y. 0@")> ><Y% P '> xܘ , 91> &  "'  "> x><Y x  ܐ@N@OQ)>,@ , ,@S` `Z> x ܀ ꀤ'>  > "cd>?  !> ?$ ( ?#> ?$a<> }"r > "#@><X a< ( "  (@ "> ><X >< a<> |Ȓ"@ >0>`(@ 2@ 2 ]G!> , #> }': ! /&  ,`$bؒg:` @Pa> c̔  > }"b> !> >!p "a"?  > !, "?> `><> a Yn* > x> !><`,> x@Sl!Ya> }"?H > ~!` @ >  > x?L?H@/ "`㿘> >"a!p> * > "">!d1> x*`"ē*`  > }#@MΒ & > x`܀  #> x "`ܐ "`#> x`܀  $`` ̐#3*`@(`ܐ$3$``>`,@M* 1> x @4& > x؀ 2 > `ܓ2  :  ?!"ؐ!"> > x"> } > |*`" * > x"t >*`" * > `" `:`d ?"ȱ. 㿘  ` %> ԀT$Ԑ/ *& @O P$`D ?$ =#$  $ H$ ,$ &`  ->!l@$!! `H  ` !*@ `!!#!  'H'L'X'\'``'d`'h@'l`'p?P ?`0 't! * @  0'L'Dx?TD䢲?@1 H䃔 ?嵒 > $`>"a>" "@=#" $` $`$`H㿘|@1 = @`23  ˔ ", ` `  $ <* `< @"` "`"`"`"0`"H@  $a  a ?"a ?`?" @$ āhalted WARNING: not updating battery clock rebooting 㿘> >>W"Xi> ""> x >al > ""al"(>>@9Wڐ"hH/` /  !?>>W̐"Xh@?>>W"  > |# s*   @> |# d* -> |*##*> |*#> |Y#㿘> x> #"`>  8> 0 > ( @2@  # @-u!> x @> y#.$ 2 * "@*`> r @``"@ >> x`,`: @ #``> 0" *` > (@  :@ ?$ * " #`> |   dumping to dev %x, offset %ld dump area unavailable %d device bad device not ready area improper i/o error succeeded error %d 㿘>% @#> yc? > x '> xr>?cW !Xc2  *"@ *`> r@`@>?V!x?> >?V!0 8c> #2` `*`" *  A 5 #  > ,<` @:- -> |"8`@>?!Vȓ4`@@e > y#̟@> }̐"@I@2  4 @@ ڠ" ǰ @,2>@ 0-@ >?V!0>?V{!0>?Vw!0 >?Vs!0 >?Vo!0>?!VjFrame pointer is at %p Call traceback: pc = %x args = (%x, %x, %x, %x, %x, %x, %x) fp = %p 㿈>@ VE>@VB! > (44@@ <  $ ( 0 ,#\ 4#` 8>@#d 8!(V(#h 8 >mapdev: zero sizemapiodev㿘> |Ā > ?x"> !8@`>@T" @?@@">@T"( > !@*@> > 0 @@ * > x!/ @%> ~#> }!> b `@  @& curproc = %p, pid %d no curproc cnt: swtch %d, trap %d, sys %d, intr %d, soft %d, faults %d stack trace with sp = %lx stop at %lx %x(%x, %x, %x, %x, %x, %x, %x) fp %p end of stack trace 㿈>!l`">@>@`0U#P> U#h> c`c#\``` >@`U#x#>>@#U|>@#`,? Us`,   >A <  $ ( 0 ,#\ 4#` 8>@#d 8#U\#h 8  >A> ,? " <>AUL g0 panicw: case 4 w: unknown case %ld w: arg not allowed 㿘N@  t>A0``>A>A>AT!p !U!0 0!Uwarning: ldcontrolb called in sun4m 㿘>  >AU"@ H/` />!l`2`> ` ┒$` H p@` * ( 22"  *@ `  `*`0*@2@  `*@㿘 u P 㿘 !<@ P*k@<  "@ `    `  㿘> x 􀢠!  N! 㿘 `E!    mmrw㿘 > |cЀ   #>B#В!`#Ж  A*$#а#Ѐ #> | "c` р Ѐ - 7> ~> }"+> '>@`  ``&@? &`>BS( >B!  D D D D D D D D ` @ 2` > a cԀ ,   `@ ``> 0, "@ 8  cԔ; c԰,@@ u`` ?G# ,?H `>  L >  `  ``  " @8 `@@8 ` @? ) S (` "&`J >  4 =k0` !> `# 2 ` T,)+ ,@J$#`,@8#:$  @`@$@"$``< @ B `>`"&``  "=@ !> |#Ѐ #A$#Ё ->@?  㿘> "؀  "  @ " @ 㿘#  T(ɔ &L, ?㿐#@2> ~#  &`'> |؀@> ~#@"'Ho opH p@  $'' > 0"ؒc@  @   #@P0#@Ӱ 0#@0#@nȰ `ð 2Ho o€H 0 @` $  T(G 'Ho o H 0Tc` Zt SmHo o H 0 @2T S7`Z .2HHo o€H 0@I @ $$  m("2 Ho o`% ! Ho o@H 0> |"#& ")A T ); TVA2PA: Asked to translate unmapped VA %p2`((2` :`  ` 2`((2` :`  ` 㿘> # >>  > "҃", ҋ@",*` 6 * @*`6    0 آ`> @ "@㿘 @  @  $@ `@ $@  *$$ `@> "> Ё"@> 8> > ?  `?`> 0pmap_next_page: too much memory?! 㿘> > `8+    > `T@ 2>  > #@  *` #`T> T>  Ā@*&>EP` 8T>`,  "Tpmap_page_index: pa=0x%lx㿘> !Ē@ >E>  Ā@ >EPB!> # > ?  8> ! @ * @*  ?2@> !"@6@> > 8@* ` ` mmu_reservemon called on Sun4M machine㿘 > ` >EO"@``#?> " L)?> " `2 @#?> " L)?> " `@@L7> }/> -> 4` *` * @@`Д@`> xa &>  0?  > ~ؠ? > ~ H2 @4` ,   2 > }` * `? @> ,Є@Ф@?@ @ >&@&mmu_reservemon4m: no existing L0 mapping! (How are we running?mmu_reservemon4m: can't handle ROM 4G page sizemmu_reservemon4m: unknown pagetable entry type㿘  !Ѓ* H@ %> Є( 0   У@%> 0c ,`> @/ 0" &@@?@I* @JP> "&@0*` ` "@  "> ~>F" >Fz>F">F O!"@O `# <$&@@G"@ 0҂` `  *  /% $أ@`҂` `  *` ҂` `  *`? @҂` ` >D * " N> "2 "@& $ 0҂` `  *  /% $أ@`҂` ` 2 *` ҂` ` 2 *`? @҂` ` 2>D * " N& (@`N  mmu_setup4m_L1: unknown pagetable entry type㿐'?. # c"+D    >F&@`  @F > !0 ?a&@Fz"@@Fw"$%` p҂` `  *  o) $¡`҂` ` 2  * c @ ҂` ` 2  *  ?# @ ҂` ` 2>D * " N>2  &@ ?  `  -` a& ?@F1"@ 0҂` `  *  /) $Ƞ@`҂` ` 2  *  #  ҂` ` 2  * ?c  ҂` ` 2>D * " M2  %$ ,  * ?   `+ "? W`  @Eڐ> a0 ?a&@Eϒ"@@E̒"$%` p҂` `  *  o) $Ƞ@`҂` ` 2  *  # @ ҂` ` 2  * ?c @ ҂` ` 2>D * " M2  &@@`M#в`   `mmu_setup4m_L2: unknown pagetable entry type㿘?. #?#-?  "\  " >H$ .  ?!&@EV"@ 0҂` `  *  /% $@`҂` ` 2 *   ҂` ` 2 *   ҂` ` 2>D * " M#2  $'    * ?   `+ "I .  ?!&@E"@ 0҂` `  *  /% $@`҂` ` 2 *   ҂` ` 2 *   ҂` ` 2>D * " LВ2  $$@@( `@,`LÐ x `W mmu_setup4m_L3: PTD found in L3 page tablemmu_setup4m_L3: unknown pagetable entry type㿘 ?. `І `" >H `"  >H &@&@L#L#`@   me_alloc: all pmegs goneme_alloc: LRU entry has no pmapme_alloc: stealing from kernelme_alloc: LRU entry's pmap has no segmentsme_alloc: LRU entry's pmap has no ptes㿘>   ` "`" "@&& ""> !H !H>IL5 ` `2> }>IL. "䀤@2>IL' ` "`" "@&& "" *` ` * @`2 >IL  * @ @>IL >  - "@@䍀@@ )`> )>  `"ꥀ> - ꭀ@> # >  >    *` *`:`* @>>   "ꥀ>- ꭀ@>    Э@`  е` > }"`'# > #??#փ@   > !x*@ > !@"@ @ 2@ > "*` : @" $ > ,@@  >     > ~H* : *` `> ~> ~ H  *`  *`:`* @@`> ~ H5  ` "` $`  "@>  - "@& 䭀@& `& `" &`.` * @ . 2 & 6 6 me_free: no segments in pmap㿘> }.`"bH* @ +  * @>  + + :`* @>   Ь`  д` #> }"`> !> !x> !@##> "! > ,҃ @2 @*" 2* :` ` " `` "` &  "@2> }>JJӐ!"䀦> ~ H*`  2``2 >  "!`""`> "!L"@"">  $" $"@" $㿘 0 6`*  * @`6` ?*@@;  > ~`H  3 І@+.@??@H /f * ' > !H!>`` Ю@`> }ж@`> }"`> ,ڦ@`@H 0 㿘 >    , 0H /f> * '>     > ","#/: > }> ~⼒ >  0@"?"?`> } ""> } > ",,`> # > @  ` " `,&`04#&+>` D&  / "⥀0@H 0   > ~ > 2 `,,: $*` *  L  ?` `H``Ъ`H``в`?ڰ 02 0!> }#  $#c#? ` +yk> }#H,` *@ (> b:  ``" "⥀/ @ 0"`H 0ctx_free㿘`2>>LI 8  &"҂>  ҋ@> # %!> @ ֦>   "0@>    "֣` "֣>  ֫@>   ` "֣``> }   "֣>  ֫@> a$@>   "a > "耤 , "> }#H*pv_changepte 1pv_changepte: no segmentspv_changepte 2㿘KH /f4 * '   >   "쀀 @ )>`2>LH!ؓ4`*` ` * @4` ?>LH!*   > ~ H 2 >LHӐ" 2<` <`  | *k$@ / > }"d@ > #l@*\  @ #@(Q  `"Ġ0 Ĩ@@> # +@) 븐%    "Ġ  Ĩ@    Ш`  а`  2<` <` >`( >`( ?* @ <  @*@"   2<` <`  | "2g>  & "저0 @H 0pv_syncflags: no segments㿘vH /f4 * '    H 0 >   " @ c'>/>4`*`  * @`4` ?>MH!P* @ > ~ H@"G  "֣0 ֫@@> # '@% !  "֣  ֫@ 2  Ҫ`ҳ` 2<` <` ( ( ?* @"  6 <  ,@2>  % "0 @H 0pv_unlink0pv_unlink㿘  >MG# > }b  "b& &   #& & > }">M` "`Gt#2    #" # <> x> }#``   2  " ,㿘   > }> }b`  "`$$ :$ " `"   &1 #>  x<@2 1> }#؀@" 1  $  >  # """$㿘)H /f4 * '   >   " @@ /> 2>LF̐!ؑ4 * @ *` 2>LF!耢 - > }"d > #l*e` #@(\>  "أ@ 0 ث@@ 0`> # `@ `鵐 `4  !<  ` ` @<` @`%*> # >隐>   "Ѓ,Ћ@@,* @4 * @*`4    0 آ`<  @ 4 * @*` 4  < @ "@2}>  & "@0 @H 0㿘qH /f4`* '`   H 0a >   "䀀` @` `C  2*`  * @`2 ?>MF!P* @ ", >   "Ġ  Ĩ@  Ģ`2* @*` 2 !: @ @ ` 2 ``":`  #@  2 >  $` "0 䨀@H 0㿘  >ME# > }b  "b& &   #& & > }">M` "`E#2    #" # <> x> }#``   2  " q 㿘  > }"  `" $$  $  @$ " `"   & #>  x<@2  > }#؀@"     4$  >  #  "" ""  " $㿘DH /f * '  `)>   "#>@#>@ "` `"Ԣ0 Ԫ@  >    "ࢀ0@H 0㿘> ,> t" > " 0> (> }: >``"`@C`@pmap_bootstrap: unsuitable number of segments (%d) pmap_bootstrap: no kernel memory?! 㿐''H> `'L` >>  "!p>  $>  "ap> ,> -" L> x"a> >h#4"cl> >i 4"`> >i#"c> ~>b!"a`> >g#l"b> >h#"`X> >i "a> >\#P"c$> >^ "a> >i#<"a(> >_ 8"`> >Y""c(> >Z#D"b> }" " "  " > `"  k> !0L T> ~?'L"`H" ?, @ * 2 >?H#L> !> }""HL*"@ *`@> "b,> }"b(`@ @<&@> "  " > "!H!H" > "!!" !>  8 >->,+> 0 @ * @ %aĒ'> $' 8 >PD#> }##a> "`T?* > @"Ĕ 0> ( @ 2@  " > >"` ,`@"`@> "cn@> ""> ?"c> }"$@> `"a> a>  > a" 2 > a*  * @ > "">  0 6 $@``  $@$@> }" > ~?>">  ?؀ #@  2 >`  >` ? 3>> }"`   9> > }"> }# ++? 6` `   6 %@ %!$!"'!$ > }$"" %4`$4? &4@* @2`> }"`?`  ?&* @*` @ -@@> (* > }"` @ >`, Ȧ@@ L> >  2`%$"@$`""$L >  0 3>> ~ H> > !p`2 "@ @  >`   ?38  ?`2®@`ȶ@`@ ꀣ >  0 ڀ`>   "¡> ©@> 4>#@ + #> ,І@ Ц@@ @ pmap_bootstrap4m: botch in memory-saver (if this doesn't work, fix pmap_bootstrap4m in pmap.c)Unimplemented MMU architecture %d㿐   > >i!4"cl> >i"4"`> >j""c> ~>e $"a`> >h!"b> >i!"`X> >i""a> >_#"c$> >`#"a> >j!$"a(> >a""`> >Z x"c(> >[#"b> }b "`#> `"` "`$"`(k@:9 `!> !0@:4 k.$@$` ?,@ * "> !'!> }" > #> `0"",$"*`@ '@:"@!> }`0$#H @: '#H *@$@ $! '@9"@! " $@g!>  ?'$ \('@9ْ"@ \" $@c!> # <'$!$'@9Ȓ"@!" $@`6>SB 2 * '> "! ҂` `  %* $Ġ`҂` `  *` ҂` `  *`? @҂` ` >D *  " A > }" `@@> !'@9"@ >  ?'"`\('@9s"@>  ?'"a '@9e"@ !> > # <'"a$'@9X"@!>  8>/>`,->   0* ' % %> $w 8 >PB?#> }##> "`T?* > @"Ĕ 0> ( @ 2@  " > > ,"` '`"` '> "cԐ ''> "b> ?"> }b%@> `"> > `> "@ 2@ > *`@ *@  '> "b'>  0 6 %@`` %@%@> }" > ~?> } 9"> !" ҂` `  *  % $Ġ`҂` `  *` ?҂` `  *`?*@҂` ` >D *  " @ > }"" ( $@8$?#>@R?#?#->4` ?T4`O!> }-`* > \* @8| 0҂` `  *  /% $Ġ`҂` ` 2 *   ҂` ` 2 *   ҂` ` 2>D * " @I4`> }*`2  "  % *` > !0@% > }"`<`  "`<` ?@6~ 2M4` ?G!  - ,> * * @8 ҂` `  *  % $Ġ`҂` `  *   ҂` `  *   ҂` ` >D * " ?4`  2``"&>@`. >#@  2<` <`  |  pЂ`"@> 4@ ?>#@; p҂` `  *  o% $Ġ`҂` `  *  @ ҂` `  *  @ ҂` ` >D * " ? 2<` <`  | 2; p҂` `  *  o% $Ġ`҂` `  *  @ ҂` `  *  @ ҂` ` >D * " ?U 2<` <`  | 2 "@> ,@@ 4` #?#   #+> }c c D@>  \!.`@7. 0҂` `  *  /% $Ġ`҂` ` 2 *   ҂` ` 2 *   ҂` ` 2>D * " >> }2 c "@ % > !0%    2D! >  - ,* @6ݐ ҂` `  *  % $Ơ`҂` ` 2 *   ҂` ` 2 *   ҂` ` 2>D * " > 2  "@&? @`"```c >  0   >> "   "@ `>   "Ơ0 ƨ@ > ">S  ">>">S>  @>S@ Р$?j 0 > Р  ?a 0  >S>Q h$Ġ`> " ҂` `  *  % $Ġ`҂` ` 2 *` ?҂` ` 2 *`?*@҂` ` 2>D *  " > 2  ?!Р $Ơ`> +Ѐ('> x "a #>`(%>,@4X: > !@@(`((,@4M:>  \@@$`($,@4B:> !@@pmap_init: CLSIZE!=1pmap_init: unmanaged address: 0x%lxpmap_init: sva(%lx) < eva(%lx)㿘>  > ,@ >W=Đ"Ю  > # > M 89> 5> 3> 7> ~@> !Ā@ ` " > !@ 2 * >  Ā@*"@ >W="2 "* , @ ` @@ >W#=   * $@-> } `@ `  @5x$`  > !> }#"> €> !> "!x>  > " "a@㿘> @ %> ~#> }@`b@ @ 㿘    < "̔ @5: <@㿘+ " & + & >  & &  E& $ " > xa` > ,@7c@& $ 0҂` `  *  /% $֣`҂` ` 2 *` ?҂` ` 2 *`?,@҂` ` 2>D * " <ޒ& (˪$ & 0㿘   ? & @ "pmap_release: segment list not emptypmap_release: releasing kernel㿘H /f4>* '>     ">X<#X    >X<# H 0  "> ">   "  $  >X }"䀦> #(ɒ> ">   "@0@@H /f@* '@ > 6` 6` ?**:` * @ @@ >H 0>   "@0@@㿘. *  ` `/ @ `>    "أ@>  ث@@> (&2  > #   Ӓ@#@ @4'>#@ *,2#> > ! * > !x> !@" > 2 "* <   "  ئ@,@@ -  ->  ../ : /  >  0 > > ~ H` "ԣ@`ԫ@`2ڮ@`ض@``Q ` ?-` 㿘. *  ` `/ @ `>   "ģ@> ī@@> (&2  > #   >@#@ @Y+>)> p`  `,K@<2">  > Y> !4 > !x*@ > !@"@ > 2 "* <   " a> # :>   "Ѐ",Ћ@@",* @6`* @*`6`   p Ģ``,>` @  "@@ p, >  ../ : /  ./  ! ڢ`> "@:,ɨ!pmap_rmu: no segmentspmap_rmu: no pages㿘. *  ` $ / >Z:#  `2>Z:#0> ~ HH >  2>` >`  | @'##>  >2> ! * > !x> !@" 2 b* &> ,@@ - Ր "% ` ?-` @ "%@ ">  > (&2  "ģ@   ī@@  > #   .*#@ %   "ģ@> ī@@>  2  `>@`>  2>` >` >`( >`( ?*  @?#@ 5>2#> (> ! * > !x> !@" > 2 "* <   S"  Ĥ@>  2<` <`  | "> ,@@ Ƣ@- 9>  ../ : /    >  > ~ Hڮ@` HĶ@`ߒ "% ` ?-` @ђ "%@>    ,@"& , 0"& 0㿘. *  `  / >Z9#  `2>Z9#0  >   "أ@>  ث@@> # > (&2  LR@O M p` آ` 6`* @*` 6` >` @ @  3><2" > [> !4 > !x*@ > !@"@ > 2 "* <   " c6`* @*` 6` >` @ "@> ,@@*-  ,./  ! ڢ` "`/ #" % ` ?,` @ "$@` " $."@>    ,@"& , 0"& 0pmap_remove_all: empty vregpmap_remove_all: empty vsegpmap_page_protect !PG_V㿀>    {B!> !x> a@& ;`9` > !x> &2 * 0'> !x> a&2 * @H /f4'* ''  >   "ڃ@'؋@'7> ;> ~ ?' 5 -`*  5  ?>\8m"* @ `2>\8c#`,``H@2  @= b |_= @t "&@ ?- i "$   "ڣ>  ګ@> # %P0!  "ڣ  ګ@ ` Ы@` г` 2= = >`( >`( ?* І &: >\8#8 􀥠@' ئ@`_ 2> >  | @U"> }"䀤2%>  0? ` "У@`Ы@`2> ~> ~`H@ڭ`? Hص`?쀢``윐 ?-- " @ `H`Hڮ`@ض`@ߒ "$@`셐 ?- ђ "%   ,`@"$ , 0@"$ 0 #"' '>  ' "أ@0 ث@@H 0쁊 pmap_protect: last segment㿘 π̀0ğ>   "ꀀ0@@H /f@* '@ %>/#)>6` 6` ?* * @**:`* @ >^74 8 *  2s> ~`H 2  >`  |>` @b@@ "@ ,@@`Y@ +  "ģ@@ ī@@@J@> }"ֆ@`    $`` > c `$` Ц@ ,@@耦@0,  "ģ@  ī@@  Ш` г@` 2>` >` >`( >`( ?@ *  ,Ђ@ Т@@ @@ @ iH 0>   "ꠀ0@@pmap_changeprot: no segments in %d pmap_changeprot: no segments in %d! 㿘> ,> }"䀦 @  !!`  @6`6` ?H / * ' *`  *  2 >^7h#02> }>_7a 0b+ `  "` > ~ H@>   >`  |>` @@ *"@   "􀀀@@ 2>   "ģ@0 ī@@@> >   "]> }@@Z> }#  F>  A ;7   "ģ@> ī@@>    Ш`> г@`>  2>` >` >`( >`( ?* @>   "> }@@> }.@>   "0@@0> }" `" H 0㿘!> !x> a@& ꀎ`` > !x> &2 *  0> !x> a&2 * @H /f4* '` >   "@@ ` 4`,* @ 4` ?>\5\"@ - `2>\5R#-`@ >  `"أ@ p ث@@ p`> #  [ ؤ`  `  <` @ @  "> >\5)#8 4`* @*`` 4` <` @ E"@> }"䀦@2@,- ! ڢ`> "@ 6@Ւ!1 ,- ! آ` -"@@  "%@ ?-   "%   "`$,"@>   `,@"&`,`0"&`0  #"&a&>  & "@0 @H 0㿘 ՀӀI0>  9 "0@H /f@* '@ )>> }" 6` 6` ?* * @**:`* @ >^4x 8 *  2z M   "Ƨ@9 Ư@@l@< '> %> pԂ``   `,$``  `$` g a  29 "Ѐ,Џ@,* @6`* @*`6`   p Ƣ`>` @ "@> ,@@ʐp-@  "@ @@!@> ,6`*` *  6` a >` ` `  $``  $`   @ @ "@ @ b H 0>   "0@㿘> ,> }"䀦 @     > }b` "`H /f4>* '>   " @@ >   "أ@p ث@@p`> # <ֶ6`*` *  6` a>`  @2>   "F> }@@C> } (> # ֎>  > "҃", ҋ@@",*` 6`* @*`6`   p آ`>` @ "@6`*` *  6` a>`  "@>   "@0@0" `" H 0pmap_enter: no such address: %lx㿘 g> !p >`  _>  . *   >  2 #> ax> a@& > ֐ > >b!2ax> a&2 * @> !6 ?*@>   "􀀀> }@> }"䀦 @ >@Ϛ>   "0@㿘6`6` ?,` * @@.@H /f * '  > ~`H "J ֆ@E # @@H 0> ̒0t2 ?> !* > !x*@ > !@"@  > 3 * ̐ >   "Ġ>  Ĩ@> #  s  ,   @ > ~`H /> ! 4   - >  0>  "ҠҨ@ Ю@`ж@`񀢠?@> }"`> , Ģ`@H 0pmap_enter: segment filled during sleep pmap_enter: pte filled during sleep 㿘)6`6` ?+   * @H /f4>* '>    0 ," 2  :  & & 0    & , 2" "Q ` >c2"H ؒ "~"$,  ?> ~ H4``, @@2` "> }"` * +@` >c2"x  "@X$@ ,`  , > ~ H@ >  2>` >`  | 5@ >   "Ġ0 Ĩ@@%    "Ġ> Ĩ@>  2  Ҩ`>Ұ`>  2>` >` >`( >`( ?* 6B `# @@H 0 8 & 8?}& 8, ?> !, > !x*@ > !@"@  > 3 * l> #    ,` 8 & 8 鲔@`> ~ H@4>  >   "Ġ0& Ĩ@0#   "Ġ> Ĩ@>  2  Ҩ`>Ұ`>  2>` >` >`( >`( ?* @>  2>` >`  | $H 0pmap_enter4m: attempt to use 36-bit iospace on MicroSPARC㿘 a@?x >  2*`>d0#>   < #> ax> a@& > K > >b!0cax> a&2 * @> !6*  >   "􀀀> }@> }"䀦 @. >@ƚ>   "0@pmap_enk4m: missing kernel region table for va %lxpmap_enk4m: missing segment table for va 0x%lx㿘6`6`*`  * @@  H /f4* '  >e!/p`  2A ` ?@<H 0> ̔0h. > !2`> !x*@ > !@"@  > 3 *  >   "Ġ>  Ĩ@> #  Ԑ  ,` K/@@ > >e!/# >һ>  > "Ҁ", ҈@",*` 6`* @*`6`   p Ģ`>` @ "@H 0㿘6`6` ?, * @H /f * '  2" " `v ""$, $ 2Q! "Ք `` "> x! > ,@$ڐ`@4$! 0҂` `  *  /% $Ġ`҂` ` 2 *` ?҂` ` 2 *`?,@҂` ` 2>D * " . $,2  " -`@@ 2Z! " @` >c/"x "@> x! > ,@$`@ې!$@ ,` 0 , ҂` `  *  /% $Ġ`҂` ` 2 *` ?҂` ` 2 *`?,@҂` ` 2>D * " .-`2  g"  >   "Ġp Ĩ@p` 6`*` *  6` a>`  @  2> ` ?@<H 0 8 y& 8?v& 8* > !2`> !x*@ > !@"@  > 3 * 舐> #   ]  ,` 8 & 8 ϔ/@ />   "Ġ>  Ĩ@> # >8>  > "Ҁ", ҈@",*` 6`* @*`6`   p Ģ` >` 6`*` *  6` a>`  "@H 0> } pmap_extract: null pmap pmap_extract: invalid segment (%d) pmap_extract: invalid segment pmap_extract: invalid pte 㿘 6`>g"*  * @6` ?>g#.  *   > ~`H W>   "@@ ` @>   "أ@0 ث@@Ԇ@,>>>   "أ@> ث@@>    Ы`> г@`>  2>` >` >`( >`( ?* Ԃ>   "@@ `2>>g#0  2>` >`  | @ >g?*> (> 0* @@#P.6 㿘 2>g.-"F *>   " @ pH>   "֣p ֫@pԂ`>   ">@>6`*` *  6` a>`  @>  > !2* ?.@o> $Ƣ`㿘>    {> !x> !@&  > !> b6* x ?$ 㿘>    {2 > !x> !@& > !> b6* @` 2 V   㿘>    {> !x> !@&  > !> b6* 8 ?$ 㿘>    {2 > !x> !@& > !> b6* @` 2    㿘>    {> !x> !@&  > !> b6*  ?$ 㿘>    {2 > !x> !@& > !> b6* @` 2 ې   㿘>    {> !x> !@&  > !> b6* 彐 ?$ 㿘>    {2 > !x> !@& > !> b6* @` 2 囐   㿘>    {> > !x> !@& > > #  > > !b2* 棐@> !?6* <@>  Ҥ> ,q ֤㿘> !x> !@& > # 2 > > !> b2* |@> !x> > &@ !@6 ?*@(  > # 2 > b* d@> !?6@* <@>    Ҧ@>`,&> #  x ئئ@㿘>    {> > !x> !@&  > #  > !> b2* *@> #> `!> 6* ` J>  > "҃", ҋ@",*` 6 * @*`6    0 آ`> @ >`," > # >!>  > "҃", ҋ@",*` 6 * @*`6    0 آ`> @ "@㿘> !x> !@& > # 2 > > !> b2* 忐@> !x> > !@&@ 6 *   > # > 2 b* 婐@> #> !6@ >  *`  `ǐ>  > "҃@", ҋ@@",*` 6 * @*`6    0 ڢ`> # > @ "@ͣ>  > "҃@", ҋ@@",*` 6`* @*`6`   p ڢ`>`  `" >`,'!> #  >y# >s>  > "҃@", ҋ@@",*` 6 * @*`6    0 ڢ`> # > @ "@O>  > "҃@", ҋ@@",*` 6`* @*`6`   p ڢ`>` @ "@kvm_uncache: table entry not ptekvm_uncache !pg_v㿘>  ? X%> #> 0`  ">k)"@  ?>   "Ѓb,Ћ@b,* @6 * @*`6    0 آ` > @ "@>> ,ɰ0  &>k)"h> #  >>Đ> ,kvm_iocache: 4m iocache not implementedkvm_iocache !pg_v㿘>  2>l)  >l І  )y(Ц> ,> }䀢2     ((@ "4> p@:88>@> }" "@㿘!>   > #  J>  > "҂", Ҋ@",*`   >+Ԣ`" >Ԣ㿘>   > ~  H> }b`@$ * >0a >`( 2㽘>  m   ī@@> ~ H )-> y >   `> }`> }"`Є"@`@ @"I`> ,`> ~ H>>  > ~ H ī@`>  H ij@`>  8!$> ~H'> y> 'y'> !0"@`@  㜒@"``4@ > y#@" trapsvr4 gethrestimesvr4 gethrvtimesvr4 gethrtimesvr4 setpsrsvr4 getpsrsvr4 setccsvr4 getcckgdb exec4.4 syscallsvr4 syscallinteger overflowfix alignrange checkclean windowsflush windowszero dividebreakpointsyscallcp exceptioncp disabledlevel 15 intlevel 14 intlevel 13 intlevel 12 intlevel 11 intlevel 10 intlevel 9 intlevel 8 intlevel 7 intlevel 6 intlevel 5 intlevel 4 intlevel 3 intlevel 2 intlevel 1 inttag overflowdata faultfp exceptionalignment faultwindow underflowwindow overflowfp disabledprivileged instructionillegal instructiontext faultasttrap type 0x%x: pc=%x npc=%x psr=%b EC EFSPSET%s[%d]: unimplemented software trap 0x%x trap T_RWRET 1trap T_RWRET 2trap T_WINUFfpe without being the FP usercoprocessor instruction T_CLEANWIN T_RANGECHECK T_FIXALIGN T_INTOF 㿐> c` @ "`   T>m> O>m&`&>!l 2 > " $ $ 쀦 $  "Z'^ "P'+ ) "' р "' ) >n " "' ) 瀦 >n ) >n 뀦?" ?m ) >m#>m(c > x"(. @>m '>m#  0('  ؘ   Ҙ   ̘  > ! *s > xa !$ > # 2  '     #> bԀ M s$b &@ "  k  ` >m` >m&#H`  @  V ` "{$`>m&#@  H`  @  ? `X`` @  6 ` ?>n&q V$`   N#> bԀ>n&b  $b uB    9>n& 8'   /   )   v  X&{ h  >n x&r&`&&k    &`&'  `  (( Ā@   "  C > , c0   "c0 (@*@ $ (*i> ! ", (H 0. `D t"`DH o@ `  (( Ā@  i " (   *3" > *b@> "Ԁ*@&㿘 ` `   x @ 2??  @$` 㿘 " text fault: pc=%x ser=%b WRITEINVALPROTTIMEOUTSBUSERRMEMERRSZERRWATCHDOGkernel faultdata fault: pc=%x addr=%x ser=%b 㿐> # >l` " > "  > !p >  p @ @  > ! @2. 2 Ho o>p @>p&=`>p%0 " > >##@@"M > 2H =#@ > #E 9 $  @    _&) @P @,  䀤@ > 0>@> ("@ ؓ2@ @8& "  @ 7 + @"' 쀢` ` 2'`Ho o>p >p%ј `>p$Đ  {'` @     O @n `  (( Ā@  B "   > , c0   "c0 (@*@ $ ()> ! ", (H 0.ʱ `D  "`DH o@ `  (( Ā@   " (   (̔" > *b@@> "Ԁ*@'@text fault: pc=%x sfsr=%b sfva=%x CSERRPARITYSYSERR UNCORR TIMEOUT BUSERRFAVOWdata fault: pc=%x addr=%x sfsr=%b 㿐> # >l` " > " ` @ +  `` `Nπ @̀ >  >  @ `2 `> 2 ``  @` > > y`Ȁ"`Ȑ$Ђ`  z @0!`@8 `` 2` @2m >  `> # @   `      @3`@ 2 Ho o>q!X>q$>p# " > >##@@"9 > 24 =# > #խ & $   բ 䀦 > 0>@> ("@ ؓ2@ @8& " ( @ @"' 쀢` ` 2'`Ho o>q!>q$L!>p#?  w'`  Θ @n `  (( Ā@  "  [ > , c0   "c0 (@*@ $ ('> ! ", (H 0.0 `D "`DH o@ `  (( Ā@  " (   'K" > *b@@> "Ԁ*@'@syscall cpcb/ppcbsyscall trapframesyscall nargsp> c` "`@>`@!l>m"!>  쀢@">r"#X#@@"$ >r"#p `0   ,3  > `0`4  !@ `4`8   .   * @@T`2 $>r"h#, `H"*~ \2) *'А`4'`В&`0Ԁ  &`4$``,   @`*@$   *`&`0@` &@&`&` `  (( Ā@  " Q > , c0   "c0 (@*@ $ (&w> ! ", (H 0.& `D "`DH o@ `  (( Ā@ w " (  &A" > *b@@> "Ԁ*@&@㿘   `  (( Ā@ F "  > . c0   "c0 (@*@ & (&> ! ", (H 0.ǵ `D "`DH o@ `  (( Ā@  " (  %ђ > *"́pagemove 1pagemove 2㿘> ,?2>t2>t@>t!?! '> > }"%> €2>t!/!( Ȕ > ~!` @  @㿘> #@7㿘 > !.> &@#@"    㿘> a@ @.@  physiodvma_mapin: null page frame㿘> 0.@ @ > !.> ( > !h :@ Г: H /* ' %> %  >t H 0: H 0??> (>  (*@ @(7> %> ~€2> >t "!>  * %  ?> }" `@ ?>  ?ޢ@㿘> > 0`.> ! .%0> }"H /*'>#>  0>( > (:@ `&  2 %S`H 0> # wvmapbufvmapbuf: null page frame㿘 0@2> >u !# H'>0%>  ,  <  @@*@ & L@& H0-> ( 4??%> #> ~€2> }>u!"? a`@ >  ?@vunmapbuf㿘 0@ H>uِ"> #> a <>`08       L& H> # & L < @ H" 㿘 `H$`"  `> "Ԁ!9 ! *9 &` y!&`c &`@ k P $"& 0 & & 0 & 4cP>s#$  "`>#"$ $ $  ?$ P># " "" ""㿘  #> bԀ2$bԐ * > # "!G& 86 6!X&(  P `> "Ԁʐ   !"@6!"!H''  ( ' #\#`#d#hP#l !X #\#`#d#h?#l &sdcd㿘 ג ?>v"``@   >v"h@  0``>  `$N` s>   , >  >  2  ,N` s2 ,  ,*@,@  "$`disk label read errordisk label corruptedno disk label㿘<  #&< 6 "`"`  `* ` 2&#"`&&@&x D m($ D$ T$ @($ <`$ 0@o2 HC" $ 0l 1>v$#6"@2@@Β !W@@ؐ 1>v #! @E"1>v#㿘`8 "; `( !25 @, !W@2- ` 2)  " c * `@ .* @    @2 @  @ Ք! 㿘@ mW( HƔ"$ D$ T$ @($ <$ 0@nl㿘 G` ` < !"@*  @`(: `@ړ2`  T@`2 @ 0@2@2@ "$ 4`( T@Ɠ2` @  < $ @.  $ 4$ <`(`@2`  T`8@ $ @  0?($ 0SunOS disk label, bad checksum㿘"  @`@ *  1>x !W&@&`&` &` &`  &`$"&`(!&`,!&`0!&`4!@t!&`8@p!&`<! 6`B! &`D!!6`H> y ! 6`J6`&`&`@@X$ ` &@ ,  , $$  ,  4   !@$ &@,   gG#ꀢ@216`  Ȁ@  @`@  2#6` > y ب! @@$ ` &@ ,  , $$  ,  4  6`z6` 㿘 (""  &@ &` &` $&`  H6a 4 D 6a B6a J6a 46a D 6a 0 6a ,!a6a* @֑2  @ ר@@,&@``% 6"6a   `  `` ````4&&`gG#&` ! @f @$``$``Ȁ@  @`@  &` " " `` &` b@ 6a@`@ 6a 㿘 @"- @"+ `>?  @29?@O & ` 46 ` D6 ` 06 ` ,6  ` J6  ` B6 ` H6 ``4`D 6@2   8` .  @  "@&& *`*@ @    (@  &?} ?㿈`d >\ `> y`*  44  4"@ 4"@`    @ 4"@  4"@ $ "#\;`@%!`?   @ 4"@  4"@   @J㿀\`` d 3?` @ * @ :* @ @ * @`:* @#\`#``:`*`"" #d#h#l#p  ; + ""   " /`/` /` @  @]* @ :*@Q * @K  *@D & : * @ؖ> y! > y"  ``4`` `ư?Q°?$r + +`@?8`*      `    4N $K + +`@`*      `    4' $% + +` ` @ `*      `    4  * @*`@v G   " A?@ *@ &:* @   *@ & : * #\`*#`. `:`*`" " #d#h#l#p *  ; + " " @ 㿘  ¢` @Y@ * @`< , `@:/ ""@E  * /> ya.`> y " .@j8 `"``"a?" ]?  @ ( @$ $ * 䀤`J > y!.`@> y" .@8 =8?/ ``"``"+?" '?  @ ( @$ $ `" `` ?  ?#  2#8#  2  2#`"``"?" ? + @# # * Ұ  @ *@ &`?` :`*  , ,  ,  `.`. :." "@u * 0> ya.`> y " .@8 `"``"?" ?  @ + @"   " * 〤`x > y!.`@> y" .@8 k8 . `"``"Z?" V?  @ + @"   "``"@``@??@;?#@`@2#@@8#@`@2@`@2#@`"@``"@?" @?  #@@.@  @#@ *   㿀\'`l 'd p& @'* @` @*  / @ @@ h) @ @'/ ??@h@) ?  @@ @ @,`&@@'* @@*   䀤-h 0> y> ya. " (`@@8 ,`. " "?" ?@ @  /@@ @ @&@@ " (`@> y!.@8y8 @" h`)  " "y?" u?@ @  /@@ @ @&` "@ @\?@X?`8#@`@``@ #@`@ `#@`@2` "@ "/?" +?@/@ @  @#@,`@.@ @" h) &` " "@?" @?/@ @  @& "@ @?@?8#@@@ #@@ #@@2 "@ "@?" @? @  /@ @ @#@,`@.@  d"h a> y> ya. " (`@+8 @" ,`. "@ "@?"@{?* @  /** @ @&@@e @"b ,`. "@ "@V?"@R?2 @  /22 @ @&@@< > y" (`@> y!.@8,8 @"- h) @`* `2% " "?" ?@3 @  /@@3@3 @ @#@+` "@ @?(@?'`38#@+`@``@3 #@+`@ `3#@+`@2`# " "?"?@2/@ @ #@@22@  @#@,`@.@n h) 쀡&@2 2`& " "|?"x?@+/@ @ #@@++@  @#@3 "@ @W?(@S?'+8#@3@@+ #@3@ +#@3@2" " "!?"?@* @  /@@*@* @ @#@,`@.@n 㿐@ _#\@㿈   \%@ 8%%,= %@@ 45    0 .  +@*` *   `, `,  4      ` ` ܦ 0@*` *    ``  #\#`-#d ? #\#`#d & ?` ` Ԧ  㿐 2/> } >b@ > }  @S0H /* & p!8  & pH 0 H>p d> } @2H /* & p ? H  & p`& p>"ܺ V  H   p  ?& p& H 0㿈 (    P    #\#`#d  H/` / 0   & 0  & 0H 0 0& ,H 0  @ > !>!P@  g㿘H/` / , "  0& ,?& 0H 0  @  >!P !>@  $`,H 0 `@ > !>!P@  +rcons_init: linebytes assumption botched (0x%x) 㿘> |c& P"c " "> } `" >!0i:`"  " \ & X@ ` @ 4&  \@ @ @ 4& > P" 2` 2`2` 2` \ @@ \"@2`@:`  & H@  \"@2`@:` & L@  & @  H ?@ @$& @ \ @` `& D $ 2 (> |& > |c& $"c  @"@> P & (> P">""`ā㿘 ( 2(      "? `  @ @&  ( @Ԑ@],G (@ 2  ( & < (& 8# 37& (  @0?@? ^ # $ "@@4  @ ^(   &@@?@&@M` ( @㿐 $ \@;   H @3  (  2` ` L  8  P 8  P \#\ $@"@ $ @& " @ "@  @@В 㿘`=>"ԓ*`@ p  | <    $." $  '?%&  $"@@_"0 @ "@  @@ 00  $` " $@ ?"@㿘`[`; ( 73$2 ( ;-(   ($! >& (& 8 8*` * ?А& 8(" =& (& < <*` * ?А & < @̐@ ( ?& (㿘`3> ̓*`@     TTP\x 8@0  8" "  $ 8 " $@  $ 8" " $ &f&0d $"  8 " @ X?V"@ < $?"@ $@6 "@?"@ 8 ?"@ @6 <"@9?7"@@w03@00 8@0, 8@)0( 8@0$ (!2& 8 8  ( & ( ?& (  (!2& 8 8 & 4 ( ?& ( ( & 4 @&㿈 $ \@   H @   L P #\#`#d   ( & (㿈 ( `2 P0` P    #\#`#d X (8 & X`& (㿈 $      P X  #\#`#d@  \`@ e  P H L @ D X#\#`#d L㿈 $ \@ M  H P@ D  L @ X#\#`#d "-㿈 @4 "@" @ &"@ \ @ # P H L @ D#\ H #` L# #d P H L D @ X#\#`#d" 㿈 $ "@@ 4  \@@ @ ` @  @  P H L  @#\  H@ #` L"@#d P @ H L \"@ @  X @ #\#`#d㿈  "@@ 4  \`@ @ @  P H L @  D#\ H #` L#@#d P H D L @ X#\#`#d" 㿈 $ "@@ 4  \@@ @ }` @ w  P H L  @#\  H @#` L"Z#d \ H L@ @ \  P X #\#`G#d㿈  "@@ 4  \`@ B@ > P H L @  D#\ H@ #` L###d \ L @ '  P H @ X #\#`#d>  %c㿘 '>c ">   "& %    >   "X%,@ ߐ`ڰ? א`?0Ф > >>ɐ"h0Ő"pŒ,@`" " H";j" &."  v" 㿘 2  `?. &   &  @"  6 & @@6  ?@2@ @ ?   @@q&㿐`@? `2  ?7 x 8" > y’b   @)  @\ XH   @ '@+'  @5ک x @/  ) 1  :1#V /@  / 7    ۘ@ (@  /`7` @0os"@ @)  (`0`  @=_# @/Ȗ  ) 1  "* /@  / 7  * "@ (@  /`7` @?Q!@ @)  (`0`  @`& ؘ @/  ) 1  "=# /@ܖ  / 7  ?֘#@ (@  /`7` @"W5#@ @)  (`0`  @!" @/  ) 1  ?f! /@  / 7  )P#@ 8  /`7` @m !@ @8'  (`0`  @=!b @@ bQ@  ) 1  0,#@  @' / 7  ) @ /`7` @:mc@ @/ @ (`0`  @5Ě`] @/@ @ ) 1  `S (@ @ / 7  6(yb@ ) @ /`7` @9cȚ@ @/Ȗ @ (`0`  @xsa @/@ܖ @ ) 1  0c֚ (@ @ / 7  =5Ca@ ) @ /`7` @V`@ @/ @ (`0`  @*xa @/@ @ ) 1  ?;c (@ @ / 7  bٚ@ ) @ /`7` @#J`@ @/ @ (`0`  @?!B @ ) 1  !}"  / 7  gX!"@  /`7` @?yN @ @ (`0`  @)/"D @ ) 1  # Ȗ / 7  =Ҙ#`@  /`7` @/ p@ @ (`0`  @ &ߘ"Ƙ @ ) 1  :I#  / 7  5;̘ @  /`7` @"!@ @ (`0`  @6u4 9 @ܖ ) 1  9!  / 7  蟘 @  /`7` @1+"e@ @ (`0`  @= H"D 0@@  ) 1  ʿ# 1@  / 7  *#@ 7  /`7` @?$ 9@ 7@  (`0`  @V֘!Ø 0@@  ) 1  #3  1@  / 7  ? }@ 7  /`7` @!a!ј@ 7@  (`0`  @"O 0@@  ) 1  ?9" 1@  / 7  (P#@ 7  /`7` @!@ 7@  (`0`  @=ߘ" 0@Ȗ@  ) 1  /N"5 1@  / 7   "@ 7  /`7` @:ᴘ#@ 7@ܖ  (`0`  @ & &  @& @;&  @*@0* @*  @ * `    ` @ `(*  `(#   `  @* * @ * ** 㿐@a㿘@W   *  @ *   "@ @b  88  b   㿘  `  `  @4 0%@/  & &@*&& @@ "   ` 㿘?c @ 6 @q6` `B  & $ @*&@$@@Y@U2  *   , "@@ 4 "  "  ,`@@ 4`   ,@@ 4  @@*  㿐  `  ` @` ?2   2@  *2  ?*@   *  2@*@  㿘  `  ` @1  `  &  4 @ *    ?: : 2@  *:  ?*@   *  2@*@    B 'D'H'L'P'T'X@@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"&  @@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   & &  /*# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@#  # # # # # # # # # # # # #@+ 3`@; ) @  ` (  2 "" 2     * " @@ @   `@ @ "`" ?* ?*  @(`  (02 @  "J@J`2J@  J " @(` @ *  J@   J@J`  H" @ J2  @*`  `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2*2J@  "  J@J`   8  *  8  *  4  &  4  & @'Ā > y"@  0.? 耦 Ā 2;  0 ؘ'7477477477ܑ477`A ڸ? 28```@@`*  @@ `*  @@`*  @Ā  @Ĕ ;--`2 @- ,`̑2 @ ĺ` `"` '``? '8  . ?2 ? '`" * #@'.`@ '  @`@?  ``77@, @9@@ΐ ,  ( ?#   . ?@, @@ "@"@4@6`#?# "6` 5 . * @? @ @ 4@6`5`5 @  Ā '   " . ? * :@ @2. 4@đ*  *`@;Α*  Г*`@ +     ( 8 2+ ( 2@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"  /)# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@&@# # # # # # # # # # # # #@+ 3`@sun4c compatible0 0 f8000000 15c6a0 map-pagesspurlev1lev2lev3lev4lev5lev6lev7lev8lev9clocklev11lev12lev13profd'( $1v @-|uEHID@@HG5wF  0 0 +45678WXOPQR012TU)*%&01+(31A(1A( `1A(hr1A( `1X1lF*+z ++,z +@+Tz ++z ++ r,,z ,, r-(-<z -(-< r-(-<r,,pr,,xr-P-dz -P-d r-P-dr--r--r-- r--z //z // r//(r//0r/8/Lz /8/L r/8/L8r/8/L@r/8/Lz /8/L r/8/LHr/8/LPr/8/LXr//z // r11,f 1X1lz 11z 11~ 12 8 88 v 99$ v 9x9 v >0>D v 1>1>r1>1> `1>1> `1>1> `1>1?r1>1? `1>1?l 1>1? `1>1?R 1?H1?\ `1?H1?\r1?H1?\r1?H1?\r1?H1?\ `1?1? 1?1? `1?1? `1@1@r1@1@r1@H1@\ `1@H1@\r1@H1@\r1@H1@\ `1@1@r1@1@r1AP1Adr1AP1Adr1AP1Ad 1AP1Ad 1AP1Ad 1AP1Ad 1A1A1A1A1A1A1A1A1A1AH1A1A 1A1A 1B1BZ1Bd1Bx 1B1B`r vt p(@ph`XPH@8-PaPX"@#TF(0)PN)RR*lCE*ST+@NM%'8CL'0PL'0RE(@RR*lCE*ST+@SL#LRR*lCE*ST+@ER+tCE*ST+@284 ;;$>H>P >` >p >H >t > > > >$>P>|?? ? ?0,?@X ?P ?` ?p ? ?L ?x ? ??? (? T@ @ @  @0 @@ 0@P \@` @p  @ @ @ 8@ d@ @ @ @   $P|,X4d(T  0 \     8 d     @ l  AC|$C|PA|C`C`C`,A(XA|AAC|4dC|C|C|C|(C|TC|C`C`C|  0 \Bt  B A CH  8C` dC` C| C| C| @ l 2R$ CCDDElEEFFFFFI X $X PL|OP,U XU\UUX 4dX W\X X (X TWQTW V 0V( \  X8 X8 W<  8Vp dX  X  X  WT @X  lX  X 2RXH H H HHY0Y8Z4Z<Z[[[[[[XP a \m\m\2x$ \X$ \$\/ \_\P$\5$\x-$\p1$\hY$\`d$\X1$ \H1$\@`$\02 $\(1$\ \$\1G$\G$\$[[$[1 $_g$gPaX|a`ac,cXctggg4dgfgg(gTgd0ggX e 0e \  g g f  8e dg g g f @g lg g2adevopndeviodevwaitdevindevoutdeviocdevclslH|$|PlX|yX{{{,o@Xr vv|wt4|d||||(|T||||  0 \y, y4 x x z  8{ d{ | | | @ l 2R\20123456789abcdef^^0123456789abcdef#2F$We6tHZl~3"VG,ud>ɍ@ۮRdv!0g&vD4UJÎXn|1 wf.TE<ˬBُPftBSap '26L^׈hzRC q`(7&:DV`rcr@Q%"40N\թjxsbPA5$*8FTbp,ӥ>@+R:Nd_mv|ҭ$6 H;*Z^Ol}l~ .<ѵ)B8 Pof~Lt]&н49(J Xnn\M| ׅ(:JD[iVx `/r>֍ 2ZKLyh^ h?.zՕ*8kFzHTY-b<pԝ"0{jNXI\=,jxiiiiiiiiiiiiiiii0123456789abcdef (t&:~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@$h$h$h%hpt͈͐,D,r8Hø8Έ $PT|ϔHX,X 4d(Th\  0 \    |  H 8 d  >d :0 bL @t lrL 1&lH|$|PlX|(HX,X vv|4|d||||(|T||||  0 \   x x  H 8{ d{ | | | bL @ lrL 1(H ... ...Z, , P         @   j j j j\d@*(*)  $ DŽ $ Ȥ < Έ  p< Έ 0 x< Έ Ҝ ΀ ܘ H hamd7930xaudio ވ  $ @ L h ߀   H P ` h < @( , ( h 8 H(  P( D X( ` ( H  @sparc(        x p h H 8 (    0           x     (  l ޭޭ ( X  * 1H ? A ?$lP @ ?TP ` ? #P( ? *P( ? *PP ? #PP ? *P( ?@ D F ? H @ fx g8 f@< k lX k` { z z z z z z z zp z` zP z8 z( z y4 p 80    p X P @ (       h  P H 0        h ` H @ 0 h ` 0      x p ` H  8        x  h  P  8         h  X @  0   0  0  0     x p h ` X  H 0 (   `  `    p h P h @ (        h ` P 8  (   4 d (  d 0 0 0`     K( Ĝ  Đ d ˤ Ę Ę Ę Ę Ę Ę Ę Ę Ę Ę Ę Ę ܀ h ` P 8 0  P  0  0 0 ۸ ۠ 0  ۈ 0  x h 0 x X 0 x @ 0 0  0   0EEEE x ڨ ڠL ܔ H ܐ  @ 0 0 0  ", ھۙ08\4 `@# ` #Ȥ" $@` `T@ ! c@"@H*/+  "b  0  "  " ̐ * " Ċ!` " @ bootxx%s: can't open device㿐@!@  "bآbؐ @    @p`@'   "@[%s: alloc failed%s: block table corrupt%s: read failure%s: short read㿐! @ Ц  ! @=` Ԣ @D  + ?# 2  !@*`   П  !@` @ Ѐ` !@`2@?@2 @a ~ 8@֒` `Ԁ@ Ʋ@  promprom0㿘   @ "   "#8 a"8 J*@J` )J  *@Can't open device `%s' 㿘@\  ` `@ "`  #8`#8`$@ 2$    c8@ 0  $    `ܒ`$`$` 㿘# b   ` ༟* `b   '@`20,6 * '@ 㿘  @S& & $& (`   €@V " '@ 㿘 " `@ 0(@ 㿘 @ $ ? $ "*@ 㿐 "  / 0T@㿘  㿘 " tInvalid controller number prom_iopen: "%s" error=%d 㿘) " ?D   @ # @Ԕ 8$ $  $ $`  @O# * @ *`@`@F $0` "`@$4` " @\$ @ & "  %"@&#@ 㿘# b    @ 4 "$b@ & 4$bprom_mapin: length=%d prom_mapin: invalid maptype %d 㿘  đ* @  @x !   !      @c     !  <  ̚@;@ ?*@Ԣ &@ `   ! @   ?( , H L\ T ` X` P d l  t$ p   *?  Ĉ`Ī` Đ`IJ`  dvma_mapin㿘? #@(1? @"1?dvma_mapout㿘 #@(1 @#@1㿘@ " ْ㿘 @ `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2*@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"   ?@ * @:@ @?  a "a" @  "@ "?? ሀ@@    @*0    @*`2( 㿘'H'L'P'T b 'X @"b@|H @l#exit㿘 #x㿘  #H @ " @   ` 㿘  .  #H    $"c<2  " @  `  ` @`$ "#<  "#<? ̆` ́*@㿘'L'P'T'X! $"  @L"*㿘'H'L'P'T'X "ؒ@ H㿘 "ؒ@8 ! `N@`%` N@ `* 4(44(44444444 444`444444444 L@t `ϒ L?,@` < ,L L  LL 4 L  ` >0 `L` L` N@` - @1 N@@) N@@! ~N@ΐ 0̐ x @ qN@ % i le0123456789abcdef㿈  $ @, ?L?|/-\㿘 Ȑ`"Ȓ `  J@   0@4p44X4\4`4h44X44`   44 44 #40,4740= (3   @31}^(@@ /mntuhul<@`bT (3   @31}^(@@=<@`bT U3@@ "xh(0l@?%ݕeA 3330]A38!3Ƙ3ŀ)*A3Ƙ3:,3:,*q G-3.3"3 "8@HPX`hpx }q3238bЀ38bЀ+JY3&3˨3k3V~1{z!3"U3$Ӏ3!,a3$3$3:* AH!3V~3V~3:*: a32323:* 3B!3 3 3:*: Va333:* %L!3 3 3:*: ؽa38!38!3:* gI!3{3{3:*: n㹛a3_/3_/3:* ŀ!333:*: _a3"3"3:*p!3%P3%P3:*:.Sa3*3*3:*;O!3,w3,w3:*:~Hm333)| (0 XKm&b3330 86m 3331;€@rI3:,3 GO3 GOHPC&h333hV 3 L_3 3 plTm33sm3smxXb5]h57Q8z|\)*Q?"3)IDrح/h_ӓةw+l)gcJ_,rCR x ܎ o>Z?UbEQ(u8e G9f~$.wt "*8 . ..B binmdecn sbinn share  . ..termcap TZ="$_a" echo "You have selected timezone \"$_a\"". return fi echo "'/usr/share/zoneinfo/$_a' is not a valid timezone on this system." ;; esac done } install_sets() { local _yup _yup="FALSE" # Ask the user which media to load the distribution from. cat << \__install_sets_1 It is now time to extract the installation sets onto the hard disk. Make sure the sets are either on a local device (i.e. tape, CD-ROM) or on a network server. You will have the chance to repeat this step or to extract sets from several places, so you don't have to try to load all the sets in one try and can recover from some errors. __install_sets_1 if [ "X$local_sets_dir" != "X" ]; then install_from_mounted_fs ${local_sets_dir} if [ X"$_setsdone" != X ]; then _yup="TRUE" fi fi # Go on prodding for alternate locations resp="" # force at least one iteration while [ X"${resp}" = X ]; do # If _yup is not FALSE, it means that we extracted sets above. # If that's the case, bypass the menu the first time. if [ X"$_yup" = X"FALSE" ]; then echo -n "Install from (f)tp, h(ttp), (t)ape, (C)D-ROM," echo -n "(N)FS or local (d)isk? " getresp "" case "$resp" in d*|D*) install_disk resp=d ;; f*|F*) install_url ftp resp=f ;; h*|H*) install_url http resp=h ;; t*|T*) install_tape resp=t ;; c*|C*) install_cdrom resp=c ;; n*|N*) install_nfs resp=n ;; *) echo "Invalid response: $resp" resp="" ;; esac else _yup="FALSE" # So we'll ask next time fi # Give the user the opportunity to extract more sets. They # don't necessarily have to come from the same media. echo "" echo -n "Extract more sets? [n] " getresp "n" case "$resp" in y*|Y*) # Force loop to repeat resp="" ;; *) ;; esac done } munge_fstab() { local _fstab local _fstab_shadow local _dev local _mp local _fstype local _rest # Now that the 'real' fstab is configured, we munge it into a 'shadow' # fstab which we'll use for mounting and unmounting all of the target # filesystems relative to /mnt. Mount all filesystems. _fstab=$1 _fstab_shadow=$2 ( while read _dev _mp _fstype _rest; do # Skip comment lines case "$_dev" in \#*) continue;; *) ;; esac # and some filesystem types (like there are swap,kernfs,...) case "$_fstype" in ffs|ufs|nfs) ;; *) continue;; esac if [ "$_mp" = "/" ]; then echo $_dev /mnt $_fstype $_rest else echo $_dev /mnt$_mp $_fstype $_rest fi done ) < $_fstab > $_fstab_shadow } mount_fs() { # Must mount filesystems manually, one at a time, so we can make # sure the mount points exist. # $1 is a file in fstab format local _fstab _fstab=$1 ( while read line; do set -- $line _dev=$1 _mp=$2 _fstype=$3 _opt=$4 # If not the root filesystem, make sure the mount # point is present. if [ "X{$_mp}" != X"/mnt" ]; then mkdir -p $_mp fi # Mount the filesystem. If the mount fails, exit # with an error condition to tell the outer # later to bail. if ! mount -v -t $_fstype -o $_opt $_dev $_mp ; then # error message displated by mount exit 1 fi done ) < $_fstab if [ "X${?}" != X"0" ]; then cat << \__mount_filesystems_1 FATAL ERROR: Cannot mount filesystems. Double-check your configuration and restart the installation process. __mount_filesystems_1 exit fi } unmount_fs() { # Unmount all filesystems and check their integrity. # Usage: [-fast] local _fast local _fstab local _pid if [ "$1" = "-fast" ]; then _fast=1 _fstab=$2 else _fast=0 _fstab=$1 fi if [ ! \( -f $_fstab -a -s $_fstab \) ]; then echo "fstab empty" > /dev/tty return fi if [ $_fast = 0 ]; then echo -n "Syncing disks..." #_pid=`twiddle` sync; sleep 4; sync; sleep 2; sync; sleep 2 #kill $_pid echo "done." fi ( _devs="" _mps="" # maintain reverse order while read line; do set -- $line _devs="$1 ${_devs}" _mps="$2 ${_mps}" done echo -n "Umounting filesystems... " for _mp in ${_mps}; do echo -n "${_mp} " umount ${_mp} done echo "Done." if [ $_fast = 0 ]; then exit fi echo "Checking filesystem integrity..." for _dev in ${_devs}; do echo "${_dev}" fsck -f ${_dev} done echo "Done." ) < $_fstab } check_fs() { # Check filesystem integrity. # $1 is a file in fstab format local _fstab _fstab=$1 ( _devs="" _mps="" while read line; do set -- $line _devs="$1 ${_devs}" _mps="$2 ${_mps}" done echo "Checking filesystem integrity..." for _dev in ${_devs}; do echo "${_dev}" fsck -f ${_dev} done echo "Done." ) < $_fstab }  . ..@ bin dev etckernu`A mntmnt2u`sbin tmp usrC varinstbin install.subinstallupgrade.profile, install.md,boot while [ "X${resp}" = X"" ]; do echo -n "Enter system hostname: [$resp] " getresp "$resp" done hostname $resp echo $resp > /tmp/myname resp="" # force at least one iteration while [ "X${resp}" = X"" ]; do echo -n "Enter DNS domain name: [$FQDN] " getresp "$FQDN" done FQDN=$resp configurenetwork echo -n "Enter IP address of default route: [none] " getresp "none" if [ "X${resp}" != X"none" ]; then route delete default > /dev/null 2>&1 if route add default $resp > /dev/null ; then echo $resp > /tmp/mygate fi fi echo -n "Enter IP address of primary nameserver: [none] " getresp "none" if [ "X${resp}" != X"none" ]; then echo "domain $FQDN" > /tmp/resolv.conf echo "nameserver $resp" >> /tmp/resolv.conf echo "search $FQDN" >> /tmp/resolv.conf echo -n "Would you like to use the nameserver now? [y] " getresp "y" case "$resp" in y*|Y*) cp /tmp/resolv.conf \ /tmp/resolv.conf.shadow ;; *) ;; esac fi echo "" echo "The host table is as follows:" echo "" cat /tmp/hosts echo "" echo "You may want to edit the host table in the event that" echo "you are doing an NFS installation or an FTP installation" echo "without a name server and want to refer to the server by" echo "name rather than by its numeric ip address." echo -n "Would you like to edit the host table with ${EDITOR}? [n] " getresp "n" case "$resp" in y*|Y*) ${EDITOR} /tmp/hosts ;; *) ;; esac cat << \__network_config_2 You will now be given the opportunity to escape to the command shell to do any additional network configuration you may need. This may include adding additional routes, if needed. In addition, you might take this opportunity to redo the default route in the event that it failed above. If you do change the default route, and wish for that change to carry over to the installed system, execute the following command at the shell prompt: echo > /tmp/mygate where is the IP address of the default router. __network_config_2 echo -n "Escape to shell? [n] " getresp "n" case "$resp" in y*|Y*) echo "Type 'exit' to return to install." sh ;; *) ;; esac ;; *) ;; esac if [ "`df /`" = "`df /mnt`" ]; then # Now that the network has been configured, it is safe to configure the # fstab. ( while read _dev _mp; do if [ "$mp" = "/" ]; then echo /dev/$_dev $_mp ffs rw 1 1 else echo /dev/$_dev $_mp ffs rw 1 2 fi done ) < ${FILESYSTEMS} > /tmp/fstab echo "The fstab is configured as follows:" echo "" cat /tmp/fstab cat << \__fstab_config_1 You may wish to edit the fstab. For example, you may need to resolve dependencies in the order which the filesystems are mounted. You may also wish to take this opportunity to place NFS mounts in the fstab. This would be especially useful if you plan to keep '/usr' on an NFS server. __fstab_config_1 echo -n "Edit the fstab with ${EDITOR}? [n] " getresp "n" case "$resp" in y*|Y*) ${EDITOR} /tmp/fstab ;; *) ;; esac echo "" munge_fstab /tmp/fstab /tmp/fstab.shadow mount_fs /tmp/fstab.shadow fi mount | while read line; do set -- $line if [ "$2" = "/" -a "$3" = "nfs" ]; then echo "You appear to be running diskless." echo -n "Are the install sets on one of your currently mounted filesystems? [n] " getresp "n" case "$resp" in y*|Y*) get_localdir ;; *) ;; esac fi done install_sets $THESETS # Copy in configuration information and make devices in target root. if [ ! -d /mnt/etc -o ! -d /mnt/usr/share/zoneinfo -o ! -d /mnt/dev ]; then echo "Something needed to complete the installation seems" echo "to be missing, did you forget to extract a required set?" echo "" echo "Please review the installation notes and try again..." echo "" echo "You *may* be able to correct the problem and type 'install'" echo "without having to extract all of the distribution sets again." exit fi cd /tmp for file in fstab hostname.* hosts myname mygate resolv.conf; do if [ -f $file ]; then echo -n "Copying $file..." cp $file /mnt/etc/$file echo "done." fi done # If no zoneinfo on the installfs, give them a second chance if [ ! -e /usr/share/zoneinfo ]; then get_timezone fi if [ ! -e /mnt/usr/share/zoneinfo ]; then echo "Cannot install timezone link..." else echo -n "Installing timezone link..." rm -f /mnt/etc/localtime ln -s /usr/share/zoneinfo/$TZ /mnt/etc/localtime echo "done." fi md_copy_kernel md_installboot ${ROOTDISK} if [ ! -x /mnt/dev/MAKEDEV ]; then echo "No /dev/MAKEDEV installed, something is wrong here..." exit fi echo -n "Making all devices..." #pid=`twiddle` cd /mnt/dev sh MAKEDEV all #kill $pid echo "done." cd / unmount_fs /tmp/fstab.shadow # Pat on the back. md_congrats # ALL DONE! exit 0 44` 4@444 44  4 ( 4D7 4H>4E4L4U4d4v4X4X4X444 4444 444%464 =4 L4 ^4 4 4 404!4x*434:4E4M4V_dvma_mapin_block_count.urem_devopen_obp_close.udiv_pgofset_sprintf_netif_debug_freelist_printf_putchar__randseed_obp_strategystart_prom0_iclose_io_twiddle_prom_ioctl_promvec_prom0_close_closeall_vprintf_block_size_prom0_strategy__rtt_dvma_init_dvma_free_prom_boothow_prom_si_prom_bootdevice_memset_memcpy_cputyp_pgshift_prom0_iopen_panic_progname_prom_open_etext_bzero_prom_init_block_table_ndevs_dvma_mapout_loadboot_errno_nbpg_exit_main_free_debug_close_alloc_edata_end_dvma_alloc___main_prom_bootfile_files_devswsrt0.obootxx.ogcc2_compiled.___gnu_compiled_cpromdev.ogcc2_compiled.___gnu_compiled_c_filestore.6_bootstore.7_prom0_fake_saveecho_pv_putchar_promdev_inuse_prom_mapin_prom_mapinfo_prom_mapinfo_cnt_prom_devmap_promvecstore.32dvma.ogcc2_compiled.___gnu_compiled_c/usr/src/sys/arch/sparc/stand/lib/kern/__main.o/usr/src/sys/arch/sparc/stand/lib/kern/bzero.o/usr/src/sys/arch/sparc/stand/lib/kern/urem.o/usr/src/sys/arch/sparc/stand/lib/kern/udiv.oalloc.omemcpy.omemset.oexit.ocloseall.oclose.oprintf.o x  @D, @' \$(+#@  /(@g / "% % @<@p@ d`Ƃd??/usr/libexec/ld.soNo ld.so Failure reading ld.so Bad magic: ld.so Cannot map ld.so crt0: update /usr/libexec/ld.so ld.so failed h!c!0`$   ǖ ? $      c a8       ?@ ?# @!  ?c؀! ?@ ?# @  c؀       c0?"  #\#`?@?# @!  09@ ! 4? ?c @ ̀@ 0'@@@ ̀@ ? ?c @! @ 0@@@! @ #d#h0   #d#h0  #d#h  Ŕ  ' c? "a0  (    c!0!0ܘ@#\#`?@?# @؀! ?@ ?# @  ?Q@؀ K?@ ?# @! 2 9@ ! 3? ?c @ ̀@2 %@@@ ̀@? ?c @! @"  @@@! @# #?B ?@ ?# @!  6 @ ! /? ?c @ ̀@ # @@@ ̀@? ?c @! @  @@@! @    #d#h  Ŕ  c ?   (]  Z 䀢 "ca0a0#\#`  #d#h  Ŕ  ?`?2 c  (9  6 ca0$  \"($  $ ( $ a0 ` ?c  @ ! ` ? c  h   c "aXcaP"!X@`㿘c!X€ 㿘c!X "? @㿘c!X  € 㿘c!X  ?Service unavailable㿐c!X     ?1 !@ *`:`J "J %s: %s not compiled in instbin㿘@z@ J 2@@L@@d} /  @(   "@ê "    € a!` b8 P@|@!㿘 ?@?`Usage: %s ..., where is one of: %s㿘a!` cp @SP(    'a+ ) @ a@  O4`@?c`#@:@`@ a!` @0c@ t hostnamekill-shshpdksh[testexprmvsleepsedmkdirmtrmmount_kernfsmount_mfsnewfsinitfsckfsck_ffschmodgzcatgunzipgzipcpedhaltrebootmount_ffsftprouteinstallbootslattachmknodrshumountbasenamefgrepegrepgrepmount_nfsmorelessresettsetlsifconfigchgrpchowncatpingcpiotarpaxdisklabellnsttyvibuildsyncmountdfmount_cd9660dd㿘@/5H/5l/8D/5/5@@/5/6/6 /6< /6H@@/6hskipseekofobsifibsfilescountconvcbsbsout of memoryunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs cannot be zerocbs meaningless if not doing record operationsbuffer sizes cannot be zerobuffer sizes cannot be greater than %useek offsets cannot be larger than %qd㿈cc""c"c  G"a`#c' %c@a` $a`  @6ca`@ɒ =2, @6a` L a`  ` @6a`'  b  @H!0 @6 @"  `@@6w $@c  "a`c耊`@"@ "c"耊` @ @ pc" @`c  @6I`!x c  @6A`"c"耊 !!,"@c耊`#`!` @"c!"bcb "bc!"b  @6`c!x  c  @6`c "bc!  c# !c  @5`! ?#@Oc ! 4  !c` 8 # ?#@:c # 4    `    ?@5̒a@㿘@ @㿘@cc"c"㿘@c"ax㿘@c "a@ 㿘@("c㿘c"耊 @ܐc"ac 㿘c"耊 @͐c"cc 㿘@c: 㿘@c: 7 F77 G7 H7777 C7 D7 E77777xunblockucasesyncswabosyncoldibmoldebcdicoldasciinotruncnoerrorlcaseibmebcdicblockascii,unknown conversion %s%s: illegal conversion combination㿈 .'D#! 1cD@d(`'"  @贘! " `@4@" ` @4 &" `Dc""D ڐD㿘@@%s%s: illegal numeric value%s: %s㿐@ ?c a(@`r`c a0@4`J k m b".  w . . .  'J x c  *2  @!c@h " aP@4k!` a0@4f`㿐@  #  c a(@``c a0@4E`J k6` m b 6`. w6`(.  .` .  .` 6` .  .`.  .` 4,!c@&!c 'J x %c ' *2!   @F 4!c@!c@ " aP@3!` a0@3`㿘c"쀢c!`!" *@`2 @c"#caa$ $  @ @  $a $cc 㿘c!h %?c!`  !  2  cc!"`!"`?@ϒ"@ c"!hca"` ?"`c!c!`" c`")c/c+cc!c!c!c"!x@8쀢 ` `   +   ` `  +  ` !xa*?" ` $?$!x 쀢`" ` !x @" %a " a %a  a  ? $a 2c "ah?$!x $@ $@ c@ސ c"c !xc!! "㿘#ca"aca` "`!c"@%"@ "a@c"쀢`" ` !cc!x! @8" cb`!x "`㿘c"쀢 c!! @ ,@??c!!c`!x@ <c'c"c"+cc!x@? " :  " @Ք$% $`$ *@@ ax@Z ax@  " %  ϔc!!@"@ c!! "%s: short input record㿘!c! 1!"@`!@? c 2c? : c! $  #cbb@{b$b$cb` "``"` *    [.<(+!&]$*);^-/|,%_>?`:#@'="abcdefghijklmnopqr~stuvwxyz{ABCDEFGHI}JKLMNOPQR\STUVWXYZ01234567897-./% <=2&?'@O{[lP}M]\Nk`Kaz^L~no|JZ_myjС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx7-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|_myOС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx    .<(+|&!$*);~-/,%_>?`:#@'="abcdefghijklmnopqr^stuvwxyz[]{ABCDEFGHI}JKLMNOPQR\STUVWXYZ01234567897-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|ཚmyO_ !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwxjJ7-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|_myOС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx㿘@ؤ@73( @qc @mc@䗐"4c@yc??&c@@ stdin%sfiles is not supported for non-tape devicesstdoutinput bufferoutput buffer㿘ca a"8"a"#caa @% $   6c b@@\ac@!(#  c! 2c @0CbHcc c ""x/"cc#c"@"&@!cb "``c"@"&@!cb"`` "`c## 6c b@@[c@"c" @ccca#a @? $? @[bcca""c!ax*#cax@c  "ac##ax@@ $? @[bc!!"c"""` $ c@c## ` c@ c"  2c!c# @   @#c""@K`!&b c!c]" ,*  * ("3cc!c\" *  * (""cc"耊" c!],*@ `* (,cc!\*@ `* (cc!"bc@ϐ! @` h b@@[ <     a@Z     @ ?   \"0   & 㿘c"%cc! 5cc!c!3/cc!'cc!+cc!`  2 c  @R c!?@?m&?+c$b@ b@@Z@4@S    @  b@`@@c $  @ $ !!2 " " $@"$  $  @$  $ ` $`耊 ca"c@o %a@@ a` $`@ؒ   $ c"wc㿘c" @cc"!@cq c"!@cc"@ #ccc   ?@"  $cc# @ %s: end of device%s: short write on character device%s: short write on tape device㿘c" "`c#3cc#c!-cc# )cc@4  \ cP@."0  c b@@Y> `@ B  <`c#2,` ` $``  $`   !p    %!p#h@%` "$ c@-`cb`""``   $` c##@"@ c"" "%u+%u records in %u+%u records out %u odd length swab %s blockblocks%u truncated %s %qd bytes transferred in %ld secs (%qd bytes/sec) @c!"@`' 'c #\ d @ @ @`    !!  d@Ƽ@ @Gc!!Ѐ  !!  d@Ƣ@ @-%c< @Պ#\#` d@Ɗ@o @㿘㿘@ %sskip reached end of input㿘c!! c? @N     @ ?JH `@X !!`9 !!@  * D?%  c(c ?"c @,ɒ`"耊$  c @a5  c `@Xv c`ƒ!㿐c# # c? @     @b ? `@XS # #  7 '  a@ v `@X?   c## 4 c g` cc##@v 4Lc   `@X7 'c## a@y?c `@X #`D # 4 c 4` 0c##@+ c `@W#`D # 4c ` c0`D ##4c`c㿘@S]h]X]P]H]@]0](] ]]]] \updateunionrdonlysuidexecdevatimeaccesstimeautorwrogroupquotauserquotaego:Rcd9660 @Ӯ ')!% \#@޵!x?I? 0B* ^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^   t`P@R @9Q#&*  @@.@`'?'  ' '''!@/Z  @V @ usage: mount_cd9660 [-egrt] [-o options] special node 㿘a!`@Tc@ ,-o %s: option not supported㿘@ @VΒ @0cࠒ5L n L  o  @  = 2*@? "   " @2    &*@& c@*ԔȠ @㿘@7hiklnt:only one -t option may be specified.retrieving information on mounted file systems%s/tmp/df.XXXXXXXXXXffs%s is not a local file system%s mounted as a %s file system0@Ҏ/"h%k #k+k)k'k@ݓ@?2? +* bbcbbcbcccccb$P$c\%cT$c\$P%#H$L)!  \ @*ZaH@"tА@̐Q#&* @@  2@ @Vap @3@. '@  %)<'k@@  @@N,`u  '  2A@@@=,`@!@à@$`@.=! W! @.` ,`@-,`@@ߒ 2G`D`@- * L`@};@@-Z @-А0`,`@-y $k#H ",` @,`!@}@`@R < 2` !@@}<`@@}`@ z  .  @ 4 &.   . @@ . @ 㿐@  6 , @ @’  @ L,  㿘)!  ) c#D`?!@    c#D@ empty type list㿘  N  n @)>c  cN  oc c "cD"#D  @U ,``!)`@* $!2$ @Tߒ   @@ ,,`*@`$`$㿘k#H 2)! 2k#L @p /- ( +k)'kcH ,` ,`w < L ,@5! ,`, L@,s `@cH) )5 ȁ 9 )))Ё 9 ))؁ 9 )) 9 ) ) )  : 0B %5.0f%cBKMGTPE %5.1f%c㿐?) B@"00)?H"8  H"P@kH 㿐   B?'  B?   B? Size%-*.*s %s Used Avail CapacityFilesystem1K-blocks%-*.*s %s Used Avail Capacity iused ifree %%iused Mounted on %-*.*s %*ld %8ld %8ld %5.0f%% %7ld %7ld %5.0f%% %s 㿐` $ cc8  @"c8k#P #c#p$c<@5!c$#4#x c<k#\  $c"c0c#"c<@!c $#4c#4c@ Βc0c"c<c##<@k#T "@ː#@Ȑ  @–   "@ k#P ONc `#4c#0@6 c@@   c @c0@/  `c#0@6 c@@  c @|c0@ `c#0@6 c@n@k  c @ec0@  @i )'' b Bb?@U (k#T   ` "@'' )b B)b 8 ?@6@2 P X@. L㿘cc@  "c@@*@Ւ k "cX!@z]O? cH@O 26@k@=#XA?6`c#|#|&`?&`?&`  @  @&` d " @?@ d?"@" &`&`c#t#t@v &` &`&` &`$C2`L#`L@ Z`@ Z`<a@ k@#X  df: %qd: %s 㿘!k#X@q #X@@ \"0 `4 @a!`@Òa  usage: df [-ikln] [-t type] [file | file_system ...] 㿘a!`@Ҫb(@ 㿘@unionsynchronousroot file systemread-onlywith quotasnosuidnoexecnodevnoaccesstimenoatimelocalexported read-onlyanon uid mappingNFS exportedkerberos uid mappingexported to the worldasynchronousffsAadfo:rwt:uvonly one -t option may be specified.rorwrqnoautogetmntinfounknown special file or file system %s.can't find fstab entry for %s.%s: unknown special file or file system.%s has unknown file system type.:@nfs/var/run/mountd.pidr%ldsignal mountd㿈@Π    #!x5k # \/k@ϔ?k? 8d* vvv\vvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvv`vvvhvvpvvvvvvvvv|vvvvvvvv  &btJ@ "@ )"  @%dc@:btbt@% ?@Q#&* @ _   0)06@$L @c  @zc  @t` @   @ђ` @ݐ ۀ   `?#\@/ 2Ϣ 0@   @Pƒ`. @@ < " @;@ &. @h)" @@@@u@ ' ` @$@@$q L2&  `H@$@) L@$d@2  @$J@2  `h@$@@c  @c   @` "  `@$@ #\  " 2#\@@`  @@M 2#\@` @@"`%@(   @`蠒`@Ô  @ ?  \"0  @P`@@ϐ,㿘N@ n N` o `@5 '`? @*J@ n J` o  `@} "  @v " @/usr/sbin/sbinrealpath %s/statfs %s%s on %s type %.*s: %s already mountedforceupdatemount_%sexec: mount_%s %s fork%s/mount_%sexec %s for %swaitpid%s: %s\@Ԓh `#h   O@ # @~@ݒ@`  @'%@'Xh ע@Ҕ Z @ʔ  k#؀ ˒ ( @`@° @`P@c@@`Xh$`@ۖ'd'h 'dd@hd`'d*`">p`'d*"p*`@"~pk#܀  p@j d1, @ @^~p d, @V o @R"?  )0-@v @_ #h97 \3$ @@Nh0 `@vu   \"0  h@vg@ @`@< `@vY ,  `>  k0#   " k@  @v60k#؀  @&h  @v2 @h %s on %s type %.*s%s%s (, %sunknown flag%s %#xs) 㿘 !  L @ǘ  a " a ?$$a` ! [!@| !ܒ@Vs    @ Ā    "   $a!"a %susage: ex [-eFRrSsv] [-c command] [-t tag] [-w size] [file ...] usage: vi [-eFlRrSv] [-c command] [-t tag] [-w size] [file ...] 㿘a!`%`%@@(#)cl_main.c 10.35 (Berkeley) 9/24/96TERMunknown]0;%s㿐@Ůkc  "c@-!l@`@@z$ (%@!p2@%!x@@@x$`\ $``@@  @ @ $`H$`D$`<$`8a!  @' @ "@ @m@L@؀  @ `? %!@ka@T! @" @@j@㿘@IP / 2  @b(2&@i&/dev/tty%s: tcgetattr: %s 㿘 @K!䰒2$`$@R@$`$@ "hT!"&! $hT!" @ǒ!? \0%# @Δ ?@帒!?  \@"0a!`%c@&@@j @6@%s: No terminal database found %s: %s: unknown terminal type 㿐 @?  a0a!`&`@@@ !`&`Ȕ@@8 l($   l($@ l($   l($ %s: %s signal-reset㿘`D $l" , ,`" !&@`` + \l ,`" !&@S  \l`,@ "@ !&@E  \l`,@ "@ !&@7Ā 1 \@R"0a!`&a@Ȇ'   &@$`   &@   &@    &@ Ā  &@ 㿈'''@!㿘 $  @!  @!  @!  @ !́""(X""(\#4"(`#"(d"(h#"(l#"(p#"(t'x"(x#"(|-H"($"($"($"("(-"($"($`"((|"($"(%"(㿘 \@"0a!`&a@@< @(#)cl_read.c 10.15 (Berkeley) 9/24/96㿀  $! @ ! @ ?$!N L  H ! D !! >$! @䀢 ?  @,  @ㅒ#'@Ӂ#* "@*`@*`'0!@#`'"*`@&`&`  &`   @ input`$!"  @P`2'ð  p @씔 '`'p 'p   @? `0 `0- @ҒȀ 2)T`  ''''''''''' ' '    !\@ 'T @ p @J p 'p @ d"` 2 * (x "x`  4 2d p  @ ?% p@=   @Mܐ ǐp8 @꺔`2d!  1&!!. '  \"0    '@@  @ ? "'!*@`'&!   @ȁlines=%lucolumns=%lup''''''$(@Ö@먐'@;  $(@@떐'@) @ @(#)cl_screen.c 10.49 (Berkeley) 9/24/96㿘 (T   $@j 2e (T ?$(T``$ 2[ `$ 2U $  ?&$$   ?&$  ! [ H 4!ܒ @R{ @D[!! [ H 4@!ܒ@Rq @LW!܀`'@v 2, a $a$ "% a "! " " "  " *` * 8?a@  .@+  @\  a ? $a 㿘 $!  # @ 2 ! ""2!@  2 ! "" @ 2   @ؔ!! ?$!016|Vi's standard input and output must be a terminalTERMLINESCOLUMNS%s%s: unknown terminal typetcgetattrtcsetattr㿘  $a 2 "@]   )@  >@' "#  " # #*` * 8!)@罐" " @y )@結"(" " "  " *` * 8)"(@f )@碐"0!` " !X !X*` * 8)"0@S ! \$"0aa@C `"0  )8 )@@^  )@ː" )@Ő"(2 )@"0 _@}! [@}@}!@v !@ww  $aܐ @趒  @ᙒa\  )(`a"$a\"$a\a$"aha\$$a\ah $ah ,aw,au,av,a{,az,a~@    @a\   )p@d@   㿘 $! [!@w3 ! !ܒ @Q !@Bݒ? [!!ܒ@Q  @J!@@R&!܁ cupsmsormsoelcuu1㿘  $! 2R "U*b(@_!*b0@Z!*b8@U!*b@@P!*bH@K!!  ! 2!! "!@8$!! "!@1$!!$!0!$!4! $!8!$!<!$!@!$!D!$!H! $!L!$$!P!($!T!,$!X!<%$!<!0!$!0!4 $!4  @^!0   )@єp 㿘@# $ 㿘@?" @X" @͐` & @  @9` 㿘! "!@&!! "!@&!! "!@&!! "!@&!! @&!%lup@ А (+@)@  @(#)cl_term.c 10.22 (Berkeley) 9/15/96x`XP@80 xphXPH80( cursor upkkcuu1cursor rightlkcuf1delete to end of screendGkedscroll upkripage upkpppage downknpcursor lefthkcub1delete lineddkdl1insert at cursorikich1go to sol^khomego to eol$kllscroll downkinddelete to eolDkelcursor downjkcud1delete characterxkdch1insert lineOkil1X @pXlakahaja㿈+! %,  @"@@@#\#`#d@l 2  ,  1,)* @~%#  `@ 2``"@@̐#\ #` #d@8` 2^  ,  "A   @J42,@a( ". @@眐#\#`#d @@獐@#\#`#d@    !D " $     @=  2 $ 㿘!D`  `$ @@| 2 `$ 㿘$  $  " @ kf%d233|This terminal has no %s keyfunction key %dH@l @-@:@~ " @  @T @-@"Ƞ@#\#` #d@s  -@ਰ 㿘 ` $``>` `" (T0+`I"0& (T`"(T$ ?&$ @1`?0  a ?"a a "a ` ``  stderr%s046|messages not turned on: %s045|messages not turned off: %s8@ 2  = -@8 @ 6 a؀ / -)     &a؀@` 6  -?c@ 6   -@Ė TERMlinestigetnum: linescolstigetnum: colsLINESCOLUMNS㿐  '   `h@?`6 ` 2v'0tn"  " *` * 8" !`^" @Z!`  !X*` * 8@ۀ J!X@Հ D`( .@ ! `.@} ( 6  .@P0`` .@} @ 6  .@@H " `" P.@ X  @[ .@ `  @R 2&2& 㿘a!?` "@ . :  "  "* `@p @(#)cut.c 10.10 (Berkeley) 9/15/96㿘  `@  @  2 @ ` @ߐ `ac   `"  `]a,*   `a#  ]!,*   !@  `    2 0 2  1  2 1@"  1@Ք ` !$  @ 2,  @   $ $  !@ $ !@"  "!@ !@$  @A $ ,  "  , @8?   @ \`@0 @2 "@@ F   @ <`@ @  @{ )  "! a# 2  1]!, e !@  `  |  2 v   p!$ @ϐ $ ,  㿘 !@`2 /#h 2 3 4 5 6 7 8 9 `?π * *`*` *` *` *`*`*`*` @`2 ` `"  "` "@@ @㿐 @z 2(   @F   "" @@J&  & &  @2 ' "'    '  㿘!@  "@G `"  "` "@@ૐ!@  !,!, @1 㿘 @ْ < @`  & @j &  @P   `@}   @& 㿘2& "`2&"@@ 2㿘  @N@L@(#)delete.c 10.11 (Berkeley) 9/15/96002|Line length overflow㿈0 '@@ Т @zF 2ް  d & d@ɚ d 2 (T   @w   (T  '@@ݐ @{ 2 @*|@  @y쀢 2 쀢@`? j#'@z 2  d & d@U d 2 (T   @v   (T  '@@ݐ@ @yd쀢 2p    "'T!"`'`  @F耢 !x t@:x "M &ttx'T!&T@`@@z` & 8 @@2S` @y 쀢 2,    "'T!'쀢  @耢 ݠ`x t@x "  &ttx'T!&T`@` `@᳔" `?"@@z_# Ѣ Ϣ `7@ @x̘ 2ذ     T!aa' @耢 x t@x " &ttx'T!&T@l @x쀢 2 쀢 Z? V"@  0@| `   " T!"x -'%   "TtT >&Tx t@Rx "e &ttx'T! &T@A耢  `@ " ?" @@@y * "@x #  d & d@ d 2 (T   @u]   (T   '@@ݐ    ` `thT >"hT@M@(#)ex.c 10.55 (Berkeley) 9/24/96script 170|Interrupted㿘`@c "l۰    `"  "` "@@ @l 2T  $2"$* ?# pd@ @2d`L@R d $d@=L a< "a4`a4*` * 8 2 @ b " b @ b "b`bؑ*` * 8 ` `hT ?"hT`x :@] 2t `(T   @t  `(T  2@<b@=X @$`x` 2`2#$ $`$ $@Ґ "`T 2@ `(T 2`  @tt  2T`(T " T`(T "(T 2@BT 2 &d @"d& $d @j 2 @&@i L$ !#&*<=>@~080|Unknown command name1bca1082|%s: command not available in ex mode083|Count may not be zero084|%s: bad line specification085|Internal syntax table error (%s: %s)lr086|Usage: %s088|Flag offset to before line 1089|Flag offset past end-of-file090|@ with range running when the file/screen changed091|Global/v command running when the file/screen changed092|Ex command failed: pending commands discarded093|Ex command failed: mapped keys discardedx  `|` "`` &a`&a`@ @xN L  g & P`*@$`` @" `a &a`  $` ` *@$`` `Q @ 3`$`@ 2 ` $``  `J  a &a`  $`  2 ` ` $``? $`` :2`  ``$`J`:`? $`` ""2!` ?` $`J  "``? $``J 2`|`  $`` $``?u$`` "``J  2 `` $``? $`` 2` $ `("`@ '  Ɛ `|` " 'I` @`  2``J ` *@$`@ 쀢   쀢 2 F``  `J  :2 `` $``? $``  `J`|` ~3@ "   ` $``?$$`` `a#`J  " ``?$`` $`` 2``2  3@l` ?* : `f5!*`@$$$$$$$$$$$$$$$$$$$$$$$$$(Q 'LJ@ 'JJ@"J l p + - ^ ##`" $``@$`Q  $`$`$`(`$`,` $`0`$`4`$`83"U$`0 L]a,*  ,@ y X$` L k s?B`L  >`L  :`?`" $``?$`Q!<$`   J c g r`?`" $``?$`Q#p#p$`$`$`(`$`,` $`0`$`4`$`8~#$`(`$$` \L`*  ,@ 1`` R!8@`$ `$` ``` `! `Q"h@ H@` ``  !р``  ""` #X "#P #P*` * 8 `  P ` @@` `P#P@2` L <"L` P#@2 ` L >2`  LJ2 ``?$`` $`` 2``@" 2`` P#@2` "Q!@2` $Q"h@2`%(`*@Q"h$` `( $``` 2`$@2 ` $`` L $`d P$`h` $`" "" "*` * 8 2` ` " ``@ $``|"4`|@*@$`$ `  $2` `" ` `  3@~]` `@`$` >$``$`` Q @   @h@@uP`  `J@ !2``$``?$``|!4`|`$`J  2 ``?$`` $`` 2`` "``J@ +2 ``$``?$`` ;`J`@"`! `   'S "` 'R@@o  ` ?$```$`J`  "`,`?$`` $`` ɠ `"$`"@ @@@2` `  `J `?$`` $`` 2`0Q#@"p@2<` '` ! `J  2`'`?$`` $`` 2`` !2`` Q#@쀢 "y`` } `J p`?$`` $`` 2`0dQ#p@a` J  2 ``?$`` $`` `Ja#@  2Q`|2`Q#p#p$`$`$`(`$`,` $`0`$`4`$`8~#$`(`$/$` "-``J $``?$` " " ``J@ \2 `` `$``?$``J "`?$`` $`` 〤`  `J @  W`J`@"`6 `   'S "`+ 'R@&@n " `  `J  '쀢 |2&,쀢 2 `a &a`  $` `?$`` $`쀤 |2, 2``  $``?$`, `?$`` $`` 2`` `$`$``$```" " $`` Q#@2` ` L \", `  "l``  `` : 3`` "`    `  ` $``` $`@s耢 2^`耢 2 L$`d` $` L$`d Pj$`h$```l$`d`pd$`h "b` +```` ( ` $` $``  $`l@sr`l 20``   `l  $`d` $`$`d$`p$`h` 6$` * 42` 2/`  $```@$` L 2$`l` @sD耢 2`耢 2  L$`l$`d` $` L$`l$`d P$`p $`h $```d$`l`h$`p2` ` P"؀@2,$`\ $`` L $`d#4   L #,*` * 8#,$`l P$`p$`h@s耢 2`耢`" $`\ L@($`\`l 8$`l$`\`  y?#+`! ` "l `J@ !2g `$``?$``|!]4`|J  2 ``?$`` $`` 2`` "O` ?ϑ* : `F-9#l*`@l,H` " `J ^"`\ l +"`\ - #"` " `\ݠ  p"`|נ  $`\?$`\ $``|"4`|( "`|$4`|($ 4`|( %(`?$`` $`` 2` ` " `J ."`| = + -" `|  ^" `|    @`| ( L 32 `| 4`|`?$`` $`` 2`~ `J + - ^ #2 `@ 1 2m `J a#@ ` 2c ,`Q` $``?$``| W4`|`Ja#@    L +2K `+`-2F `J -2``| J +`| 4`|`@I e䀢 L 0K`" `" $`$`L a `l$`d`p$`h`d ?$`l$`X`|  4`|`@ `ۀ @쀢 쀢 7܀ "`@q? "$`T` P` "` @ `? ```'=J`"`" `   'S "` 'R@@k  `  ?$```$` `,  2 ,` $``? $` `?$`` $`` 2` @ $ 2``J  2 ``?$`` $`` 2`` "` `'2J`"`", `   'S "`, 'R@@kE 2,`  ?$```$` `,,`?$`` $` ` 2` $ @ T 2s`_```@ ` h L NR?'L  o2$$ "J``$쀢@2<` C`` ` ` *` * !X  @jNL 3X@y L  ` "```$`J@  2``? $`` 2 ` 3@|2c " ```  3@y``` - 2I$`l 2``2$`d$ @2`d`   @p`l 2`d`|    @p*耢 2`$`l`d 2``$ @2$`  ϖ @o`d 2$  Ŗ  `@9@322```  2'``l  L@ ``"``l`d  L@ ``" ``d " & L& P L@ P`$``o$``@ L' P'`*@$` '@x3  2x`$ "  , & ,  $@2`@py` @"!`   "`$ "`hT 2`@2 h|` P"؀@2`h|€ ` *@$``  € 2hT (T 2hT  @jŖ  2$ (T " $hT "&`$$!&$ " @z-  ".$`\`"*$  L  3@x} `8`\     L`\@o  2  L 3@xf` L`\ & L$ L   H  L D `|`:! @4`|`@@?`|! @4`|`|b  "$@! "! !*` * 8 2`  ` @2"  L''@0 :`@J? "`#` ?`8    'S "`` ? R@*@i-:` 2 ``$` *` $``"$``$``@Ն` $``$``$`$"@?   |`0 > (+3)4 `P "* Ltt 2@  @wc@2 @  @w (@@q@`2 `P pn $"@2y'`| 3@w` `3@xŖ8 `     @P` 2A`` "=```$`J@`@"` `   'S "` 'R@@h  ` ?$``  $` |2 ``   $``? $`` ``|  4@w&h@@k   4@w '&a$*@&$094|The second address is smaller than the first㿈&&``` ݠ >#p'  ` ?* :  2* <`2`   @mz`l  `l@ &`d&`p&`hE&```2`   "``` " L  " L`" `l`&`d P&`h &``&`d`p&`h L&`l P&`p&```J ; `` "`d  `" `l  @8& L`h& L`p& P ` &``?5&`@ 2  {쀢 ) X`` "   "`l &`d&`h&``&`l&`p &``&`d`p&`h&`l&`p ` 2-``@2M ;`` "2 L  " L2 "%`l-``&`d P&`h&   @ܖ .   @֖ (   @ϖ ! !   @ǖ  &`d`p&`h L&`l P&`p &```` 2 `l`d@ >@uԔ & $0123456789'\/?.+-^095|No mark name supplied096|\ not followed by / or ?097|Reference to a line number less than 0㿈'&`* &`  2``?#@J@     @p '` ?ܑ* : `8@! *`@8,,,,,,,,,,$ &` &`&@l 2 ` &` &``@  @ m'&&`" `" &`&` &` &`` 2 ` @@uQ'J`@s  2s ` &``n?`  `J  / ? @@t \ ` &``?&``J /!ք  L& P&`@@!p p#\`` 6 `" `" &`&` &` *&` & P& L 2&@k| "   &`  a`Jc   +*` &``?&``  `J  2 `` &``? &``  `Ja#@  2 `+`-`^2 2 ` & L& P&` &`%a#` "~`J  2 `` &``? &`` "k`J@  2 ``+`-`^2\`J  2`J  2 `+2? `?&`` &`J - ^  ` &``?&` `@q 2  ` " $   ` $   T `$`" `" &`&`  "   @ @@s˔@7 8  , & 㿘$*@&$ |@2 `@q @l$ 2j `P "F@`<`<"`<  @`<2 $`@ "` 2 $`<"@@δ`<2 `<2+`H `P `D`@j  " `D@j5 L " L)   & L@ΐ`H@`"``"``@"@@΅|$``L @@ `L$`  $ & L$`D `P $ &$ 㿘 `|`"7`|` P "# < < <2& @"`2& <"@@G  <2@A H`"  "` "@@6`|2 P`|"  098|The %s command is unknown㿐     (T!' @ 1,@ x  t@ x %$ t t x'(T!$(T,@@m B@t8   ` `t@hT >"hT@ߐ㿘 @" P#Ȁ@%@ 㿘@ J? !   @ R @`?㿘P""؀ " JL@4 JL@2   @    2J 099|Address value overflow100|Address value underflow101|Illegal address combination102|Illegal address: only %lu lines in the file103|Illegal address: the file is empty104|The %s command doesn't permit an address of 0㿐"     @r 0B C@r0< C@r 07 @@SR 0/.C#0.@D\ C@q0@h  C C@qߔ(0 @ͮ CP@@q@(#)ex_abbrev.c 10.7 (Berkeley) 3/6/96105|No abbreviations to display106|Abbreviations must end with a "word" character107|Abbreviations may not contain tabs or spaces108|Abbreviations may not mix word/non-word characters, except at the end㿈`x  "`t0 @ 2u  D@q}n @K`@ ?a#@  2 `t`_ DW `t D   EX ` `t `a# @   `_2   @   `_@  @ ?`t `#\#` #d   @/@ 2  hT "hT D @q 109|"%s" is not an abbreviation㿘`t (T  @`@ "   @D@r3 @(#)ex_append.c 10.29 (Berkeley) 6/28/96㿘@ 㿘@ 㿘@  273|Entering ex input mode.㿐   ` @| `d & L`22``d `d`l 骘  2ڰ 떖  2Ұ ` E`     ? 2$ $@&   .2 ` "?`  @f & -  ? `D @e 2  Ę 2&`&`$@|`$ (€   ` @ @Qu $2` ` &$D@*cE`@u= @*D@*c@*`|!5! "! !*` * 8 2!< "!<!< "!4 !4*` * 8 2@ @ @Ξ '' @KD 2! ``  @ey  2 ` & L@fh   & L @(#)ex_args.c 10.16 (Berkeley) 7/13/96111|No more files to edit㿘`x 2` ( "  2` FJ8!"`|`x  (@0 @  2 @}@}y a@]D  2r `x J$@ $ "@ʢ  @ʛ $$*@&$& (`x @Ғ   & $  @oWH `t@   $@ $`@  $ $& (@T@ $ &$ (@T`$@  2`|!  $ @U? 2   "$ ( & ($(&$ 㿐 @ / @ߔ `t@T@  `|2 @U   @ @+ @ "$"( "& $ &$ 112|No previous files to edit㿘 ( $@2 ` F@n5 !"`| (@R?@ ? 2' @֒" a@\j  2  (@T9" `|!  $@T 2   (?& ($(&$ 113|No previous files to rewind㿘 $ 2 `| G@nx!  a@\4  2  $& (@T@" `|!  $@T 2 $ &$ 114|No file list to display %s%s%s[]㿘 $   G@n70Q  $ H G")G@ ( `@  8?@   GaG a@(y (G"" (G""@(H (T   @`  2  (T   G@(La 㿘` `x @O  @m֔ ``2`t@g@ $  @  "$@ $`@  $@(#)ex_argv.c 10.26 (Berkeley) 9/20/96㿘 $ $@Z  &`t $&`x 㿘 @O $ * @@3 $ * @* $ * @"  $ $ $ &`t $&`x x    "'(T!" x'' @5" "c '쀢!  t x@)" "W $ t t' x'(T!$(T'#\#`#d@ɚ     t@T >"T@^-  @@  J@  @ `@ *J@@ |    t@T >"T@2 echo x ` "'(T!" x'' @" ΰ '쀢!  t x@" 2$ t  t' x'(T!$(TH#0 #0* *  *  *  *   '#\#`#d@9   3@{  2V  4@{  O cp " ch`ch*` * 8 a#*`:       L   J  +@xL  7aL` `  㬐@  2@x̐  " L' * ,@@f   @` ` t@T >"T@K㿘z )"wN  "k `N  `   'S  'R@ @]"     ֤@$*` "  )`" @L@ "` @`   'S "` @ @ 'R@ *@\:` 2 @` @,`۠ ,$ $$&`t$&`x 115|No previous command to replace "!"116|No filename to substitute for %%117|No filename to substitute for #㿐\d`'@+N #"a  % ! `A \`"`  J@@'    "(T t(T >'(T x@  t x@  " ' t t x'(T! '(T@ @ ֠O  Đ@ɲ@'    "(T t"(T+@ɝ@'    "(T t(T >'(T x@  t x@ " ' t t x'(T! '(T@ @ @{`?&`( `N % # !2``'    "(T t(T >'(T x@  t x@{ "a ' t t x'(T! '(T@ @i E, "`'   `"hT`thT >&hT`x@ `t`x@G - &`t`t`x'hT!&hT@@5    В J J @jP  ,'@%`# 㿘 ` `$?@&%``  ` @D,  @,  $` @j& ` 2` @mE* `  @ǔ P$` `, 2` @ ` "@ @j `, '`, $ ` :&$  @ @>  $ @i  2 $$  ,  @iؔ !  , `, 2` @= ` "@ @i” `, `, "  㿘   "$  . @`"   ` " @@ . @@  & @ $ $ $ $ ./%s304|Shell expansion failed㿘 @"ڒ /L   2,L  @ @@ؐ2 $ L@j^ @D L .@@@ @ `$* @ @ݔ M@ / /, @ϔ`$* @ "`$ $$&t$&x@$@  .` " L@~9$  L@i 㿘@@@289|Shell expansions not supported when the secure edit option is setpiperfdopenvfork-c118|Error: execl: %s119|I/O error: %sH''''#X  #P*` * 8  P  L0H cd  `c\*` * 8'\'@! / '''@''Đ?''@   L@h L@ c ' L@? 03 L@hf̀`@?"@? @ @! @@@ݐ L@ D  L@i@Ǡ @ ?  @@`#@ @DĀ:쀣` ` "(T t2(T >&(T@*  x  t@۔ x "I & t t' x#@(T!&(T*  @܀ 4 '@"'.@`Ě'@( .@N  2.@.@#@  @@M̀   L@i   @+z 2  N@  `"  2  L@g @ @(#)ex_at.c 10.12 (Berkeley) 9/15/96㿘`|  @`Q @ *2 . $ @2  6 . $  &$ a#  ]!,*    !@  `  2   `*` * !X  @Wݒ  @H 0f@ 5`<$`<$`@ @ -`d"`@"`l" `P " `P ,`P`<"`<"`@ 2`<$`@" $`< @   ``@ @@ ,  $` @g ) `$`H$`L`*` @"  `@Ĝ``,`@   | $@  |"  " |  |$` @(#)ex_bang.c 10.33 (Berkeley) 9/23/96!!%s 303|File modified since last write.! 㿀`t` 2 ` `   @@N@ $  @f  `@$@2```Nc@@ ``Nc@ @@!`` L  > X ";$!$ "! !*` * 8  $T  @TΒ  "#$n $T "$L $L*` * 8 2$$ "$$@2 $Nc@k] $ @ @)T`?;$ 2 `` @ @G 0: @&``d  `l 2#\@\쀢 )  2#\&`l&`d #\`d`l@a@& L$ & P L@ P$& P$ @2 O@ a` @(#)ex_cd.c 10.10 (Berkeley) 8/12/96120|File modified since last complete write; write or use ! to overrideHOME121|Unable to find home directory location%s/%s122|New current directory: %s%s㷘  X "`x`|!2`x  J / O@eh `x  "`t0 O@a#@>@  "J 2 O@en @W@ 2`xb Y`t@ /R` .J (!H@ @ .2 !H ` .2 !H ` /; :!H " !@ !@*` * 8 'O)ON@  :2`@.@(@.@@b 2N@@Œ(  @fq# N@ `ڲ` P@fc @(#)ex_cmd.c 10.19 (Berkeley) 7/12/96_____<__`_0_(_ _^^^^^^8^^p^X^PB_ ^(^^1^]]]B_ ]]]8^]p^X]h1_]P]8](] ]\\_\\\T_\\\x"\p\H\0\(@\ \[[@\ [[[B[[[h[`b[X[@[[}B[ZZZ~ZZpZHZ@Z8ZYYZ8YYYPYYYYZ8YpYHY@hZ8Y0YX[XXXXO_XxX`XX1_X@X XBXWWWZWWW@_ W`W8W0DBW(WVVZVWVVVVhV`VXVHV0V(TV VUU_ UUUxT^UXU0U(_ UTT4^TTT4^TTXTH_T8TT_SSSq^SSpShP_SXSHS@d1^S RRxVXRRRRRRxRp_R`R0^^QQQd\ QQQQQ@QQh_QPP,PPPP_PPhP`_PPPhPHB[P([hP &DPPOO)_OOO-POOXOP*|_O@O O/l_ONND@4^NNNM@_NNxNhZNXN@N8N0N NM^MMM^8_MMhM`^!MXM(MM`Z8LLLSYLLLxb($[XLHL8L0aP$[XLKKa$[XKKKbD$\ KhK`KXiKPK(KKjJJJJ4^JxJ@replace previous RE with previous replacement string,[line [,line]] ~ [cgr] [count] [#lp]~display different screens of the file[line] z [-|.|+|^|=] [count] [flags]3c01zcopy lines to a cut buffer[line [,line]] ya[nk] [buffer] [count]bcayankexit[line [,line]] x[it][!] [file]xitwrite the file and exit[line [,line]] wq[!] [>>] [file]wqwrite the file and switch to the next file[line [,line]] wn[!] [>>] [file]wnwrite the file[line [,line]] w[rite][!] [ !cmd | [>>] [file]]writedisplay vi key usage statement[viu]sage [key]viusageedit another file (from vi mode only)[Vv]i[sual][!] [+cmd] [file]enter visual (vi) mode from ex mode[line] vi[sual] [-|.|+|^] [window_size] [flags]2c11visualdisplay the program version informationversionexecute a global command on lines NOT matching an RE[line [,line]] v [;/]RE[;/] [commands]vdelete an input or command mapunm[ap][!] word!w1runmapdelete an abbreviationuna[bbrev] wordunabbreviateundo the most recent changeu[ndo]undorun the tcl interpreter with the commandtc[l] cmdtcldiscard all tagstagt[op][!]tagtopmove to the previous tagtagpr[ev][!]tagprevreturn to the previous group of tagstagp[op][!] [number | file]tagpopmove to the next tagtagn[ext][!]tagnextedit the file containing the tag[Tt]a[g][!] [string]!w1otag[line [,line]] t line [flags]tsu[spend][!]suspendsuspend the edit sessionst[op][!]stopread a file of ex commandsso[urce] filef1rsourcesuspend editing and run a shellsh[ell]shellset options (use ":set all" to see all options)se[t] [option[=[value]]...] [nooption ...] [option? ...] [all]wNsetrun a shell in a screensc[ript][!] [file]scriptsubstitute on lines matching an RE[line [,line]] s [[/;]RE[/;]repl[/;] [cgr] [count] [#lp]]re-edit all the files in the file argument listrew[ind][!]rewindgrow or shrink the current screenresize [+-]rowsc+resizerecover a saved filerecover[!] filerecoverappend input from a command or file to the line[line] r[ead] [!cmd | [file]]readexit ex/viq[uit][!]quitappend a cut buffer to the line[line] pu[t] [buffer]putedit the previous file in the file argument list[Pp]rev[ious][!]previouspreserve an edit session for recoverypre[serve]preserverun the perl interpreter with the command, on each lineperld[o] cmdperldorun the perl interpreter with the commandpe[rl] cmdperldisplay lines[line [,line]] p[rint] [count] [#l]printenter "open" mode (not implemented)[line] o[pen] [/RE/] [flags]openchange display to number lines[line [,line]] nu[mber] [count] [l]numberedit (and optionally specify) the next file[Nn][ext][!] [+cmd] [file ...]!fNnextwrite a .exrc filemkexrc[!] file!f1rmkexrcmap input or commands to one or more keysmap[!] [keys replace]!Wmap[line] ma[rk] keymarkmove lines elsewhere in the file[line [,line]] m[ove] linelmovedisplay lines in an unambiguous form[line [,line]] l[ist] [count] [#]listmark a line position[line] k keykjoin lines into a single line[line [,line]] j[oin][!] [count] [flags]!ca1joininsert input before a line[line] i[nsert][!]insertdisplay help statementhe[lp]helpexecute a global command on lines matching an RE[line [,line]] g[lobal][!] [;/]RE[;/] [commands]globalbring a backgrounded screen into the foreground[Ff]g [file]fgdisplay (and optionally set) file namef[ile] [name]filedisplay ex command usage statement[exu]sage [command]w1oexusage[Ee]x[!] [+cmd] [file]exbegin editing another file[Ee][dit][!] [+cmd] [file]f1oeditdisplay buffers, screens or tagsdisplay b[uffers] | s[creens] | t[ags]w1rdisplaydelete lines from the file[line [,line]] d[elete][flags] [buffer] [count] [flags]bca1deletecreate a set of tags using a cscope commandcs[cope] command [args]!scscopecopy lines elsewhere in the file[line [,line]] co[py] line [flags]l1copychd[ir][!] [directory]chdirchange the current directorycd[!] [directory]!f1ocdchange lines to input[line [,line]] c[hange][!] [count]!cachangeput a foreground screen into the backgroundbgdisplay file argument listar[gs]argsspecify an input abbreviationab[brev] [word replace]Wabbreviateappend input to a line[line] a[ppend][!]append@ [buffer]@shift lines right[line [,line]] >[>...] [count] [flags]>display line number[line] = [flags]1=shift lines left[line [,line]] <[<...] [count] [flags]<execute a buffer* [buffer]b*repeat the last subsitution[line [,line]] & [cgr] [count] [#lp]s&display numbered lines[line [,line]] # [count] [l]ca1#filter lines through commands or run commands[line [,line]] ! commandS!scroll lines^D@(#)ex_cscope.c 10.13 (Berkeley) 9/15/96bebpbXbPlb(``wL```x``x`pz$`H`pDiscard all current cscope connectionsresetkill numberKill a cscope connectionkillhelp [command]Show help for cscope commandshelpfind c|d|e|f|g|i|s|t buffer|pattern c: find callers of name d: find all function calls made from name e: find pattern f: find files with name as substring g: find definition of name i: find files #including name s: find all uses of name t: find assignments to nameQuery the databases for a patternfindadd file | directoryAdd a new cscope databaseadd309|Use "cscope help" for help㿘 $8   @\ " $8P  ,$8`t `a#L  `` `-`a#L  2L` L ,  a#*`:    L  @ 2   X@\Ŕ CSCOPE_DIRS :㿐Y@q 0"U @G     (T!" x' @m   t x@a 2$ t.  t x'(T!$(T@)'!Y@ @ J @  ` `t@hT >"hT@ %s/%scscope.out8 `x@S 2 `x X@qbz  @= r `t,  @=  @\)c <  $YY@ɘ!@"  @\H Y !@b /,@`@ @o 8`4 @[ / &`&` `@&`@- @  &@" $&`@! @G   @ cscope.tpath%s:8(Y`Z@e @ T@` &`, @[ _  @ &`,@ Z@\Ԗ J @F @`,* `, @ :2`J` 2`J@  @@  #&`(`,Z@`(#Z$  @`(2$ @C` &`, @ƒ &`(`,"@  `,  @y&`,pipevforkcd '%s' && exec cscope -dl -f %s/bin/shsh-cexecl: %swrp'''Ԑ?'''@{ @v耢  Z@܀?#` !0E Z @[?"@?"@耢?"@쀢?@ @}@+ @( @% @s@q(Z(`@Z"PZbXZ`@͘  Z@\ h@) @U@S#`$Z@vDbx#` #`Z@v<b#` 310|No cscope connections running%d%s 278|No matches for query㿐     [@Zx   @  $ $  @ ,  %%  2 $ " $ $ @   L P  ` !`?'"!+[` `@͖@ @?  @r@2>^ 2 2 ` [@Z.P $``| !`! @/V :   @/%` 2 2 $$ 2$" $$@$`2$" $@`"    "`  L"`   P"`"  "  "  @  @ sgdct efi311|%s: unknown search type: use one of %s㿘`VN@N@ "` "`N@ JN`  D&[#J# "LLN@@" L & L 2LL 2N`@`*` * !X` @J&N@ [[@Y#n  `L    L  L 2LX@bPV "% L "`L  `a#  ]!,*   `!@`  ` `@`2 ```  @ِ @# @Y6  & &  & @.   *`&   @͔ *   .  cscope: %d lines%1[ ]%s: "%s" x%\#\(@]` ϐ@* @ek '* b`@X??'/\(@]z` @eO '``? "`@t`?`" ? 2`*' @4袒 "   "   @@@ِ  耤 ]耢 "Y쀤`"V@+@o܀ 2  \@qb 2 .   .@@  @`> ($ "  @  /*  ' @@  $ ` $     $ $ $@`$ $ @2 &"&  &??\'@  @X3  `  \ "b0 Z @Yh`@  8`( ""'%Y$@~@ 2 &@'`@&  '@ '㿘@"%s doesn't match any cscope command Command: %s (%s) Usage: %s cscope commands: %*s: %s 㿘`N@ @]ch@$ ]c@ ]c@  ]@cW##䀢 " 3]cД @    㿘@[u@  312|%d: no such cscope session㿐` $ `  @ `@```2 ` ^@Wm* ` "` @s` "`@s`@M @`"``"``@"@`, "`(@`( @y@w 1㿘   " #^b "    No cscope connections. %2d %s (process %lu) 㿘 ` 2`^@Zb0   %^ @O  ` 㿈   @M 2 ''' #\  $@vd  @/;`   & & L& P L@{ϔ P 㿘@cW##䀢 " @0    㿘 > ``? "`@r`?`" ? >2`?2` % `? "`@rc` >`@"@ ``? "`@rR` `@"@ 2` @(#)ex_delete.c 10.8 (Berkeley) 3/6/96㿐  2 `|` @@7 $   `Q`d`lX  2 `d`lD  2 `d& L@M  2  L 8& L @(#)ex_display.c 10.12 (Berkeley) 4/10/96buffersconnectionsscreenstags㿘`t c"`t s b" `tF` $ t"2`t@`  :_@|b 25` @F6  +_@|b 2&` Ӑ'`t _@|b 2` @8  _@|rb 2` @,O` `@7  123|No cut buffers to displaydefault buffer㿘 a@ 2  a 2  `@U0\!@ "( #a c  2   @]  (T D  @G  2 (T 8 2  !@ "' #a c     @4  (T   @G  2 (T  2  ! `@0 ********** %s%s (line mode) (character mode) 㿘2```*` * !X  @E`` `"`" `@ca``@1%```"`` *` * !X  @E @i (T   @G    (T  2 @Q8@@2`@(#)ex_edit.c 10.10 (Berkeley) 4/27/96㿘`x  "`t0       @:_ 6  @:V@-  `t@CM@`@`!@`|@B a 2 `|!,@: 2 $(&$  㿐 @r: 4 @_ `|2  @:  @h @r  "@ "@"   6 L"L P"P x"`$"`(& $ &$ @(#)ex_equal.c 10.10 (Berkeley) 3/6/96%ld 㿐  2 `` @@5  @ @J   `d'ab@l @(#)ex_file.c 10.12 (Berkeley) 7/12/96㿘  2 `x` @@5Z 1  ) % `t@y72    @B @% $  ?#? @`4   (` @ L@Vd  @(#)ex_filter.c 10.33 (Berkeley) 4/27/96piperfdopenvfork-cexecl: %sfilterforkwparent-writer@'''''''  ܐ  ܒ 3@b  '?''''\ @ ܒ a%@耢 ܒ aa@oc 'ܒ b@)?ܒ b@Sb?"@?@@o쀢?"@쀢?, @מ䠀?"@  @  @ | ?"@?@@@d " \\*` * 8@ u /2d " \\*` * 8d " \\*` * 8 b@  d " \\*` * 8ܒ b@T+@K @u@s\ '@jb`(Ԙ@Q   '\ \\      `X @*`X? 0"ܒ b@R0@5@3Y @/b@n#`82#\@  #`b`(@6 @@\ @l  'b`(̘@   '\ \ܒb@ @%   '\ܒ Z    F   '` @H܀ ?  `X *`X \  @ ܒ@ 2 2 filter read㿐 @2# 2`  (T   @D$   (T   , @ ߘ ` @ c@Q@nm @(#)ex_global.c 10.21 (Berkeley) 6/30/96㿘`|2@ 㿘@ 124|The %s command can't be used as part of a global or v commandppp  2$` @u @ `  c@QS `x "$` `t'J`'J` ܀ `J`a#@  2 ` `\`|` ` `? J 'ܘ J   J@ 2#*`'*J@ \J` 2ܐ` 'J` \  @*ܐ 'ܔ *ܐ 'ՔK   2$  @2 0@2 L #\  Ė  @ " Lװ #\ "   @ 2̰  &  L' P' '@PU  2  @| `<$`<$`@@܀ 'd @'ܐ '@ *  $` @P  `$`H$`L` @$`D `P  ,`P  | $@  |"  " |  |$` `d`ly d`<( (T 2@  @Bݖ   (T @`"``"``@"@@`@ڐT@r  d @Eu؀    ?? ܔ @ `  ". `@"*`@@"I `@  $  @  @Ph " $ $ $`@$ `<2`@$`<"$`@(@rN  㿘``@2  g  @P@ a  |"] P T<<"P$D<  F `2 ?$  ?:$ $   5$   $   (-2 $@ "` 2 $<"@@2@n $`  $` $ $@$`2" $@$2 $D2 P @(#)ex_init.c 10.26 (Berkeley) 8/12/96㿘 @A$<2&`$$ $  $ $    "@7 $  @O   @&   㿘 `2$$ @@ @@  2 `, "`@` @@(B 2 @& 㿘`= @'/etc/vi.exrcNEXINITEXINITHOME%s/%s.nexrc.exrcؐ!f!` @  2  @В!` 2˰   |  "$ͳ$&2 !f@!p" !f@!p @ʚ K @!x" f@!x @ ; @ܐ!"9 L@ 48$ff@u! @9  "$    8$ff@u! @!  2  8@h 2c   |  "$K$&2W ! "! !*` * 8 G "D 8f @ "2   8, 8f @ߘ 2" 8@<@f a@<@ fa@ "     |  "  X#\ 5   @._ @ @.v@q㿘 `|   @Ԓ 2`| @NZ 3  $`|" $`|`|$ ` $ $ `2 $ @sz $  `$ $ @ΐ@sj $  $   $  125|%s/%s: not sourced: not owned by you or root126|%s/%s: not sourced: not owned by you127|%s/%s: not sourced: writeable by a user other than the owner128|%s: not sourced: not owned by you or root129|%s: not sourced: not owned by you130|%s: not sourced: writeable by a user other than the owner㻐@|ܒ  @ 1997/01/10 18:29:48 etheisen Exp $ɬ$OpenBSD: nice.c,v 1.2 1996/08/19 08:25:05 tholo Exp $$OpenBSD: glob.c,v 1.5 1997/04/12 19:05:48 millert Exp $$OpenBSD: getttyent.c,v 1.3 1996/09/15 09:31:03 tholo Exp $$OpenBSD: getpass.c,v 1.4 1996/12/04 23:02:13 chuck Exp $$OpenBSD: getmntinfo.c,v 1.2 1996/08/19 08:23:45 tholo Exp $$OpenBSD: getlogin.c,v 1.2 1996/08/19 08:23:41 tholo Exp $$OpenBSD: getgrent.c,v 1.6 1997/01/25 04:59:42 downsj Exp $$OpenBSD: getbsize.c,v 1.3 1996/08/19 08:23:04 tholo Exp $$OpenBSD: fts.c,v 1.7 1997/03/24 02:54:15 millert Exp $$OpenBSD: fstab.c,v 1.3 1996/08/19 08:22:51 tholo Exp $$OpenBSD: errx.c,v 1.2 1996/08/19 08:22:36 tholo Exp $$OpenBSD: disklabel.c,v 1.3 1996/09/15 09:30:58 tholo Exp $                p ` P H 8 0 (                           $OpenBSD: confstr.c,v 1.3 1996/09/15 09:30:55 tholo Exp $$OpenBSD: alarm.c,v 1.3 1996/09/15 09:30:54 tholo Exp $$OpenBSD: tcsetattr.c,v 1.2 1996/08/19 08:34:42 tholo Exp $"#$%@$OpenBSD: sscanf.c,v 1.2 1996/08/19 08:33:07 tholo Exp $$OpenBSD: fwrite.c,v 1.2 1996/08/19 08:32:50 tholo Exp $$OpenBSD: ftell.c,v 1.2 1996/08/19 08:32:47 tholo Exp $$OpenBSD: regfree.c,v 1.3 1997/04/28 20:45:01 millert Exp $*h$OpenBSD: herror.c,v 1.4 1997/03/13 19:07:28 downsj Exp $...x.`.@$OpenBSD: getservent.c,v 1.3 1997/04/05 21:13:09 millert Exp $$OpenBSD: getprotoent.c,v 1.2 1996/08/19 08:28:52 tholo Exp $$OpenBSD: getnetent.c,v 1.7 1997/04/24 08:37:09 tholo Exp $$OpenBSD: gethostnamadr.c,v 1.25 1997/04/29 19:28:38 deraadt Exp $:$OpenBSD: md5crypt.c,v 1.7 1996/12/14 06:49:36 tholo Exp $./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzm$OpenBSD: verrx.c,v 1.2 1996/08/19 08:27:32 tholo Exp $$OpenBSD: waitpid.c,v 1.2 1996/08/19 08:27:46 tholo Exp $$OpenBSD: wait.c,v 1.2 1996/08/19 08:27:41 tholo Exp $$OpenBSD: siglist.c,v 1.2 1996/08/19 08:26:05 tholo Exp $$OpenBSD: getpwent.c,v 1.10 1997/04/18 18:55:16 deraadt Exp $8$OpenBSD: getcwd.c,v 1.3 1996/11/27 22:00:45 millert Exp $$OpenBSD: getcap.c,v 1.4 1997/02/01 04:35:33 deraadt Exp $$OpenBSD: exec.c,v 1.5 1996/12/05 05:37:10 deraadt Exp $$OpenBSD: err.c,v 1.3 1996/08/19 08:22:30 tholo Exp $H`H$OpenBSD: vfscanf.c,v 1.3 1996/09/15 09:31:46 tholo Exp $  $OpenBSD: ungetc.c,v 1.2 1996/08/19 08:33:11 tholo Exp $$OpenBSD: rewind.c,v 1.2 1996/08/19 08:33:02 tholo Exp $$OpenBSD: fseek.c,v 1.2 1996/08/19 08:32:46 tholo Exp $$OpenBSD: fread.c,v 1.2 1996/08/19 08:32:44 tholo Exp $P$OpenBSD: res_query.c,v 1.9 1997/04/06 07:55:04 deraadt Exp $$OpenBSD: res_mkquery.c,v 1.8 1997/04/13 22:37:21 provos Exp $$OpenBSD: res_debug.c,v 1.7 1997/04/30 05:54:43 tholo Exp $ d'B@;40$OpenBSD: res_data.c,v 1.1 1997/03/13 19:07:36 downsj Exp $9X9P9H9@98909(9 999888889999999(9 999999x9p9`$OpenBSD: nsap_addr.c,v 1.3 1997/03/13 19:07:34 downsj Exp $$OpenBSD: inet_pton.c,v 1.2 1997/04/13 05:08:24 deraadt Exp $$OpenBSD: inet_ntop.c,v 1.1 1997/03/13 19:07:32 downsj Exp $$OpenBSD: inet_ntoa.c,v 1.2 1996/08/19 08:29:16 tholo Exp $$OpenBSD: inet_network.c,v 1.6 1997/04/24 08:35:21 tholo Exp $$OpenBSD: md5c.c,v 1.9 1997/04/30 05:56:06 tholo Exp $$OpenBSD: verr.c,v 1.2 1996/08/19 08:27:30 tholo Exp $$OpenBSD: warnx.c,v 1.2 1996/08/19 08:27:50 tholo Exp $$OpenBSD: warn.c,v 1.2 1996/08/19 08:27:48 tholo Exp $$OpenBSD: toupper_.c,v 1.2 1996/08/19 08:26:56 tholo Exp $Y$OpenBSD: syslog.c,v 1.2 1996/08/19 08:26:33 tholo Exp $$OpenBSD: sleep.c,v 1.7 1997/04/25 04:20:41 tholo Exp $$OpenBSD: getdomainname.c,v 1.2 1996/08/19 08:23:22 tholo Exp $bHbc`cdpde0efx mw$OpenBSD: strtouq.c,v 1.4 1996/08/19 08:33:53 tholo Exp $$OpenBSD: strtoq.c,v 1.4 1996/08/19 08:33:52 tholo Exp $$OpenBSD: wbuf.c,v 1.2 1996/08/19 08:33:15 tholo Exp $$OpenBSD: vsnprintf.c,v 1.2 1996/08/19 08:33:14 tholo Exp $$OpenBSD: setbuf.c,v 1.2 1996/08/19 08:33:04 tholo Exp $$OpenBSD: perror.c,v 1.2 1996/08/19 08:32:56 tholo Exp $$OpenBSD: fputs.c,v 1.2 1996/08/19 08:32:43 tholo Exp $d$OpenBSD: res_send.c,v 1.4 1997/03/13 19:07:41 downsj Exp $$OpenBSD: res_init.c,v 1.14 1997/04/13 21:30:43 provos Exp $$OpenBSD: res_comp.c,v 1.7 1997/04/30 05:54:44 tholo Exp $$OpenBSD: inet_addr.c,v 1.5 1997/04/05 21:13:10 millert Exp $$OpenBSD: _def_time.c,v 1.2 1996/08/19 08:28:18 tholo Exp $$OpenBSD: vwarnx.c,v 1.2 1996/08/19 08:27:39 tholo Exp $$OpenBSD: vwarn.c,v 1.2 1996/08/19 08:27:38 tholo Exp $$OpenBSD: tolower_.c,v 1.2 1996/08/19 08:26:52 tholo Exp $8$OpenBSD: time.c,v 1.2 1996/08/19 08:26:39 tholo Exp $$OpenBSD: gethostname.c,v 1.2 1996/08/19 08:23:35 tholo Exp $@@$OpenBSD: localtime.c,v 1.10 1997/04/02 03:57:30 deraadt Exp $WILDABBRvv$OpenBSD: asctime.c,v 1.3 1997/01/14 03:16:42 millert Exp $X`HX$OpenBSD: sprintf.c,v 1.2 1996/08/19 08:33:06 tholo Exp $$OpenBSD: setvbuf.c,v 1.2 1996/08/19 08:33:05 tholo Exp $$OpenBSD: printf.c,v 1.2 1996/08/19 08:32:57 tholo Exp $$OpenBSD: fopen.c,v 1.2 1996/08/19 08:32:41 tholo Exp $$OpenBSD: fgets.c,v 1.2 1996/08/19 08:32:33 tholo Exp $x`\p0$OpenBSD: send.c,v 1.2 1996/08/19 08:29:52 tholo Exp $$OpenBSD: catopen.c,v 1.8 1996/09/15 09:31:23 tholo Exp $$OpenBSD: catgets.c,v 1.5 1996/09/15 09:31:22 tholo Exp $$OpenBSD: catclose.c,v 1.3 1996/08/19 08:30:05 tholo Exp $P   X<  h$,H@HPX`$l\$l,8h!+$OpenBSD: opendir.c,v 1.3 1996/09/07 19:04:06 tholo Exp $$OpenBSD: getpagesize.c,v 1.2 1996/08/19 08:23:54 tholo Exp $$OpenBSD: closedir.c,v 1.2 1996/08/19 08:21:55 tholo Exp $909$OpenBSD: seekdir.c,v 1.2 1996/08/19 08:25:43 tholo Exp $$OpenBSD: telldir.c,v 1.2 1996/08/19 08:26:35 tholo Exp $$OpenBSD: readdir.c,v 1.2 1996/08/19 08:25:35 tholo Exp $$OpenBSD: fdopen.c,v 1.2 1996/08/19 08:32:20 tholo Exp $$OpenBSD: ftruncate.c,v 1.6 1997/04/26 08:50:12 tholo Exp $$OpenBSD: rget.c,v 1.2 1996/08/19 08:33:02 tholo Exp $$OpenBSD: refill.c,v 1.3 1996/08/19 08:33:00 tholo Exp $$OpenBSD: flags.c,v 1.3 1996/08/19 08:32:37 tholo Exp $$OpenBSD: fclose.c,v 1.2 1996/08/19 08:32:19 tholo Exp $$OpenBSD: db.c,v 1.2 1996/08/19 08:20:25 tholo Exp $$OpenBSD: hash.c,v 1.4 1996/09/15 09:30:47 tholo Exp $$OpenBSD: bt_open.c,v 1.4 1996/08/26 00:17:14 deraadt Exp $$OpenBSD: bt_get.c,v 1.3 1996/08/19 08:20:06 tholo Exp $$OpenBSD: bt_conv.c,v 1.3 1996/08/19 08:20:03 tholo Exp $$OpenBSD: bt_close.c,v 1.3 1996/08/19 08:20:01 tholo Exp $qX$OpenBSD: snprintf.c,v 1.2 1996/08/19 08:33:06 tholo Exp $$OpenBSD: mktemp.c,v 1.8 1997/04/07 22:48:50 millert Exp $$OpenBSD: hash_log2.c,v 1.3 1996/08/19 08:20:38 tholo Exp $$OpenBSD: hash_func.c,v 1.4 1996/09/15 09:30:49 tholo Exp $x0$OpenBSD: hash_buf.c,v 1.4 1996/10/14 22:17:27 downsj Exp $$OpenBSD: bt_put.c,v 1.3 1996/08/19 08:20:11 tholo Exp $$OpenBSD: bt_delete.c,v 1.3 1996/08/19 08:20:05 tholo Exp $$OpenBSD: bt_split.c,v 1.3 1996/08/19 08:20:16 tholo Exp $$OpenBSD: bt_seq.c,v 1.3 1996/08/19 08:20:14 tholo Exp $$OpenBSD: bt_search.c,v 1.3 1996/08/19 08:20:13 tholo Exp $$OpenBSD: bt_utils.c,v 1.3 1996/08/19 08:20:17 tholo Exp $$OpenBSD: bt_overflow.c,v 1.3 1996/08/19 08:20:09 tholo Exp $$OpenBSD: bt_page.c,v 1.3 1996/08/19 08:20:10 tholo Exp $$OpenBSD: mpool.c,v 1.4 1996/09/15 09:30:51 tholo Exp $$OpenBSD: fprintf.c,v 1.2 1996/08/19 08:32:41 tholo Exp $H 0000000000000000$OpenBSD: fvwrite.c,v 1.3 1996/10/26 06:58:58 tholo Exp $$OpenBSD: isnan.c,v 1.3 1996/08/19 08:17:39 tholo Exp $$OpenBSD: isinf.c,v 1.3 1996/08/19 08:17:38 tholo Exp $8}A@???5?55?5A??҇coCa?Ɗ(`ȳ?DPy?@$@@?X$OpenBSD: wsetup.c,v 1.2 1996/08/19 08:33:16 tholo Exp $$OpenBSD: makebuf.c,v 1.2 1996/08/19 08:32:54 tholo Exp $$OpenBSD: findfp.c,v 1.2 1996/08/19 08:32:36 tholo Exp $)e0H FGGLH FGGL `H FGGL$OpenBSD: fflush.c,v 1.2 1996/08/19 08:32:26 tholo Exp $%0$OpenBSD: _def_numeric.c,v 1.2 1996/08/19 08:28:16 tholo Exp $&X$OpenBSD: _def_monetary.c,v 1.2 1996/08/19 08:28:14 tholo Exp $&x$OpenBSD: flt_rounds.c,v 1.2 1996/08/19 08:17:28 tholo Exp $$OpenBSD: infinity.c,v 1.2 1996/08/19 08:17:37 tholo Exp $$OpenBSD: isatty.c,v 1.2 1996/08/19 08:24:32 tholo Exp $$OpenBSD: ctype_.c,v 1.3 1996/09/15 09:30:56 tholo Exp $(@)H$OpenBSD: tcgetattr.c,v 1.2 1996/08/19 08:34:39 tholo Exp $$OpenBSD: malloc.c,v 1.24 1997/04/30 05:52:50 tholo Exp $EF($OpenBSD: stdio.c,v 1.2 1996/08/19 08:33:08 tholo Exp $$OpenBSD: fwalk.c,v 1.2 1996/08/19 08:32:50 tholo Exp $$OpenBSD: sysconf.c,v 1.3 1996/09/15 09:31:06 tholo Exp $$OpenBSD: signal.c,v 1.2 1996/08/19 08:26:09 tholo Exp $M$OpenBSD: mmap.c,v 1.6 1997/04/26 08:50:12 tholo Exp $$OpenBSD: lseek.c,v 1.5 1997/04/26 08:50:12 tholo Exp $)rxPQQ$OpenBSD: sysctl.c,v 1.2 1996/08/19 08:26:28 tholo Exp $U)rx$OpenBSD: scandir.c,v 1.2 1996/08/19 08:25:41 tholo Exp $$OpenBSD: rec_open.c,v 1.3 1996/08/19 08:21:05 tholo Exp $$OpenBSD: rec_seq.c,v 1.3 1996/08/19 08:21:10 tholo Exp $$OpenBSD: rec_get.c,v 1.3 1996/08/19 08:21:03 tholo Exp $$OpenBSD: rec_delete.c,v 1.3 1996/08/19 08:21:00 tholo Exp $$OpenBSD: rec_close.c,v 1.4 1996/09/15 09:30:53 tholo Exp $$OpenBSD: rec_utils.c,v 1.3 1996/08/19 08:21:12 tholo Exp $$OpenBSD: rec_search.c,v 1.3 1996/08/19 08:21:08 tholo Exp $$OpenBSD: hash_page.c,v 1.3 1996/08/19 08:20:39 tholo Exp $_hashXXXXXX$OpenBSD: ashldi3.c,v 1.2 1996/08/19 08:30:16 tholo Exp $$OpenBSD: hash_bigkey.c,v 1.4 1996/09/15 09:30:48 tholo Exp $$OpenBSD: rec_put.c,v 1.3 1996/08/19 08:21:06 tholo Exp $a  n}nobody*Unprivileged user/nonexistent/sbin/nologin2id$$ingres* J& Group/usr/ingres/sbin/nologin2ingres* J& Group/usr/ingres/sbin/nologin1ingresnobody*Unprivileged user/nonexistent/sbin/nologin3bin*Binaries Commands and Source,,,//sbin/nologin1binrootCharlie &/root/bin/csh3rootCharlie &/root/bin/csh2ng  &:/root:/bin/csh daemon:*:1:31:The devil himself:/root:/sbin/nologin operator:*:2:20:System &:/usr/guest/operator:/sbin/nologin bin:*:3:7:Binaries Commands and Source,,,:/:/sbin/nologin uucp:*:66:1:UNIX-to-UNIX Copy:/var/spool/uucppublic:/usr/libexec/uucp/uucico nobody:*:32767:32767:Unprivileged user:/nonexistent:/sbin/nologin ingres:*:267:74:& Group:/usr/ingres:/sbin/nologin nobody*Unprivileged user/nonexistent/sbin/nologin1nobodydaemon*The devil himself/root/sbin/nologin3daemon*The devil himself/root/sbin/nologin2 |s(#&&08/14 08:47:20 downsj Exp $ # List of acceptable shells for chpass(1). # Ftpd will not allow users to connect who are not using # one of these shells. /bin/sh /bin/csh /bin/ksh /bin/rksh /usr/local/bin/bash uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Boperator*System &/usr/guest/operator/sbin/nologin3operator*System &/usr/guest/operator/sbin/nologin2operator*System &/usr/guest/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonrootCharlie &/root/bin/csh1root`[uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucpbin*Binaries Commands and Source,,,//sbin/nologin3bin*Binaries Commands and Source,,,//sbin/nologin2YKYingres* J& Group/usr/ingres/sbin/nologin3 uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2#!/bin/sh # $OpenBSD: install.sub,v 1.35 1997/05/18 23:12:02 deraadt Exp $ # $NetBSD: install.sub,v 1.5.2.8 1996/09/02 23:25:02 pk Exp $ # # Copyright (c) 1996 The NetBSD Foundation, Inc. # All rights reserved. # # This code is derived from software contributed to The NetBSD Foundation # by Jason R. Thorpe. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by the NetBSD # Foundation, Inc. and its contributors. # 4. Neither the name of The NetBSD Foundation nor the names of its # contributors may be used to endorse or promote products derived # from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE NETBSD FOUNDATION, INC. AND CONTRIBUTORS # ``AS IS'' AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED # TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR # PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE REGENTS OR CONTRIBUTORS BE # LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR # CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF # SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS # INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN # CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) # ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE # POSSIBILITY OF SUCH DAMAGE. # # OpenBSD installation/upgrade script - common subroutines. ROOTDISK="" # filled in below VERSION=21 VERSION_MAJOR=$(( $VERSION / 10 )) VERSION_MINOR=$(( $VERSION % 10 )) export VERSION VERSION_MAJOR VERSION_MINOR ALLSETS="base etc misc comp text man game" # default install sets UPGRSETS="base misc comp text man game" # default upgrade sets SNAPSETS="bin dev etc games man misc sbin text \ usr.bin usr.binutils usr.games usr.include \ usr.lib usr.libexec usr.misc usr.sbin usr.share var" THESETS= # one of the above local_sets_dir="" # Path searched for sets by install_sets # on the local filesystems # decide upon an editor if [ X$EDITOR = X ]; then if [ -x /usr/bin/vi ]; then EDITOR=vi else EDITOR=ed fi export EDITOR fi # Please don't use the 1 of n form below, good idea, wrong implementation! # get a reponse with default[s] getresp() { valid="false" while [ "X$valid" = "Xfalse" ]; do read resp if [ "X$resp" = "X" ]; then resp=$1 fi if [ $# -gt 1 ]; then for i in $@; do if [ "X$resp" = "X$i" ]; then valid="true" fi done else valid="true" fi if [ "X$valid" = "Xfalse" ]; then echo "Try again: Enter one of [$@]" fi done } isin() { # test the first argument against the remaining ones, return succes on a match local _a _a=$1; shift while [ $# != 0 ]; do if [ "$_a" = "$1" ]; then return 0; fi shift done return 1 } rmel() { # remove first argument from list formed by the remaining arguments local _a _a=$1; shift while [ $# != 0 ]; do if [ "$_a" != "$1" ]; then echo "$1"; fi shift done } cutword () { # read a line of data, return Nth element. local _a local _n local _oifs # optional field separator _oifs="$IFS" case "$1" in -t?*) IFS=${1#-t}; shift;; esac _n=$1 read _a; set -- $_a IFS="$_oifs" if [ "$1" = "" ]; then return; fi eval echo \$$_n } cutlast () { # read a line of data, return last element. Equiv. of awk '{print $NF}'. local _a local _oifs # optional field separator _oifs="$IFS" case "$1" in -t?*) IFS=${1#-t}; shift;; esac read _a; set -- $_a IFS="$_oifs" if [ "$1" = "" ]; then return; fi while [ "$#" -gt 10 ]; do shift 10; done eval echo \$$# } firstchar () { # return first character of argument local _a _a=$1 while [ ${#_a} != 1 ]; do _a=${_a%?} done echo $_a } basename () { local _oifs if [ "$1" = "" ]; then return; fi _oifs="$IFS" IFS="/" set -- $1 IFS="$_oifs" while [ "$#" -gt 10 ]; do shift 10; done eval echo \$$# } dir_has_sets() { # return true when the directory $1 contains a set for $2...$n local _dir local _file _dir=$1; shift for _file in $* do if [ -f $_dir/${_file}${VERSION}.tar.gz ]; then return 0 fi # Try for stupid msdos convention if [ -f $_dir/${_file}${VERSION}.tgz ]; then return 0 fi # Special check for kernel if [ $_file = "kernel" -a -f $_dir/bsd ]; then return 0 fi done return 1 } list_has_sets() { # return true when the list $1 contains a set, given dir $2 for $3...$n local _list local _file _list=$1; shift for _file in $* do if isin ${_file}${VERSION}.tar.gz $_list; then return 0 fi # Try for stupid msdos convention if isin ${_file}${VERSION}.tgz $_list; then return 0 fi # Special check for kernel if test $_file = "kernel" && isin bsd $_list; then return 0 fi done return 1 } ftp_list_files() { # log in via ftp to host $1 as user $2 with password $3 # and return a list of all files in the directory $4 on stdout local _host local _user local _pass local _dir _host=$1; shift _user=$1; shift _pass=$1; shift _dir=$1; shift ftp -V -n $_host <<__ptf user $_user $_pass cd $_dir ls quit __ptf } twiddle() { # spin the propeller so we don't get bored while : ; do sleep 1; echo -n "/"; sleep 1; echo -n "-"; sleep 1; echo -n "\\"; sleep 1; echo -n "|"; done > /dev/tty & echo $! } get_localdir() { # $1 is relative mountpoint local _mp local _dir _mp=$1 _dir= while : ; do echo -n "Enter the pathname where the sets are stored [$_dir] " getresp "$_dir" _dir=$resp # Allow break-out with empty response if [ -z "$_dir" ]; then echo -n "Are you sure you don't want to set the pathname? [n] " getresp "n" case "$resp" in y*|Y*) break ;; *) continue ;; esac fi if dir_has_sets "$_mp/$_dir" $THESETS then local_sets_dir="$_mp/$_dir" break else cat << __get_reldir_1 The directory \"$local_sets_dir\" does not exist, or does not hold any of the upgrade sets. __get_reldir_1 echo -n "Re-enter pathname? [y] " getresp "y" case "$resp" in y*|Y*) ;; *) local_sets_dir="" break ;; esac fi done } getrootdisk() { cat << \__getrootdisk_1 The installation program needs to know which disk to consider the root disk. Note the unit number may be different than the unit number you used in the standalone installation program. Available disks are: __getrootdisk_1 _DKDEVS=`md_get_diskdevs` echo "$_DKDEVS" echo "" echo -n "Which disk is the root disk? " getresp "" if isin $resp $_DKDEVS ; then ROOTDISK="$resp" else echo "" echo "The disk $resp does not exist." ROOTDISK="" fi } labelmoredisks() { cat << \__labelmoredisks_1 You may label the following disks: __labelmoredisks_1 echo "$_DKDEVS" echo "" echo -n "Label which disk? [done] " getresp "done" case "$resp" in done) ;; *) if isin $resp $_DKDEVS ; then md_labeldisk $resp else echo "" echo "The disk $resp does not exist." fi ;; esac } addhostent() { # $1 - IP address # $2 - symbolic name # Create an entry in the hosts table. If no host table # exists, create one. If the IP address already exists, # replace it's entry. if [ ! -f /tmp/hosts ]; then echo "127.0.0.1 localhost" > /tmp/hosts fi sed "/^$1 /d" < /tmp/hosts > /tmp/hosts.new mv /tmp/hosts.new /tmp/hosts echo "$1 $2 $2.$FQDN" >> /tmp/hosts } addifconfig() { # $1 - interface name # $2 - interface symbolic name # $3 - interface IP address # $4 - interface netmask # $5 - (optional) interface link-layer directives # Create a hostname.* file for the interface. echo "inet $2 $4 NONE $5" > /tmp/hostname.$1 addhostent $3 $2 } configurenetwork() { local _ifsdone local _ifs _IFS=`md_get_ifdevs` _ifsdone="" resp="" # force at least one iteration while [ "X${resp}" != X"done" ]; do cat << \__configurenetwork_1 You may configure the following network interfaces (the interfaces marked with [X] have been succesfully configured): __configurenetwork_1 for _ifs in $_IFS; do if isin $_ifs $_ifsdone ; then echo -n "[X] " else echo -n " " fi echo $_ifs done echo "" echo -n "Configure which interface? [done] " getresp "done" case "$resp" in "done") ;; *) _ifs=$resp if isin $_ifs $_IFS ; then if configure_ifs $_ifs ; then _ifsdone="$_ifs $_ifsdone" fi else echo "Invalid response: \"$resp\" is not in list" fi ;; esac done } configure_ifs() { local _up local _interface_name local _interface_ip local _interface_mask local _interface_symname local _interface_extra local _hostname _interface_name=$1 set -- `ifconfig $_interface_name | sed -n ' 1s/.**$/DOWN/p 2s/inet// 2s/--> [0-9.][0-9.]*// 2s/netmask// 2s/broadcast// 2p'` _up=$1 _interface_ip=$2 _interface_mask=$3 # Get IP address resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo -n "IP address? [$_interface_ip] " getresp "$_interface_ip" _interface_ip=$resp done # Get symbolic name _hostname=`hostname` resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Symbolic (host) name? [$_hostname] " getresp "$_hostname" _interface_symname=$resp done # Get netmask resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Netmask? [$_interface_mask] " getresp "$_interface_mask" _interface_mask=$resp done echo "Your network interface might require additional link-layer" echo "directives (like \`link0'). If this is the case you can enter" echo "these at the next prompt. Values used by some drivers are:" echo " -link0 BNC" echo " link0 -link1 AUI" echo " link0 link1 UTP" echo "But please keep in mind not all drivers use flags like this." echo "" echo -n "Additional link-layer arguments? [$_interface_extra] " getresp "$_interface_extra" if [ "X${resp}" != X"" ]; then _interface_extra=$resp fi # Configure the interface. If it # succeeds, add it to the permanent # network configuration info. if [ $_up != "UP" ]; then ifconfig ${_interface_name} down if ifconfig ${_interface_name} inet \ ${_interface_ip} \ netmask ${_interface_mask} ${_interface_extra} up ; then addifconfig \ ${_interface_name} \ ${_interface_symname} \ ${_interface_ip} \ ${_interface_mask} "${_interface_extra}" return 0 fi else echo "Interface ${_interface_name} is already active." echo "Just saving configuration on new root filesystem." addifconfig \ ${_interface_name} \ ${_interface_symname} \ ${_interface_ip} \ ${_interface_mask} "${_interface_extra}" fi return 1 } # Much of this is gratuitously stolen from /etc/netstart. enable_network() { # Set up the hostname. if [ ! -f /mnt/etc/myname ]; then echo "ERROR: no /etc/myname!" return 1 fi hostname=`cat /mnt/etc/myname` hostname $hostname # configure all the interfaces which we know about. ( tmp="$IFS" IFS="$IFS." set -- `echo /mnt/etc/hostname*` IFS=$tmp unset tmp while [ $# -ge 2 ] ; do shift # get rid of "hostname" ( read af name mask bcaddr extras read dt dtaddr if [ ! -n "$name" ]; then echo "/etc/hostname.$1: invalid network configuration file" exit fi cmd="ifconfig $1 $af $name " if [ "${dt}" = "dest" ]; then cmd="$cmd $dtaddr"; fi if [ -n "$mask" ]; then cmd="$cmd netmask $mask"; fi if [ -n "$bcaddr" -a "X$bcaddr" != "XNONE" ]; then cmd="$cmd broadcast $bcaddr"; fi cmd="$cmd $extras" $cmd ) < /mnt/etc/hostname.$1 shift done ) # set the address for the loopback interface ifconfig lo0 inet localhost # use loopback, not the wire route add $hostname localhost # /etc/mygate, if it exists, contains the name of my gateway host # that name must be in /etc/hosts. if [ -f /mnt/etc/mygate ]; then route delete default > /dev/null 2>&1 route add default `cat /mnt/etc/mygate` fi # enable the resolver, if appropriate. if [ -f /mnt/etc/resolv.conf ]; then _resolver_enabled="TRUE" cp /mnt/etc/resolv.conf /tmp/resolv.conf.shadow fi # Display results... echo "Network interface configuration:" ifconfig -a echo "" if [ "X${_resolver_enabled}" = X"TRUE" ]; then route show echo "" echo "Resolver enabled." else route -n show echo "" echo "Resolver not enabled." fi return 0 } install_url() { # Get several parameters from the user, and xfer # files from the server. # Note: _ftp_server_ip, _ftp_server_dir, _ftp_server_login, # _ftp_server_password, and _ftp_passive must be global. local _sets local _f local _file_list local _get_files local _failed_files local _osetsdone local _url_type # Is this an ftp or http install? _url_type=$1; shift echo "\nThis is an automated ${_url_type}-based installation process.\n"\ "You will be asked several questions and then the\n"\ "files will be retrieved iteratively via ftp(1).\n" # Proxy the connections? if [ "X${_proxy_host}" = X"" ]; then _proxy_host=none fi echo -n "http/ftp proxy URL? [${_proxy_host}] " getresp "${_proxy_host}" if [ "X${resp}" = X"none" ]; then unset _proxy_host ftp_proxy http_proxy else _proxy_host=$resp export ftp_proxy=${_proxy_host} export http_proxy=${_proxy_host} fi if [ "${_url_type}" = "ftp" -a "X$ftp_proxy" = "X" ]; then # Use passive mode ftp? (incompatible with proxy) case "${_ftp_passive}" in -p) resp=y ;; *) resp=n ;; esac echo -n "Do you want to use passive ftp? [${resp}] " getresp "${resp}" case "$resp" in y*|Y*) _ftp_passive=-p ;; *) unset _ftp_passive ;; esac fi # Provide a list of possible servers echo -n "Do you want a list of potential ${_url_type} servers? [y] " getresp "y" case "$resp" in n*|N*) ;; *) ftp ${_ftp_passive} -V -a ftp://ftp.usa.openbsd.org/pub/OpenBSD/${VERSION_MAJOR}.${VERSION_MINOR}/ftplist | grep "^${_url_type}:" ;; esac # Get server IP address resp="" # force one iteration while [ "X${resp}" = X"" ]; do eval echo -n "Server IP? [\$_${_url_type}_server_ip]\ " eval getresp "\$_${_url_type}_server_ip" eval _${_url_type}_server_ip=$resp done # Get server directory if [ "${_url_type}" = "ftp" -a "X${_ftp_server_dir}" = X"" ]; then # Default ftp dir _ftp_server_dir="pub/OpenBSD/${VERSION_MAJOR}.${VERSION_MINOR}/${ARCH}" fi resp="" # force one iteration while [ "X${resp}" = X"" ]; do eval echo -n "Server directory? [\$_${_url_type}_server_dir]\ " eval getresp "\$_${_url_type}_server_dir" eval _${_url_type}_server_dir=$resp done if [ "${_url_type}" = "ftp" ]; then # Need default values even if we proxy ftp... if [ "X${_ftp_server_login}" = X"" ]; then _ftp_server_login=anonymous fi if [ "X${_ftp_server_password}" = X"" ]; then _ftp_server_password=root@`hostname`.${FQDN} fi if [ "X${ftp_proxy}" = X"" ]; then # Get login name resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Login? [${_ftp_server_login}] " getresp "${_ftp_server_login}" _ftp_server_login=$resp done # Get password resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Password? [${_ftp_server_password}] " getresp "${_ftp_server_password}" _ftp_server_password=$resp done fi fi # Get list of files from the server. # XXX - check for nil $_file_list and deal if [ "${_url_type}" = "ftp" -a "X${ftp_proxy}" = X"" ]; then _file_list=`ftp_list_files "$_ftp_server_ip" "$_ftp_server_login" "$_ftp_server_password" "$_ftp_server_dir"` else # Assumes index file is "index.txt" for http (or proxy) # We can't use index.html since the format is server-dependent _file_list=`eval ftp -V ${_url_type}://\\$_${_url_type}_server_ip/\\$_${_url_type}_server_dir/index.txt | sed 's/ //'` fi _sets="" if list_has_sets "$_file_list" $THESETS; then for _f in $THESETS ; do if [ "X${_f}" = "Xkernel" ]; then if isin bsd $_file_list; then _kernel=bsd fi elif isin ${_f}${VERSION}.tar.gz $_file_list; then _sets="$_sets ${_f}${VERSION}.tar.gz" elif isin ${_f}${VERSION}.tgz $_file_list; then _sets="$_sets ${_f}${VERSION}.tgz" fi done else eval echo "There are no OpenBSD install sets available in \"\$_${_url_type}_server_dir\"." echo -n "Search for *.tar.gz and *.tgz files? [y] " getresp "y" case "$resp" in n*|N*) return ;; *) ;; esac # *.tar.gz and *.tgz are possible sets _sets="" _kernel="" for _f in ${_file_list} ; do case "$_f" in *.tar.gz|*.tgz) _sets="$_sets ${_f}" esac done if [ "X${_sets}" = X"" ]; then echo "There are no *.tar.gz or *.tgz files in that dir." echo -n "See a directory listing? [y] " getresp "y" case "$resp" in n*|N*) return ;; *) ;; esac echo "" echo "${_file_list}" echo "" return else echo "Adding *.tar.gz and *.tgz files to selector." fi fi # Yes, all those blackslashes really are necesary... eval echo "\\\\n"\ "You will now be asked for files to extract. In addition to the\\\\n"\ "files listed in the selector you may enter any file located at\\\\n"\ "\$_${_url_type}_server_ip:\$_${_url_type}_server_dir. You can also enter\\\\n"\ "'all' to install all the standard sets, or 'list' to list the\\\\n"\ "files avilable at \$_${_url_type}_server_ip:\$_${_url_type}_server_dir.\\\\n"\ "When you are done selecting files, enter 'done'.\\\\n"\ "Some of these sets are required for your ${MODE} and some are optional.\\\\n"\ "Consult the intallation notes if you are not sure which sets are required!\\\\n" _osetsdone="$_setsdone" while : ; do echo "" echo "The following sets are available for extraction." echo "Enter filename, \`list', \`all', or \`done'." echo "" _next="" for _f in $_sets $_kernel ; do if isin $_f $_setsdone ; then echo -n "[X] " _next="" else echo -n " " if [ -z "$_next" ]; then _next=$_f fi fi echo $_f done echo "" # Get the name of the file. echo -n "File name [$_next]? " getresp "$_next" if [ "X${resp}" = X"done" ]; then break elif [ "X${resp}" = X"list" ]; then echo "" eval echo "\$_${_url_type}_server_dir:" echo "${_file_list}" continue elif [ "X${resp}" = X"all" ]; then # XXX - setting _setsdone like this # is not entirely correct. _get_files="$_sets $_kernel" _setsdone="$_sets $_kernel" break fi _f=$resp # Ensure file exists if ! isin $_f $_file_list ; then eval echo "File \$_${_url_type}_server_dir/$_f does not exist. Check to make" echo "sure you entered the information properly." continue fi # Add file to extraction list _get_files="${_get_files} $_f" _setsdone="$_f $_setsdone" done # User may have said "done" without selecting any files if [ "X${_get_files}" = X"" ]; then return fi echo "" echo "Fetching files via ${_url_type} may take a long time," echo "especially over a slow network connection." echo -n "Ready to download files? [y] " getresp "y" case "$resp" in y*|Y*) ;; *) _setsdone="$_osetsdone" return ;; esac # Download the files one at a time and keep track of which ones failed while test -n "${_get_files}" ; do _failed_files="" for _f in $_get_files ; do echo "" if [ "X${_f}" = "X${_kernel}" ]; then if [ "${_url_type}" = "ftp" -a "X${ftp_proxy}" = X"" ]; then ( cd /mnt ; ftp ${_ftp_passive} -V ftp://${_ftp_server_login}:${_ftp_server_password}@${_ftp_server_ip}/${_ftp_server_dir}/${_f} ) else ( cd /mnt ; eval ftp -V ${_url_type}://\$_${_url_type}_server_ip/\$_${_url_type}_server_dir/${_f} ) fi else if [ "${_url_type}" = "ftp" -a "X${ftp_proxy}" = X"" ]; then ( cd /mnt ; ftp ${_ftp_passive} -V ftp://${_ftp_server_login}:${_ftp_server_password}@${_ftp_server_ip}/${_ftp_server_dir}/${_f} | tar zxvpf - ) else ( cd /mnt ; eval ftp -V ${_url_type}://\$_${_url_type}_server_ip/\$_${_url_type}_server_dir/${_f} | tar zxvpf - ) fi fi if [ $? -ne 0 ]; then # Mark xfer as having failed,. _setsdone=`rmel $_f $_setsdone` _failed_files="${_failed_files} ${_f}" fi done # Give them the option of refetching failed files. _get_files="" while test -n "${_failed_files}" ; do echo "" echo "The following files failed to transfer and extract correctly:" echo "Choose which one(s) to refetch or 'done' to exit selector." echo "" _next="" for _f in $_failed_files ; do if isin $_f $_setsdone ; then echo -n "[X] " _next="" else echo -n " " if [ -z "$_next" ]; then _next=$_f fi fi echo $_f done echo "" # Get the name of the file. echo -n "File name [$_next]? " getresp "$_next" if [ "X${resp}" = X"done" ]; then break elif [ "X${resp}" = X"list" ]; then echo "" eval echo "\$_${_url_type}_server_dir:" echo "${_file_list}" echo "" continue fi _f=$resp # Ensure file exists if ! isin $_f $_file_list ; then eval echo "File \$_${_url_type}_server_dir/$_f does not exist. Check to make" echo "sure you entered the information properly." continue fi # Add file to extraction list _get_files="${_get_files} ${_f}" _setsdone="${_f} ${_setsdone}" done done } install_from_mounted_fs() { # $1 - directory containing installation sets local _filename local _sets local _next local _f local _kernel _sets="" if dir_has_sets $1 $THESETS; then for _f in $THESETS ; do if [ "X${_f}" = "Xkernel" ]; then if [ -f $1/bsd ]; then _kernel=bsd fi elif [ -f $1/${_f}${VERSION}.tar.gz ]; then _sets="$_sets ${_f}${VERSION}.tar.gz" elif [ -f $1/${_f}${VERSION}.tgz ]; then _sets="$_sets ${_f}${VERSION}.tgz" fi done else echo "There are no OpenBSD install sets available in \"$1\"" return fi while : ; do echo "The following sets are available for extraction:" echo "(marked sets have already been extracted)" echo "" _next="" for _f in $_sets $_kernel ; do if isin $_f $_setsdone; then echo -n "[X] " _next="" else echo -n " " if [ -z "$_next" ]; then _next=$_f fi fi echo $_f done echo "" # Get the name of the file. if [ "X$_next" = "X" ]; then resp=n else resp=y fi echo -n "Continue extraction [$resp]?" getresp "$resp" if [ "$resp" = "n" ]; then break fi echo -n "File name [$_next]? " getresp "$_next" _f=$resp _filename="/$1/$_f" # Ensure file exists if [ ! -f $_filename ]; then echo "File $_filename does not exist. Check to make" echo "sure you entered the information properly." continue fi # Extract file if [ X$_f = X$_kernel ]; then cp $_filename /mnt/$_f else cat $_filename | (cd /mnt; tar -zxvpf -) fi echo "Extraction complete." _setsdone="$_f $_setsdone" done } install_cdrom() { local _drive local _partition_range local _partition local _fstype local _directory # Get the cdrom device info cat << \__install_cdrom_1 The following CD-ROM devices are installed on your system; please select the CD-ROM device containing the partition with the installation sets: __install_cdrom_1 _CDDEVS=`md_get_cddevs` echo "$_CDDEVS" echo "" echo -n "Which is the CD-ROM with the installation media? [abort] " getresp "abort" case "$resp" in abort) echo "Aborting." return ;; *) if isin $resp $_CDDEVS ; then _drive=$resp else echo "" echo "The CD-ROM $resp does not exist." echo "Aborting." return fi ;; esac # Get partition _partition_range=`md_get_partition_range` resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Partition? [c] " getresp "c" case "$resp" in $_partition_range) _partition=$resp ;; *) echo "Invalid response: $resp" resp="" # force loop to repeat ;; esac done # Ask for filesystem type cat << \__install_cdrom_2 There are two CD-ROM filesystem types currently supported by this program: 1) ISO-9660 (cd9660) 2) Berkeley Fast Filesystem (ffs) __install_cdrom_2 resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Which filesystem type? [cd9660] " getresp "cd9660" case "$resp" in cd9660|ffs) _fstype=$resp ;; *) echo "Invalid response: $resp" resp="" # force loop to repeat ;; esac done # Mount the CD-ROM if ! mount -t ${_filesystem} -o ro \ /dev/${_drive}${_partition} /mnt2 ; then echo "Cannot mount CD-ROM drive. Aborting." return fi # Get the directory where the file lives if [ "X${_directory}" = X"" ]; then _directory="/${VERSION_MAJOR}.${VERSION_MINOR}/${ARCH}" fi resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo "Enter the directory relative to the mount point that" echo -n "contains the file. [${_directory}] " getresp "${_directory}" done _directory=$resp install_from_mounted_fs /mnt2/${_directory} umount -f /mnt2 > /dev/null 2>&1 } mount_a_disk() { # Mount a disk on /mnt2. The set of disk devices to choose from # is $_DKDEVS. # returns 0 on failure. local _drive local _partition_range local _partition local _fstype local _fsopts local _directory local _md_fstype local _md_fsopts getresp "abort" case "$resp" in abort) echo "Aborting." return 0 ;; *) if isin $resp $_DKDEVS ; then _drive=$resp else echo "" echo "The disk $resp does not exist." echo "Aborting." return 0 fi ;; esac # Get partition _partition_range=`md_get_partition_range` resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Partition? [d] " getresp "d" case "$resp" in $_partition_range) _partition=$resp ;; *) echo "Invalid response: $resp" resp="" # force loop to repeat ;; esac done # Ask for filesystem type cat << \__mount_a_disk_2 The following filesystem types are supported: 1) ffs __mount_a_disk_2 _md_fstype=`md_native_fstype` _md_fsopts=`md_native_fsopts` if [ ! -z "$_md_fstype" ]; then echo " 2) $_md_fstype" else _md_fstype="_undefined_" fi resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Which filesystem type? [ffs] " getresp "ffs" case "$resp" in ffs) _fstype=$resp _fsopts="ro" ;; $_md_fstype) _fstype=$resp _fsopts=$_md_fsopts ;; *) echo "Invalid response: $resp" resp="" # force loop to repeat ;; esac done # Mount the disk if ! mount -t ${_fstype} -o $_fsopts \ /dev/${_drive}${_partition} /mnt2 ; then echo "Cannot mount disk. Aborting." return 0 fi return 1 } install_disk() { local _directory cat << \__install_disk_1 The following disk devices are installed on your system; please select the disk device containing the partition with the installation sets: __install_disk_1 _DKDEVS=`md_get_diskdevs` echo "$_DKDEVS" echo "" echo -n "Which is the disk with the installation sets? [abort] " if mount_a_disk ; then return fi # Get the directory where the file lives resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo "Enter the directory relative to the mount point that" echo -n "contains the file. [${_directory}] " getresp "${_directory}" done _directory=$resp install_from_mounted_fs /mnt2/${_directory} umount -f /mnt2 > /dev/null 2>&1 } install_nfs() { # Get the IP address of the server resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Server IP address? [${_nfs_server_ip}] " getresp "${_nfs_server_ip}" done _nfs_server_ip=$resp # Get server path to mount resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Filesystem on server to mount? [${_nfs_server_path}] " getresp "${_nfs_server_path}" done _nfs_server_path=$resp # Determine use of TCP echo -n "Use TCP transport (only works with capable NFS server)? [n] " getresp "n" case "$resp" in y*|Y*) _nfs_tcp="-T" ;; *) _nfs_tcp="" ;; esac # Mount the server mkdir /mnt2 > /dev/null 2>&1 if ! mount_nfs $_nfs_tcp ${_nfs_server_ip}:${_nfs_server_path} \ /mnt2 ; then echo "Cannot mount NFS server. Aborting." return fi # Get the directory where the file lives resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo "Enter the directory relative to the mount point that" echo -n "contains the file. [${_nfs_directory}] " getresp "${_nfs_directory}" done _nfs_directory=$resp install_from_mounted_fs /mnt2/${_nfs_directory} umount -f /mnt2 > /dev/null 2>&1 } install_tape() { local _xcmd # Get the name of the tape from the user. cat << \__install_tape_1 The installation program needs to know which tape device to use. Make sure you use a "no rewind on close" device. __install_tape_1 _tape=`basename $TAPE` resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Name of tape device? [${_tape}]" getresp "${_tape}" done _tape=`basename $resp` TAPE="/dev/${_tape}" if [ ! -c $TAPE ]; then echo "$TAPE does not exist or is not a character special file." echo "Aborting." return fi export TAPE # Rewind the tape device echo -n "Rewinding tape..." if ! mt rewind ; then echo "$TAPE may not be attached to the system or may not be" echo "a tape device. Aborting." return fi echo "done." # Get the file number resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo -n "File number? " getresp "" case "$resp" in [1-9]*) _nskip=`expr $resp - 1` ;; *) echo "Invalid file number ${resp}." resp="" # fore loop to repeat ;; esac done # Skip to correct file. echo -n "Skipping to source file..." if [ "X${_nskip}" != X"0" ]; then if ! mt fsf $_nskip ; then echo "Could not skip $_nskip files. Aborting." return fi fi echo "done." cat << \__install_tape_2 There are 2 different ways the file can be stored on tape: 1) an image of a gzipped tar file 2) a standard tar image __install_tape_2 resp="" # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Which way is it? [1] " getresp "1" case "$resp" in 1) _xcmd="tar -zxvpf -" ;; 2) _xcmd="tar -xvpf -" ;; *) echo "Invalid response: $resp." resp="" # force loop to repeat ;; esac ( cd /mnt; dd if=$TAPE | $_xcmd ) done echo "Extraction complete." } get_timezone() { local _a local _zonepath # # If the zoneinfo is not on the installation medium or on the # installed filesystem, set TZ to GMT and return immediatly. # if [ ! -e /usr/share/zoneinfo -a ! -e /mnt/usr/share/zoneinfo ]; then TZ=GMT return fi if [ ! -d /usr/share/zoneinfo ]; then _zonepath=/mnt else _zonepath="" fi cat << \__get_timezone_1 Select a time zone for your location. Timezones are represented on the system by a directory structure rooted in "/usr/share/timezone". Most timezones can be selected by entering a token like "MET" or "GMT-6". Other zones are grouped by continent, with detailed zone information separated by a slash ("/"), e.g. "US/Pacific". To get a listing of what's available in /usr/share/zoneinfo, enter "?" at the prompts below. __get_timezone_1 if [ X$TZ = X ]; then TZ=`ls -l /mnt/etc/localtime 2>/dev/null | cutlast` TZ=${TZ#/usr/share/zoneinfo/} fi while : ; do echo -n "What timezone are you in [\`?' for list] [$TZ]? " getresp "$TZ" case "$resp" in "") echo "Timezone defaults to GMT" TZ="GMT" break; ;; "?") ls ${_zonepath}/usr/share/zoneinfo ;; *) _a=$resp while [ -d ${_zonepath}/usr/share/zoneinfo/$_a ]; do echo -n "There are several timezones available" echo " within zone '$_a'" echo -n "Select a sub-timezone [\`?' for list]: " getresp "" case "$resp" in "?") ls ${_zonepath}/usr/share/zoneinfo/$_a ;; *) _a=${_a}/${resp} if [ -f ${_zonepath}/usr/share/zoneinfo/$_a ]; then break; fi ;; esac done if [ -f ${_zonepath}/usr/share/zoneinfo/$_a ]; then #!/bin/sh # $OpenBSD: install.sh,v 1.12 1997/05/17 21:16:46 millert Exp $ # $NetBSD: install.sh,v 1.5.2.8 1996/08/27 18:15:05 gwr Exp $ # # Copyright (c) 1996 The NetBSD Foundation, Inc. # All rights reserved. # # This code is derived from software contributed to The NetBSD Foundation # by Jason R. Thorpe. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by the NetBSD # Foundation, Inc. and its contributors. # 4. Neither the name of The NetBSD Foundation nor the names of its # contributors may be used to endorse or promote products derived # from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE NETBSD FOUNDATION, INC. AND CONTRIBUTORS # ``AS IS'' AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED # TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR # PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE REGENTS OR CONTRIBUTORS BE # LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR # CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF # SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS # INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN # CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) # ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE # POSSIBILITY OF SUCH DAMAGE. # # OpenBSD installation script. # In a perfect world, this would be a nice C program, with a reasonable # user interface. FILESYSTEMS="/tmp/filesystems" # used thoughout FQDN="" # domain name trap "umount /tmp > /dev/null 2>&1" 0 MODE="install" # include machine-dependent functions # The following functions must be provided: # md_copy_kernel() - copy a kernel to the installed disk # md_get_diskdevs() - return available disk devices # md_get_cddevs() - return available CD-ROM devices # md_get_ifdevs() - return available network interfaces # md_get_partition_range() - return range of valid partition letters # md_installboot() - install boot-blocks on disk # md_labeldisk() - put label on a disk # md_prep_disklabel() - label the root disk # md_welcome_banner() - display friendly message # md_not_going_to_install() - display friendly message # md_congrats() - display friendly message # md_native_fstype() - native filesystem type for disk installs # md_native_fsopts() - native filesystem options for disk installs # md_makerootwritable() - make root writable (at least /tmp) # md_machine_arch() - get machine architecture # include machine dependent subroutines . install.md # include common subroutines . install.sub # which sets? THESETS="$ALLSETS $MDSETS" if [ "`df /`" = "`df /mnt`" ]; then # Good {morning,afternoon,evening,night}. md_welcome_banner echo -n "Proceed with installation? [n] " else echo "You seem to be trying to restart an interrupted installation!" echo "" echo "You can try to skip the disk preparation steps and continue," echo "otherwise you should reboot the miniroot and start over..." echo -n "Skip disk initialization? [n] " fi getresp "n" case "$resp" in y*|Y*) echo "" echo "Cool! Let's get to it..." ;; *) md_not_going_to_install exit ;; esac # XXX Work around vnode aliasing bug (thanks for the tip, Chris...) ls -l /dev > /dev/null 2>&1 # Deal with terminal issues md_set_term # Get timezone info get_timezone # Make sure we can write files (at least in /tmp) # This might make an MFS mount on /tmp, or it may # just re-mount the root with read-write enabled. if [ "`df /`" = "`df /tmp`" ]; then md_makerootwritable fi # Get the machine architecture (must be done after md_makerootwritable) ARCH=`md_machine_arch` if [ "`df /`" = "`df /mnt`" ]; then # Install the shadowed disktab file; lets us write to it for temporary # purposes without mounting the miniroot read-write. if [ -f /etc/disktab.shadow ]; then cp /etc/disktab.shadow /tmp/disktab.shadow fi while [ "X${ROOTDISK}" = "X" ]; do getrootdisk done # Deal with disklabels, including editing the root disklabel # and labeling additional disks. This is machine-dependent since # some platforms may not be able to provide this functionality. md_prep_disklabel ${ROOTDISK} # Assume partition 'a' of $ROOTDISK is for the root filesystem. # Loop and get the rest. # XXX ASSUMES THAT THE USER DOESN'T PROVIDE BOGUS INPUT. cat << \__get_filesystems_1 You will now have the opportunity to enter filesystem information. You will be prompted for device name and mount point (full path, including the prepending '/' character). Note that these do not have to be in any particular order. You will be given the opportunity to edit the resulting 'fstab' file before any of the filesystems are mounted. At that time you will be able to resolve any filesystem order dependencies. __get_filesystems_1 echo "The following will be used for the root filesystem:" echo " ${ROOTDISK}a /" echo "${ROOTDISK}a /" > ${FILESYSTEMS} resp="X" # force at least one iteration while [ "X$resp" != X"done" ]; do echo "" echo -n "Device name? [done] " getresp "done" case "$resp" in done) ;; *) _device_name=`basename $resp` # force at least one iteration _first_char="X" while [ "X${_first_char}" != X"/" ]; do echo -n "Mount point? " getresp "" _mount_point=$resp _first_char=`firstchar ${_mount_point}` if [ "X${_first_char}" != X"/" ]; then echo "mount point must be an absolute path!" fi done if [ "X${_mount_point}" = X"/" ]; then echo "root mount point already taken care of!" else echo "${_device_name} ${_mount_point}" \ >> ${FILESYSTEMS} fi resp="X" # force loop to repeat ;; esac done echo "" echo "You have configured the following devices and mount points:" echo "" cat ${FILESYSTEMS} echo "" echo "Filesystems will now be created on these devices." echo "If you made any mistakes, you may edit this now." echo -n "Edit using ${EDITOR}? [n] " getresp "n" case "$resp" in y*|Y*) ${EDITOR} ${FILESYSTEMS} ;; *) ;; esac echo "" echo "The next step will overwrite any existing data on:" ( echo -n " " while read _device_name _junk; do echo -n "${_device_name} " done echo "" ) < ${FILESYSTEMS} echo "" echo -n "Are you really sure that you're ready to proceed? [n] " getresp "n" case "$resp" in y*|Y*) ;; *) echo "ok, try again later..." exit ;; esac # Loop though the file, place filesystems on each device. echo "Creating filesystems..." ( while read _device_name _junk; do newfs /dev/r${_device_name} echo "" done ) < ${FILESYSTEMS} else # Get the root device ROOTDISK=`df /mnt | sed -e '/^\//!d' -e 's/\/dev\/\([^ ]*\)[a-p] .*/\1/'` while [ "X${ROOTDISK}" = "X" ]; do getrootdisk done fi # Get network configuration information, and store it for placement in the # root filesystem later. cat << \__network_config_1 You will now be given the opportunity to configure the network. This will be useful if you need to transfer the installation sets via FTP or NFS. Even if you choose not to transfer installation sets that way, this information will be preserved and copied into the new root filesystem. Note, enter all symbolic host names WITHOUT the domain name appended. I.e. use 'hostname' NOT 'hostname.domain.name'. __network_config_1 echo -n "Configure the network? [y] " getresp "y" case "$resp" in y*|Y*) resp="" # force at least one iteration if [ -f /etc/myname ]; then resp=`cat /etc/myname` fi#!/bin/sh # $OpenBSD: upgrade.sh,v 1.7 1997/05/14 21:22:07 millert Exp $ # $NetBSD: upgrade.sh,v 1.2.4.5 1996/08/27 18:15:08 gwr Exp $ # # Copyright (c) 1996 The NetBSD Foundation, Inc. # All rights reserved. # # This code is derived from software contributed to The NetBSD Foundation # by Jason R. Thorpe. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by the NetBSD # Foundation, Inc. and its contributors. # 4. Neither the name of The NetBSD Foundation nor the names of its # contributors may be used to endorse or promote products derived # from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE NETBSD FOUNDATION, INC. AND CONTRIBUTORS # ``AS IS'' AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED # TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR # PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE REGENTS OR CONTRIBUTORS BE # LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR # CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF # SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS # INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN # CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) # ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE # POSSIBILITY OF SUCH DAMAGE. # # OpenBSD installation script. # In a perfect world, this would be a nice C program, with a reasonable # user interface. ROOTDISK="" # filled in below trap "unmount_fs -fast /tmp/fstab.shadow > /dev/null 2>&1; rm -f /tmp/fstab.shadow" 0 MODE="upgrade" # include machine-dependent functions # The following functions must be provided: # md_copy_kernel() - copy a kernel to the installed disk # md_get_diskdevs() - return available disk devices # md_get_cddevs() - return available CD-ROM devices # md_get_ifdevs() - return available network interfaces # md_get_partition_range() - return range of valid partition letters # md_installboot() - install boot-blocks on disk # md_labeldisk() - put label on a disk # md_welcome_banner() - display friendly message # md_not_going_to_install() - display friendly message # md_congrats() - display friendly message # md_machine_arch() - get machine architecture # include machine dependent subroutines . install.md # include common subroutines . install.sub # which sets? THESETS="$UPGRSETS $MDSETS" # Good {morning,afternoon,evening,night}. md_welcome_banner echo -n "Proceed with upgrade? [n] " getresp "n" case "$resp" in y*|Y*) echo "Cool! Let's get to it..." ;; *) md_not_going_to_install exit ;; esac # Deal with terminal issues md_set_term # XXX Work around vnode aliasing bug (thanks for the tip, Chris...) ls -l /dev > /dev/null 2>&1 # Make sure we can write files (at least in /tmp) # This might make an MFS mount on /tmp, or it may # just re-mount the root with read-write enabled. md_makerootwritable # Get the machine architecture (must be done after md_makerootwritable) ARCH=`md_machine_arch` while [ "X${ROOTDISK}" = "X" ]; do getrootdisk done # Assume partition 'a' of $ROOTDISK is for the root filesystem. Confirm # this with the user. Check and mount the root filesystem. resp="" # force one iteration while [ "X${resp}" = "X" ]; do echo -n "Root filesystem? [${ROOTDISK}a] " getresp "${ROOTDISK}a" _root_filesystem="/dev/`basename $resp`" if [ ! -b ${_root_filesystem} ]; then echo "Sorry, ${resp} is not a block device." resp="" # force loop to repeat fi done echo "Checking root filesystem..." if ! fsck -pf ${_root_filesystem}; then echo "ERROR: can't check root filesystem!" exit 1 fi echo "Mounting root filesystem..." if ! mount -o ro ${_root_filesystem} /mnt; then echo "ERROR: can't mount root filesystem!" exit 1 fi # Grab the fstab so we can munge it for our own use. if [ ! -f /mnt/etc/fstab ]; then echo "ERROR: no /etc/fstab!" exit 1 fi # Grab the hosts table so we can use it. if [ ! -f /mnt/etc/hosts ]; then echo "ERROR: no /etc/hosts!" exit 1 fi cp /mnt/etc/hosts /tmp/hosts # Start up the network in same/similar configuration as the installed system # uses. cat << \__network_config_1 The upgrade program would now like to enable the network. It will use the configuration already stored on the root filesystem. This is required if you wish to use the network installation capabilities of this program. __network_config_1 echo -n "Enable network? [y] " getresp "y" case "$resp" in y*|Y*) if ! enable_network; then echo "ERROR: can't enable network!" exit 1 fi cat << \__network_config_2 You will now be given the opportunity to escape to the command shell to do any additional network configuration you may need. This may include adding additional routes, if needed. In addition, you might take this opportunity to redo the default route in the event that it failed above. __network_config_2 echo -n "Escape to shell? [n] " getresp "n" case "$resp" in y*|Y*) echo "Type 'exit' to return to upgrade." sh ;; *) ;; esac ;; *) ;; esac # Now that the network has been configured, it is safe to configure the # fstab. We remove all but ufs/ffs. ( > /tmp/fstab while read _dev _mp _fstype _rest ; do if [ "X${_fstype}" = X"ufs" -o \ "X${_fstype}" = X"ffs" ]; then if [ "X${_fstype}" = X"ufs" ]; then # Convert ufs to ffs. _fstype=ffs fi echo "$_dev $_mp $_fstype $_rest" >> /tmp/fstab fi done ) < /mnt/etc/fstab echo "The fstab is configured as follows:" echo "" cat /tmp/fstab cat << \__fstab_config_1 You may wish to edit the fstab. For example, you may need to resolve dependencies in the order which the filesystems are mounted. Note that this fstab is only for installation purposes, and will not be copied into the root filesystem. __fstab_config_1 echo -n "Edit the fstab with ${EDITOR}? [n] " getresp "n" case "$resp" in y*|Y*) ${EDITOR} /tmp/fstab ;; *) ;; esac echo "" munge_fstab /tmp/fstab /tmp/fstab.shadow if ! umount /mnt; then echo "ERROR: can't unmount previously mounted root!" exit 1 fi # Check all of the filesystems. check_fs /tmp/fstab.shadow # Mount filesystems. mount_fs /tmp/fstab.shadow echo -n "Are the upgrade sets on one of your normally mounted (local) filesystems? [y] " getresp "y" case "$resp" in y*|Y*) get_localdir /mnt ;; *) ;; esac # Install sets. install_sets $THESETS # Get timezone info get_timezone # Fix up the fstab. echo -n "Converting ufs to ffs in /etc/fstab..." ( > /tmp/fstab while read _dev _mp _fstype _rest ; do if [ "X${_fstype}" = X"ufs" ]; then # Convert ufs to ffs. _fstype=ffs fi echo "$_dev $_mp $_fstype $_rest" >> /tmp/fstab done ) < /mnt/etc/fstab echo "done." echo -n "Would you like to edit the resulting fstab with ${EDITOR}? [y] " getresp "y" case "$resp" in y*|Y*) ${EDITOR} /tmp/fstab ;; *) ;; esac # Copy in configuration information and make devices in target root. ( cd /tmp for file in fstab; do if [ -f $file ]; then echo -n "Copying $file..." cp $file /mnt/etc/$file echo "done." fi done echo -n "Installing timezone link..." rm -f /mnt/etc/localtime ln -s /usr/share/zoneinfo/$TZ /mnt/etc/localtime echo "done." echo -n "Making devices..." #_pid=`twiddle` cd /mnt/dev sh MAKEDEV all #kill $_pid echo "done." md_copy_kernel md_installboot ${ROOTDISK} ) unmount_fs /tmp/fstab.shadow # Pat on the back. md_congrats # ALL DONE! exit 0 #!/bin/sh - # # $OpenBSD: MAKEDEV,v 1.28 1997/05/14 15:41:21 niklas Exp $ # # Copyright (c) 1990 The Regents of the University of California. # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by the University of # California, Berkeley and its contributors. # 4. Neither the name of the University nor the names of its contributors # may be used to endorse or promote products derived from this software # without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE REGENTS AND CONTRIBUTORS ``AS IS'' AND # ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE # IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE # ARE DISCLAIMED. IN NO EVENT SHALL THE REGENTS OR CONTRIBUTORS BE LIABLE # FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL # DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS # OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS INTERRUPTION) # HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT # LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY # OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF # SUCH DAMAGE. # # @(#)MAKEDEV 5.5 (Berkeley) 5/28/91 # # Device "make" file. Valid arguments: # std standard devices # local configuration specific devices # Tapes: # st* ? tape # Disks: # sd* SCSI disks # cd* SCSI cdrom drives # st* SCSI tape # ch* SCSI changer # uk* unknown SCSI # ss* SCSI scanners # xy* Xylogic 450/451 disks # rd* "ramdisk" pseudo-disks # xd* Xylogic 753/7053 disks # fd* Floppies # vnd* "file" pseudo-disks # ccd* concatenated disk devices # Pseudo terminals: # pty* set of 16 master and slave pseudo terminals # Printers: # Call units: # Special purpose devices: # audio # openprom # bwtwo* # cgthree* # cgfour* # cgsix* # cgeight* # bpf* packet filter # lkm loadable kernel modules interface # tun* network tunnel driver # *random random data source PATH=/sbin:/bin/:/usr/bin:/usr/sbin:/usr/etc this=$0 umask 77 case "$os" in # set os in the environment if not OpenBSD SunOS) add () { expr $1 + $2 } mult () { expr $1 '*' $2 } hex () { case $1 in [0-9]) echo $1;; 10) echo a;; 11) echo b;; 12) echo c;; 13) echo d;; 14) echo e;; 15) echo f;; esac } trunc () { expr $1 : $2'\(.*\)' } unt () { expr $1 : '[a-z]*\([0-9]*\)[a-p]*' } ;; *) add () { echo "$(( $1 + $2 ))" } mult () { echo "$(( $1 * $2 ))" } hex () { case $1 in [0-9]) echo -n $1 ;; 10) echo -n a;; 11) echo -n b;; 12) echo -n c;; 13) echo -n d;; 14) echo -n e;; 15) echo -n f;; esac } trunc () { # XXX pdksh can't seem to deal with locally scoped variables # in ${foo#$bar} expansions arg1="$1" arg2="$2" echo ${arg1#$arg2} } unt () { # XXX pdksh can't seem to deal with locally scoped variables # in ${foo#$bar} expansions arg1="$1" if [ "${arg1#xy}" != "$arg1" ] then unt=${arg1#xy} else unt=${arg1#*d} fi echo ${unt%*[a-p]} } ;; esac for i do unit=`expr $i : '[a-z][a-z]*\([0-9][0-9]*\)'` [ "$unit" ] || unit=0 case $i in all) sh ${this} std sd0 sd1 sd2 sd3 sd4 xd0 xd1 xd2 xd3 xy0 xy1 xy2 xy3 sh ${this} cd0 st0 st1 rd0 sh ${this} fd0 fdB0 fdC0 fdD0 fdE0 fdF0 fdG0 fdH0 sh ${this} uk0 uk1 sh ${this} ss0 ss1 sh ${this} pty0 vnd0 vnd1 vnd2 vnd3 audio tun0 tun1 tun2 tun3 sh ${this} ccd0 ccd1 ccd2 ccd3 sh ${this} bpf0 bpf1 bpf2 bpf3 sh ${this} ipl sh ${this} bwtwo0 cgthree0 cgfour0 cgsix0 sh ${this} cgeight0 sh ${this} lkm random local ;; floppy) sh ${this} std random sh ${this} fd0 sd0 sd1 ;; ramdisk) sh ${this} std random sh ${this} fd0 sd0 sd1 rd0 cd0 ;; std) mknod console c 0 0 mknod tty c 2 0 ; chmod 666 tty mknod kmem c 3 1 ; chmod 640 kmem ; chown root.kmem kmem mknod mem c 3 0 ; chmod 640 mem ; chown root.kmem mem mknod null c 3 2 ; chmod 666 null mknod zero c 3 12 ; chmod 666 zero mknod eeprom c 3 11 ; chmod 640 eeprom ; chown root.kmem eeprom mknod openprom c 70 0 ; chmod 644 openprom mknod drum c 7 0 ; chmod 640 drum ; chown root.kmem drum mknod klog c 16 0 ; chmod 600 klog mknod stdin c 24 0 ; chmod 666 stdin mknod stdout c 24 1 ; chmod 666 stdout mknod stderr c 24 2 ; chmod 666 stderr mknod ttya c 12 0 mknod ttyb c 12 1 mknod fb c 22 0 ; chmod 666 fb mknod mouse c 13 0 ; chmod 666 mouse mknod kbd c 29 0 ; chmod 666 kbd ;; fd) rm -f fd/* mkdir fd > /dev/null 2>&1 n=0 (cd fd && while [ $n -lt 64 ]; do mknod $n c 24 $n; n=`add $n 1`; done ) chown -R root.wheel fd chmod 555 fd chmod 666 fd/* ;; bwtwo*) mknod bwtwo$unit c 27 $unit; chmod 666 bwtwo$unit ;; cgthree*) mknod cgthree$unit c 55 $unit; chmod 666 cgthree$unit ;; cgfour*) mknod cgfour$unit c 39 $unit; chmod 666 cgfour$unit ;; cgsix*) mknod cgsix$unit c 67 $unit; chmod 666 cgsix$unit ;; cgeight*) mknod cgeight$unit c 64 $unit; chmod 666 cgeight$unit ;; audio) mknod audio c 69 0; chmod 666 audio ;; openprom) mknod openprom c 70 0; chmod 600 openprom ;; bpf*) rm -f bpf$unit mknod bpf$unit c 105 $unit chmod 600 bpf$unit chown root.wheel bpf$unit ;; ipl) rm -f ipl mknod ipl c 59 0 chown root.wheel ipl ;; tun*) rm -f tun$unit mknod tun$unit c 111 $unit chmod 600 tun$unit chown root.wheel tun$unit ;; fd*) umask 2 ; unit=`expr $i : 'fd.*\(.\)$'` typnam=`expr $i : 'fd\(.\).*'` case $typnam in 0|1) typnam=; typnum=0;; # no type specified, assume A A) typnam=; typnum=0;; B) typnum=1;; C) typnum=2;; D) typnum=3;; E) typnum=4;; F) typnum=5;; G) typnum=6;; H) typnum=7;; *) echo bad type $typnam for $i; exit 1;; esac case $unit in 0|1) blk=16; chr=54;; *) echo bad unit $unit for $i; exit 1;; esac nam=fd${typnam}$unit rm -f ${nam}? r${nam}? basenum=`expr $unit '*' 128 + $typnum '*' 16` mknod ${nam}a b $blk `expr $basenum + 0` mknod ${nam}b b $blk `expr $basenum + 1` mknod ${nam}c b $blk `expr $basenum + 2` #mknod ${nam}d b $blk `expr $basenum + 3` #mknod ${nam}e b $blk `expr $basenum + 4` #mknod ${nam}f b $blk `expr $basenum + 5` #mknod ${nam}g b $blk `expr $basenum + 6` #mknod ${nam}h b $blk `expr $basenum + 7` #mknod ${nam}i b $blk `expr $basenum + 8` #mknod ${nam}j b $blk `expr $basenum + 9` #mknod ${nam}k b $blk `expr $basenum + 10` #mknod ${nam}l b $blk `expr $basenum + 11` #mknod ${nam}m b $blk `expr $basenum + 12` #mknod ${nam}n b $blk `expr $basenum + 13` #mknod ${nam}o b $blk `expr $basenum + 14` #mknod ${nam}p b $blk `expr $basenum + 15` mknod r${nam}a c $chr `expr $basenum + 0` mknod r${nam}b c $chr `expr $basenum + 1` mknod r${nam}c c $chr `expr $basenum + 2` #mknod r${nam}d c $chr `expr $basenum + 3` #mknod r${nam}e c $chr `expr $basenum + 4` #mknod r${nam}f c $chr `expr $basenum + 5` #mknod r${nam}g c $chr `expr $basenum + 6` #mknod r${nam}h c $chr `expr $basenum + 7` #mknod r${nam}i c $chr `expr $basenum + 8` #mknod r${nam}j c $chr `expr $basenum + 9` #mknod r${nam}k c $chr `expr $basenum + 10` #mknod r${nam}l c $chr `expr $basenum + 11` #mknod r${nam}m c $chr `expr $basenum + 12` #mknod r${nam}n c $chr `expr $basenum + 13` #mknod r${nam}o c $chr `expr $basenum + 14` #mknod r${nam}p c $chr `expr $basenum + 15` chown root.operator ${nam}[a-p] r${nam}[a-p] chmod 640 ${nam}[a-p] r${nam}[a-p] umask 77 ;; ccd*|sd*|xd*|xy*|cd*) umask 2 unit=`unt $i` if [ 0$unit -gt 15 ] then echo bad disk unit: $i - $unit exit 127 fi case $i in ccd*) name=ccd; blk=9; chr=23;; sd*) name=sd; blk=7; chr=17;; xd*) name=xd; blk=10; chr=42;; xy*) name=xy; blk=3; chr=9;; cd*) name=cd; blk=18; chr=58;; *) echo bad unit for disk in: $i;; esac if [ "$unit" = "" ] then n=0 while [ $n -lt 32 ] do sh ${this} $name$n n=`add $n 1` done fi rm -f $name$unit? r$name$unit? minor=`mult $unit 16` for slice in a b c d e f g h i j k l m n o p do dev=$name$unit$slice mknod $dev b $blk $minor mknod r$dev c $chr $minor minor=`add $minor 1` done chown root.operator $name$unit? r$name$unit? chmod 640 $name$unit? r$name$unit? umask 77 ;; vnd*) umask 2 unit=`unt $i` if [ 0$unit -gt 15 ] then echo bad disk unit: $i - $unit exit 127 fi blk=8; chr=110; for name in vnd svnd; do case $name in vnd) off=0;; svnd) off=128;; esac if [ "$unit" = "" ] then n=0 while [ $n -lt 32 ] do sh ${this} $name$n n=`add $n 1` done fi rm -f $name$unit? r$name$unit? minor=`mult $unit 16` minor=`add $minor $off` for slice in a b c d e f g h i j k l m n o p do dev=$name$unit$slice mknod $dev b $blk $minor mknod r$dev c $chr $minor minor=`add $minor 1` done chown root.operator $name$unit? r$name$unit? chmod 640 $name$unit? r$name$unit? done umask 77 ;; rd*) umask 2 ; unit=`expr $i : '.*d\(.*\)'` mknod rd${unit}a b 17 `expr $unit '*' 16 + 0` mknod rd${unit}c b 17 `expr $unit '*' 16 + 2` mknod rrd${unit}a c 106 `expr $unit '*' 16 + 0` mknod rrd${unit}c c 106 `expr $unit '*' 16 + 2` chown root.operator rd${unit}[ac] rrd${unit}[ac] chmod 640 rd${unit}[ac] rrd${unit}[ac] umask 77 ;; st*) umask 2 case $i in st*) name=st; blk=11; chr=18;; esac rm -f $name$unit n$name$unit e$name$unit en$name$unit \ r$name$unit nr$name$unit er$name$unit enr$name$unit sixt=`mult $unit 16` mknod $name$unit b $blk `add $sixt 0` mknod n$name$unit b $blk `add $sixt 1` mknod e$name$unit b $blk `add $sixt 2` mknod en$name$unit b $blk `add $sixt 3` mknod r$name$unit c $chr `add $sixt 0` mknod nr$name$unit c $chr `add $sixt 1` mknod er$name$unit c $chr `add $sixt 2` mknod enr$name$unit c $chr `add $sixt 3` chown root.operator $name$unit n$name$unit \ e$name$unit en$name$unit \ r$name$unit nr$name$unit \ er$name$unit enr$name$unit chmod 640 $name$unit n$name$unit \ e$name$unit en$name$unit \ r$name$unit nr$name$unit \ er$name$unit enr$name$unit umask 77 ;; ch*) umask 2 case $i in ch*) name=ch; chr=19;; esac rm -f $name$unit sixt=`mult $unit 16` mknod $name$unit c $chr `add $sixt 0` chown root.operator $name$unit chmod 640 $name$unit umask 77 ;; lkm) rm -f lkm mknod lkm c 112 0 chown root.kmem lkm chmod 640 lkm ;; pty*) case $unit in 0) offset=0 name=p;; 1) offset=16 name=q;; 2) offset=32 name=r;; 3) offset=48 name=s;; # Note that telnetd, rlogind, and xterm (at least) only look at p-s. 4) offset=64 name=t;; *) echo bad unit for pty in: $i;; esac case $unit in 0|1|2|3|4) umask 0 n=0 while [ $n -lt 16 ] do nam=$name`hex $n` rm -rf {tty,pty}$n mknod tty$nam c 20 `add $offset $n` mknod pty$nam c 21 `add $offset $n` n=`add $n 1` done umask 77 ;; esac ;; random|srandom|urandom|prandom|arandom) rm -f random urandom srandom prandom arandom mknod random c 119 0 mknod srandom c 119 1 mknod urandom c 119 2 mknod prandom c 119 3 mknod arandom c 119 4 chown root.wheel random srandom urandom prandom arandom chmod 644 random srandom urandom prandom arandom ;; uk*) unit=`trunc $i uk` rm -f uk$unit mknod uk$unit c 120 $unit chown root.operator uk$unit chmod 640 uk$unit ;; ss*) unit=`trunc $i ss` rm -f ss$unit mknod ss$unit c 121 $unit chown root.operator ss$unit chmod 440 ss$unit # backwards compatibility with older PINTs rm -f scan$unit ln -s ss$unit scan$unit ;; local) umask 0 test -s MAKEDEV.local && sh MAKEDEV.local ;; *) echo $i: unknown device ;; esac done 4x 4x 4x 4x 4 4H 4Mh 4O 4X 4a( 4m !4n '4rx .4sp 54t @4xP G4yp M4 X4 ^4` g4 o4H x4 4 4 4@ 4 4` _max_htonl_getsecs_rpc_fromaddr_open_dvma_mapin_htons_MD5Updatelshldi3.omax.o_getsn_gateip.remmin.o___adddi3.urem_sendudp_getprop_netif_put_nfs_getrootfhmuldi3.o.mul.div___divdi3lshrdi3.onotdi2.osaveregs.o_socktodesc_devopen_obp_close___muldi3_bp_getfile_bp_server_addr_strtabgetsn.o.umul.udivucmpdi2.o___anddi3_hostnamestrncpy.o_getchar___ashldi3_xdr_string_encode_nfs_readdir_in_cksum_strcat_pgofset_MD5Final_hostnamelen___subdi3_arpwhohasmoddi3.ohtonl.o_strcmp_net_close_inet_addrscanc.o_strlen_strcpy_ether_sprintf_readudp_nfs_open_inet_ntoa_sprintf___xordi3_netif_debug_freelist_netif_close_strncasecmp_net_open_nfs_close_printfbcmp.o_MD5Initmul.o_sendether_file_systemulmax.o___builtin_saveregs_cd9660_closexordi3.oulmin.o_swapipmd5.o_rpc_pmap_putcache___ashrdi3_nfs_readdata_domainname_xdr_string_decode_ufs_readdir_putcharhtons.oimax.o_arp_replyimin.ostrncmp.oashrdi3.o_strncpy_netdev_sock_nfs_lookupfhntohl.oadddi3.o_rpc_xid_nfs_readlinkumoddi3.oiordi3.o__randseed_nfs_read_strncmpntohs.o_strtablen_ip_convertaddr_nfs_seek_obp_strategystart_nfs_root_noderem.o_nfs_mountlmax.ocmpdi2.o_cd9660_writelmin.o_prom0_iclose_nfs_stat_twiddle_rarp_getipaddress_hz_getdevtype_rootip_net_mountroot__main.o_rpc_pmap_list_prom_ioctl_rpc_port_obp_xmit_ufs_read_promvec_ufs_seek_srandom_obp_recv_strerrorsubdi3.o_file_system_nfs_prom0_close_arp_num_closeall_bootfile_vprintf_ufs_stat_prom0_strategy_prom_getether_xdr_inaddr_decodeqdivrem.o_ufs_open_nfs_stat_typesudiv.o_netmask___qdivrem__rtt_rpc_call_file_system_ufsumul.o_mountroot_dvma_init_dvma_free_prom_boothow_prom_si_getpropstring_prom_bootdevice_memset_nfs_writesdiv.o_rootpath_cd9660_open_xdr_inaddr_encode_memcpy_nameipstrcat.o_bp_whoamiudivdi3.o_cputyp_cd9660_stat_pgshift_rpc_pmap_num___moddi3_memcmpanddi3.o_prom0_iopen_ulmin_ulmaxskpc.o_cd9660_read_panicstrcmp.o_netif_open_prom_openashldi3.o___iordi3_cd9660_seek___umoddi3_peekchar_scanc___one_cmpldi2_etext_ifname_bzero___negdi2_getticksstrlen.ostrncasecmp.ostrcpy.o_readetherurem.o_prom_init_skpc_ndevs_loadfile_dvma_mapout_read___udivdi3_arp_list_rpc_pmap_getcache_ufs_write_prom0_recv_errnosrandom.o_sockets_esym_intoa_nbpg___cmpdi2_lmin_nfsys_exit_lmax_main_free_sendrecv_debug_close_imin_domainnamelen_imax_alloc_edatabzero.o_ntohl_cngetc_fbuf_end_bcmp_dvma_alloc_bcea_getsnegdi2.o___ucmpdi2___lshldi3___main_netif_get_version_prom_bootfile_file_system_cd9660_prom0_xmit_bp_server_port_dbuf_ufs_close___lshrdi3_cd9660_readdir_ntohs_myip_files_devswdivdi3.o_minsrt0.oboot.ogcc2_compiled.___gnu_compiled_cpromdev.ogcc2_compiled.___gnu_compiled_c_filestore.6_bootstore.7_prom0_fake_saveecho_pv_putchar_sun4_idprom.44_dtab_stringbuf.51_promdev_inuse_prom_mapin_prom_mapinfo_prom_mapinfo_cnt_prom_devmap_promvecstore.60dvma.ogcc2_compiled.___gnu_compiled_cbootnet.ogcc2_compiled.___gnu_compiled_c_open_countnetif_sun.ogcc2_compiled.___gnu_compiled_c_netif_promconf.ogcc2_compiled.___gnu_compiled_cversion.ogcc2_compiled.___gnu_compiled_c/usr/src/sys/arch/sparc/stand/lib/kern/libkern.obootparam.orarp.onfs.ocd9660.oufs.oalloc.orpc.oread.oopen.ostrerror.ogets.onet.oin_cksum.oarp.omemcpy.oether.omemcmp.oglobals.omemset.oexit.ocloseall.oclose.oprintf.ohX4 `@# ` & " $@` `T@ $!` &`@ג"@H*/+ # %"a  0  ""h #""t * #""l!` #""p@>> OpenBSD BOOT [%s] /bsddevice[%s]: boot: open: %s: %s Booting %s @ 0x%x 㿘@@h ## @"S  %#` L@ % % !% %+ %/ %- %Xt  b@";!@M㰀 2%b @"2! @MX 2@W   %@" a(@"t $t !8@"@@BBad format %d+%d+[%d+%d]=0x%x boot: short read x%@ < ?@ ?# @!2?3 a/?@ ?# @!% a!?@ ?# @!  a ?@ ?# @ 2   `"  " @!"?@ ?# @! "` a ` @܀ 2 @?@?# @! a ?@ ?# @!" a  @" .@`@2.@ "@!p@\ 2k @@!d  .@  `耢 B .@.`.` ".`@!H`@4耢 2C @# %`@)  9 `.@ .` .` .``䀤   ?`@2$ @ "@! %` ?> "H "@!@ Đ #"h  %!   % #HĀb00"@   promprom0㿘 #"h  %@ %! (* % %"" $@!` %"cK` -  %* K   %# J  8*   $ap"K  *K ) K  * %!` ` %"#@ `&J@ -" @ % % *:  d` d s atJ@t J@  t#cL @"tJ@  @Can't open device `%s' Can't open network device `%s' 㿘@2  #bh ` @ !D$`  ! %!`  %"`"`$@2$@   |$`   $`  %" @ 4 04% %@ $`&` 2! % %  #c@  @s @ !0  #cx@   #c@  # "c # #bh`"| $$ 㿘# %a   ` ༟* `a   '@`20,6 * '@ 㿘  @& & $& (`   €@ " '@ 㿘 ` @@   %!` (`(`@0@ 㿘   @ @ & ? $ $"*@ 㿘 %!  4㿘 %!  8` @xmit: not a network device 㿘 `,  @V!(?@o`@w`?㿘  ,@Y €@b㿐 %`  !  !O`P/O O /O㿘㿐 %!     O ?X/O O /O㿐 %!  / 0T@㿘  㿘 %! t㿘@ #@b㿐 %!    %X %! p%x mac-address drop swap 6 cmoveX #"h # % $ a  a  Њ@*@` $ !.@! .` .` .` .` .`a` `€0  `@_a |@ielefdxyxdstsddevice_typeblocknetworkbyte㿘 %!` ! #`@ @XaX @ [ah '  @ Sap   @ Kax   "`"N@J2N`J@" 2 node %x property %s length %d > %d 㿘 %! `€  `  "x@ 㿘 $aޖ ??" *Invalid controller number prom_iopen: "%s" error=%d 㿘) $"쀢 ?D   @ %"x @4 8$ $  $ $`  @#H* @ *`@`@F $0` "`@$4` " @f$ @ & "  %"@#h 㿘# $b쀢    @ 4 "$b@ & 4$bprom_mapin: length=%d prom_mapin: invalid maptype %d 㿘 #"l* @ !@ؒ ##d   #"      @Ð!     ##h #"l< #"t@;@ ?*@Ԣ &@ ` #"p ##h @ % $ ?( , H L\ T ` X` P d l  t$ p  $ *?  #hĈ`Ī` Đ`IJ`  dvma_mapin㿘? #@(1? @\# 1?dvma_mapout㿘 #@(1 @J#h1㿘@ " ْ㿘 @㿘 $"  @  # "cp % "@0 $b "b㿘 $b ? "b #@{#pboot: client IP address: %s boot: client name: %s rootroot addr=%s path=%s 㿐' #@ $p?7 &!  0 @'@]@ p ) %   $@Scp `# %a` $@ V  %! a` @'@=a`p@'  %  %"Ё 2  %"؁㿘 %"   % @  $"" $ v   "bа?  %  ? % 㿘 ;  < 㿘  #b @ 5(  " ?$Revision: 1.4 $ # x  %c㿘 '  "    "& %        @#%,@ @㨢ڰ? @㨰?0Ф     @#0Ő#@~,@`" " H";j" &."  v" 㿘 2  `?. &   &  @"  6 & @@6  ?@2@ @ ?   @@q&㿐`@? `2  ?7 x 8"  #’cؐ   @)  @\ XH   @ '@+'  @5ک x @/  ) 1  :1#V /@  / 7    ۘ@ (@  /`7` @0os"@ @)  (`0`  @=_# @/Ȗ  ) 1  "* /@  / 7  * "@ (@  /`7` @?Q!@ @)  (`0`  @`& ؘ @/  ) 1  "=# /@ܖ  / 7  ?֘#@ (@  /`7` @"W5#@ @)  (`0`  @!" @/  ) 1  ?f! /@  / 7  )P#@ 8  /`7` @m !@ @8'  (`0`  @=!b @@ bQ@  ) 1  0,#@  @' / 7  ) @ /`7` @:mc@ @/ @ (`0`  @5Ě`] @/@ @ ) 1  `S (@ @ / 7  6(yb@ ) @ /`7` @9cȚ@ @/Ȗ @ (`0`  @xsa @/@ܖ @ ) 1  0c֚ (@ @ / 7  =5Ca@ ) @ /`7` @V`@ @/ @ (`0`  @*xa @/@ @ ) 1  ?;c (@ @ / 7  bٚ@ ) @ /`7` @#J`@ @/ @ (`0`  @?!B @ ) 1  !}"  / 7  gX!"@  /`7` @?yN @ @ (`0`  @)/"D @ ) 1  # Ȗ / 7  =Ҙ#`@  /`7` @/ p@ @ (`0`  @ &ߘ"Ƙ @ ) 1  :I#  / 7  5;̘ @  /`7` @"!@ @ (`0`  @6u4 9 @ܖ ) 1  9!  / 7  蟘 @  /`7` @1+"e@ @ (`0`  @= H"D 0@@  ) 1  ʿ# 1@  / 7  *#@ 7  /`7` @?$ 9@ 7@  (`0`  @V֘!Ø 0@@  ) 1  #3  1@  / 7  ? }@ 7  /`7` @!a!ј@ 7@  (`0`  @"O 0@@  ) 1  ?9" 1@  / 7  (P#@ 7  /`7` @!@ 7@  (`0`  @=ߘ" 0@Ȗ@  ) 1  /N"5 1@  / 7   "@ 7  /`7` @:ᴘ#@ 7@ܖ  (`0`  @ & &  @& @;&  @*@0* @*  @ * `    ` @ `(*  `(#   `  @* * @ * ** 㿐@a㿘@W   *  @ *   "@ @b  88  b   㿘  `  `  @4 0%@/  & &@*&& @@ "   ` 㿘?c @ 6 @o6` `B  & $ @*&@$@@W@S2  *   , "@@ 4 "  "  ,`@@ 4`   ,@@ 4  @@*  㿐  `  ` @` ?2   2@  *2  ?*@   *  2@*@  㿘  `  ` @1  `  &  4 @ *    ?: : 2@  *:  ?*@   *  2@*@    B 'D'H'L'P'T'X@@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"&  @@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   & &  /*# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@#  # # # # # # # # # # # # #@+ 3`@; ) @  ` (  2 "" 2     * " @@ @   `@ @ "`" ?* ?*  @(`  (02 @  "J@J`2J@  J " @(` @ *  J@   J@J`  H" @ J2  @*`  `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2*2J@  "  J@J`   8  *  8  *  4  &  4  & @'Ā  $ @  /-? 耦 Ā 2;  0ؘ'7477477477ܑ477`A ڸ? 28```@@`*  @@ `*  @@`*  @Ā  @Ĕ ;--`2 @- ,`ˑ2 @ ĺ` `"` '``? '8  . ?2 ? '`" * #@'.`@ '  @`@?  ``'7@, @7@@͒,  ( ?#   . ?@, @@ "@"@4@6`#?# "6` 5 . * @? @ @ 4@6`5`5 @  Ā '   " . ? * :@ @2. 4@đ*  *`@;Α*  Г*`@ +     ( 8 2+ ( 2@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"  /)# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@&@# # # # # # # # # # # # #@+ 3`@bootparamd: 'whoami' call failed bp_whoami: short reply, %d < %d p41a"'А ''ؐ 'ܐ' &`0ТX@' 2R??$ab  $`H ?#`H2 !#\#`@ ?#@   @. 6?# $c! %@ #Z c4#@ '\ ` !@?' % "ܐ $c@z ? %"P %``@pP ? $@c`  ǐ4'' $c %@E 2@?@< 27?ab $ `H $?2 #`H㌘"#\"#` @Κ#@ 4' % H"b? '@$ 2?@E 2 ?#'@` 㿘`&"@  &@ 㿘 &   ? @&@m.@& @"  #d d  e  f g #" ?+d +e+f+gd "@#rarp: bad socket. %d No response for RARP request  !h@>H? @ . 7Ɛ(7Ȑ /ʐ /ː 7` 7`#7`~7`7 `b7`7ܖ 4#\@ ؖ .  @!? &2`0`02 `0 @ 0 $ ? @  $??"aX & 0 $`㿘 $ @  5㿐@  %"bЀ  5@2?@ 2?`(2?`&2?`   ?`@$  ?p  @+ 8 'pt@  , #\ $#`ab   @`?  % H "b؀` %@ s  ""а?㽠P  @ x 'P 'T 'X '\ '` $'d ('h ,p'l 8 t@ L 'p ab  h `$#\#`@\ ?  %"x  |&&&&& 0&$&( D@ &, 㺈 ? ?a b?  (`? #\$#`@$ ?  %"`   d 'd@ hd .@ ?nfsread: short packet, %d < %ld 0 ' ' ' ' ' $' ($' ,''$''ab  ,#\$L#`@ܖ ? L `P %""В?@T@ 0  "@  % H"bа?㿘@2& % "b $`H"`H6  %` 2 ?& &` !&`$&`( ?nfs_open: must mount first. 㷈 %` ` @ ~  N n`/2N N /" N ` 0 \ @1 x   $<N   /   I  N  /.Ɣ>.0 .29 %>; $) `` &`;@ @ O /@ x@ x @ x N  ` %&`  耤@ x@ x㿘  "& @ x&  nfs_read: hit EOF unexpectantly㿘' # %! %% @    ݖ? b  #L @ Đ ; @  & B> 2&       D": 0 0   @  :  ` : ??0   $0 4(2`82` <"` @ "`D :`0  @ ` J@(8(8    `J/`? `2> ` `!JJ@ 2+  `J2# &  J@;. .2J`;  `J@;"Є <` CD001㿐 (@( # @  - `(``(F b` @ Y   ꀢ   * @h… * *` *   *  *` * h @ʒ(g 8@@  - ```   ` `  `* *` * ` ` M`: @:7?L  *  / 2  !   @ ` *  **`    L  *  " M  ! M ̀?  g2 @ @  - `(``R(  gh 8  * *`  *   @ @@ ̀g@) @  @  &`  >   *@ * @ *@ &   * +   *  :@>  @ @㿘  @&  㷐 Y U@4 @N@I (O g  `2@  ,`(`)􀢨$ 2h g8' w" @ '@   B<& hB <2&     ":0 " 0  @  : ` :??0  $2`"`"`  :`0 㿐` 0@0@ <ฐ ,@  Y x``* d `  0, 200@"x < *` @  ? " ? 6" ?% 0@㿘 ` `.` 8 U& `@&@`,D B @< h "8&` ` @0$`@  ` ``d@  0, 2`0@ր$` ``T,ʬ& 㿐  `Pe8P @  4`0*:  8  2`0 8 `0e8e@ `L  Ȁ)x 2; @T`0$  " @ [ `d   +   0 @$ $  $&@&   b 8   @  "@ & 㿐`Q  `<@@ 3 2:@ "  2  F  2  &*@ B`<@@@8Ӑ@2 ``@ː 㻀  @Ґ Ц @v &`@@ $  ```찒`@2 %\F!T@  0@@eg`0 @i   t`$ `  'b`L@  @7<`/2L@`L@ /"`L@"s   Ԓ  / ``4e `L@  /,@K谒X,@.S`(  2HL@ $D  A`;@b%(`8@= 0 S䰒)`@ A` 0`  d( @<O /' '`L@  @ `  0@7 @1@. Ё㿘 `&   " ` 0@    `` 0@ `@@  Ё 㿐 %`@@8 ``@B@ղ@@ B<@2&     ":0 " 0  @  : ` :??0 2`"` "` :`0㿐`   =<@`@@8@2.@``@.@.?,   " #" @ @ B <@  O @ B<@ 㿘  *  `&  %L?&  &%P%, %  0 :* * :>%0   t  Օ; %0 B >%0 H8  ;  L>%88  ; >%@ $@ @?@ * @:@ @?  $`D "`D" @  "@ $@"?? @callrpc: error = %d 㿐\`@?: 4 '?'??@_  '?ܐ '?'?Ȑ '?'?'?'?ز@ a? % # '?Ė&#\ " @ ?  %` @` &@" % H"bа?recvrpc: reject, astat=%d, errno=%d 㿘! %$"А@˖  %@ @2?``2 ?`` ` #@$"а??"@?2 % %h(  ? ?    ? %" #""#"( %h    getport: %s㾐a"@2 o'?' ''''p#\ #`  5   p'0 # %b! @!@ H$bа?㿐 .  & 8   % ."b"'@   (0  8   ` % "b  B<   % "b&?㿐  & 8 " `    % >"b$$ $ 'X22$`  ) "`J 2 #`#$@ $ c̀@  %   @€#̤``"   @$ %""а?bad adaptor numberbad controller numberbad drive numberbad partitioncan't read disk labelunlabeledDevice not configuredOperation not permittedNo such file or directoryStale NFS file handleInappropriate file type or formatExec format errorInput/output errorUnknown error: code %d㿘`V "4*`@4w4w4x,4x,4x 4w4x,4x4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4w4x,4x,4x,4x,4x,4x,4x,4x,4x4x,4x,4w4w4w4w4w4w1 , 1 ) 1 & 1 # 1  !1 ! 1 !01 !H1 !`1 !1 !1  !1 !1 $# @a㿘i  ,  ". 0.".,.&   ""#..圐 0?喐 唐 咐 0叐 @͠L  0Ű傐 0 0sendudp: bad write (%d != %d)x @  . .<* @*@@ &6 & @&6 6 66''' ' @'@66&&&&&`  $!X  @ @ $ c@ 'ܖ@(@? !p@ereadudp: huge packet, udp len %ld x@ް?~ {ހ( (ꀢ u?@sp?2n?<  2g?퀢 2c?2 <]@u 2Y?怦&U?`` 2M? @|& 4  "` @2>? 6 % #@@~1?' ' '  '  @'@74  $$ $ $ ?$ $$ $ $ $  ??sendrecv: short write! (%d < %d)㿘   ) % <\q-  %"(?@@@, 4 2 "Ѐ   F$@$Ӧ`l     *  (Ї8*`J. 64 "2/?`"8" ?#   `(?`d((  `dh(* ( ?#㿘@㿘1 $#X.  .?   0.L ?  0.B  0?.?.`4  "@ ((*8"@ Є (@㿐 "< N -N $*` .! ؒ?*` @N  . ɒ?#*` @N  .   J @?    `&     ,` ` `  (  `߀` ܗ(2 :?# :* arpwhohas: overflowed arp_list! arp: no response for %s   $ P@ $ @ 'l@@C`@ ` 3 $`  &` @Ґ"ȠƐ @E . 7Ɛ(7Ȑ /ʐ /7 l7 n7 7 ! `7 777 ! l~$@ 4#\j .? lh! "'h@  `4```4` &`4`㿘 $@(㿐@ %"bЀ(2(?@ 2$?`(2 ?`&2?`  @?2?` $` *` * $`P@ ?㿘@ /`(+`&'` # `@   `6`` `6`6`` 6``6`6` 6` (6`  6`  2`  .2`@"`@@    @*0    @*`㿘 6 6 6......6? ??㿘?  @-    $`@&  "` ?` ?7 $`  $ : `0 `(   ((( $#`" @ `  ?  2 @ 2( 㿘'H'L'P'T $cx 'X @"cx@|H "@l exit㿘 "! 㿘  & 8 @ " @   ` 㿘  .  & 8   % $"b2  " @  `  ` @`$ %""Ѐ % ""а? $` *@㿘'L'P'T'X! $$# ""`@L#*㿘'H'L'P'T'X #T@ H㿘 #T@8 "#l `N@`%` N@ `* 4444|4|4|4|4|4|4|44|4|44H4|4|44|4(4|4|4\ L@t `ϒ L?,@` < ,L L  LL 4 L  ` >0 `L` L` N@` - @1 N@@) N@@! ~N@ 0 x @ qN@ % i le0123456789abcdef㿈 #!J @, ?L?|/-\㿘 $`" ` #"(AJ@? 44 l44 4444 44 44P4H4@48404(4    4f4j4j4kH4kP4k4Zh4^4^4`t4`|4`4T4V4W84W4W4X|4x@` 40123456789abcdef/4= 4:44p'4sp-4,94:@4KU[4b 4j44ou424B4y444O4742P4044 (4  4,4J" 42 4:B4GH4EpNX41b 4lv4 414L84X44;x4p4 44,4 4;( 4t4~ (4:04:84G4{dP4TZ4e4xn4+x 44@44844V444 4 4204^'/ 4X7=4q0P41@[4Ri 4`u4Lt4k4T44:4p4P 44R)24x=4W8G4:pPX 4c4s4W}4 4 44S4`t44X|404M 44 4`"41: 4hI4U4H_4 |i4js 4|4kP44 4v44 444@ 444k4 l 4<4M,64f@4 PW4X`4=k4|q4n{4x 4p44 4t 4x4  444W44Zh4L/4`7 4?H4I4S]4he4`r4t{ 44/`4H44<4<4^44$440x4`|4,&404974,F4hM 4U4;\4,f4py4X449X444t4rx4,04P4p4kH 4  4  ' 4 0 4H 64 =4l C41 M4=8 S4 Z4( `4=P f4L l4n r4} | 4L 4 4=h 4P 4= 4m 4`  49 4| 4X 4 4< 4 4 4xP  4,` 40 4= 4 %4 . 4 =4 Q4 D ] 4 m 4 s4j ~4/ 4a 49 40 48 4|  4= 4 4 4 4 4 4 4 4` )4p 648 B4 L4 X4 h4 n4 |4 4@ 4 4d 4h 4 4 4 4 4 4 4 (4 44 @4 O4 a4 m4x t4x 8\4 `@# ` #Ȥ" $@` `T@ ! c@"@H*/+  "b  0  "  " ̐ * " Ċ!` " @ bootxx%s: can't open device㿐@!@  "bآbؐ @    @p`@'   "@[%s: alloc failed%s: block table corrupt%s: read failure%s: short read㿐! @ Ц  ! @=` Ԣ @D  + ?# 2  !@*`   П  !@` @ Ѐ` !@`2@?@2 @a ~ 8@֒` `Ԁ@ Ʋ@  promprom0㿘   @ "   "#8 a"8 J*@J` )J  *@Can't open device `%s' 㿘@\  ` `@ "`  #8`#8`$@ 2$    c8@ 0  $    `ܒ`$`$` 㿘# b   ` ༟* `b   '@`20,6 * '@ 㿘  @S& & $& (`   €@V " '@ 㿘 " `@ 0(@ 㿘 @ $ ? $ "*@ 㿐 "  / 0T@㿘  㿘 " tInvalid controller number prom_iopen: "%s" error=%d 㿘) " ?D   @ # @Ԕ 8$ $  $ $`  @O# * @ *`@`@F $0` "`@$4` " @\$ @ & "  %"@&#@ 㿘# b    @ 4 "$b@ & 4$bprom_mapin: length=%d prom_mapin: invalid maptype %d 㿘  đ* @  @x !   !      @c     !  <  ̚@;@ ?*@Ԣ &@ `   ! @   ?( , H L\ T ` X` P d l  t$ p   *?  Ĉ`Ī` Đ`IJ`  dvma_mapin㿘? #@(1? @"1?dvma_mapout㿘 #@(1 @#@1㿘@ " ْ㿘 @ `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2*@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"   ?@ * @:@ @?  a "a" @  "@ "?? ሀ@@    @*0    @*`2( 㿘'H'L'P'T b 'X @"b@|H @l#exit㿘 #x㿘  #H @ " @   ` 㿘  .  #H    $"c<2  " @  `  ` @`$ "#<  "#<? ̆` ́*@㿘'L'P'T'X! $"  @L"*㿘'H'L'P'T'X "ؒ@ H㿘 "ؒ@8 ! `N@`%` N@ `* 4(44(44444444 444`444444444 L@t `ϒ L?,@` < ,L L  LL 4 L  ` >0 `L` L` N@` - @1 N@@) N@@! ~N@ΐ 0̐ x @ qN@ % i le0123456789abcdef㿈  $ @, ?L?|/-\㿘 Ȑ`"Ȓ `  J@ 4p44X4\4`4h44X44`   44 44 #40,4740=4F4O 4\4f4n4w4444 444` 44\44D4444 4  4, 45 48F4N4xV4^4g4\t4{44X44 4x444 L4 4<44#!/bin/sh # $OpenBSD: binstall.sh,v 1.5 1996/12/12 08:42:44 deraadt Exp $ # $NetBSD: binstall.sh,v 1.3 1996/04/07 20:00:12 thorpej Exp $ # vecho () { # echo if VERBOSE on if [ "$VERBOSE" = "1" ]; then echo "$@" 1>&2 fi return 0 } Usage () { echo "Usage: $0 [-hvt] [-m] net|ffs directory" exit 1 } Help () { echo "This script copies the boot programs to one of several" echo "commonly used places. It takes care of stripping the" echo "a.out(5) header off the installed boot program on sun4 machines." echo "When installing an \"ffs\" boot program, this script also runs" echo "installboot(8) which installs the default proto bootblocks into" echo "the appropriate filesystem partition." echo "Options:" echo " -h - display this message" echo " -m - Look for boot programs in (default: /usr/mdec)" echo " -v - verbose mode" echo " -t - test mode (implies -v)" exit 0 } PATH=/bin:/usr/bin:/sbin:/usr/sbin MDEC=${MDEC:-/usr/mdec} set -- `getopt "hm:tv" "$@"` if [ $? -gt 0 ]; then Usage fi for a in $* do case $1 in -h) Help; shift ;; -m) MDEC=$2; shift 2 ;; -t) TEST=1; VERBOSE=1; shift ;; -v) VERBOSE=1; shift ;; --) shift; break ;; esac done DOIT=${TEST:+echo "=>"} if [ $# != 2 ]; then Usage fi WHAT=$1 DEST=$2 if [ ! -d $DEST ]; then echo "$DEST: not a directory" Usage fi SKIP=0 case $WHAT in "ffs") DEV=`mount | while read line; do set -- $line vecho "Inspecting \"$line\"" if [ "$2" = "on" -a "$3" = "$DEST" ]; then if [ ! -b $1 ]; then continue fi RAW=\`echo -n "$1" | sed -e 's;/dev/;/dev/r;'\` if [ ! -c \$RAW ]; then continue fi echo -n $RAW break; fi done` if [ "$DEV" = "" ]; then echo "Cannot find \"$DEST\" in mount table" exit 1 fi TARGET=$DEST/boot vecho Boot device: $DEV vecho Target: $TARGET $DOIT dd if=${MDEC}/boot of=$TARGET bs=32 skip=$SKIP sync; sync; sync vecho installboot ${VERBOSE:+-v} $TARGET ${MDEC}/bootxx $DEV $DOIT installboot ${VERBOSE:+-v} $TARGET ${MDEC}/bootxx $DEV ;; "net") TARGET=$DEST/boot.sparc.openbsd TMP=/tmp/boot.$$ vecho Target: $TARGET vecho Copying to temporary file. cp ${MDEC}/boot $TMP; chmod +w $TMP vecho Stripping $TMP strip $TMP vecho Creating header magic. printf '\01\03\01\07\060\200\0\07' | dd of=$TARGET bs=32 conv=sync vecho Concatenating boot code. dd if=$TMP of=$TARGET bs=32 skip=1 seek=1 rm $TMP ;; *) echo "$WHAT: not recognised" exit 1 ;; esac exit $? i#35:\ :te=\E[>4h:ti=\E[>4l:tc=sun: vt320-k3|MS-Kermit 3.00's vt320 emulation:\ :am:es:hs:km:mi:ms:xn:\ :co#80:it#8:li#49:pb#9600:vt#3:\ :AL=\E[%dL:CC=\E:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RI=\E[%dC:SR=\E[%dL:UP=\E[%dA:ae=\E(B:al=\E[L:\ :as=\E(0:bl=^G:cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:\ :cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:\ :ds=\E[0$~:ec=\E[%dX:ei=\E[4l:fs=\E[0$}:ho=\E[H:im=\E[4h:\ :is=\E>\E F\E[?1l\E[?7h\E[r\E[2$~:k0=\E[21~:k1=\EOP:\ :k2=\EOQ:k3=\EOR:k4=\EOS:k6=\E[17~:k7=\E[18~:k8=\E[19~:\ :k9=\E[20~:kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=^H:kd=\EOB:\ :ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:ku=\EOA:le=^H:\ :mb=\E[5m:md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:nw=^M^J:rc=\E8:\ :sc=\E7:se=\E[27m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:\ :ts=\E[1$}\r\E[K:ue=\E[24m:up=\E[A:us=\E[4m:\ :vb=\E[?5h\E[?5l\E[?5h\E[?5l\E[?5h\E[?5l:ve=\E[?25h:\ :vi=\E[?25l: vt320-k311|dec vt320 series as defined by kermit 3.11:\ :am:es:hs:mi:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=^O:al=3\E[L:as=^N:bl=^G:cd=\E[J:ce=\E[K:cl=\E[;H\E[2J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:\ :dl=\E[M:do=^J:ds=\E[2$~\r\E[1$}\E[K\E[$}:ei=\E[4l:\ :fs=\E[$}:ho=\E[H:im=\E[4h:\ :is=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h\E[1;24r\E[24;1H:\ :k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:k6=\E[17~:k7=\E[18~:\ :k8=\E[19~:k9=\E[20~:kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:\ :kr=\EOC:ks=\E[?1h\E=:ku=\EOA:l1=pf1:l2=pf2:l3=pf3:l4=pf4:\ :le=^H:mb=\E[5m:md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:nw=^M\ED:\ :r1=\E[?3l:rc=\E8:rf=/usr/share/tabset/vt100:sc=\E7:\ :se=\E[27m:sf=\ED:so=\E[7m:sr=\EM:st=\EH:ta=^I:\ :ts=\E[2$~\E[1$}\E[1;%dH:ue=\E[24m:up=\E[A:us=\E[4m:\ :vb=\E[?5h\E[?5l:ve=\E[?25h:vi=\E[?25l:vs=\E[?25h: vt50|dec vt50:\ :bs:\ :co#80:li#12:\ :bl=^G:cd=\EJ:ce=\EK:cl=\EH\EJ:cr=^M:do=^J:le=^H:nd=\EC:\ :sf=^J:ta=^I:up=\EA: vt50h|dec vt50h:\ :bs:\ :co#80:li#12:\ :bl=^G:cd=\EJ:ce=\EK:cl=\EH\EJ:cm=\EY%+ %+ :cr=^M:do=^J:\ :le=^H:nd=\EC:sf=^J:sr=\EI:ta=^I:up=\EA: vt61|vt-61|vt61.5|dec vt61:\ :co#80:li#24:\ :bl=^G:cd=\EJ:ce=\EK:cl=\EH\EJ:cm=\EY%+ %+ :cr=\r:do=^J:\ :kd=\EB:kl=\ED:kr=\EC:ku=\EA:le=^H:nd=\EC:sf=\n:sr=\EI:ta=^I:\ :up=\EA: ter:ns#83:nt#15:nc#2619:\ :pb#498000:ob#0:\ :pc#3260655:oc#0:\ :ph#2761410:oh#498000: Seagate ST1239N SWIFT:\ :ty#winchester:ns#35:nt#9:nc#1264: Seagate ST12400N 2.4GB:\ :ty#winchester:ns#82:nt#19:nc#2668:\ :pa#32718:oa#0:ba#8192:\ :pb#65436:ob#32718:\ :pc#4156744:oc#0:\ :pg#4058590:og#98154: Seagate ST12550N:\ :ty#winchester:ns#80:nt#19:nc#2747: Seagate ST1480N:\ :ty#winchester:ns#64:nt#9:nc#1456: Seagate ST15150N:\ :ty#winchester:ns#78:nt#21:nc#5119:\ :pc#8384922:oc#0: Seagate ST410800N Elite 9:\ :ty#winchester:ns#108:nt#27:nc#6087:\ :pc#17749692:oc#0: Seagate ST42100N - Wren 9:\ :ty#winchester:ns#96:nt#15:nc#2574:\ :pc#3706560:oc#0: Seagate ST42400N Elite 2:\ :ty#winchester:ns#84:nt#19:nc#2604:\ :pc#4155984:oc#0: Seagate Sabre-5 ST81236J:\ :ty#XD7053:ns#82:nt#15:nc#1633:\ :pa#99630:oa#0:ba#8192:\ :pb#261990:ob#99630:\ :pc#2008590:oc#0:\ :pd#548580:od#361620:\ :pe#1098390:oe#910200:\ :pf#361620:of#0:\ :pg#1646970:og#361620:\ :ph#1908960:oh#99630: SeagateST3283N:\ :ty#winchester:ns#57:nt#5:nc#1689: Sun1.0G:\ :ty#winchester:ns#80:nt#15:nc#1703: SyQuest SQ555:\ :ty#winchester:ns#34:nt#2:nc#1273:\ :pc#86564:oc#0: Toshiba MK 156F:\ :ty#winchester:ns#34:nt#10:nc#815: Vertex V185:\ :ty#ACB4000:ns#17:nt#7:nc#1163: dumb|80-column dumb tty:\ :am:\ :co#80:\ :bl=^G:cr=^M:do=^J:sf=^J: unknown|unknown terminal type:\ :gn:tc=dumb: pcvtXX|pcvt vt200 emulator (DEC VT220):\ :am:km:mi:ms:xn:\ :it#8:vt#3:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:SF=\E[%dS:\ :SR=\E[%dT:UP=\E[%dA:\ :ac=llmmkkjjuuttvvwwqqxxnnoosspprr``aaffgg~~..--++\054\054hhII00yyzz:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :ct=\E[3g:dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:ho=\E[H:\ :i1=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:im=\E[4h:\ :k1=\E[17~:k2=\E[18~:k3=\E[19~:k4=\E[20~:k5=\E[21~:\ :k6=\E[23~:k7=\E[24~:k8=\E[25~:kD=\E[3~:kH=\E[4~:kI=\E[2~:\ :kN=\E[6~:kP=\E[5~:kb=\177:kd=\EOB:ke=\E[?1l\E>:kh=\E[1~:\ :kl=\EOD:kr=\EOC:ks=\E[?1h\E=:ku=\EOA:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:nw=\EE:\ :r1=\Ec\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:rc=\E8:\ :rf=/usr/share/tabset/vt100:sc=\E7:se=\E[27m:sf=\ED:\ :so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[24m:up=\E[A:us=\E[4m: pcvt25|dec vt220 emulation with 25 lines:\ :co#80:li#25:\ :is=\E[1;25r\E[25;1H:tc=pcvtXX: pcvt28|dec vt220 emulation with 28 lines:\ :co#80:li#28:\ :is=\E[1;28r\E[28;1H:tc=pcvtXX: pcvt35|dec vt220 emulation with 35 lines:\ :co#80:li#35:\ :is=\E[1;35r\E[35;1H:tc=pcvtXX: pcvt40|dec vt220 emulation with 40 lines:\ :co#80:li#40:\ :is=\E[1;40r\E[40;1H:tc=pcvtXX: pcvt43|dec vt220 emulation with 43 lines:\ :co#80:li#43:\ :is=\E[1;43r\E[43;1H:tc=pcvtXX: pcvt50|dec vt220 emulation with 50 lines:\ :co#80:li#50:\ :is=\E[1;50r\E[50;1H:tc=pcvtXX: pcvt25w|dec vt220 emulation with 25 lines and 132 cols:\ :co#132:li#25:\ :is=\E[1;25r\E[25;1H:tc=pcvtXX: pcvt28w|dec vt220 emulation with 28 lines and 132 cols:\ :co#132:li#28:\ :is=\E[1;28r\E[28;1H:tc=pcvtXX: pcvt35w|dec vt220 emulation with 35 lines and 132 cols:\ :co#132:li#35:\ :is=\E[1;35r\E[35;1H:tc=pcvtXX: pcvt40w|dec vt220 emulation with 40 lines and 132 cols:\ :co#132:li#40:\ :is=\E[1;40r\E[40;1H:tc=pcvtXX: pcvt43w|dec vt220 emulation with 43 lines and 132 cols:\ :co#132:li#43:\ :is=\E[1;43r\E[43;1H:tc=pcvtXX: pcvt50w|dec vt220 emulation with 50 lines and 132 cols:\ :co#132:li#50:\ :is=\E[1;50r\E[50;1H:tc=pcvtXX: pc3|IBM PC BSD/386 Console:\ :tc=bsdos: vt52|dec vt52:\ :bs:\ :co#80:it#8:li#24:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\EG:as=\EF:bl=^G:cd=\EJ:ce=\EK:cl=\EH\EJ:cm=\EY%+ %+ :\ :cr=^M:do=\EB:ho=\EH:kb=^H:kd=\EB:kl=\ED:kr=\EC:ku=\EA:\ :le=\ED:nd=\EC:nw=^M^J:sf=^J:sr=\EI:ta=^I:up=\EA: vt100|vt100-am|dec vt100 (w/advanced video):\ :am:bs:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :@8=\EOM:DO=\E[%dB:K1=\EOq:K2=\EOr:K3=\EOs:K4=\EOp:K5=\EOn:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=^O:as=^N:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:do=^J:\ :eA=\E(B\E)0:ho=\E[H:k0=\EOy:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k5=\EOt:k6=\EOu:k7=\EOv:k8=\EOl:k9=\EOw:k;=\EOx:\ :kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:\ :ku=\EOA:le=^H:mb=\E[5m:md=\E[1m:me=\E[m\017:mr=\E[7m:\ :nd=\E[C:r2=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:rc=\E8:\ :..sa=\E[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t\016%e\017%;:\ :sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: vt100nam|vt100-nam|vt100 no automargins:\ :am@:xn@:tc=vt100-am: vt100-w|vt100-w-am|dec vt100 132 cols (w/advanced video):\ :co#132:li#24:\ :r2=\E>\E[?3h\E[?4l\E[?5l\E[?8h:tc=vt100-am: vt100-w-nam|vt100-nam-w|dec vt100 132 cols (w/advanced video no automargin):\ :co#132:li#14:vt@:\ :r2=\E>\E[?3h\E[?4l\E[?5l\E[?8h:tc=vt100-nam: vt100-nav|vt100 without advanced video option:\ :sg#1:\ :mb@:md@:me@:mr@:sa@:se=\E[m:so=\E[7m:ue@:us@:tc=vt100: vt100-nav-w|vt100-w-nav|dec vt100 132 cols 14 lines (no advanced video option):\ :co#132:li#14:tc=vt100-nav: vt100-s|vt100-s-top|vt100-top-s|vt100 for use with top sysline:\ :es:hs:\ :li#23:\ :cl=\E[2;1H\E[J:cm=\E[%i%+^A;%dH:cs=\E[%i%i%d;%dr:\ :ds=\E7\E[1;24r\E8:fs=\E8:ho=\E[2;1H:is=\E7\E[2;24r\E8:\ :ts=\E7\E[1;%p1%dH\E[1K:\ :tc=vt100-am: vt100-s-bot|vt100-bot-s|vt100 for use with bottom sysline:\ :es:hs:\ :li#23:\ :ds=\E7\E[1;24r\E8:fs=\E8:is=\E[1;23r\E[23;1H:\ :ts=\E7\E[24;%p1%dH\E[1K:\ :tc=vt100-am: vt102|dec vt102:\ :mi:\ :al=\E[L:dc=\E[P:dl=\E[M:ei=\E[4l:im=\E[4h:tc=vt100: vt102-w|dec vt102 in wide mode:\ :li#132:\ :r3=\E[?3h:tc=vt102: vt102-nsgr|vt102 no sgr (use if you see snowflakes after highlight changes):\ :me=\E[m:sa@:\ :tc=vt102: vt125|vt125 graphics terminal:\ :cl=\E[H\E[2J\EPpS(E)\E\:tc=vt100: vt131|dec vt131:\ :am:bs:xn:\ :co#80:it#8:li#24:vt#3:\ :RA=\E[?7h:SA=\E[?7h:bl=^G:cd=50\E[J:ce=3\E[K:\ :cl=50\E[;H\E[2J:cm=5\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :do=^J:ho=\E[H:is=\E[1;24r\E[24;1H:k1=\EOP:k2=\EOQ:\ :k3=\EOR:k4=\EOS:kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:\ :kr=\EOC:ks=\E[?1h\E=:ku=\EOA:le=^H:mb=2\E[5m:md=2\E[1m:\ :me=2\E[m:mr=2\E[7m:nd=2\E[C:nw=^M^J:\ :r1=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:rc=\E8:sc=\E7:\ :se=2\E[m:so=2\E[7m:sr=5\EM:ta=^I:ue=2\E[m:up=2\E[A:\ :us=2\E[4m: vt132|DEC vt132:\ :xn:\ :al=\E[L:dc=\E[P:dl=\E[M:ei=\E[4h:im=\E[4l:ip=:sf=\n:tc=vt100: vt220|vt200|DEC VT220 in vt100 emulation mode:\ :am:bs:mi:pt:xn:xo:\ :co#80:li#24:vt#3:\ :@7=\E[4~:RA=\E[?7l:SA=\E[?7h:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:ho=\E[H:\ :if=/usr/share/tabset/vt100:im=\E[4h:\ :is=\E[1;24r\E[24;1H:k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:\ :k5=\E[17~:k6=\E[18~:k7=\E[19~:k8=\E[20~:k9=\E[21~:\ :k;=\E[29~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=^H:\ :kd=\E[B:kh=\E[1~:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:nl=^J:\ :r2=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:rc=\E8:\ :rf=/usr/share/tabset/vt100:\ :..sa=\E[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t\E(0%e\E(B%;:\ :sc=\E7:se=\E[27m:sf=20\ED:so=\E[7m:sr=14\EM:ta=^I:\ :ue=\E[24m:up=\E[A:us=\E[4m:ve=\E[?25h:vi=\E[?25l: vt220-w|vt200-w|DEC vt220 in wide mode:\ :co#132:\ :r3=\E[?3h:tc=vt220: vt220d|DEC VT220 in vt100 mode with DEC function key labeling:\ :F1=\E[23~:F2=\E[24~:F3=\E[25~:F4=\E[26~:F5=\E[28~:\ :F6=\E[29~:F7=\E[31~:F8=\E[32~:F9=\E[33~:FA=\E[34~:k5@:\ :k6=\E[17~:k7=\E[18~:k8=\E[19~:k9=\E[20~:k;=\E[21~:\ :tc=vt220: vt220-nam|v200-nam|VT220 in vt100 mode with no auto margins:\ :am@:\ :r2=\E>\E[?3l\E[?4l\E[?5l\E[?7l\E[?8h:tc=vt220: vt220-8|dec vt220 8 bit terminal:\ :am:bs:mi:ms:xn:xo:\ :co#80:it#8:li#24:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RI=\E[%dC:UP=\E[%dA:ae=^O:al=\E[L:as=^N:bl=^G:\ :cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:\ :cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:ec=\E[%dX:\ :ei=\E[4l:ho=\E[H:if=/usr/share/tabset/vt100:im=\E[4h:\ :is=\E[?7h\E[>\E[?1h\E F\E[?4l:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k6=\E[17~:k7=\E[18~:k8=\E[19~:k9=\E[20~:kI=\E[2~:\ :kN=\E[6~:kP=\E[5~:kb=^H:kd=\E[B:kh=\E[H:kl=\E[D:kr=\E[C:\ :ku=\E[A:le=^H:mb=\E[5m:md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:\ :nw=\EE:rc=\E8:sc=\E7:se=\E[27m:sf=\ED:so=\E[7m:sr=\EM:\ :st=\EH:ta=^I:ue=\E[24m:up=\E[A:us=\E[4m:vb=\E[?5h\E[?5l: vt320nam|v320n|DEC VT320 in vt100 emul. mode with NO AUTO WRAP mode:\ :am@:\ :r2=\E>\E[?3l\E[?4l\E[?5l\E[?7l\E[?8h:tc=vt220: vt320|vt300|dec vt320 7 bit terminal:\ :am:es:hs:mi:ms:xn:\ :co#80:li#24:ws#80:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :K1=\EOw:K2=\EOu:K3=\EOy:K4=\EOq:K5=\EOs:LE=\E[%dD:\ :RI=\E[%dC:UP=\E[%dA:ae=\E(B:al=\E[L:as=\E(0:bl=^G:cd=\E[J:\ :ce=\E[K:cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:\ :cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:ec=\E[%dX:\ :ei=\E[4l:fs=\E[0$}:ho=\E[H:im=\E[4h:\ :is=\E>\E[?3l\E[?4l\E[5?l\E[?7h\E[?8h\E[1;24r\E[24;1H:\ :k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:k6=\E[17~:k7=\E[18~:\ :k8=\E[19~:k9=\E[20~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:\ :kb=\177:kd=\EOB:ke=\E[?1l\E>:kh=\E[1~:kl=\EOD:kr=\EOC:\ :ks=\E[?1h\E=:ku=\EOA:le=^H:mb=\E[5m:md=\E[1m:me=\E[m:\ :mr=\E[7m:nd=\E[C:nw=\EE:rc=\E8:sc=\E7:se=\E[m:sf=\ED:\ :so=\E[7m:sr=\EM:st=\EH:ta=^I:ts=\E[1$}\E[H\E[K:ue=\E[m:\ :up=\E[A:us=\E[4m:ve=\E[?25h:vi=\E[?25l: vt320-nam|vt300-nam|dec vt320 7 bit terminal with no am to make SAS happy:\ :am@:\ :is=\E>\E[?3l\E[?4l\E[5?l\E[?7l\E[?8h\E[1;24r\E[24;1H:\ :r2=\E>\E[?3l\E[?4l\E[5?l\E[?7l\E[?8h\E[1;24r\E[24;1H:\ :tc=vt320: vt320-w|vt300-w|dec vt320 wide 7 bit terminal:\ :co#132:ws#132:\ :is=\E>\E[?3h\E[?4l\E[5?l\E[?7h\E[?8h\E[1;24r\E[24;1H:\ :r2=\E>\E[?3h\E[?4l\E[5?l\E[?7h\E[?8h\E[1;24r\E[24;1H:\ :tc=vt320: vt320-w-nam|vt300-w-nam|dec vt320 wide 7 bit terminal with no am:\ :am@:\ :is=\E>\E[?3h\E[?4l\E[5?l\E[?7l\E[?8h\E[1;24r\E[24;1H:\ :r2=\E>\E[?3h\E[?4l\E[5?l\E[?7l\E[?8h\E[1;24r\E[24;1H:\ :tc=vt320-w: vt340|dec-vt340|vt330|dec-vt330|dec vt340 graphics terminal with 24 line page:\ :am:es:hs:mi:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=^O:al=\E[L:as=^N:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:\ :dl=\E[M:do=^J:ds=\E[2$~\r\E[1$}\E[K\E[$}:ei=\E[4l:\ :fs=\E[$}:ho=\E[H:im=\E[4h:\ :is=\E<\E F\E>\E[?1h\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h\E[1;24r\E[24;1H:\ :k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:k6=\E[17~:k7=\E[18~:\ :k8=\E[19~:k9=\E[20~:kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:\ :kr=\EOC:ks=\E[?1h\E=:ku=\EOA:l1=pf1:l2=pf2:l3=pf3:l4=pf4:\ :le=^H:mb=\E[5m:md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:nw=^M\ED:\ :r1=\E[?3l:rc=\E8:rf=/usr/share/tabset/vt300:sc=\E7:\ :se=\E[27m:sf=\ED:so=\E[7m:sr=\EM:st=\EH:ta=^I:\ :ts=\E[2$~\E[1$}\E[1;%dH:ue=\E[24m:up=\E[A:us=\E[4m:\ :vb=200\E[?5h\E[?5l:ve=\E[?25h:vi=\E[?25l:vs=\E[?25h: vt400|vt400-24|dec-vt400|dec vt400 24x80 column autowrap:\ :am:es:hs:mi:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RI=\E[%dC:UP=\E[%dA:ae=^O:al=\E[L:as=^N:\ :cd=10\E[J:ce=4\E[K:cl=10\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:\ :cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:\ :ds=\E[2$~\r\E[1$}\E[K\E[$}:ei=\E[4l:fs=\E[$}:ho=\E[H:\ :ic=\E[@:im=\E[4h:\ :is=\E<\E F\E>\E[?1h\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h\E[1;24r\E[24;1H:\ :k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:k6=\E[17~:k7=\E[18~:\ :k8=\E[19~:k9=\E[20~:kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:\ :kr=\EOC:ks=\E[?1h\E=:ku=\EOA:le=^H:mb=\E[5m:md=\E[1m:\ :me=\E[m:mr=\E[7m:nd=\E[C:nw=^M\ED:rc=\E8:sc=\E7:se=\E[27m:\ :sf=\ED:so=\E[7m:sr=\EM:st=\EH:ta=^I:\ :ts=\E[2$~\E[1$}\E[1;%dH:ue=\E[24m:up=\E[A:us=\E[4m:\ :vb=200\E[?5h\E[?5l:ve=\E[?25h:vi=\E[?25l:vs=\E[?25h: vt420|DEC VT420:\ :am:mi:xn:xo:\ :co#80:li#24:vt#3:\ :*6=\E[4~:@0=\E[1~:RA=\E[?7l:\ :S5=\E[?0;0r\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :SA=\E[?7h:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:ho=\E[H:\ :i2=\E[?67h\E[64;1"p:if=/usr/share/tabset/vt300:\ :im=\E[4h:is=\E[1;24r\E[24;1H:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k5=\E[17~:k6=\E[18~:k7=\E[19~:k8=\E[20~:\ :k9=\E[21~:k;=\E[29~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:\ :kb=^H:kd=\E[B:ke=\E>:kl=\E[D:kr=\E[C:ks=\E=:ku=\E[A:le=^H:\ :mb=\E[5m:md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:\ :r3=\E[?67h\E[64;1"p:rc=\E8:rf=/usr/share/tabset/vt300:\ :..sa=\E[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t\E(0%e\E(B%;:\ :sc=\E7:se=\E[m:sf=\ED:so=\E[7m:sr=\EM:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: vt420pc|DEC VT420 w/PC keyboard:\ :@7=\E[4~:F1=\E[23~:F2=\E[24~:F3=\E[11;2~:F4=\E[12;2~:\ :F5=\E[13;2~:F6=\E[14;2~:F7=\E[15;2~:F8=\E[17;2~:\ :F9=\E[18;2~:FA=\E[19;2~:FB=\E[20;2~:FC=\E[21;2~:\ :FD=\E[23;2~:FE=\E[24;2~:FF=\E[23~:FG=\E[24~:FH=\E[25~:\ :FI=\E[26~:FJ=\E[28~:FK=\E[29~:FL=\E[31~:FM=\E[32~:\ :FN=\E[33~:FO=\E[34~:FP=\E[35~:FQ=\E[36~:FR=\E[23;2~:\ :FS=\E[24;2~:FT=\E[25;2~:FU=\E[26;2~:FV=\E[28;2~:\ :FW=\E[29;2~:FX=\E[31;2~:FY=\E[32;2~:FZ=\E[33;2~:\ :Fa=\E[34;2~:Fb=\E[35;2~:Fc=\E[36;2~:\ :S6=USR_TERM\072vt420pcdos\072:k1=\E[11~:k2=\E[12~:\ :k3=\E[13~:k4=\E[14~:k5=\E[15~:k6=\E[17~:k7=\E[18~:\ :k8=\E[19~:k9=\E[20~:k;=\E[21~:kD=\177:kh=\E[H:\ :..px=\EP1;1|%?%{16}%p1%>%t%{0}%e%{21}%p1%>%t%{1}%e%{25}%p1%>%t%{2}%e%{27}%p1%>%t%{3}%e%{30}%p1%>%t%{4}%e%{5}%;%p1%+%d/%p2%s\E\:tc=vt420: vt420pcdos|DEC VT420 w/PC for DOS Merge:\ :li#25:\ :S1=%?%p2%{19}%=%t\E\023\021%e%p2%{32}%<%t\E%p2%c%e%p2%{127}%=%t\E\177%e%p2%c%;:\ :S4=\E[?1;2r\E[34h:\ :S5=\E[?0;0r\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:S6@:\ :me=\E[m:sa@:\ :tc=vt420pc: vt420f|DEC VT420 with VT kbd; VT400 mode; F1-F5 used as Fkeys:\ :F1=\E[23~:F2=\E[24~:F3=\E[25~:F4=\E[26~:F5=\E[28~:\ :F6=\E[29~:F7=\E[31~:F8=\E[32~:F9=\E[33~:FA=\E[34~:\ :k1=\E[11~:k2=\E[12~:k3=\E[13~:k4=\E[14~:k5=\E[15~:\ :k6=\E[17~:k7=\E[18~:k8=\E[19~:k9=\E[20~:k;=\E[21~:\ :kD=\177:kh=\E[H:l1=\EOP:l2=\EOQ:l3=\EOR:l4=\EOS:\ :tc=vt420: vt510|DEC VT510:\ :tc=vt420: vt510pc|DEC VT510 w/PC keyboard:\ :tc=vt420pc: vt510pcdos|DEC VT510 w/PC for DOS Merge:\ :tc=vt420pcdos: vt520|DEC VT520:\ :am:mi:xn:xo:\ :co#80:li#24:vt#3:\ :*6=\E[4~:@0=\E[1~:RA=\E[?7l:\ :S5=\E[?0;0r\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :SA=\E[?7h:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:ho=\E[H:\ :i2=\E[?67h\E[64;1"p:if=/usr/share/tabset/vt300:\ :im=\E[4h:is=\E[1;24r\E[24;1H:k0=\E[29~:k1=\EOP:k2=\EOQ:\ :k3=\EOR:k4=\EOS:k5=\E[17~:k6=\E[18~:k7=\E[19~:k8=\E[20~:\ :k9=\E[21~:k;=\E[29~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:\ :kb=^H:kd=\E[B:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:r3=\E[?67h\E[64;1"p:\ :rc=\E8:rf=/usr/share/tabset/vt300:sc=\E7:se=\E[m:sf=\ED:\ :so=\E[7m:sr=\EM:ta=^I:ue=\E[m:up=\E[A:us=\E[4m: vt525|DEC VT525:\ :am:mi:xn:xo:\ :co#80:li#24:vt#3:\ :*6=\E[4~:@0=\E[1~:RA=\E[?7l:\ :S5=\E[?0;0r\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :SA=\E[?7h:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:ho=\E[H:\ :i2=\E[?67h\E[64;1"p:if=/usr/share/tabset/vt300:\ :im=\E[4h:is=\E[1;24r\E[24;1H:k0=\E[29~:k1=\EOP:k2=\EOQ:\ :k3=\EOR:k4=\EOS:k5=\E[17~:k6=\E[18~:k7=\E[19~:k8=\E[20~:\ :k9=\E[21~:k;=\E[29~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:\ :kb=^H:kd=\E[B:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:r3=\E[?67h\E[64;1"p:\ :rc=\E8:rf=/usr/share/tabset/vt300:sc=\E7:se=\E[m:sf=\ED:\ :so=\E[7m:sr=\EM:ta=^I:ue=\E[m:up=\E[A:us=\E[4m: sun-il|Sun Microsystems console with working insert-line:\ :am:km:ms:\ :co#80:li#34:\ :%7=\E[194z:&5=\E[193z:&8=\E[195z:@7=\E[220z:AL=\E[%dL:\ :DC=\E[%dP:DL=\E[%dM:F1=\E[234z:F2=\E[235z:IC=\E[%d@:\ :K2=\E[218z:al=\E[L:bl=^G:cd=\E[J:ce=\E[K:cl=^L:\ :cm=\E[%i%d;%dH:cr=^M:dc=\E[P:dl=\E[M:do=^J:ei=:ic=\E[@:im=:\ :k1=\E[224z:k2=\E[225z:k3=\E[226z:k4=\E[227z:k5=\E[228z:\ :k6=\E[229z:k7=\E[230z:k8=\E[231z:k9=\E[232z:k;=\E[233z:\ :kD=\177:kN=\E[222z:kP=\E[216z:kb=^H:kd=\E[B:kh=\E[214z:\ :kl=\E[D:kr=\E[C:ku=\E[A:le=^H:md=\E[1m:me=\E[m:mr=\E[7m:\ :nd=\E[C:r2=\E[s:\ :..sa=\E[0%?%p6%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;m:\ :se=\E[m:sf=^J:so=\E[7m:ta=^I:ue=\E[m:up=\E[A:us=\E[4m: sun-ss5|Sun SparcStation 5 console:\ :AL@:al@:tc=sun-il: sun|sun1|sun2|Sun Microsystems Inc. workstation console:\ :tc=sun-il: sun-s|Sun Microsystems Workstation window with status line:\ :hs:\ :ds=\E]l\E\:fs=\E\:ts=\E]l:tc=sun: sun-e-s|sun-s-e|Sun Microsystems Workstation with status hacked for emacs:\ :hs:\ :ds=\E]l\E\:fs=\E\:ts=\E]l:tc=sun-e: sun-48|Sun 48-line window:\ :co#80:li#48:tc=sun: sun-34|Sun 34-line window:\ :co#80:li#34:tc=sun: sun-24|Sun 24-line window:\ :co#80:li#24:tc=sun: sun-17|Sun 17-line window:\ :co#80:li#17:tc=sun: sun-12|Sun 12-line window:\ :co#80:li#12:tc=sun: sun-1|Sun 1-line window for sysline:\ :es:hs:\ :co#80:li#1:\ :ds=^L:fs=\E[K:ts=^M:tc=sun: sun-e|sun-nic|sune|Sun Microsystems Workstation without insert character:\ :ei@:ic@:im@:\ :tc=sun: sun-c|sun-cmd|Sun Microsystems Workstation console with scrollable history:\ :l# $Id: disktab,v 1.15 1997/05/24 10:05:14 johns Exp $ # # @(#)disktab 5.5 (Berkeley) 2/27/91 # # Disk geometry and partition layout tables. # Key: # ty type of disk # ns #sectors/track # nt #tracks/cylinder # nc #cylinders/disk # rm rpm, 3600 default # se sector size, 512 default # sf supports bad144-style bad sector forwarding # so partition offsets in sectors # p[a-p] partition sizes in sectors # b[a-p] partition block sizes in bytes # f[a-p] partition fragment sizes in bytes # miniroot:\ :ty=winchester:se#512:nt#2:rm#300:ns#64:nc#80:\ :ts=3500:\ :pa#10240:oa#0:ba#8192:fa#1024:ta=4.2BSD:\ :pb#0:ob#0:\ :pc#10240:oc#0: rdroot:\ :ty=ramdisk:se#512:nt#2:rm#300:ns#8:nc#1024:\ :pa#8192:oa#0:ta=4.2BSD:ba#8192:fa#1024: \ :pc#8192:oc#0: floppy|floppy3|3in|3.5in High Density Floppy:\ :ty=floppy:se#512:nt#2:rm#300:ns#18:nc#80:\ :pa#2880:oa#0:ba#4096:fa#512:ta=4.2BSD:\ :pb#2880:ob#0:\ :pc#2880:oc#0: # test if not having an 'a' works? fakecdrom|Fake image for Bootable CDROM:\ :ty=winchester:se#512:nt#1:rm#350:ns#640:nc#2048:\ :pa#1310720:oa#0:ba#8192:fa#1024:ta=4.2BSD:\ :pb#1310720:ob#0:bb#8192:fb#1024:tb=4.2BSD:\ :pc#1310720:oc#0:bc#8192:fc#1024:tc=4.2BSD:\ :pd#1310720:od#0:bd#8192:fd#1024:td=4.2BSD: ASI-1.0GIBM:\ :ty#winchester:ns#80:nt#15:nc#1632: Arte DEC DSP3160S:\ :ty#winchester:ns#112:nt#16:nc#1744: CDC 9720-850:\ :ty#XD7053:ns#66:nt#15:nc#1358: CDC EMD 9720:\ :ty#XD7053:ns#48:nt#10:nc#1147: CDC EMD 9720-1230:\ :ty#XD7053:ns#82:nt#15:nc#1633: CDC IPI 9720:\ :ty#ISP-80:ns#82:nt#15:nc#1631:\ :pa#33210:oa#0:ba#8192:\ :pb#131610:ob#33210:\ :pc#2006130:oc#0:\ :pg#196800:og#164820:\ :ph#1644510:oh#361620: CDC IPI 9722:\ :ty#ISP-80:ns#156:nt#7:nc#1630:\ :pa#33852:oa#0:ba#8192:\ :pb#132132:ob#33852:\ :pc#1779960:oc#0:\ :pg#197652:og#165984:\ :ph#1416324:oh#363636: CDC Wren IV 94171-344:\ :ty#winchester:ns#46:nt#9:nc#1545: CONNER 30170E:\ :ty#winchester:ns#46:nt#8:nc#897:\ :pa#14720:oa#0:ba#8192:\ :pb#40480:ob#14720:\ :pc#330096:oc#0:\ :pg#274896:og#55200: CONNER 30200:\ :ty#winchester:ns#49:nt#4:nc#2121:\ :pc#415716:oc#0: CONNER CFP4207S 4.28GB:\ :ty#winchester:ns#125:nt#20:nc#3353:\ :pc#8382500:oc#0: CONNER CP3500-540MB-3.5:\ :ty#winchester:ns#50:nt#12:nc#1768:\ :pc#1060800:oc#0: CP3100:\ :ty#winchester:ns#49:nt#4:nc#1023:\ :pc#204864:oc#0: Conner CFP1060:\ :ty#winchester:ns#111:nt#8:nc#2329: Conner CP3540:\ :ty#winchester:ns#49:nt#12:nc#1805: DEC DSP3107L:\ :ty#winchester:ns#83:nt#8:nc#3147:\ :pc#2089608:oc#0: DEC DSP3210 2 GB:\ :ty#winchester:ns#86:nt#16:nc#3040:\ :pc#4183040:oc#0: DEC DSP5200:\ :ty#winchester:ns#71:nt#21:nc#2619:\ :pa#32802:oa#0:ba#8192:\ :pb#65604:ob#32802:\ :pc#3904929:oc#0:\ :pg#3806523:og#98406: DEC DSP5350:\ :ty#winchester:ns#91:nt#25:nc#3053: DEC_RZ26:\ :ty#winchester:ns#57:nt#14:nc#2568:\ :pa#66234:oa#0:ba#8192:\ :pb#132468:ob#66234:\ :pc#2049264:oc#0:\ :pg#1850562:og#198702: DEC_RZ28:\ :ty#winchester:ns#84:nt#16:nc#3043:\ :pa#64512:oa#0:ba#8192:\ :pb#196224:ob#64512:\ :pc#4089792:oc#0:\ :pg#3827712:og#260736: DEC_RZ58:\ :ty#winchester:ns#85:nt#15:nc#2112: DEC_RZ58_whole_disk:\ :\ :pc#2692800:oc#0: DEC_RZ74:\ :ty#winchester:ns#91:nt#25:nc#3053:\ :pa#65975:oa#0:ba#8192:\ :pb#193375:ob#65975:\ :pc#4192825:oc#0:\ :pg#3931200:og#259350:\ :ph#2752750:oh#4192825: Fujitsu M2243AS:\ :ty#ACB4000:ns#17:nt#11:nc#752: Fujitsu M2246E:\ :ty#winchester:ns#35:nt#6:nc#1196:\ :pa#16170:oa#0:ba#8192:\ :pb#28140:ob#16170:\ :pc#251160:oc#0:\ :pg#206850:og#44310: Fujitsu M2263SA:\ :ty#winchester:ns#53:nt#15:nc#1652: Fujitsu M2266SA 1.2GB:\ :ty#winchester:ns#85:nt#15:nc#1652: Fujitsu M2266SA 1GB:\ :ty#winchester:ns#85:nt#15:nc#1642: Fujitsu M2344K:\ :ty#XD7053:ns#64:nt#27:nc#622: Fujitsu M2511A:\ :ty#winchester:ns#25:nt#1:nc#9950: Fujitsu M2512A small:\ :ty#winchester:ns#25:nt#1:nc#9950:\ :pc#248750:oc#0: Fujitsu M2512A v2:\ :ty#winchester:ns#25:nt#1:nc#17840:\ :pc#446000:oc#0: Fujitsu M2622SA:\ :ty#winchester:ns#64:nt#7:nc#1429:\ :pc#640192:oc#0: Fujitsu M2624FA:\ :ty#winchester:ns#64:nt#11:nc#1440:\ :pa#22528:oa#0:ba#8192:\ :pb#67584:ob#22528:\ :pc#1013760:oc#0:\ :pg#450560:og#90112:\ :ph#473088:oh#540672: Fujitsu M2652SA:\ :ty#winchester:ns#88:nt#20:nc#1935: Fujitsu M2654SA:\ :ty#winchester:ns#88:nt#21:nc#2174: Fujitsu M2684S:\ :ty#SCSI:ns#74:nt#6:nc#2338: Fujitsu-M2284/M2322:\ :ty#XY450:ns#32:nt#10:nc#821: Fujitsu-M2312K:\ :ty#XY450:ns#32:nt#7:nc#587: Fujitsu-M2333:\ :ty#XD7053:ns#67:nt#10:nc#821: Fujitsu-M2351 Eagle:\ :ty#XD7053:ns#46:nt#20:nc#840: Fujitsu-M2361 Eagle:\ :ty#XD7053:ns#67:nt#20:nc#840: Fujitsu-M2372K:\ :ty#XD7053:ns#67:nt#27:nc#743: Fujitsu-M2382:\ :ty#XD7053:ns#81:nt#27:nc#743:\ :pa#80919:oa#0:ba#8192:\ :pb#129033:ob#80919:\ :pc#1624941:oc#0:\ :pd#470205:od#209952:\ :pe#944784:oe#680157:\ :pf#209952:of#0:\ :pg#1414989:og#209952:\ :ph#1544022:oh#80919: Fujitsu-M2624S-512:\ :ty#winchester:ns#64:nt#11:nc#1429: Fujitsu-M2651SA:\ :ty#winchester:ns#88:nt#16:nc#1934:\ :pc#2723072:oc#0: Fujitsu-M2694ESA:\ :ty#winchester:ns#77:nt#15:nc#1830: HP 97549T:\ :ty#winchester:ns#64:nt#16:nc#1909: HP 97556:\ :ty#winchester:ns#72:nt#11:nc#1668: HP 97558:\ :ty#winchester:ns#72:nt#15:nc#1933: HP 97560:\ :ty#winchester:ns#72:nt#19:nc#1933: HP C2247 1.05GB:\ :ty#winchester:ns#95:nt#13:nc#1661:\ :pc#2051335:oc#0:\ :pg#1640080:og#0:\ :ph#411255:oh#1640080: HP C3010 / Cranel 2.0GB Fast SCSI2 H10:\ :ty#winchester:ns#95:nt#19:nc#2165: HP97548SU 664MB:\ :ty#winchester:ns#56:nt#16:nc#1445:\ :pa#35840:oa#0:ba#8192:\ :pb#71680:ob#35840:\ :pc#1294720:oc#0:\ :pg#197120:og#215040:\ :ph#342720:oh#609280: Hewlett Packard C2490A:\ :ty#winchester:ns#107:nt#18:nc#2159: Hewlett Packard C3323A:\ :ty#winchester:ns#98:nt#7:nc#2995: Hewlett Packard C3725S:\ :ty#winchester:ns#140:nt#9:nc#3362:\ :pc#4236120:oc#0:\ :ph#4193280:oh#1260: Hitachi DK315C-10:\ :ty#winchester:ns#75:nt#11:nc#2467: Hitachi DK315C-11:\ :ty#winchester:ns#58:nt#15:nc#2478: Hitachi DK315C-14:\ :ty#winchester:ns#75:nt#15:nc#2462: Hitachi DK326C-10:\ :ty#winchester:ns#87:nt#7:nc#3200: Hitachi DK326C-6:\ :ty#winchester:ns#87:nt#4:nc#3200: Hitachi DK515C-78:\ :ty#winchester:ns#69:nt#14:nc#1354: Hitachi DK516C-16:\ :ty#winchester:ns#80:nt#15:nc#2170: Hitachi DK517C-37:\ :ty#winchester:ns#81:nt#21:nc#3297: Hitachi DK815-10:\ :ty#XD7053:ns#67:nt#15:nc#1735: IBM 0662-S12:\ :ty#winchester:ns#114:nt#6:nc#3002: IBM 0662S12:\ :ty#winchester:ns#108:nt#5:nc#3803: IBM 0663-E15:\ :ty#winchester:ns#37:nt#20:nc#3182: IBM 0663L12:\ :ty#winchester:ns#66:nt#15:nc#1979:\ :pc#1959210:oc#0: IBM 0664-M1H/N1H:\ :ty#winchester:ns#86:nt#16:nc#2856: IBM 0664CSH:\ :ty#winchester:ns#125:nt#30:nc#2787: IBM 0664M1H:\ :ty#winchester:ns#94:nt#15:nc#2787: IBM DFHSS1x:\ :ty#winchester:ns#125:nt#4:nc#4383: IBM DFHSS2x:\ :ty#winchester:ns#125:nt#8:nc#4388: IBM DFHSS4x:\ :ty#winchester:ns#125:nt#16:nc#4390: IBM DPES-31080:\ :ty#winchester:ns#108:nt#4:nc#4901:\ :pc#2117232:oc#0: IBM DSAS-3270:\ :ty#winchester:ns#108:nt#2:nc#2542: IBM DSAS-3360:\ :ty#winchester:ns#108:nt#2:nc#3297: IBM DSAS-3540:\ :ty#winchester:ns#108:nt#3:nc#3259: IBM DSAS-3720:\ :ty#winchester:ns#108:nt#4:nc#3292: IBM OEM 0664M1H:\ :ty#winchester:ns#94:nt#15:nc#2787: IBM OEM DFHSS2F:\ :ty#winchester:ns#135:nt#8:nc#4076:\ :pa#4100760:oa#0:ba#8192:\ :pb#301320:ob#4100760: MAXOPTIX (NON-ISO, 1024b) DATA:\ :ty#winchester:ns#66:nt#1:nc#15104: MAXOPTIX (NON-ISO, 1024b) SYSTEM:\ :ty#winchester:ns#66:nt#1:nc#15104: MAXOPTIX (NON-ISO, 512b) DATA:\ :ty#winchester:ns#60:nt#1:nc#15081: MAXOPTIX (NON-ISO, 512b) SYSTEM:\ :ty#winchester:ns#60:nt#1:nc#15081: MICROP 4221-09MZ 10204:\ :ty#winchester:ns#139:nt#9:nc#3198:\ :pc#4000698:oc#0: MICROPOLIS 1991-27:\ :ty#winchester:ns#149:nt#27:nc#4400: MICROPOLIS 3243-19:\ :ty#winchester:ns#106:nt#19:nc#4139: MICROPOLIS 4110-09:\ :ty#winchester:ns#95:nt#9:nc#2283: Maxtor 7213SR NB:\ :ty#winchester:ns#65:nt#4:nc#1595:\ :pc#414700:oc#0:\ :pg#414700:og#0: Maxtor DXP3105S:\ :ty#winchester:ns#57:nt#14:nc#2568: Maxtor LXT-200S:\ :ty#winchester:ns#43:nt#7:nc#1117: Maxtor LXT-340SY:\ :ty#winchester:ns#70:nt#7:nc#1355: Maxtor LXT535ST:\ :ty#winchester:ns#61:nt#11:nc#1547:\ :pc#1038037:oc#0: Maxtor MXT1240S:\ :ty#winchester:ns#70:nt#15:nc#2306:\ :pc#2421300:oc#0:\ :pg#2421300:og#0: Maxtor P0-12S (1632):\ :ty#winchester:ns#90:nt#15:nc#1478:\ :pc#1995300:oc#0:\ :pg#1995300:og#0: Maxtor P0-12S (1795):\ :ty#winchester:ns#90:nt#15:nc#1510:\ :pc#2038500:oc#0:\ :pg#2038500:og#0: Maxtor P1-17S:\ :ty#winchester:ns#83:nt#19:nc#1816:\ :pa#78850:oa#0:ba#8192:\ :pb#78850:ob#78850:\ :pc#2863832:oc#0:\ :pd#78850:od#157700:\ :pg#2469582:og#236550:\ :ph#78850:oh#2706132: Maxtor P1-17S NB:\ :ty#winchester:ns#90:nt#19:nc#1711:\ :pc#2925810:oc#0:\ :pg#2925810:og#0: Maxtor XT-1050:\ :ty#ACB4000:ns#17:nt#5:nc#1020: Maxtor XT-3280S:\ :ty#winchester:ns#25:nt#15:nc#1222: Maxtor XT-4380S:\ :ty#winchester:ns#36:nt#15:nc#1202: Maxtor XT-8380S:\ :ty#winchester:ns#53:nt#8:nc#1626: Maxtor XT-8610E:\ :ty#winchester:ns#52:nt#12:nc#1626: Maxtor XT-8760E:\ :ty#winchester:ns#50:nt#15:nc#1616:\ :pa#97500:oa#0:ba#8192:\ :pb#63750:ob#658500:\ :pc#1212000:oc#0:\ :pd#280500:od#97500:\ :pe#280500:oe#378000:\ :pf#489750:of#722250:\ :pg#561000:og#97500:\ :ph#658500:oh#0: Maxtor XT-8760S:\ :ty#winchester:ns#54:nt#15:nc#1614: Micropolis 1304:\ :ty#ACB4000:ns#17:nt#6:nc#825: Micropolis 1325:\ :ty#ACB4000:ns#17:nt#8:nc#1022: Micropolis 1355:\ :ty#winchester:ns#34:nt#8:nc#1018: Micropolis 1528-15:\ :ty#winchester:ns#83:nt#15:nc#2102:\ :pa#32370:oa#0:ba#8192:\ :pb#64740:ob#32370:\ :pc#2616990:oc#0:\ :pg#2519880:og#97110: Micropolis 1548-15:\ :ty#winchester:ns#131:nt#15:nc#1701:\ :pa#33405:oa#0:ba#8192:\ :pb#66810:ob#33405:\ :pc#3342465:oc#0:\ :pg#3242250:og#100215: Micropolis 1558:\ :ty#winchester:ns#35:nt#15:nc#1218: Micropolis 1578-15:\ :ty#winchester:ns#35:nt#15:nc#1231:\ :pa#32550:oa#0:ba#8192:\ :pb#65100:ob#32550:\ :pc#646275:oc#0:\ :pg#548625:og#97650: Micropolis 1588-15:\ :ty#winchester:ns#53:nt#15:nc#1637:\ :pa#32595:oa#0:ba#8192:\ :pb#65190:ob#32595:\ :pc#1301415:oc#0:\ :pg#1203630:og#97785: Micropolis 1598-15:\ :ty#winchester:ns#70:nt#15:nc#1931:\ :pa#32550:oa#0:ba#8192:\ :pb#65100:ob#32550:\ :pc#2027550:oc#0:\ :pg#1929900:og#97650: Micropolis 1624-7:\ :ty#winchester:ns#114:nt#7:nc#1647:\ :pa#32718:oa#0:ba#8192:\ :pb#65436:ob#32718:\ :pc#1314306:oc#0:\ :pg#1216152:og#98154: Micropolis 1674-7:\ :ty#winchester:ns#35:nt#7:nc#1255:\ :pa#16415:oa#0:ba#8192:\ :pb#32830:ob#16415:\ :pc#307475:oc#0:\ :pg#258230:og#49245: Micropolis 1684-7:\ :ty#winchester:ns#53:nt#7:nc#1785:\ :pa#32648:oa#0:ba#8192:\ :pb#65296:ob#32648:\ :pc#662235:oc#0:\ :pg#564291:og#97944: Micropolis 1908-15:\ :ty#winchester:ns#95:nt#15:nc#1890:\ :pa#32775:oa#0:ba#8192:\ :pb#65550:ob#32775:\ :pc#2693250:oc#0:\ :pg#2594925:og#98325: Micropolis 1924-21:\ :ty#winchester:ns#94:nt#21:nc#2072:\ :pa#33558:oa#0:ba#8192:\ :pb#67116:ob#33558:\ :pc#4090128:oc#0:\ :pg#3989454:og#100674: Micropolis 1926-15:\ :ty#winchester:ns#101:nt#15:nc#2769:\ :pa#33330:oa#0:ba#8192:\ :pb#66660:ob#33330:\ :pc#4195035:oc#0:\ :pg#4095045:og#99990: Micropolis 1936-21:\ :ty#winchester:ns#101:nt#21:nc#2772:\ :pa#33936:oa#0:ba#8192:\ :pb#67872:ob#33936:\ :pc#5879412:oc#0:\ :pg#2846382:og#101808:\ :ph#2931222:oh#2948190: Micropolis 2105-8:\ :ty#winchester:ns#94:nt#8:nc#1448:\ :pa#32336:oa#0:ba#8192:\ :pb#64672:ob#32336:\ :pc#1088896:oc#0:\ :pg#991888:og#97008: Micropolis 2108-10:\ :ty#winchester:ns#94:nt#10:nc#1450:\ :pa#31960:oa#0:ba#8192:\ :pb#63920:ob#31960:\ :pc#1363000:oc#0:\ :pg#1267120:og#95880: Micropolis 2112-15:\ :ty#winchester:ns#94:nt#15:nc#1452:\ :pa#33840:oa#0:ba#8192:\ :pb#67680:ob#33840:\ :pc#2047320:oc#0:\ :pg#1945800:og#101520: Micropolis 2205-05:\ :ty#winchester:ns#109:nt#5:nc#2088:\ :pa#32700:oa#0:ba#8192:\ :pb#65400:ob#32700:\ :pc#1137960:oc#0:\ :pg#1039860:og#98100: Micropolis 2210-09:\ :ty#winchester:ns#109:nt#9:nc#2099:\ :pa#33354:oa#0:ba#8192:\ :pb#66708:ob#33354:\ :pc#2059119:oc#0:\ :pg#1959057:og#100062: Micropolis 2217-15:\ :ty#winchester:ns#109:nt#15:nc#2105:\ :pa#32700:oa#0:ba#8192:\ :pb#65400:ob#32700:\ :pc#3441675:oc#0:\ :pg#3343575:og#98100: Micropolis 4110:\ :ty#winchester:ns#114:nt#9:nc#1998: Micropolis 4221:\ :ty#winchester:ns#109:nt#9:nc#4079:\ :pa#4001499:oa#0:ba#8192:\ :pc#4001499:oc#0: NEC D2363:\ :ty#XD7053:ns#67:nt#27:nc#964: NEC-D2352:\ :ty#XD7053:ns#57:nt#19:nc#758: Quantum ELS 127S:\ :ty#winchester:ns#54:nt#3:nc#1541: Quantum ELS 170S:\ :ty#winchester:ns#54:nt#4:nc#1542: Quantum ELS 85S:\ :ty#winchester:ns#54:nt#2:nc#1535: Quantum Empire 540S:\ :ty#winchester:ns#92:nt#8:nc#1431: Quantum Empire 1080S:\ :ty#winchester:ns#92:nt#16:nc#1431: Quantum Empire 2100S:\ :ty#winchester:ns#137:nt#12:nc#2497:\ :pc#4105068:oc#0: Quantum GoDrive 120S:\ :ty#winchester:ns#56:nt#4:nc#1067: Quantum GoDrive 160S:\ :ty#winchester:ns#58:nt#4:nc#1413: Quantum LPS 105S:\ :ty#winchester:ns#42:nt#4:nc#1221: Quantum LPS 120S:\ :ty#winchester:ns#60:nt#2:nc#1987: Quantum LPS 240S:\ :ty#winchester:ns#60:nt#4:nc#1995: Quantum LPS 270S:\ :ty#winchester:ns#76:nt#7:nc#992: Quantum LPS 525S:\ :ty#winchester:ns#70:nt#6:nc#2444: Quantum LPS 540S:\ :ty#winchester:ns#125:nt#4:nc#2113: Quantum Lightning 730S:\ :ty#winchester:ns#63:nt#16:nc#1415:\ :pa#161280:oa#0:ba#8192:\ :pb#96768:ob#161280:\ :pc#1426320:oc#0:\ :pg#1168272:og#258048: Quantum PD 80S:\ :ty#winchester:ns#34:nt#6:nc#832: Quantum PD 120S:\ :ty#winchester:ns#42:nt#5:nc#1114: Quantum PD 170S:\ :ty#winchester:ns#42:nt#7:nc#1117: Quantum PD 210S:\ :ty#winchester:ns#49:nt#7:nc#1189: Quantum PD 425S:\ :ty#winchester:ns#60:nt#9:nc#1540: Quantum PD 700S:\ :ty#winchester:ns#70:nt#8:nc#2441: Quantum PD 1050iS:\ :ty#winchester:ns#92:nt#12:nc#1859:\ :pc#2052336:oc#0: Quantum PD 1050S:\ :ty#winchester:ns#70:nt#12:nc#2444: Quantum PD 1225S:\ :ty#winchester:ns#70:nt#14:nc#2442: Quantum XP32150:\ :ty#winchester:ns#109:nt#10:nc#3850: Quantum XP34301:\ :ty#winchester:ns#118:nt#20:nc#3561: Quantum XP34300W:\ :ty#winchester:ns#107:nt#20:nc#3907: RICOH RO-5031E:\ :ty#winchester:ns#54:nt#15:nc#710:\ :pc#575100:oc#0: RZ24:\ :ty#winchester:ns#38:nt#8:nc#1344:\ :pc#409792:oc#0: RZ55:\ :ty#winchester:ns#35:nt#15:nc#1218:\ :pa#32025:oa#0:ba#8192:\ :pb#59850:ob#32025:\ :pc#639450:oc#0:\ :pg#547575:og#91875: SEAGATE ST11950N:\ :ty#winchester:ns#81:nt#15:nc#2715:\ :pc#3298725:oc#0: SEAGATE ST15230N:\ :ty#winchester:ns#111:nt#19:nc#3974: SEAGATE ST31200N:\ :ty#winchester:ns#85:nt#9:nc#2692: SEAGATE ST31230N:\ :ty#winchester:ns#104:nt#5:nc#3978:\ :pc#2068560:oc#0: SEAGATE ST32550N:\ :ty#winchester:ns#109:nt#11:nc#3495:\ :pc#4190505:oc#0: SEAGATE ST3600N:\ :ty#winchester:ns#79:nt#7:nc#1853:\ :pc#1024709:oc#0: ST83220K:\ :ty#"ISP-80":ns#102:nt#19:nc#2652: SUN0104:\ :ty#winchester:ns#35:nt#6:nc#974: SUN0121:\ :ty#winchester:ns#39:nt#4:nc#1520: SUN0207:\ :ty#winchester:ns#36:nt#9:nc#1254: SUN0327:\ :ty#winchester:ns#46:nt#9:nc#1545: SUN0424:\ :ty#winchester:ns#80:nt#9:nc#1151: SUN0535:\ :ty#winchester:ns#80:nt#7:nc#1866: SUN0669:\ :ty#winchester:ns#54:nt#15:nc#1614: SUN1.3G:\ :ty#winchester:ns#80:nt#17:nc#1965: SUN2.1G:\ :ty#winchester:ns#80:nt#19:nc#2733: Sabre ST82500J:\ :ty#XD7053:ns#82:nt#19:nc#2609: Seagate (CDC) Wren V 94181-702:\ :ty#winchester:ns#48:nt#15:nc#1543: Seagate (CDC) Wren VI 94191-766:\ :ty#winchester:ns#52:nt#15:nc#1659: Seagate (CDC) Wren VII 94601-1.2G SunOS 4.1.1:\ :ty#winchester:ns#70:nt#15:nc#1925: Seagate (CDC) Wren VII 94601-15:\ :ty#winchester:ns#71:nt#15:nc#1905: Seagate (CDC) Wren VIII ST41650N:\ :ty#winchester:ns#89:nt#15:nc#2070: Seagate Elite ST43400N-3.5G:\ :ty#winchester:ns#99:nt#21:nc#2736:\ :pa#2843360:oa#0:ba#8192:\ :pb#2843360:ob#2841993: Seagate IPI ZBR Elite:\ :ty#"ISP-80":ns#78:nt#17:nc#1893:\ :pa#34476:oa#0:ba#8192:\ :pb#132600:ob#34476:\ :pc#2510118:oc#0:\ :pg#663000:og#167076:\ :ph#1680042:oh#830076: Seagate ST11200N:\ :ty#winchester:ns#80:nt#15:nc#1714:\ :pa#2056800:oa#0:ba#8192:\ :pc#2056800:oc#0: Seagate ST11900N:\ :ty#winches# $OpenBSD: dot.profile,v 1.4 1997/05/25 22:56:41 grr Exp $ # $NetBSD: dot.profile,v 1.1 1995/12/18 22:54:43 pk Exp $ # # Copyright (c) 1995 Jason R. Thorpe # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by Christopher G. Demetriou. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH umask 022 # XXX # the TERM/EDITOR stuff is really well enough parameterized to be moved # into install.sub where it could use the routines there and be invoked # from the various (semi) MI install and upgrade scripts # terminals believed to be in termcap, default TERM TERMS="sun vt* pcvt* pc3 dumb" TERM=sun # editors believed to be in $EDITBIN, smart and dumb defaults EDITORS="vi ed" EDITOR=vi DUMB=ed EDITBIN=/bin EDITUBIN=/usr/bin if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES # mount kernfs and re-mount the boot media (perhaps r/w) mount_kernfs /kern /kern mount_ffs -o update /dev/rd0a / # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? 9600 # get the terminal type _forceloop="" while [ "X$_forceloop" = X"" ]; do echo "Supported terminals are: $TERMS" eval `tset -s -m ":?$TERM"` if [ "X$TERM" != X"unknown" ]; then _forceloop="done" fi done export TERM # get the editor preference if [ "X$TERM" = "Xdumb" -o "X$TERM" = "Xunknown" ]; then echo -n "$TERM can't handle $EDITOR" EDITOR="$DUMB" echo ", using $EDITOR as text editor!" elif [ "X$EDITOR" = "X$EDITORS" ]; then echo "Only one editor available, you get to use $EDITOR!" else _forceloop="" while [ "X$_forceloop" = X"" ]; do echo "Supported editors are: $EDITORS" echo -n "text editor? [$EDITOR] " read _choice if [ "X$_choice" = "X" ]; then _choice="$EDITOR" _forceloop="$_choice" else for _editor in $EDITORS; do if [ "X$_choice" = "X$_editor" ]; then _forceloop="$_choice" break fi done fi if [ "X$_forceloop" != "X" -a \ ! \( -x $EDITBIN/$_choice -o \ -x $EDITUBIN/$_choice \) ]; then _forceloop="" fi if [ "X$_forceloop" = "X" ]; then echo "Sorry, $_choice isn't available." _forceloop="" fi done EDITOR="$_choice" fi export EDITOR # Installing or upgrading? _forceloop="" while [ "X$_forceloop" = X"" ]; do echo -n '(I)nstall or (U)pgrade? ' read _forceloop case "$_forceloop" in i*|I*) /install ;; u*|U*) /upgrade ;; *) _forceloop="" ;; esac done fi ongratulations_1 } # $OpenBSD: install.md,v 1.12 1997/05/22 17:01:23 johns Exp $ # $NetBSD: install.md,v 1.3.2.5 1996/08/26 15:45:28 gwr Exp $ # # # Copyright (c) 1996 The NetBSD Foundation, Inc. # All rights reserved. # # This code is derived from software contributed to The NetBSD Foundation # by Jason R. Thorpe. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by the NetBSD # Foundation, Inc. and its contributors. # 4. Neither the name of The NetBSD Foundation nor the names of its # contributors may be used to endorse or promote products derived # from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE NETBSD FOUNDATION, INC. AND CONTRIBUTORS # ``AS IS'' AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED # TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR # PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE REGENTS OR CONTRIBUTORS BE # LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR # CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF # SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS # INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN # CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) # ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE # POSSIBILITY OF SUCH DAMAGE. # # # machine dependent section of installation/upgrade script. # # Machine-dependent install sets MDSETS="xbin xman xinc xcon" MSGBUF=/kern/msgbuf HOSTNAME=/kern/hostname # an alias for hostname(1) hostname() { if [ -x /bin/hostname ]; then /bin/hostname $1 else if [ -z "$1" ]; then cat $HOSTNAME else echo $1 > $HOSTNAME fi fi } md_set_term() { if [ ! -z "$TERM" ]; then return fi echo -n "Specify terminal type [sun]: " getresp "sun" TERM="$resp" export TERM } md_makerootwritable() { # Was: do_mfs_mount "/tmp" "2048" # /tmp is the mount point # 2048 is the size in DEV_BIZE blocks if [ ! -w /tmp ]; then umount /tmp > /dev/null 2>&1 if ! mount_mfs -s 2048 swap /tmp ; then cat << \__mfs_failed_1 FATAL ERROR: Can't mount the memory filesystem. __mfs_failed_1 exit fi # Bleh. Give mount_mfs a chance to DTRT. sleep 2 fi } md_machine_arch() { cat /kern/machine } md_get_diskdevs() { # return available disk devices # dmesg | egrep "(^sd[0-9] |^x[dy][0-9] )" | cut -d" " -f1 | sort -u sed -n -e '1,/^OpenBSD /d' -e '/^sd[0-9] /{s/ .*//;p;}' \ -e '/^x[dy][0-9] /{s/ .*//;p;}' < $MSGBUF } md_get_cddevs() { # return available CDROM devices # dmesg | grep "^cd[0-9] " | cut -d" " -f1 | sort -u sed -n -e '1,/^OpenBSD /d' -e '/^cd[0-9] /{s/ .*//;p;}' < $MSGBUF } md_get_ifdevs() { # return available network devices # dmesg | egrep "(^le[0-9] |^ie[0-9] )" | cut -d" " -f1 | sort -u sed -n -e '1,/^OpenBSD /d' -e '/^le[0-9] /{s/ .*//;p;}'< $MSGBUF } md_get_partition_range() { # return range of valid partition letters echo "[a-p]" } md_installboot() { echo "Installing boot block..." /usr/mdec/binstall ffs /mnt } md_native_fstype() { } md_native_fsopts() { } md_checkfordisklabel() { # $1 is the disk to check local rval disklabel $1 > /dev/null 2> /tmp/checkfordisklabel if grep "no disk label" /tmp/checkfordisklabel; then rval=1 elif grep "disk label corrupted" /tmp/checkfordisklabel; then rval=2 else rval=0 fi rm -f /tmp/checkfordisklabel return $rval } md_prep_disklabel() { local _disk _disk=$1 md_checkfordisklabel $_disk case $? in 0) echo -n "Do you wish to edit the disklabel on $_disk? [y]" ;; 1) echo "WARNING: Disk $_disk has no label" echo -n "Do you want to create one with the disklabel editor? [y]" ;; 2) echo "WARNING: Label on disk $_disk is corrupted" echo -n "Do you want to try and repair the damage using the disklabel editor? [y]" ;; esac getresp "y" case "$resp" in y*|Y*) ;; *) return ;; esac # display example cat << \__md_prep_disklabel_1 Here is an example of what the partition information will look like once you have entered the disklabel editor. Disk partition sizes and offsets are in sector (most likely 512 bytes) units. Make sure these size/offset pairs are on cylinder boundaries (the number of sector per cylinder is given in the `sectors/cylinder' entry. If this disk is previously un-labeled, only the "c" partition will show up in the editor and you will have to enter lines similar to those shown in the example for the other paritions. If you are uncertain about the syntax or space requirements, this is a good time to review the installation notes. Do not change any parameters except the partition layout and the label name. It's probably also wisest not to touch the `16 partitions:' line, even in case you have defined less than sixteen partitions. [** EXAMPLE **] disk: p4200s bytes/sector: 512 sectors/track: 40 tracks/cylinder: 8 sectors/cylinder: 320 cylinders: 1280 total sectors: 409600 16 partitions: # size offset fstype [fsize bsize cpg] a: 51200 0 4.2BSD 1024 8192 16 # (Cyl. 0 - 159) b: 51200 51200 swap # (Cyl. 160 - 319) c: 409600 0 unused 0 0 # (Cyl. 0 - 1279) d: 307200 102400 4.2BSD 1024 8192 16 # (Cyl. 320 - 1279) [End of **EXAMPLE**] __md_prep_disklabel_1 echo -n "Press [Enter] to continue " getresp "" disklabel -W ${_disk} disklabel -e ${_disk} } md_copy_kernel() { echo -n "Copying kernel..." cp -p /bsd /mnt/bsd echo "done." } md_welcome_banner() { { if [ "$MODE" = "install" ]; then echo "" echo "Welcome to the OpenBSD/sparc ${VERSION} installation program." cat << \__welcome_banner_1 This program is designed to help you put OpenBSD on your disk, in a simple and rational way. You'll be asked several questions, and it would probably be useful to have your disk's hardware manual, the installation notes, and a calculator handy. __welcome_banner_1 else echo "" echo "Welcome to the OpenBSD/sparc ${VERSION} upgrade program." cat << \__welcome_banner_2 This program is designed to help you upgrade your OpenBSD system in a simple and rational way. As a reminder, installing the `etc' binary set is NOT recommended. Once the rest of your system has been upgraded, you should manually merge any changes to files in the `etc' set into those files which already exist on your system. __welcome_banner_2 fi cat << \__welcome_banner_3 As with anything which modifies your disk's contents, this program can cause SIGNIFICANT data loss, and you are advised to make sure your data is backed up before beginning the installation process. Default answers are displayed in brackets after the questions. You can hit Control-C at any time to quit, but if you do so at a prompt, you may have to hit return. Also, quitting in the middle of installation may leave your system in an inconsistent state. __welcome_banner_3 } | more } md_not_going_to_install() { cat << \__not_going_to_install_1 OK, then. Enter `halt' at the prompt to halt the machine. Once the machine has halted, power-cycle the system to load new boot code. __not_going_to_install_1 } md_congrats() { local what; if [ "$MODE" = "install" ]; then what="installed"; else what="upgraded"; fi cat << __congratulations_1 CONGRATULATIONS! You have successfully $what OpenBSD! To boot the installed system, enter halt at the command prompt. Once the system has halted, reset the machine and boot from the disk. __chX4 `@# ` & " $@` `T@ $!` &`@ג"@H*/+ # %"a  0  ""h #""t * #""l!` #""p@>> OpenBSD BOOT [%s] /bsddevice[%s]: boot: open: %s: %s Booting %s @ 0x%x 㿘@@h ## @"S  %#` L@ % % !% %+ %/ %- %Xt  b@";!@M㰀 2%b @"2! @MX 2@W   %@" a(@"t $t !8@"@@BBad format %d+%d+[%d+%d]=0x%x boot: short read x%@ < ?@ ?# @!2?3 a/?@ ?# @!% a!?@ ?# @!  a ?@ ?# @ 2   `"  " @!"?@ ?# @! "` a ` @܀ 2 @?@?# @! a ?@ ?# @!" a  @" .@`@2.@ "@!p@\ 2k @@!d  .@  `耢 B .@.`.` ".`@!H`@4耢 2C @# %`@)  9 `.@ .` .` .``䀤   ?`@2$ @ "@! %` ?> "H "@!@ Đ #"h  %!   % #HĀb00"@   promprom0㿘 #"h  %@ %! (* % %"" $@!` %"cK` -  %* K   %# J  8*   $ap"K  *K ) K  * %!` ` %"#@ `&J@ -" @ % % *:  d` d s atJ@t J@  t#cL @"tJ@  @Can't open device `%s' Can't open network device `%s' 㿘@2  #bh ` @ !D$`  ! %!`  %"`"`$@2$@   |$`   $`  %" @ 4 04% %@ $`&` 2! % %  #c@  @s @ !0  #cx@   #c@  # "c # #bh`"| $$ 㿘# %a   ` ༟* `a   '@`20,6 * '@ 㿘  @& & $& (`   €@ " '@ 㿘 ` @@   %!` (`(`@0@ 㿘   @ @ & ? $ $"*@ 㿘 %!  4㿘 %!  8` @xmit: not a network device 㿘 `,  @V!(?@o`@w`?㿘  ,@Y €@b㿐 %`  !  !O`P/O O /O㿘㿐 %!     O ?X/O O /O㿐 %!  / 0T@㿘  㿘 %! t㿘@ #@b㿐 %!    %X %! p%x mac-address drop swap 6 cmoveX #"h # % $ a  a  Њ@*@` $ !.@! .` .` .` .` .`a` `€0  `@_a |@ielefdxyxdstsddevice_typeblocknetworkbyte㿘 %!` ! #`@ @XaX @ [ah '  @ Sap   @ Kax   "`"N@J2N`J@" 2 node %x property %s length %d > %d 㿘 %! `€  `  "x@ 㿘 $aޖ ??" *Invalid controller number prom_iopen: "%s" error=%d 㿘) $"쀢 ?D   @ %"x @4 8$ $  $ $`  @#H* @ *`@`@F $0` "`@$4` " @f$ @ & "  %"@#h 㿘# $b쀢    @ 4 "$b@ & 4$bprom_mapin: length=%d prom_mapin: invalid maptype %d 㿘 #"l* @ !@ؒ ##d   #"      @Ð!     ##h #"l< #"t@;@ ?*@Ԣ &@ ` #"p ##h @ % $ ?( , H L\ T ` X` P d l  t$ p  $ *?  #hĈ`Ī` Đ`IJ`  dvma_mapin㿘? #@(1? @\# 1?dvma_mapout㿘 #@(1 @J#h1㿘@ " ْ㿘 @㿘 $"  @  # "cp % "@0 $b "b㿘 $b ? "b #@{#pboot: client IP address: %s boot: client name: %s rootroot addr=%s path=%s 㿐' #@ $p?7 &!  0 @'@]@ p ) %   $@Scp `# %a` $@ V  %! a` @'@=a`p@'  %  %"Ё 2  %"؁㿘 %"   % @  $"" $ v   "bа?  %  ? % 㿘 ;  < 㿘  #b @ 5(  " ?$Revision: 1.4 $ # x  %c㿘 '  "    "& %        @#%,@ @㨢ڰ? @㨰?0Ф     @#0Ő#@~,@`" " H";j" &."  v" 㿘 2  `?. &   &  @"  6 & @@6  ?@2@ @ ?   @@q&㿐`@? `2  ?7 x 8"  #’cؐ   @)  @\ XH   @ '@+'  @5ک x @/  ) 1  :1#V /@  / 7    ۘ@ (@  /`7` @0os"@ @)  (`0`  @=_# @/Ȗ  ) 1  "* /@  / 7  * "@ (@  /`7` @?Q!@ @)  (`0`  @`& ؘ @/  ) 1  "=# /@ܖ  / 7  ?֘#@ (@  /`7` @"W5#@ @)  (`0`  @!" @/  ) 1  ?f! /@  / 7  )P#@ 8  /`7` @m !@ @8'  (`0`  @=!b @@ bQ@  ) 1  0,#@  @' / 7  ) @ /`7` @:mc@ @/ @ (`0`  @5Ě`] @/@ @ ) 1  `S (@ @ / 7  6(yb@ ) @ /`7` @9cȚ@ @/Ȗ @ (`0`  @xsa @/@ܖ @ ) 1  0c֚ (@ @ / 7  =5Ca@ ) @ /`7` @V`@ @/ @ (`0`  @*xa @/@ @ ) 1  ?;c (@ @ / 7  bٚ@ ) @ /`7` @#J`@ @/ @ (`0`  @?!B @ ) 1  !}"  / 7  gX!"@  /`7` @?yN @ @ (`0`  @)/"D @ ) 1  # Ȗ / 7  =Ҙ#`@  /`7` @/ p@ @ (`0`  @ &ߘ"Ƙ @ ) 1  :I#  / 7  5;̘ @  /`7` @"!@ @ (`0`  @6u4 9 @ܖ ) 1  9!  / 7  蟘 @  /`7` @1+"e@ @ (`0`  @= H"D 0@@  ) 1  ʿ# 1@  / 7  *#@ 7  /`7` @?$ 9@ 7@  (`0`  @V֘!Ø 0@@  ) 1  #3  1@  / 7  ? }@ 7  /`7` @!a!ј@ 7@  (`0`  @"O 0@@  ) 1  ?9" 1@  / 7  (P#@ 7  /`7` @!@ 7@  (`0`  @=ߘ" 0@Ȗ@  ) 1  /N"5 1@  / 7   "@ 7  /`7` @:ᴘ#@ 7@ܖ  (`0`  @ & &  @& @;&  @*@0* @*  @ * `    ` @ `(*  `(#   `  @* * @ * ** 㿐@a㿘@W   *  @ *   "@ @b  88  b   㿘  `  `  @4 0%@/  & &@*&& @@ "   ` 㿘?c @ 6 @o6` `B  & $ @*&@$@@W@S2  *   , "@@ 4 "  "  ,`@@ 4`   ,@@ 4  @@*  㿐  `  ` @` ?2   2@  *2  ?*@   *  2@*@  㿘  `  ` @1  `  &  4 @ *    ?: : 2@  *:  ?*@   *  2@*@    B 'D'H'L'P'T'X@@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"&  @@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   & &  /*# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@#  # # # # # # # # # # # # #@+ 3`@; ) @  ` (  2 "" 2     * " @@ @   `@ @ "`" ?* ?*  @(`  (02 @  "J@J`2J@  J " @(` @ *  J@   J@J`  H" @ J2  @*`  `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2*2J@  "  J@J`   8  *  8  *  4  &  4  & @'Ā  $ @  /-? 耦 Ā 2;  0ؘ'7477477477ܑ477`A ڸ? 28```@@`*  @@ `*  @@`*  @Ā  @Ĕ ;--`2 @- ,`ˑ2 @ ĺ` `"` '``? '8  . ?2 ? '`" * #@'.`@ '  @`@?  ``'7@, @7@@͒,  ( ?#   . ?@, @@ "@"@4@6`#?# "6` 5 . * @? @ @ 4@6`5`5 @  Ā '   " . ? * :@ @2. 4@đ*  *`@;Α*  Г*`@ +     ( 8 2+ ( 2@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"  /)# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@&@# # # # # # # # # # # # #@+ 3`@bootparamd: 'whoami' call failed bp_whoami: short reply, %d < %d p41a"'А ''ؐ 'ܐ' &`0ТX@' 2R??$ab  $`H ?#`H2 !#\#`@ ?#@   @. 6?# $c! %@ #Z c4#@ '\ ` !@?' % "ܐ $c@z ? %"P %``@pP ? $@c`  ǐ4'' $c %@E 2@?@< 27?ab $ `H $?2 #`H㌘"#\"#` @Κ#@ 4' % H"b? '@$ 2?@E 2 ?#'@` 㿘`&"@  &@ 㿘 &   ? @&@m.@& @"  #d d  e  f g #" ?+d +e+f+gd "@#rarp: bad socket. %d No response for RARP request  !h@>H? @ . 7Ɛ(7Ȑ /ʐ /ː 7` 7`#7`~7`7 `b7`7ܖ 4#\@ ؖ .  @!? &2`0`02 `0 @ 0 $ ? @  $??"aX & 0 $`㿘 $ @  5㿐@  %"bЀ  5@2?@ 2?`(2?`&2?`   ?`@$  ?p  @+ 8 'pt@  , #\ $#`ab   @`?  % H "b؀` %@ s  ""а?㽠P  @ x 'P 'T 'X '\ '` $'d ('h ,p'l 8 t@ L 'p ab  h `$#\#`@\ ?  %"x  |&&&&& 0&$&( D@ &, 㺈 ? ?a b?  (`? #\$#`@$ ?  %"`   d 'd@ hd .@ ?nfsread: short packet, %d < %ld 0 ' ' ' ' ' $' ($' ,''$''ab  ,#\$L#`@ܖ ? L `P %""В?@T@ 0  "@  % H"bа?㿘@2& % "b $`H"`H6  %` 2 ?& &` !&`$&`( ?nfs_open: must mount first. 㷈 %` ` @ ~  N n`/2N N /" N ` 0 \ @1 x   $<N   /   I  N  /.Ɣ>.0 .29 %>; $) `` &`;@ @ O /@ x@ x @ x N  ` %&`  耤@ x@ x㿘  "& @ x&  nfs_read: hit EOF unexpectantly㿘' # %! %% @    ݖ? b  #L @ Đ ; @  & B> 2&       D": 0 0   @  :  ` : ??0   $0 4(2`82` <"` @ "`D :`0  @ ` J@(8(8    `J/`? `2> ` `!JJ@ 2+  `J2# &  J@;. .2J`;  `J@;"Є <` CD001㿐 (@( # @  - `(``(F b` @ Y   ꀢ   * @h… * *` *   *  *` * h @ʒ(g 8@@  - ```   ` `  `* *` * ` ` M`: @:7?L  *  / 2  !   @ ` *  **`    L  *  " M  ! M ̀?  g2 @ @  - `(``R(  gh 8  * *`  *   @ @@ ̀g@) @  @  &`  >   *@ * @ *@ &   * +   *  :@>  @ @㿘  @&  㷐 Y U@4 @N@I (O g  `2@  ,`(`)􀢨$ 2h g8' w" @ '@   B<& hB <2&     ":0 " 0  @  : ` :??0  $2`"`"`  :`0 㿐` 0@0@ <ฐ ,@  Y x``* d `  0, 200@"x < *` @  ? " ? 6" ?% 0@㿘 ` `.` 8 U& `@&@`,D B @< h "8&` ` @0$`@  ` ``d@  0, 2`0@ր$` ``T,ʬ& 㿐  `Pe8P @  4`0*:  8  2`0 8 `0e8e@ `L  Ȁ)x 2; @T`0$  " @ [ `d   +   0 @$ $  $&@&   b 8   @  "@ & 㿐`Q  `<@@ 3 2:@ "  2  F  2  &*@ B`<@@@8Ӑ@2 ``@ː 㻀  @Ґ Ц @v &`@@ $  ```찒`@2 %\F!T@  0@@eg`0 @i   t`$ `  'b`L@  @7<`/2L@`L@ /"`L@"s   Ԓ  / ``4e `L@  /,@K谒X,@.S`(  2HL@ $D  A`;@b%(`8@= 0 S䰒)`@ A` 0`  d( @<O /' '`L@  @ `  0@7 @1@. Ё㿘 `&   " ` 0@    `` 0@ `@@  Ё 㿐 %`@@8 ``@B@ղ@@ B<@2&     ":0 " 0  @  : ` :??0 2`"` "` :`0㿐`   =<@`@@8@2.@``@.@.?,   " #" @ @ B <@  O @ B<@ 㿘  *  `&  %L?&  &%P%, %  0 :* * :>%0   t  Օ; %0 B >%0 H8  ;  L>%88  ; >%@ $@ @?@ * @:@ @?  $`D "`D" @  "@ $@"?? @callrpc: error = %d 㿐\`@?: 4 '?'??@_  '?ܐ '?'?Ȑ '?'?'?'?ز@ a? % # '?Ė&#\ " @ ?  %` @` &@" % H"bа?recvrpc: reject, astat=%d, errno=%d 㿘! %$"А@˖  %@ @2?``2 ?`` ` #@$"а??"@?2 % %h(  ? ?    ? %" #""#"( %h    getport: %s㾐a"@2 o'?' ''''p#\ #`  5   p'0 # %b! @!@ H$bа?㿐 .  & 8   % ."b"'@   (0  8   ` % "b  B<   % "b&?㿐  & 8 " `    % >"b$$ $ 'X22$`  ) "`J 2 #`#$@ $ c̀@  %   @€#̤``"   @$ %""а?bad adaptor numberbad controller numberbad drive numberbad partitioncan't read disk labelunlabeledDevice not configuredOperation not permittedNo such file or directoryStale NFS file handleInappropriate file type or formatExec format errorInput/output errorUnknown error: code %d㿘`V "4*`@4w4w4x,4x,4x 4w4x,4x4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4x,4w4x,4x,4x,4x,4x,4x,4x,4x,4x4x,4x,4w4w4w4w4w4w1 , 1 ) 1 & 1 # 1  !1 ! 1 !01 !H1 !`1 !1 !1  !1 !1 $# @a㿘i  ,  ". 0.".,.&   ""#..圐 0?喐 唐 咐 0叐 @͠L  0Ű傐 0 0sendudp: bad write (%d != %d)x @  . .<* @*@@ &6 & @&6 6 66''' ' @'@66&&&&&`  $!X  @ @ $ c@ 'ܖ@(@? !p@ereadudp: huge packet, udp len %ld x@ް?~ {ހ( (ꀢ u?@sp?2n?<  2g?퀢 2c?2 <]@u 2Y?怦&U?`` 2M? @|& 4  "` @2>? 6 % #@@~1?' ' '  '  @'@74  $$ $ $ ?$ $$ $ $ $  ??sendrecv: short write! (%d < %d)㿘   ) % <\q-  %"(?@@@, 4 2 "Ѐ   F$@$Ӧ`l     *  (Ї8*`J. 64 "2/?`"8" ?#   `(?`d((  `dh(* ( ?#㿘@㿘1 $#X.  .?   0.L ?  0.B  0?.?.`4  "@ ((*8"@ Є (@㿐 "< N -N $*` .! ؒ?*` @N  . ɒ?#*` @N  .   J @?    `&     ,` ` `  (  `߀` ܗ(2 :?# :* arpwhohas: overflowed arp_list! arp: no response for %s   $ P@ $ @ 'l@@C`@ ` 3 $`  &` @Ґ"ȠƐ @E . 7Ɛ(7Ȑ /ʐ /7 l7 n7 7 ! `7 777 ! l~$@ 4#\j .? lh! "'h@  `4```4` &`4`㿘 $@(㿐@ %"bЀ(2(?@ 2$?`(2 ?`&2?`  @?2?` $` *` * $`P@ ?㿘@ /`(+`&'` # `@   `6`` `6`6`` 6``6`6` 6` (6`  6`  2`  .2`@"`@@    @*0    @*`㿘 6 6 6......6? ??㿘?  @-    $`@&  "` ?` ?7 $`  $ : `0 `(   ((( $#`" @ `  ?  2 @ 2( 㿘'H'L'P'T $cx 'X @"cx@|H "@l exit㿘 "! 㿘  & 8 @ " @   ` 㿘  .  & 8   % $"b2  " @  `  ` @`$ %""Ѐ % ""а? $` *@㿘'L'P'T'X! $$# ""`@L#*㿘'H'L'P'T'X #T@ H㿘 #T@8 "#l `N@`%` N@ `* 4444|4|4|4|4|4|4|44|4|44H4|4|44|4(4|4|4\ L@t `ϒ L?,@` < ,L L  LL 4 L  ` >0 `L` L` N@` - @1 N@@) N@@! ~N@ 0 x @ qN@ % i le0123456789abcdef㿈 #!J @, ?L?|/-\㿘 $`" ` #"(AJ@? 44 l44 4444 44 44P4H4@48404(4    4f4j4j4kH4kP4k4Zh4^4^4`t4`|4`4T4V4W84W4W4X|4x@` 40123456789abcdef/4= 4:44p'4sp-4,94:@4KU[4b 4j44ou424B4y444O4742P4044 (4  4,4J" 42 4:B4GH4EpNX41b 4lv4 414L84X44;x4p4 44,4 4;( 4t4~ (4:04:84G4{dP4TZ4e4xn4+x 44@44844V444 4 4204^'/ 4X7=4q0P41@[4Ri 4`u4Lt4k4T44:4p4P 44R)24x=4W8G4:pPX 4c4s4W}4 4 44S4`t44X|404M 44 4`"41: 4hI4U4H_4 |i4js 4|4kP44 4v44 444@ 444k4 l 4<4M,64f@4 PW4X`4=k4|q4n{4x 4p44 4t 4x4  444W44Zh4L/4`7 4?H4I4S]4he4`r4t{ 44/`4H44<4<4^44$440x4`|4,&404974,F4hM 4U4;\4,f4py4X449X444t4rx4,04P4p4kH 4  4  ' 4 0 4H 64 =4l C41 M4=8 S4 Z4( `4=P f4L l4n r4} | 4L 4 4=h 4P 4= 4m 4`  49 4| 4X 4 4< 4 4 4xP  4,` 40 4= 4 %4 . 4 =4 Q4 D ] 4 m 4 s4j ~4/ 4a 49 40 48 4|  4= 4 4 4 4 4 4 4 4` )4p 648 B4 L4 X4 h4 n4 |4 4@ 4 4d 4h 4 4 4 4 4 4 4 (4 44 @4 O4 a4 m4x t4x 4x 4x 4x 4x 4 4H 4Mh 4O 4X 4a( 4m !4n '4rx .4sp 54t @4xP G4yp M4 X4 ^4` g4 o4H x4 4 4 4@ 4 4` _max_htonl_getsecs_rpc_fromaddr_open_dvma_mapin_htons_MD5Updatelshldi3.omax.o_getsn_gateip.remmin.o___adddi3.urem_sendudp_getprop_netif_put_nfs_getrootfhmuldi3.o.mul.div___divdi3lshrdi3.onotdi2.osaveregs.o_socktodesc_devopen_obp_close___muldi3_bp_getfile_bp_server_addr_strtabgetsn.o.umul.udivucmpdi2.o___anddi3_hostnamestrncpy.o_getchar___ashldi3_xdr_string_encode_nfs_readdir_in_cksum_strcat_pgofset_MD5Final_hostnamelen___subdi3_arpwhohasmoddi3.ohtonl.o_strcmp_net_close_inet_addrscanc.o_strlen_strcpy_ether_sprintf_readudp_nfs_open_inet_ntoa_sprintf___xordi3_netif_debug_freelist_netif_close_strncasecmp_net_open_nfs_close_printfbcmp.o_MD5Initmul.o_sendether_file_systemulmax.o___builtin_saveregs_cd9660_closexordi3.oulmin.o_swapipmd5.o_rpc_pmap_putcache___ashrdi3_nfs_readdata_domainname_xdr_string_decode_ufs_readdir_putcharhtons.oimax.o_arp_replyimin.ostrncmp.oashrdi3.o_strncpy_netdev_sock_nfs_lookupfhntohl.oadddi3.o_rpc_xid_nfs_readlinkumoddi3.oiordi3.o__randseed_nfs_read_strncmpntohs.o_strtablen_ip_convertaddr_nfs_seek_obp_strategystart_nfs_root_noderem.o_nfs_mountlmax.ocmpdi2.o_cd9660_writelmin.o_prom0_iclose_nfs_stat_twiddle_rarp_getipaddress_hz_getdevtype_rootip_net_mountroot__main.o_rpc_pmap_list_prom_ioctl_rpc_port_obp_xmit_ufs_read_promvec_ufs_seek_srandom_obp_recv_strerrorsubdi3.o_file_system_nfs_prom0_close_arp_num_closeall_bootfile_vprintf_ufs_stat_prom0_strategy_prom_getether_xdr_inaddr_decodeqdivrem.o_ufs_open_nfs_stat_typesudiv.o_netmask___qdivrem__rtt_rpc_call_file_system_ufsumul.o_mountroot_dvma_init_dvma_free_prom_boothow_prom_si_getpropstring_prom_bootdevice_memset_nfs_writesdiv.o_rootpath_cd9660_open_xdr_inaddr_encode_memcpy_nameipstrcat.o_bp_whoamiudivdi3.o_cputyp_cd9660_stat_pgshift_rpc_pmap_num___moddi3_memcmpanddi3.o_prom0_iopen_ulmin_ulmaxskpc.o_cd9660_read_panicstrcmp.o_netif_open_prom_openashldi3.o___iordi3_cd9660_seek___umoddi3_peekchar_scanc___one_cmpldi2_etext_ifname_bzero___negdi2_getticksstrlen.ostrncasecmp.ostrcpy.o_readetherurem.o_prom_init_skpc_ndevs_loadfile_dvma_mapout_read___udivdi3_arp_list_rpc_pmap_getcache_ufs_write_prom0_recv_errnosrandom.o_sockets_esym_intoa_nbpg___cmpdi2_lmin_nfsys_exit_lmax_main_free_sendrecv_debug_close_imin_domainnamelen_imax_alloc_edatabzero.o_ntohl_cngetc_fbuf_end_bcmp_dvma_alloc_bcea_getsnegdi2.o___ucmpdi2___lshldi3___main_netif_get_version_prom_bootfile_file_system_cd9660_prom0_xmit_bp_server_port_dbuf_ufs_close___lshrdi3_cd9660_readdir_ntohs_myip_files_devswdivdi3.o_minsrt0.oboot.ogcc2_compiled.___gnu_compiled_cpromdev.ogcc2_compiled.___gnu_compiled_c_filestore.6_bootstore.7_prom0_fake_saveecho_pv_putchar_sun4_idprom.44_dtab_stringbuf.51_promdev_inuse_prom_mapin_prom_mapinfo_prom_mapinfo_cnt_prom_devmap_promvecstore.60dvma.ogcc2_compiled.___gnu_compiled_cbootnet.ogcc2_compiled.___gnu_compiled_c_open_countnetif_sun.ogcc2_compiled.___gnu_compiled_c_netif_promconf.ogcc2_compiled.___gnu_compiled_cversion.ogcc2_compiled.___gnu_compiled_c/usr/src/sys/arch/sparc/stand/lib/kern/libkern.obootparam.orarp.onfs.ocd9660.oufs.oalloc.orpc.oread.oopen.ostrerror.ogets.onet.oin_cksum.oarp.omemcpy.oether.omemcmp.oglobals.omemset.oexit.ocloseall.oclose.oprintf.o# $OpenBSD: services,v 1.9 1997/02/11 04:16:35 gene Exp $ # # Network services, Internet style # # Note that it is presently the policy of IANA to assign a single well-known # port number for both TCP and UDP; hence, most entries here have two entries # even if the protocol doesn't support UDP operations. # Updated from RFC 1340, ``Assigned Numbers'' (July 1992). Not all ports # are included, only the more common ones. # # from: @(#)services 5.8 (Berkeley) 5/9/91 # tcpmux 1/tcp # TCP port service multiplexer echo 7/tcp echo 7/udp discard 9/tcp sink null discard 9/udp sink null systat 11/tcp users daytime 13/tcp daytime 13/udp netstat 15/tcp qotd 17/tcp quote msp 18/tcp # message send protocol msp 18/udp # message send protocol chargen 19/tcp ttytst source chargen 19/udp ttytst source ftp-data 20/tcp # default ftp data port ftp 21/tcp ssh 22/tcp ssh 22/udp telnet 23/tcp # 24 - private smtp 25/tcp mail # 26 - unassigned time 37/tcp timserver time 37/udp timserver rlp 39/udp resource # resource location nameserver 42/tcp name # IEN 116 whois 43/tcp nicname domain 53/tcp nameserver # name-domain server domain 53/udp nameserver mtp 57/tcp # deprecated bootps 67/tcp # BOOTP server bootps 67/udp bootpc 68/tcp # BOOTP client bootpc 68/udp tftp 69/udp gopher 70/tcp # Internet Gopher gopher 70/udp rje 77/tcp netrjs finger 79/tcp www 80/tcp http # WorldWideWeb HTTP www 80/udp # HyperText Transfer Protocol link 87/tcp ttylink #kerberos 88/tcp krb5 # Kerberos v5 #kerberos 88/udp supdup 95/tcp # 100 - reserved hostnames 101/tcp hostname # usually from sri-nic iso-tsap 102/tcp tsap # part of ISODE. csnet-ns 105/tcp cso-ns # also used by CSO name server csnet-ns 105/udp cso-ns rtelnet 107/tcp # Remote Telnet rtelnet 107/udp pop2 109/tcp postoffice # POP version 2 pop2 109/udp pop3 110/tcp # POP version 3 pop3 110/udp sunrpc 111/tcp sunrpc 111/udp auth 113/tcp authentication tap ident sftp 115/tcp uucp-path 117/tcp nntp 119/tcp readnews untp # USENET News Transfer Protocol ntp 123/tcp ntp 123/udp # Network Time Protocol netbios-ns 137/tcp # NETBIOS Name Service netbios-ns 137/udp netbios-dgm 138/tcp # NETBIOS Datagram Service netbios-dgm 138/udp netbios-ssn 139/tcp # NETBIOS session service netbios-ssn 139/udp imap2 143/tcp # Interim Mail Access Proto v2 imap2 143/udp snmp 161/udp # Simple Net Mgmt Proto snmp-trap 162/udp snmptrap # Traps for SNMP cmip-man 163/tcp # ISO mgmt over IP (CMOT) cmip-man 163/udp cmip-agent 164/tcp cmip-agent 164/udp xdmcp 177/tcp # X Display Mgr. Control Proto xdmcp 177/udp nextstep 178/tcp NeXTStep NextStep # NeXTStep window nextstep 178/udp NeXTStep NextStep # server bgp 179/tcp # Border Gateway Proto. bgp 179/udp prospero 191/tcp # Cliff Neuman's Prospero prospero 191/udp irc 194/tcp # Internet Relay Chat irc 194/udp smux 199/tcp # SNMP Unix Multiplexer smux 199/udp at-rtmp 201/tcp # AppleTalk routing at-rtmp 201/udp at-nbp 202/tcp # AppleTalk name binding at-nbp 202/udp at-echo 204/tcp # AppleTalk echo at-echo 204/udp at-zis 206/tcp # AppleTalk zone information at-zis 206/udp z3950 210/tcp wais # NISO Z39.50 database z3950 210/udp wais ipx 213/tcp # IPX ipx 213/udp imap3 220/tcp # Interactive Mail Access imap3 220/udp # Protocol v3 ulistserv 372/tcp # UNIX Listserv ulistserv 372/udp # # UNIX specific services # exec 512/tcp biff 512/udp comsat login 513/tcp who 513/udp whod shell 514/tcp cmd # no passwords used syslog 514/udp printer 515/tcp spooler # line printer spooler talk 517/udp ntalk 518/udp route 520/udp router routed # RIP timed 525/udp timeserver tempo 526/tcp newdate courier 530/tcp rpc conference 531/tcp chat netnews 532/tcp readnews netwall 533/udp # -for emergency broadcasts uucp 540/tcp uucpd # uucp daemon remotefs 556/tcp rfs_server rfs # Brunhoff remote filesystem # webster 765/tcp # Network dictionary webster 765/udp # # From ``Assigned Numbers'': # #> The Registered Ports are not controlled by the IANA and on most systems #> can be used by ordinary user processes or programs executed by ordinary #> users. # #> Ports are used in the TCP [45,106] to name the ends of logical #> connections which carry long term conversations. For the purpose of #> providing services to unknown callers, a service contact port is #> defined. This list specifies the port used by the server process as its #> contact port. While the IANA can not control uses of these ports it #> does register or list uses of these ports as a convienence to the #> community. # ingreslock 1524/tcp ingreslock 1524/udp prospero-np 1525/tcp # Prospero non-privileged prospero-np 1525/udp nfsd 2049/udp nfs # NFS server nfsd 2049/tcp nfs # NFS server rfe 5002/tcp # Radio Free Ethernet rfe 5002/udp # Actually uses UDP only # # # Kerberos (Project Athena/MIT) services # Note that these are for Kerberos v4, and are unofficial. Sites running # v5 should comment these out and uncomment the v5 entries above. # klogin 543/tcp # Kerberos `rlogin' kshell 544/tcp krcmd # Kerberos `rsh' kerberos-adm 749/tcp # Kerberos `kadmin' (v5) kerberos 750/udp kdc # Kerberos (server) udp kerberos 750/tcp kdc # Kerberos (server) tcp kerberos_master 751/udp kerberos-master # Kerberos admin server udp kerberos_master 751/tcp kerberos-master # Kerberos admin server tcp krbupdate 760/tcp kreg # BSD Kerberos registration kpasswd 761/tcp kpwd # BSD Kerberos `passwd' eklogin 2105/tcp # Kerberos encrypted `rlogin' # # Unofficial services # supfilesrv 871/tcp # SUP server supfiledbg 1127/tcp # SUP debugging radius 1645/udp # radius authentication radacct 1646/udp # radius accounting icb 7326/tcp # Internet Citizen's Band @ . .. catchmod cp dd df edexprhostname ln lskillmkdir mt mv pax tarcpio rmpdksh shsttysleepsynctest[\A ...B . ..D chgrpE ftpF gzipnG gunzipH gzcatI sedJ buildK vi L basenameM grepnN egrepO fgrepP rshQ tsetnR resetS lessnT morenC . ..U tmp08@HPX`hpx (08@HPX`hpx(08@HPX`hpx (08@HPX`hpx08@HPX`hpx (08@HPX`hpx(08@HPX`hpx (3   @31}^(@@=<@`bT U3@@*(0l@?A33/q3/qSA3=03=03 EA3з3 GO3 GO <~A3ŀ3.3. P 333333../../instbinrdN 333../../instbin' 3(J3(㇀3(㇀../../instbin'+ 30 30 30 ../../instbinfA 371371371../../instbinPD 3V~3V~3V~../../instbinA 3 3 3 ../../instbin 333../../instbin: 3=03=03=0../../instbin|6 3d>3d>3d>../../instbinc 333../../instbinrT$ 3%3&-3&-../../instbin!3 3-3-3-../../instbinM" 346346346../../instbinB" 3:*3:*3:*../../instbinYw4 33Qn3Qn../../instbin  3 GO3 GO3 GO../../instbin:5C3.3.3./tmp's(ڜn$"uHJmWH(DzuZֵ" ban%Wgg@ŧ'r4'#RZnN8ROJQuQP GG"]"yd(ui(*pj)?ҞJ2_kR"hT@   g @ gp g@MR    ` `thT >"hT@q @(#)ex_join.c 10.10 (Berkeley) 9/15/96131|No following lines to join.?!㿈  2 `d` @@.k . @C   h@M`!    "'(T!"  x' @qі! `|  t x@qŖ! 2$ t &`l t x'(T!$(T`| "`d`l &`l`d`l@ `&`l `d`l   @A쀢 쀢`    "(T t(T >$(T x  t x@q " $ t t x'(T! $(T @qm |A `|!>쀥  쀢 5J  /' '`J )"h"@X ,@`  ,@`쀢  J   ' `'쀢 @@  @J $@?"& P " ?"& Pi`d& L`d`l@ @Ay  @ @B|$@    ` `thT >"hT@<   ` `thT >"hT@* h `l`d"@  & h @(#)ex_map.c 10.9 (Berkeley) 3/6/96132|No input map entries133|No command map entries134|The %s character may not be remapped㿈`|!  `x  "`t0@o  2 `ii##@K  @t #B` ac  :`     a#` @  2` @ '``t `#\#` #d   @m@ " X ( `t @`IG 26`t  22`t `   'S 'R@ @<   " `t2`t `*` * !X  @;  i@K*  `#\#` #d   @m+@135|"%s" isn't currently mapped㿘`t `|!  @@m 2`t   j@L9Ȱ @(#)ex_mark.c 10.8 (Berkeley) 3/6/96136|Mark names must be a single character㿘  2 `t` @@,!  `  @ @`d@J   j@J @(#)ex_mkexrc.c 10.11 (Berkeley) 3/6/96.exrc137|%s exists, not written; use ! to override%swabbreviate map map! 138|New exrc file: %s8`x  "`t0 k  P@9`|@R`|! @y  k]X&@y!Rk@e` \"0@E \k@nI 9 \` @5 \k@n<  , \` @( \k@n/   \` @ \@[  \` @ \@f  \"0 k@Kf "0@f \""0 k@KX @(#)ex_move.c 10.10 (Berkeley) 9/15/96X    ` @@+L : `d'`h'`l'`p'̐ؒ @ '' В  *؀  Ȁ /`T''ؔ @`    Р"@& L& Pĉ139|Destination line is inside move rangex  2 `d` @@*  '`h'`l'`p'`T@ @  l@I `T  8   '"  8    , @A 2     "'(T!"  x' @n>! 耢   t x@n2! "İ $ t t x'(T!$(T"@@F &@?` @>܀ 䀢@n 䀢 @ܐ @>܀ ~  8   '" "$  2 @>a eǐF ?@ @=ژ܀ R䀢@mɔ䀢 H@ܔ` @>܀ :"  8 "  '" "$  2 @>  Ő   ` `t@hT >"hT@& L& P  8 " l  '"   @A 2  l& l @(#)ex_open.c 10.7 (Berkeley) 3/6/96140|The open command requires that the open option be set141|The open command is not yet implemented㿘" " " "*` * 8  m m(@H[ @(#)ex_perl.c 8.10 (Berkeley) 9/15/96306|Vi was not loaded with a Perl interpreter㿘 m@H< @(#)ex_preserve.c 10.12 (Berkeley) 4/27/96142|Preservation of this file not possible143|File preserved㿐  2 X` @@)a '  @2   m@H h  X @` 2 @>Ȓ 2 @`  2  m@G 㿘`t@6|`|@5 a 2 @-r" ` 2``|!  $@- 2 $(&$ @(#)ex_print.c 10.18 (Berkeley) 5/12/96㿘`|`d`l@7$ 2 `l& L`p& P 㿘`|`d`l@%" 2 `l& L`p& P 㿘`d`l@`| 2 `l& L`p& P %6ld TOOBIG x  2 ` @@( U PТ"?n! "'䀦 n @n''  @ 25  @<#܀ ܀  $2 n@a0  @ 2  (T   @9J  2 (T 2 " $㿘 'PP$@ 29  (T 2   @9#  $ (T 2 $ nbP @ "   (T 2   @9   (T 2 n@<a0  [ynq]㿈'" "" "*` * 8 n  nc'  @P 2J @ @;쀢 2A ` @= 27 ` '` "   @) ^ 2#  (T 2   @8  n (T 2 nc'  @  2 @ %c㿘", ""$ "$*` * 8 2$#Ā "#ĸ$#Ā " # #*` * 8o!-n@ *`$( @ے% 8:m??h` @i (T a  @89  2 (T 2V& `*` * !X  @6  *  * @ a]@6x `2-? 8@'@N' @E0" @  (T   @7  2 (T 2 &??2 82@& 㿘'L'P'T'X$44$"@ @/wL$4$$4 L 3 b@%㿘`  $ @$4 $$4@* 4` `  N@ 2$4@㿘 $4  ( 4$$4 @(#)ex_put.c 10.7 (Berkeley) 3/6/96㿐  2  L` @@&  ' P'`|  `Q `d@[  2 & L& P @(#)ex_quit.c 10.7 (Berkeley) 4/27/96㿘`| !@3@ 2 @% `  $$"&$ @(#)ex_read.c 10.38 (Berkeley) 8/12/96!!%s ! r%s145|Only regular files and named pipes may be read146|%s: read lock was unavailable `x   "`t0%&   @ !2 `#X   #P*` * 8 2 `  #P "  ` @ @   @*Q ڐ @*֖ 2#    А`x/  2 `x?` `    "`t@`t,@@, $  ͔ $ `@"$`t,@pb@$`@ `t,@pb0pǒb$`2$@&$$ (€  ` @l $ &$`t,@ #\`d @ 2 ` @&`& L$ & P L@i) P  L ) 2 `x 7  `t3@   !  !@i>"  @2  "  ?#? @2 ` 2`  (` @2 `t@ @%,O p@HFbT @В   p@E; < @ @ @`@ p@C 0'  T @2^  p@@C`d@# $ " `d`d& L `& L & L 147|Reading...148|%s: %lu lines, %lu characters㿐    r @# 0`@ d  (T &  @5  ` (T `    h   ,@8 8͢` @1@_ 2, 2'`/ @H r@C&    ` `thT >"hT@E   p@DN@_ `h  @(#)ex_screen.c 10.11 (Berkeley) 6/29/96㿘@㿐` !`x `t @b    & $ &$ 㿘`|       `   ` `@$   @Ȱ`X149|No background screens to display 㿘     s@BP0Q  9  (T 25 -s+s  @4  2  (T 2&  @ @  8?@   x"  ` `  (T Ӑ (T   @4v   (T s`x @(#)ex_script.c 10.30 (Berkeley) 9/24/96150|The script command is only available in vi mode㿘$   s@B%0 `x  E  @@ tcgetattrptyforkTERMemacsTERMCAPemacs:EMACSt-iexecl: %s㿘 3@Q  2 @ 2&  @A  $ $ ?$ $  @ \?2 ` s-ؐ ?$ ` d ?$ d `h@@ T?  sؒ   \@ T? s@?$ s0W s@A ?" @7 ?V @1H"sc@1 s#sc@+ s#sc @% @Ҋ `a@ @  @Ē  @  @ @  #d " #\ #\*` * 8@Œ /`s(@c  s@B0@ @! 2  $@ &$ hT "hT selectError: timed outError: shell: EOFshellhА @  ''  2`* ` * ؐ "    @QŘ "  ? $ o t@A 0~$ $ @a" ?  t@@ 0l t@@80f) `   'S 'R@ @2   2 @7̀ H ̖@6q$ @  * $@M@a'"'  Д  @Q\ " ?  t@@0$@7g̀   ̖@63 @ @.151|No command to execute x@7D 2  @5H쀢 2߰ @-耢 8耢 6      "'(T!'   @e䀢   x  t@e x " $ t t x'(T!$(T@ @4٘܀ ܀ ~  @ޖ耢 @  u@@ i "  ''  @C@ `  ua0@8  ` \ "b0 t@?8E B   `"hT`t@hT >&hT@`x `t@d`x "< &`t`t`x'hT!&hT 䀢 @d䀢 & @@9@6     ` `t@hT >"hT@p  В @4 ''``@ `$"  2 * +@ؐ "  4 2$ Д  @P? +  ` t@?R" `'@`$"  2`*  `?ؑ: "@  2 2$ `@5̀ 2˰     "'(T!"  x'Ȑ @c$ #  t x@cݖ$ " $ t t x'(T!$(T  `@U$?  @@  t@>8| ' `   'S 'R@ @0   2 $̐'̐ @4h V  * C$@Ā Ā &'a"'А @X `2`* ` * ؐ "`   @OA @@1 * '̐ @4   ̀& L& P& P@9    ` `thT >"hT@㿘  @@e $  @>K   @є$  * @D   1 - * K2K %? K"? " KJ@`" KJ@` ?ؔ  2" script-shell㿘 @$*@&$@ ?" @ ?"@zw  @ @ @&     "(T@ 䠀 "(T 2(T߁"(Tttypqrs0123456789abcdef㿘x@  ? x J Q* -x ,M( D( p, ,  @l   t \"0 2/:?@.,@Ϛ@ϟ!@͐ @l ?&&@@@< @  `g@ޔ @L  p M 2  \ "b0?@(#)ex_set.c 10.7 (Berkeley) 3/6/96㿘`x  ` `t@Iu  0@L  @(#)ex_shell.c 10.38 (Berkeley) 8/19/96%s -i㻘 3@L> /  #d   #\*` * 8#\ $x@cŔ` (  $3   @   (` $ $$ vfork-cexecl: %s㿈''  3@K  d (€  ` @@  u (\  d #d x(cH#xcH>@.` M x@<PK  cd " `c\*` * 8c\@ /2 cd " c\`c\*` * 8 cd " c\`c\*` * 8 xX@w  cd " c\`c\*` * 8 x@=`@Ȑ  @  waitpid%.*s%s: received signal: %s%s ...; core dumped%.*s%s: exited with status %d㿈! \#y$"0@* ? "0 "$"0 @<.a   M K  HNN " "@As@@[ ` `y!y!#\ y!y!#` y@; €   ` `thT >"hT@G  2C :  >2= NN " "@A$@\  `y!y!: #\ y@; ~   ` `thT >p"hT@͐  ( p`P H 8   x`H0Filesize limit exceededCputime limit exceededWindow size changesVirtual timer expiredUser defined signal 2User defined signal 1Urgent I/O conditionStopped (tty output)Stopped (tty input)SuspendedTrace/BPT trapTerminatedBad system callSuspended (signal)Segmentation faultQuitProfiling timer expiredBroken pipeKilledIOT trapI/O possibleInterruptInformation requestIllegal instructionHangupFloating point exceptionEMT trapContinuedChild exitedBus errorAlarm clockAbort trapUnknown signal: %d㿘 z @  ``1k# ({@aS8#@(#)ex_shift.c 10.11 (Berkeley) 9/15/96㿘@ 㿘@  152|shiftwidth option set to 0㿈   ` @@” h #| " #t #t*` * 8  {@:`T  `d`lb  2L `t' J " #t #t*` * 8`'J` >"#| <"#|    "'(T!"  x' @^! `d   t x@^! " $ t t x'(T!$(T`d`l@   @.쀢  쀢 ; + J # J % #Ā " # #*` * 8#Ā   #*` * 8#@~$@쀤    $@  L" `    "(T t(T >$(T@ x  t@^} x " $ t t x'(T! $(T@@^j " #@ "` ,#Ā    #*` * 8#$@#Ā  #*` * 8@ `, @@ "" @/"    ` `thT >"hT@x9  L2` $ P $ P " & P`@$ & L& P@^# P   ` `thT >"hT@G p `l`d"@  & p @(#)ex_source.c 10.12 (Berkeley) 8/10/96%s8`t @h  &H@ CȀ 4  \  @ \ 3"b0@  @8Ք `@d2 ,@@%̲@Z >`Ȁ ̀>`Ȁ̀ \ "b0@ |@9(  ̘ 7 @(#)ex_stop.c 10.10 (Berkeley) 3/6/96㿐`|!2  @&  2  (€    2  @Ĕ  @(#)ex_subst.c 10.37 (Berkeley) 9/15/96㿈`x `t  L   2L@jfa#   \2.  S . L  \L" ,@2 L  \  ,@ ` ,@ `L   2$ @] ' @)  #\  Ė  @n 2  #\$@  @a 2   #\$@ ؘ @U Ȁ 2  & L   %L"  "& @& & L    L   Ѡ  *`:  ~  L      (T!" x' @\l   t x@\` " $ t t x'(T!$(T L  \L"N M2%LL  \> 2L  ,@ `6 ~24 "D    "<*` * 8"< 2$   ~2 "D ""< "<*` * 8 2  "   @  @ ,@ `(&  @T@2 &  @7   ` `thT >"hT@:  @   ` `thT >"hT@#@㿐 ؀ 2$ @+    @2`x #\  ܖ  @< Ȁ "`x   `t @g 㿐 2$ @   @2`x #\  Ė  @ "`x   `t @< 153|Count overflow154|Count underflow155|Regular expression specified; r flag meaningless156|The #, l and p flags may not be combined with the c flag in vi mode169|Confirm change? [n]157|No match foundp'L'  2 L` @ ' P'! " !| !|*` * 8  . . '  L J  "' \# ?* :  i*                         H       L \  llllllllll                                         P           `\ `&`\`\?\&`\lL$0L@s! LJ@ 0'L0 "2`l     &`d`l@&`l@, .L@,H`l (L #  `?. $  @ '' `?.    '쀏 $@  'L`'LJ` 2% LJ 2 ` `2 $ "$` ` $ "'  `쀠"' H' ' ''''`d`l8*  (T $  @'2   (T  L@)ޘ E  E   "'T!'/ '   "TtT >&Tx t@Yx "= &ttx'T! &T@Y IL@e'L ' '    ?  ?(L   @ؘ`%`Ԇ '܀`A  2> $ 2: ( 26 , 22 `   @`   !'  @  @ ' @4k  "'L *@ '  "& L''$',' 2$''$ 3 ' '& L& P@  ua@9B @u ؔ @&F e ")  r @(#m иȐ았 b = [  @[( ?  /䀢 qL  y"N& L  (@ B   20L@ -L  (@ B  2 a`(a (@ B @ '  @  @ ' @3  L@@Z,, ['' hT ("hT$& P  @ B   20L@ -L   @ B  2 a`(a  @ B @ '  @  @ ' @3m  L@@ $$ ' L  @C  ',$@Ī   `+@    !'  @F  @ ' @3(  "'L@@ǔ@' !   /  @) " I    \ & \  " '$ &  @)P 0 L@'˜ (   "TtT >&Tx t@Wx "9 &ttx'T! &T@W EL@a'L"'  !'  @  @ ' @2  " '@L@;'  ` Ψ 䀠`+@    !'  @|  @ ' @2^  "'L@@@'     /  @(C"     \ & \  " '&  @( i  X& X ` & `2 'Ȁ`2'쀠" '''̀'ԐЖꏘ$`Жꇘ"쀠Ж~Ԁؤ  L2& P P& P L@Vޔ P܀ `쀠` @&`@  $@  @1 !   ``thT >"hT @1 0  @ 0 ('@ϐ @㿐'H'L\N ! "! !*` * 8 2`! "!`! "! !*` * 8 2`!䀢 "!`!䀊 "! !ܑ*` * 8 L L`Ha#J  ``"` $@ @ސ $*@&$  $@ @ѐ $ *@&$S HL@n 2e `HL@Ֆ L@] 2T   @7& L'L@  & @0  H@LL*@     Ht@T >"T@ H " 'HH@ 2 @ $ &$ $ &$ [[:<:]][[:>:]]㿐 @` L ["i"D \ *c ."b"Dq ~"E"Dk`(h L < < [ *% ."$"DY [ ~ >"  P""DL I " "< "<*` * 8 2=% "D " "< "<*` * 8 2-)  ""< "<*` * 8 2  "  "D " "< "<*` * 8 2    &&    T!"x' @T  @ t@Tܔx 2&t tx'T!&T@` H P ~ \L [""D \ * .""D  ~"k"D `(. L < < [ *F ."E"D.@ [ ~ >w."#"Ds. H. . . . . .  P. . . . . . .X ""< "<*` * 8 2J.. +C."D ""< "<*` * 8 22.2 "/ +. ""< "<*` * 8 .  @  ."D " "< "<*` * 8 2 . .X &@&& ^.[]$*㿐 &    T!, , ' @S @x t@Sx 2&tY tx'T!&T@  J? / ? ?  J? $ ?   N / ? ^ ?N ^. ? ) \N \ "N  / ?"  ?@;KN ".. ? $.&@&& ([ ]|/\*([^*]|\*/)*\*/)*\^.[]$*+?()|{}㿐   @L@ "`?` &@$@`*` *  *      T!"x ' @SY @ tx@SM 2&t; tx'T!&T@ ^,`(@  )' \L@ H (@   @:L@ " @.  @. ?``(@   $. &@&& RE error: %s㿘8@N @> @.$ 0 @@ @@.@J㿀'''   @7aM& \  "D ""< "<*` * 8 {   t  Mڀ`O#*`@ #P#P#P#P#P#P#P#P#P!<!<!<!<!<!<!<!<!<!<#P#P#P#P#P#P#P#P#P#P#P##P#P#P#P#P#P#,#P#P#P#P#P#P#P#P#D#P#P#P#P#P#P#P#P#P#P#P#P#P#P#P##P#P#P#P#P#P# #P#P#P#P#P#P#P#P#8"D    "<*` * 8"<   M?Ш *@ ?*@  ?{*@`?*` ?r*@  "@    'R@`@`'`"  ` 0`` 0 㬐  ] !, 㬐   \ *  @ (`@-@h` @- `M@.@`            `   'S 'R@ @!   '`  @2 `&  耢 2 @*` @*` &  @,Ɣ  耢 2 & W  &  * )"@'`"  ` 0`` 0 㬐  ] !, 㬐   \ *  @d (`@@Ӓ` @,z `@.@`2mM##' @(#)ex_tag.c 10.36 (Berkeley) 9/15/96X#\ 9   @ ; @@ R@ $ > &$ 158|No previous tag entered㿘`x . 5` "`t@\`t@b $` @,  #Ѐ " # #ȑ*` * 8 @``*`   @+( @@`"  @  @e_ k $ $  @eW ,c  $$ 2 $ " $ $   L P   "`|`!2`| `| !`! @  =   @  5 @2 @$$ `2@$`" $@@%% `2@$`" $@  $@i `"    "`  L"`   P"`"  "  "  @@@v 282|Already at the last tag of this group㿘 2  @ %  @2 `| @+O` @S "$    > ` `$@   255|Already at the first tag of this group㿘 2  @z %   @2 `| @+P @ "$     ` `$@  㿘` 2 `@` &`` @ @  2 ` @ 2  $ >(&$  㿐` 2  @_` $&` @Hr 2< @  `@| 0` @ @̖ @ @H  "@ "@`"   2`` "`$"`(d > "d& $ &$ 159|Less than %s entries on the tags stack; use :display t[ags]160|No file %s on the tags stack to return to; use :display t[ags]㿐 @2`x @ f   "`t0WX@@2p J `$P @ `2;  @*(9 @@@"   '@q /`@ 2@2 @ @+B` 2`|  @`|@ 㿘 @  ``|`@  @8  㿘@   @  & L & P@  2)   "`  "` ` 2`  @ږ "$ (&$@@  2@@@2 @ 292|Display too small.%2d ... %*.*s %*.*s*%s%.*s 㿘 2 8 @Ҕ 0 " @)o0|  (T w!  @   (T hfZ@ `㕔`㐒`` 2`` @ؐ  ?`ؔ   `  t2l`@!`" 8?• @  8?݀8!! JFa@@2 (T  㿈 B`@ ^  & @ 2U  "`" "@" "@"` "@`"`@2`$@"@$`Ð "@"쀢 "@` "`` "$`   " @ $` @(   㿘@ 2@ @(y  $`$ `$ ` $ `$ @` $ &  㿘`  ` !@m @(S  @ $ $ $ `  $ & 㿘`  ,` -` ``$@@D @(*  @ϔ`  ($ ` "& `  $ & 㿘@` `"``" `@"@@7`@5 㿘`` `2&` "`2&`"@@ `2@ 2@`$ `"``2`@$@"@@ 164|%s: the tag's line number is past the end of the file165|The tags stack is empty166|%s: search pattern not found㿘` ` `  0 @(ܖ0  @'@0@(Ӗ`0@^㿘 t N@   / &@`()`@  @'l $ @{` $  @'a   @ @ *, $ $  "$ `N@ ˲` 㿘 C@ ( `  @b 㿈N@ac  @+'@ 0"  '' #\@F @b ( #\#@F{ "   Q   & & L& P L@K P 162|%s: tag not found%s㿘@q @`G !J & &  & & @s   @J     ,     2)&  @'㐀` 3 \#   2  &b0  @'ؖc  ,  2 @   163|%s: corrupted tag in %smunmapclose` @U  \"0&`  @|g  \#\  ̔  @d?  \"0&` @۰ @@+ 'J@ @` '@J@  *@' @⥒  " @     `"@>@+e'`@+` @%     t@T >"T@    ` `t@hT >"hT@@>a =@P.@@  @_0`. ($ "  @]  /*  ' @@P $    $ $ $@E`$ $  2 &"J& @̀  @%0@  @%{8 %s/%s8'N /"@T{ `@’ /,@$@`@L /,@@Te `@&'㿘&2  : !L  *L0@8 2&2  :  L  *L㿘@  ?"    *N뀦  "@ : J @ (8 *8"  ?`J @ J@  @J2  @  J@  ` @(#)ex_tcl.c 8.10 (Berkeley) 9/15/96302|Vi was not loaded with a Tcl interpreter㿘 @$ @(#)ex_txt.c 10.16 (Berkeley) 9/24/968@  8$ Z  & " @$$ `2@&`" &@ L $  T   w*@a %a q*  L  @u 2h @l !+aؔ @t V? * FDF(K0GF0EF0F0F0F0EV @DR     @I "2 $ ?`"*`@HHJJJJFJJJFJJJJJJJH쀊 @  `  @J? \$ $   @ @J? .2 &` "` 2 &@"@ٰ  e р  $` @uB 2ð @~    @u6  @$`$ @2`&@"H&`  @2 @  @~2| {@(  @  J  2 `@ *J  @ $  *@ * a? " @  j   ""  ," 04  @''  @H "K ' @  ''   @ |€ $ $   @Ӑ@e 2* |@~|€ @&@a#@ ` 耢   $  *@  %c%6lu %.*s㿘@'J#@" "" "*` * 8   #H@'0`"a#P`@'(`a@v!㿘#Ā " # #*` * 8#| " #t #t*` * 8 `@ `J 2`@gJ$@ `*`@g?$@  @g9$$@ `  `@GP` 2&` &` &` ` &``*@    ` &``?*@ @(#)ex_undo.c 10.6 (Berkeley) 3/6/96㿐 L' P' '@!  2,   X 2 4 , X $ 4 4 "  @? 2   $ 4@    $ 4@}& L& P @(#)ex_usage.c 10.13 (Berkeley) 5/3/96To see the list of vi commands, enter ":viusage" To see the list of ex commands, enter ":exusage" For an ex command usage statement enter ":exusage [cmd]" For a vi key usage statement enter ":viusage [key]" To exit, enter ":q!" 㿘-b)c %cX!cc؁ The %.*s command is unknown Command: %s Usage: %s ^D%*s: %s 㿀`x ` `t a#    ]!,* * P""؀ "@@@H  "@`@ 2@ ``!` \ `*  *`P ۡ0o`p`ۛ`R!8@ @cR!8@R`!8`p`ۅ`0SP""؀ N (T IP"ؐ  @L  @ (T ;@2`# ! [/@J\ *`@ `/@ / ]/@ / ` * @` ?``@   (T 0@| The %s key has no current meaning Key:%s%s Usage: %s %s 㿘`x i `t  ` `@  `t ~/ [ ] ~`t # ~, $ "# #*` * 8 ,   ē, ݐ!|@  2 `*` * !X  @ÒcU J  ##Ȑc ڱ C  (T = #ݲ!|  @{   ~ (T - ~, $ "# #*` * 8  `,  `đ,  |cР  ~4   (T 2 ͐@{ @(#)ex_util.c 10.23 (Berkeley) 6/19/96㿘\ @~Ô .`* Pbؐ & & `& d& l & p`& h |!6 |& x & t$ x t( "@"` x" x t( 㿘  \""0 ,' \0   ,@D0 "3 $,,`? &`@;@`&@ @`  0 2 $0` ?6` ` 2 ,@2& 2&  `Ġ 167|%d more files to edit㿘`2&  0  ,@"   ( "   " & 0 (   " (`@ 2` ("@ : @x 㿘 (€  "(\#   " " "  " *` * 8& 4!` " !X !X*` * 8& 8$ ? &$ 168|Buffer %s is empty144|%s: expanded into too many file names283|The %s command requires the ex terminal interface272|That form of %s requires the ex terminal interface274|Command failed, no file read in yet.173|The %s command requires that a file have already been read in171|No previous buffer to execute172|No previous regular expression230|This screen may not be suspended290|The %s command is not supported when the secure edit option is set284|That form of %s is not supported when the secure edit option is set174|Usage: %s㿘 W x.@\\\\\],]D]\]t]] ?  @ؖ 09 3P . @0' " @x80 @r`0 @l0    @@[@(#)ex_version.c 10.31 (Berkeley) 8/22/96Version 1.78 (10/1/96) The CSRG, University of California, Berkeley.㿘 @4 @(#)ex_visual.c 10.13 (Berkeley) 6/28/96175|The visual command requires that the open option be set%luz%c%lu%luz%c 㾐" " " "*` * 8 2 `d @z  " & L`| (b  - @  ^  ( +  . L"` "  L@Bה P ` -2``|  ! L@D|`X!@Du L @  `|" @d" 4$b2 $ !   @,s $`2$@&$$@"$  &  @ "@'@} 2  2  b ? &$ @(#)ex_write.c 10.30 (Berkeley) 7/12/96㿘@h 2  @  2 &`x㿘@S  2 @  2 `| ! `  $$"&$ 㿘@2 㿘  2 X` @{ !  @  2 @ \ 2 `| !z 2  `$$"&$ ! 㿈  2`|` @ !  `x x`t *`:   2`x L  `x a2``dL !2\`d#X "#P #P*` * 8 2`     ` @ *`:   2L L  L ` ` @{A/  2 $ &$`t  #\`d`l@ 2 $ @2 b `d `l@` "``x  L >2`xL  >2`x`  *`:   2`x L  `x L `d`lO @zL 2H `x 7  "`t2@x   !  !@Aa"  @wU  "  ?#? @2 ` 2`  (` @   Q `d`l@253|Writing...%s0\` `%'@   Q#@N @` d  (T B  @     (T 6  `  h  @ ? @@27  ? &`&*@  @2  @nސ 2 V@q  <  @TV 2  @8 2    X  @P@7  `h  `%'@@(#)ex_yank.c 10.7 (Berkeley) 3/6/96㿘  2 `|` @     `Q`d`lD @(#)ex_z.c 10.10 (Berkeley) 3/6/96---------------------------------------- 㿈  2 `|` @g   "$` `X " $X $X*` * 8? `d'`| (• @& @  \`2(_ V`, 쀢  "   &`dS`d( " &`dM?4 쀢 " &`d&`l L' P' '@  7`?4 쀢 " &`d?&`l! 2: bh&`d&`l 2- bh  &`d@ ' &`d?&`l` @W쀢 2 `l쀢 8&`l 2 2& L @(#)exf.c 10.47 (Berkeley) 8/12/96/tmp㿘`1 0 0-  0  @2 $ 4 "` 2 $ 0"@  @uv@ut@2Ғ 52  @S  @- `# @2ap  0@[  & @uL @   0& 4&  0@2 4$ 0"$ 4%s/vi.XXXXXX237|Unable to create temporary file238|Warning: %s is not a regular file%s239|%s already locked, session is read-only ``   ?#ߐ @6`@5` 6` @S= \2$` @Ô  $`?$`H$`T `X ,`Xx@}t s `t V @( 24`!x  x !p*` * 8!p $@@A@@Wx? @ `@w` x` 6`@  &` ` 2` @ &`` "@t @c @?x`` $` 6`@&`D*ؔ  @NcB  $@N 8 "  `X ,`Xx$`<|$`@$`D<  ,  @qHؒ @wؔ  /' (T2   'ؐ@1+` `L'@P $`L @  ``L' `X ,`X@?  ! @5؀  $` @5p @ 2|`@P 2v` "  `" ` 2 `@m   ` 6`@ @ V``?# @6` ` @`H@` "  "  `!6` @x$@`  `@ %   )    )   @'G@ $@& & @$ @&$2 "` @s&`` " `X@>@s` &` `X @"`L@>`L`L "`@s$`L`  @@s} f %s/%s㻘`2Lb& / .L / . L / @G/`?L&@G) 2"Ȑ D&    "*` * 8" -L@ : 2` @,@$0@>,@@F " L@ `` "&@r` @ܔ   @u`@s`&`& -c option㿈 & L& P ! "    2$@ L q L & L& P@vJ! c!  A  ^J$! $  @k L S L 2 ;  ` " !l`& L  & P$ &$ " !d !d*` * 8  0  @ & L  L  @ D쀢  & L& P` P@` `& P L@$ " $ $*` * 8 0  @DȒ   !!H ɔ  @D 2 !h!@ , @D $    `X  `<@ `@@ `D@ !"   &"  @$|  !0 " !( !(*` * 8@  " @Db!  `p   @   @v@ "h"p@0 ` @dp@r @ ''@  2 '@#\#`D @D  " `X@ ɐ`D  ,`X$`<$`@$`D  2  x@' 0x?c 4   `X ,`X   @4?# @4@$<`` 0 b""@Ŕ H$@D@;\@@px 8 H@s9@@ N@ /2` 8? @ `@ @ H ..@.@.@ @<    ` `thT >"hT@o 258|%s expanded into too many file names.%d259|%s: not a regular file260|%s: not owned by you261|%s: accessible by a user other than the owner?b?   ! \$"0 @CC 6"0 :` #\     N N  @r 2D    @C@q7 `    ?(T!?#@"@ *  2# @8 ? *  2 x  t@8 x ?$ t t?# x"@(T!$(T   %`%2 LL  %" * /" * L    %-@ d-``-`@+! ,@@+ /,@` ?#@.Ő   @@ @40@+ߐ?#%@@"@ @: @Bk )*<    @a?@@  @T? 6  @zI?$`@BE!?>#@p  @p_+ :@ D "@p @p ݀   ` `thT >"hT@n$+ ?@p}@9d@pv @p   ` `thT >"hT@m 㿐  @    JJ #$!&$  @| 9 #J #" 0& L -J@ /)J` *%$!&$ ( J@ *2J` /& L' `'  @E 262|File modified since last complete write; write or use ! to override263|File modified since last complete write; write or use :edit! to override㿘 2 X7 1!$ "! !*` * 8 `  `@   4`2!!А@   @B264|File modified since last complete write; write or use ! to override㿘  X   ` @۔ @265|File is a temporary; exit will discard modifications㿘 `"    @" @ 4  `2  @а 266|File readonly, modifications not auto-written㿘  X !$ " ! !*` * 8 2" "" "*` * 8    @sp   n 㿘 `@l` & @ &  @U 㿘"8 " "0 "0*` * 8 1 \&"0@ :  "0 #   @(#)getc.c 10.10 (Berkeley) 3/6/96177|Empty file㿐@`` @Ҙ    @x ` `"&`@k` "&`&` &``` .` 㿐`` ```"*` 067`3@`&@ @˜` @?&@ %&`&`` `"&`@k "&`&` &`&`` .`?`@2`  &` &`` @.`@l 㿘` 2 ` 2  ` "  㿘 "`  " " 2  ` "  㿘``@!(*`@<<@ '@&@ `@H`  @ '&@` `"&`@kO` "&`&` &`` `  ?@    &` &`?&`` @.`@l 㿘 "`  " " 2  ` "  @(#)key.c 10.33 (Berkeley) 9/24/96079|No non-printable character found㿘  @{7b@l @8  @4  @0  @, #*!* a` @%,R a`@:  ,R   *gS 2 R a# ` J  ",p` 㿐 h % "*  "@ ` 2`"@@ 2 `@ **`*  * `* "@  "`㿘  *` , !X@& ,!] ,@`2   㿘@ 0123456789abcdef01234567+g Ԁ" ̅(( 8 "   g(    " xx(( 8  g   g   ga㬄H g g*`  ga 2 ☄ ^* g g@ ?*H  ☀"␅(( 8 \!* \* g0`*   8 ` g8  (`2 ?"* x* g H 0 (`  (` " (#㿐/**`` @Oʘ!  㿘 !( !! ! 2 !!! "-!!("! @`!@ `? @ @ "!Q ! ."* #H!!*"@ *`+ "  @ @n* $!!$!!*`" * !0  `"$ @$`$ `$ ` $ `$ `$ `$ `, `   'S  'R@ $ $ , ՠ  㿘`  ` a  ?aa a"@ ? @@a*`" * a a*`" *  $a` 2#@,` $ @, ``   'S  'R@ 5$ $ ,  0$`$ `$ ` $ `$ `$ `$  h` ب   @2v  A>T "x> 2g x1 2^ `?`  X*`@xxx`   @GC   hT "hT^ 25 A22 * "@*`@ ` `@ &@`&``&`` &` `&``&``&`? $$ $2Z ` ` 2V ` "S ` ` `  2  !H `: "G `   #\  @0)Ԁ 3 $ "$ $*` * 8 2`t q ` 2 !! ! *` *  8 ! *` * 8*` *  S* & ` ac  2@) a@&@`&``&`` &` `&``&``&`? $$ $"  a c  2  a.` &` &`.`} * "@*` @ @1 `? " $$  $  " # "# #*` * 8  I E  @Q xؔ  2    (T`"(T &`     " Ԙ  2&    ˘   * "@*`b@     "       "P `  㿘   "   @%H    @%<276|Unexpected character event277|Unexpected end-of-file event279|Unexpected interrupt event280|Unexpected quit event281|Unexpected repaint event285|Unexpected string event286|Unexpected timeout event316|Unexpected resize event287|Unexpected write event㿘`?` R#p*`@,Hd @ ۔ <`  @ Ԕ@5`  @ ͔h.`  @ Ɣ'`  @  `  @ `  @ `  @  `  @ (` @gq @f ! !!( (  !"!"!!"!!  㿐 !@* "@*`.`"*   '!@0; 2$! @`  $!   ` @(#)line.c 10.21 (Berkeley) 9/15/96㿐 '@ ` @  2 `  @X  ' 㿈`K'H ` j H 1H$@!H x` |     @` 2@ `'@ <`H@" "@'H`H 2&` +'` H' '`  ? 2H @H 2'2& &`&`  &`' `& 003|unable to delete line %lu㿐'H `  ?  @ IH 29  SH 22 H@ H' '`   H 0@ H `@(&`` ?&``X  @# `X .`XH @ 004|unable to append to line %lu㿈'L L 륔 L ' '''  ? L x@ AL6 @*&  &X  @"ȐX .XL`@! L @ Ɣ@ L Д 2  L @D 2  005|unable to insert at line %lu㿈'H `H C H ' '?`  ? H @ H3 `@:&``  &``X  @"g`X .`XH@  @ gH@  rH 2  H @  2  006|unable to store line %lu㿈'H `  2 H@ H' '?`  ? H x@ H `@"&``X  @" `X .`XH@f H @ 㿘 ` ꪔ  2 $@" | x `"   `?   `?007|unable to get last line㿀  2  z F &@$@">  | x `" 5 ' '   ? "'&@  @ 0&@  @/ `/ `/ `/$ $ $ $ $@ |  8&@&@ 008|Error: unable to retrieve line %lu㿘 @Ӗ㿘$ 2&  @   " 2 @ؔ 2    @ǔ@(#)log.c 10.8 (Berkeley) 3/6/96009|Log file㿘&`&`  &`,&`0&`(&`$ "! @%D &`   @`X .`X 㿘` "` @&`` "&` @c&`&`  &`,&`0&`(&`$ 㿘  `X "`,  L"`, P"`0  "`, P"`0@ /usr/src/usr.bin/vi/build/../common/log.c㿈     @- "& $  *   ,@g  (' ' ' '   ? ( $ ($ $ b@Δ ð 㿀'H `X  a .`X`,   2W &`,H ǘ H`"' D " 'H  28  `  `@,` ", &``*` H@gO ` @gJ`(' '`' '`  ?`( &`(&`$ b@c! 㿈  X " ,; W  23 $ ,    @,Y  "' $   *@  @g  (' ' ' '   ? ( $ ($ $ b@ !W 010|Logging not being performed, undo not possible011|No changes to undo`  `X  @> `( 2 `X @3 b@!  ,`X`(' ' "`(?$`(`   ? d*  <x<"`( @f  `X ,`XS  Ē @f ?Ā 2E `X d & d Ē @fq Ĕ  23 `X \ & \ Ē @f_ Ĕ -   X "`(& X ` & ` В @fH ''̐@ 2 `X`(@b~ `X ,`X 012|Logging not being performed, undo not possible`  `X  @ `( 2 `X} b@C!v  ,`X`(' '!`(?$`(`   ? W* @@@@,Ȓ @e  L@2 `X`( ې? `XȒ @eՔ  L@`( $`( `X ,`X3 Ē @eŔ  L@2  X   X & X ` & `В @e ''̐@] 2 `X`(@a `X ,`X 013|Logging not being performed, roll-forward not possible014|No changes to re-do`  `X  @ `(`$@2 `X @ޔ8 b@"I  ,`X`(' '  @`( $`(`   ? f* `x`( $`( @e3  `X ,`XS  Ē @e) Ĕ  2B `X \ & \ Ē @e Ā 23 `X d & d Ē @e Ĕ ֖   X "`(& X ` & ` В @d ''̐@ 2 `X`(@a' `X ,`X 015|%s/%d: log put error267|Log restarted㿘@*n @7   @  @(@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. @(#) Copyright (c) 1992, 1993, 1994, 1995, 1996 Keith Bostic. All rights reserved. @(#)main.c 10.47 (Berkeley) 9/24/96exnexnviewviewc:eFlRrSst:vw:only one -c command may be specified.only one of -r and -t may be specified.only one tag file may be specified.-s option is only applicable to ex.window=%s((h !!P&(h(  "!&( & &  & & & |&  & | |&  . p 0& 0& 4!,&!,&!0&!@&!D @ cp @cx 2 @c @ c    @  *       (T @&(T!! \@D?k? 8d* \\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\$,\HT! "t&! `(T ?&(T  t r  rt t"t `"t( 0Q#*  `  @k `(T 2  @!Ԁ Ԁ  "" 2 & "`{&  " " " 2 & "`&  g  ' 6' )"@`` 2"@`?"@@  M  !ؐ@@*9'@b'''''Ԓ@ Ԓ   @; Ԓ (  @5 Ԓ C  @/ Ԓ G  @) $@ "$  "  *` * 8" "4 ` " X*` * 8!X"8` rԀ  d&2 r  2 `@kԀ ޠ ~ ` " X*` * 8$X 2 "! `  ` "֥   & @a @^   & \b0@t   @`"("$@r"@"` 28d`$  Ԑ b   $Z@{$@ 2Ԓ  Ֆ l  |  d&  @  [ Y d !  @z @_Ԓؔ  E  2 (d耢  (d@ ? ` "$ h @bĐԀ Ԁ 2$      @Ұ 0 @ %s%.*sex/vi: 㿘    @ s   @"   @ k  @  @" (T @ _  @(T a!`@;b  l a!`"(%#  b80 @;} `"  "` "@ l 2 ---c$-s㿘`@ e'#p#x@@pch "[ @J@ +& -J` 2@@\ (&@ p*@ `*` `*` `>*`@`X@\А &@ -*@@ c*`@ @v -`2+`J` 2@@\   &@ \b0@*   @ #x*@ *` *`J  c T t w2`@J  "``@  %s: %s 㿘!a!`a0@:!`a8@:`  \@"0a!`@:ޒa8a!`@:ْa@@(#)mark.c 10.13 (Berkeley) 7/19/96"`8 㿘 `8`""`"@@\p `82 017|Mark %s: not set018|Mark %s: the line was deleted019|Mark %s: cursor position no longer exists㿘``" '@` " `*` * !X  6H ``*` * !X  !`   x  2 ``*` * !X  `@İ 0 & & 㿘``" '@D &@[   @ 0 2  8 "@  8"  " 8  8 "` "@" $"`  2     $ $ ,  , ,   8  *  2 㿐`"   `< @\% 8`"6 `*@ ?` .`@&`@`2`! Ւ  2    "   8`  `  &`@`2` @(#)msg.c 10.48 (Berkeley) 9/15/96020|Error: %s, %d: : %s%.*s㿐'P'T  'X` F `"C Bl`; #*`@הT4T$ . $$ " $ $*` * 8   T $T$$ " $ $*` * 8  0  $@l0@[l`   "` $   ` `t@hT >"hT@Z͐,'     (T!" x' @$X "l  t x@$L "l$ t t x'(T!$(T` b@z @]@``? ;: 6 ""` "*` * !X  L@%' L  "@@%'q @' "@@ؖP`'Z`2$ \@A"0@%'G  A  /k 蔒 a!`c@8S   ` `t@hT >"hT@Yl" 㿐! \0 "0@$"0    ` `thT >"hT@YɐP@0 299|yanked298|shifted297|moved296|joined295|deleted294|changed293|addedxh301|lines300|line%lu 㿐$@& X# " # #*` * 8  , \@`@   t   ," \0    "'(T!"  x' @"" z"  t x@"" n$ t t x'(T!$(T   Ф  , \ 8 ; ,@`,@`, @$ \'@!\ \ 2`@@@[@,@`@@[~@," \¨  ,@L (    ` `thT >"hT@X317|%d files to edit021|new file022|name changed023|modified024|unmodified025|UNLOCKED026|readonly028|empty file027|line %lu of %lu [%ld%%]029|line %lu㿈 @\ '    "'(T!'*    @"2 p*   x  t@"$ x b$ t t x'(T!$(T   ( * @ *`  !]L' `*` * !X  L@Z@ L   :,@` ,@$@%` $ !  @ 2` `x@ @ߔ@[@ :,@` ,@`$*@&$ `  ?# @2%`   `@@Z{@  ,,@` ,@`  X ``@Δ@Z_@  !  ,,@` ,@``@@ZF@ "쀊 " " "*` * 8 0  ,,@` ,@``@@Z @  :,@` ,@`(3쀢 w쀢  `@p@Z a@e.`* * @P@)0 a(@R@@ZА@ ,@`$@'( 8@$@N@ /2 `$@ 8?@@`@*N@@  8?$@ .@ ..@.@.@$@' (    ` `thT >"hT@W!LC_MESSAGESLANG%s%sVI_MESSAGE_CATALOG030|The file %s is not a message catalog㻀@* /"#L  2@W#pK  @Wy#K  $@"`   @_  *ah 2+"ah +' ' '`  2` 2 `c@"  *`@*ah "ah   0 "!h  h "  @ " h 㿘 h  @268|confirm? [ynq]269|Press any key to continue: 270|Press any key to continue [: to enter more ex commands]: 161|Press Enter to continue: 275| cont?271|Press any key to continue [q to quit]: 㿘`)"ԓ.`@ ,<aؐa b bPbpb@@V㿀Nac  :N   4N   .N  |*' '@'䀤    "  h   2   ?& *?  @Y@&㿐& @ a#*`:  J  "L@`L@  @L@  { ` `thT >"hT@U  @U"-1.    (T!" x ' @+ 1  t x@  1$ t t x'(T!$(T3  & @ $!`*` * !X L@  : `, J  `L@  @,@(#)options.c 10.50 (Berkeley) 10/1/96p'`P@8( (p,,x,p`-X),P+H-@8( +,`-,`,$,`,xp`P-hH @0 @@-@ -xp.0 h- `. XP.@8(writeanywrapscanwrapmarginwraplenwindownamewindowwarnw9600w300w1200verbosettywerasetimeouttildeoptersetermtagstaglengthtabstopsourceanyslowopensidescrollshowmodeshowmatchshiftwidthshellmetashellsecuresectionssearchincrscrollrulerreportremapredrawrecdirreadonlypromptprintpathparagraphsoptimizeopenoctalnumbernoprintmsgcatmodelinemesgmatchtimemagiclocklistlisplinesleftrightkeytimeignorecaseiclowerhardtabsflashfilecextendedexrcerrorbellsescapetimeedcompatibledirectorycommentcolumnsceditcdpathbeautifybackupautowriteautoprintautoindentaltwerase   ph!`$X%P+H)@/8103(9 675=<A;>>HMHJKLwswmwlwiwawttytypettytstotltagswsmdsmslowshsectscrroreparaoptnumodelinesliichtexedebdircobfawapaicdpath=%sCDPATH:directory=%sTMPDIR/tmpescapetime=1keytime=6matchtime=7msgcat=%s./report=5paragraphs=IPLPPPQPP LIpplpipbppath=%srecdir=%s/var/tmp/vi.recoversections=NHSHH HUnhshshell=%sSHELL/bin/shshellmeta=~{[*?$`'"\shiftwidth=8sidescroll=16tabstop=8tags=%sscroll=%ldwindow=%lu031|Unable to set default %s optionh'''''' >  @  ,# .#   @  s," ."   @ g,!` .!` 2  @w  [,#X .#X@Rb! !$@L@U1'@Ĕ > @RI" "$@3@U'@ % b b ?' /@U'@  b0 b0?7@T'@  b@ b@?'@Tڐ'@m  $P@`@TȐ'@[ դ bh bh? /@T'@G  -bx  bx????@T'@/  %$@@T'@  &$@@Tx'@   *bЀ  b??'7@T`'@ m 1@Qx" #$@b@TG'@ڔ T 3c  c??' /@T/'@” < 4c c ?' /@T'@ & 5c0 c0?' 7@T'@  8c@ c@?7@S'@  ;$P@@Sݐ'@p "" = " "  " *` * 8?2 '̀ 2А '̐В$X@@S'@K " Ť /(`€̀ 2Ȱ ̀"X ̀$ " " "  " *` * 8?'̐В$h@@S'@  H## s ` "  h  +, 0`  @   @ W`, *  a  ,  `*` * 8*   @{ <`*  a ,  `*` * 8  , )`*  !, *  a  ,  `*` * 8*   @G +,`@PH`@  @?#@* @@(@R'@ 2 @`@?*   , xI  all032|Usage: %s033|set: no %s option: 'set all' gives all option values291|set: the %s option may not be turned off313|set: the %s option may never be turned on034|set: [no]%s option doesn't take a value035|set: %s option isn't a boolean036|set: %s option: %s037|set: %s option: %s: value overflow038|set: %s option: %s is an illegal number314|set: the %s option may never be set to 0039|set: %s option isn't a boolean㿀    9@ Xb  z #   L  = ?2  = "k  L ꀢ =',@XL n L o  '@H  #%< , *  ``2 ` 2  @ ?2    "  0    `    ` ␀` z`` 25  , *  a " ,  `*` * 8*  2 Ҷ*  a " ,  `*` * 8*  2     2  s 2  @& 2  (  2     @   @   ` ``aL#@ ` ]@ `L䀤` ` `0  0@N[    ` `thT >"hT@M䀢    ` `thT >"hT@M J A ? ">  XF耢    ` `thT >"hT@Me䀢 r   ` `thT >d"hT@MQخ  @  2  Q 2 , *  a  ,  `*` * 8*  @"    2 g 2 @% 2  ( 2   z   x ```2 `"   k- 26 , *  a ,  `*` * 8  , " *  , *  a " ,  `*` * 8*  @  "6    2*  2" @%j 2  ( 2   @ " @M |`@㿘.`*  a  .``* @*``8 @*   @[      2&`` "&`@L<&`&` 2 &@@ "&@@L.&@&@ 305|No %s edit option specified㿘.`*  a " .` `*` * 8*  J 2 2  .`  P %ld%*s   8@Ea ? p`  ## V p#$:  2I`",  ``", 0 ,   1, , *  a  ,  `*` * 8*  , *  a " ,  `*` * <*  " , *  a  ,  `*` * 8*  , *  a " ,  `*` * <*  ܑ, *  a ,  `*` * <  , C*  ;, *  a  ,  `*` * 8*  , *  a  ,  `*` * <*  @ , *  ! ", @K*  ! `*!@Nq "!,   9, i?, *  a " ,  `*` * 8*  "Q`P?*  a  ,  `*` * 8*   @N @N3p3@*  a ,  `*` * 8  ,  `*  , *  a " ,  `*` * 8*  @N@`?@/`. "= ">Ⱥ` E@D@4 2     ? 8@C  6- #/- @.`=*`@B@@@ ('g`@.``Őw`0&ޢ  ##ő,>ȓ*`@@_`0,X`0%s%sno%s=%ld%s="%s"㿘 #&@` ,;    ?+ 0t+  *  a +  `*` * 8   Ɛ *  "Ɣ#hƒc`N@+  *  a  +  `*` * 8 *  5cp *  a +  `*` * 8  +  *  +  *  a  +  `*` *  8 *  "ƒcx@set %s set no%s set %s=%-3ld set 㿘## Ǫ! \ 2#$:  "-,`  C,`` ,`*  a ,` `*` * 8   ǐ*  ǐaǐa@'` *  a   `*` * 8,`*  @' ` *  a ,` `*` * 8  ` *  @'aa,  \2``?`&``@ \@`&@*@@_`?`&``@ @`&@*@@LL Ԁ `?`&``@ =@ &@ =*@6,`*  a  ,` `*` * 18* ,   \2``?`&``@ \@`&@*@@ `?`&``@ @`&@*@@L Ԁ `? &`@ &@ * @` @ H   2  㿀'c| % @.B#4 1 * #0'c N @.1#L0"! @K##  JL &  @ 2 `  2J㿘@@㿘@@㿘``@J#  #, ` 2  ` 2  , *  a " , ``*` * 8* @ ,       _ *  a  , ``*` * 8* @  e    ] 8, *  a , ``*` * <  , ) * @ !, *  a  , ``*` * <* @  (  X    Mq, 㿘 #, ` 2g  ` 2c , *  a ,  `*` * 8  ,  *  , *  a " ,  `*` * 8*  @GF, *  a ,  `*` * <  ,  *  , *  a " ,  `*` * <*  @G  M, @(#)options_f.c 10.25 (Berkeley) 7/12/96㿘  B    040|Screen columns too small, less than %d041|Screen columns too large, greater than %d㿘  ʔ  !  ʔ@!떰 042|Screen lines too small, less than %d043|Screen lines too large, greater than %d㿘 ! ʔ   ʔ!j 0   . 2;?& $` " $X $X*` * 8$` " $\ $X*` * <$`  $X*` * 8 P $X K H    H  > 2 & $` " $X $X*` * 8$` " $\ $X*` * <"$`  $X*` * 8 8  $X (  H  ? H  ? 044|The lisp option is not implemented㿘 ֔ 㿘 048|The paragraph option must be in two character groups㿘@IU   곔 㿘$ &$ $($"$ 㿘$@  @9 $*@&$$ @@. $ *@&$ $ "$ 049|The section option must be in two character groups㿘@I   b0 㿘      㿐 (`€   $@8 㿐 (`€   ;P.@  㿐 (`€  "@@  b`b (( 8: b0b   b" b `b (( 8" " @(#)put.c 10.11 (Berkeley) 9/23/96053|The default buffer is empty054|Buffer %s is empty㿈`2E2 ! `2= 鹔 a#  ]!,*   !@`  `` `@`2``2`*` * !X    酔e  '`J 2\  2```      ' \ & \ '' = ` "%B?' '``     ' \ & \' @4  ' 쀢 2     "'T!" '     @ 耢 Z  x t@ ؔx " &ttx'T!&T쀢 B ` @F@' @F  쀢  `?$@ "  '쀢  `  @  P@ ' ` 2` `@Fe& 2  X } & X ` x& `&'쀦   "Tt2T >&T@x t@ bx "n &ttx'T! &T@耢@ O耢 ¤@F`@F@Ŗ& 22  X "& X ` & `` `     ' \ & \ ܘ   \ & \     ` `thT >"hT@CT@(#)recover.c 10.21 (Berkeley) 9/15/96%s055|Files with newlines in the name are unrecoverable%s/vi.XXXXXX056|Modifications not recoverable if the session fails8 * V" " " "*` * 8@  \"0 @yR  ͔ʖ4͐ Ô-@y֒#  ` N $͔@^@!?"@E6@ݐ &`L 癔 @ 璔  `X @.`X 057|Copying file for recovery...058|Preservation failed: %s059|Modifications not recoverable if the session fails㿐  X @, XC X , X P 20 L @i 0 + (hΒ`   €   L  (h   (h   L@yB! X @, X  !@ 060|File backup failed: %s061|Copying file for recovery...㻘 `"z `X @ t `` €    `X ,`X`L5a `` `X ,`X@r`P`J  * 2C " " " "*` * 8$͔@ {@-!?' (hbȟ @`L  @DE  @ " @ &@D8  (h  ` ` ^  2 062|Information on user id %u not found%s/recover.XXXXXX063|Unable to lock recovery file%s%s %s%s %s %s %s%s %s%s %s X-vi-recover-file: X-vi-recover-path: Reply-To: rootFrom: root (Nvi recovery program)To: Subject: Nvi saved the file Precedence: bulk%s%.24s%s%s%s%s%s%s%s%s%s%s%s%s%s%s On , the user was editing a file named on the machine , when it was saved for recovery. You can recover most, if not all, of the changes to this file using the -r option to : -r 064|Recovery file buffer overrun065|Recovery fileX@w @  ϔ  * 2 " " " "*` * 8?$ϔ@ v@(!ߒ   d   宔(2 &`T?@@ &`P 埔 `L  @ /`?"@]?#@g!?##\ϐ!#`ϐ!#dϐ!#h@#lϐ!#p#tϐ"#xϔPϖp@ a6@Bq@/@#\ϐ"X#`#dϐ"x#h#lϐ"#pϐ"#tϐ"#x#|ϐ###ϐ# ##ϔϖ@@ bH ? *(D#+ <@@ & <N 2& <8N .&@BDڢ?@ @B "  P  ?&`T @Br .recdir: %srecover.r+066|%s: malformed recovery file%.24s: %s vi: no files to recover. 8 *̔ ""  " " "*` * 8@v͐ 2 @#   ږv / \@ӐfАc@B  А@c࢒  T`(  "  I$@  "ϐap@Bؔ  @ג $@ ϐa@BŔ   @Ē 2 * 剖0,%0@M 0 2T`@ 0 T`@:1@ѐ @茔 @0@胐 @ %s/%s067|%s: malformed recovery file068|No files named %s, readable by you, to recover069|There are older versions of this file for you to recover070|There are other files for you to recover' * ""  " " "*` * 8@C ' `'|?     't@ Аc@B$  t$@ \t @   L      {0''$@ޔ "ϐap@A  @ $@˔ ϒa@A   @ 2 , 䩖0H,@ \#b0@k   \b0 @ Ԑ 07@| 2@9H@)@} : @s ` / @>`@>Y@>W@@b@@0^@  |іR 0.  H` "  @>'@>%@@ & P& T`2 X`!3` X @. X ?c @ ?+?@@)  @@   @   а 㿘@@ ?@  " :  @@ 0 㿘@ `? . Ж0@t2`/usr/sbin/sendmail071|not sending email: %s%s -t < %s !Ӑ!@~  !㬖 0 (Ӕ@Ӗ@ @@(#)screen.c 10.15 (Berkeley) 9/15/96㿘& @$2& D    & $  $ $  $ , x$ x`$ |c$ ` "d@i C$ d "`$ $$`, `@ $ ``@N`Ā ,$ `$ `؀`@C`܀ !$ `$ ``@8`䀢 $ `$ `쀢 "* @= $    耢 2`  0 $ `$  `@? d $ $$  @u  &@ 㿘 ? & p `"$ @ " "`   2 ""@$ ?&$@@  2 $@2 x $ " x@<  @< $ x " \> x " @< "$@<$@" @v   ؀ "$@<$ @" @v  " @< 耢 @<@<}`` 2``%``"! 2 "`  ` 2 "` `"`" ` 2`"` "`@(#)search.c 10.25 (Berkeley) 6/30/96㿈 L ̒ 2x  ` `  ` R2N   'N@2!N ' 2$ @Q @J`@`   #\  Ė 7 J@ 2` ( @J@ \2 @J` 2 @` @*` 2'"  Ě `  `2 `2 #\ 2 `@2&  㿀\ w 2ڰ ` @ @ G 2̰ `@` 20?/ `  & @  -  $ " $ $*` * 8  `@   ``   d     (T   C  ` (T v`@  d @   " `\@ Y`$ " $ $*` * 8   `G@ D`>  ": ? ?耢  쀢 "  @/`"` ` (d@` a@y &쀌` &@  ? & y `@ x\    "`@'`%   @ ?$ " $ $*` * 8 2 @ @1  ?8 逌 '`  d    (T א  t    (T ˀ @D  d@ 䀢 2 @  $ " $ $*` * 8    @ߒ  䀢 䀢 2   @В  '  ߘ܀    ??     @/!`f`>    耢 [쀢W䀦而!@ 蒂B?  耢܀1쀢/ܐ ?耢 쀢    @.`` A (d@&  " 耢̖쀢䀌  &܀@  ? && ?'$ @z 072|File empty; nothing to search073|Reached end-of-file without finding the pattern074|No previous search pattern075|Pattern not found076|Reached top-of-file without finding the pattern077|Search wrapped㿘`1א"@.`@^X^p^^^^А -80! '`0 !0 0 0  0@9078|Searching...㿘 hhגb@(#)seq.c 10.10 (Berkeley) 3/30/96㿈\`#\ @Ú2 ``  @ \  "$ @9$ w$  @: (  ` \5"0 $ @ $  \$"0$ @ $  \"0`$ $  @Д $  \"0@8  @8@8 \""0 ݂ . $ $ , $  !D $ !D"  "!D  !D@ $@" "$   `  2   ` *@ H *H 㿐#\  @&  @㿘`"  "` "@ @8d@8b   @8\@8Z 㿘\`2$@ !D L   @8E`*> 2: $ 26  8@  @8-`*& 2" $ 2  8@  & 8 ``" `2&@0  $@ `2&@ 㿘!D " @7  " @7  "@7`"  "` "@@7ߐ!D 2  㿘 !D  +@2 $ 2|  @` *` * !X   @`@!Ȓ % $ Ԓ`$    @` *` * !X   @` , '@! % $ `$  @` *` * !X  ̺ @``2~%s㿘 !Dè 2 $ ِb@`F  |   `   'S `? 'R@ 2``?`&``@ @`&@*@@c`?`&``@ @`&@*@@P2 `?`&``@ @ &@ *@< "G` `B  | `   'S `? 'R@Ò 2``?`&``@ @`&@*@@ `?`&``@ @`&@*@@2 `? &`@ &@ * @2B " `   ?"` @(#)util.c 10.11 (Berkeley) 9/15/96㿘"*! @60@6j     @9& && 㿈&Ϯ쀢 쀠#`? @'" J   ` '? 'B& 㿘@) / 2 㿘@5ؐ ڿ @8c. 㿘! \$"0@'$@"0  \  "0 " @8@? 㿘! \$"0@⾔&"0  \ "0 "2 #@  @  @(#)v_at.c 10.8 (Berkeley) 4/27/96 %lu㿀`0" @` @ *2 $$ @2  5 $  &$ a#  ]!,*    !@   `    2  2. `*` * !X  ʽ  q:   @""`0 '  @  ` Z 2#  ``Q 2 `@2 `0( ۔h@` :   @(#)v_ch.c 10.8 (Berkeley) 3/6/96㿘 !.` !`$ې#*`@oppp0pD@3 @В@b@ @:@5㿘 !.` !`$ܐ ,`@ppppq@ @7@@ @}@5R "!㿘@ "`@ ?&`@`, "`< @2 `<&`D`@&`H  "a 㿈`0@` *!  "a`4쀢 쀢 6<  /`8'`0( ` J@` ' " &`@`, "`< @" `<`4&`D `8@ &`D`@&`H 㿘@ 2  `@ &`@`<&`D`@&`H  "a 㿈`0@` *!  "a`4͗쀢 쀢  ;  @N2 ?`8 '`0( `?J@ ' " ?&`@`<&`D`@&`H`,    @`8?&`8178|No previous F, f, T or t search㿘 ؑ179|%s not found㿘 `* * !X   u@(#)v_cmd.c 10.9 (Berkeley) 3/28/96T@"(  X\H0t  xD (D(pDH`0(D ؄D(@  xpPtH0  p@ x`X8D (D,  xDpXLD@"P80<C(hD@"D@"(DHPphD @؄DH@"@@ `@0oD  ,  , @"x`ml X@( 0MhD ID xXsLF @HEHE < pxE`@@E8@" Ɍ x0 hP8rF ? E,D RD h@(WD@ pD@ D D@h B"`P @(MD  ` ID hqF P(D  (D؄DD xXP@@"( x ̘  hq0F P ? EHD ~~Q, ~~S0 ~~XT$@~0~D@"~}D }}D@"}}; }}p ~ reverse case[count]~ } move forward paragraph[count]} | move to column[count]| { move back paragraph[count]{ z reposition the screen[line]z[window_size][-|.|+|^|] y copy text to motion into a cut buffer[buffer][count]y[count]motion x delete character[buffer][count]x w move to next word[count]w u undo last changeu t before character in line forward search[count]t character s substitute character[buffer][count]s r replace character[count]r character p insert after cursor from buffer[buffer]p o append after line[count]o n repeat last search m set markm[a-z] l move right by columns[count]l k move up by lines[count]k j move down by lines[count]j i insert before cursor[count]i h move left by columns[count]h f character in line forward search[count]f character e move to end of word[count]e d delete to motion[buffer][count]d[count]motion c change to motion[buffer][count]c[count]motion b move back word[count]b a append after cursor[count]a ` move to mark`[`a-z] _ move to first non-blank_ ^ move to first non-blank^]] move forward section]][[ move back section[[ZZ save file and exitZZ Y copy line[buffer][count]Y X delete character before cursor[buffer][count]X W move to next bigword[count]W U Restore the current lineU T before character in line backward search[count]T character S substitute for the line(s)[buffer][count]S R replace characters[count]R Q switch to ex modeQ P insert before cursor from buffer[buffer]P O insert above line[count]O N reverse last searchn M move to screen middleM L move to screen bottom[count]L J join lines[count]J I insert before first nonblank[count]I H move to count lines from screen top[count]H G move to line[count]G F character in line backward search[count]F character E move to end of bigword[count]E D delete to end-of-line[buffer]D C change to end-of-line[buffer][count]C B move back bigword[count]B A append to the line[count]A @ execute buffer@buffer ? search backward?RE[? offset] > shift lines right to motion[count]>[count]motion < shift lines left to motion[count]<[count]motion ; repeat last F, f, T or t search[count]; : ex command:command [| command] ... 0 move to first character0 / search forward/RE[/ offset] . repeat the last command. - move up by lines (to first non-blank)[count]- , reverse last F, f, T or t search[count], + move down by lines (to first non-blank)[count]+ ) move forward sentence[count]) ( move back sentence[count]( ' move to mark (to first non-blank)'['a-z] & repeat substitution& % move to match% $ move to last column [count]$ # number increment/decrement[count]# +|-|# ! filter through command(s) to motion[count]![count]motion command(s) move right by columns[count]' '^^ switch to previous file^^^] tag push cursor word^] ^\ switch to ex mode^\^[ exit input mode, cancel partial commands^[ ^Z suspend editor^Z^Y page up by lines[count]^Y^W move to next screen^W^V input a literal character^V^U half page up (set count)[count]^U^T tag pop^T^R redraw screen^R^P move up by lines[count]^P^N move down by lines[count]^N^M move down by lines (to first non-blank)[count]^M^L redraw screen^L^J move down by lines[count]^J^H move left by characters[count]^H^G file status^G^F scroll down by screens[count]^F^E scroll down by lines[count]^E^D scroll down by half screens (setting count)[count]^D^C interrupt an operation (e.g. read, write, search)^C^B scroll up by screens[count]^B^A search forward for cursor word[count]^A@(#)v_delete.c 10.8 (Berkeley) 5/19/96㿐`02  " ``4`0 `<  J 2I `4`<LӖ 2A `Dl` 2Ȗ 24   &`D+&`H`D  ƒ    Ɗ  &`D`0   > &`0`H ` &`H`0  > @&`0 @(#)v_ex.c 10.42 (Berkeley) 6/28/96X#\  `4 d } @207|The Q command requires the ex terminal interface 㿘 (€  (\    L"`  P"` ` 2`$ ? &$a  <` `4`0(`` pp#\  `4  @/<X#\  `4`<  @>X#\  `4`<  @suspendX#\ 6   ɚ h @180|No previous file to edit  Ô    2 X#\     @/G@X#\ 9     @/,!0!0@p#\ ;   f @!`0@ p`,ސ"\@"@!p#\  `4`<G  " $@ b  2C   $'  '6p !b@ 21  x 8  L&`D P&`H& @ :@@{က 2w  x 8    @ 2i K J`!T "!L !L*` * 8   @ 2M     5  2C @;̐$ ? "`$*@ @ M @>! ! `  , & ,` $ &$@>  2 @ 2    @%㿐 L   & L & P P ` & P L&`D P&`H`0 > &`0 㿐   @ 26 ڔ 2/ @R  _$   "` "  "`   2 ؒ`L`L 2&  "`L& @ "& $ &$ 307|No ex command to execute㿐 L    L  @*    ӔH   c 2  & $"&$ 㿐   2 @$ 2     @2     & r 2 &  `=`&  㿘 ) =  2        `X *`X  @(#)v_increment.c 10.12 (Berkeley) 3/19/96%#0*lo0x%0*lx0X%0*lX%+ld%ldabcdefABCDEF181|Cursor not in a number` # +.`` + -`(`@)z  `0(  ` 6`@  `4ܘ   `8a#J  " *Jo`8%P@>̒ "J@ 0># J  X x2J@Ja#@   @]! "< J  XE!C!J@ 0J@ a#@ `   Ȑ ,!J + -2 !Jac     !|Jac    ͚  D%!a`  ``"J01!0. #@ ` Ȑ 8'  ?Ȑ $ !|J#  2 %J#@  2  @Ԑ! 2  %@))  À` %  "'(T!' 2    2 x  t x " $ t t x'(T!$(T  @,-@` 8x| y `2o ` - | `#" *^ | |` @ " 4R |@ '|!!" d@|$ *`2: ` + x8 1 x + x"`'x d@px@,E@@,@% @,9"""'`4 @(` ` `t@hT >"hT@'182|Resulting number too large183|Resulting number too small㿘` ` ``  0 @(<  b@(#)v_init.c 10.8 (Berkeley) 3/30/96㿘 @Œ!̢ &`$a-$a !H "!|@'V $aD <  aD!D@+!H!H$aH!| " !@*c!| $a|   !,a!$a!$a 㿘 !0 "!D@'D!D "!|@'>!| " @'8 ! @'1@'/&  㿘`1""`H`%"#L%  ! " #D #D*` * 8  " *` * 8@0@+@(#)v_itxt.c 10.15 (Berkeley) 9/25/96㿐`4   2   ? & P   *`" *   =@x@ & `4& L=쀢 쀢 2'! `"   P @2 P& P & P #\`0( `#`#d @: 㿘& P`4Y P "    *`" *   @x@E  & `4& L쀢 쀢 2'  " #\`0( `#`#d @ 㿘@  㿘@ x@  &  L  2Z  ''B #'& P   *`" *   u Lі 24  L 쀢 2+  L   L[ 2   L`& L 쀢 " L ?#\`0( `#`#d @p x`0 > &`0`4`<@<쀢  쀢 ܐ@  & `02 "`4&`8! "! !*` * 8  `4  `4Z`8 2ݰ `4& L`8& P   *`" *   2+`0`4`<@&`0" ``4`<C; 2  "#\`0(`<` #`#d@ " ``4`<C 2 > `8 :`4 ٘ 2     "'(T!"`8'`8  耢 > x  t x "] $ t t x'(T!$(T@)Z`8`4`<DĖ 2H `4`8 2> `4& L`8& P'`4b쀢 쀢 2'+ `8@:#\`0( `#`#d @i `   ` `t@hT >"hT@$x@  & `4!쀢  쀢 2'#   " H`4&`< ? &`@#\`0(`<` #`#d@ x@H  & `4쀢 쀢 * ' " `4&`<`0(`8`@&`@?@8&`@ "#\`0" ``4`<B "#\   #`#d`<@њ !!`0 "(( 82 "  "(( 82 <" < <"44(( 82@ ㈀" ㈔@ ㈀"々(( 8䠀@2 "(( 8 x x" pp(( 82 䄀" ||(( 820!!!( (`0 @(#)v_left.c 10.7 (Berkeley) 3/6/96㿘`8 2`0@#& ( ``8 " &`@&`@`, " `< @"`<`8?&`8`<&`D`@&`H 㿐`, " `0 @`0 &`0`0( ` " &`@`?&`@9`<`@ 22 `< 2`,`@ 2`,`,ސ#@2`, 2  2`,@"ɐ @ ߐ! 2`<`4&`D`8`<&`D`@&`H 㿘&`@`<Ô`@ "`,4  "`8 @" `8`8`@@2`8@"# `@ `, "`< @&`@`4&`D`8 " `< @"`<`8?&`8`<&`D`@&`H 㿘`0("`,`&`@?`4&`@`, " `8 @`82`@@"5 `, "&`@ @" &`@`8 2&`@@"D$ `8`@ `, "`< @&`@`4&`D`8 " `< @"`<`8?&`8`<&`D`@&`H 㿘`, "&`@ @" &`@`8 2&`@@" `, " `< @"`<`8?&`8`<&`D`@&`H @(#)v_mark.c 10.8 (Berkeley) 9/20/96㿘``4H 㿘@  㿘@ 㿈``<Ԗ  2 ""&`@0)`<  쀢 2 `@쀢 *`,2`, `,    @"&`@`0 &`0&`@`<뾔`@ "`,i @" "`< @`<&`D`@Y&`H2`4`<`4@2 `4`@`8@2`4@!IJ `<@8 `42`4`8`@@`4'`8'`<&`4`@&`8&`<&`@`4&`D`8-&`H`4`< &`@ $?&`<  K쀢 2 쀢 ? &`@'`4a쀢 2 `8쀢@  `0 &`0?&`@ @(#)v_match.c 10.8 (Berkeley) 3/6/96184|No match character on this line185|Matching character not foundp`4ܖԀ Ԁ  а `8؀@  YJ >(> ])# ( <( )` >` ] { [  ]ے` }  {Ւ` [ }#$ <!`4?ƒ 2      ``22` (İ 0l&`<&`@`4`<@* `,2&`D`8 :`<`, " `< @"`<`4&`D`8&`D`@&`H`, "J  @"E `4`<@"@ `4`<  'ꉔЀ 22  @*- `4`<@ `<`4 Q؀    ܐ '  " J   ܐ 'ؐ? '`0 &`0 @(#)v_paragraph.c 10.7 (Berkeley) 3/6/96㿈`, "`4 @"`4`8 "`0`4&`<&`@`<4`@ 2 `8`@@8`4`0 &`0`4  2`4`0( ``, @  "?    k``D0c`"?@ ?B J 2?";`,ܨJ .2ب (Ԩ !| ͒J*`:  2J 2J "?JJ@2?J  `"@ 2?2 `, "&`< @ &`<&`@&`@`4&`DU`8&`<O&`@@ m`4@@2"`,`4A쀢 쀢 ? <&`8 `8?@ `,`2`,@ے + @ ސ#`0 > @&`0&`< ? &`@`, " `< @"`<`4&`D`8`<&`D`@&`H 㿐`, `4 @"`4`8 2?2`4@`4 ?&`4`0 &`0&`8`4 ~  2w `0( ``, @ "? `8   ޘ W``D0O`"?@ ?G J 2?"@&`<ޤJ .2ڤ (֤ !| ϒJ*`:  2J 2J "?JJ@2?J  `"@ 2? @~ &`<&`@`<&`D`@&`H 㿘` @"5 @"/`@"! @ 2  Æ  !| `@`@#`@"&!| @(#)v_put.c 10.5 (Berkeley) 3/6/96㿘`0@@p`0(* (``0" ` `4`Dل 2 `D&`4`H&`8 (T 2   \    (T   ؠ? 㿘`0@@5`0(* (``0" ` `4`DI  2 `D&`4`H&`8 (T 2   !    (T   ؠ?  `π!(ˬ˴˼ 2  3  4  5 6 7 8 9 *`(@(#)v_redraw.c 10.6 (Berkeley) 3/6/96㿘 h€ @(#)v_replace.c 10.17 (Berkeley) 6/30/96186|No characters to replaceh `4 tЀ 2J Ѐ 2 `0 Žx? ( ``4&`<`8 &`@А?@@`4, `0@O  & @37 2 ؔ  2 ?` 5!*`@((pPpppp8  耢  ܨ  ,<$@$$&$ @r  @2ܒ؀ Ő߰ 4ڰ    "'(T!'Ѐ  ̀  x  tڔ x " $ t t x'(T!$(T@!Ѐ '@ "`4@ 2`8`4 &`<&`@`4E`8  `8Ԑ '`8 А" ''! "! !*` * 8  Ѐ J   В'Ԑ `'Ԑ"hT@`<&`D`@&`H@(#)v_right.c 10.7 (Berkeley) 3/6/96㿐`4   !I  `0(`8`@`&`@?`8@2`@`, " @2`@@ (  &`@`, "`< @"`<`4&`D`8`, "`< @" `<`@?&`@`4&`D`8&`D`@&`H 㿐`0((` #&`@`4۔`@ 2O `, "` @" ``8`@@8``0 &`0`?&`@G 25 `< m  ") ' 2?`,@ސ#@(  &`@`, " `< @"`<`4&`D`8&`D`@&`H @(#)v_screen.c 10.10 (Berkeley) 4/27/96308|Enter to execute a command, :q to exit187|No other screen to switch to㿘$@@    @" &  2   PO 0  &   "$ &$ @(#)v_scroll.c 10.9 (Berkeley) 4/27/96㿐`0(` `   2  " @`4  2   " &`<@; 㿘`0(`<`? @A   @' 㿘`< @A   @ 㿘`0(`<`? @A  @  <" D @" H ,'" 0@" 0 < 4*  ,2" D @ 8: 4 ,߄   < 4" D" D 8" H㿘`0( ``4 " &`<&`D`@&`H @_`4 㿘$@@@0 @@0`4㿘`0(`4`@` 2&`<@ђ`4 `, " `< @"`<`4&`D`8&`D`@&`H 㿘`0(`& `< @<   `<&`D`@&`H 㿘`0(`& `< @;   `<&`D`@&`H 㿘`0( `  @2$`  $$`  @ $X*` * 8   $`$X  @$`   $X*` *  8    $X*` *  8$X@  ?`<@;   `<&`D`@&`H 㿘`0( `  @2$`  $$`  @ $X*` * 8   $`$X  @$`   $X*` *  8    $X*` *  8$X@  ?`<@;S  `<&`D`@&`H 㿘`<`0( `@;?   `<&`D`@&`H 㿘`<`0( `@;+   `<&`D`@&`H @(#)v_search.c 10.18 (Berkeley) 9/19/96㿘@" 㿘@ search+%lu188|Characters after search string, line offset and/or z commandx`0@   @y p` / ?#@ "#8 #8*` * 8 "" " " @ 2հ  x`8 π 2  L&`< P&`@`, " `< @S `<&`D`@&`H `&`&& ! 2 L@& L PF˔܀ 2   &܀ 2&`D `  " l  d&`< h&`< p&`@M`< 2`,`<   *apK~ w&`D "  @   @=i `R @L z2Y a#J@  ` @Ӑ *`:  + ^  27      21   2(   @`<  2  aȐ!2a`<&`D`@V&`H`0 > @Q&`0 -(&`D&`H 㿘 2     @p 㿘   @f %s%s%s[[:<:]][[:>:]]㿐 !4      (T!" x' Ô     tḔ x 2$ t-  t x'(T!$(T !0@ずc @@     ` `t@hT >"hT@189|No previous search pattern㿐`,   @2  ! "!`" #\ `#\`4`<  `4`< " `,  |X @J "`< @ @  0`<&`D`@&`H 190|Search wrapped to original position㿈`4`<@`8`@@  HP "`4`0 &`0`4`<@8 `42`4`8`@@`4'`8'`<&`4`@&`8&`<&`@`4&`D`8-&`H`4`< &`@ $?&`<  쀢 2 쀢 ? &`@'`4쀢 2 `8쀢@  `0 &`0?&`@ @(#)v_section.c 10.7 (Berkeley) 3/6/96㿐#L " #D #D*` * 8" `, "`0 @"`0`8 "`0`4&`<&`@`<ǔ`@ 2 `8`@@`0 &`0`0( ``4'`  ] "`J`{" ?`, " `} ?2`J {"3`,9&`<J 2?")`,Ӣ`J .2Ϣ` (ˢ` Œ*`:`J @2J  JJ @2?2 `, "&`< 2&`<"&`@J  ``4 @ )    2  &`< ? &`@`, "`< @" `<`4&`D`8&`H`0 2&`H &`D`@&`H 㿐`4 @ v #L " #D #D*` * 82`0f ( ``4 ՘ ? "J {J ?"2&`<J .2 ( ڒ*`:`J @2J  JJ @2? &` @&`0`4?&`4`0 &`0&`8`<&`D`@&`H @(#)v_sentence.c 10.7 (Berkeley) 3/6/96x`4'`8'j 2 `0( `     Ւ 2 2 `4@2&`<`8䀢@ "xc      2 2 P    2 ѢѠ ? T8͠ * PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPr  pn  "  e 2c 2`  K `4@2&`<`8䀢@@ < &`<&`@`, "0`< @"+`<`8 2!`@ 2`42`@`4`< &`<  a܀ 2 ܀` &`@`0 &`0?&`@`4&`D`8&`D`@&`H x`4 2'`8 " `4'`8': 2 `0( `   2ذ Ò           | 2  2  ."  ? h ! S2Q ڠ ؐ   )" ]" "" '    2 `4B 2m `4@2`8@/O U "  "  `''䀢     ) ] " '~{ &`<&`@`, ",`< @"'`<`8 !? 2`42`8`4&`4  f܀ 2 ܀ ? &`8`0 &`0  ?&`8`<&`D`@&`H @(#)v_status.c 10.9 (Berkeley) 5/15/96㿘`4  @(#)v_txt.c 10.86 (Berkeley) 9/20/96㿈 L&`D P&`H@_ 2Z  !& L& P$ &$ ! "   *` * 8 2$ "$$ "$ $*` * 8 #\ #\ #`#d   @ 2 $*@&$@i " 4   2`D$ @&$`D& L`H& P `4P` ` ` `@ `D `< `D`@"(`(!!   ` ` `ᐄ ` *` `  ` `(.`ᐄ `@"`@"`D"`< 㿘 4 M a& <a& Da& @ D "  < 8  (  (l@  @(   <*` * ? "a?"a" " " "*` * 8 2$a @7 2  !a@a@$aaȐ 4aȰ 191|Abbreviation exceeded expansion limit: characters discarded 192|Illegal character; quote to enter㾐'\ ' $ &$ x x  :$ (1א$ $$  $ $  @ $ 1 "; @$$ `2@$`" $@ $ 8 L$  P $ d "  "  $ ('?'$ d @  2 d    @F 2   $ d " $ $ $ $ $d   `$  *   $  $ $ $d    *   $   $  @/ ''d  $ " $| $|*` * 8`"$x 8 " " $p $p*` * 8',' T  d2  d@   *@'d d   /#/#''4d   '('( & L & P@'   2 0@ؐ T( 2p 4 "$ 2'4 '\ 4  "@ ' 4'%\%X%T@&@&ے ?` $"*`@(( \p8ppppX$$9&$@&؀ 2  @*   `d@   D   *@ 'd2g  d!% !T "!L !L*` * 8 2!T@ @!T " !L !L*` * 8J @" @d & ! "! !*` * 8 2!   ! " ! !*` * 8J @"   J   $@C 2 @B4  ' ˒   Z' ed'  d $`* "@*`H DH "%DD/`"* """ " """`d /`"* D `􀠠" ' `  2, #`( ?'(d '(?    ?$  ( X$ (  S `a c  D2  @  ?`#ē*`@ H |  pdh@  @-ה   $@@ @    $@j h$ 8  d T  0@К, 2Ȑ0 d 2 (  d @W(d "    ?$  ?$  $ 4 $ 0 $  @-~  $ , (@d ( "&   @K     , $ ,7@`5K  2.@  , '$ ,K   !  !*` * 8 ` !  `  K     @  . @ x& |& x@2 |& x"& |& &(  &d ( x@l 2#    t@T >"T@    @Q  &;\ 2 ` 2X "0'\ ` X    } "&\` X@@( \` X  &\ &`&(X& '( !    M "&d 'd *   &  & @,  $` d@R`'`   *@ `'d@@" ($ $ (@*@'d  $@ $ 8#   $  @  $ 8 (d(T  0@_, 2W0 Nd(  d @(d @  d ?$  ?$ @d  x@ Ֆ ( "    @ @p@   (" $ d @  x       מ "$   *@  ?$  @+ٔ  "$   @d 2  @  @d 2  @d  @  ^"  ?"# 0J`d $@  @8d''   S "' @  ''  `id $@  @bd     *?  $"  ( $ ($  $$  `Nd $@ @G@i `@  $@d " f$ 8  2   x@ dn` $@(d ?$ #   *@  ( $ (   $   2   x@dI  $@d `"$    $  $   @ J?  2   ?$  ( $ ( @ @    d@  $  ( $ (# "   *@  @J?  @  #d "  ?$  ( $ (#    *    J? p o` @ (  @J?a#@   `_2'0 '0  f a$  ( $ (#   *@   J?㬐@   `_0 0 H#  @J? @ >@ ڔ ;#  2   x@5d  $@ d@`@ p` `"$    $  $ "  ( $ (#    ?$  *@  ?#$ #  /#d$@?  \ d@ '(  ^,  (  ?k'( d @a c  "     Hd@2$` a#@  8 `_4 2" d2 T  0@, 2 0 d @`'@   (  d@@(  a #@  2 `_   @d 2ؐ` ?$  ( $ (   ` @2 Ð`"@'J$ $ 80@ d 0 "     ' '      * "$ d 'd   *   $   $ " " ``d@ ` !   @)H  2g "\ ! 2 '@' 2X '\ 2$T `$@ `4  `@8 2? `2  ! # & L & P@ @ 2, #  @ږ# 2! d@$*@&$d @2%L$@    D  H@U x 㿈'``$@" `?``$6  ?` 2` 0a#@  `$`_a#?  ` ?@  2`_"a#? ` ?@  `_` ` 2"#\``$2 @<ǒ  G'@'@ 2C #\  : 7 /   2.      % `"&` *` `(@&`(" `(``  `(  @@ `(  &`( $@ `" &`' 㿘`?` J  2`  ``$"```$2 f"hT@cT@  @@ 2   H;  @7,@ cPe    ` `thT >"hT@YT )  cX&@ea`T `@ Α, etchT  *  eichT 2Te ?&T쀣 $ &$ 㿐'L  "5`LJ@   $`L@"L @*  * @ a]`LTJ '(S`` `  `ϔ` 2&`L `  "`L@@@ <``&``(&`(`L J 2` &'L , `L @`*` * !X  `LJ L'L,` 2 @`L*@`@# 㿘@  `& L & L& P$ @&$㿘`` @*@`?`@  J@@"``$@ J 2` ! \$"0 @c "0 2`(```$*@`*@`"&``"&``` *?`(" ` ``@ @ @`  ``@`(@ @ @ 㿈@`( ɐ?&`( "``' 2` @  *@ ``@!"`*@*  * @ a]`'   `( ?&`(`J@  `@  @*  * @ a]`9J '@[@" V'` `  `p` " &`"@`@ `(` @`@  `&``(&`(`J 2` ??(`*@??`'' @` *` * !X   `J  `@ *@??`' 2}`(`"  &``@`(`  @@ɔ "'`` `  `` 2&` ` &``  2```@  *`@`(` `@ `&``*@  㿈 4 2 . 8`4&`D`8&`H@J \2 #p`" J \2 #p " #h #h*` * 8@ @SJ "`" `4@J? \"`4&`D`8&`HJJ@2"`4J \"`4&`D`8&`H aȐ 2a$*@&$ 2d   @`4'`8'`D'`H' HJ / #\`D?  #\`D? 2`D& L`H& P . !  @= )  .z 2"  ?# @2$ &$ !& !@  @2 2  (€  㿐@J'``` 29  `@!K  2/ `@ x@"%$ x(' `` 2   `@!)  "@  @@ $*@&$ Unmatched %sx`& L`& P@  2v ؔ @)  2n `'`?' 2c  ) { (  #8 ,`* !XB D   2` K : `ߐ؀@*+ @܀@*# & L& P@Y  2 "P  "H *` * 8  *` *  *   @`` H@  ``"G"`$2?A"``""$3 ` " `("(`  "``(@` ` "`  "` `(@` ` "`"` "`("``"`` `$  ?H@ "` "` " 㿐( / @ x2,  &(@8@` ٘ @@("@" &&( @& 194|No more characters to erase㿘 ܔx@(#)v_ulcase.c 10.7 (Berkeley) 3/6/96㿐`4`8`0(5 3`   `, @ (  ?&`H "@$&`H? &`H@?    2` ΐ&`D 㿐`4 a 2# `4 `8`0 `<`@@    `<ڐ 㿐     (T!" x'     t x 2$ tL  t x'(T!$(T@ @@` a\] `#   * `#@  a,*`@ `/  * g 2    ` `t@hT >"hT@&@(#)v_undo.c 10.5 (Berkeley) 3/6/96㿘&`H  X`*X  E"4㿘  ,"a  X 2`0 *X  @4   "44   v`D Œ`D@@(#)v_util.c 10.11 (Berkeley) 6/30/96195|Movement past the end-of-file㿐` d @@  @Ȕ 0 196|Movement past the end-of-line㿐`@  L ?`@ @ 0 a197|No cursor movement made㿘 Q198|Already at the beginning of the file199|Movement past the beginning of the file㿘`@   &200|Already in the first column㿘       2J 201|Buffers should be specified before the command209|The file is empty202|Already at end-of-file203|Already at end-of-line204|%s isn't a vi commandWindow resize interrupted text input mode205|Usage: %s㿘< 0.@DPDhDDDDDDА 0' P0! h0 0    0 @(#)v_word.c 10.5 (Berkeley) 3/6/96㿘@  㿘@ 㿀`0( ``4'`8'> 2   *  $`,@  ސ#`,#@!P@ 2۰ ?6 ?%ޢ#ߴ! '     2 `,` `@Z@0Vd  n ؠ?j`, f?#aޤ#ߦ!    c@  `_  b I ` `  c@  2`_ @  `_ `,@2!`, "`,R        ?`,  @`4@ `8@`4$ &`<&`@`, "`< @ 2`,&`@`, " `< @"`<`4&`D`8&`D`@&`H 㿘@  㿘@ 㿀`0( ``4'`8' 2̰    1 2      | 2 % {?  r   2 H^ y ` ?\`, X?#a   c@  `_  X ? ` `  c@  2`_ @  `_   0 "`,C        ?`,  @`4@ `8@`4 &`<&`@`, " `< @"`<`4&`D`8&`D`@&`H 㿘@  㿘@ 㿀`0( ``4'`8'/ 2°     2       2 % {?  r   2 Hؒ p ` ?\ X?#a   c@  `_ o O ? ` `  c@  2`_ @  `_   ϒ 9     }   ?`4@ `8@p`4 &`<&`@`<&`D`@&`H`,    @`8?&`8@(#)v_xchar.c 10.8 (Berkeley) 3/6/96206|No characters to delete㿐`4 )   7  2 `0 e, (`@?` &`@?`@ *`8&`@`8 ? &`H`0" ``4`<K 2 7 㿘`8 2`0' ( ``8@ " &`8&`8`@?&`@`8&`H`0" ``4`< 2  @(#)v_yank.c 10.9 (Berkeley) 5/19/96㿐`0" ``03 `4`<  2#  t `<`4"@  & t`D    `0  > &`0`H ` &`H @(#)v_z.c 10.10 (Berkeley) 5/16/96㿐`0("`4`'S  }  '&`D`8&`H`0@",`` '$` "$X $X*` * 88$`$` " $X $X*` * 8&`@s` 2n ` -" . +"`0@` ^"!`0:`T P (@  2M `D @! C `D <@ = (@ 27 `D @!  2/ `D% `D <@ " `   'S` 'R@ ^   `(`S    @   "<"D4<("<"D<((!"!@" @(#)v_zexit.c 10.6 (Berkeley) 4/27/96㿘  X     ܘ  2  2  2 2 $"&$ @(#)vi.c 10.56 (Berkeley) 9/25/96110|Vi command failed: mapped keys discarded231|Interrupted: mapped keys discarded236|Interrupted0  @I LА '@h "   (`      *`" *   2 Ȑ@ 2ڪ Ȁa?" @ 4Ȑ $ @- 2ʪ `0!` ?Ȑ# @4Ȑ@  T  *`" *    ' G' |  ސ!$`( @ L ` @Ϛ`"*`@_,_TZ`_Z  `( @"(`0 #X "#P #P*` * 8 2 @`0 "`0 @`*` * !X   @< @   "``(`0 @p@$`0 L' P' L$`D$`<$`4 P$`H$`@$`8`0@ `@ "`0 (T 2   ٖ   (T 2 `0 ((2 ,`<?` $`< , $ ,`(€ $+ ] @"  2 &@#͔ &     (` Ȑ 4`0@ 2`0  @  L  "`0$ `Ȑ("` `Ȑ >"``0 ! "*`D % "0 " @"$`H0! 0`D@S @$`H @ 4Ȑ`D(`H -`D@`D$ L`H$ P`0@@@ L@`0 @ L@ P@ 'F  "  d   0 (T 2      2$ (T "$ hT ?"hTD   ` $@*@ $$    (` Ȑ 4Ȑ@  2 $( 7$$  (` (T 2&$ " &@ <, `` ~ change case to motion[count]~[count]motion234|Only one buffer may be specified208|No command to repeat210|%s may not be used as a motion command211|Already in command modex@ `?@   :& &&&&& ,&$耢 쀊  '@ `"2 `  g   @   耢 쀊  '@.0"&0 @  耢 쀊  '@ `a#@   `0@T ߰ 0(&0 ' @}  耢 쀊  '@'`"6 `0"   Д  @Z  耢 쀊  '@.0"&0 @E  耢 쀊  '@ ``~ `*` * !X  + `Δ { . `*ݐ!|D @0("'&0 7&0  `~@^`~2&( $ "# #*` * 8 &(  &( 2L0 ``.`*` * !X  ߒ `耢   ~+ `w ! ,@2 `0ߐ &(0 &0 @2 0 %8 ("0`0(&`0&`0".`@ L (@B2# @@0"7@@ @  耢 쀊  '@.0"&0 [ ] Z2> @k  耢 쀊  '@)2  ~2 $ "# #*` * 8   *`ݐ!|@`ߔ  z8 @,  耢 j쀊  '@. a#@  @ߔ j 0 &0 @   ]耢 G쀊  '@. ` @2`*` * !X   ` MX6 @ @֖  *耢 쀊  '@.@" @    "  0   (d@ @0@ @ L   ° @ L ?'؀( '0( @'ؐ('0 7$&0@2'(0 &0 L&4&8 L@&<   < I c !Cv&@ ? p&@'( Ā@  ߐ! &(0  !  ?0 >&0 >ؐ ' L''' P'''€ 2R (< <  c !  = &@ &(ؐ !0 !&0&0&,䀢@8 &4耢@ &4&8&< &4&8&<&@&D&H( @@ L&` 214|Windows option value is too large, max is %u㿘  (€  2n (\  $ ? &$" " "  " *` * 8$a& 4!` " !X !X*` * 8& 8$` $X *` * 8& D& < 4 ?@  & <& D0 < 4? & @& H ! @Q  "a  <*` * ? " ! L"@ !"  ! "`$ &$aȐ 4a    %d screens backgrounded; use :display to list them㿘 ``. `` ! "@ "!2 $`  "` 2 $`"@$`$ `2`$`"$``ب ` 2 $` "``  2 $`"@`&` & `@2` $`" $`  HN?212|Cursor not in a word㿐 L  2b   Pa#J  "      E `"& P@  Ja#@   `_   a#H @   `_   2  *H  "'a4 a0a4   $a0a0 @ka0*@ 㿐@ D D S C  $0 Y  _0 $/ d _/ c/ y.@     @*`ݐ!|@235|Number larger than %lux/ !a.`*  ?Ѐ@ @& 2! #   p?  @ 2  #  Ց.`& 㿘 !  24 ? + * uv0v0vv8vvLvLvLvLvXv8 2 ߠ  (d@ @ Ԑ  ` = @(#)vs_line.c 10.19 (Berkeley) 9/26/96%7lu 'd'\$@2$ !\ .$ "` !&@*` *  *  *  :  @ 4 @ ?@`@ 'Td`2    (ptp !&@* @*`@*`@*`@ (:` @ lh"  8 "*` * 8   `"  ``?@멒", " "$ "$*` * 8'D'D$@D*'<'<" " " "*` * 8 0 @ `x @0@(Xdh W`d`"T@ L@2T !&@ *` *  *  *  : #@ 8"\#@T`2h(&`&` .``-.`"<@  ~<`" $ `*` * !X  ʒ *  * @ a](X(l@2( T &`  .`l'l`l` `'l" "1" "*` * )8 !@, (@@$    &` .`l'l" " " "*` * 8 2 8@d 8 "   "*` * 8 Ch" h<`'l @ # D` #Ā " # #*` * 8#Ā   #*` * 8#@A$*  * @ a] h *lQ 8&` $H$@`'l @ # D` #Ā " # #*` * 8#Ā   #*` * 8#@$*  * @ a]ʒ* $ 8 h*l"  &` $@.`l?'l &` .`d`"T@ L@2 T P@  : PT`* x"x'4'Lhݦ xl`'l @ & D`##Ā " # #*` * 8#Ā   #*` * 8#@ڎ$" * @ *`  !]W"  2 .`$$@.`.` $$@.` 'L&`hHTF`$ 2 L`<T !&@ *` *  *  *  : d#@$ $\#@" "" "*` * 8 2$T T$@ T``\@ #@T`T`2= "6 4 ,(X$ ,$ 4 ,(X$ ` *` * !X   @Ғ,`2 @ h ( 7 * @ *`  !].``.`.`h?&`<`4  "5 ,x(X$ "0,`2 @x(l@x ,(X $ (tp 㿀$@`  !x`hp !!8Jh" "" "*` * 8 2   "   2* ` 2 J "%h !$* @*`@*`@*`@ h:`  @EhX  !("h @(#)vs_msg.c 10.76 (Berkeley) 9/26/96|/-\㿈$  = " !`h"P!\h $!`!\ 2h`2h$!d!t@y hp!l!p^ @ 4@ h? hXhp!hhl@V @!` [?$!`!\ 2h`h @ 4@ ? hl@h!l@!p 2@h!` ;@1 !t" *" * "@*`@ *`!x" @z G@*$!t$!x!d "$!d @ 4@ h?!h!d$!d!aHhX   @ 4@ h?!hh€ 㿘 @ 4@   4?  (€ %s 㿐$  `" @" @"M`8N)hp @ 4@ h? hl@` @% 8?hX"h@  8@ "hXhh€ %.*s. ; 㿈 $@ T $  T ?$Td@$ $T$@`5```  (€  s ߀`"\  "!@}`2a\  a@^!$*@`&$ ( $ 2p@h0`  @J? " 4 2' Ȕ ' 8?X  P"  P"@  " @{$P"lN  "`X .$@ N J  J   X$@L? " $J " "$$ " J? ."@'" "@  (T      (T  €'l  ںx @K'@X@  8 8"@ X 2\ @ 4`0\ 2\ @ ? 4? l@@jȐ 4\ $\T $T\ @@2\Ȁ  $\T?$T?# 4\  @  @ 4@ ? \ $\T $T (T {    l (T p`  4@ ?Xl x\  x?8M@ " *  * @ a]3@ ,@X$@ `*` * !X   +,@``??2 @??̪`@,@X$@l 2l\  l@$X`&4,`ptX.x  &@!Ȑ 4!!X  !P$  $!X $!P$ " $ (€  "$t @2 $!\ *@h&$$* @'&$ (T 2#$  E  2$ (T 2$$" @ `?`@@@@ 2= $ " !Ȑ 4!  @"!$ @&$!Ȁ "h\$ &$h\  $?# @&$!\  '!\ 4@ "  ' 4'$!\$!X$!T@ $!\$!X$!T p  hpԟhT  ?$hThd@$@*@&$ L: N`l "(\$ 2`l@m  "`lK    `"  "` "@@ @`l 2hȐ 4\  2` @(  Ȑ 4  @  '\ 4@ "  ' 4' $\$X $T@hԟа 㿘  4 ( a\@   @@:"@ "  ( (t@  @ @ 4@ (? (@aT @@ @p  @ 4@   4?(  4       ݔ@(Xa\ $a\$aT(l@(€ `2&@ؔ  #   q(d@/(T $(T   q (T $(T :` &@+=+=+=+=+=+=+=+㿘 8`8  (\  (X&`H(\  %.*s 㿘 @ )a@ꢐ $ @$ $   l`2@$" l l$ @ 2@@ $@" "@$  a@Ꞑa!`&`@@(#)vs_refresh.c 10.43 (Berkeley) 9/26/96㿘`  *@ *`!@* ( "`   `&` `@  㿘$ @ `    @"$ $$   `"   "*` * 8 2 `  " " `   "$&2 !Ȁ"  !Ȓ `@8` aȐ 2a  値`  $  !   @ "    "$#$   2$$ &$ h   $  $$!  L$  L   @b 2 $ @&$ D @ "  ! L@:& @ @ 2  R @ N "  < @@z a "a@  Р? < m& < <! L@e@ @ @ 2  ( @ $ "U  < @@"P  ! @A   !`"! a" ? < 6& < < @ 4@ (? (l@ <!!"*@ *`@*`@*`@ (:` (l@ <?& < a?"a < D@8  L  a L*2$a("$!2 2 <2 a@l L < 2  ?G D??""@ T /??"!2w 2q < 2 a@@ L < 2 * =  2:  !J@ ??"\"@5 ??R"g܀ 2  L' ! ' '@  < < 2  ( L $& ' ! '' <2 @ L < 2   L   L  L @ 2 $ @&$" " " "*` * 8 2l$ a La2`$ L@. P ! L@2( @#" < 2 @ !` !"  @Δ $ @ &$@  2y  ! @  ! L@2($@#$@ < 2 @ !` !"  @ $ @ &$@ \ 2M  ! @$ @`" " " "*` * 8  !""Ȁ 2  L2  P@ ؖaЀ Ѐ 2   P Sؐ ' P"@Ԁ@`   ' @  * @ *`  !]}2ؔ  ? *@ *` !]  |   *  @ *`  !]|ݒ $ ]"T$ ؐ ' P"@-`' @ K * @ *`  !]|"  "*` * 8  8"  8?:$$"  "*` * 8  8"  8?:  (p̟  ! L@" " L  2 " "" "*` * 8 ?   L P@  " "" "*` * 8 2  "   *#    #*` * 8: #O #@*K # " # #*` * 8""߀ 9$" "" "*` * 8   8  8  8 "*$ 8:%$#  " # #*` * 8 8 $@" ($ !  !($   @2 ?'$ !8R L@L ̀?2B$  !  !(, ?'$ ! r̀?" Ā "$Ġ  !$ @  D @ " <@ 8( (l@` @@(( Ā 2  P$ &$(T$ L$" "" "*` * 8 2` `Ȁ  ` 23 `2``` 4 `Ȁ  `$@`@=` (̟`@k T`(€ `$ >&$?#J @4Ȱ 8(219|Replace218|Insert217|Command216|Change215|Append%lu,%lu x @ 4@ (?(   @   "(l  L 2   842  /"7  * @ *`  !]zL@@(!?  q*`  @@   * @ *`  !]zL$@@8  ?  8L" (Xl q (X  &`*` * !X  zL *  * @ a]znL(X L  (l@ 8?#( "#  # *` * 8 4# 0@ܐ +H L@o 'ؐ 2 $2@   @ 4@ (?ؐ @ (X+aP `آ@(X#  #*` * 8 2  `# `  X 2? +*`@ تؠ$`, @ 4@ (?# " # #*` * 8 2 0   X  (XT Y(X؁@(#)vs_relative.c 10.11 (Berkeley) 5/13/96㿘 "  "*` * 8   "   ?@ 8" "" "*` * 8 2&@ "&@&@ 㿘  " *` * 8 ) 2 a a   @ @݈8@̈́8D` " "!"!㿐'H`  H}  H 2", 2'Ұ " "$ "$*` * 8" " " "*` * 8H "   "*` * 8 2 `" `2Q??' "` #Ā " # #*` * 8#Ā "  #*` * 8#@ &@ *  * @ a]xԒ@ 8 *  2 8 @$@&??'H` "` #Ā " # #*` * 8#Ā "  #*` * 8#@̿&@ *  * @ a]x@ 8 2 8 @̢$@&`   "5@ $@'㿐  | 2    ? T @ 㿐 |  2",ư " "$ "$*` * 8" " " "*` * 8@H 8@D 8 H 88 # `! #Ā " # #*` * 8#Ā "  #*` * @8&@@#&@ * @ *`  !]wɠe 2 8  8$S " ` #Ā " # #*` * 8#Ā "  #*` * 8#@&@ *  * @ a]w* %? 8 @ 8@ *  2 8 @˥$$@2 ?@(#)vs_smap.c 10.25 (Berkeley) 7/12/96㿐 ` ` }q     ` !@8  !@/"  " q @! <?"2 L ?& L! < "2 L  & L!Ȑ K4!!Ȑ 4!$! L2$!Ȑ 4!$@2 `2! !\ ( !Ȑ /4!(p00@ @ 2 !Ȑ  4!@ "   @! ( 㿀 ! < 2, $ @ &$ kL`0 ''' <2 @ < 2 @`1| "'   ' <2 @ < 2 @( 1 `8.  !"@ !"` !c "   !" !"  ! "`  <! @Ô `u   <2 * @*`@"@$   $ @ؔ?耢 Բ ? !  <2 * @*`@:P  @ / !  A ` !" !"   a"` !!(, @?耢 2 ? ! @A ! " !"  !"   !@R  L  !  㿘 !@2`" "" "*` * 8  ` `  !@  @2 <`@  <* $ &$^  !$@* @*`@*`@*`@ :` @ 2G ,,  !"@*` *  *  *  : " * @@}* !"@ 8  @?$@`@ (@ ,@*`!"  !@@ɔ` 2 ` 쭖 2  !@2  㿘 ! 2  <* $ a&$!",`*  *  *  :  8  !$* @*`@*`@*`@ :` @H ,8 ,  !"@*` *  *  *  : " * @*  $  !( @$$ $ ,  3 ΢`@  㿘 !2" "" "*` * 8      !  a2  `  <@ @$ &$@,  }*,ð ]$ !",`*  *  *  :  8`(3   !$* @*`@*`@*`@ :` @ 2 - *  a"*@ *`@ *`@ *`@ :`"@`*` @G* "w  !q$$ ,  뉖  `$@  !$* @*`@*`@*`@ :` @< - K @*` !"* *  *  *  : " *  @*  $ ,  H ܠ `2$ - @*`!"  !@E  2   ) 2  !2  㿐 aȐ 2aȐ@ 27 "2"t.@ʔʴʴʴʔʔʔʴ@ @  @" ` 2  @`   ` a@ 2m  !@(& Dy 2! D !@͔ 2Q @(  Dym 2 D/ B  @  Q !@'`'`'` '`'`'@  2& @Ȁ @y; '''''' !"@"`"`"` "`"` 6 2  @  @Ā  > < @@9 a@M  ! " x & `""`"`"` "`$"`("`, a  k2 <Đ ' < & <&@ &`"  4  a@  K ! x "@ ;  !8?   !(?! 2 2` " `60D,"C 0>"P &@ T@| 8" "" "*` * 8 2    "  ? @թ 8*&` !"  ! x?    @k  2  p  &@ &` 㿘 (  @*  2%  4 2  a ! 4?*  `@* !@T "  a 7 㿐 4  (l@0(p@ @ 4@ (? (@(2(t ` ! $" " " "*` * 8   !    !ђ _ `? D @  \ !@'`'`'` '`'`'@F 2A (@Ȁ Ȁ 2'" " " "*` * 8 Ѐ ''''''ِ !"@"`"`"` "`"` e  2  @J  @Ā  / < @@* ! 2 " " " "*` * 8  !   a "a@ g < & <&@ &`"  ;  ! " " " "*` * 8 ( !  "@͐ 6  !*    !: ! 2 2v ""  0Z0"Y 0T !!(Q v 2K ? !C !' *` *  *  *  : .* /' ,!`": &@ T@ą 8" "" "*` * 8 2    "  ? @Ӳ 8&`@ۊ  2  珖  &@ &` 㿘 @ 4@   4?( (l@ <!!"*@ *`@*`@*`@ (:` (l@ <?& < a?"a < D@8  㿘 (  @)  2$  4 2  a ! 4?* `@* !@m "  a $ 㿐 4   @` (? (l@0 (p 4@ ?( (t@((@2 @ 㿘." "" "*` * 8 2@  @ &`&@ ` @ & &` & 㿘." "" "*` * 8 2@ ` "`@?&`& "@@&`?& &`?㿘 a L*> a( 7 5 ! L@"   L  2  !8# a"  @2&@  2   ` 2   P@:&@  a 220|Movement past the end-of-screen221|Movement past the beginning-of-screen㿐"+ "s 0 !!"@ *` *  *  *  :  .* @ t@ 2 7h!t@ 2. t 2  !@  ! (    !w&*` *  *  *  : 2 @:`*`b !!"@ *` *  *  *  : 2 @:`*` *  .* N!!" *` *  *  *  : 0.* "tg 26t 2@ @  ! (    !& *` *  *  *  :  . 7} * &@f 2  k  &@ &` 㿘 b "b`b*` * 8 2@ @ " @@.&@+&2@`%?@`? P ?@H `"   ?   @(#)vs_split.c 10.30 (Berkeley) 9/20/96222|Screen must be larger than %d lines to split㿐 4    8`}   I  42  8  ! @z ` "a | `! 2` ! L"@`!" `! "` D @ @  8&`8 .   !"@*` *  *  *  :  :  "&&`4 4"&`4 H&`H& 4 H`4 & H&@ &``  2"$`&  `4* *! @" *   @.* 4 4"@& 4 H &`H&@&`` 2" $` & 4 ? & @`4 ? +&`@ <`4" & < < @ 8& < D @ 8& D$` " $X $X*` * 8&`<&`D`<`@ 8&`<`D`@ 8#&`D"  4 ? & <& D$` " $X $X*` * 8&`<&`D`4`< `  &`<&`D  4  <*` * ?"``4 `<*` * ?" @2  &  & `@2  &` &`d`  $ ` &d 㿘 `"   L"`  P"` ` 2`   " 4 4 "4    "   H"H4 4 "4  `2&@ B D @@ 4?& D& < 4?& @2 &   <጑*` *  "?"?"? "?"?"?  <*` * ? "  0  c  $ ^ $@p &$ 223|There are no background screens224|There's no background screen editing a file named %s㿐  @  i @' &@::   |T 0  $  "`  $  "@ 2 " " @2 $ "@$ #   2 $  "`   2 $ "@ & &  @2 $ "$  225|You may not background your only displayed screen㿐  7     :z-  2 $  "`   2 $ "@ & &  @2 $ "$  @! "!& $ &$ 㿘 @C&@ `" &  L"`  P"` ` 2`& $ &$ !"a 8&8 4&4 H&HD@@"4` " XX*` * 8&<&D< @@(D@&<D @@ @&D?&D&@&<@2 &! @ܒ  "a za ; <*` * ? "L   )  2$ "`  2$ "@&&  2" $ &aȐ 2a @@& 227|The screen cannot shrink228|The screen cannot grow226|The screen can only shrink to %d rows㿘`   @"  "  @&@  `& ` @ 3`   1 /`` @ *  2  4 ``;;""y J  @   ;y >  4"# 4 H# H4@"4H"H<@"<D@@@@ "D@@"@.`*  " @" <"# < @"# @ D 8# D .`@*`" "$ @#$ 㿘`    ` 2      @ " 2    "    @2 / 2   @ؒ " 2  " 㿘@   x ph ` XPwerasetimesuspstopstatusstartreprintquitminlnextkillintreraseeol2eoleofdsuspdiscard rprntflushbrk㿘@P@option requires an argument -- %sundefmaximum option value is %d -- %soption requires a numeric argument -- %s㿀'<bh  %=@$2<c  @$2] `&` 2 N= @@Y @ N u2 N=@`h "  N <2  =@`p  @4 ? @x `= x @Xߔ@ J = @XՒ@  @* (N ^ @N  ? - `  *(@* ( &`  illegal gfmt1 option -- %sillegal gfmt1 option㿘 =@Ub=@RbЁgfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d 㿘=#  @|F <"h"h #=  cH@|9   2 @b@]=#P@|*:%lxcflagiflagispeed%ldlflagoflagospeed㿐'H@' : 'H H  'H%>>H@4`L @ =2,@,@`>`@ L c i>@` 2Ls&  i2 L>@ ` 2Lf& i2L>@` 2 L(@ U& $ l2 L>@`0 2LH& o2 L>@`8 2L;&  o<>@Ւ`@  <(@ i*& ("h"h " @@LJ@2` @ 2` `? (@ M`* @ 2@@ HH g>ttyspeedsizesanerowsrawostopostartospeedoldnlnewlcaseispeedextproceverythingdeccookedcolumnscolscbreakall㿘@l@illegal option -- %soption requires an argument -- %s㿈L@ -2&` &``'*b@  >@#2 # 2  ` >#@W=@   "  &  &`>#@W,@  @ 㿘  D @ז 㿘  " @0"@&   &  $$ >& $ & 㿘@zF 6 F &  * + * - * 0 $߄C" $ "  " 㿘  D @ 㿐   '`` '``@Ӯ & 㿘 @z @ &    ("  "  $@ ( "   "  $@" $ "   "  "  "  " 㿘 @y @m & 㿘  @0 @g  ?` #&  & 㿘@y 6 D &  `"  ""  $ g" $ "  " %d %d 㿘@  D@z F%d 㿘@B @@z @TIOCSETD㿐' `@  @@.`hTIOCSTART㿘@`n  @@.`TIOCSTOP㿘@`o  @@.`xph`XPH @ 8#03(# 3233#@@@@-mdmbufmdmbuf-crtsctscrtscts-clocalclocal-huphup-hupclhupcl-pass8pass8-oddpoddp-evenpevenp-parityparity-paroddparodd-parenbparenb-creadcread-cstopbcstopbcs8cs7cs6cs5XPH@80(   @@xphXP @ -imaxbelimaxbel-decctlqdecctlq-ixanyixany-tandemtandem-ixoffixoff-flowflow-ixonixon-iuclciuclc-icrnlicrnl-igncrigncr-inlcrinlcr-istripistrip-inpckinpck-parmrkparmrk-ignparignpar-brkintbrkint-ignbrkignbrk        x p h ` X P @ 0      @ @ @ @        x p h `@ X@ P H @  8  0C$ (C C$ C -xcasexcase-kerninfokerninfo-nokerninfonokerninfo-newcrtnewcrt-crtcrt-pendinpendin-flushoflusho-tostoptostop-noflshnoflsh-icanonicanon-isigisig-prteraseprterase-echoprtechoprt-ctlechoctlecho-echoctlechoctl-echonlechonl-iexteniexten-altwerasealtwerase-crtkillcrtkill-echokeechoke-echokechok-crtbscrtbs-crterasecrterase-echoeechoe-echoecho 8 0 (           @ @    -oxtabsoxtabs-tabstabs-onocronocr-onlretonlret-onlcronlcr-olcucolcuc-ocrnlocrnl-litoutlitout-opostopost㿘@!0!0 @ @@ 2   ` *@&`   L&`  @## A @' 2   `*@&`  3&` A"`"` B @ 2   `$*@&`$  &`$ B""Ȁ "  @ 2   `*@&`  &`&`    tablet disc; slip disc; ppp disc; #%d disc; ispeed %d baud; ospeed %d baud;speed %d baud; %d rows; %d columns; lflags-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extprociflags-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrkoflags-opost-onlcr-oxtabscflags-creadcs5cs6cs7cs8-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbufcchars%s = %s;%-8s%s Ȓ `C``"CC" CC@u! @u" @u"@u" @@ C"0@uC"P@uܒC"`@@u`" C@u͐"x C@T"! 4  `C"@]@  4  `C"@R@$ 4 `C"@G@  4  `C"@<@  4  `C"@1@  4  `C"@&@  C"@@  4  `C"@@ @ 4  `C"@@  4  `C"@@" 4 `C"@@ 4 C"@@4  `C#@ڐ@4   `C#@ΐ@4  `C#@@4  `C#@@(" 4 `C#(@@C@#8  4  `C#@@@! 4  `C#H@@ @ 4  `C#P@@  4  `C#X@{@" 4 `C#`@p@$ 4 `C#h@e@( 4 `C#p@Z@4  4 `C#x@M@  C#@C@  4  `C#@8@  4  `C#@-@  4  `C#@"@ "  4  `C#@@ C@#  C#@ @  4  `C#@@ 2  4  `C#@@ C@ې#Ѐ(2 #4 `C#@@ #!"C" " C4  #" C 4 ##C##@4 `D @Ð@4  `D @@4  4  `D @@4   `D @@$ 4 `D @@4 @ `D (@@4  `D 8@{@! D@a @<"h"h %D@`@  dH@@a` @ 2@@F 0B@C <"h"h 2  dD X(D `,``@"` %@@`@a @ 2 `  @s@s` @ ڀ!D `@s| `@sy(㿘!l 8 C@so"x$ 8l" <%s: %s %s %s㿘!l 8  lF"`<@sX$ 8@͍ 8 H F@sM#F#@sI  !lF#@sB 8 $ 8%d㿘 ?  1l 0 F@~& 0l1F # 0 M*0` -*@`  ^*@` ? *@4*@ ^*@`@*@`*@1l 0-aefgaef:g%snot a terminalTIOCGETDTIOCGWINSZgfmt1illegal option -- %stcsetattrTIOCSWINSZH@'H'Q"#Q#: #Q% \c* HG@v`c* H@@(GH@?! e"  f a" Q g" Qt@c  'G `@'UtQ#cQ#*`H 'H@=  G@~``@ˠ  G@'5``h@˕쀢 `G@N Ȁ`` `8'H 2'['''H IH 1 8H[ 2H2 ,HJa#@ `  H@q @L@M'G`@=   HH`'G @NX@@4H 'H     @2  G@&`   `g@쀢 G@N@!@^ usage: stty: [-a|-e|-g] [-f file] [options] 㿘a!`H@`@H 㿘@ Ffs.%s8@)H'l %l#l@Ĕ!@? f"$L s F"$D0"$`@@Q#*`@& l Hl @ F"G!X "@   . 0" @. @@HaH@4 @`@/ @?@4  HaP@&.<    @@@ `@@А%s: is a directory%s/%s8l @ @ H!PKl D <  H#@M{= @ l<  l@&( / $H@tl L  l@: l \"0  Hl H€ H!P@ML 0 usage: ln [-fs] file1 file2 ln [-fs] file ... directory 㿘a!`I@ `@Q 㿘@bvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth Edition4.1BSDSystem VVersion 7Version 6swapunusedadoscd9660lfsmsdosffsBNRWb:ers:wnv%srioctl DIOCWLABEL㿐@k I"!+  '|%|#lI@o`?}? 8v* ((((((((((((((('((((((((($((((((((((((((H(((((((((((((h(((((x" "'@ '$""  @  $"" "'@ '$"" "$"@ $"\ $\"  @  $"d $d`T $`T@ IQ#&* @+b   "bl@ l@"`P+b` ` ` !|@!֖ X+ Ibp@$ X"?`vJ!*`@))***Ā @ j@@a @ _@a!@C@ Q? t@ Nt X|`h@o`I@obx I bp@$>`@ϒ 4t.`X| d , `m@ȑ % I@$'b?  @   ``!|@ h3t`X h@9 h@Ȫ!@  `X@y@ɻunknown disk type: %s㿘@А JcX@/@ȉ! @ɉ `@we DANGER! The disklabel was not found at the correct location!To repair this situation, use `disklabel %s > file' tosave it, then use `disklabel -R %s file' to replace it.A new disklabel is not being installed now.ioctl DIOCSDINFOwriting label to block %d (0x%x) lseekwriteioctl DIOCWDINFO㿐  | `  J@K#!lK @K  PK P@K PK@K ~ !W&&6@ 6| \ b| d l e`f@ǔ  l \"0  K[ l T  `&a@:` K @n: | d 2&'@C 6 K ' `m@Ǖ 6I@T "@[ K!@S 0$'| d 2  `m@x  I@S"  d 2  e`g@g  K!@H %s: No disk label on disk; use "disklabel -r" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of disk㿘 \"0    " KI "KI@J*#x0@J'#0 L@J# 0L@J @0@J("preading label from block %d (0x%x) disk label corruptedno disklabel found. scanning.no disk labelfound at 0x%xioctl DIOCGDINFO㿘| \ j  l T   L! @m: @W  t`X@Ɩc t| Ibp@"?X   !W@L  L  |@ r*  A|0@I!`|`` "``L!t X{"Ā !W%L{"2  2   H@ L*  LH (@; | he`e@Z   L@!at`X!@Iu& Bootstrap doesn't leave room for disk label㿘`( "&`(&` @ @n!!ԀL!J  @c *J# %s: type: %s type: %d disk: %.*s label: %.*s flags: removable ecc badsect bytes/sector: %ld sectors/track: %ld tracks/cylinder: %ld sectors/cylinder: %ld cylinders: %ld total sectors: %ld rpm: %ld interleave: %ld trackskew: %ld cylinderskew: %ld headswitch: %ld # milliseconds track-to-track seek: %ld # milliseconds drivedata: %d %d partitions: # size offset fstype [fsize bsize cpg] %c: %8d %8d %8.8s%8d %5d %5d %5.5s %5d %5d %5d %20.20s # (Cyl. %4d- %d)㿘|M`p@X`  +*M`x M``@qM` @k`M` @e`M@a``X M@Z``X M@S``X M@L`ؐM@H`M`@C`(Ma@>`,Ma @9`0Ma8@4`8MaP@/`4Ma`@*`<Max@%`HMa@ `JMa@`LMa@`NMa@`PMa@ `TM@b  , \ ,&  #M, b0@\ , Mb8@`M@bP ``+!+I *Mba@ M*bMb @  #MM#M @'b@bX`8 @b@`8b@bX`8`T@M@b@`8  ?`&  @& *`&*@?`&  @&  & *@P `8 @?Mb@b@`8  ?`&  @ *`&*@@PbM@HbM@D``g@ w # Notes: # Up to 16 partitions are valid, named from 'a' to 'p'. Partition 'a' is # your root filesystem, 'b' is your swap, and 'c' should cover your whole # disk. Any other partition is free for any use. 'size' and 'offset' are # in 512-byte blocks. fstype should be '4.2BSD', 'swap', or 'none' or some # other values. fsize/bsize/cpg should typically be '1024 8192 16' for a # 4.2BSD filesystem (or '512 4096 16' except on alpha, sun4, amiga, sun3...) re-edit the label? [y]: +@""IO@`8I@üI"p+@Fɒbv I"p@FÒm+@+@"i  O@`@O@`P@+"`a!#aa @l LI@jfbx֐ @ġ!@  @Ó!t`Xe @cO@j<"@&?? %?@?``$` @  n? n? $@ ``$` @ ? n N+@." sh-cEDITOR/usr/bin/vifailed to start editor%s %sfork/bin/sh㿀P x'P '''P@F P @+@"@ P@F J P`+@iR' @ˆ  @…  @‚ 1 \@!"0 # P@G 0P @@ĵ @E @~ '@y@ 4  ` @͑:`  @S  @P  @M 䀠`? 㿘P@)bN` 㿘P@BbL 2,   P@bL` # line %d: syntax errortypeline %d: warning, unknown disk type: %sflagsremovableeccbadsectline %d: bad flag: %sdrivedata%d partitionsline %d: bad # of partitionsdisklabelbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindercylinderstotal sectorsrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: bad partition name: %sline %d: too few fieldsline %d: bad partition size: %sline %d: bad partition offset: %sline %d: warning, unknown filesystem type: %sline %d: unknown field: %s㻐  &`&`/P5P-Q+!#@h G P@fc2,@@p :2 ,P"# !$: 6` P@|c8 2(+I!+! 4+! " @| + *@g 'P#@@D6`P@|ch 2*' +ܐ@|p  '@|} P '@|sc P '#@Dm 2L@{&`XP@|^c  `"qL@ "m 4j@g, @"`\ Pc@ܔ    P#@D9 6`J H6`I"XP@|&c耢  `P@|c `@p 0P@|c  @gV '!&`(Q@|`  @gE '&`,Q@{`0  @g7 '&`8Q@{`H  @g) r'&`0Q@{ג`X  @g d'&`4Q@{ɒ`h  @g  V'&`<Q@{`x  @f H'6`HQ@{`  @f :'6`JQ@{`  @f ,'6`LQ@{`  @fՐ '6`NQ@{`  @fǐ '&`PQ@{u` 2 @@f  '@Cm }&`T QL` Q*`: `@ `Q ؐ`6`*` @@f  'Q!@C? $Q @C4 }@fq  'Q!0@C% $3, g+! H+"@ " @f $ *L@a#@ `  @f?' : ' Q!X@B',  *@f $#@f'@, @f $  @e'@, Q @B° @e4!@B @`?sector size %dsectors/track %dtracks/cylinder %dcylinders/unit %dwarning, revolutions/minute %dboot block size %dwarning, boot block size %% sector-size != 0super block size %dwarning, super block size %% sector-size != 0warning, number of partitions (%d) > MAXPARTITIONS (%d)warning, partition %c: size 0, but offset %dwarning, partition %c: size %% cylinder-size != 0warning, partition %c: offset %% cylinder-size != 0partition %c: offset past end of unitpartition %c: partition extends past end of unitpartition %c: block size < fragment sizewarning, unused partition %c: size %d offset %d㿘 (  S#( , 2 0S#8 2 4S#P@Aڒ   2 HS#h@Aђ  H 2 8S#@AȒ  8 2 < ,@ 0& 8 < 2  8@ 4& < 2 S#@A  @ ( S@A# S#@A  @ ( " T@A  `T 0@A I ,`     T*` h@A}:`@ 8 T, @As:` @ 8 T, @Ai:`  <@T,!@A`:`   < T,!0@AT:` 2 `  T,!h@AG:`` @&`a`4%T,`    `a@A. ``,` usage: disklabel [-nv] [-r] disk%s (read) disklabel [-nv] [-r] -e disk%s (edit) disklabel [-nv] [-r]%s -R disk proto (restore) disklabel [-nv] [-r]%s -w disk dtab [id] (write) disklabel [-nv] -[NW] disk%s (protect) `disk' may be of the forms: sd0 or /dev/rsd0%c. `dtab' is an entry from %s, see disktab(5) for more info. /etc/disktab`proto' is the output from the read cmd form; -R is powerful. The manpage %s describes procedures specific to this architecture. installboot(8)x#IbXUؐ`@ @@*!a!`U@aa!`Ua@\!`UaP@W!`Ua@R!`Ua@M!`Ua@H!`Ub0@C c!`UbhU@=!`U@9b!`UbU@3@@w  (    *`2 㿘@8Failed open to read on %sFailed open to write on %scan not gzip while appendingFailed open to read/write on %sFailed chdir to %sFailed stat on %sCannot write an archive on top of a directory %s`+#,?+@+?"c,+|||""p"b""@+"#0""- Ѐ`rV"P*`@ZdZdZ[\[耦  +"#,V -"c @8!+ &"c, \ b0V@I  + "c,V "c&@!+ "c, \ b0V+ "c@" .+@#,++"   V@a  + "c,V "c @!+ "c, \ b0V@@H+V!`"c+#, !?# "!+@   \b0Vh@H# !+#,|@b  | \ b0V@H0"<  | Va@HW!+@&#,?$#,+"#@ΰ?"<  2|+#0+#,a@   "$"<  ++ "c0#,  @} ?+2 "#0 \"0 ++ "c0"#0+#0 +"#@- Ѐ 2++"#0`|W"(*`@^^L^L^<^L+q?- Ѐ  |"܀+""e"c|"P` >#@a2"""b- Ѐ B+#0 ?+A+- Ѐ "܀ |< @"@ 2 `+""0"cȔ ?"b1|!Ԗ: @"@ "Ԁ`">$"Ԁ bԀ - "b- Ѐ ++b "#?"c+""b"+ "c8 %s: Waiting for tape drive close to complete...done. %s: unknown format, %qu bytes skipped. cpio%qu blocks tar%s: %s vol %d, %lu files, %qu bytes read, %qu bytes written. 㿈+#,  -||"""b" Ѐ aa!!`# !+#0 #+"  ? $  $ * @FX`(@0@#+c@ |+#,@Jb +|""<  +(  +, 2+@#$c@+@#,# +#0  +X X@G<""@l+?"c,|" ||" s|"""b- Ԁ +c4 "c4# b" - ? $  $ * @F""- Ԁ  X``@a00<X @uqc0 ### ` #" @o X@A`0X @uQc0 - +#4##\#`"#d#hX`c0?@%b@""?c+#0 +#8  %+#?,@?,+"#8Unable to truncate archive file㿘+"#<+#0  +#,  @   +  @x3#,    \ b0Y@FJ?Cannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s spec㿘+#0 | Y@Ea?"p   Ya@E0? Failed read on archive volume %dEnd of archive volume %d reached㿘+#8 3+#0 +@[#,| ""bԀ"! "b|""p@J#,| "b+  "#8 \+ b0Y@E40+ Yb@E4Write failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWED㿘+#8 +#,@͔ + "#<|""+"#8"#8+#0 I , C !+#,  @|  4>  b+  @w%#, * %+ % \"0倢 `E +  \"0   \ Y@Dc+"#8F "0 ?  +"#8  + "c<| "b+#<   Z&` + Yb@D40 - \+ b0Z@@D40  ` @S   Z`hZ`@DCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.㿐|" q?+#8 l- А?  ZbcX|" | "b+#0  |4F| C|""b  7"b7 '+#, a@  0+/"#8|"P +#0 +"+#,  @  >   @@ d+#,@  ++ "c8""+#8  Z@D!c  Zc@D?Foward positioning operation on archive failed㿘  > 2B `(? +#8 4+8#0 24 +#,  @C  |@C"@"@4 |2 >`(>|@@ b >@+#,  @$    \ b0[@C+?"c8?Reverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsTape drive unable to backspace requested amountUnable to backspace tape %d blocks.㿐+#8 6+#0 O  4  +`} [@Cdc(t+ + r+`(p #,  @    \ b0[@CtXZ+b++#4  [@C;cK+  +#,  @ D+ \ b0[@CR8+@u2 ""Ԁ 1+`/ @<   `" [@C c+7@< '+#, a@ + \ b0\@C+?"c8? "c8 Unable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Unable to backspace tape over %d pad blocks?c+#8  '+?#,@;? @   \ b0\@B? 7 '+#, a@:    \ b0\@Bv?7 '+#, a@&  + \ b0\@Bb??c#, @? '+ \ b0\@BP??#,@? 4,    \ b0\@Bn;?7 '+#, a@  + \ b0\@BZ'? `#"c8@  [@B!c? 7@'+#, a@Ŕ   \ b0\8@B4?Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > .Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Ready for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again ..Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again 㳈 c@쀢  \ b0]@AG @  | \ b0]@A80|" ?+#< X @oc0 D]"P@@c01#V@oǒ` "+#V@o`Ȁ "++#0 z x  +]"#@@4] "+]"c@@4]"@@- А? 8]]#(| "b+?"c8 ^@@a@?#P@@%#^!]#X@@0]@@#]@@|#]@@y#А@@, ]@opc O| J"b $`O  `O Y  s S"^` y`i# l^ 0@@K#]^@@F P %@@B]+^ x@@;c4% !+#^ @@20^@@/ @@>, ]@o&c O|""+?"c8^ @@0"" ^^@@ ^@o ` ^@@ ^@,^@?! ^ ^#D @c$#D@> U$c$#D!`@?^ could not pipecould not forkar_start_gzip: impossible-c-dccould not exec㿐@菐  _@;a@Y _ @3b- Ѐ   2  @X0 _@]b@@0/ Ѐ    @C @@ _"0@: @7 _"8 _@:b@~@|"Ē@  _@b@?#p@<@ \#-` D U`  O#  @  F@  A@N )a  x@ '-@+6 &"-2@/ 2@* -@,  &-2@! B@ -  ( c@ @*iCannot chdir to %sCan't chdir to %s?#p@ˤ@ u!-  D n   h@7` c#@ @4 Z@N   x?# 8?#0 @?#8-a @ 1-@*&,-4u@/y 2p# "쀢 *@0 %# "쀢 @@M"쀢 " @B@$>@*  -@+Z&-@3."̀ "Ѐ *@ &"̀ "Ѐ  @ "̀ "@  B@#  @)` @>` "b "  "@   \ b0`P@>q  3 1? @0@1 B@u @2# 6" 2`? "` %` * @= !""@g - B@K@2h0 ? < @# " `? "` %` * @= "" 2 ?# B@   !@-#H  \ b0`h@=#H0  ( c@& d@6~@(Unable to open %s to read㿈?'-   @1g  @ !-  ,   0#@ @3N @L  '#a%  x@! ̀`@. ?'#  @2&`@2 @1B   ?  @  ' \a b0x@=g0@)@Ӓ@1` "  @  @@10  @ܔa` @=ga` $b "b@_`   a`? "a``$a`*@ @< $@0t-  @@z  a`? "a` $a` * @< $ 耢 2 쀢 (@耢 ` = 9@ 4`-  4@e c@  H# @5]@Cannot mix current archive format %s with %s%s: Reading archive to position at the end...done. ?#p@#-@`Ԁ   `Ԁ  c`@@3 9#@ @1 0@M;?#?#  8 @/%a+@ ?$@+Ɛ # 2L`b쀢 5L` /`?@"  cc@;`0`@ @].@j -#  b쀢 @@ @b쀢 @@@@ǐ@.ڐ ʐ @'&Ő ?# @( "̀ `"Ѐ #`@- "̀  "Ѐ  @@@ "̀ @@@| `@;` %bb "b#$ @@א` ]b Z`? d"``$` a*@ @ ! ? @o@p`@.Ԑ 5b 2`? 6";  @  @  $ \ b0ax @:y@ 0@@@.0 @@ڒ@ْ b `? "` $` * @9 %b c@ @2@Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.㿐 '-  |"x?3e--/e'|"x @В  @ ` La"Ѐ > @9 `!-  $€ $ ` ``8 ( `Βx xЀ   e@9bp`x @[ - ` "`8@ 0ea?0 ebH@9w?0b "b Cannot identify format. Searching...Sorry, unable to determine archive format.㿘" ,#  ,#,".  *` *   & .  . @  "k?-@*` * "Ԑ@j_  |"x/|5-3f,#@!4 H @ B" xЀ > @9 `h  ,"|"x. @* @*`@`€  .  6. 2 ?Ѐ  @8`h?  x @""x"x  f@8В`?Write block size of %d too large, maximium is: %dWrite block size of %d is not a %d byte multipleWrite block size of %d larger than POSIX max %d, archive may not be portable㿘}bx""xb܀ -  "b"?  fb"܀ fc0 """ f ch@8q?0!+""b"R#  9 ?  :""xbܐ"|"" Write block size %d too large, maximium is: %dWrite block size %d is not a %d byte multiple㿘}"x"bx- Ѐ "܀?  g `"܀g a "@8?0#   ?"xbԐ "|"b  :# }x x+? ȁ""Cannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.㿘#(  gbh܀ +b"#"b"# "|" : @ F+#Ȣ: @@~ 4+ @+#Ȓ :@ D &W @d  1`/"x"+#Ȑ@@"|%)'"Ԁ 8 $|@*'%x" :  'x@$+#Ȓ@ "|+"xcȐ"|""+#"b@b:  :"  - "`  gb@75?Unable to append when there are archive read errors.Archive read error limit (%d) reached㿘+#̀ M - Ѐ  h@7 a`D?{ ! 8?"x"b"b| :#@ B ;#*   :#!)+'+%h#"x#Ȕ4̀    @6ؒ0H "x    >? 8@ ic@5  > Unable to obtain block size for file %sActual crc does not match expected crc %s( H  '" @7 2  \؀ 2  'N> b0j@5'  ;>"|b" ; @?7;    @ "#\ @"  ‒ " ? b"b :@ d  `  H`4 `   @ 4  ` "  ?"  2 `2    ja@4j  Failed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %s(      '" H P2`*    *` 2  @] 2 \؀ 2  ' b0j@4<')7+"x@Ƞ"x@ "x#\@ @<` D` \ b0k @4 / H    k`@    \ b0k@3  8@  k` @3   H`4 `   @㿘+#Ѐ  0)"x"b"b|> #@ B ;# "c !%+#"xȰ4 Q +  `p   k:"  :"+"xcȐ @"|a +#Ȁ&&%'++/-xȠȀ < b@ B =b`x|@x@%Ȁ@#$@xx%< b@ B =bx%&@֔x%-  `"@t   =b  xȐ @%|Ȁ&&x "c(?Unable to allocate memory for user id cache table㿘,   , , ?!,!=@[  $   , ,`" , l@2c?Unable to allocate memory for group id cache table㿘,  , 0 ?!, @/  $   , 0`" 0 l@2qc?Unable to allocate memory for user name cache table㿘, $  , 4 ?!,!=@  $ $  , 4`" 4 m@2E`p?Unable to allocate memory for group name cache table㿘, (  , 8 ?!,!=@֒  $ (  , 8`" 8 m@2a ?%lu㿘,  R >1m@!=,`* @ !,`  $2  `27 `"4 $1m   @   $  @/ (@?   & $&  m@n`2 1m!2& $ @ @@T . # & 㿘, ' >1m@ ,` * @ !,`  $2  `27 `"4 $1m   @b   $  @ؐ (@   & $&  m@ng`2 1m!2& $ @ @@T8 . # & 㿘@7"R?N M, $  D@*x!=,`$* @ #,  @`  #, .?& $`  @ؐ ` $`  @z (  @=?`@S , #@2 $`$ $&@  $?㿘@ߐ"R?N M, (  D@*  ,`(* @ #,  @_  #, .?& $`  @ˬ ` $`  @" (  @D?`@S , #@9 $`$ $&@  $?㿘@$|TRAILER!!!㿘 n@_vcx  ? H   ` 㿘   > &  & < @@"+$@")@".@")@&% (@0@"  '&  #&  &  &  &  &  /  6   & H> @$: #?cp @ $ $? 4??ctn#x#x$ $ $ 4  , -  0@Cpio file name length %d is out of rangeCpio file name in header is corrupted㿘`l   ob@/?  J   N    o@/Ӓb8?Cpio link name length is invalid: %quCpio link name read errorCpio link name is corrupt㿘 H     H` `! ,  HH ob@/ ? H,     oc H &,*, N,   oc0@/y?070707㿘`K p`P@   ?㿘 L w x  >` @ `& `  @ `& ` @ ` 6 ` @ `$& ` @ܔ `(& `$ @Ք `"6 `* @Δ `,& `0 @ǔ `8& @`0& & `A @' H> `; @ `&&   < ( 2 &, H     &,., < &?Y?  W㿘@%`File is too large for cpio format %sUnable to write cpio header for %sUnable to write cpio link name for %sCpio header field is too small to store file %sHc@% Ұ? x  >  ?  ,&  ",   4  H A @   pb  A @X  !ǒ @O     @E     @;  v   @1  l $  @'  b (  @  X " $ @  N , * @   D 8 0 @   : ; @   2 L    pbؐ       2 , , 6  pc@-  ? pc(@-  070701㿘`m qb@{   ?070702㿘`m qc@k   ?㿘 @!~"b㿘"  n ђ n  x  >` @ 9 `& ` @ 2 ` 6 ` @ + `$& ` @ $ `(& `. @  `8& @`0& & `6 @ } H> `& @  `"6 `> @  `F @  , @& `N @  `V @  ,, @& `f @  `& `^ @ ߔ `J&F C`n  " r 9 < ( 2 &, H    &,.,  x H   @ b  `> O  H   @ b  `; ?[  |㿘 @#b"bFile is too large for sv4cpio format %sCould not write sv4cpio header for %sCould not write sv4cpio link name for %sSv4cpio header field is too small for file %s(?@#? 6%?  ?  ,&" !’ @ y    ! @ l    f @ d    "(  (4& "`x H    @ b  `>   6 @ Ř   rɒb x  >, x  >  6 @ %     @      @    $  @    (  @    8 . @    " & @   v   > @ ޖ  k  F @ Ֆ  b ,  N @ ʖ  W  V @   N ^ @   F n    n  "   r'bА    '   2" , ,   , "  6  rb@+  ? rc(@+  `("? (8 (0ǀ2  (8 (0ǀ2 ?∀   ∁㿘ْ   x  >" ]`* ` & `* ` &  `*`` 6 $` * ` & (` * `  & "` *``  6 ,`* ` & 8`* ` & * `*``@  & `H`* `  >   2` * *``* `   > `, \``* ` & `* ` &  `*`` 6 $`* `  & (` * `  & "` *``  6 ,`* ` & 8`* ` & * `*``@  & `H`* `  >   2` * *``* `   > `, `@`0 8& H& ?& @  ɐ 9 < ( 2 &, H    &,.,  x H   @ b  `>   H   @ b  ` ?  &File is too large for bcpio format %sCould not write bcpio header for %sCould not write bcpio link name for %sBcpio header field is too small for file %sx?c@! \? ?  ,&  P؀   f4d ` x`H    @ b  `>   +   ; + +   ; + * 2 :+ + *    0(@( *      . q ua0 x  >N,+V,+,: +, + *` @*` *  @,   q x  >++++ q+ +` : + + *   @` 2 + + *   @`  2 + + *   @`$ 2 + + *   @`( 2 +  + *   @`" 2 +  + *   @u`, : + + *   @f8N +V + : + + *` @*` *  @ M`< ++ *   Bϒ   ʒ  `    u%aX    %   2  , ,  ,  6  ua@(  ? ua@(  Unable to create %s㿘    @m. 6,` @  "?, - \+ $ (&@mܕ4 6c,  0@ v p@( ?Unable to close file descriptor on %s㿘@B @2   \ b0wh@( #<  `$(  @' # ``  36 #  ` @@ - ؀ - ܀  `80   @ Unable to link to %s from %sA hard link to the directory %s is not allowed8, @mc   \ b0w@(& ?<  ,  @h  wa@', ?㿘    `  @O  Unable to copy %s, file would overwrite itself8 @m #L   @2  @2   wb@'   Unable to link file %s to itselfUnable to remove %sCould not link to %s from %s8@l >% \#L 2P @@`@  wc@'o??<   @ % \  \@d % \*  \ b0w@'{!? @'s?#@ c,  0` @}` w  %s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCould not create: %scpioCould not access %s (stat)8    # x"p , $ (? 3* ((((, @Ξ2``&$   *` 2`@, @΁2`x  ap, @  x a@& ?`  \"0 @$#,    @ 6 x@&Ė ?#<    `$(  @w  `$(  @[    x# ``  36 #  ` @m   M-x!@U)c0 D @D(  )@k  \ b0x@&j*`@G2` c @Aa#  6   #  - ؀ - ܀     @- ؀ - ܀ "  `80   @  Unable to remove directory %sCould not unlink %s8@kG !#L 2&?<  @Y 6 ` \  b0y 8@b  \   b0yX@%?8L /?  /@Hf /1,@k (@e! ,#?#<  @v@Cn  6,@j 2 , c@a$@ ,͠ Unable to obtain file stats %sAccess/modification time set failed on: %s8, " ("`- ؀ - ܀  @j 2 \- ؀ -,"`- ܀  ,"`Ȑ b0z0@%h,@8`  \ b0zP@%[Unable to set file uid/gid of %s㿘@n  \   b0zp@%??㿘@  \   b0zp@%,?Could not set permissions on %s㿘@Ho  \ b0z0@%File seek on %sFailed write to file %s㿘\J' \  '&"& $& N    L "  2'<`  @  z 0 @ z 0@$?2&Failed seek on file %s㿘??@Ж   \ b0{ ,`@   \ b0z@$㿘@ @/?&@#   `80   File changed size %sFailed stat on %sFile %s was modified during readFile rewind failed on: %s?c8  `  &h  X 8+?@ :@ D @  `@  H   @"? {ac@(   \ b0{" 8?c   {a0@# ?  @   \ b0{X@# ? & Unable to allocate memory for file name buffer㿘 "b"؀  b "b"耢 b "b"Ȁ b @"b,! @ڐ, "b {@#cH?@ #  @ &?Invalid file name arguementUnable to allocate memory for filename㿘  N  | `p@  |`@#H?0@?`$$N /". $$ $ $ ,! ,a" ,"!"a 㿘,! ` "`#4  "b#P    ,!$`,!@4 WARNING! These file names were not selected:%s 㿘#  @,! )|'a%|  4   2 `` @"" `0@r 2 Can't chdir to %s㿘1,! ',@}&!!1,%# \)|+ ! a",@= ."@Ef 2-*," " &! +?&! !   ! @H !  b0" H@ !  b0"@" ?$""b@ , "a File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s㿐b #,~"b #,}!     8,@-!  $a$f ,հ?a$ 4? E* $D\||# ,a$ <@`@ &,a$  ,}a$ `H@!,a$} ha$ `}@",a$ }u  > x>&,., a$ <>< < <  < (< (0< 08< 8@< @H< HP< PX< X < @@"Q (@"K @E E!,@ @!,@"% 0 @ 5!,@0 0!,&# )a$ 0 @Z  !,& H>&a$ , @ ,6   \a$ b0}@!6,*, &,&!,!$ `@,&*  !$`& %s %b %e %Y%b %e %H:%M%s%2u %-*s %-*s %4lu,%4lu %9qu %s %s == %s => %s 8# ~`@p 0p `@sΒ#8 ` ;!@@~~  #8@6`  @@ "/`  `O `  #\#`~` @p ?  ~a `@p `~a@p`0~a @p  ? ~ a(  2~a0@p, 0? & & * @ @I%s%s %s @#8 2 8;!@/ 4~~  #8 8@5 @@ "/ @s2~#8@ \  J@ *  `0  **  J@*  ` **"    J 0  *J0 0 Є *`(8*`(8 *`(8  0Є *`(Ѕ8  * @  #  8W0(2    0 0(2      0( :(`     J 0*JFF Є  3`+ +`*8І8 + +`*8 &3`+ +`*88 @@B* 0Є3`+ +`*8І8@B*   㿘 / 9  `8W0 (.W.* 2`@2  `  00.* 2`@2  ` `  0.:. ?`" %s: unknown option %c %s: %c argument missing 㿘 \""t" `N?`"bJ -Q b *b "cJ" @u8⠐`"J@ "-?. :  @A  :2J . a!`` :2. Q# . a!`a@@n:  ? \Q* @ "t ". > ustartarsv4crcsv4cpiocpiobcpiopax㿘@@l / "c0 @"c0"@Mc0 @0"@Mc0 @0""c0@Vab:cdf:iklno:p:rs:tuvwx:zB:DE:G:HLPT:U:XYZInvalid block size %sInvalid -p string: %cUnknown -x format: %spax: Known -x formats are: %s gzipInvalid write limit %sWrite limit is not a %d byte multiplenoneError count value must be positiveDestination directory was not suppliedP  9- \ # 5-@tx??`8M!$*`@ <  < , H<<< \<<< p<<<  <<   <<<<<<L\<l<<<<<,8<``@ t`'" c@t@.""`"#P`t"c`"#@` "#L`@"#$`"#4ab@t 60t 7+)%-* :  "* `h|&%c<%# &$ $ %c< %#  c@L@ L  HdFh@t ?@"#:@"#5@"# 0@@-@t'!-,b  H@t#Ѐ $ @ c@ft#a@a` +a),", *a` @m  (,  a@a`0Q"" "b@Lt:     `(@1t@d "@m"  `" `@@ "@S̢@""Ǣ@@ h@Kt +?"c@7$t+ "c̐ @`p0@jt @""@"" @""@@@t @@ t @""@""@""}@B@ @-" sې"/ @( B- "`qȐ % @  @@ B-  ` @ @ @ B- "` ! @ @ - "`" @@@Ґ@@ - Ѐ --,#x"`- Ѐ`K H*`@ \ \   Q#;!Qc* @@` #@# $#0)Q# @T`@?. @ "#DQ#+!Qc* @ #@q# $#+"#́b:cef:hmopruts:vwxzBC:HLPXZ014578write_opt=nodircompress/dev/rst0/dev/rst1/dev/rst4/dev/rst5/dev/rst7/dev/rst8-CTAPE㿘 - " "+% \'-#5 /-`?Ґ?Ѐ J* TdtT (4@ LXl@t` %b c@t@@bܑ* %bܐ $+"#tJ@ -  J` t $ct$c-" @+! "#<"# -" -s" ܐ p$@t 6l@ he$c `"c]"#@[$% V%tR"c O""M&-J" G""%!B%!>$c!:$c!6$c!2$c!.$c!*$cQ#&* @- А?  -@ - Ѐ --,#x"`- Ѐ   '@  #!@@Iƒb 2 @`@  $#  ``@#  @@  0."# # " @w  6@@|@ +!@@I" 2 @`@  `` \ 6@@a@ 2@+"#̀ # "J @"`"#J@ !"c/%s8#'@lȒ@lL`?,@_Ò  \"0  @+!  @g?<    @ ?` /,`ΐ abcdfiklmoprstuvzABC:E:F:H:I:LO:SZ6rUnable to open file '%s' for readUnknown -H format: %scpio: Known -H formats are:H "#L"#<"# -" "#"#P-?"`"#, )-'-751% \/+a9,"@p??ʀ D֑* b< xxxxxxxxxx x0xxxxxxxxxxxxxxxxxxxxP\lxxxxxxxxxx"#,"X% "#,""$"#$-" ܐ $,"% Ԑ $"#@$"#L"#& &Đ |$y&"@3tu&"t@4&a  a @rt@@ْ  *? @] @L#WtJ@ -tJ` tK%I%t',b  H@p#Ѐ <% Ԑ aH@@t!`@a` , *a` @h  (,  @a`@< ""&!&% Q#* @- Ѐ`G!*`@@@ ;`@ 6@@@ 2@0-@ 2  @`@@c"cD `@@ +@+"#!a @G  *?@O x  @%s: Invalid combination of options: -%c㿘 a!`b@hu0'a%,!@듐 6` @hgL0a`? "` "` * @l 㿘@Ge@,   These format options are not supported %s = %s 㿘,"  @p`!a1!` 8@h#0@ Invalid option nameUnable to allocate space for option listInvalid options format㿘  N   `@ `@3?09 ` `@*@.?`"+ ),',L@ $@:ϒ ,2,@:ɒ =@a , "@"`"` "  %"" `$  㿐@  # `  [`YVJ k6` m b 6`- w6`'.  .` .  .` 6` .  .`.  .` (@# 'J x  *  @fm @   usage: pax [-cdnv] [-E limit] [-f archive] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdiknuvDYZ] [-E limit] [-f archive] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [pattern ...] pax -w [-dituvHLPX] [-b blocksize] [ [-a] [-f archive] ] [-x format] [-B bytes] [-s replstr] ... [-o options] ... [-U user] ...[-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-diklntuvDHLPXYZ] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [file ...] directory 㿘 !a@!` H@!`%h@!`#`@!` @ !` @ !` @!`!@!`!0@!``@!`!`@!`!p@!`!@!`!@!`!@!`h@!`#b@ߒ!`"@@ے!`"P@ג!`"x@Ӓ!`"@ϒ!`b@̒!`"@Ȓ!`@t usage: tar -{txru}[cevfbmopswzBHLPXZ014578] [tapefile] [blocksize] [replstr] [-C directory] file1 file2... 㿘 p!a@!` @!`@J usage: cpio -o [-aABcLvVzZ] [-C bytes] [-H format] [-O archive] [-F archive] < name-list [> archive] cpio -i [-bBcdfmnrsStuvVzZ6] [-C bytes] [-E file] [-H format] [-I archive] [-F archive] [pattern...] [< archive] cpio -p [-adlLmuvV] destination-directory < name-list 㿘!!a@@!`!`@<!`!@8!`!@4!`"(@0!`@ܐ Empty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %s㻘  N   b@8HN \b@ݐ 2, c@?0f` @~ @|֖$ cH@q@Q?, @8N2 *@F`@ѐ *b$@ $` +%*`:  P"` g G" `0  p"`0` $` $`@`@, x@2?J  $`- $ -`(" -" $"`( Empty pattern stringUnable to allocate memory for pattern string㿘  N   a@N 2$ a@?0$ @Ȑ$ $ $ $ -  -` " -" "`  WARNING! These patterns were not matched:%s 㿘-   )'a%  2 `` @" `@dw  2 Pattern select out of memoryPattern list inconsistant㿘-     #4   $ \ 2Y #P 6-  2 *  ,-  2*@   $ @qc` ` /*@5$  ` /*@$ @9$ ?J / * $ $  &            "@@ &@7c?㿘 &-   -#4 ? ":@?    "   J  /2 @   @&     2  "`? &"   P  & ?㿘&N ?  ? [  *"N;*`"/N@7*`N@  #P 5?N@ /1&. N@ ܲ`(? N *`"   N@˔ `N@ ?``@2?: N@ `?J!`?   * 8]#2J" -2* J ] * 8 4 @$ * 8 "  *  ] ` Removing leading / from absolute path names in the archive㿘- " N  /-N    . .  @@?&-`  - "` @)`- *-N, /&- ? -N, ,  . ., , @@Ւ,?&,-`  - "` @`- $  @< &  ?  , ,@- #@ @g   ? , @ ", ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > ..Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s 㳐"@Cc0)'1#!@:#0@8`@6#@E, &@A.c @)#0@*,@!#0O  .@#   O  @# ? @@.,$,> 㿘 @ ? ? ,  ,@ : File name %s/%s, too long㿘@N /@ ?#l @b?@ &@ @+@ ?@ * . @+@ ?.  Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s  - $?#P@*PAP X@x 1\@@     @,`@  !X@f 6 V b@X d\"  @L@   ː  Đ ? L@ ,  `,L@  $ b@OP% OP OP  a!`c@` OP!`c0@`POP  P,&@., 㿘I  L D  &\ \ А  *`: ?Ѐ- . @\2 ,@L \ &2,@  ,@` @ @ "@ @'4 r@?@* $@Can't get current working directory.㿘@\T @ٗ   "cH \ b0@0@s (@[ "- Ѐ`#*`@;;;;;v ) #(Cpu time limit reached, cleaning up.Signal caught, cleaning up.㿘 "b " ` `(@h@ 2# @@_ LC_TIMEUnable to set up signal maskUnable to set up signal handlerh @ 2? @ @ 2? @s @ 2? @g @ߒ 2? @[@ "c8"cc@ "@c@ "@c@ "@c@ "@c@ "@c @ "@c@@ "@#'' D'ذȐ @f 6 Ȁ 2 Ȑ @[ ZȐ @T 6 Ȁ 2 Ȑ @I HȐ @B 6 Ȁ 2 Ȑ @7 6Ȑ @0 6 Ȁ 2 Ȑ @% $Ȑ @   Ȁ    @  'ذؠȐ @   @    \ b0@?㿘-!0 -@ 2 -!4 -@! 2  -!( " @F   Unable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memory㿘 "V?N $!-!0 2 N!=@^͒  $!0 :aN # \N  #" @" 2  a8@.?  @b @ҹ@iޒ!=-!0, @ " 2@4 2" aX@۰?0-!0,  ""  㿘 $@i!=-a0* @`  $@2` `2@ Unable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memory㿘 "V?N $!-!4 2 N!=@^7  $!4 :cPN # \N  #" @ 2  c@k.?  @b @A@iH!=-!4, @ " 2@ 2" c@E?0-!4,  ""  㿘 (@i!=-a4* @`  (@2` `2@ Empty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]㿘  N  a@\ /"N,@`N $ А ,2 J2J* .  2a a@  J 2 @~ ` a L@ 2$  *$  @ &*:  M"  c C"    m     $   $ bL@@ eS `L@  @@j $ $N @ 6  b@ $ "($ L #@  6   b`@ 8@~$   $  @  b@ &@~?$ -a( 2--"a("!,  a," "a, b@ ?-( J8@  " * )  @ 6 @ &/  /@  *@  " @ &  @  " @ &    @   2 `?㿘@!@/h ."$@, @ 2j?L?Г* @*`L @`=$@]?@r?`8W?#*`@LKLKL|KL@KLN?Г* @*`N @ D$` d$` N?Г* @*`N @` $``?$` N?Г* @*`N @`$`  N?Г* @*`N @`$` N?Г* @*`N @`;$`@$T&@8@?Cannot allocate memory for hard link table㿘-!t  !-)@[ܒ  $!t  @ "a(?Hard link table out of memory㿘-!t r  e " ` @f)Ǥ-!t,@ 8     2   @    2  ", p,&, .   &   & ? $  $@@}9@}7' @}  @ 8  $ $  $  "$ -!t, $ "   @} @ a?㿘-!t`4 " /  *? ' @fo)Ǒ* @     2   @    2   "@|@|֐㿘-!t  '-t,@ ""@`@|@|`2tCannot allocate memory for file time table/tmp/paxXXXXXXUnable to create temporary file: %s㿘-!x ) !-1!G@Zђ  $!x @ a?@ !H@H- "a@Gʐ@|{   \ b0X@ +@|p?Failed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memory㳐-!x 2  1@G-!x-`@ ;%-' \)2%    @       0@ Ӕ"8c?@~=J @L    2   8 @ G$ E @{ؐ 6-!  @~Ӗ  < -! @} \ 8$ $-!x-` $ " #  b0@ h  \ b0@   \ b0@ |P ? @ Lb ?@{?Cannot allocate memory for interactive rename table㿘-!|  !-"@Yޒ  $!|  @ $a?No interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memory㿘-!|  @ aH @"-!|, @`@8@ ````@8` ", @{I`@Q &` a@{  @C &@@>  &`-!|,  &`" @{(@@{& a@ ?㿘!-!| @@Д"!|* @ @8p 2   %,&@., Cannot allocate memory for device mapping table㿘-!  !-!=@Y)  $!  @ oc?㿘 @ @?Device map table out of memory㿘-! +@d:!=-!,`@  `   2 ` @z  -&& !,` & "  @ +` Unable to fix truncated inode/device field when storing %sArchive may create improper hard links when extracted㿘  -!   @ 2 "`*  ` 02% & V&Q s A#5-!@z 8 "" "$ 5-[ @@%R   #-   &#-a  @y  "a" "$  &  & a@  @aȁ Cannot allocate space for directory access time table㿘-!  !-!=@X  $!  @]`0?㿘-!  %-,`@ " `  ߖ   2`a<Directory access time reset table ran out of memory㿘-! 4@c!=,`  2     2  @yc  @  $$ $ $ $ -!,` $ " @yn @a0㿘-! -@bؒ!=-!*@ #-*! @ 2      2  ? "@ & &@y;@y9 ?Unable to create temporary file for directory times: %s㿘-!? @&!H@D-  "a c @@y?@DX@y  Unable to store mode and times for directory: %sUnable to store mode and times for created directory: %sx-! .  @{  ? !cؔ`'7 '''3-a@zے؀  a@zӔ  b "b`@EUnable to set mode and times for created directoriesp-! W "@E!-!??@{x  =!@z 7!  @{j /!@zЀ (!  @{[  # 쀢 - ؀ - ܀ ზ `"@ !!-@z!?$!"@ @ْa 㿐`@  @6` `  *   @`' *  @@a 㿘 $ $ J$J` ?  "&  @   (  ((( (  0(2      0( :(` 㿘     .  ... .  `0.* 2`@2  `  0.:. ?`"  !   ustar㿘aL  ab(@z    ? 剔 Β"` write_optnodirUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.㿘!#%"") @4}"  @4wb   b@  b" b- А?   c( @?0 $㿘" °?` & `" 6 `&  c&* `d  ` /6 `l  `$& `t  `(& `|  H > `  `8& @`0& &   x  > >N` 1"= 2 5)8.,   &, `䯔 c&,*, `  (  & " 6, `䜔 c&,*, `    A6   &`   6  " 6., 1&,., &,L /  &`   6  " 6  &`    6 `x H   "@ b  a>  > L /2 ,?& Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %s㾐 ?` 8 *`@lllm`m@mm(m@m@m`" %ݰ  ԒcH Βcx Ȓc ’c, d c,   ``d `  㚔 c/S x  >   / @x d /* l   2 ?  1,  , q c,!  | n  q%,   @xӔ d H |    _`  x H  "@ b  a>   d @ C $ l 6 9 ( t , / 8  "  %!    o! &?  Ͳ ? ` `     `@ @w 㿘 ?;  ?㿘Э ?  ?㿘aL  !b(@w    ?  *"` 㿘 ߒ" 2?  & " 6 &&NaY   aY⭔ .a /, `⢔ c@&* `d ⬔ ` /6 `| ⤔ H > ` ⛔ `8& @`0& & .aH (a) 6.a(`t ⅔ &.a( $a | 6., `l w &., &, x  > > ,&N``7#,*`@uuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuu$u$ttt0t u  &`  |  &`   6  " 6 J  /2k &e* N` 4   &`     &`   6 aI  aQ  `,, A& N` 2   &`  ( 6   &`    6  " 6, `᱔ c&,*,   &`x H   "@ b  a>  > `    6  Ustar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sFile is too long for ustar %s00Ustar header field is too small for %s㽠   6b0  ?   , d bX',  @'2 bx x     >,Y  /, aY @v   c,`c ?` b *`@xHxhxhyyyxyyy 5,`` @v_ d:aI   4 3,`` @vQ d , aI ږ   aQ і     6,`` @v5 daI   1 2,``, ൔ c,aaI @v" aQ @v  `|   2a   0 7,`` @v daI @v aQ @v `x H   "@ b  a>  `|    kbab(n abi  `d e  S $`l [  I (`t Q  ? 8` G  5a γ 9 a) 1 !` ,  ʄ! &?   ?        b @ `da  ?  /"J J J" `4 ` /dev/ttywrFatal error, cannot open %s㿘 @E @2`-  "b@2`-  "b-@3"@t#@   `@2?㿘'H'L'P'T'X1-" H@PN@i"㿘` -"@ 2. ?@" 2* %s: 㿘'L'P'T'X L "c(#  !"  a@Wْa`$"!a!`b@O0!`@P  @Wʒ!` <%s>㿘'P'T'X P "c(#  1"  a@Wa`&"1a!`b@Ox0!`@O`  @4!`@Ojb a@Wa`㿘@ɔicmpunknown protocol icmpsocketDI:LRS:c:dfh:i:l:np:qrs:T:t:vw:bad number of packets to transmit: %s%sbad interface address: %sbad timing interval: %sbad preload value: %sbad packet size: %spacket size too large: %sbad tos value: %sbad ttl value: %sttl value too large: %sbad maxwait value: %sunknown host: %s-f and -i options are incompatiblemallocbind-R option and -D or -T, or -t to unicast destinations are incompatiblerecord route not valid to multicast destinationsping: record routesetsockopt IP_MULTICAST_LOOPsetsockopt IP_MULTICAST_TTLsetsockopt IP_MULTICAST_IFgetsockoptsetsockoptPING %s (%s): %d data bytes PING %s: %d data bytes ping: recvfrom0@J`  ' / / @}#  @Rc @% "` @ c@ @%% \@!@9--"Ħ #--7-@UA؀?? 3 * (( P`Lt @ϔ  "` c@t $$    @$ @0   !@ϐ  @Ԓ  $ a!@b t@ _Ā  @wt2` `(@t @/ `/ `/ `/ "y$ t @ '"̐ `H@t  i$ ` "`c/@  t@  @`  @g 6R ``@t  H$   $ @_tA  <$   8$   4$ t @C % `x@^t?#@# `@St $$ t @Qy ` `@Ct ($ t @ / 2 `@2t !$ t @ &А `@"t@Q#&*  @@@!  @rp   ,  ,@  " @2 `  a@,`@@qN` @@ 0 "   - @a("  "`-" @n' @̑aP  -"@,`@@p!?c $!  "#< 8 !` "` Ȓ @r  Ȑ , Ȑ *`"` @$   @UaX @  ?c @#Ә    ?c @#ǘ  (< 8 ` "``$"` $ $  @^a` $#!    @#  <* @*@@ $ ,`4`4`4`,` ,` $` $`  < 8   @*a/Ȑ '/ɐ /   @#j ( 6@!@q     @#W   @ƒa    @#E   @˴b    @#3    @ˢb8 ' ?c@#A 6 @ːbX@0 ?c@#   0 @|bh' ?c@"   !'@b-"x @  -"`@ @ofc @obcT?@?2?  @C #!   @v'' ,@'   @"Ș  '  @"Ě  \"0 @"@ ` @*@p 㿐@= @o cT `- -" -"B-ąB' "  -"А @nc@ping: sendtoping: wrote %s %d chars, ret=%d 㿘--Ī -- 5 `"`5 !"5  , 4 '-@V⼤<#`4 @V⼐  *@ * , ؀ Đ @@ -" @`5` $  ܢ 5 @T5    @"  @Q  (`@   -b@n packet too short (%d bytes) from %s%d bytes from %s: icmp_seq=%u ttl=%d time=%.3f ms (DUP!) wrong data byte #%d should be 0x%x but was 0x%x %x %d bytes from %s: LSRR: 0.0.0.0 %s (same route) RR: NOP unknown option %xx@@)  -  @ !'@!@0Dz&@ ת`a ` "` ؀ ">` `/ ` / ` / ` / ` / ` / `/ `/"@'"@`''А"@@'-bDčB?-"腡B:"-"؁):"-"؁-:"`-@Ub: `J :@` ` "``?"` `, 4 '-@U⼤<#`4 @U⼐  *@  ,  J "  -b@m p '@l"@`"0@  ؀  @"8 @"H-"Ē  -"J`!-3' @ @ "P@ ":`!- ?$ @b@ @"`% `"ڒ`  !  *  @@c @"@[@p  +a @ "  " < @A"?` @`` @* ` @@* ` @@* ` @@@("@v!@!"Ȧ}?a? "a`%a*@ @E բ`` @` @?a#X @c\@63  2@"Ф ?%@@"#X#\@m$@א"` @* ` @@* ` @@* ` @@@Đ"@!@"Ȥ?a? "a`%a*@ @ բ`@"?"@ @? L` a? " " * @ a@bs! ` 3f` `: +ff:? :8 3f* 2 #--- %s ping statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, -- somebody's printing up packets!%d%% packet lossround-trip min/avg/max = %.3f/%.3f/%.3f ms 㿈 @k a? " " * @Q a@b!#@`#(@`#H@ ` `@#` ` @#xa "@ * *  @cݑ* @#a? " " * @   `%  ؀ --" F @' …D--b #\b?@# @m`?Echo Reply Destination Net Unreachable Destination Host Unreachable Destination Protocol Unreachable Destination Port Unreachable frag needed and DF set Source Route Failed Route administratively prohibited Dest Unreachable, Bad Code: %d Source Quench Redirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect, Bad Code: %d(New addr: 0x%08lx) Echo Request Time to live exceeded Frag reassembly time exceeded Time exceeded, Bad Code: %d Parameter problem: pointer = 0x%02x Timestamp Timestamp Reply Information Request Information Reply Address Mask Request Address Mask Reply Bad ICMP type: %d 㿘`!*`@hxTd`@ː"0 ` 1*`!@$DDDDDDD4@"0e@"00a@"P0]@"x0Y@"0U@"0Q@"0M"H @#0E  "  "  "@|# @x#8@s#H @o#p#@j # @c#07   " @W#0 @T#0    0 @K@ܐ 0@E X0@A h0@= 0@9 0 @5 0 @1 0 @,Vr HL TOS Len ID Flg off TTL Pro cks Src Dst Data %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %s %02x㿐 , @#2` @2`   @  8 ? `2` @*  p  @  '@煐!@ؐ  '@}@ѐ   ! @Ȑ  a? " " * @ %s (%s)㿐'D  DD @ D'@H#!@2 1'@<#!@21#TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) 㿘l `*`    *`  *  "   *`  * "@ @O patterns must be specified as hex digits%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0x (N@ aJ㬐  D @ #pJ 㬐#\#`#d#h#l#p#t#x#|###c@ȚĠ? #"?#" @6 @ .`@ ò`@. (  @Ր#ز @ #`@`@&`@Ɛ#<2 2 ((  ` `?usage: ping [-DdfLnqRrv] [-c count] [-I ifaddr] [-i wait] [-l preload] [-p pattern] [-s packetsize] [-t ttl] [-w maxwait] host 㿘a!`@Db@i 㿘@benstuvusage: cat [-benstuv] [-] [file ...] stdout㿘@@J- @v*b#% +#)'@KJ?:? 81a* 88888888888888 0$H%0$a<%aL$H%!@$a<$8a!@ $a<a!`@D5b@iy Q#* @!0 !L !H !@  !8 !< @a@a@'! " @Öc@iJ!Dstdin-r%s㿘a !"a4/-+)'a%a  @" @Β(2 a0@ %!D  $4 @"@&А 2%6d 㿘   'aa! ^ ? & @& `& @?` 9 )!@  2 ?` " "* `@ ? Ң!H !0  !H  b@Cx` @2  !L ?`"@&  $ " $* $@p ?"  +!8 ?`"@& ^`"*@ ^@R ??`"@& I " I* I!< c ,?`"@&  M " M* M@' ?j?`"@&  - " -* -@ ?U a#  0?`"@& ^`"*@ ^@ ?:  ? @?` "@ *:  "  "   ?` "@ , :  "  "* ` @?"  @ !0@a4 "aD ?6 a! @ @ c㿘aR !"a4+)'a % @!a  @8  6 !0@ $D T`$4 @T`"@fs 2buffer8aR!!,  %@^ɒ " a0@4؀d!($"!@c!( $!, @c%+),@fa( ,@ @e 6 @#@ !0@8a4 "aD㿘@*$Id: chown.c,v 1.4 1997/01/26 05:54:28 downsj Exp $HLPRfhthe -R and -h options may not be specified together.%s: %s%sfts_read㿘@=!T@@ /  @$!TJ  o`?"aX   /"P+ )@HH?E? )>* 44444444444444444444444444444444444$4, Ȣ  Š    %a\%!h @ Q#*`& @@!\    @0aP2 `? ?"ad"`!X @@D . 2 *@@> : *@v @@`@p@`@   @’  )3%@bN \ 4? 0* LLLLLLL@@!\ @u 0 @  !@  @  !@͠  a` @d  0 @xd !h !@  "0  @ea@fgroup㿘N "!P!d@~ 2 @"a$$user㿘N !`@  2 @ b@$$%s: illegal %s name㿐! \$"0@D "0  a@J  b@Q usage: %s [-R [-H | -L | -P]] [-f] %s file ... [owner][:group]㿘!T!X "#P!a!`c @@^@e 㿘@d-link2link2-link1link1-link0link0EtherIIsnap802.3802.2tr802.2nsellengthsnpaoffsetipdstbroadcastmetricnetmaskdelete-aliasalias-debugdebug-arparp-trailerstrailersdownupisoipxnsinet-a'%s' requires argumentencapsulation routingSIOCDIFADDRSIOCAIFADDRH@; ?@`@@a   ""?`"@@ ? `."8"b"8 @@   ".b *` "̀  @@@d !"b@ @ڐ"Ȁ  @d  @^@d 9?#.#`Ѐ  `@@ "  2@ 2 " 2   "? 2 ` 2  a@<@`?`@€ ? Ͳ`. ̀     2.@*" %!!А@cn  " !!@cb  @c^ !  @G " 6@M! !t b@/ !@c  . \"0 1"耢 .@/!8. Ā b@ !@b @!H@d: 㿘."؀?@b! @  "a.?"b.""؁socketSIOCGIFFLAGSSIOCGIFMETRIC㿘. !耢  @Qa!0a@b @ܐ!?V "ap!0a@b @̐!"" "b mallocSIOCGIFCONFp !. !耢 + @a'#0)'@`U' @ ba$@bm  @" , /Т @2)@ `` ` @cL  ""@e ' ' ' ' ' ' ' 'v @@@_㿘b "b"耢  "at""8  €2`㿘" € 㿘" € 㿘@' b "b"!t." ā㿘" "耢 `6"""`` @b `"" "!t." "!tNote: trailers are no longer sent, but always received 㿘@!㿘" € SIOCSIFFLAGS㿘!0a@aȀ  @9aȐ"b@ R"؀`"p "pap@"ap!r2! @aa  @b0SIOCSIFMETRIC㿘!"b@ @Ր"$ ! a@ac @䐐#%s: flagsUPBROADCASTDEBUGLOOPBACKPOINTOPOINTNOTRAILERSRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST metric %d㿘#@b#ar@"`@  a? " " * @3 " . @ 0"8"8  " ,` @   2 SIOCGIFADDR inet %s SIOCGIFNETMASKSIOCGIFDSTADDR--> %s netmask 0x%x SIOCGIFBRDADDRbroadcast %s㿐 !耢  ! \"0 +Đ @da"Ȓ @a "b@ܔ !0a!@`"Ȁ 6! \"0 1 /2  "ؒ @a !@֐!!"#b@ "'@.@!("Ȓb@ !0a%@`"Ȁ  \"0 1@㳐!8"ؒ @a b""!p (!0a"@`lȀ  \"0 12 "ؒ @a @㍐!H"b@r "'@@8!X!`@3b!p +!0a#@`<Ȁ  \"0 1 "ؒ @aj @]!p"b@B "܀  a'@ݲ@!a? " " * @+  ns %s 㿈 !耢  ! \"0 + @a"Ȓ @a+ "b@ !0a!@_"Ȁ 61 \"0 1 /2  h"ؒ @a 1@!1"b@ " 7 7 7 7 7 7@e8@ !p 1!0a"@_"Ȁ  \"0 12 @`۔ @ΐ!H"b@ " 7 7 7 7 7 7@e@n!Xa? " " * @딒 . ipx %s SNAPframe %s X| !耢  ! \"0 +ϐ @a"Ȓ @` "b@g !0a!@_D"Ȁ 61 \"0 1 /2  "ؒ @`n 1@a!1"b@F " / / / / / / / / / / / /@h@#@!p =!0a"@^"Ȁ  \"0 12 @`. @!!H"b@ " / / / / / / / / / / / /@gې@!X ' (' ' 'Đ ' '̐ '#P' !7' '''   @ "``` 2@``@#Xa? " " * @꫒ SIOCGIFADDR_ISO iso %s SIOCGIFNETMASK_ISO netmask %s SIOCGIFDSTADDR_ISOh !耢   \"0 + @a @_ 0b@ s !0 a!@^P 6 \"0 1 /2  iؒ @_{ @n"ؠȐb@ S @gݒ@"!0 a%@^)  \"0 1 @_X  @K" @f @#!p "!0 a"@^Ȁ  \"0 12ؒ @_6 @)# b@  @fѐݒ@ؐ!Xa? " " * @ %s: bad value㿘."ܓ.`@ `, ,  @7 @O@@] 0@j "  @h $ a@%s=%o%s=%x㿘  N . .`"H. "P@2ta!?`"@ < " <*@頒 N`K. 2 %a ,>@ : ?`"@ ,`"*@@遒 * :  % a!:` ?`&  @  `&*@ @d* :` :`NN 4N`a!?`"@ > " >*@@ Attempt to set XNS netmask will be ineffectual 㿈.".`@ ,  ,#@@c( 4 4 4 4 4 `4 @ܐ Attempt to set IPX netmask will be ineffectual 㿈.".`@ ,  ,#@@f , , , , , , , , , , , , . €`4 @!8㿘.# .`@@e8 @\ܔ `  ,, , , 㿘@"bNegative NSEL length is absurdSetting NSEL length valid only for iso㿘@. "`Ȑ @Ob" " R   @Cbȁ .* 㿘.# #   usage: ifconfig interface %s [ af [ address [ dest_addr ] ] [ up ] [ down ] [ netmask mask ] ] [ metric n ] [ arp | -arp ] [ -802.2 | -802.3 | -802.2tr | -snap | -EtherII ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] ifconfig -a [ af ] 㿘a!`c@8@]Y 㿘@㿘 @@`@㿘`@@ @㿘`< < ` 4 `< < ` &?`< $`$$`<   $`$ؒ?㿘`< < ` 4?`< < ` & `< $`$$`< ? $`$ 㿘`< < `4 `< < `&?`< `$`<   `?㿘`< < `4?`< < `& `< `$`< ? `u 㿘`< < (`(4 `< < (`(&?`< ,`,$`<   ,`,L?㿘`< < (`(4?`< < (`(& `< ,`,$`< ? ,`,/ 㿘`< <00@4 @2  <44@( < `<00@4?@ 44@?㿘`< <00@4?@2  <44@( <?`<00@4 @ 44@ ߒuappnd,uchgnodumpopaquesappndarchschg㿘*"  "@#a!  `@""@a!  `@ ""@a!  `@""@a! `@""@a!@ `@""@ےa! `@ѐ""@̒a!``" ,archiveddumpsappendschangesimmutableuappenduchangeuimmutable㿐` &@2&')@'%@3c"$ &L " n2 L  o2    ?* : ` *`@`a@#   ``c@# 2 `"&`"@&@`?c@"  2ǰ `" &`"@ &@a@"  2 `" }&`"{@ v&@a@"ʔ  2``c@"  2`"^Y&`"W@R&@a@"  ``c@"  c@" 2a `"4/&`"-@(&@a@"|  2``c@"p  2`"  &`" @ &@a@"Y  ``c@"M  c@"F 2 `" &`"@ &@ COLUMNS1ACFLRSTWacdfgiklnoqrstu㿈@0θ @O  @W9 " @T/"`@`h@X 2`/" @ "c" "c@   "c",) '%31/-+/@;耢??π D* @````````````````P````````````(<``T```````````````l`0H%#$$$%#$$&c$&c%#$&#%%&#"# `%` "#"#%"#"#$"c~ {"#x"#u"#s%`Dp"#m"#ؐ j%`Dg"#@(dQ#&* # #Ѐ #  # / D "`#Ѐ  # # "`#Ā 2`#Ѐ # @c## &!: "@# (/ D   D @<!9!#Ȁ 2"# "*#'! D    ! x#Ȁ  "H# #`!0"ct#  ##Ѐ  t#@"cp /`L@@X %s: directory causes a cycle%s: %s %s: %s: fts_read㿘#  "@2 @ޒ @ƒ @n # _#  . a5@rL \`4 "   "V`20 !0#`@@`@0!`@@`#@70  xN`@ .x# x #@`  #@` &x@w@#  @Y 0"0  @wc%u-%lu%qu''`; 'L#   #Ѐ 2'L# "'t'L't '|  'l'd'\'T  Ю 'D'<4   !@@n#@ٿ `2 L@4`# $ . #  $ #Ԁ @ @[&&8L` <`8   2``< (``<`| 8'|` t 8't`08 `02`<`4(`<`0`<#Ѐ f#  Da@{` < a@u`D <` @rX `@r @WOT 4'T@WH\ 4'\# `DXa@W9d@ 4'd    @S   @ $@O $ @J`< @@@ 'l#  $ @4$294J'''L`.l''̠ #a@@V'd'\' a@|@V' a@t@Vِ' @@Vϐ'T'#p@ "cx#Ѐ  @SU㿘 4"- @ 4 &   2  2?|@R 2 2   ?#t€@㿘 #a   @ a? "a`$a*@ @c   2 total %lu %*u %*qd %s %*u %-*s %-*s %-*s %3d, %3d %*s%*qd %sxR 2 "#Ѐ 2 # "  ?c@L@ @ -+<)a # <  @`#  #?: `8@ B  @-;   @Ȓ`@3ʒ $`  , #\ #` (@#  @ @ ` @@2   H `@ `    ( X"@ h@`0  (@`0#Ȁ `# "` `(@ p@|@# "`@`` ( !@5!? "! %! * @ 2s 㿘/ @$"! #@R=*` $#@׌ ` #` .`"```2` #    #   # 2  /-  @ !/А0p @@L @@L@K@; 2R 2  #Ѐ 2 # @ ?c@K9 @  @B95a  )#,@ @8  a!`?`$``@ @`$@*@@ &#? " & * @ `@Ŧ 㿘 <#   @`# #?: `8@ B  @+ϕ;   @ p@| @# @`㿘'D@D a!L@ ?`&  @  `&*@ @ߋ  $L@#؀  a!L@ ?`&  @  `&*@ @l  $L@VaD;!@  a!L@ ?`&  @  `&*@ @G  $L@1aa!?`"@  " *@.  a!L@ ?`&  @  `&*@ @  $L@a!?`"@  " *@ 㿘<(@"6a @ @ a] I0@88@FaT I!?`"@\ / " /X*a!?`"@K | " |G*!?`"@; @ " @7*a!?`"@* = " =&*!?`"@ % " %*a!?`"@ * " **@~   %s/%s ls: %s: %s -> %s㷈V 2 2  $p@ @ $@x @@R$  \@"0a!`c@.30 *7#@ aJ  #H ? (usage: ls [-1ACFLRSTWacdfikloqrstu] [file ...] 㿘a!`@.`@SF 㿘@%s><@=!:illegal -m option format: %s㿘@ܤ@Ow  2 $ \@"0@@!H$`쀢 2"`"!XaX""aX$ $ @aP $ i$ @$  "l@?ߑ* :  9*  (<<<<<<<<<<<<<<<<<<<<<<<<<<< ; $  5 $     $ IJ`N@ : $ `@b :.@`@m$ N@ $ , 8 $    "$ !X@$ 㿘 쀤`I¦ \% Z` "` @ P 2;@` 2* x & T` `?T`6   T`4   T`$   T`&  "@``2`㿘N B" @Q%s: %swrite to stderr: %s㻘 @"z   \@"0!`@B'% \@P$ @P?@0@.h  \@"0!`@#@P̐㿘a!`?` "@ . :  `"*@@ܴ tset: 㿘'H'L'P'T'XH!a!`@,b!`@,!`@,b@Qɐ 㿘 !@I!$!$  " , !$ `" * !$ `" * !$ `" * !$ `" * !$ `" * !$ `" * !$ `" * !$ `" * !$ `" * !$ `" * !$ `" * $$?# @#@"$ ? "? @k" # @a"  @ kbbcbsos㻐'Ð!@J` Ð!@ؒ`J`  @@!`  䀢 @!  !7  @!  `?"``䀢  `, :  " "`" !7  䀢  !$  䀢   `* !<   !$    `* !9  耢  !$  耢   `*UCLCEPOPNLHDpt㿘@荐#(  " Ö$$ "$ @}#0  a$a$*"a$ ?"a$a$ ?"a$ !& @g#8   * & @\#@  $  "!!$ `& !$!$!$  & `& @B#H "   ?& !$ >$!$@6#P a$` ?"` @,#X a$` ?"`a$`  "` pcrsisrfif㻐'Đ!(@֒  [*b@\!T ,`'Đ!0@’  Đ!8@绒  @ H 'Đ!@@笒 Đ!H@禒 `Ґ `a!`?`"@&  " *@ڹ a@Dl!`@ stctchcmOOPS%s 㻐'Đ"@mĐ"@ga!`?`"@  " *@ڀ  @ HĐ"@H Đ"@AM !P4a)%€`"А @'J@ O  ! @J@ O  @ VH aĐ!`b@*) @ IH !PԀ`a!`?`"@  " *@"   TERMunknownTERMCAPtset: terminal type %s is unknown termcap: %s㿘!@L*!@f_ "@ /  @q " !!@L! " NJ /"N@\!N ? %N    @2%#a!Ő @  ! a`@)@$ ? \"0 " @g!H! &@ Terminal type? [%s] Terminal type? 㿘a  @%a@)b@NĐ a!`! Ő`b@)s0`@)ob@C9#!@P 2 # Ő@)`b@N @R 2*L# 2# Łstandard error: %sreset-a:d:e:Ii:k:m:np:QSrsarpanetdialupplugboardcoli|:%s%s Terminal type is %s. EraseKillInterrupt%s SHELLcshset noglob; setenv TERM %s; setenv TERMCAP ''; unset noglob; TERM=%s; TERMCAP=''; export TERMCAP TERM; 㿈@$ @E|a$   \@"0U#a$a$" " " "  " " " " "  $"$ ("(@*! Z4#@@ / @Lac  @ڒc  :"aT@ؐ      Ƹ"! \   Ɛ@/~??Ӏ F* @H A > "tJ@ ^ "tJ`  ?  `"tJ% "tJ@ ^ "tJ`  ?  `"tJ%"tJ@ ^ "tJ`  ?  `"tJm$@ Ɛ ($"tfc a _ ] @oZQ#&*  @@d@쀤=@ 81!P&!P@ @!! $!  `h@Kє  !  !P    77 `g@KU!!$`@ٔ ,   @!$쀤 L :ư@ǒ`H ,@^2 , \@`"0 P,Ɛ X@p`a!`ƒ``@'Ɛ x @R Ɛ  @M Ɛ  @H  Ɛ @M@쀦 @I "@Lz?@q` 2Ơ   ư!@.@@*@L %s %s isset tokbbackspace. delete. control-%c (^%c). %c. 㻐!4@!@:  1a!`@'`'Ȑ @ O O  !`@'`(0  a!`@&`80 a @!`Ȓ`H@&0!`Ȓ``@&-e^H-i^C-k^U6ȖȔȒH-2(  "H-2  Heik2 H2 Hi" "ke"" ""  2Husage: tset [-IQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] 㿘a!`@&b@Kѐ termcap names not colon terminated| %s%s:\E\040\041\054\042\047\140㿐'D@W : 'Đ#* 'Ƞ#(Ȣ#0'%ȐD@HaN D@b8 D@@!?`"@ : " :*@> %aɢ!!aȐ@cHN   N "N倢 E* &0''''&<&P&x''''&''''&d'''''''''''''''''''''''''''''''''''''''''''''''&'&'&@#P@#XHN@#`CN@#h>N@#p9N@#x4N@}#/N!?`"@  `"*@ @՝ N !?`"@  `"*@ @Յ Nd !?`"@ : " :9*@o 6ȁ㿘@2more-E-m-GMORELESS--help-?--version-VVISUALEDITORviLESSEDIT%E ?lm+%lm. %fNo filenames allowed with -t option㿘@ @"``( @(c / "b@9@@1@ W@./"Ȁ  @*B#@*? @*<  ʐ @G.@*3 2*?@@` 2@@*& (@@`0 2? @J - +@J  2@@,  @`@*? 4@@, "@,@ې @F H`"!J@ 2@F P`"!J@ 2ʐ X"a@F֐ ``" |J@ 2?ʐ p"`|?  @@a`?@?@  "`@=  @ @0@  @@  @ @'8@ @8@7` 0! ,@ $ 0ʐ @/ @n 0@7!!, 2@d @@!, @\ @8T?"`8@T `" <@ @ @6 @? @@@9 㿘@.㿘@I @  @ECannot allocate memory㿘@# ː!(@/' @ JJ "  " 㿘 !`"!` "`@Ր  ܀ /"Ā @@^@.d@ @Ih/"܀р Ȑ @@7h"h"`"`"` "`"`"`"`"` "`$"`(@%bX"f Z#`n"W Z`2"O Z`I Zo`KH Zj`"I Z`C Za`Ba,C ZZ !@"I Zg"> Zd8 ZKi`7"@6 ZB%"@"5 Z#@- Z58!@*p"@) Z*'2#$ "      Z      Z        Z  2c"a"`"a4Ԑ >'̐  ?''̐ //!h!h'`'`'` '`'`'`'`'` '`$'`('  @{/""܁WARNING: terminal cannot %s㿐  /"Ȁ '!@. LINESliCOLUMNSco㿐 `h@F  `" @D! "@ @ߴ!"``䀢   "` `h@F  `" h@Dΐ" "@@ߑ""`h`h  P"`hkrklkukdkPkNkh@7kDh  '̐#0@J̦!#$@렒@Gr` ,` ,`@듒`@Gd ,'̐#8@)̦!#$@@GP , ,@r@GC ,'̐#@@̦!#$@^@G/ ,!!@R @G# - '̐#H@̦!#$@>@G ,!!@2 @G - '̐#P@Ȓ̦ !!@ @F - '̐#X@޴̦ !!@  @Fې - '̐#`@ޠ̦ !#$@@Fǐ ,'̐#h@ތ̦ !#$@@F ,'̐#p@x̦2 //Ҧ#$@ɒ@F , ,@꼒@F ,/ !//ҠА@ꬒ@F} ,!4!4  `//ѐ@Ꚓ@Fk,!@K#$@_TERMunknowndumb:hc:hcamxndadbsgpcksketitececlear to end of linecdclear to end of screenclclear screen cmsoseusuemdmembvbbsbchohome cursor|^llmove cursor to lower left of screen alsrscroll backwards㷐@C Β @  4 Δ  ? /@ߐ 0@,@ؐ 8"`@Ӑ @"a@ΐ H"a@ɐ P"`@ݮ X "`D"`D D"d"!"" "" H`""  'ΐ `@l"  [ *bΐ h@` "`ΐ p"`ΐ x@U "aΐ p"a/"Ȁ 2ΐ @D"aΐ @>"aa 2ΐ p"aa ΐ p"aΐ @( " ̀`J@ 2 V ΐ p"`ΐ @"   ΀`J@  : ΐ p"`ΐ @ " Ȁ`J@ 2 # ΐ "`ΐ @ޒ " Ā`"J@  Β`p" "  "`ΐ @Œ" Ԁ`ΐ p"`ΐ!@ܵ" ؀`ΐ p"`ΐ!@ܥ" ܀``" ΐ!@ܕ" ``" ΐ!@܅" 䀢`2  "` ؐ! @r" 耢`ΐ p"`ΐ!(@b" 쀢`2  "` ؐ! @O" `ΐ p"`ΐ!0@?" `2ΐ p"`@h!8 ΐ!H@)`" J@ ΐ!@"`ΐ!P@􀤠`΢ p J  p Ē @ @]@D.  'ΔX@th"`ΐ!p@􀤠`΢ p J 2 p `Ē @͔@/@D  'Δx@F"`ΐ!@۾􀤠`΢ pΐ!@۲􀤠 Π p!  " Δ@p"` J " ā  㿘!$! `@|! 㿘N  N@ 2N "N@  ݐ6㿘  !`@ / "b؁㿘  !/"؀  !`@} $"؁㿘  @s 㿘 `@i 㿘  @` 㿘 Ē @ @T 㿘 Ȁ @@( 㿘 J  `@: 㿘 `@0 㿘 ̒ @' 㿘   ̒ @ 㿘 Ԓ @  㿘 ؒ @ 㿘 ܒ @ 㿘  @ 㿘  @ 㿘  @ߔ 㿘  @֔ 㿘  @͔ 㿘#` !@Ĕ @([ ` @ 㿘  @ Nothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracket㿘@)@??@  "=";#!@M ?.#0@` #Ԡ! ?@ ?@ѐ#P@([ seek errorread errorWaiting for data㿘! !`  2 `  @3!!2 ! @`? x !   !0!   @ " x!  & & ! *  @ ?@6?!`@!/`  ?!<`   @AD ?  !Ґ @'ޒ k?!" /"?2  ! $  @&P"   / *` ?"?〤  /Ґ @' s /"̀  $ ` @@3!`"`  & "`$ Ԁ  Ґ @'֒ @|  ! 2?! "` "@&& " "!  @n ch_ungetchar overrun㿘? /"?Ӑ P@'] /""Finishing logfile㿘/"̀ !/b䀢 !/! $? "bӐ @' !@?! !/@@ "̐?$"/""ԁWarning: log file is incomplete㿘 ! c`g:  ')2 !X@'    /"̒@?   2  2 㿘@ ?4=  #: #a` '`#Ԑ a " ! 6 #!@q?a !   !"  # <&"`  㿘1!` @` !"`$@:? @B? !  㿘 ! 2 ! !@&  2!"`"`  Ԁ?$* 㿘!@   @  ??!` #4 "` !` "`"` 㿘!` ?!   !` 2 `? ?!`?"`#"` !@   @  Cannot allocate %d buffers㿐! !#@N ! &'bX@%ђ!     ! seek error to 0㿘!` ?$"`$!@?"`@@2"`!!@ !"`$"`"`"` `   @> ?Ԑ#@% 㿘 @C$!` "`?""`"`""`  㿘!@ !! " @;"!@ !!" 㿘  @> ?  㿘!/@ "  $! @ ($!" "?" " " " " " " " $" ِ /!` "`/"@a!` ?""` d㿘!    !` 2   @=` !?"`  !@;u!$!/"@ 8bcccbcc18b95.bb125.bbnext8bcccbcc18b95.b128.koi8-r8bcccbcc12bc5b95.b.dos8bcccbcc18b95.33b.latin18bcccbcc18b95.basciiinvalid chardefchardef longer than 256㿘  !  8" 'Ց*`:  9   06,` ." Հ b c"    * ?N? "@$ } *,@$ u ,`  N " " , *,invalid charset name㿘 "" N /   ""耢 ֐@3   2֐ 8@$L 4 㿘 @J` a!   㬐@J  *@ @  "*@ *@ ``㬁*s<%X> J*֐hJ*"/J k/sd  / u //   /      / LESSBINFMTLESSCHARSETLESSCHARDEF㿘@:"0@:"@t @:ߐ"P J@  0      %cESC^%c㿘   !c !@Ԓc1/ @ܐ /!֒c!c@1! ""(   㿘@=_" 㿘"" @#Q b$b!"J@=J""@$"b,@`L@ 2 `" !?"" @ *`: @"@=$`L@  @" /!g?"/#`   " @J `?㿘!"J a" $"@"!@<" $" 㿘"" @J 1" "J? y"J?b " 1" "J? d"8J? 㿘"J  1"J 0"J 1"J  "J " 㿘b " #!" b$bJ@<""@$"N  "b 㿘J"   "E*/#``?㿘!"J " $"@" !@"c(#c(@#Y$c(  @  @  ` `ݐ"x@  @ 퇐 :%s helpExamine: -Cannot edit standard inputCannot edit file processed with LESSOPEN(N-th) No %snext fileNo %sprevious fileNo such file_+mark: goto mark: |mark: Brackets: 㿈 "c(  2  : "/%- +)#(A%$$,*#0  @$& ?  $ "/  $ "/_  '/'@7쀢 ` `i`cސ"X*`@||d} {@Ht}||}~~`~~( p~~~|}~d||Ph@@@8,h@@}$~@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@x ݒc  \ ,`" , @k$,, @  0*,`" , @X$,, @  0, $$,;,, $$,>,, $$,,+ , $$,,- @ " " \  !  @ j !  " , 4%`` @ Y 0, 4%`` @  0 J@@ , $$,zX, &$,, d d$,o@ ,0j, @ t@ ,0_, &$,,@ *`0T@'#L 밐 %#(, $$,fP %#(, $$,^0#( %#(, $$,U. ,0d#(  ? #( ? &#(  ? #( ? &#( %#(, $$,1  ,@%#(@ 耢 ?@#@ J 0,/ ݒcH0?/@ "@>cȀ 20Y#! R# |@͒ @/@0" 0 0, $$,@),  ؀  \ , , $ !`' (, $$,@, ,  ې!`'ސ 8@0, $$,@, ސ P@ 0 /ݒc "#4 ޒ`` ! ےa`@ 0 ޒ`hi 0/ ے`b\0 ޒ`p\ !   @0| ޒ`xD ~!p l j h@0d %ޒ`, f!X T   .@ J*#8/ %ے`\0[ޒ`  0U$ R ޒ` 0H P (" X㿘/#p@)!L0 @= C@O㿘  @   @"`"`"@& ?Warning: some commands disabled㿘0!ߔ  @0 Warning: some edit commands disabled㿘0!ǔ !P@ @ 4J@K)` @ g `"$ ?""2J@ 2 J@J`g2J@ fJ@`J@?`J@2`?`@ И  d㿘  d   d 2㿘0!㿘0!"H"H* @㿘@J J ?i 㿐@N E27?N n23?N d2/? ' J `e'`e`x`c0 0Ð? O@'@.?  㿘@ B @[@    @1 ?  @.@1%?@0ܔ@1"L@@.? L` M L` +L` Go}.lessCannot use lesskey file "%s"㿐@$!  '!@@.ux!@E  @ ?  *?*? ܰ  ` ` 6 d` "  d ` ` d`  d ܀ ?@J?耤 ?0 㿘舐@1& @ & N@ ".@` @*N@㿘`@1n@ @*N@  N@ "` @` `@ J"?8J?  ?J?㿐#/b @?b@@1!0!  /@"!@@@-!$!/""㿘/@b0 @-%s"%s" may be a binary file. See it anyway? 㿈/"" /"   " @'@{  L @ђaX 0!'A@ '!`@@-]쀤`@@-U@$n @/ '@'  @  @k '!h@쀢 y Y @/π` !//""$"0"!"c@@b"@Y`8 "`O/"Ԁ` ܀ /@ /" !/"Ā@`? $" ܀ " @;@ (@S   Ѐ '!`@k 㿈/"  '/ǒ`@  耤`@@,!/ @""     㿘/""@  㿘/""@ 㿘/"@p? " ` 㿘/"@k? " ` 㿘 @K"  @ɐMissing filename ("less -\?" for help)㿘0@%X! " "@˒ 泐 !X㿘{?@?@!Warning: "%s" exists; Overwrite, Append or Don't log? Overwrite, Append, or Don't log? (Type "O", "A", "D" or "q") Cannot write to "%s"㿐 w@ @.d /"Ѐ "' O#(@?`0T <*`@pppppppppppppppppppppppppppppppppppppppppph@a5!/"b̐@ !/$"̒  @. ?/"@."̐?$" #` /"̀ '#@%s/%s㿘% L@ !@.@. @   a@%@R @+j @-HOME㿘@+"`В  LESSHELP/usr/share/misc/more.help㿘@+ѐ" "㿘  @ #'/%/*`:  # %2 ⼀ 0  g5@R`@.`L@  @ i  @ 1/'/*`:  # %2 @"@1`@Ҍ@.^, `L@  @,%s*㿘@.M ; `@@Ӓ@@< @*Ր @*ҐX !  @- ?   @, @  @m ?  @ 㿘  @-  㿘 d d ? $@4`$ @` $@&,,,Ԓ @ @*x@-ې,۠ ,SHELL%s -c "%s"r㿘@-ɐ`@-Đ" @- 䫒 @@*א"8N "@-@- 䓒 b@@@*4@IbP@*,echo %s㿘#H {@IaN @*0@* LESSOPEN-㿐 !?@*#Ƞ @Yc؀ ". L |    `T @,   @I' O&&@# 1@IN` LESSCLOSE㿘"@I@*D ؀ P@H8@ @, ( <  @,  @#0a<   @, ْ @0a(@(8@$? ǐ㿘 Ȁ 邞㿘 Ԁ ! @R??{`\ "`\㿘`` @"``...skipping... 㿘    ?4    ?   2C?7̀  ?<@̀ 0!@ ; 0I@?@@ "?@7 @  ̀   ?0!@ 2?@#?,@)07' ?" 0@  @ ?)@ِ  `!@ ̀  0!  0! ̐  $`̀ @?ɀ  Ԁ " \ ! `\ "`\)` 0"0@0"!@@1?㿘/ @ 4   ? ? " \@@` HO@? `ڞ@@?㿘 ؀  \    ;♐ 07@&??2-`   @ # Ԁ @  @     @?? `\ "`\ 㿘@ ?2 `@? wiĀ  ̀ #?Cannot find help file-%s -m -H -+E -+s '-PmHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when done ' %sEnd of help㿘W @ 0@*#@*`  ``@:@'@q !X@ @'{0H 0H @" 2 㿘`2@0!H@&& @" &@` &  0ah "ah㿘 "` "@ђ?0ah?"ah㿘 ᔒ & ?& & ˒㿘 !/"@'$"Ԑ@'" @'  20H0H  2 0H 0H 㿘 ܐ  0h㿘0!H!H " !H@E   㿘   @" `"  "@ "` "   " 㿘?c 0!p* @@H G T@@,>?H  ! !#! < ??@. `T  ?  ? ٰ@ L !   ?! @'?0㿘?f d  0!p* @  & @Ғѐ? R L &#ec鈠  ##~  ?a 02#0/@ Ca &d ?2a .蕐  0+ @j@w艐)+"?!  @?0` ?@  `T 2  @K .0ۀ@@CCannot seek to end of file㿘  @4 0h    @Cannot seek to beginning of fileCannot seek to line number %d㿐@? $  @y`04' 2 '@l`! !@㿐@@@YDetermining length of fileDon't know length of file㿘u?"@ (k?"@ 0 @@N d6?@`㿘ǐ  ? UL@Cannot seek to that file position㿘@А@|$ $ @?D@ g玐 #@j 0_@ @ސ?2 ? @|" \" `" 0 ?  &@01 "?  x 0' " ?#? ` ?@J" 0@ ?   H L T X P(\%6d㿘! B@G#! cH@b cH@'ĐcL  "cL#H#H`##H *@ a ! "a  #H#1#H*#H`$#H*@cL $cL@S! #HcL"#P         D         Hd㿘 %?  #H`  #GJ@` `#H`#GJ@㿘#H"#H! cHJJ #L"@$#L㿘@- 2  cL@ @ h@4K #H#!D #H`` J@ #GJ@  \ #H *@#H`#GJ@   `H]  cL?"cLH *@H#H*@cL@"cL 㿘J#\  @c`  *#\  !( *#\"#` @㿘cT ."cT#H . :`J@ _  f  #H J@ #H J@ _ Ȑ D  !( "    r 0n ͒ #H h  b"cTa ! "a%#   K#H $#HL@ a  G 膐 5  臐/#!@&#L `h 4%   !*`:  #H $#H N   Ҕ  cH "cH 㿘J#\  2 J#\?c`#L`h 쀢  !  HH  *H#H*@H "HH *@H#H*@~ X "@ HHJ"@   X㿘?"+? 2&?X?  ` A ,A 6?`, &@㿘? $!?䏐? !?  , F  ??,  `2&@ @    | hh  h   h   " 㿘#h#h    A 2 | @"|#h"#h"@"`"`"`$ $@ʐ ȐƐ#h #h#h  #h 4##h  2 #h " "@Calculating line numbers㿘"@  0 "ax㿘!#l   d$#l@ c$#lcp` ?$#l㿘! li`q #h#h     ` @ @ 5"cp#h"    $@  "@)   G "#l  0%’  27 ?"4  0"!x64'?0%o  ! "#l  0%̒  2 ?  w?0"!x㿘`Z #h#h     I @ {#h"    $@  "@ !  24? - %Q  2'??   2?  %g  2 ????㿘@ Dq? ?%䀦 ? @ 4? 䀤?""?! /dev/ttySHELL%s -c "%s"sh㿘N -  Y@ *#`@ (@ %#h/"k @ڌ @J @Vʐ @"S #p@ђ  @V @ p# L@  N @#:@#7 $ c@z  N 2#@@@" @V@"@ @ ߀ "`0  @ 㿘@?@  ?" @ ? .@ @Cannot seek to start positionwCannot create pipe㿘  "@>,b8"@@ڒ t?ߝ@n#`@l@i#h+?@1Ԑ @  @!) "y?E  ?` $  @ . :  "  $* `@?*ݲ`$ $P? ?` $  @ . :  "  $* `@X? ހ?@>8 @ ג @; y ޹  "`0@   ?(( 3 ? Invalid mark letter㿘? . * 1"?  @>  . * 1!Cannot seek to end of fileMark not set㿘 '", . $0' ^$/#x& & b*"#xt  !8!Ự#x&  ?& !Ჰ#x& & /"$#x!  ?!X@  㿘`?㿐 @ & & /"&㿐@? "`"`/""㿐!@ `?2 '/"""` "``'`'/@"@ Mark not in current file㿘h /"@#@ ?Input is not a pipeLog file is already in useNo log fileLog file "%s"㿐 &/  /0.0+*""d    /"̀  ( &/"b<"̀ / H "' X@1㿘/ "bА’Line number is required after -l㿐 ' l@b 2`0!p@  0 "aCannot use lesskey file "%s"㿐   '"@㿘  0"0 "!׾@4!,`/" @? ﰐ װ 0<`Tags file "%s"㿐 1  ""#0׍1"c#'#@/㿘  0 "!騐饐#%s㿐 (  "N@0+*N@ M" m = 1  p ` t`#` l@' &!$ l*`@'#@]㿘   !n!0$!0㿘   @ 㿘     Use "h" for help㿘 耢    !@@ 0'  @4c/ "b 4There is no %s flag ("less -\?" for help)㿐'D!" " D € $"""J  " J? `0Z'D*`000Ө|DJ@ +`?`"iJ@`d'D0 "!DJ@ +`L'D/"bDD@P'DD?'D z@2  @b'"@t\    "`   `, # D&     `?"N  @  @*`? J aD@q'DD@  "@ D €DJ@ U There is no %s flagCannot change the %s flagCannot query the %s flagCan't use "-+" or "--" for a string flagCan't use "--" for a numeric flag㿐'H@e@'!P ` @@א' !h `! @̐'!@ޒ0    HJ "  ` @  "j``  "#   ^`: 1X`M"` O`"` K`@``?C"@9"` ;`"N@7`N@@@` @c`?` *"@4)`% !"` H`` @ 2``  "` `"@!@] 05`   `€H`  @ $`  "`    ` *  '`@1`  "`0`  @ ` -%s㿘]1"@<a"㿘@p "   S@ 㿘@d" ` 2` @ String is required after %s㿐͐'"P@ߒ㿘"J㿘N 2Է   `$2 . N Number is required after %s㿐ԐL -    ?А ? $&'#@Ԁ   ?А* *`:` ?Р  А (. $&`2 Scroll window size is %d linesScroll window size: Forward scroll limit is %d linesForward scroll limit: Don't use init/deinit stringsSend init/deinit strings to terminalTab stops every %d spacesTab stops: Display ~ for lines after end-of-fileDisplay nothing for lines after end-of-filePrint backspace as ^HBackspaces cause overstrikeDisplay underlined text in underline modetags file: tag: Chop long linesFold long linesSqueeze multiple blank linesDisplay all blank linesDisplay control characters as ^XDisplay control characters directlyNever ring the bellRing the bell for errors but not at eof/bofRing the bell for errors AND at eof/bofprompt: Log file: log file: Constantly display line numbersUse line numbersDon't use line numbersLong promptMedium promptShort promptPosition target at screen line %dTarget line: Ignore case in searches and in patternsIgnore case in searchesCase is significant in searchesDon't allow help commandAllow help commandBackwards scroll limit is %d linesBackwards scroll limit: Highlight all matches for previous search patternHighlight matches for previous search onlyDon't highlight search matchesOpen even non-regular filesOpen only regular filesQuit immediately at end-of-fileQuit at end-of-fileDon't quit at end-of-fileBe less helpful in promptsBe helpful in promptsRepaint by painting from top of screenRepaint by clearing each lineRepaint by scrolling from bottom of screenAutomatically allocate buffers when neededDon't automatically allocate buffers%d buffersBuffers: Search skips displayed screenSearch includes displayed screen0H  "    J2 0H\J "  J( P J 㿀'''@2d" " @@L ?@! $ @@$ @ ?㿘"@2M 㿐@j%s: %s㿘 \@"0@%@"  `Ȕ@e * 8"㿘!1! 1@ d$!1! . * * @ d@㿐!  j"`0  ;L;    0 0      0 0׹  כ  `@9   0  0 חק׷㿘1!"8@/"Ā   b8@ "`01"8"a㿘1!"8@ ` 15"`1!"!*㿘  *` : N 㿈6 `2 @ 0, @ ` -, 耤 $?L?㿘  ,*`:  % `N d  s2N@` *` : `L  N@` @N 㿘`А "`/"Ā  ֽ D/"Ā 1j 0%"Ġ  d@  q    ?P h "`0)㿘ք֔1P"֕ "`㿘/"Ā  ko@/"Ā  0  h "`0??? 11 2 818*  䀢@ 18*` `@  18( ` 18*` `"18  䀠 18? ("@㿐 b8!1"8 ?@S@"8#1'#1!  $b8 "b8b8*  "?18@ ?䀢6?18* @&? * ?㿘  @ 4 18*   *   䀠?18( "   (?"  $ 䀢6?㿘1b"@`l"`l1\"x$ 1X"$ 1T#01"c `6!d*`@LLLLLLLLLLLLLLLLLLLLLLLLLLLLL@\LLlxLLLLLLLLLLLL4#<"@ ?@ 188 \/"@ѹa0/@ ,! ! ' 0Y 4!  0  q?i 4  0b8 @ /"@  㿘?`6#*`@Hx\Hh?\0;!0X/P"/ "< Jޞ ` A <А?0:˞?.`+!|b@#< "@: or @ speccan't resolve hostname for address %scan't resolve address for host %sNFS PortmapCannot MNT PRCMNT RPCbad MNT RPCnqnfs 2can't access %s: %sp?'!!@ Z!, Z@ؒ @  @Ғ : @ 0  *#@2a< `$a< @I  22  @H= @ϒ !<@@  2     ""  ` =&`  " "aH" 7!8%2!H+ -  o5 2 ,`   ab@۔, 2 5  b@Q!{b ''2 `  ab @  ''ܐ8ab@И   Tb@%! Ob@$ ''`$  %%'' #\@ " # 22 Ā p@qa0a!`@ c@ b@ca8@#@ b `@  @%bb? "%b  ?@i$  ? @fqaH@ % @>]@  @  @  @?|#P $@ <b A !H 2  \@  !H@"b0!P@ђ !82 &` &`!X&`?&`!&`D 㿘'HH@$㿐 @! "J @ "`D    =  &` `@0 5@` "0 ` ? ?*`@!` $@   @ڒ `@"` &`2    P`  P&@ usage: mount_nfs %s %s %s %s [-23bcdiKklMPqsT] [-a maxreadahead] [-D deadthresh] [-g maxgroups] [-L leaseterm] [-m realm] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-w writesize] [-x retrans] rhost:path node㿘a!`c  P   @`@ E ,-o %s: option not supported㿘@ @ez  @?a0?L n L  o  @̒ = 2*@ "   2  @2   "*@ " 2Š   a8@9v @W㿘@lMemory exhausted㿘@儒 @;ʐ"/usr/src/gnu/usr.bin/grep/dfa.cn != 0㿘@  " h @;  @;"㿘@;` " u @;ה  @;"2 (  (@2 *  (@ "@ 2 *  (@ ("@  *"@ (" *`8``" *@ * 㿘  ".  ( b b"  @"``* "`!" *`""@"` "`. @       a@  a  a@   a@   aD@   a@   a@   a@   aH@   a@   a @ :cntrl:]:graph:]:print:]:alnum:]:punct:]:space:]:xdigit:]:digit:]:lower:]:upper:]:alpha:]㿘@ 3" @ b`? Unfinished \ escapeunfinished repeat countmalformed repeat countUnbalanced [x  %')7#5;  !3  !@2!0 ⤐`$ @??`rY$ !*`@5@;(;(;(;(;(;(;(;(;(;(;(;(;(;(;(;(;(;(;(;(;(;(;(;(;(0,;(;(;(552 2`;(;(68;(;(141414141414141414;(;(1d;(1|1;(;(1;(;(;(;(;(;(;(;(;(;(;(;(;(;(;(;(;(;(;(;(6;(;(;(7/;(/;(;(;(1;(;(;(;(;(;(;(;(;(;(;(;(;(;(;(;(;(;(;(;(6;(;(;(25    @9  "  !⬀?!! 2"Ⱀ!&!":!`5` J  J@ \2"J` )#!" @  J  J@ \"J` |!"( J !&!|"@y"Ⱀ!&!p!&!j!&!d!&!^!&!"$X R" !Ⰰ 2J"Ⱀ!&y!B" ! Ⰰ 2:"Ⱀ! &i! "$1 +" ! Ⰰ 2#"Ⱀ! &R! "b@&$b ⤀ ??@8a⤐`$ @? )$a㬐  "?$b ⤀ %?@8a⤐`$ @? $a㬐  b*` * ?Ѐ , @8!( ,"b ⤀ ?@8a⤐`$ @? $a㬐   *` * ?&&"@ } \ @8^!( ⤀ Ұ?@8Ua⤐`$ @?$ } @8I!("Ⱀ! &! "d @  "$y2w"Ⰰ(s "Ⱀ! &! "@eb "b "Ⱀ!&!"@S" "@2J"""""Ⱀ!&s!<" @  f"  _O"Ⰰ$iؠ  a㬐  Bؠ    W\M 2⤀3?@7a@⤒ $ ? ^$ 2⤀"?@7a@⤐`$ @?$  [? \" ; \ 6 ,`4 * ,` @ ؠ  $ ,`@T⤐ $@O"@`$?@7ja@⤐`$ @?$`,` ϑ,` \"  ⤀ʰ?@7Ma@⤐`$ @?$ 2⤀"?@7=a@⤒ $ ?`-=$ ⤀"?@7,a@⤐$  ]$$)$ \"  ⤀"?@7a@⤐`$ @?$ ⤀"~?@7a@⤐`$ @?$4-5d  a㬐  ]!,.  R  a㬐   \ .  R B ڐ ]/ [ X"!ݐ ْ"" 0 .a㬐  (9a㬐  ]!,.  R \ .  R @ذ! &⬠  m@?㿘"  @"``* "`!"  Ǔ*`""` " `"  *`" ?` *`@=<<<<<<<===<<<<b ?"` "`bĐ "bb"@4"Unbalanced (㿘"`a!~  ~ ~ a "!"$"!$"@ "!@6 !@"b!㿘" ,  ?! !  !4 !  ?  ? $ 㿘  #b *`P  b㿘I"! ?!!" " "" 2! "  +! "6'Ȓ!  ⸀"'!!  ⼀Z"b"S$""~ ~ 㿘"!! !"  ! "!!  㿘"! !"$" ! !"! No syntax specifiedUnbalanced )㿘"""""b""?"b "b""" @5!!!$""b "?" @5!  8!   !  &    *"@@ "`&#  `@*:` *`6@* 2   #h #l`"`@*#`#d@h l `#hd#l`&@#   "`@\  @W+ @+` (@ "* @ "@@ "`/ + +`  "*  "@@ "`* @+  "@@ "` "(+` " ``& 0 "* @+  "@@ "` `&  "* +` "@@ "`` @&  *" *"* "@ &㿘 @ @  `@ @,`` `@   (@6> ( $ (,`*  21` ``* J` 2'`J` 2#` 6`@ $,`* @`(@   `2 `@  @2`(``@ʑ,` ( ,@ (*& ,@ ,* @ $*`& $ $,`, "`*  $@"` $ ` $*  $*  $*  $*  $"  `6 (,`* ,`@,`* @(  * @ 6X@  @ 24 $@ 2% $ 2 $ $ 2 $  $" $ $@ ` *` $+`  2@(@ * @"(@ * @!2  $  *  $  * `&@ ( & (㿀`?*  $@ `,   m#,,  ` *@ ^!\!4[ '  ''@ '@ `'* @ F?*  $@` * @>  * KDKPK\KhKtK      '  `0*` , @''' `0* *?  &@h& 4 * ' * ' * ' * ̴ *  *  * @ *  % &, * ' z & 0  6E'  , ? * !8 MtPPPPPPPN|MMPNPTPT% $%@`''3 @*` 0@ k@* @.`@ *` * % @ * @6@ .`@ 0* *  N*`@ 0*`" .`@*` 0@ `@͡.` , ! 2%?''* 3 @*` 0@ &@* @.`@ *` * % @ * @6@ .`@ 0* *   *`@ 0*`" .`@*` 0@ `@͡.`? " %* ?  * ?, .`$@@ "`* $?  ?@  % $?  ? "%? %?? ,  !`?"@$%@`%& %&%   0,"  &   67' ,@ !!$, 0'' 0 쀢 6,q*` 0"@, 0  & '   ' `', 쀤 ,  `2  `0 2  &, & ,& ( ,*` #* & $Ж @L@J@H@F@D@B@@?cbx   "bx #a!` c@  $"8``` bX?#ؒ2@ `$ . * @`@6Y`?#?#؉. ?ct@ @?ct@@?ct@ @?cl@ @*  -`@ $@ `'`` * @ 8ߒ?* @!* ?a @ ?c  `$. @*` J   ? Ē ?#`$?ct@@(` J @ ? "X- @@   " ?#`$. @*` J ? "8-  *@  "?c`$. @*` J 2 "8- @@   "    ?#ب  -   "   n ??#` * @ - 6 "[   - ?, @`" ,D   -  ??#,@@* "@ ,* `" (, ?#- -  `ˑ* -" -  -  `" *`"  ``" &2 `?- ?#l ?cl@@`* -"@ @  "@ "@`"```$. *  @&Ɛ`* ?c$ `|* ?c$ `4 a  `$ @ `-`   `2  `0 2 `$ -`   ` 2  ` 2 ``$`@&``$?c        ?c    a#` ` &(@  -`&-`&```    ?-```& @6 ?#?#?#? ?#d!'  -` @`65`4     - @`0*`   * ,@ &@ `&`0*    -`  &Ѧ `4 "  `$ 6 `- @ &@ `&{ `$`&` -` ?#dÒ  ?# ?#-   `2  `0 2   -   -`?"8-  @   -  ? #?#@-    ` 2  ` 2  @ &@        -` ?a - -  : ` `&(@  *`&`4*`&(   ( `@&'  @6 ?-`@7`@&-`?#@.?#@*㿘`<#  ,` "`H@ `@ "`@`H"``8@&`@&`<`< &`<`L. "@`$* @J`  ``$.  `$. @*` J `2`L `$`"`$`L.   " `$. @*` J `@`$. ``$. @*` J `2`L `$`"`$`L.   " `$. @*` J `@2`$0``$. @*` J `2`L0 ``L.   " a$Q ,``8 *  *&`8 @`8``D[*`&`D &`@`8`HT*`&`H`8`LO*`&`L`8`PJ*`&`P, " `H"  `8&`@``Б,``P. ("@ ?$(`$* @ ` "`@`H" . "@㿘 & 8& < 8  & D & @ 8 & H 8* & L 8* & P 㿘b|  "b| "| a#  ` ` "(@  *`" *`" ``` 8    @ ."|, ` * @,``  * @, `   '%, H ! L* @ @`7$*` J   .'@,'@H,  * @    ?  '  z@?  ,`P@㿘 & \ && & W & & & & & & 4& 8& Tout of memory㿘" ?@Q2@+! ""a] 2, * : #@  ,*`@ ` , * @F@& &&&& "b @:㿘@&@$   , @*` @   (& $@ $  , @  @  & 0@ 0 , @  H, @ " @  8& @@ D@ H@ P T   @ @2 㿘` @?   @5 @@ @` `@N㿘 ْ㿘@ @  N  㿘@㿘    ,`@&`,` ,`㿘 "F ǐ2.@=   . .. .  ,  ,   @Y . && ,  2, @g*` .&" @?0 㿘  `"8 @ 2$@1  , *`:`   N J @N 2N 4 N@T2N  " N 㿘 `2@  ,`@@Tg`,`@ ,`㿘 `0 @ 2&) :%  ! @  ,,`@ ’# `,`@ ,`, 2@㿘   **@* 㿘!p   @v*   @:",`$  "`"` "` ` @,`% @Y ,`$@U $ @Q $ @N $  6 2  .`,`*@**" @ܬ  -@! x!  !!!?t`0 !! 6` ! ` ߀?݀?0ޤ  @ " *J    JJ@2`J  *@r@o    @ 6  $@ " JJ?@2 `@ $  $ * * E@$ *@  ,`@+@@(`@@,`@ ,`@` " 0} { q$J@ "` J "` ߐ b]@$@ P` J "  ` E$` J `*` 9$`` J " `  J@ "`  "$` #*' %! *@** * *`*  $  & @ @  $@@ $ @ T$ & T {x v t ` @$,`@ %s: %s: %s %s: %s 㿘@@!a!`c"@B a!`c@9 "b㿘@t memory exhausted㿘@   p 㿘@`@`  pԒ 㿘bȀ ( "b@ˠ"c $@$$"*` "!@(  $" p """"""㿘!"̀  @ $"@"쀦b* "b"*` "@    p} """""@""*@`??2 %$#b"b @k" b@ @ """b "  H c("c(*H %s%c%d%c%lu%cwriting output㿘#  .#xb@3:# ѐ#(`"#(, #@#:"# #  "& , #@ @: &@!a@+!! @ \#b0"#$㿘c$ ""c$#, #!c$#,?$#,  @ݓ& `c$ -#, c$--㿘#  #, ͐# @#$ "#@#@ ( `@ (`L 2`@ @ # # "Ѐ #$@@ؾ!@ @ @=& M -@ @ % @*&@  23 :@   &# $ :#"c, "bЁ㿐 '%ؐ&@@2 @@N @   d  ^#  P㿘<"#"#$"#("#,   -'%)+Y  \"b00l% $ 2$$""@ Q "  "L? ""? 8L?" " #,  ߐ #$# $  J 2  򀢀 $2$$$ "" "c %c# O 0`"!"I"#, "usage: %s [-[[AB] ]] [-[CEFGVchilnqsvwx]] [-[ef]] [] 㿘a!`bH@ϛ@ߐ 㿘2#t  2#t'), * @@   @ $ %"  , *  ,  0123456789A:B:CEFGVX:bce:f:hiLlnoqsvwxyegrepyou may specify only one of -E, -F, or -Gposix-egrepfgrepgrep%s matcher already specified-rdefault(standard input)%s:%d (standard input) 㿀@!  $"@O / "@N / $"ܨ   '' ' "!321  ;@XDЀ In*  ! <<<<<<<<<<XL|#*` *  ?###*` *  ?##@b##@b## 6 ####!  @c #T #p&!!  @#Ȁ #D #`&!!  @cЀ #4 #P&!a!`c2@[H! #  b=&!:"#'c 6'@_b*` -@}b# b @F` b @`a   \bb0 @,`@(,` - $@@Wga2 ,  a @J? "׮  ' "!'cζ?'c˶ "# "#'c '"# "" "! 2 @ `" *`@Ր a 2 ""a ! 2    @"Ԑ€2" '  2쀣 "  "c2" W %2'"  + *  @`  * @  ` 䀣 /` *  \b0'` * $% #   0@2  8@.  `c@#` @R  $   "b    8@   2 @ @"䀢  @\㿘'%<8$ ,  j ?#`*` @.8* <*#2b "  @#*8b  <" * @b <"8 $8$<POSIXLY_CORRECT--%s: option `%s' is ambiguous %s: option `--%s' doesn't allow an argument %s: option `%c%s' doesn't allow an argument %s: option `%s' requires an argument %s: unrecognized option `--%s' %s: unrecognized option `%c%s' %s: illegal option -- %c %s: option requires an argument -- %c 㿘2""2 # " "c<"8"#0N - + "c4""#4 @! "#4 "c4#0 "J #4 /!2#8c<  2" @<22#<b "#82 "   * @J@ - J`  2b "# 㿘   㿘!%HI  @#& ,  " @ϒ   $  2( "(  * " "@"@4"  " & 0# 0"  0"  0"  0"  0"  0" #& 4?& 8&%<&%D@B memory exhausted8@4 0 %D` @''  ` ,`" ,`"`"?`  2 2  "  @U  @$  2( "(  * " "@"@4"  -"$$   "  @+  $  2( "(  * " "@"@4"  " $ 1%ɰ!@ " "  "  "  "   "` " , , ,` ,`"?" `,` 2,` ` ?? `   *` ,` ?J " `p,`  ,` ` ?*` *  ,` 2_ `  *` *  V,`?J ? ,`B,`?   ,`8,`?$",* ?`   ,``$"`*` ,`?`$"`$"L  @?*` L 8`?* , ,` ,`"?"    ,*  % , & , 4@&& 4 8@4& 8 㿘   @ "` &@㿘 ' `" `"` @" :2 "` "``2` " 㿘   @*.㿘` @ `   `  @" :  2 @ 㿘    *  &@㺐 4     7*  , @ *? , 2f 0%D 2b 0 4  " @` $`  2( "(  * " "@"@4"  "&%< 4?  0%<` *@ `   46&%@%<   7" * 4&%< 4&%@  4?6%D%<  K J?@2" &%@ 4 s%D5'` 4$` 4$```2`` 0` "`  9` 2 @` "  @&$ @ "  ` "   4$   2 ` `2` 0 ` `` @4$``` 4$`` `2` * "; 0 %D * *`@ {"!< %D* ;"a<%D    * <0   * < 㿘 4`@`  <%<J@@ӛyw& %<@%@+` * I@ @" 8D@?  ? `# ?  ?  ? ` ?  ?  ? `  ?  ?  (?@?2Ұ  46& & @  & 4(& @? ? ` N?  & @  &  @  㿘4 `<<D4`X0 4( K I"@@ @:`@@@@@@@@@`@`@@`,"@(?  " :2    "@"@ R "@84 "@> @@`25"@(.?  " :2   €`"@ "@6ǂ@ 0##  # 㿘 , %D   && 4&.㿘 @ @h㿘" `"/& & &&  ( *@& ( @&  & &  "& "  (*@& (㿘" `"/& & && & $ (  & (  $€ @& `& & @"@& "` (*@& (㿘  " @<`@`d@  ( 6   $€& @& $ & $   4`  *@  "  $€"       @ *     (@  $  ( &  @ & @&  (*@& (  :     @ 㿘 '`# %: ( (  $€  @  (& (`& & & & @㿘 '`# %: ( (  $€  @  (& (`& & & & @㿘2"耢 (#@ @黔! a#@ *@``z$*@ A#@ *@``Z$*@ 0#@ *@``9$*@#@ * _2 "b2 Unmatched ) or \)Regular expression too bigPremature end of regular expressionInvalid preceding regular expressionMemory exhaustedInvalid range endInvalid content of \{\}Unmatched \{Unmatched ( or \(Unmatched [ or [^Invalid back referenceTrailing backslashInvalid character class nameInvalid collation characterInvalid regular expressionNo matchalnumalphablankcntrldigitgraphlowerprintpunctspaceupperxdigit㾸'ĺ'ĸ@   '@d"  ' ''& *@* *@&&+& 2 @凒 &@D &  Ԑ &䀢 /@'$䀢  '  ?`r +"*`@,ڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤxڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤڤX@Đ`䀢@ `2 @ j*   q $@  -  ( * &&@  & $@ %` %@ $@ %@$@   ؀  䀢 `2 @ H*   / $@  -   * &&@  & $@ %` %@ $@ %@$@   ؀  Q?d 2/`  ` 퀥 /  `. :  +` *:  ?` 䀢1  '  *".   +".  ?ޑ.  \䀢"   w  '`` + ?Ĥ?'䀤 J* l$@  -  Y * &&@  O& $@ %` %@ $@ %@$@   ؀ ?NJ?`.N.@. $$"$.  䀢"J N` N @`@$ $`@ $ @  /$ @ `$@  -   * &&@  & $@ %` %@ $@ %@$@   ؀`  $@@ Ж .   `$@  -   * &&@Q  & $@ %` %@ $@ %@$@   ؀  @  a`$@  -  s * &&@  i& $@ %` %@ $@ %@$@   ؀, /䀢 G $@ " -  9 * &&@  /& $@ %` %@ $@ %@$@  " ؀$@  -   * &&@ & $@ %` %@ $@ %@$@   ؀`J ^  *@J@ ^`''$@  -  * &&@c & $@ %` %@ $@ %@$@   ؀ ,@` @嚔  ؀a1a ` ,`1a䀢" |  ' ` \ ]䀢"s j  '`ސ` ]`䀢 ` -J ]2V -Ā J [Ā J [J ^J ]J@ -`J` ]@' '@ "!` [2/J@ :2/@  '䀢 䀢`'䀦 @  : ]䀢 ` ` $@*?`$@*? :NJ ]I+@˒aH`?/+@ĒaP`?/+@aX`?/+@a``?/+@ah`?/+@ap`?/w+@ax`?/o+@a`?/g+@a`?/_+@a`?/W%+@`?/O3+@~a`?/G+@waP B@r =+@lax 7+@fah 1+@`aH +@[a &+@Ua  +@Oa +@Ia +@Cap +@=a` +@7aX 2H 䀢= '䀢4 '<'4','wog_WOG<` #  q 4` #  f ,` _ ^  #  T ` #  I ` #  ?  #  5  #J  +  #  !  #   ` #   #  D"  2  *@ @  ,@ ~< /?'  `  ,` ` ,`// 2   *@ @  ,@    ? ,@ ?  Q@@2 @` hd  @d "@@=? 䀢O F ' ?ـ`U|1 *`@lTڔڈڔڔڔڔڔHHHHHHHHHڔڔHڔڈڔڔڔڔڔڔڔڔڔڔڔڔڔڔڔڔڔڔڔڔڔڔpڔڔڔڔڔڔڔڔטڔڔڔڔڔڔڔڔڔڔڔڔڔڔڔڔڔڔڔڔڔҘڔڔڔ @ &`'쀢@*`*`@@*` '* '* @*`%" *` * `%@ ""*` * $@" * * @`E"`*` * $@ "$@  +  * &&@2 & $@` %@ $@ %@$@   ڀ ,@`,@`,@` '  ; @ `@N ?$@  - > * &&@ 4& $@ %` %@ $@ %@$@   ؀ ,@``$@  @ @C  ?'* @*`    *` *  Ǩ  @* $@  - ֠ * &&@y & $@ %` %@ $@ %@$@   ؀ ,@`,@` @!@܀d݀ $@  -  * &&@7 & $@ %` %@ $@ %@$@   ؀$@ @x ``$@ @b$@  + Q * &&@ G& $@` %@ $@ %@$@   ڀ`  b]"@@XĀ?@Q?䀢?@2.' +`' @  !a#@   & . *   ?䀢 `' @  `@ ,25䀢+`' @   a#@   & , *   ?䀢 `' @  `@  # c@@@ \䀢`'䀦 @  }@2'  ` y` < $@  - o * &&@ e& $@ %` %@ $@ %@$@   ؀ $@@T`  $@ - 2 * &&@ (&@ $@ %` %@ $@ %@$@  ؀ `"" @`  @ `$? @` $@@`'䀢`'䀦 @ @ Ā J? \ $@  -  * &&@_ & $@ %` %@ $@ %@$@   ؀u $@  -  * &&@) |& $@ %` %@ $@ %@$@   ؀? $@  - Q * &&@ G& $@ %` %@ $@ %@$@   ؀  $@  -  * &&@ۿ & $@ %` %@ $@ %@$@   ؀Ր $@  -  * &&@ۊ & $@ %` %@ $@ %@$@   ؀ $@  -  * &&@U & $@ %` %@ $@ %@$@   ؀k $@  - } * &&@  s& $@ %` %@ $@ %@$@   ؀6 $@  - H * &&@ >& $@ %` %@ $@ %@$@   ؀ ,@`@V А`'''А@`*  D $@  -  * &&@ڝ & $@ %` %@ $@ %@$@   ؀ ,@`,@``  "3   2-`)J@ *% ^#` \ bJ`J + ?bN@J {"FJ@ \2AJ` {2=$@  -  * &&@) |& $@ %` %@ $@ %@$@   ؀ ,@`,@`$@  - M * &&@ C& $@ %` %@ $@ %@$@   ؀,@`  -䀢V䀥` $@@  @ٜ$@&          *@*`:*`*@*`:*`*`:*`㿘  *㿘  ?? +ې J\`?H(  2 2  H| 2 2 J\`?    J H)"  J|"  0 H|"   , ((  (  24  "2  )  8%   8   8    (@  *@ 㿈     ` '7? '' @(! @ *@& 2  2@ *` * &  ?'* @ `8!ē*`@DT8hX   - * ? Ӥ ``:  `` ?$@:@ 2-` * `4  -``$- ,`?  ``:  `` ?$@:@ "-`  #@ L@ "-``$L@   #@ L@ 2-``$L@ |   -``$- @2 n- l { L* @`c  ^ L* @S*@MJ' L* @#쀤22 @Ѓc48E?, h#`@0, '* '`'*`"    &   L* @` î @/ 耤 䀤 2@ *` * &    (" "@"` "` (" "@"`"`㿈#\#`#d  @㿐\`d`` 4??84$` `@  `  4y? ` `@ ) l?) j?) `BA `= * &$&@ " @ O@  `?? " @O@ `"&@& @J   2 #\`"#\`"?#\#`@ ?  $ ? ??㿐#\#`  @'''''` ' '  !!'l'T` ' ''  L/```c ?#`'`c ?#`'`c ?#`'`c ?#`'|`c ?#`'d`c ?#`'\`c ?#`'t`c ?#`'L`c # `'D c`` ]|`Zt Wd`T\ QL`ND T?`OĐJ? Ĕ?07#;#=#. | @ !  @ ! t@    @ Ā  Ԁ`'''̸@Ă'Ԇ''̲&@̀  @Ԧ̦$2" "[\ :̀   T@̐@T@ `?@l` `T`a^  'l'TV . @d!@\  !Il`"\TԀ ( \. d@!\@  !\` @2@2" ` 8 @ \ @\@\* \ `@@W* \!   t`r`* @! `  \`\@ : @`@v*`\!  @p*`\ `` N`U?\  " $$̐"@ ?̖@\@@ =.  ?@ ? \\ .  " +" `̀  . @ Ԁ ". @"̐" \`̀  . @ Ԁ ". @"̐"  \@:?\ .  " "   \$̐&߰"@ܰ"@`b< ԓ*`@ HD  $   T   P  @ p  l 0   `9 IL@+?@%LL@?@*t@    @ ~ @ `"L H@  `" L H@ @ @ٔ*t   ! G  `? "`" @ * @ 2`  `: 2  @*t   ! ' * t@0 2 @t ** t 0* @! * t@ 0@  * @! *  @ *t  ! *` *! a  * t@ 0@  * @|! *  @ *`t *@! ?* t@@ * t "  !! * t@@ 2Ē '         J *  `' ' ' 2\ ` 2X ` @2S*`t@ @*@ @ *  @ | @ @   * ' J *  '"%`*`  %-2*`  %`*`  @4쀢* h#`@o* '* '"@@ @`'*`+  " `'*`@ " `'*`t  " `'*`" `'*`" `'*`" `'*`J" *@C?> ̀`  Ԁ@` ̀`  *Ԁ@  ̐@ `? *@*@ @@ %%$4`@i @” @Ц̀ Ā 2L`    @@2LN  `@@-̀ "Ā  L* "%`*`  &52*`  %`*`  @ʯ4쀢* h#`@\* '* '"@@ @`'*`+  " `'*`@ " `'*`t  " `'*`" `'*`" `'*`" L* ' `': ` @ @   ` `a "%`*`  %52*`  %`*`  @'4쀢h* h#`@ԕ* ^'* '"@@ @`'*`+  " `'*`@ " `'*`t  " `'*`" `'*`" `'*`" `'*`'" L*  ? 8 * 9   . ..MAKEDEVconsole ttykmems\ memnullsXzerosUeepromopenpromdrumpGklogt@stdin@@stdoutstderr@ttyattybsR fbmouseZ kbdrandom@srandomurandomprandomarandomfd0are@fd0bq2fd0cpE@rfd0agrfd0b@rfd0csd0apE@rsd0aAsd0btrsd0bV@sd0c rsd0c`sd0dq;@rsd0db@sd0eq0rsd0e`@sd0ftrsd0f5sd0gpF@rsd0ggsd0htrsd0hsd0iq=rsd0i6@sd0jpHrsd0jsd0k rsd0k1@sd0lq3rsd0l sd0mq9@rsd0mOsd0ntrsd0n@sd0orlrsd0o_sd0ppIrsd0p?sd1at@ ... . ..bootgxbootxx8binstallj . ..MAKEDEVconsole ttykmems\ memnullsXzerosUeepromopenpromdrumpGklogt@stdin@@stdoutstderr@ttyattybsR fbmouseZ kbdrandom@srandomurandomprandomarandomfd0are@fd0bq2fd0cpE@rfd0agrfd0b@rfd0csd0apE@rsd0aAsd0btrsd0bV@sd0c rsd0c`sd0dq;@rsd0db@sd0eq0rsd0e`@sd0ftrsd0f5sd0gpF@rsd0ggsd0htrsd0hsd0iq=rsd0i6@sd0jpHrsd0jsd0k rsd0k1@sd0lq3rsd0l sd0mq9@rsd0mOsd0ntrsd0n@sd0orlrsd0o_sd0ppIrsd0p?sd1at@rsd1a8@sd1brc@rsd1bksd1ctrsd1cl@sd1dtrsd1dZ@sd1e rsd1eJ@sd1fq:rsd1fsd1gsRrsd1gsd1h rsd1hsd1iq=rsd1i sd1jrirsd1jsd1kpJrsd1k^@sd1ltrsd1lT@sd1mrcrsd1m=@sd1norsd1nGsd1otrsd1o?sd1ptrsd1pDrd0aq6rd0ctrrd0arrd0c^cd0aq6rcd0aHcd0btrcd0b@cd0ctrcd0c cd0dtrcd0dHcd0epOrcd0e9cd0ft@rcd0fcd0gs_rcd0gWcd0ht@rcd0h@cd0irircd0i cd0jrl rcd0j] cd0kt rcd0k@ cd0lpBrcd0lDcd0mtrcd0mccd0nrjrcd0n@cd0osQrcd0o@cd0pq9@rcd0p3@ (3   @31}^(@@=<@`bT U3@@(?(0l@A 3 }3%P3%P bA33n]3n] #(dA3331;€ jm/3[3%3%!3\3\3\R!3Z3Z3!yp!3$Ӏ3$Ӏ33k!r!36v36v3Mkr!3 A3 A3\!3 L_3 L_3  }!3 x|3 x|3з ‡f!33333FCr|!3_/3_/3$j.O!3&-3&-3(㇀qJa!3+E3+E3-';+!3/q3/q31YB!333336v%!37:37:37: e!3:,3:,3:, %!3[3[3!333 FUZ!3Ȁ3Ȁ3 "(~!3=03=03"wj!333"w)}!3iN3iN3"w-)!33333"w`!3k3k3"wpla3 x|3 x|3/qa333/q"]-a3{3{3/ql!3_/3_/3/q6Ȃ!3!#3!#3/q6y!3%3%3/q6p;]a3[3[3:,]$uS!333:,[Va333:,峑!3 L_3 L_3:,ka333:,\r!3sm3sm3:,3a333:,xLB!333:,7Ra3Ƙ3Ƙ3:,!3\3\3:,8k%a3"U3"U3:,f!3$j3$j3:,i&a3(㇀3(㇀3:,l!3+E3+E3:,XXa3/q3/q3:,!31Y31Y3:,yEBa36 36 3:,I!38bЀ38bЀ3:,ba333:, )!333:, a32323:, Z:!3 }3 }3:, |a333:, !3 3 3:, q_a3з3з3:,  ,,, L* ?,> , L* ' L* *> *`̀`Ā`""#@2N@2LO?J `?#@N2LO?@J `?g̀`Ā`#@2N@2LO?J `?#@N2LO?@J `?0#@N2LO?@J 2̀`Ā`"#@N@2LO?J ̀ Ԁ{Ā x#@N@2LO?J h#@N2LO?@J RP#@N2LO?@J 2;@3*t   ! )#@N2LO?@J @ *t@    @ {@  n?'* @ 2'* '* '*`  *?'* @t! ?'* @ @ ?'* @! :+      Ԁ Ԕ ' L*  ' '   (  l`MT?㿐 ]' @ H K`' `J`*`  H'@G*  @'  `' `J`*  ' ?  ?   ?J?*  @@!*   '' & @0*  "   㿐'  @*   `' `J`* `@ '  㿐`' @`gC"p*`@             <        h         K, 0 **0* &*-  J *`  '-  ' J *  '?' ?J?*  '' * 0@    '&  @JJ`  2  㿘* *@@ "2C2b*  No previous regular expression㿘  !   @ 2, 1D)  @ 2! @̑ Ȁ  $ @!  @ $ @̈! $ 1+ !  @ @ $ @22b*  㿘@  @   82 㿘"@"&& & !& @O! & :  a]  c  !,*   * & @ ?!   @*@& 6 `*` * & @ϡ槖 " h@ϓ @ @ ' ' ' ' ' ' '  * *@ 7  `*`* * @`''.@ߐ'@ܐ'쀢 `& Ȁ`  `  ** &    "`@@6 Success㿘  2@`". @ E @  @} *?@s<㿘 "&@ˡ&& &   "& @˘&  *@&   "& @ˍ& gfgrepfgrepgegrepposix-egrepegrepggrepgrepdefault㿘׎ memory exhausted㿘 !    `a] #  ,*   * 񀢠 !   ` K "aE"(Y 㿘! ! D! ' )   $!@Ί| "6 2 ! '  2@oa " 2 %!䀢  ^\(\(^\|[^0-9A-Za-z_]\)\(\)\([^0-9A-Za-z_]\|$\)\)$㿘Đ+ +Ja Ā "   <!l "  ! E@ʡ`2F (,@ !  F 0 0,@ `,` `,` `,` " F`8@ @ @@ " F@`P@   !  F h h,@@ *` *` *`@@ l ?^((^|[^0-9A-Za-z_])()([^0-9A-Za-z_]|$))$㿘 !E@Ēa !*!.C# #>! !a oĀ " d  Ҷ!l "  ! A@`2F (,@ !  F" ",@ `,` `,` " Fb@̙ @͆@@̒ " F@b0@̈  !  F"H "H,@@ *` *`@h@ l҂ 㿀˶ !?#/ -a !` !䀢 )$T谒 @$"  ?8N? !耢@  !l  њ䀢 ,  !l  э䰒, @$" ?8N?䀢 {$ $  /`j !h" !   " b ! $\ " Q`P$`@ ? 2 @* :   @J? _<@  2 @ * :   @ N _+  $@ ``@` $$@˚`"`` A  @&㿘!   N@ "!`@*N@! g&@ @! @*`  )!䀢  㿈e' @%a$^谒Z !  N? 2?  :A N 27 ;  " 5-* `@  2   _"  : `@   _ז   @  @m"   @ &N? ?8N?㿘@ / %s 㿘@!H H@cb@"?Q@`#&* @? (@@T@HHN  /@(b( @qq@Ր 2N N 2 ?N /"? .?@ N /"`? :N`@  @˅@˂6 H"@w@ ".H"0@q;@˟ usage: basename string [suffix] 㿘a!`H@Gc@ˋ 㿘@aFfh:t:vonly one -t option may be specified.nfs㿘@ @5II -  + ) # \' @8?V? 0O*  % & & & & & & & & & & & & & & & & & & & & & & & & & & % & & & & % & % & & & & & & & & & & & % & %  %%b bt%"3!< I @`H@bt$@yQ#*` @    @g "  3!<  I@ p   @ @\@ 2 `@ @ِ/㿐@ϒ 2 @%  %I,` L@l Z "@f < " @, L 2 ,`%s%s: not currently mounted%s: not a directory or special device%s: unmount from %s Cannot MNT PRCBad MNT RPCx@ xI#@ h @Ք0 @Δ)I"#<    @hI#<   I @h I##@L @h hI`p@    @w @ ,@e @,@wԒ :  ,@Y :,@%  " I#@o " 2h  @b hI#@Kܰ 0ZI`p@ɢ  2T "Q  "@2K , @Δ  /7 @@ʣ  ''?'d'X'\ab X@y dI@Yg#( @Z$ 'x'|'X'\ X#\@ KXȘ!؟ J@XE`   `@   @getmntinfo㿐@  J@Kr#: 67 ``.  @S ` `<@] .  L2 .  L@; 2  `<@E .  π` 㿘3!<  3  "`?!<@     "@ empty type list㿘  N  n K@a`  N  o    "b""  @vŒ ,``!3`@Y* $!<2$ @#O   @v ,,`*@`$`$㿘  "  "@m "/ @v . "  * "@m 2   " ! "@m " @vy . "  *"@m   " 㿘'HH@~Ô$usage: %s %s umount [-fv] [-t fstypelist] special | nodeumount -a[fv] [-h host] [-t fstypelist]㿘a!`KcxKK@D@Ȉ 㿘@rsh8KLdek:l:nwxrlogin/usr/bin/rloginrsh: can't exec %s. rsh: must be setuid root. rsh: unknown user id. ekshellkshelltcpcan't get entry for %s/tcp serviceshellrsh: shell/tcp: unknown service. RSHrsh: unknown service shell/tcp. remote host doesn't support Kerberoscan't provide Kerberos auth datarsh: the -x flag requires Kerberos authentication. rsh: can't establish stderr. rsh: setsockopt: %s. rsh: fork: %s. 㿀@     ' '@@" / @L@`@ " '  ,`  7L`J@ -L' ,`7LL#$% \/''"+'&@@dH?f?Ȁ @_*  2 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4( 2 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 44 2 4 4 4 4 4 4D 4< 4 4` 4 4 4 4 4 4 4 4 2 4h3"! t%⸐t@uC (&  %b''#h@ْb8&@&Q@"  Q`"*`@ '@Q#* @ 2Q`L X&@@!!L@@@! `@ a!`L`p@ `@6 #* @!@ a!`L@`@) @@ a!`L@ג`@ "'"耢 2 @%3!䀢  '"耢 L L L@`Р3"!'"耢 "LL  L@ ؀ L!L@Ғ`Р2 La!`L@a@ސ @+!03!䀢 N \""0#'b '@$b'"耢 ''"#\'"8#` '"@$b ' '"@b 73"!L!L@А`Р2  \a!`L@Xa8@Ɯ "0 =2 \L@!` \"0 3L@!3'"耢 " a!`L@;a@  '@Ǝb찒'@s "쀢  a!`L@$a@h (?c @x4  6 ' \@j"0a!`L@b'"?c @x     \@j"0a!`L@b@@ @Ð  @ď   O@ĉa @Ć   O@Āa @}   O@wa'@#  ' \@j"0a!`L@ƒb @  '"耢 '"! "~@Ĭ"~@Ĩ@@Ė @ rsh: select: %s. 㻐 MJ'@ī" \""0 @l$9 *'  @w  \"0 " @j?a!`N@tb@Ÿ : '"耢 @ @& & \Ǣ@А "0 #ː@̒ @Ř @3'' b* *@1 \5' ,8'b쀢&   @wd "0 L`!a@i#N!`@,b@p b: &"0耢  @$b@$   "0 #b,,@@͔: `&"0耢 @$@Ӕ$  "0 #2 @`@î`2'㿐/'"耢 '"@ 0"@Ù rsh: warning, using standard rsh: . p'H'L'P'T'X@s !a!`O@aؐ!`@"H!`O@brsh: %s. 㿘 @Ļ@`@ 2 @- @iZ a!`O@bp@Ӑ @  @h@@h@L 2 ` `, @ usage: rsh [-nd%s]%s[-l login] host [command] x [-k realm] 㿘a!`Oc`OO@T@Ę  , 03 $㿘",@hƒ "0@h’ 㿐53$ !"(@ݔ"($"($"]&$!3"$ "(@Β"$@@&$"$@9  2I ` @` ` ? b(@%3  "(b(0",@& 􀢠"0" "("b(53&$!"(@@"($"($" &$!3"(@"$"$@$"$㿐 3b(  "b(@^ @@' b @b  b("@@\  "  b40",@Ϛ '@^  , b4@V rcmdkrcmd: %s P?'ܕ.`#\#`P"#d#h#l#p#t#x#|#ܒ2 @? @! 2?N. a!`Pb@` ? ?܁krcmd_mutual: %s \` .`#\#`P"#d#h#l#p#t#x#|#2 @m? @ 2?N. a!`Pc@$ ? ?can't allocate memorykcmd(socket): All ports in use kcmd: socketkcmd: connect to address %s: Trying %s... %dkcmd(write): setting up stderrkcmd:acceptkcmd(socket): protocol failure in circuit setup. kcmd(getsockname)KCMDV0.1kcmd: bad connection with remote host '''h| #@'Դ@>@'O?@Lq@ Q@DԐ E?&N @* @q ' \/a@5Ԥ 0 #QQ`@`0SP  @@g  / ` /7`@(` @\  ?\@0 0 =Ԑ?'2` 4`ʩ-   0'@>`Q@W`$0@MÐ ``$``@` '@>Ґ`Q@Da00 =@@M@Ѱ?Qa(@ U'@ȐԴ '?@+ Ȑ Q0@N@3 @ڒ@, @Q@M|!8@?@Ġ?*  @@@  \Q@M_!X'? 7ـ a~* 2 !a!`QNah'' ' '  'x@t  Q!@M4?R@#\t#`l#dp#hx#l#pQ!#t`@82:@ @h@ @b@v   ?a!`Qa@?O @`   @B O ?@:   \@@@-㿈@h0 \"0 2,?# $ /'  @sa &? 7@s  # \b0 0 ?$$@L #$b0@G?㿘@&node must be type 'b' or 'c'.non-numeric major number.non-numeric minor number.major or minor number too large%s㿐@ "`@_`J c! !`J b S@ﺒ`` @ ` @ J@  S@禍``@Ҕ ` @ J@  S@`,  2    S@`. `@2`  Sa@A`@ usage: mknod name [b | c] major minor 㿘a!`S@bp@ 㿘@,hms:t:/dev/%s%stcsetattrTIOCSDTRTIOCSETD%sslip.%s.pid/var/run/w%d Failed to create pid file %s: %m`@1#+SS#'@?#! \@7b?P? 5I*  P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P@ @@et"t3"c@"t3"c@Q#&*  @@@1S"@   !*  S"@# @ k@KW@, ''''̐ //3@c @ڔ  S@_b`y@  S@Tc `3@  S@Ic@g  @ !T@O# @L#@*"`@$N@ N@ /N@ /"!) Sc(S8@d@   @#  S@ewcH!*  $ *ScP@@}  'Đ ScX!)@B0 , '@:0unable to delete pid file: %m㿘) J @]  ) \"0 T @B ch)* @ slipstrip㿘T@yXc   T@yPc  @usage: slattach [-t ldisc] [-hm] [-s baudrate] ttyname 㿘a!`U@ `P@d 㿘@q_block_size_block_count_block_tableusage: installboot [-n] [-v] [-h] [-s isofsblk -e isofseblk][-a ] 㿘a!`U@a@- a:vnhs:e:sysctlSUN-4sun4csun4boot: %s proto: %s device: %s architecture: %s sun4mUnsupported architectureopen: %sproto bootblocks too biglseek bootstrapwrite bootstrap㿈@p/UU"+2# \)2 '2%2@u᐀?5? .*  W8 W W W Wp W W WD W W W W W WL W W W W W\ W W WTbt%a`%!d$$@cbt4"`0@cbt4"`4xɐQ#& 2n2Q#* @"2 "T2 "al2!` *2 ' ' d' 2 @ ? U@Ēa  U2 a@  22U!U!"a`2 䀢 U2!@c`2U!@caT2U!@cal2U!@ca`2!`U@xa 2!`U@xa  2!`U@x b  2 "adU@컒b2!T@袒!2@* !l @v 2 Ub0@h!l @ @ @2 耢 3"@!2 U@쎒b@!l @R  Ub0@D!l "@F  bU@7b`@@e耢  U@*bp@ nlist: %s: symbols not foundnlist: %s: wrong typefstat: %smalloc: %s: no memoryread: %s%s: invalid address: block_table = %x%s: invalid address: block_count_p = %x%s: invalid address: block_size_p = %x%s: entry point %#x %s: a.out header %s left onstripped offproto bootblock size %ld room for %d filesystem blocks at %#x 84@Z` V"4   V4   V4   V"@?0 0@ U"0@?1 @ V#@?'0kȒaB  "@!2`* @ *`  @ V#@?0U@̖: ȀV̀V#(@?0B@ 2!d  `  a`a >@?@`?# @@! ?@@ ?# @  ?Q@@ 2K@@?@ `?# @! 2 @9@@ ! 3@? ?c @ ̀@2 @%@@@@ ̀@@? ?c @! @"  @@@@! @# #?B ?@ `?# @! 2 @6 @@ ! 0 @? ?c @ ̀@2 @" @@@@ ̀@ @? ?c @! @   @@@@! @ @?@ ?# @!@ ?@!@? `?c @! @ ?+" @@@@! @? " ? `?c @! @  @@@@! @##? "@? ?c @! @ "@@@@! @""24   "a\2  "aX2 "`V#8 2!XV#`2 쀊 V#@=@I@6 22!X"ah2 䀢 V#@ad`2!d V#V#V#@aWV#@aS24W ah@aL@!&  & &@2!d `  %s: devread: lseek%s: devread: read㿘. >@ޖ   "Xc@̔@ Xc@”statfs: %s%s: Too many blocks%s: %d block numbers: %d ffsufs%s: must be on an FFS filesystemfsync: %ssuperblockNo memory for filesystem blockinode%s: block numbers: %s: block numbers (indirect): indirect block8@{  Ub0@m@tْ 4 Y``@c 0 J2 ""@2X4 4 0"  * "X2ah2 Y`p@酔 䀢 2!XY @` 2!X2-4+2)2'Y%20* a\, "@ 䀢 @`u X02 䀢 Y@`h 0ԐY`@r   Y`@k   Y`@A@M  Y`@@ V c@@r!*  Y  @ 0 Y@a@u @  ,@ @ @@g @e x `* @ d,@  0Y!(@W x* 2  0"@ 0?: `@ B  @;  2!h2 Y`p@ߔ!X"2 䀢 Y!0@_`(`(  5232/Y2 d*@\,"@`䀢 @_В   뀤2 䀢 Y@_ C2 䀢 Y!H@_`X 0Y!h t" 2/2-2+Y2 d*@\,"@䀢 `@_  t ꀤ2 䀢 Y@_  Y`p@i 㿘@Uroute: botched keyword: %s usage: route [ -nqv ] cmd [[ - ] args ] 㿘a!`Z@sba!`Z@nc@ route: %s: %s 㿘 \"0!a!`Z@]cx !`Zc@U@^a!`Z@Mc@ nqdtv/dev/nullsocket㿘@ /[ /[[ +4 )4'4%4#4@?)? "*  m m m m m m m m m m l m m l m m l m l%a\%! $$$c ՐQ#&* @@4"c@!4$#4!  [ @ 4  @j 4"`!4@#@#4  6@[u @ K@ ?`'E[!*`@ n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n4"#@Z 4"#@  @s 0 @K @ must be root to alter routing tableroute-sysctl-estimatemallocactual retrieval of routing tableExamining routing table from sysctl (address family %s) route: write to routing socket: %s got only %d for rlen %-20.20s done x4#耢  \ ""0[֐#4 @ꭒ X T`@J@ -O@ `?`I\ *`@ q q, qL q< q q q q q q q q q qL q q q q q q q q q q q q q4 '"`4 #"`4 "`4 "`4 "`#aa`![# \@\"0@[#@]’04 "`c@ ' ''' ''  ܘ @< [d#0@Xܠ2[\#H ܘ @( 6[O#Pܦ4  [@]#x4 [@#@]`P +4)[` @ `,>4 `4 `M 27@4# 22@ ,`$`4 @>@@@4!  ` @ В@` `L@C@@]<# @9@]6#\@]3 @ ` 2p  Q(p`4 .2_ 0*@` *@`*@? `` * *2!pdefaultiso %s(%d) %s㿐4`  "`#2c`@Qw!  2c`@e .c`@[Q  2*#`  2 2`] *` `* `* `* `* `* `* `y*?`j]!*`@ u w w w v v w w w w w w w w w w v w w w w v  '  ] 4!\ ` @ @d . 2@p’c` ",`!2'@3*!2"`@d "`$, @>"@@ؐ@` 2"`!]@~12 52"`!]@~12"`af %d: %s㿐 ?`m ]#*`@ w y( y( y( x x y( y( y( y( y( y( y( y( y( y( x y( y( y( y( x 4]$ !\ !?  0  ??   2:@` :``: @  2` '@2!3 `@d)  `$, @"@$@T@ܐ 3 `!]@~213 3 `!]X@~%13 `㿐 `"J^!*`@ z@ z z z z z z0 z z z z z z z z z z z z z z z z z z z z zP z z z z z` z zp4  4  4  4  4   4   4  @4  4a"a4!` 44 "4`"`4` 2"`@Z$0%s,%sold usage of trailing 0assuming route to if old usage of trailing digit, assuming route via gateway %s %s %shostnet: gateway %s (%s) not in tableentry in userouting table overflow: %s 㿐^# '4#耢 ( \ ""0[А#@N g4 @磒 ? _ '4%4 /4 `@J@ -4@ `? +*  ~P  ~t     ~ ~  ~4  } } ~ ~ } } } } ~ ~ ~(     T ~ } ~\ ~h  ~H   }    ~ } } ~| $ $ $ $  $ *$ $ ,$  $$ܐ % wd4" 4"!`3c "c`@ @@abh?2`@& ` ?2`@ ` ?2`@ `y ?2`@  `p ?2`@ ` @@Lf@?2`@ ` @@> 4a V"a?2`@ `@lK?@ې F?!X  4@ @:!X  @0@Y@ ?4! ^@@nGc  ^#^c ^@Z 8% %܀ 4! 2%^@Y#P^@Y#p%ܐ @ @? 4`3# 2 4! 2 ``4#܀ "` ! \'4%4$"0N@"0 3 2N 2NM 􀢠"N`  `"`@ ߲`N g \@ "04! 0 ^#^#^#@YM  ^#@Y` 4  4!@'@0+^@Y~#  ^@Yx#Ȁ  " ^ 7 "^0 "^0 ###@XG_@Y^  4X  X*  ?#( ?* ??* ??* ? ? ???"`4"`(*`J` ` H  *@Internal Error%s: bad value p4` 24 "`4 "`4aX"aX?`>aa ԓ*`@ T ` l x 4 44  4 4#4 `4 4 ,ab P4 ,]@l` 24 "*,  4> "!,: a "a  1  ?`a"`*`@ T T T T T T  T T T T T T 8 T T T T #4` @ ,  ,`4!!4 `4 4aX "aX#@@ 44444 4  h  ߰  #4` @ ,  ,`4! !,  `,  `,  `, 4aX "aX#@@m ,,,,,, , , , , ,, &   @@J   2   ,@J@ ""@,@ڒ} @   @wsq ,,@hj "&@_ /  @,@@J=? ` @ה 2,@@J/? 2$4!  $'@Ѐ  8 @.Y? 3# @   "  , @# '& ,@@   a!`a``@@ѐ 4X X4 4?(*(4 (༁ *.**.0x%xany*0x%02x%02x%02x%02x%02x%02x.0x%x0x%x.%s%sH 7 7 7 7 7 77 7•4 ! 24`2131b=#`!`bch@V6!`4!@yM  4b#p!@yC  b#x#\#`b@Vxc@b@Vrc13/13!`!2b@y2а!`*.0x%XH%02X%02X%02X%02X%02X%02XH.%XH%XH.%s%sx / / / / / / / / / / / /*   /////* /+4(`4 24`2131bN#`"ca0@VG"4!@xɔ  4b'#p! @x  b#x#\#`!3#c@Ua8L#΀ 0 #3#ڀ :  K 0  @3#c@UޒaX13*#13"!2c`3@xcİ"actual retrieval of interface tablex ' ''' ''  ܘ @ [#0@ܠ2[ސ#H ܘ @ 6cѐ#ܢ @ got message of size %d 㷘4 "`4# '4@Y %d@(@U@kuwriting to routing socketroute: read from routing socket: %s 㿘4! \""0? @"L a c  g   4 `a  `a *`a *4aX "aX4ad*`"` *`3 ""`4!X"` 4  "`$"`("`, "`0"`4"`8"`<"`@ "`D$"`H4!"` @4!X 4 4 ?`` 4 4@4 d@a4!X 4 耢 ?`` 4 @4 d@qa4!X 4 ?`` 4 @4 d@Ua4!X 4 # ?`` 4#@d4 d@9a4!X 4 ` ?`` 4 `@H4 d@a4!X 4  ?`` 4 @,4 d@a4!d$ 2!d4  @S4# 29 4 4ad@  d@:L! +?) %44!d#3!4@"L c @ #䀢@` 4 \@S"0a!`d@a@ !d@ 4@ (J@@84XZ45/e(4༄"@(  t  t t t  L t t  t t t t t t t t t t t t 4, 494445 4? *4༄46@ 46? @ @ *@455"(RTM_IFINFO: iface status changeRTM_DELADDR: address being removed from ifaceRTM_NEWADDR: address being added to ifaceRTM_RESOLVE: Route created by cloningRTM_OLDDEL: caused by SIOCDELRTRTM_OLDADD: caused by SIOCADDRTRTM_LOCK: fix specified metricsRTM_MISS: Lookup failed on this addressRTM_REDIRECT: Told to use different routeRTM_LOSING: Kernel Suspects PartitioningRTM_GET: Report MetricsRTM_CHANGE: Change Metrics or flagsRTM_DELETE: Delete RouteRTM_ADD: Add Routerouting message version %d not understood %s: len %d, if# %d, flags:metric %d, flags:pid: %d, seq %d, errno %d, flags:㿘4 B `f@Sq" 0: 4a*f"P @Sg    2ff"`@S[ a! 4@  Tf"p@SO a! 4@ @ 0f"  @S? a! 4@ڔ@v route to: %s message length mismatch, in packet %d, returned %d RTM_GET: %s (errno %d) destination: %s mask: %s gateway: %s interface: %.*s flags: %s recvpipe sendpipe ssthresh rtt,msec rttvar hopcount mtu expire%8d%c %8d%c sockaddrs: 㿘    4ِ 4f@RՐ# a!`f@b 0!`fc@  "  @Qa!`g` @ 0뀢 . L  & "  "      2  2 ?` @` ـ  ,  {g@Rw 8 !4!\ $!\og@Rk P$!\     ag@R] h"gg @RUg@RR a! 4@g g@RG` $   Lg!@R> 4 $   Lg!@R5 8 $   Lg!@R, < @!@s# $ @  Lg@R! D!@f# $   Lg@R! $   Lg!@R  , $   Lg!@R ( 0 " $@Fj  0"@& 0 $   Lg!@Q 04 " @&0?Hg@Q!!a! 4@|!? "! $! * @7  locks: inits: 㿘h@Q!x#aa $!4@Z!Xh@Q!a @S!X L@   sockaddrs: %s㿘`Bh@Q!!a!4@<!? "! $! * @6’  #h"@Qb  ? @ a? " " * @6 a@O!㿘`Y @>@ 6  , < ?`&  @  `&*@ @6v !  ?`&  @  `&*@ @6_ 4  8  ?`&  @ > & >*@6<㿘4"" " @e/ "    %s: link %s; %s: iso %s; %s: inet %s; %s: xns %s; %s: ipx %s; 㿀 ?`b*`i!d@ T@ i? @ i9  '@'Ri1! 7 7 7 7 7 7@)i! / / / / / / / / / / / /@i!(@Pta@]!㿘@@    @ `i#А *`: ? *`: ? *`: ?N 2    ,    *  ,`  * **".@$NetBSD: show.c,v 1.1 1996/11/15 18:01:41 gwr Exp $UGHRD M@dmCXLS1@2route-sysctl-estimateout of space sysctl of routing tableRouting tables x ' ''' ''  ܘ @m j@5g @< @ܠ2j@Oΐ @2  ܘ @V 6j@5O @$ j@O ؀ @+ %-*.*s %-*.*s %-6.6s DestinationGatewayFlags㿐j"#\j"#`j!  j @O %-6.6s 㿘 M3  L"@F    $ @   ,   @  j@bha? " " * @4 InternetXNSIPXISOX.25 %s: Protocol Family %d: 㿘?`,j#Г*`@ ( d d d 4 L d d X d d d d d d d d d d d d @j#Xj #hj #pj#xj# `j#j#@Olink#%d%s%x:default(%d) %02x%02x%s %-*s %-*.*s   Lx   "6 H F      2 `xk`@NV Y `  ` @k `6Kx)k'k @N@@ర  ``;x@7 `k1 +R'b# zk`@N @)k'k@`@N  Ȁ@ @`@NР@ x4k @Nq0!\ k @Nh0k @Napj \R \ Ж :*R@"` `*`R@ 􀢀 *@NDЁxresolvexnsx25staticssthreshshowsendpipesarttvarrttrejectrecvpipeproto2proto1osinostaticnetmasknetmtumonitormasklockrestlockllinfolinkisoipxinetifpifainterfaceifacehopcounthostgetgenmaskgatewayflushexpiredstdeletecloningchangeblackholeadd㿘  @ * .` *.@N p r h"  p p h r .`2 ` .` N p"N r"N hN ,2u  N T`` %`*`:  , . :2 B@M 6` .`?А 6:P ,  N N C ``* 6` `, @6` 6`N V` "6`N # V` ``   `, @N V`  `$6` J\2 Є(  *@  J  ЄЅ*(8  Є Ї**8Ѐ4*@ *@㿘@0/LtenexEebcdicimageIbinaryAasciiusage: %s [ %s%s | ] Using %s mode to transfer files. %s: unknown mode. TYPE %s %sTYPE %s㿘 !A#Hma@@m!5 h h  #A!m3mcH!@  a Am!(@2]cH*@  5A#Hma0A@@;""| h h "`@` "  2` 2  A#HmaX@`@?"b| mJ m!p@   m!@    A#@J@G "a"internal error: unknown type %d.㿘@ " @";K ` 5` h@""5 h h " @`"@`@ 2`@  m#8@(`0mK (J ( m!p@` m!@` @@""@""type㿘5`m "`: 㿘5`m "`0 㿘5`m "`& We only support %s mode, sorry. 㿘A#HnaK@@?"b|We only support %s format, sorry. 㿘A#HnaXA@`@?"b|We only support %s structure, sorry. 㿘A#HnaF@ʔ@?"b|local-fileremote-fileusage: %s local-file [ remote-file ] STOUSTORAPPE㿘'D'H   'D`&` D  DHn@:B D  DDHn@:7 D  HAH#Hnb0@ @  @;  H@?@"b|`H`""`HJ a A#P n"Xn"`n"h  K t H@  H"`  B!0 H@} H"`H   `@!local-filesusage: %s local-files Continue withmput%s: not found`'D 'HDHo@9X JAH#Ho`h@ @?a"b|JH"cG "a q@bl'F@!A#耢 !G%a#FH @: @ N !$!쀢 H@; HG! /J`@   㬔J   "J  /J   * *K t B@ . B!0 A@ А A#P n"Xn"`  aX    @ ^!쀢 HB!T HaX $aXo o@:` ! $!~$aX D %G+K)B#FK K쀢 H, @@:z@ `t H@ H, @!0 A@ y A#P n"Xn"`H, @  aX  @  쀢 2y B!T saX $aXo o@:@`  $e$aX @@ ,H, @, @X HȀ  H, o @& 0J H`D쀢 >H@: 9`t "@ u!0 A@  A#P n"Xn"`@  aX  @ 쀢 2 B!T aX $aXoo @9`  $$aX 2@gȠ DMK @IG"!r+w㿘 p@*␁w㿘9""  pp""@ usage: %s remote-file [ local-file ] local: %sRETR8'D'H   'D`&` D  DHn@8  D  DDHn@7 D  HAH#Hpc@~H@?"b|  @9   @?"b|:G! 6H J`a#@  2 JJ   "J  H  /aJc   * *H"`  K t H@  H"`  B!0 H@ " H"`#H @sq  9Hp#8@$`* :HH @9  H H  p p#H`@"9  :" 㿘@=3 A#H? " " * @- A@c#HG!쀢 B!T #FaX!K p $aX$ pJo @8c F$aX$ pF!@ "!XK" pG"!F!@| remote-filesusage: %s remote-files mget㻐'D 'HDHq@7h JAH#Hqcx@}N@?"b|JH"cG "a q@ߒbl'F@0!3G%a#]!FAHc@7T g N a&a쀢 AH@8G "AG! N     a,*   +@J+K t B@  B!0 @ )  !X p p#H p@!Ŗa쀢 AB!T H!X $!Xo q@7c a &a$!X@hG"!onoff rrConnected %sto %s. and logged inNot connected. Connected for proxy commands to %s. No proxy connection. Passive mode: %s. Mode: %s; Type: %s; Form: %s; Structure: %s. Verbose: %s; Bell: %s; Prompting: %s; Globbing: %s. Store unique: %s; Receive unique: %s. Preserve modification times: %s. Case: %s; CR stripping: %s. Ntrans: (in) %s (out) %s Ntrans: off. Nmap: (in) %s (out) %s Nmap: off. Hash mark printing: %s; Mark count: %d; Progress bar: %s. Use of PORT cmds: %s. Command line editing: %s. Macros: %s 㿘A#L`A#Hr"Xn x@rb@@|AAr"h@,cHA#耢 'A@' A#L " AA@#Hrbx@{0r"@,cH@& 'A@."Hr@{bHrbKAA#`F@{ܚa@"K xF!XK Hrc@{ŘA#PA#Hrc8@{F!ؔHr@{c`G!F!`Hrc@{K t  Hrc@8K@{LBAr#@,(cHB!0  HA#HrcؔF@{%AAr#@,cH%AK h#JF!ܘHs`@{lcK HHs@{d`@G!Hs@{\`X#Ba< s x@+H a<@)A'sA#, *#H@{D a<&, @""|usage: %s [ on | off ] %s %s. 㿘  `? & `r@E?b   & A`r@E3b A &#Ht`8@{ @? !AG#Ht`P@{Bell mode㿘Kxt0@"b|Editing mode㿘Gtp@@:"b|Packet tracing㿘At@"b|usage: %s [ on | off | bytecount ] %s: bad bytecount value. Hash mark printing %s (%d bytes/hash mark). 㿘  K`h-`? A#Hta@z@@>?`r@Db "K`r@Db K" h@<`4 JA#Htb @z}`@ ?"#K "`h1A!K h#Ht@zmb@ h J#HtbX@zdAt"p@*cH@K h"b|Verbose mode㿘@t@"b|Use of PORT cmds㿘KHu @"b|Progress bar㿘FuH@"b|Interactive mode㿘FXu@"b|Globbing㿘Kuٖ@"b|Preserve modification times㿘FuŖ@"b|usage: %s [ on | off | debuglevel ] %s: bad debugging value. Debugging %s (debug=%d). 㿘  A#Hua`@y@@E?2$K`r@Cb 2`K r@Cؒb K" `@D`6 KA#Hua@y`@#?" ````?"``K ` @b b ?"b#A!K `cHua@y `@ ` 4  "b|remote-directoryusage: %s remote-directory CWD %sCWD command not recognized, trying XCWD. XCWD %s㿘'D  'HDHu@3 AD  AH#Huc(@yO@?$"b|Hu#H@```@"|!`@" uA#P@)cHHu#@``K "`lusage: %s local-directory Local directory now %s getcwd: %s㻘   5 d&`  A#Hv`@y@@@4m`  @@Ѥ`  p#8@ `@?"b|@$  A#Hv`@x@v @ `@""|usage: %s remote-file DELE %s㿘'D  'HDHn@2t AD  AH#Hva@x@?"b|Hv!@@`mdelete㿐'D 'HDHq@2Ph JAH#Hqcx@x@?I"b|JH"cG "a q@-bl'F@~!3G!FH @2 - N a&a쀢 H@3 Hv!@a쀢 HB!T H!X $!Xov @3bX a &a$!X@G"!from-nameto-nameusage: %s from-name to-name RNFR %sRNTO %s㿘'D  'HDHv@1ܔ耢 AD  DHv@1Д D  HAH#Hw`@x@? "b|w @` Hw (@`-usage: %s remote-directory local-file dirLISTNLSToutput to local-file:㿘   &`   w!&`  A#Hwa@w@1@@w@Va0 ww!8!@`w@Vߒa "`@31` "@`w@VӒa `J |@3 ` w!H@2` @? "b|``p@ A@j#Husage: %s remote-files local-file mls㿀'D  'HDHq@11h AD DDHn@1%  DAH#Hwb@wq@H*`@'"w@V{a J |H@2ɐ w!H@2| H@?V"b|Hw@V`b؀ 2ww!@!8'JH"cG "a q@ؒbl'F@)!G!쀢 0  w a!G#FD?' 2//H.  @ !쀢 2 B!T aX $aXoH @20@ ! $!$aX!쀢 ذ  @G"!SHELL/bin/shsh -c%sTry again later㻐 @  @ @T @   @t  @q x@ !8x!@@ /" -/ @I͔#/x@U̒aH  +/K `  !A@'B#Hx!P@'>#H@p#H  KxX@ x@ x!`@@?"b|@ѐ  @ @" @?@x@!h@""|""|usernameusage: %s username [password] [account] USER %sPassword: PASS %sAccount: ACCT %sLogin failed. H'D'H  DHx@/XD?  AH#Hxch@v:@?V"b|Hx#@` 8 D 4 Hx@#H"`D 'DHx#@` $ D 4H!Ax#@&#H@#H Oa@A%@ @*H" D 'DHx#@` ` Ax#@&cH0` AD  ?Hx#@q` A?"cLPWDPWD command not recognized, trying XPWD. XPWD㿘@" ""y@T! @@"|!2 @Ay!@&ScHy@D!@""Local directory %s getcwd㻘@$  yA#HbP@u@y@"h@""|directory-nameusage: %s directory-name MKD %sMKD command not recognized, trying XMKD. XMKD %s㿘'D  'HDHy@/Ȁ AD  AH#Hyb@uc@?"b|Hy"@` @"|!@" yA#@%cHHy#0@`RMD %sRMD command not recognized, trying XRMD. XRMD %s㿘'D  'HDHy@.ԔȀ AD  AH#Hyb@u@?"b|Hz @` @"|!@" zA @%cHHz H@`command line to sendusage: %s line-to-send 㿘'D 'HDHz@.( nAH#Hza@@t@?"b|n xD@.Harguments to SITE commandSITE 㿘'D 'HDHz@.h؀ zAH#Hza@@t@?"b|z!D@H㻘@G#`#/@#@G"@  $#*< , @ @G$@? @  @ modefile-nameusage: %s mode file-name SITE CHMOD %s %s㿘'D  'HDHz@-X AD  DHz@-` D  HAH#Hzcp@t<@?"b|z#@SITE UMASKSITE UMASK %s㿘@b  "b{ `{ p@`@""SITE IDLESITE IDLE %s㿘@b  "b{ { @`@""HELPHELP %s㿘@b  "b{!0{!8@v`@""㿘A#L  @ @ A#L  @  @ QUIT㿘A#L {@R!K | "K@VK" |A"#L9?"bA#耢 B"!<usage: %s [password] Account:㿘  A#H{b`@s@@? "b|2{`@u"xx@#ȁ㿘@3 A#耢 A@ A#L @ "b@""@ F!h@ commandusage: %s command ?Ambiguous command. ?Invalid command. ?Invalid proxy command. 㿐'D 'HDH{@,X  HAH#H{c`@sAN@H@$ ? '!A{#x@##H@#H@g""|2 J !A{#@##H@#H0@  F!A{#@##H@#H$@@!h 2@ {@b@ J A#L 3I!Ar"h@##H@#H@  @@?)"b|3Ic({@ucȰ !I#)@c("c(@DH?€`A#L @ "b@""@ِ  @iCase mapping㿘G|@"b|Carriage Return stripping㿘F`|wH@"b|Ntrans off. 㿘  K!K$ tA|"@#+cH@ t"b|`t "`t@"b|!@"8`@E "8 , K * L!K L`@E  L, 4KHL  KL 4J K J(@8KL K` `JJ@ 2 `@   @*J@ `2  * J *4#Nmap off. mapoutusage: %s [mapin mapout] 㿘'D  'H!B$!0A} H@"cH@!0F"b|D  DH}@+X D  BAH#H}``@r@?,"b| "!0@""|K @D A#耢 ", L " K" @Dݒ ,KH"`@D# L " F!@D#nmap: unbalanced brackets. H"К   *` ``"?Z UJ P $ \23JJ*/: J 0$*JJ  94%JKJ@"#J?ϓ+`@ ""ؘ   J*`: +` K  +`"?K@2 K 2 J 2K   5K +` "?5#*#F!J!耢 "+a AJ [ [ \ $"J 2 J ߖ J $20 Jc  ") J 0?N  @+`J@  f +` _@ @+`@ Q * C: :  ]D \2J9 $20JJc  ")JJ 0?N & @+`J@   +` @ @+`@  +  J  ,*`J   *`:  ] \2J 2J  J @}!@!0#H0EJ ,\ ]"5Xc  "* J 02JN # @+`J@  ϑ+` @ @+`@ + J  [+5#J# 2 Passive mode㿘@" ~# @@"b|Store unique㿘AP8@"b|Receive unique㿘Ax@"b|CDUPCDUP command not recognized, trying XCUP. XCUP㿘@ ``@"|!`@" A @ cH@} `K "`lrestart: offset not specified. Restarting at %qd. Execute get, put or append toinitiate transfer 㿘 A!@ _cH0 !9@wy` :<"A#H@oaSYST㿘@>"@Limit of 16 macros have already been defined. macro nameusage: %s macro_name Enter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4K buffer exceeded. 㿘'D'HB!< 2DA̐"`  DDH@)  D  FAH#Hb@oT@!X A"@cH!B!<*` * AcH`@BO !<*` * * !< AB!X*& A"@cH@""|$< "B<`"<*` *  ?" @""|B!<*@ *`@ * *    "` B!<*` * Ac  F!X/a#a %BA#F!X`? &`@QB``$` @?, :  .<*` *  `N? A. 2`3aa  ? & @Q``&` @ ?2 ? ?  & @Q   ` &` 2 A# @5cH@?"b|filenameusage: %s filename %s %qd 㿘'D  'HDH@(, AD  AH#Hb@nu@?"b|H @*  ?A" @H#Hb@n]@""|%s %s㿐'D  'HDH@' AD  AH#Hb@n?@?H @* ?'!AH@3a@7#Hc@n)`@"b|STAT %sSTAT㿘   @ `Local file "%s" is newer than remote file "%s". 㿘?p⸀ A#H``@m`PAGERmoreCan't allocate memory for $PAGER|%s㿘'D  'HDH@' AD  HAH#Hb@m@@)5  @?4"b|@!P!X@Ґ@J 2 @~a`a@8)9" 'Kh%@$$h  ="Hp#Hp@z @H< ="$h$?verboseuserumasktypetracetenexsystemsuniquestructstatussizesitesendportsendruniquerstatusrmdirrhelprestartresetrrrenameregetrecvquotequitpwdputcproxypromptprogresspreservepassivepageopenntransnmapnlistnewermsendLmputmoremodtimemodemlsmkdirmgetmdirRmdeletemacdeflslpwdlessllcdimageidleChelphashglobgetftpformexiteditdisconnectrldirdeletedebugcrclosenrchmodcduprcdcasebyebinarybellasciilrappendaccount$!㿘@K@㻘@ܐ <  `@5@-A4A@Ȑ .`@ LJ@ &`@*@@?*<A#T@W?  A#H? " " * @  @H@+p 㿘@# @z7## @q@ @C 2 @#   @#  ...Can't allocate memory for local dir㻘@ /@ .//$@ // /@?**<`@J@ @"@Mϐ- +)-@K`0 @K 8 @  @ @ߒ  @ @@@"@Mڰ @Jɐ@"  complete/Can't allocate memory for remote dir %s p!'ؒ''?'@덒 /2L .// / @L@ /@@$@ // /@> *<K l  6@Jc Y@ @Ja   @J`0  6# @"B @" !G6"cG "a'+)6 @%}Ԣ!쀢 L@  $!@L@ /2 @@ @a@!#ԀA#H@k5b 6 6#@4tK" l@!Ѱ 6#. @@:@78 @2@ 2 @!͒ 6c  c@@!ْ   Must be logged in to complete. 㿘@`@"@$!I#(@@=#(.@`@" "9K "`9!J#@"`#$9K ` 9J cA#X+ 7# @ A A#XK *`J7# @=J#7#*@ K A} #X@?y x @ K   a J?c  2"K ` K   ??* : `/U#p*`@          0      H                          0      H7#  A#L?A!0@cH 7#k 7#  macro nameusage: %s macro_name '%s' macro not found. ?Ambiguous command. ?Invalid command. Not connected. 'D'H   DH@#   AH#H`% B!<@BA#!BH,`@*` @@Ŕ !<`@HB!<@0AH#H`@i@?"b|I@2c(,`* Ac   A)a7I,%A5@,`#N#   ( N  2 ( X*`:  $ \"F EN #  * * :    㬓, @*`*: @а N  D?"?H,  @2`H N  i2 D H@2@H@c@.@`N 2 N @.@A#X@?  @HM&|2L  !  A#L  @! @H?:&|@" (@H!0@HIA#X €@K x (L  H?`"@  " *@ (@2/0@I#'DA#X'H- 2 ,`*  20ND,`http://ftp://url_get: invalid url '%s'Can't allocate memory for proxy url.Malformed proxy URL: %shost %s, port %s, path %s, save as %s. Invalid IP address: %s%s: %s%s: not an Internet address?Invalid port: %sCan't create socketCan't connect to %sRequesting %s:%d/%s Requesting %s (via %s) GET %s%s HTTP/1.0 /write200Error retrieving file: %sContent-Length: Can't open %sWriting %sReading from socketSuccessfully retrieved file. Improper response from %sX? ??Ԇ ?Ć a@2`   b@2W    b@@;  /?L@ ,@`" ?L@ @ޒ /?̄ ?̆ ?̄?̄ ̄ ?̆?̄H ݀`L@?Ą ?Ć? @b(Ąa@1  ??ĆĄb@1  "P?Ć?Ą"?L  /,@: /"L@ 2,@@: :K. `  A#Hbh?̆@g| @  /Lac   @$В쀢 b"@2  \@"`"@sW? N"@@w AN A@1?# "7"5#7  @>D ?Ԅ ?Ԇ?@>""?Ԅ@& ??#@;?Ć A#Hc@g ?#Hc0@f?#?Ą@#`#h H@T?#@?Ԇ@@ #p??# @ 1?Ԅ@  N  "`@ ?#*@?#@9 cx@  #?# @  1?Ԇ@f  N  2` `@ @?#*?#@J@ N#]!a,*  R  c2 #@0  "NN a,N N@9G H!@*"@0: <""  ? ;` 7??̆&@[Ŕ!?܄ ?܆?#?̄@ C??܆ ?㼆 @@"P ? ?㼆@? @a? I  :#J#: @"o??#@%I)A #?Ԇ@I @ B <?܄@`"KK h ?F!܀ چ?`"@ #`"*@@ J# :@ F #H`@(@a#H?K h K F!܀ F I## 4 J = ` 9 J#: I##4 AA`A#H?`"@ # " #*@o A#H? " " * @_ A@#H @ g#??@! @" A#@cH ?㼆@?Ԅ@=??܄@2?Ć?Ą@' #?̆@ 0? @ ?Ԅ?Ԇ@ ?Ą?Ć@? http fetch aborted. 㿘@$j !A!x@t#H@~#H@"P@ ftp_proxyhttp_proxyCan't allocate memory for auto-fetch.:@/Bad ftp URL: %suser %s:%s host %s port %s dir %s file %s Can't connect or login to host `%s'cd*?[]{}Retrieving %s/%s %s/%sgetmget-X''''@@"   A#L   @a̐ @a@!Ь@! 7B"/F܀(@7Y : y    @2 @!aa@.    ̀?W0Tb@.v  2V ̀?E0 @7$ /@-Hb"C N /! @2 .ē(" @ 1 &Ĵ@ @@-*bJ@ /` J@  :ހ *@`٪L ՠ @6 : ,@6ܒ : L `K,@``L@  @㬒 /`*@ K `  A#\#`Hb0@c39@B̒`Ȁ 8`@,A#L  ߒ ( '''耤  L `'' `4&4 @&4A#L   @=  "`@ DZ '#h'' K l  K  ` L@ @,b@  `L @,ub 2 `L@ ''' K l N"K?L @E?" `#`AHb@c# $@PK "''䀤'耥` X%X"' 奒 %X"'`' b@"|@~Ȓ d İ@Ą 'A#L ?  %s: %ssocketconnect to address %sTrying %s... connectgetsocknamesetsockopt TOS (ignored)rwfdopen failed.Connected to %s. setsockopt㿈 !B!@ @ٔ B@ aD !@ * !9!@2B \@7"`!@ @?"b|!@ *  @@ !9!@5 !, @9a""B !A @9 6 B@ !@?"b|!@2 B!@) \-@?@!  71  +"0`'@ِ%"0@ q!`$``@n A#H#`'@Ɛ@b9a@K` @9E 6ѐ@ S!s%|@ N!l%| 'Ac@9a  @ ?!D@'  @9*  6@ 0!@Db!K$ d@D b K" | d `@@ "(K" A@#Hb8@a@ K d "K@DK | @@D@?"b| '?c!@8   @K ` @"P@"@ΐ 㿘@!= A#H? " " * @ A@{m#H9b "b9" A#@ ---> PASS PASS XXXXACCT ACCT XXXXNo control connection for command. QUIT㿘'H'L'P'T'X9""K ` 83A"@cHH"@P  "@cHA"@C   A#@cHA@i4A#H? " " * @L A@z#HK |   @E#@?"b|( @ÒbD!K |@aH#8@ |@z |J "c@@%c@@&`?9" ` @  @%c%c%c421 Service not available, remote server has closed connection. %s:㻈'   I"А @~bD'+@)K9K;@3A%b|   d`? "`@C!  d" ހ F? d`? "`@C   d"  d  `?`? "`@B  d"  |a(  "`@B  d"  |a(  @`@zI | d`` @b !0@cH@z6cH!%b|  <b  4?6 55``1 4H"Ȁ ,`@" `` cHb 2 @cHax@`?cH?` "@ , :  `"*@@? `a#  b|*` * ?А%b|`b| " `  a#  2  `  )"--- ` - 2%b| " d,b  cH?! 5 H"Ȁ `cH?` "@ , :  `"*@@ג @ycH쀣`$d8$!@"@2”",@ b|"#"쀦 1,J"# @=b|!9@9"  "D"?Пƀ  ?`'@  %b| 㿐''   @6 send aborted waiting for remote to finish abort. 㿘@ G"!9""!A#`@#H@y!#HA#@\ sentlocal: %s remote: %s -%slocal: %s%s: not a plain file. STORAPPEREST %ldr+w%s %snetout''''tJ#'L: 'HH?HF#"a\I  :#@??:F!'<@" `" K@ -A#Hc@^ A#H`@^A#耢 @ 0n@G"a耢 "'l o 'l'\'T'd" 'DA@ɐ# +J# 1J # 19" \@?&"\` @X\T  @RTd` @LdF<"!ܐ @Dc'\ @?`'d@=` a '|F\"!K@ |$ @* 'T @b '| @ @\ @T @d@F"!0!6'l@)Vb '| @ @\ @d@Ґ!('l|S`@zВ <  @A#H`0@^C @\ @d@A?|@:@ A @\ @dT  @T@?""|F<n"!@# ` 9"" ` G@=!`H @=`P :@"  ?9|b@   ` |9S`bb@ ` 19 @ 9  :"" Xe` 9  >"  :" h'D` pP 3 @_\ @\dF<"!T` @STl 6|02 4  @C\ @@dF<"!T  @7Tl`@|0@PD 't@ ? @& 'T@" %@   \ ""07I#A #|S @K$Z>`@ B >tS`@%$K&@`K h |F!܀ @" 6S H1H@cH`L(?`"@ #`"*@@ D J# :H@ C?HH@ HcH`L@(@vcH|K h O`F!܀ @" F`I## 4 J =`` 9`J#: I##4 AA`A#H?`"@ # " #*@  A#H? " " * @ ܒ A@v#H` @ \05II#| ? # @?||@`#@ @q` 2Tt1A) #H0H@#H`L8)t?`"@ #`"*@@  @vK#HJ# :H@ C?HK h  F!܀  t` @5K`?`#``@  t # *@ jt`B >t`?` #``@ .`:   t`#*@@ Ot`B >K h ?F!܀ @" 8|I##H@4 AHA`L@A#H?`"@ # " #*@  A#H? " " * @  A@u#H| @ @t` @  \"0 I@ xI??:@\ F<"!l`@|@>t  @h\ @edT : @_T7I @Z\ @WdF<"!T  @NTJ# 19@?,"b|" t@?&"t`@>t @?"b|l |`I|I## ` @  receive aborted waiting for remote to finish abort. 㿘@ G"!9""!A#@@ #H@u(#HA"@c receivedRETR./mallocnetin%s: short writeWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %s㾨''|'t'l'\'$J#': '?F#"a\I  :#@??:F!'F!' @:c؀`? '4@"  |` tK@ -A#Hc@Z|t A#H`@ZtA#耢  4`|@t0?'T'D'<',F!` A4 @ ',@"耢 (J# !Jϐ # !9" D@~?$"D` @~CDL  @~=LF"!F "!ؐ @~2cx'D @~-`'L|@9` i|K@ |f4|@(  VA|@S / \"0   @|m  2,|  |##@(t   /,`A @t|N # A \"0 A|@ؒ! A @_|9 # 4 \"0 `@|  '|) # 4@| '|4` @"  إ 0G"a耢  ؜ t@ @:@  A @}D @}L@?i"b|@"耢 2F4 9"" 29`  t9 Xlb Ot`  pat  =  X @" '\|@8֒`  |a!'dF"!F."!K || @}O '<|`@-b 'd @ǒFF"!F"!0!@$l 'd @|FҐ!('TdS @v ؀ 9$'9"Ȁ@9"̀ !9@{%@{؀ $"@#9""9"b<  F"!F"!@ܐ?@" "9% # !9"" 29`  9dS`bb@}Ԗ  \ ""0791I5A #9\S`@} ȠIdS @|@A< #@ B >#K h "9F!܀  @" 9#?`"@ #`"*@@  J# :@ C?#@ #H`@(@rH9K h O F!܀ @" F I## 4 J = ` 9 J#: I##4 AA`A#H?`"@ # " #*@ A#H? " " * @ A@r_#H @ \"0 @#I??:@V`Q @|0N"" d` <d @y %9"  d ? # @:d?d@`#@ @? "  d @V  61I @k|F"!F "!T d01I7@I#3A\`? #`@:\\`# @? p $`l'$#0@cH)#?`"@ #`"*@@ @qcHJ# :@ C?K h  F!܀ ∀ ##`B >#\`? #`@:2\\`# @ 2d,` d @29$ ?`#  @  d@ #@ *@d ?\ " #d ?` #  @ , :   d@`#@*@@d#`B b>#$   @"l$A H@cHK h ?F!܀ @" 8\I##@4 AA`@A#H?`"@ # " #*@n A#H? " " * @^ A@q#H\ @  \"0 @`#I??:d` @ @T|@ F"!F "!T  d @zD @zL<` @z<@:\) I# }4 zI##  F` F@3 F!؀ hҐ!(T@ct@ɒ ?^'@: ''|@2?S@@ x@!|0HF"!F "!<  @zk< @zh J# @?,"b|@\@?""|!9" T@z$"T`d "\@d\`I@9\I##   `  @ΐ  @z3D @z0Lsetsockopt (ignored)PASVPassive mode refused. %d,%d,%d,%d,%d,%dPassive mode address scan failure. Shouldn't happen! setsockopt (reuse address)bindlistenPORT %d,%d,%d,%d,%d,%dp '@" a   @-` 9 "b@m! @" ?9"c @-S  6@Y"# A##\#`I"c @͚䀢 A#8@cH!9!A#8 @{> #8 , , , , , , , 9"@}   @!!9A8A##"8`"`"` " K H 229"?" @y  @, 9 "b@! K H 9"?c @,ܘ  9@#pm!9"Ac8@,  @@Ր#`!9" 9"?c @,  6 @" '9"Ac8@,֔؀ 9@!?!9"@  !K@#!K H Ac< c<    ? ?#\#    H?$ Hw "@ K "`H '9"  @,q   @w!  @ya"?$" K "`H accept㿀 '@" %9!9"@䢒6 !9@S @y?"?$" @y9"$" '  @,6  69@<!9"@7㿘I## ` @8 㿘@ 9b "b㿘9"" @xa(  Ac耢 < @9"А  "cAc耢 9"< @"cAcL&@"cL@"` @'ܔ .!. @`"bB@@&!`&!`&!` &! a"@a"`a"`a "` A&!`&!`&! ` &!a"a"`a "`a"` K`d&!$a$"`dK`|&!(a("`|Ga&!,a,"a@b&!0a0"bJc&!4a4"cAcP&!8a8"cPAc&!<a<"cGa&!@a@"aK`t&!DaD"`t!H!@"8@' .!X"8@aH!Y!K L@'w .!i L@aYBa0&!lal"a0!p!H"@'i#.%o"@ap%p!F!@'`#.)o!@ep @w9b "bĀ 㿘@Đ A#H? " " * @A A@m#HAc\ "c\G"!9""A#@' STOUproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s abortH''''!@3#؀ # 'A#   H'G!耤  @@"  @" 2 @""\ T# A @YcH0ː A#L  @A @LcH @?"b|"9 !I/bЀ A@# : @w8`(' pĀ  @w- 0@   ' p ̀  !9" $"    @wy $"A#Ha@Sd0@w 9""@2pc؀ A#耢  @2cc؀  !JA#耢  Q!J# J  # p̀ k0# "A@ A#耠5`?!J# J # p̀  J" # H@ 0D# "A@ A#耠`?J# .ؐ @x) K d *`:`2*:` ` *  "n 6A@!0A#\ @?"b|@   A#耢 ؐ ֐ A#\ @?"b| @v_resetxؒ @w -K )'@?dR 2 * -@ ") @Ð"0@$|   drunique: can't find unique file name. 㿘@] / ` 1,@@`##@  ` /,@!> @< A"@cH5 !@@wn!! .*'`1> 1  d,,@`:  9,@ 0!@ V ,:  02 L .2 , ," 1>!Lost control connection for abort.%cABOR xK | @( A#\ @?"b|@;Аa(  @d K |R  @   !K@!0!K |`@Q @k |ؒ @w K d * : 2`*`@ :   +{ "{ * : 2`*`@ :  +{ "{K  6A@!0A#\ @?"b|@ V 2`*  `;ؑ:  V @u}$ 4V  @"|"(  ftptcphttppftpTERMdumbemacssuadeginpPr:tvVbad port number: %s (ignored)-r requires numeric argumentRetrying... p'@M-'Ԧ ?"@b A  "c"@b A P "cK " F"!XB"!4@""F"!@""F"!G"!A"#TI"# J$@"cA"cX@ / @06c 2@ "b@sV# @0'c @0!c @0c 2a a@kR B  "aT@ `""G"!Aa!"cH@kR  `AF "aAa!`"cHR?!)G %@#K3 \!@@W(?p? &i*  z { { { { { { { { { { { { { { { { z { { z z { z { z { { { { z { z { {( { {l { {x%! $`` $``G"!K" F"!XB"!4@""@btA#8@bt"#btJa#@ `  @ѐ H"b@;cXA"#$"$"@Q#ܖ"'ܑ* Ԗ'J"#A"#F "a`K?@"`H@@d@5"`d@@  @sՒb܀G@#$ :  G "a뒔 8@uf@@"  @u^ @sa̐ @sa( '''''3H1A%B#!Aܐ@cbȀ #L  cx$<@#H@b#L @@@ܐ"`?   @sa̐ @s{a@e 㿘@[ @"@ْ 㿘@R A#L !K | " !9R @5 @2 |$ |!9" & A@+ @s"?$"A"#L A#L !K | " AR @ @2 |$ |A"#L@"" ftp> "sorry, input line too long. ?Ambiguous command. ?Invalid command. Not connected. 㿐 !AG! -IA#H? " " * @s !A-I'aI#(a +A)IG! B@B!T " (@#H@i#H($@\ఀ  W @tR '?'J@ 2` H*@$E"@#H? $@1t'ఒ $ ' ?2 ""cT@. ?  ?'J@  d "@#Hg  c @s*I#  @&@# "GA#X@V? #2N A#XcT#@ "wG #  A#L  K#8@R#HgGK" pA#X #€@K x " N  #H?`"@  " *@  !l@?G @r,a̐ @r(a /   7`$J J@ `JJJ@`J2  "  "  ` ?㿘@I#("bBG""aP@""A#X" I"#%A#I@-X@ c $c@"I#(@@K" J"#" KI#"!JA#X*`@@s2$#!$ @BPJ@! $4 @$@*J@@⤄ @Ⰴ @"2 J@KI JBP" ""J@!ϐ͐⤄ K@ J@    @@`@ @2J@KI JBP" " @ J@@⤄  K J@ "u  "o n ( @\2$ @`@ @2!J@KI JBP" "‒`@ @2'J@KI JBP" "*J@?*`@ @ KI JBP" " J@("2 @`@ @2J@KI JBP" "*`@ @ KI JBP" "ؘ  B* P@  @ @  @⤄  K  %sommands may be abbreviated. Commands are: Proxy cC?Ambiguous help command %s ?Invalid help command %s %-*s %s 㿘 2>?@A#HA#耢 !!@@Lג`7#9!*` * 3A197#  c耢 L @z !*` * *@ @ 0"  %A+)'`@? Ha H!@@L?` @L ? `usage: %s [-adeginprtvV] [host [port]] %s host:path[/] %s ftp://host[:port]/path[/] %s http://host[:port]/file 㿘(a!`b  @L] @q macdefmachineaccountpasswdpasswordlogindefaultHOME.%s/.netrc%s/.netrc: %sr%sanonymousError: .netrc file is readable by others.Remove password or make file unreadable by others.Remove account or make file unreadable by others.Missing macdef name argument. Limit of 16 macros have already been defined. Macro definition missing null line terminator. 4K macro buffer exceeded. Unknown .netrc keyword %s8 @n  @p # @ ? @ߒð `@$@`0?  "a \"0  8@Ԓ @ ! &/@ .-? @?!#@%?)BA#@ t   0  ?;a@ @ 4b@ /b@n ."@ b @$ b$J @V .@w à$@ L ;a@L ) ' % "%@   0> WA@5 @  @pC@l &@@j0@*7 2-?0Ӏ @*.`H  R @g  ?@   @p@l &R @gw  ?@  @p@ly &@(0#耢 ?`? "`@-, "   "` 2!< !<*` * *  `? "`@- "  c  ,``  ,`? "`@, "  kA!< !<B!X$ `%!<*` * ?:" *` **` *   " !<* @*`@` F!X#F!X`? "`@, " 2*:  ,L? !<, F!X!xA@H&?!@@0@= X ?@-!! A !AA!H@cH ?@$ X @ ?@-!?㿘?! @ !?!`? "`@,E !"   (!` "!`,"!d?`"+!!?!`? "`@,# !" H`"F`\2.!`? "`@,  !" .ڰ . !?!`? "`@+ !"  ` `,`\2.!`? "`@+ݐ !" .հ .?J! 9 ## " !?@(! "    stringlist: %m㿘@j 2&  @c&  & @j P & @֒c㿘   2 & @k *` & @c  & * "@㿘  `  .`@j ` @*@j@jĐ㿘  , @(   * Already connected to %s, use close first. tousage: %s host-name [port] %s: bad port number '%s'. asciinon-printstreamfile8SYSTRemote system type is %s. 215 UNIX Type: L8binaryUsing %s mode to transfer files. 215 TOPS20Remember to set tenex mode when transferring binary files from this machine. 㿘'D'HA#L A@#Ha8-D  ?DH@/hD? AH#HA#D H@ *  H!AH#Ha@HhH#Hap@Ha@?"b|*` 媓:` A "#LA! !* `* `* `* `* `*G"!@""A`! !*` `* `* `* `* `* `* `* `* ` * @""xK! !* `* `* `* `* `* `*I"#$F! !* `* `* `* `*F"!K(! !*( `*F "adB!4 H  @ @K ` b?"bo! 2"@`1@ "@ϒ "@ʒ  AL? ."? ,A#Ha@@GĔ쀤 2,@"b@l  *A#耢 @ "b@ "bG"!A" " * `* `* `* `* `* ``"*A#Hb(@G @#耢 @""@""`@"bP@lq @A"`@cH@""%s@ftpanonymousName (%s:%s): Name (%s): USER %sPassword:PASS %sAccount:ACCT %sLogin failed.init$init0'H'L `'HLi H@?"b|ذ H L !G!  @lY!  @lT!@'H@!! P@4KH'L#X'H#`'HH 23A@ @#@ 2  cHcp@FacHc@Fa O@@l@*O 2'H'HH #eH L 2@#'L#VL   @#'#F A`9# @#Ȁ2C G! f A#耢 A5 I(# #*( `* `* `* `* `6*IA#X܇@ ?"cL B!< 3A##B, @*`c@%@ Ԡ a<&,  sorry, arguments too long. (%s) 㿘I@km#($A#@cHwA#Hc@FDI#( , $Ȑ"@a@U 2IaI#(@kI L ", I#@&A#X&@4  TMPDIR/tmp/unable to create temporary file: %sftpXXXXXXXXXXunable to create temporary file %swNLSTarcan't find list of remote files, oops. can't find list of remote files, oops.㻘G!쀢 K !:@>""   @($ K :@b ""b@`"` ""0  !:@g  @jÐJ? /  $0 d @_ ?@찐  @גJ{ /" /*| ` `*< *< *< *< *< *< *< *< *< *< *< *< *< *< @2 !@셒o @io@bb?"b"K h`" hA#耠U`?!0`@ @1!!8@ `@ !@@"|@a d @"&`"@A#耠/`?@""K" h@aH!:$ @2  2!: A!P@cH !xp&?"$@  ?@' d$ "@ 2.1?"%s %s? Interactive mode: off. Prompting off for duration of %s. 㻘F!X ;K p 27 !A#Hah@D̔@^#H$a@ O% ]a,*  R  n"  p aK  F"!XA!p@@cH   "`pA#Ha@D %s: not foundhK Ȑ @i ,, @Ֆ Ȁ  "@@0 @3&@)Ȱ SIZE %s%*s %qd 㿐@???K ` ?"#`  `@"ch@@K `  @!A@"@#H#p@#H@""MDTM %s%*s %04d%02d%02d%02d%02d%02dCan't convert %s to a time. H@K ` ?"⧐ 8 =`#\#`@"`@Ė@Ȑ @i5 ,''''?'Đ8'ܐ?'@ D?2쀦`AK `  A#H``@@C@K `  @!A@"@j#H#p@f#H@""㿘@K  KMGTP %3d%% |%.*s%*s|********************************************************************************************************************************************************** %5qd %c%c --:-- ETA - stalled -%2d: %02d:%02d ETAh?!@"0@9 @b"0"0"b"@9":(@9 F!܀ @"" 4 I x` tI9#b B5- -@B2`* @ *`B2*@ *@@?g@& d4 d!@0dB!8?․@]@^ d@h>@@h;!"@"#\ "0@0G$  a" ,4  <   2a" @h @h!"@"M`  B#\#\@0@"""@'"@`''А"@@'@"("(4 @@`@b"b"@:"( @b0b0 "b0 "'@"0"0"@'"@`''А"@@'荠셠: čB?I## 4 :  `  :(؁+@g@g!"@@/aA @g@g!"@@/QA@9"@ b @@?I@?#؁ Ё؁Ɓ@'@^.@g[@gX!"@@/j@gM@gJ!"@@/]@M.@g=@g:!$@] <@M <@/CA#HR @g$@e˒?  @ea@ AA@ A#H? " " * @ A@[#H%qd byte%s %s in %.2f seconds (%.2f %sB/s) sMK ETA: %02d:%02d:%02d @"  @7e @"0"0"@'"@`''А"@@'荠셠:0čB?xI@?K#:8xB3? ?@>   II I##   "!F!\#\x  @?;` :@:H € ;h!!#p d@. MI##  : E ` A 8x:@" 6@9"@ b @>?pI@>#x pxƁ@'@\.@L.@f9@f5 d$@\ <@L <@.=  A#HR @f@d’㿘   ,@f@4 *  ?B!8@\"  @@\ N-A   @6E@[A* @ @^H@[5  H? "`"%*@ @ƒ !@eŐ6`  ?H?`"@ `"*@@ 뀤@ 㿐A#HR `h@dv?B P"a8㿈'''' @ emacsftp-completeContext sensitive argument completion^I㿘G! @#AcT =G!I# 8G(A a`@sH@L$cT$#  @ dcT 5@# cT @hcT @cT !#p@!TcT #p@ cT@2 cT @ 0G! !I# "!A@5$# !A#T @[$#T㿘@ x p h X P H @ 8 0 ( @   reloadupdatesyncasyncunionrdonlysuidexecdevatimeaccesstimeautorwrogroupquotauserquotao:ffsmount table fullspecified device does not match mounted deviceincorrect super block%s on %s: %s @;H%'Q [ "a"# \!@FM? ? obt!8@f@NQ#&*  @@C@'`?'  ''"@.  \"0  2 \"@@"""@"0 c@@dk usage: mount_ffs [-o options] special node 㿘a!`@?`@dU ,-o %s: option not supported㿘@ @ @`5L n L  o  @ܒ = 2*@ "   " @2    &*@& `@Ƞ @`q㿘@Ihaltlnqd%s???halted by %srebootrebooted by %s~shutdownSIGTSTP init: %s/etc/rc.shutdown/bin/shsh%s: SIGTERM processes: %sWARNING: some process(es) wouldn't die %s%s(can't restart init): 㿘@:8@@E /`@J@ -"` @sbP  K "`    + @E)bX?H? 2A*      !@@  `@ @ܐ"`` @̐ \@"0@А"`)@t K@@ ""hK  "P @桔 "  bp" @昔 " b@~"b@ @ @a ?2   \@t"0@" @aH #b@  ??@O? 2  "bb@ @bא @ ?@ax ? \"0 K "P" \@?"0a!`b@=s% \@擐 @@挐  # \?@aO ? b0   \0a@{.  !`@=Qc@' \"0 @a6 ?#H"@#@@usage: %s [-nqd] 㿘K ""P"a!`@=&`8@bj %s: 㿘'H'L'P'T'XK H"P"!a!`@= `!`@=u!`@=`@bF 㿘@cannot seek temp fileout of memorycannot read temp file㿘K"K  "`K   @2K @K :K!(@Ҕ 6  @2 ; {aH  :"$ b :#d`"#d: b" " @^{::@ ;!` !`* `* `* `* `* `* `* `* `* ` * ` * ` * ` * ` * :cd? "cd:#p :@"O :#p = @" 9 ""$:"" :cd? "cd:#p :@"6 :#p :@"u :K"  @Ů(  K@츐 ; ap@`m   >  В@ B ; :b *b line too longcannot write temp file㿘@]  @쐐 ;!` !`N 2 &#@#; P P* `* `* `* `* `* `* `* `* ` * ` * ` * ` * ` * D K Ā &K!( @   !K@P ; aH  K@!(: < K" K @( "$K??:@1 ; `` @_ 0 !K <@ <` В@ B < а 㿘!K@3 &"`"& K` "` ܐ $ ܁invalid address㿘K"@   "@@@    K"@; b@_ ?㿘:#d`"#d:", +K @: 4:@H:::("(b, "b,<:K""b(:K 2"b,:( "(b,?"b,(::",:`@::( "(b,?"b,::Kb""(:  "",::("(b, "b,:cd? "cd:#p :@  :#p :@!) :"(/tmp/ed.XXXXXXw+cannot open temp file㿘KK" "`@K ?* 2 :b0aa;b0 "  2 @(.* ?":@aK "a(?:@^:@@"0; a @^ @!?@ cannot close temp file㿘K!( K@  K:@"0; b@^Ҕ  ?"!(:@'"0KK" Ę  :`а 㿘K!( @:@'"0@_Ґ㿘a K`@By  K K""""` K!*@``$*@ :"@"@K*@""@*  ?K(? 㿘::"""bK"В @_y @ @@ K!@@2 ,  㿘:!:"@K""@7$":"  :b"bK" ?㿘3:b  :K"@ :"b&b:"  :b"bK"Ȓ* `?㿘!:"  :K"Ȓ @:"b$":"  :K"b@  ?Enter key: 㿐@!N  @ @^ @: @^  㿘2; \@"0;@ ?Ѐ6p( L T \ p ׄ ט ׬ t t t t t t t  $ 8 L ` t t t t t t t t t t t t t t t t t t t t t t t t t t  $ 8 L `K I `F?D `A?? `<?: `7?5 `2?0 `-?+ `(?& ` #?! ` ? ` ? ` ? ` ?  ` ? `? ?bad hex digit in keybad binary digit in key㾘N@ 0N` x X26N@`N@  % 4 N@Q , @?"= N@   4  ,    "? ,  ? `*` ? @.  , BK 0BN` b B<`N@  %  ?N@ , @?" N@   ?4  ,    ?"?  , *  *`@  .   K "`@  des_setkey㿘K  :"   @ 2``$ @   ?.  @nC "Ёdes_cipher㿘`-  K"@  .``$  ?@m #xK* *` *` *` *` *` *` !*`K a@\\".  K"@  .``$  ?@m Y#x  @ܖdecryption failed (block corrupted)decryption failed (incomplete block)cannot read file㿐  @Q I / / / / / / / / @mw? #x K"  . $ K**`*`*`*`*`*`*`@@2 N   @M ! ?!(ݰ?invalid pattern delimiter㿘K!J   ; b@[ B?@KJ, : @"@ !K آ K!4* +K)K` `    @N   2@ Ť!@  p unexpected end-of-file& no previous commandout of memory㿐   K!@4`( @ ?; `8  `X @[3?0 0@%)K'K%::"@l "̰ g % ܀  ܐ @f a @G '@J?  ?4   À  @`(  @ے`P 2`;p@  :"Ԁ _ :cd "cd "&"@@Xy::@ ; p p* `* `* `* `* `* `* `* `* ` * ` * ` * ` * ` * :cd? g"cd:#p :@M :#p A?@ =?""$:cd? "cd:#p :@5 :#p "@t В@Z{K"!L@ L!K@& @   ! @ ! J 02㿘K  K` [#:cd $cdKb @W, 9K@成 ; p p* `* `* `* `* `* `* `* `* ` * ` * ` * ` * ` * cd? $cd:#p :@Ő :#p &?@ "?" K" :cd? "cd:#p :@ :#p K@ K`"K *`"  㿘)K3KKK 6`.@ `'@  !4 !K` KK KK* K`   ( KK 6   K* 㿘#:cd $cdKKKK" "a ""!K@W  $ cd? $cd:#p :@$ :#p @c rcannot open input filecannot close input file%lu 㿘N ! @u`@c@`  @勐; `  @;6N)? !@v :0@  :@n; `8 @Y"?0#l  P Xa!`@4K ܰ&newline inserted newline appended 㿘b KK`K @`?""`:#\  qK" 3:%:@Ncd &cdK!$  cd? C&cdp  @ p {?@ w?$ K ܐ @"D cd? %&cdp  @a p ]?@ Y?cd? &cdp  @N p "@  B? `!K   K  K`  !a@a`K K  "  K "`K ``"`"K`@"`:#\   "@out of memorycannot read input file㿘 3K+:/K5;;  -::#\ " Ӑ? % @Y`% @`  @d` b ` T cd %cd b$" @U 24&`@N  . , , , , , , , , , , , , , cd? %cdp  @ p ?@ϐ ?%$cd? %cdp  @{ p $@ $*,`  K "` K b :#d`"#dK b!$" @UQ:K@ ; * `* `* `* `* `* `* `* `* ` * ` * ` * ` * ` * :cd? <"cd:#p :@% :#p I?@d E?" K"!$:cd? "cd:#p :@  :#p ` @K ` 2 K!$*  @ @㏐ ; `@WD ? K!$ *@ K "`K!$*K K  2?wcannot open output filecannot close output file㿘N ! @sla(@!@ϒ` @J; a0 @36N,? !@sƐ :0@Ɛ  :@,; aH @V?0#l  P Xa!`@2&  㿘(:#\  C`&:-K+K)K @:@ ``  *@ @ ?`@:#\ k  "@cannot write file㿘"" !:#;%#\  N@`2  0`@:w  @ⱐ `@Vh ?#\ unexpected end-of-file㿘K!J@ `K!"@@N ?'Kk!':# b :#d`"#d:#" @S֒::@n ; * `* `* `* `* `* `* `* `* ` * ` * ` * ` * ` * :cd? R"cd:#p :@ :#p   @  "#:"#:cd? "cd:#p :@ :#p !:@А !:K#a@U֔# *?3K5;1:-:+:;  /:@& b@J?  `H@U ڰ # T d %d bc" @SJ 24&#@  . -  -  -  -  -  -  -  -  - - - - - d? %dp  @# p  @c  %cd? %dp  @ p c@O cb@UVc`@T  c *?:# b :#d`"#d: b#" @Rؒ::@p ; * `* `* `* `* `* `* `* `* ` * ` * ` * ` * ` * :cd? T"cd:#p :@ :#p " @  "#:"#:cd? "cd:#p :@ :#p :@Ґ :c*'cstdincannot read stdin㿘  9aa 7K-:+K;;;  3:5K ? % @ `' @j 쀢 U  d %d bb" @RG 24&@ߐ  /` , , , , , , , , , , , , , d? B%dcp  @  cp H?@` D?%bd? %dcp  @  cp b@L b*,`  K "`` 2 K` "` @@"p`bx@T<  ?5 &? ?5 r bb*b&%ld \  \abfnrtv\㿘 @ɐ!0 5a!@ ;  !8@o "N ^*`:  \?`}"@~ 2x{ ?`"@ \ " \*@߿ N`  @ "aPJ 2  0?`"@  `"*@ @ߛ  82  0?`"@  `"*@ @߃   0?`"@  `"*@ @l  ?`"@  `"*@ @V \ a? " " * @B  @(#) Copyright (c) 1993 Andrew Moore, Talke Studio. All rights reserved. *usage: %s [-] [-sx] [-p string] [name] p:sx ? interrupt? invalid filename%s warning: file modifiedscript, line %d: %s unexpected end-of-file㿈'@*':#h @S@`$ $@@J? r`?$+)K' \%: !:@5`? s"$l x p"t aa0% $#\;!``|@.@S Q*`' 'J -: "#l " '?'@ @IH "  @R!a @Rcܐ @R  @R` K@jh"!a@a`;! !* `* `* `* `* `* `* `* `* ` C* : "ct  J@ @  @H #J@ ! :@s#x#: !a@޼a`J ; a @RC @Hא #:{ #:!a3;a!/K-a!`+%)Ka  Kc` !`a8@-`K @ފ@GK?+K #:#l @w`a@@R @H 2 c` aXp @-̖`3  ?4 %°?+ K"@J?  `ax@Q  ?4 ?K@d" ?@1 KK ܒ@K? ???0221 %@#!``a@@Q @HD  c` )aX'p@H9  c` aXp!` @-n`0 "p!8!`@-e`̐ @!`@H Z c` aXp!` @-R` M 㿘K""KKK "a"#K'K!K1K%K@<bؐ $b!$$!!J , ; K! &!J ;"$0K""؀ 4  "@K! KKa" ؐ@??number out of rangeinvalid address㿘K K!Ja#@ `  K#J@  `"J`  K!#K´!)a#%;'+KK!aJ? U*  8 8 P 8 P 8 P P P P P P P P P P P 8a`$aJ`#@ ` aJ@  `$aJ`  aaJ#   a@  @@ - \"0 " -`w  ^2w u& #  d - ^2_ h?^aa@ٔ  2P  \"0 "K `M Ga  .6$aKG ܀>@ / @ ;`?9aJ@, `)$a*a`$a@J` *?a $aKbؐ "b؀ ;KK "a &@`a ?`  @O? invalid command suffixunexpected addressunexpected command suffixno current filenameinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioninvalid pattern delimiteraw%ld ! unknown command㿘  K!Ja#@ `  KJ@  `"J`  K!"!J`pKÐ#*`@ 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 / 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 . 0 0 0 0 0 0 0 p 0   0 0 0 0 0 0 0 !` 0 0 0 0  *d 0 0 0 0 0 0 0 0 0  0 P < D `   t L ,   ( 0  !` ", # (` )  *d , 0 -l KaJ n"   p l" 2 a "aaKa"aJ ;K 2K@K@ ! K @  KaJ n"   p l" 2 a "aaKa"aJ ;K K@mKK @a K@  ܀ ?K @ } KaJ n"   p l" 2 a "aaKa"aJ Y;K K@2KK @da PK ܒ`K @$   EKC" K! :#l K8?K"؀ ;Ð b+ K!Jac  ;Ð b( @ KaJ n"   p l" 2 a "aaKa"aJ ;K @` &?@+ &? 6L?  !:#x@L :J#x 2L;Ð bH͔  :#x &ư?@K"!;;?"b"K"؀ ;Ð b K!Jac  ;Ð b( @"?L ! ;Ð b` KaJ n"   p l" 2 a "aaKa"aJ o;L :#x@:@#x@1g0hK ;Ð bx\ K @]` W`g `G  L`G `V   KaJ n"   p l" 2 a "aaKa"aJ ;K` "` K"؀ ;Ð b  KaJ n"   p l" 2 a "aaKa"aJ ;4 K"؀ ;Ð b  KaJ n"   p l" 2 a "aaKa"aJ ;: #`"@ `"#`; J a!`@(a80K!  ; a KaJ n"   p l" 2 a "aaKa"aJ ;K 2K@`K!@ ?g K ܐ @~` x KaJ n"   p l" 2 a "aaKa"aJ T;K K@-KK a M@ / Ka"aK! J; a7  KaJ n"   p l" 2 a "aaKa"aJ 2;K!@  K @   KaJ n"   p l" 2 a "aaKa"aJ ;KK aL K @ K K! K"؀ K;Ð bΔ !`K K; a aK" ؀@ "a  ;Ð b  KaJ n"   p l" 2 a "aaKa"aJ ;K @g@ p K @  KaJ n"   p l" 2 a "aaKa"aJ ^;KK a” K @] W KaJ n"   p l" 2 a "aaKa"aJ 3;KK a K"؀ ;Ð b'  KaJ n"   p l" 2 a "aaKa"aJ ;K     \"t 2"@; x"@K"؀ ;Ð b  KaJ n" a p la2a "aaKa"aJ ;K! ϰ?:#l ʀ`q0K!Jac  K;Ð b( "؀ KK`"!@* KaJ n"   p l" 2 a "aaKa"aJ ;K :@a:#xJ#x L ! @ﶒL 2 L:J#x 2L;Ð bHk  :#xK+a&c?aK ]K Z"a#K#%;aJ g"  p ". ) 9( 0%  a r"   a $aa@Ԕ ;"  @@2  \"0 "  ?$ ; aJ a  ;  ;Ð b   ;" K!J@  ;J` ;;Ð b  :cd  "cd %;@ b%;:cd? "cd:#p :@  :#p װ?@  Ӱ?@ ";@@Gp;" ; "`:cd? "cd:#p :@  :#p  @    K; ;@ ` K ;` ` ? "`;` "` ;`  ?"`K;aJ n" p l 2    "a "aaK @o i KaJ n"   p l" 2 a "aaKa"aJ E;K ;@;;; `@" K @: 4K K! -K"؀ K;Ð b! !`K K; a aK" "a KaJ n"   p l" 2 a "aaKa"aJ ;K @@΀ K"؀ ;Ð b۔  KaJ n"   p l" 2 a "aaKa"aJ ;@ K!JqQK?Ka "aK!Jac  ;Ð b( @K"؀  KK  KK"!"`ؐ @` &? KaJ n"   p l" 2 a "aaKa"aJ `;:#xJ#x L ! @핒L 2 L:J#x 2L;Ð bHJ  :#x`W##KK B7K K2"!! .:#l *q"(?0&K"؀ ;Ð b  KaJ n"   p l" 2 a "aaKa"aJ ;:"c\K "`K ܐ @` K!! ?ϐ  @ ;"  @#@2  \"0 "  ; `@G ;"  KaJ n"   p l" 2 a "aaKa"aJ ;K!;!`K @ 4 @  0 KaJ n"   p l" 2 a "aaKa"aJ s;K"؀ K!K @B#0lK"؀ ;Ð b` @] KaJ n"   p l" 2 a "aaKa"aJ 29; K !8@ `K @&Ґ :#l /@# 0+K "`K ܐ @&`  K!@ ?;Ð c( ; `@G* ;" Ð a @G!?㿘K"؀ K" K"!KK a 4 ; K @  ; a@G ?no match㿘KD 'K+K)K`  ?,ఒ BѢ+` ` ?   @9W  ܀ڀ`;̒! !* `* `* `* `* `* `* `* `*?filename too longout of memory㿐K!J` Na#@  KKJ@  `"J`  K!J  ; a @F~  " K "aKJ@ !`@" ' K !8@`K ?  ;̐ c@FU  ; `4]'!:#d $#d;b @C9;@҅ ;̒# # * `* `* `* `* `* `* `* `* ` * ` * ` * ` * ` * #d? H$#d:#p :@ :#p = @ 9 " ;" :cd? "cd:#p :@ :#p "'@ 'K!J ;K'`!`#! @* !J 1; *@@   shell access restrictedno previous command㿐':#h  ;͐ b _ K"a? ; b :#d`"#d;  "&"@@CD:;@ܐ ;̒# # * `* `* `* `* `* `* `* `* ` * ` * ` * ` * ` * :cd? "cd:#p :@ :#p u?@W q?" ;" :cd? "cd:#p :@ :#p ;@> ;  !*@K!J Ϥ3;):/;5;; 7̰# +:-K; aJ !k %E` S #d %#d b" @BĒ 23&`@\  . ,` ,` ,` ,` ,` ,` ,` ,` ,`  ,`  ,`  ,`  ,` #d? E%#dcp  @ cp ?@ސ ?%#d? %#dcp  @ cp @ʐ  *@%J \U% *N_` S#d %#d " "@BY 23&`@  . ,` ,` ,` ,` ,` ,` ,` ,` ,`  ,`  ,`  ,`  ,` #d? %#dcp  @3 cp ?@s ?%#d? %#dcp  @ cp @_ `% @*K 耢 J  K͐9b ` S#d %#d " "@A 23&`@Ѕ  . ,` ,` ,` ,` ,` ,` ,` ,` ,`  ,`  ,`  ,`  ,` #d? n%#dcp  @ǐ cp %?@ !?%#d? %#dcp  @ cp K@ K `K @ { *@  o:J#x :@#x@DΦ'` Z#d %#d " "@Av 23&`@  . ,` ,` ,` ,` ,` ,` ,` ,` ,`  ,`  ,`  ,`  ,` #d? %#dcp  @P cp ?@ ?%#d? %#dcp  @< cp  @|  *@??'`% KaJ CaK 􀢀 j :#d`"#dK b " @ABK@Ϟ ;̒# # * `* `* `* `* `* `* `* `* ` * ` * ` * ` * ` * :cd? "cd:#p :@ڐ :#p 7?@ 3?;Ð bH @C?0*" K" :cd? "cd:#p :@ :#p !K@ !K; `@BK"  *L ! % 㿘 K" -Ka )K!:':+KK !?@J?  ?5 u` N ! %!J  !K "J !"`  N . #dN  #dT #d $#dT#d? $#dp  @F p =?@ 9?``$ @  #d? $#dp  @' p ?@g ?K "a#d? $#dp  @ p {K@O wK 㿘 `K @  ⦐@r;5K-:3;9; ̤# /:)` V d %d`"`" @?ʒ 24&@b  # / , , , , , , , , , , , , , d? %dp  @ p ذ?@ ԰?&`d? %dp  @ p `@ϐ `@A``@@ K b :#d`"#d; b " @?e:K@ ;̒# # * `* `* `* `* `* `* `* `* ` * ` * ` * ` * ` * :cd? 8"cd:#p :@9 :#p m?@x i?" ;" :cd? "cd:#p :@  :#p ;@_ ; є p p*@@ *`@Q !KA?$ :cd "cd;   @ ϔ K:cd? "cd:#p :@ :#p ?@( ? "a:cd? "cd:#p :@ѐ :#p  @  㿘K! K   K ب? K!: :cd  "cd\YKKaZ" ܐ @ r  K @   @ f :cd? "cd:#p :@ :#p U?@ Q?(K ؀  $" `"`$$$`K K ؀6 " KK!`ؐ" "K K樒K "a:cd? "cd:#p :@0 :#p  @o  㿘!K ئ K! آ" ` K@" ܀ `& `"`N1:):?-K#d &#d@+#d~K$ ܐ @ ͒  #d? &#d#p  @ #p '?@) #? %#d? &#d#p  @Ԑ #p "@ @¢ K w ` 㿘!:#d $#d @  `#d? $#d:#p :@ :#p =?@ 9?K @  HE?K "$$$`K?&@" "K?"`K "a:cd? "cd:#p :@n :#p  @  㿘  `; a@? $?K @ @" #Kފ `$`ܰ w &?@@ invalid mark character㿘a#@   J;Ӑ c@?r ?#.`@ JKa "aJ#.`"@ 㿘a#  J#. ߗ@ ;Ӑ c@?K ?K K0K`*` K "K`㿘@<  >  %& @e ;̒# # * `* `* `* `* `* `* `* `* ` * ` * ` * ` * ` *  㿘"  N \2 `?㿘; `\ %:d $d;b @<9;@ ;̒# # * `* `* `* `* `* `* `* `* ` * ` * ` * ` * ` * d? $d:#p :@\ :#p . @ * " ;" :cd? "cd:#p :@C :#p ;@ ;ਔ`N \  * ; 㿘:#d  :? * p "p@㿘:#d  :? * p "p@Oed.hupHOME㿘:#t :ߋ :? * p*@"pK 0Ր hÒc$  (@ "" ;"":cd? "cd:#p :] :#p 1; 1;!K"!@<"*$!K ;"; ֔!!; :"2 *"  J^" J]"  ]&(8 ![2 J `.`:`=2  J ]   J]2J 2J J] J]@?number out of range㿘&@&K!J K" G @V KB?!J K9 J, : @K"K!! ?ϐ  @旔  @&@#@2  \"0 " ;א `@< &@?K!J g2  K!`"! & no previous substitutionout of memory㿘 K"J % J-: @K"K 䀢  K;א b@;Ŕ K $K!J-: @;3K):+K7; ע"0-:'K5K a N #d %#d b`" @9E 2.&a@ݐ  "0. `, `, `, `, `, `, `, `, ` , ` , ` , ` , ` , #d? %#dp   p%`#d? %#dp   p `P ``$ @*  J@ "?\%``$ @*  K a k"   @J? ` ?6 u J-: @w  K! b :#d`"#dK b " @8:K@M ;ג"0 "0* `* `* `* `* `* `* `* `* ` * ` * ` * ` * ` * :cd? "cd:#p : :#p # Ȑ  "!K" :cd? "cd:#p :p :#p K K" K`*`no match㿘K`K ؐ"`ܬ K! s +K':):`ܐ %`ܒ@&?Y`ܤ  yK! @d $d2d? j$d#p  $ #p m?d i?``$ @ d? K$d#p   #p N?E J?d? $d#p   #p "0 `ܬKK!`ؐ" `K" ܀``;ؒ# #* `* `* `* `* `* `* `* `* ?` K ܒW ? infinite substitution loop 㽨'    K ` P `'  @,e 5K):-K; ײ"0+:`"@t$ V #d %#d b " @7a 25&@  b0;+``,``,``,``,``,``,``,``,`` ,` ` ,` ` ,` ` ,` ` ,` #d? 9%#dcp  9 cp O?y K?% #d? %#dcp  % cp Ke K $ Җ  @9c@( n$!? W#d %#d " "Ka @@6 25&@Ň  b0;+``,``,``,``,``,``,``,``,`` ,` ` ,` ` ,` ` ,` ` ,` #d? %#dcp  ǐ cp ݰ? ٰ?% #d? %#dcp   cp K K  `  @8$ L  ` 2`   @+a  ` #@ K b :#d`"#dK!  "&"@@6g:K@ ;ג"0 "0* `* `* `* `* `* `* `* `* ` * ` * ` * ` * ` * :cd? <"cd:#p :; :#p P?z L?" K"! :cd? "cd:#p :" :#p  a   K$ 2K` ;ِ a@8Z  ?K  ٹ !K! @8I! @ٔ! !*@@ *`  㿐'K K Ȁ A3K+:-K; 7פ"0/:N &c \  "` O cd %cd " " @5 2.&`@L 0;+ , , , , , , , , , , , , , cd? F%cdp >  9p% cd? %cdp   p @ @6Դ @*@`@ ˴r N 0m 9l`? h *   "` Pcd %cd  "K! @5B 2.&`@ڐ 0;+ , , , , , , , , , , , , , cd? %cdp ̀  p% cd? %cdp    p @M @6b @*@`@ Y` Pcd %cd " "K! @4 2.&`@| 0;+ , , , , , , , , , , , , , cd? v%cdp n  ip% cd? %cdp   p    *@ K & K Ȁ@&N K b :#d`"#dK b! " @4:K@ ;ג"0 "0* `* `* `* `* `* `* `* `* ` * ` * ` * ` * ` * :cd? "cd:#p :V :#p  ? ?" K"! :cd? "cd:#p := :#p K| K! *out of memory㿘;";;"⠀  `d"⠓* @ @4*`!;$"#;b*` * "b"*@ *` "ֹb"*@ *` & ,$b@‘ ;ܒ# #* `* `* `* `* `* `* `* `* ` * ` * ` * ` * ` @* !;@3"$";"" nothing to undo㿈K K ;"?;"? ;;ݐ a@@6  ?" K "aa :cd "cd;"@X;"+` *  +`  +`@ =  +` *  ` @" @  ,"`@ *` `"`"`"`@" @ *`@ `"`"` "` "``"``" +`@ *`  " ;" `2  : *;";"2  :  +` * ' ''` * @*` "" ""K KK;b""bK;b""b:cd? "cd:#p : :#p  >  㿘';⤐??!$);b"* @*` 2 ``@ @@2@⤐??$;"";K "b;K "b㿘@2HLPRfiprthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s@ } "#  9޶"5 %a -+@|!?O? *H*  {p { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { {Ȧ  ƨ   ¦    &$@+U$% %c@]Q#&*  @@R#  #  @da  ހ " @ca# 2  @h?!"c#@gr * 2 $#@gm`?. @@5)$#; ޒb0@c֔c`@J!;@5c`c` $#X$#X .,c`*;#X` #X ;;#aXJ /"X*X X;#X#X$ . &@ @i  \"0  ޒbH@^ <  3  @@5 * # 2 @#  @@:8@@@E8@<  2  #  #  @?@4%s: %s%s: directory causes a cycle..%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).fts_read8@\  @ْ );;#`+;;#a/<-@]v \4   ` `!@""@< L#`V2 2`"$@ / " ߐ@c "$";#\L / L? / /, $$,ߐ#H @%cX,cX;#acXJ /%cX*cX cX#`@`?2<- @2<@2<ߐ#@#`@<  y @^ 0s      ߐ#h#`@ 0c <  @" @[@Oa@I(@[@]`?Y #  #  ߐ#@@]ߔ 4 < #`@fla 6 ޒbH@#`   \ ""0 ޒbH@#`#  <@ 2   #`<@f`0# <@p`? # <@@`? @2  "0  @c4   @4     ?`?%soverwrite %s? 8  @ `! D <# :a!`a;@ `a `? "`@2 a "  a#a  y`? &`@``$` @`  y Y;@1ɐz ;#`$ ;#`& @=?  !;@Ēc`@1a K"+-;@1n@@1P@2aa@` ` !@   @1@18 # @̒ 2# , #@@)ے @ o#@e*@ !;@nc` @1Y@1W !;c`@a readlink: %sunlink: %ssymlink: %s㻘 @0$ @  ` *<3;@c`  P c`;@dvc`  `@- 0 #  @ <mkfifo: %s㿘` 3;@c`   P3;c`@d  !8@c`  #  @8 mknod: %s㿘` 3;@ːc`   P3;c` @d  !@c`  #  @ utimes: %schown: %schflags: %s㿘   -6 b "b @(h#$  $  $@(b#$ #;c`@cʒ "p@c` `  @d    \`;#` @e   \"0 ";@c`   36 ` @d    \;#`@d  ";@uc`  \` ""0@d D   \0;#`@d D  \"0 - D ";@Vc` lchown: %s㿘!;#` @d;    \"0  p@?#`  %s %s usage: cp [-R [-H | -L | -P] [-fip] src target cp [-R [-H | -L | -P] [-fip] src1 ... srcN directory㿘a!``@ @11 㿘@ Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA. along with this program; if not, write to the Free Software You should have received a copy of the GNU General Public License GNU General Public License for more details. MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the but WITHOUT ANY WARRANTY; without even the implied warranty of This program is distributed in the hope that it will be useful, any later version. the Free Software Foundation; either version 2, or (at your option) it under the terms of the GNU General Public License as published by This program is free software; you can redistribute it and/or modify Copyright (C) 1992-1993 Jean-loup Gaillybitslzwbestfastversionverboseno-timetestsuffixrecursivesilentquietnameno-namelicenselisthelpforceuncompressdecompressstdoutto-stdoutasciiusage: %s [-%scdfhlLnN%stvV19] [-S suffix] [file ...] r㿘+a!`app@ ј! file... files to (de)compress. If none given, use standard input. -9 --best compress better -1 --fast compress faster -V --version display version number -v --verbose verbose mode -t --test test compressed file integrity -S .suf --suffix .suf use suffix .suf on compressed files -r --recursive operate recursively on directories -q --quiet suppress all warnings -N --name save or restore the original name and time stamp -n --no-name do not save or restore the original name and time stamp -L --license display software license -l --list list compressed file contents -h --help give this help -f --force force overwrite of output file and compress links -d --decompress decompress -c --stdout write on standard output, keep original files unchanged%s %s (%s) 1.2.418 Aug 93%s 㿘!=!+a!`a@ ͘!!  %a!@``@ !@ 2@㿘!<#+a!`a@ !#  %a!@``@ !@ 2@Compilation options: %s %s DIRENTUTIMESTDC_HEADERS HAVE_UNISTD_H 㿘+!a!`a@ {!!`b@ sؐ!`@ ob!`@ kb!`@ gc.exeGZIPunguncatgzcat.gzab:cdfhH?lLmMnNqrS:tvVZ123456789%s: -Z not supported in this version %s: option --ascii ignored on this system %s: incorrect suffix '%s' 㿘'D@'HH@ #+@.>$c  c?@1c Dc*?DH@ ̀ "c=H"`!̐ @,  @ $#` @,`ؐ @,   @,`ؐ @,   @,`!+#c@-Ք   #c@-Δ  !+< "c# @c #@c #<< "c"#̐cc@Δ !@-Ӑc$ " )?'<%<5<1<-<+=3#c""?@"b< "c"#p<#䀢  @"= "`=@  <# ="@@`0C+=a )<'%#aT €T f 6#䀢  dc@ @Y"= &"`+"#<# =  a!`c<#䀢 +#`" h"@!a@A!`!`c@-%s: %s is a directory -- ignored %s: %s is not a directory or a regular file - ignored %s: %s has %d other link%c -- unchanged %s: %s: %s compressed to %s %s: %s OK -- replaced with %s8@Xc !<#$#!@}#x #<  0<#  #x#x???? ?(?0?8?@?H?P?X?@ @0= 2A=+a!`c#<  = 0=+a!`c8@`%=#`&<# 2#<#耢 2= 2=+#`  sa!`cp@Ȗ`=` B @"`#"b"<# <# # "@<# <# =  !P !P* `* `* `* `* `* `*@5 !ː#` @!?"b+a!`c@y@#`= "`@"#p<#䀢  !p7H+!a!`ax@o#` a @'V   !`@aa@+!`H O@wOHa#@  `Y aOH ya!`@Fa=`   @=# + a!`c@2@#= "` 㿐`'` '@9o !<`  =  =+a!`c@ =` = "`= @n#%s: time stamp restored 㿘<#䀢 "䀢`! <& #  a!`a0@ܔ!# #@Ul o =  =+a!`c@=` = "`= @&## @UB =" (@魐#` =  =+a!`c@=` = "`= @#`%s: %s unreadable ..%s: %s/%s: pathname too long 㻘@k+a!`b@p= <"`+=@-4@wc8 @qc @!p@!m #a@ő  /*< @Ň0+!`c@7 %`@ 㿘="\ =@!n "b\!#؀ "!=@$#!=  @$ @!Z㿘= ( @  @#א 㿐77""" "= "` " *bԐ""В?*@ @IԐ""В *@@:" 2 bԐ"b"*b@@'"##"b `* "Ԑ#"`2 #* Ԑ"" b*@@Ԑ"b"2 * @@"##"b* "Ԑ#"2 #* Ԑ""b*@@Ԑ"b"2 * @2 @ @e "c @ s=@)`= @7Ԑ""*@@Ԑ""В *@@" @ܐ#`3"!bԐ`&b*@bԀ2N@xN  1"@"`"#&"c `* "Ԑ&"`2 #* Ԑ"" c#*@@KԐ"b#"2 * @@:"##"b * "Ԑ#" 2 #* Ԑ""c *@@Ԑ"b# 2 * @@"##"̒ch `* "Ԑ#"`2 #* Ԑ"" ck*@@Ԑ"b#j2 * @@"##"bh* "Ԑ#"h2 #* Ԑ""ch*@@Ԑ"b#h2 * @@` @"` 㿘"Ȓ@?  @0"c ch"chbad pack level㿘? @Y "#8k# @3@. =bd "4 ""c+ "c@  @ 6@""+"#!#l#€@ $#0? "#,$"#0"#,#0!1!@#0!#, "#( ##(*   "(㿘+ 쀦 @7`+] X @S  `M ` ` @6'` @/'` @('` @!'` @'` @'` @ '` @@*ɲ`'!  >  Є@ ( 2㿘="`c0""$?#A?b?"@;ʐ#c@. ? "b $b+ " k## * @ @2 3  * +## * @ @2 3  * #, #0c l € "c,c0"c0㿘 "b#0  )%"##+#k#'##/+#(*` @ @%#( * *`@2 2@" "@ Ӑ 08 0"А"@@y?0"$0#4?$#(*   %#( ** 2 ?2$ %#(*` @ @ %#( @L @0?$0 $    " @Ĕ %0! #, 0#!c0!#, 0 #(+#`#@ +"c " @ 㿘 #8  LX#0 5%"##+#k#)'-+(*` @ @&( * *`@2`2@%""Ѐ "#4@" "@" 0@8` ""В"@@8 "؀<@ : " @0 "ؐ" $0%"$(*   &( ** 2`2"ؐ? %"ت    4$`#@ " @ $%` b@y @ `b`  " @ %  $0?$00! #, 0!10#0!#, 0 Z(`"b @> +#`#@ +"c " @ 㿘""+"# "" "b! Ė  !=" "*" (6 =" *@*   *"*  !=#, #*" (6 =#, *@*   *":!=#,  **"@ @?(  =#, * @ ?*@* "*```2  !( ".  2  `  2` !!( ".  2  `  2`!!!( ".  2  ` !2`!!( ".  2  ` !2`!(@#! ! . 2 @   4@ @(0 4(0  (0@ 0   ""( (㿘܇.`.`Ѐ9؟) . ./ *  ....*.`  .`. .`Ѐր܇.` 㿐 '      ".   2 #"ܓ*@* <;2 "75,b ,  *   , `2 . @ 2@ $* @, @   & @@ &<Α,`C""-.   . "?.  "?. @ ?2@ @  2@  ?`2 !""%.  "?, *  `&@  $4`?. x  "*  * 2 ,  "  *@ 2@ 6 , 㿘@``? "#"= "c"#ؑ, @  cА "cБ* " , , @2   , #Ѐ 4)&`"ܞ #cА #cЀ* "@ "  " * 4@ *"?#"  " "#Ѐ c&`#Г2  :   1? 1"/-#"А%Г*`@&" "Ԑ%ԑ* "%ԓ*`"@,, *@@  4@  @  ,, @ *@2 2%`_ Ѐ 4"#Ԓ"#"ܓ*` "@0㿘?       +? <0 .  "- .0 .0`@ 0`@ 4`H`D0`D0`H         ˴㿘?        @O" -`   "A`  ,@@@1?2@&  ,@$`?"`"`@`?   "d"d@`? "h"h@ `? @        `@㿘>#@P`> 4K`$> ( > H"  *    ? 4 ` * @"㿘>@ɒ @ƒ @Ò  > H" *  @  & #@]? 4Yblock vanished㿘" " b*"?#@2=@Y=A#>> " 2" 2b @ "b  `  @p ` ,  "@ 0( @^ !(@Ēa b@Q > >`$ `~`#@@`4 b " @b "b"6 㿘b"b#  *#@.``92?"@a@*`@  2@   4#>   @*  #>   @*` 4@ 2`"#*`2@  b * "* +"" =b "b " ** +"=  &"/2#* +"c"  4=#,. @@@ `  @"2 b@6`4@* "#@ " @ 㿘   " J "# "="!#   ,`*` @*`d@od`"-`@h$@-```# @4`  @*`@@@V`=#,`!$@@K" Ƨ4$@C$-l used on binary file   @(  @( @ @( ܅2``?0 (0,? 0l l㿘 "b0@H. ",@3",#","b `* Ԑ"",2 $* Ԑ"" b-*@@ Ԑ"b",2 * @@. 2 0" :3",@ "0"0. , 2,@ #"0 0`* 2 㿘"0 1"##"b, * "Ԑ#",2 1* Ԑ"" b-*@@Ԑ"b",2 * "0 Ԑ"" b-*@@2",""0㿘`# "b* Ԑ"ԑ6`* bԐ"b"*b@@_Ԑ""Г6`*@@P"# #"В8* "Ԑ#"ԓ2`!* Ԑ""В8*@@/Ԑ"bА82 * @2@5"!Ԑ`&*@Ԁ @ ԁ %s: %s: not a valid zip file %s: %s: first entry not deflated or stored -- use unzip %s: %s: encrypted file -- use unzip 㿘# d@""  *   * @`  "d#+ @ *   * @*` Ґ#P+a!`$b= ` " `+a!`b    "c> 2  "`d> "`` +a!`c@+`= "` out of memoryinvalid compressed data--format violatedlen %ld, siz %ld invalid compressed data--length mismatchinternal error, invalid methodinvalid compressed data--crc errorinvalid compressed data--length error%s: %s has more than one entry--rest ignored %s: %s has more than one entry -- unchanged 㿈  """  @֒ > ` > d =#. #. * @  * @*`@  *  * @*` =  >@U  q qm  ` g=  d#6 #6 *   * @*` *  * @*` #܀ @ #2 #2 `*  ` `* *a!``Д@W @  #?%-# 3#' d@`$d @@s bԒ &b*bԀ@ ?@>!@u> ` (> !'# #d@@`$#d @@F   .* @* @*`@ * * d * !'# #d@@`$#d @@   .* @* @*`@ * * @*` "@ޒ @@!8+#@!`> ` H#d #@Ac ` * ` ` * * Ґ#P2/><# =  =+a!`a@`=` 2> "`+a!`a@~`= "`>>" `"`d >>" `"`d ''''\ @ D*`@  " 2'@$  ,  ?   , * ,` ? ,`8$  *,  ?@   .`,`?@,`  ?@ "? ' "@`   ,  :`":*`@ "z`@ * '? 'h @  '|-`?@L  '%@.|"-`@`@"  *.@Q*    @h b̐ #b̒'@"-  "p"/ /'&4@l, "@ @ "`@ 4 %@/+`   c/    /" * @ /" * @7%@4@ ., "  " .@@4 @@.? @- @z  ?&+? @- @ z 2?a`@Z-``  @ 㿘?@ ? x''""">!/`@'/ @'-1# #7 #@`%d @@: * d *   % cm? `$4d#@`%d @@ * >!, @ * ` ߢ `4  $ `- ʀ@=""Ĩ :`d#@`%d @@ * `>!, @ @$4d#@`%d @@ΐ * ܐ *   ' c2 `p $?4d#@`%d @@ * >!, @ * ` ݢ `$4d#@`%d @@ * `%>!, @ $@4$# @@&& % %@@^@@ @-`? `@""Ԩ `ߢ @!"""""" 㿘"""Ԣ & 4#)# cd#@`$cd @@1 *  ?# ? 4 '+# dc@`$d @@ *  ?#*@4 3 (?'+# c@`$d @@ *  d#, 24 @'""Ԥ 4 ?""""""   .    ";  ! .    ";! ! .   !";!   .   !"; 'pp#\x! !>> t*  .    "; 'hh#\x  >0>!ll tt0 lph  t l  incomplete literal tree incomplete distance tree 㺐""` !)# #d#@`$#d @@J *`` `4!)# #d#@`$#d @@0 *`` `4!)# #d#@`$#d @@ *`` 496 $)-# @`%#d @@ *``#d> h, @*`@ "{4    > h,  *    "; '#\    ) 0>!*`@  )3# c@`%#d @@ *`@ #d *  ' 4$@  . ";t  ) ` #dc@`%#d @@ *``  4??T. ";?? K5``8 #dc@`%#d @@Y *``  4{?"; ??. # c@`%#d @@8 *``#d  4Y?"; ??.   y"""">!'#\!>> h 4a!`@˒`80>!'.#\ >0>!lN a!`@鱒`X}{0   pn  㿘""  `%)# d#@`$d @@ * @ `&? 4`%)# d#@`$d @@ *  @ `4`?""`""2``@ 㿐"""""" !$" ""8 "$""  "d?`"db@"b԰ 㿘 \""0# !# #+#@c# $c@  $##?  \"0 @{+c"#h >?`> (0  > ؁8  d +  h㿘"# \""0)!# % ##"Ȓ@ $ ` #@$## 2̀ ?@.hc "h̐ "cd # 㿘!"Ԁ  @%b+"Ԑ "$"ԁ㿘#bԀ`!#=  + #@ b+Ԑ ""ԁ㿘@ .?&@@JaJ@㬄 @*@`J@㿘@h / 2 㿘@h . @"` _J@ ."*@@ out of memoryargc<=0㿘@ @ Z^ @ .@ @VN  x@ꎒN @ꭒN .N 2@@ 5 $@ @ܒ 2@@1 @&@@) @$` 3@W`x$ N $` 2@$ %s: %s: %s 㿘+a!`b@˖`@穘%s: %s: warning: %s%s 㿘=  +a!`b@玖`=`  "` %s: %s: unexpected end of file 㿘+a!`c@u \"0 @ݐ#`0a!`c@f`T㿘+a!`c@Z@Ɛ#E%2ld.%1ld%%㿘@1  @4 . "* * @#@  ?`&@ - & -*@; ?`&@  & *@)@ @ߒ c@㿘@J output in compress .Z format not supported 㿘?!  ? "!a!`@a8="   %s: %s: warning, unknown flags 0x%x %s: %s: compressed with %d bits, can only handle %d bits corrupt input.corrupt input. Use zcat to recover some data.x''= d#@`"d#  @Ԑ $?= ```"=  =+a!`a@扖`=` 2= "`=` "`  , '+a!`a˖`@o =" A # !!'?  #d* ?!耢 !!+# @ ! #,?<,<"  6   *   `?  @@  @ ch@"ch`@G$,  @ D!!- ?@$? !!'*  "À`5+@- ?@˒$? = ܄ (? (?'<   * @ * @ :@ @ ,!?!耢 ++!= 2 < ?&<# "(,@  +# ,@,  8 + +,@3&@4 А@ = 2  & @+  ݐ&@ А@ {܀@6 +-`2 -@`D@`<=  2  bĔ+c"c 㿘`T*2`T \%'! X%+# #`\& X*@T 4Tdc@`$d @; % X?"$ X $`\ `\""`\X2@T 2T㿘`T "@> 㿘2 T" X" \ Bad table  * 2?ؖ  @ *`@ ؐ  27  * ؐ#@ *@ 2  !  " * ?:@2?& + 2?.  *@ #@ +2.?:  * * 6 "  ?*@k#+#@`2+`??@ @ &+`* 6+`+`?3* @ +222* * + 2+`2?*@㿘E @  "<, &, "T,   2 0>,'"<T* 2 ` 2 @`T2  `` ,    ? , T "<, &,b< T㿘    ",@`a$,@ #,``o2 0T@Ba'"Tk#T2 *   T+# ,  2`"<y  4        ? @",@?`@"В?,@`@Ta !",@`a$,@!bД 㿘1"P v  &"P-!  '   !?bP?"bP T2`#*`@!  Tk#+# .   !2`" 㿘 T2`"T*`@   Tk#+# .   2`"< ?! *@㿘#""P㿘" `" d㿘 ``? "``#8@.@8   9"8``? "``s!  +"`d#.@ $0?$``!&??* $"8``? $``#b8@.@b8   "b8``? $``0ρ㿘"""  d ##=!`   d ! d  invalid compressed data -- Huffman code > 32 bitstoo many leaves in Huffman tree㿘" h - h%)# h* d#@`$d @ @  %@ ld#@`"d#  @| $ l  #  l@ !'/# +d@,``$d @\ %,```l@d! g#8 laؕ*  "  @ ' !p! p+-,`" # cd@`%cd @' ? ,` l@,` laؕ*  " l` @pؑ: *`  `l 4  (В @*`" (*2`@*`ЀД*invalid compressed data--length error㿘""" #"""" "*@ l!ؓ*`@?5)"'-b@b# !"* d@`$d @ %b`$b"@"b" "2@ @" @`",3@`,  bb# "* d@`$d @a %b $bb"@"2 "@.`@@*۲`@ l@Ԑ "!p.`@ p@ @+  @btb"$bn+ hc ;"ȁ  J   (8  J  (?( " *b* ?Ą "b( " *(? ą( " *POSIXLY_CORRECT--%s: option `%s' is ambiguous %s: option `--%s' doesn't allow an argument %s: option `%c%s' doesn't allow an argument %s: option `%s' requires an argument %s: unrecognized option `--%s' %s: unrecognized option `%c%s' %s: illegal option -- %c %s: option requires an argument -- %c 㿘?"!? # ""b"""N - + "b"" @O# "" "b" "J " /!?"bĀ  ?!@ ??"a ""? " * @J@ -J` ?a""!?!'* @@ےc !?! $!"bĀ @  "Ā@?!"""?"!? ?"bĀ2"?!* @J@ -J` " ??? "* @" Q "?!*  @ J  -`? @  " ?!* @J@ -!J` -`"""    @  `="`L@  @  )" @-$@ 2"$@M2   ?!  ?!*a!`c @@@ !+"" $"v?!`"!L@ 3 ?`V"a?! ?!* ?J  - ?a!`c@@@!!* ?a!`cp@J@!"" $"  )!?􀢀 ??"*@"a!  ?!*a!`c@@޶!"" $"N :@? :!"" $"'`  "@ `!* @J  - "J@ /!?! ?!* @J  - ?a!`c@@t!* @a!`c@J@f" "b?a "ai !"`$" @uJ@"J ?a "a :2J?!  . a!``@@::?. : "aA :2=. J : "J@  ?/"!"J@ ?"!?a $"a?!??!  . a!``0@@ :?. :`"!N :@? :? "* @""". > 㿘   㿘 㿘@"HLPRXfgorstuwxthe -R and -h options may not be specified together.invalid file mode: %s%s: %sfts_read㿐@ف     /"!Q@䆔Ȕ^ 0W*  Gd G G G Gp G G G G| G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G         #*?J@ -QJ`  QJ` $#@Q#*`& @@  ` @1a2 "@ ? @ @?А !% \$0@ϔ  \ "$0 \"0  b@\J   b@0ڔ  @  b@0Δ`@*E   @\ !'@+(H \ 4? -*  I J( J( I J( IT J J( J( J J( IT IT @,<  @ (@   @ (@ڒͲ   <@U`* .2 @5I `@  "0  @\1b0@usage: chmod [-R [-H | -L | -P]] mode file ... 㿘a!`@܊b@ΐ 㿘@ lost+found㿘"\* b  @@ `" `  " `@  $  $ " `@*@@  ͘  *@  J 2    "  㐁wrong type to dirscan %d 㽘N 0`" $@4 (   a 2 ` aB  "@D2`* @ *` > #h @`4 @   =   b> 8 & @<&ͦ #P`@!& ( @ @   "@, -2@2`  4   2     DIRECTORY CORRUPTED㿘#h @3`4 @b !8  4  3  (.  6* `@@ 2#  f@+\a @=`  "4 " , , ,  ,` "&  ~B?\>  4  2W   (S  6O  `@ &     b>  !=`:@  25  (1@1 2, ` a >"@""@ & <  b>   @*a @ג`@ 4  ,`  " @:; `. 45 22 @2 `,   ? `  `   ` ` ` H  /   &HH`?㿘 @%s NAME=%s %s=%s DIRFILE㻐!@@ @!ؐ@)є`"@@ѐ@%b <  !"!@0!@UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED) ADJUST㿘@ T .`>`  @ Eb@B 0?#H @ <  2!"?"@"@ T ,`: " @'""h  6 @!@#@#"h 2  @%*#(  "@4 㾐 (@; ,/    ` `  " 6  " 74   $4 # ", @, , ,    ,@ 㿘 (   ,@ "  $# ", @, ,  UNREF %s (RECONNECTED) RECONNECTNO lost+found DIRECTORYCREATE (CREATED) SORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. CANNOT CREATE lost+found DIRECTORY SORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORY..DIR I=%u CONNECTED. PARENT WAS I=%u ` @ 8@@<  `?"!"@!@"h  ` `  "h 2 @$A! ! @!!#H M@Z ?b' /a'Ē '@ 1$#H@""h !@$" $!?  @$#H? @쀢 "h  " !#H@s $#H"h !@#H 2Z"0@#H<  7@3"h@#ܐ" !#H?  @ $#H,"?͐ b@|H  "@#͐ /+!''b,`*`<:`b2@#H##HJ@ "@ 0R@##H@a  "@ @r"`0>".  ?72 #͐!#@4cH 2 !̀cH@@#!@#H` @>4`#H!"*`  2 # @Ò #8@B".`  2 "h  @5!ذ ` @{ 8 /!`'''''@c@ X G"C`A@? @] 8 / '?''@F "@` 2```aB  "@צ2`* @ *` @>`@Ӓ  @'@ @ @  NO SPACE LEFT IN %s (EXPANDED) EXPAND㽘#h @լP 4ڰ , ( "԰    #h@&Z 8ř,  (# ,# (ch 0 : @ B > ch 0:  h & h ͐ch`P* :  8   #h  0 #he< eD`L  ,@5 ` s,`@"'h@&`0` d,`@"`"h`0  )?"@ "h` 0@  ,`, ͒#h P*@:`    #h  0 #he< eD`L  ,@ ` ,?`b@\ !`@"h @!x @"!  @,` , ," (" ,#h 0 :  b> #h 0:`  h" & h#h@&`8 㿘@ʒ # ??# #$&@&` @#h (@`4 4@ b#h 4@@  '?%͐@ bh 4@@  . @4   " 2`@ ' # ? @ @ @*@J  ".  2@ ,`@  2@ @  @\4 㿘@ @O2 @㿘"`   @ 2 ?,$?@ᔒ  0,@  #,㿘"L ?"@"."bLDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDS @ &@&`$ >`< @@@(@+x#h%(:  8ܰ  #h%( x h x˰ @(` @b< @ސ @"" @  #h 0?: @ B  @~; Ѐ] +ͦpchche<@ :e@@ B `L ;  @ @ѥ`T&`ch 8&` 2+&`N`0 26 2`@$Ւ #@@  `2% @`% `: ch@`0: < @ @j"" N`0 `@ ] R Ѐ ch 8&`ch 0+  * :  b ; Ъ p " N`0&`@; "+ 2̀2`"`@$t #@@ O  J#h t: @d  d``$ PARTIALLY TRUNCATED INODE I=%u㷐M 0   @ 2 0 D @   !#h @ `0#h 0 : #ch t: @$  ch#h t: @8 #h t@  b: @ǐ @"" ?%z F@B@k  % @+. #h t6&*  .  ͢9    0@ @$u " $- *"@ . @:99 `% @^  ?#%M 0 2  @# #@ǒ@p `f * ?% blk %d < cgdmin %d; blk + cnt %d > cgsbase %d blk %d >= cgdmin %d; blk + cnt %d > sblock.fs_fpg %d 㿘b( 'U h@ `@``,@``  `@=# #@h@  ,@ @ #@@ % 'h@{`@# Đ@r``,@m``#Ȓ@Ԕ h#@  bad inode number %d to ginode 㿘 "!@ْ ` #h x@ 1#h@ @2  ,@@-  @ @ x `* #`!` ?"`#h@`0"c##h@ x@  x$`##h@޾`x*  bad inode number %d to nextinode 㿘"l ""l"+"@zb =" "" #h@ @  ,@@  @ކ @ x `*  d,͐@#c  "" %b"Db "!#"`@ ٔ"`"`  " Cannot allocate space for inode buffer 㿘" ""l"""" #he<8`H "bD͡4 "")`@%#%`@ڒ$͓*  " %#""b"D"b!"` 2 @"D $"`@ `"l !^"l"l 㿘"` "@""`cannot increase directory list㿘#h 0?:  @ B  @M;  8 ,@E $7!͐@b* "T $@" $` $``$`$`$`$`$` $`,$` `$@ ("\ @2͒`d" !"@Z*` $"@!\`"\"*`" cannot find inode %d 㿘͐@ݗbbT* @     2 #@@^㿘"T "\* ?b #@?b#@bT!@"$"$bT (%s %sDIRFILECLEAR (CLEARED) 㿘F <  2 ` h X@m@h "h 2@ p "h @ߐ xb?"b’͐b@ #  * 㿘 ( @2   ,@  㿘 (  @ , 2 ` "@8 &    I=%u OWNER=%s %u MODE=%o %s: SIZE=%qu MTIME=%12.12s %4.4s 㿐"@ 7"3@x" @D< p"(@"0 p@k"8@g"h " @@\"H  @W"P '@ǐ"`@M%d %s I=%u BAD STATE %d TO BLKERR㿘#x@@4##J "   #4̀  0#  *@# *@##@9J@㿐  #J \  ͒" #bJ "Ͱ  *J"<@ @"(@ 9 @4 # # *@@  $ (# *@4@9$ $ $ h 4 :< h 4: $ hb "b# ",6` *@` @ 8 /+!''ߐ͐b@ߔ ~# *@b?"bdfpnNyYb:c:l:m:numberAlternate super block location: %d conversion levelmodebad mode to -m: %o ** lost+found creation mode %o %c option? 㿘@G @'-͒ *"$#'% \+)?#!@Fx +8s*  }, }T }T }T }T }T }T }T }T }T }T }@ }T }T }T }T }T }T }T }T |d | | }T | }T }T }T }T }T }T | }, }T |T }T }T }T }T }T }T }T }T }@h %h,$ bbt@p ""@",$ cbt@a "b@c %c,$ mbt@R p%"@""@" cL ,cL,"p "p ,"p,cL@#Q#&* @ @   >@c"h  >@zc  @@`  @  ?"4 2 @ -%c flag requires a %s 㿐@_"J " @ufsffsrwro㿘 @b "   @b 2  @b "   @b 2     starting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups %d files, %d used, %d free (%d frags, %d blocks, %d.%d%% fragmentation) %d files missing %d blocks missing The following duplicate blocks remain: %d, The following zero link count inodes remain: %u, ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** / ***** REBOOT NOW ***** ("h  >@^c!͐@"h# "h @ #@@?l  "h f@#Pc "h #h#p@x`@ "@p#@m#@O"X "h "@ΐ#@\#@"h  @S @"h  @J 0@ "h  @A X@ "h  @7 @ #%h``'!͐@`8  "d@ . * * h@ (. "* *  (2`@ :@ @   @ # h Ȑ b"@" `$ @ # R'#h``" @}`,d$d`$d`?`4@Ґ $d!͐@j`8"("@$ `$d @ΐ!!"X  @ǐ! "X   # aH@  2aH @!P!"  @!X"   # a@  2a @!P""""Xf"#" ͠#h#h@  , "@ )͒#lJ#l #  ,71#h@ ``,@```d, @#h ,@b @2"0@/#@,"" 5"h 2 @M!"  @F!@f "! !@$Β 2W@'''"!ؔ @%6 "  "h  @$!@$ 0 ` ͒#h ,>+ͨ ch@``,@``! #h@``,@`` : b0   ?$- @ @*   ch ,ch#h``?`4@Ő 6͘   : b0   $ +   *  @ 8 /% 'Ģ ""d"b ͒#hch 6'̀`@o h `ch ,& PARTIALLY ALLOCATED INODE I=%uCLEARbad size %qu:HOLD BAD BLOCKbad size %qu ndb %d:cannot read symlinkconvert symlink %d(%s) of size %qd bad direct addr: %d bad indirect addr: %d LINK COUNT TABLE OVERFLOWCONTINUE%sINCORRECT BLOCK COUNT I=%u (%d should be %d) (CORRECTED) CORRECTUNKNOWN FILE TYPE I=%u㿘Ɛ@< 4`(͒b@\ 0 "`X͒c @T "@  "` "` ""@ r"@"  =͒b@A # *@""H#h 0 :`@ B B?` 8`  # "~""`` @ѐ"w""h <2"@ސ" #h 4 :<` !4@#h 0?: `@B @[; @6# "G"""Ȓ@?"@@((w"< B` ` :` 5 2`h` ;0`h +"j ?#`#h`( dc@"+ ""@ "#  ` ,""`` @P`(@` 2$`h#h%(: `8``  #h%( `h  ``B   @    )#h@`t?   4",  (`  ""@ "  , 􀤠  )#h@`t  ",  X`  ""@8"  , @ b "b". `2 T` @ 2""@ 5#P"@ސ#p  "#"@ cb""b`  ` # # *@# *@",4 *@"< "`?"А`$`p?4``$`tp4`" "`&`g#h 4: @ `$&`$`h 0"#@ "h ""@f#0@~#Ѐ `$" h"#@ ƒ!# *@"@k"  # *͒b@ .BADEXCESSIVE BAD BLKS I=%u (SKIPPING) DUPEXCESSIVE DUP BLKS I=%uDUP TABLE OVERFLOW.㿘   $$ cޔ` "`$#@  "h "$@# @#p  "#"@ !c $/-3"5"7"#+̀ ǒ   u   :`0J   ?$:@ 2$d %d  : 0   ?$ *@  N*  c` "`$#@ - "h $@Ɛcp 2> @ ʒ@V 2 "$@ #@cp . @ c c$c%bX"@""@bXc@ `"c@@ 2`c@2 $`2$c $ & $~ ` @ 8 /%#'"X"`  ͒#h ,* )͢ ch @6'̀ (`"`'#J  & `h @ ch ,ܢ DUP㿘  2 '-%+͐  2  c  c Ҕ  $ " $ c"c 2 c  @ բ`ROOT INODE UNALLOCATEDALLOCATE%sCANNOT ALLOCATE ROOT INODE DUPS/BAD IN ROOT INODEREALLOCATECONTINUEROOT INODE NOT DIRECTORYFIXBAD STATE %d FOR ROOT INODEDIRECTORY TOO SHORTDIRECTORY %s: LENGTH %d NOT MULTIPLE OF %d (ADJUSTED) ADJUSTMISSING '..'..BAD INODE NUMBER FOR '..'# ?* : `l&"*`@ x 4  x&@  &@  &!&@ a !퀢 "T&@ !&@ Ր!8&@~!P &   |!퀢 "?&@ y!@m!` 27&!&@ oa&@ !p&@_!P &   ]!퀢 " &@ Z!@N! &!&@ Qal  / 2 #&!@ @J`#  # *`", *`#!b"\ *@ז∐ @R 8 /(!'"\* b  @Sͦ8+ͤ@@  F  & 0a"$ &!!% @ &!В @ S"bh &@Ґ" ! >$ bh &"@     :  @  7@  ?Hh $@  ' '̐`@*@"@J+&'&%@ `"?`  ";`  6?4 2&$ &  @a "(`  c( * 2  ϔ0@a "` *`  2  *` ?2  $  (- `@*@.BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'CANNOT FIX, FIRST ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '.' BAD TYPE VALUE FOR '..'CANNOT FIX, SECOND ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '..' EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYUNALLOCATEDDUP/BADZERO LENGTH DIRECTORY%s %s %s IS AN EXTRANEOUS HARD LINK TO DIRECTORY (IGNORED) BAD TYPE VALUEBAD STATE %d FOR INODE I=%d㶀 ("<  ` "@", ,  $   ''@ޒcP 2"     'cX $&@! "`# "a $  \' ђcx P, 'ʒc '#  // /'#P7  &@b( '#@Ԓ3 $6'@ː#* $,`@6 7@ꛔ&$7@ꓔ $ & $"*` ?2  @뉔4&@Q! "` $ 4  '#  // /&"("(7 `/ $    @z"@74 $ & $"*` ?2  @K4 &@(b( % # "X  S( *` ,&@! "H`G '@cP  &  &( @5?   &(@( X?%  &%    7@&@! "` $ & $`"*` ?2  " ` `8  $L . $ `2L  (`$&@! "`` .2 $ (` & $"@  (D# $   2     2 (꥔Ȑ $ ,&@]! "`# @?* : `)#*`@   8 8 $ ( {(@7  $ #J@ 2( "h } (  `(@ r=#<    * "*` 2   & $ $ @ @  (!( @H"h ((@Ő!H  $@ܐ 2 $  % # ! ",J @  (X", @,&@! "`"*` ? 2 #(!h@J@ ` $`@$$ 㿘"\* ?b >)+ `"3  #J 2+# J $  ` #J  b@ ` #H$ $ "*` ?2 # *@":UNREFZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%d` @q 8 /+!'Ġ "HY'+ #%*' ?* :  6㐑*  x 8", R@`b靐2 "/ "b2% (`  ` *cА*c*#J@@ "$b@坐   "H('ȁ㿘  `M '+)͐   >  & $X@y  :`b0J   ?$:@ %X   "X 2  2  : b0   $  * *@* "d?%"d` DELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCREATEXPANDCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS UNKNOWN ROTATIONAL TABLE FORMAT %d CG %d: BAD MAGIC NUMBER BAD STATE %d FOR INODE I=%ldFREE BLK COUNT(S) WRONG IN SUPERBLKBLK(S) MISSING IN BIT MAPSSUMMARY INFORMATION BAD?bȝ#h!?#H@?, # *` @L``5 "@ $eL`X !e$ "h +@c""h 2 %e$+@ # " `X%e$͐ "b8͐#P * `X $eLe$  + #0e$`X@```+#8`"eL`X e$ %e$`* @EeP*  ``,`: `@9`@ޘ`|`,`: e$ `0* `@)``|``@ކ* `,`: + ̀+#@@P%e$"h 2+@ #X E"h +#p@`* @eP*  ``,`: `@`@N`|`,`: e$ * `@``|``@=* `,`: @ e@ B`L ;   %`͐ "b8͐#P * eL?  n+ T?< ``"`: !@"U?, eP?4  V%eP% T`,  % X`@ܘeP* % \``,`:  \ % `e$  `@܇`@`|`,`: ! `@|`@`| , :` `@ % he$ *  % l`@i``|``@Ɠ* `,`:  l % d@"U%  ?<  \ T"@ d" #@eL@ @  @͖ ,"*  * 0"< 2" , @ `$`8@    ͘ : b0  $ +  *  `,6weL@"U @``.@`` ͐ @ ` Ԁ+#@Β@```$4% % `,?2``@=`5 5 &% e$  @2`8% p% % $% `% ( @6% (% (, @6% ,% ,U 0@6% 0% 0 4 @r   T T @i@eL??, @ۡ` `F .  ?* :  +*   t   %  ?% :  " \b  ?$. @ *( +㐐#J@@` # :  " \b  ?$. @* ?%   `85 ,`:`0J ` ` ?"@: 2, :  c `    " .  *`8Ғ`8]  % @`|@P` ,`T T @ "@@`|@=`@:`@`@4`@`@@.`@eP@*`*  ,   X@ڼeP*  4e$ <@`8 & :  l@`8&` ?"@. @&,$ $% $:  " `@ @ ?$: `8" :@   4@ `8De$ 4  h l   p@ @ ` ` e$@4*`  #   *   p瀋@ ` e$@4*`  #  $ '  '  '  '`p> *`@`l.* bؠ @͔  @+@hc  $ $  $  $$ ͐#P* "8 b` " \\ @ x,@=` \ " \ @㕔̈́(?<@   T TTT @n !,@ `8 ?<@jTT  T T @Z͆( `,eL??4%eP`@;  @+@֒c  =`=`-`-`͐#P * @ @ @@㿘'H'L'P'T'Xa!`@aH@6 %s: %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. 㿘  @!쀢 @0!h@a@Ƽ @!쀢  0@!p @!쀢  @(0!xa@@ 㿘'H'L'P'T'X ͔H㿘'H'L'P'T'X H%s (%s)㿘 \@Y"00"ޒ㿘'H'L'P'T'X H@ǐ 8@>V /@ <  L  r @ /r㿘@>9 /1, (@ /, (0@c (@  ( /Can't stat root Can't stat %s %s is not a character device x @"!!1 @ 6 1@ 0M@8  @1 @@<  "@L@@a "a@؀  f1 @ؒ"<  1 0<   `g @F ` malloc failed㿘@` 1 @=WaЁrealloc failed㿘@ߎ 1 @=Fbstrdup failed㿘@lj 1 @=7bPvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth Edition4.1BSDSystem VVersion 7Version 6swapunusedadoscd9660lfsmsdosffsCan't stat %s: %s %s is not a character deviceCONTINUECan't open %s: %s ** %sNO WRITE ACCESS (NO WRITE) cannot allocate space for superblock LOOK FOR ALTERNATE SUPERBLOCKS%s %s %s %s %s %s SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO FSCK_FFS TO SPECIFY THELOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ffs(8).USING ALTERNATE SUPERBLOCK AT %d clean = %d %sile system is clean; not checking f** F** File system is already clean UNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED) IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=%x IN SUPERBLOCKFIXINCORRECT FMASK=%x IN SUPERBLOCKINCORRECT MAXFILESIZE=%qd IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%qx IN SUPERBLOCKINCORRECT QFMASK=%qx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATBAD SUMMARY INFORMATION%scannot alloc %u bytes for blockmap cannot alloc %u bytes for statemap cannot alloc %u bytes for typemap cannot alloc %u bytes for lncntp cannot alloc %u bytes for inphead *"͐?"bJ"$@r 6  \@"01#@ <   1#2@Ɛ  " @[ ̀  "c \@"02 @ "h 2 0@J#L  ͐@< ̀ "b͐?"b"h "22 82@t H"h 22@l X"""#H!͠#P, ?$ $ #͢cp,`$`$`@$ @ $`  `22r ` @c  (͐""b"@ܐ  Q" 2 "h 2 ͐c@/0 " 2@A } \@%@ծL,@@թH8,$@ \`@\@2!p#\2 2`222!02@aPN  2!hb# #h2!@J`#h р "h 2!2!2K!)?"h 22B"#h $"b(# ,@P $b 0 :`*` * ?:  !#h t:   @ @ E #h!#h #h2 "(2@"P 2!#h"  ,`!#h <`c#h2"`2@"P #h " < ,`#h `! @$#h2"`#h "`"h 2@c""h 2 2@v"P  ͐#P * ͐#p* #h  @* @%!!#h2"`#h`"`"h 2@7""h 2 2@J"P  !͐#P * ͐#p* !#h`0 `H@!2"#h`0 "`H"h 2@""h 2 2@##  !͐#P * ͐#p* !#h`4 `L@!2o##h`4 "`L"h 2@""h 2 2@#  ͐#P * ͐#p* #he, e0!e4%#h#h2e4e0>#@#h:%0"h 2@""h 2 2@͐#  !͐#P * ͐#p* !#h%(`< 2#h#h <"e("h 2@""h 2 2@#  ͐#P * ͐#p* #h`H8: e8 !e< (#h2e<e8##hH8: :8"h 2@c""h 2 2@v#  ͐#P * ͐#p* #h`L8: e@ !eD (#h2eDe@##hL8: :@"h 2@0""h 2 2@C#  ͐#P * ͐#p* ͐ "chH8: :8hL8: :@"#"@ 5#h%, 1"h 2 23@  P n#b< "b<͘hh "e,h:%0h <"e(hH8: :8hL8: :@ + ͐#p* "@ i#h%L?e"h 2 33@ݐ X  6 (b8 "b8h "eLh "ePh#\"eTh%`"eXh* @7P*  `,`: @#h @) @Ԉ |`,`: @#he$ * `@``|``@u* `,`:  ͚#h#h%@ B L ;   $ +`͐#p* ͠#J# "   #h? @ܢh"@?  ͒#h = +ch`"`04 @Sch-  "b#chؐ@ 8  d* @ 2ch3 2@;  231 =cch 0   Ȓ"(```:   !͐@  $"03 @0Q!#b @  $#b3 !#b @  $",b3 @ߒ`05!#b @   $"b`3!@ϓ*`0%%#h $"b\͐ "b #@Ԓ $b!@ϒ $"Tb ` "3!@@*`0@S 0@  MAGIC NUMBER WRONGNCG OUT OF RANGECPG OUT OF RANGENCYL LESS THAN NCG*CPGSIZE PREPOSTEROUSLY LARGEsuperblock mismatches offset %d, original %ld, alternate %ld VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATE㿘" ":  @ #ch@ 2 ͐#P" "  %\F!T@7b#h , ͐7b(#h ͐7b@#h ,@ѷ    ,?@ѯ 7ܒbX#h h@!͐7ђbp@ћ"͢#h#h  d 4@* $"@$" #h`,?@с``,@|``͐#p @&`h# 2 #c!#h"@c#h% "e c#h "` c#h`"`"`"`"c#h""bc#h *`c#h *`c#h *`c#h *`c#h X"`Xc#h <"`<c#h "`c#h @"`@c#h \"`\c#h"ؒb@ |c#h#T"cTc#h Ԓ`@ؔ"c#h$\d\@Ҕ c#h d"`dc#h "`c#h "`c#h%P"ePc#h%H"eHc#h%8:8c#h%@:@c#h%H"eHc#h%0:0#h c@h %# 7@V"#h h ?c)7'@ "h$ @D:`  `7b@ ͐ *b %s: BAD SUPER BLOCK: %s 㿘 "h " 8?8@#8#%s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: NOT LABELED AS A BSD FILE SYSTEM (%s) 㿘@ ??" L ?? Lac  9 HT @Lac  "L`* :@ ``@"d*`@1"9 x2e  @ %h &4 &8 &&$`0&`,&`8&4@`(&|`` ?4@ ?8@@/&?&` * :``& "* &?|@v ?8@q@&@ @i|&$@e?@a &,&d|`$ d :``&d`("b ioctl (GCINFO): %s %s: can't read disk label 㿘e`e@\H 61̀  \  @#"09#09#H[ Hbad file type 0%o 㿘< @@"$  (@"  @" 0 @" ̀@  # 9#@ INTERNAL ERROR: GOT TO reply()CONTINUE %s? no %s? yes %s? [yn] 㿘"h ":M :@``?:@Ր Ѐ J#L :" : @Ē` J"p 2 :  aJ#L a: @N !'aa : @@Β?? %?@?ఐ`$ @, :  , : ?  $@ 2  , ఒ $  ,  ` 2, :  y Y n N2::@l Б, :  y Y  cannot allocate buffer pool 㿘""L"c#h@ 02:p#!" * ?" " ͐bx" "bx#h(@/`0$  @6&-/:'ͪ"x?@ߐ h@ 0 `2$ `B$ x$x" $x, $ `@$ ""deadlocked buffer pool 㿘͒"x"x #h d+͖"x  "! 2 ͐b|b|? ͒"x  "  2 ͐"x2; p@ bP "bP "@ "`͐bx& bx&bx" "bx  & 㿘#h d.@ "@ b "b# @i& & & WRITING %sZERO'ED BLOCK %d TO DISK PARTIALLY 㿘N` E` ` @|b;;"8"@;"`.`&```@` ͐#P@'  ` !)'"ch,`"ؐ@ 8   d*  " 04@h 0 ` CANNOT %s: BLK %dProgram terminated 㿘"h 2;:@~6 ;#x:I ;N#UPDATE STANDARD SUPERBLOCKPanic: lost %d buffers MARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEANcache missed %ld of %ld (%d%%) 㿘"  #"acPJ" 0#X: ":  @+2̀@ "h 2<  "!":  @#P$  , "/"*a@ԍ!"|`ͨ"x'̀@ ✤`@}`@{@"@"< ("@""L #"c#h р "h << @  ` "  ͒#h#h **`"# "#", * * @ZbP< x@}abP@֒#"@֎SEEKREADTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %ld (%ld), %ld,㿘>": @s @ <#@ <@ <\ #Hߒ@͖  <#@Ӓ  @Z<@}#P> -9͐@ /<@ E  ;  B  @֥ "#<@w@Ւ@ђc@|ٔ  !<@"#@|ϒ Ȳ@:@|Ɛ аWRITETHE FOLLOWING SECTORS COULD NOT BE WRITTEN:㿘 `>": @ @W <#@] =@y=͐ ="b!N@< 6=<#@B=@||! %:#)<@Vbb <  D  ;  B  @ @Rb#@|[ b@:@|S Ё㿘wh8@s  1h"(8 i ;͒ ch8 V ,80H >2?  6 0,8N >@ 6 "d@,80@ *@ .@"d@""d ch8 ch8( ch `?/?..`@ @2#@>!h !h#@  ># ? >!p !p. `K. @ "c@ @ 8 / '#@-.#'!'>!x'Ր{ "@''at''n @@ո$ @Ē? /,  @Ȁ2'@"#@? ?,<@ԭ& 㿘"< Y @ս returning to single-user after filesystem check 㿘>@{C#P͐ "b4 @ 㿘@Y|  @  @  (SALVAGED) SALVAGEUNKNOWN INODESC FIX MODE %d 㿘 &   $ "' ">N 0 U  "h >>@{#  #   & & #㿘 8A. . @..`@H@l  &@>/`  8@/`@2 / &/./  8. ` 8@۰ffs_isblock㿘 8 "  $?  ?@ `?*  *@>*  *@>@   `? * >@  `?!ffs_clrblock㿘 8 >  >? ?.@>*` *`  * @ *@.@ "ffs_setblock㿘 8 >  >? ? .@>*  *   *@@  .@ #`㿘@0init: %s init: already running initinitial setsid() failed: %mrootsetlogin() failed: %msfunrecognized flag '-%c'ignoring excess arguments`@@,  @x̐ a!`@@`0@E @  " @a!`@@`@@9  X @W @m 6@@@Ɛ `@@ +@@@ +@)AB"%A !@@``f`s%"`$\@ Q#"A@@ A! @M  #\ #`#dA!D    @@ G p   @9 G#ܒ @4 ?' #\#`#d #h #l #p #t#x    @;  @6 ''' @F  @B @҈ @҆ @҄ A@"` x'H'L'P'T'XH'?' ``䀢`''' @ `#####Ȓ \  ` *#"0("#㿘'H'L'P'T'X @V H@W9@WI 㿘'H'L'P'T'X @UH@W)㿘'H'L'P'T'X @UH@W㿘A"d""d@ fatal signal: %s㿘@ÐAݐ!0@W @Ґcannot get kernel security level: %s㿈 ' ' '  @B ?  \@w"0A!x?cannot change kernel security level from %d to %d: %skernel security level changed from %d to %d㿐'DD ' '   D@  ? A \@wX"0A"zD0"HgD㿘㿘  @+ Ac(@* can't open %s: %mcan't get %s for controlling terminal: %m㿘@"@V| @ ?A#h@2 @+?A#@( Enter root password, or ^D to go multi-user /bin/sh-sh/dev/consoleconsolePassword:single-user login failed Enter pathname of shell or RETURN for sh: PATH/usr/bin:/bin:/usr/sbin:/sbincan't exec %s for single user: %mcan't fork single-user shell, trying againwait for single-user shell failed: %m; restartinginit: shell stopped, restarting single user shell terminated.single user shell terminated, restartingB P?B X'  @/hBW `B@ɐ p@@ . *(J # B` @] ,'B1B@vxL@ @r @ @Ѵ @ \ 0@D@ {p B`@6 * @I ? " ,L :, ,Op p@u@,0 /2` -/@u'l l@ ''B B`@X @*#Ba#B X''!B P@*a P@UM @  2AB!(? @  ?D1B""`) \+B1B'B%A?h@ ?@? "0 ߐaX0"h   Ԑᐐ@ޒ ?` ې?A"` h   BB!@U @ !1B"A ""\1C"sh/etc/rcautobootcan't exec %s for %s: %mcan't fork for %s on %s: %mwait for %s on %s failed: %m; going to single user modeinit: %s on %s stopped, restarting %s on %s terminated abnormally, going to single user mode~rebootp@.71?'' 'ؠؐ @G  @C B `C!'C!'A"\ 2 C!'' @ !B P@*!C" PC&@; ' \C"(B`PC9? @  ?@Tg `1B)C#B%C?@ ?@? 0 "H`P G1BԐ   C"`P@ ?ڐ?Ԑ    A"`G#@2Ԑ?'@ɐ0Ԁ  C"B`PCՔ1Bԑ:  21BA""\C"CbA@(0(1E""session database close: %ssession database open: %s㿘# "  @  \@t"0D!    @ ̀ "c   \@tu"0D! insert %d: %s㿈'D ' 'D?#   D \@tT"0D"w delete %d: %s㿐 ' '#    \@t9"0D#\ 㿀'DD' '#     @/ `/ `/ `/ 㿘@e 2  @ڑ* D@c$    #D @c. $  㿘@   " @@   @@ @ΐ%s%s/dev/㿘 & ,  (@˘ , @0 , & &@@ˍ & E`E@tY@&    & ("#& $$ (& $%s %scan't parse getty for port %scan't parse window for port %s㿘  @x@v @`@@@N & Ea`@t@f   & E! @] &  ` "   @P@XX`L&   & E!q @C &   㿘#    " ( (M "# 1B"@ `V20@,1G can't fork for window system on port %s: %msetsid failed (window) %mcan't exec window system '%s' for port %s: %m㿐@+? E#! 0 '@ @ 6 E# @'@ E#@ @ can't fork for getty on port %s: %m01getty repeating too quickly on port %s, sleepingcan't exec getty '%s' for port %s: %m㿈@h?  `?  @Ð?x?@+`F  l? "h@@̦  @[?@O 1   & O") @  @E!? \"0   2 F`@a @̯@ F`@Y @̧@̥@Q   $ 4  F c @Q   "'@@Q ' @)  @'6@ F!0@; @P 㿘# 61  @#D Ӑ$   $`" ("`( ("c (` $"`$0L?2$ AG!"b`@g $  A  GA A A `H8 `G ` `㿘A.""` ^ # G#A!  2 ( ?2&  $b`@gC & N ( 2 A"` A1A? @T ?""`w"` ?A"`port %s changed utmp index from %d to %d㿘#    ?&  ( 2  @@#   @’   ( 2  (  & G! v& "    ?&  E!b   &  @i 0’g0@@# "1G 2 ( &  @T  ( 2 1G  G  (2 G ̈́   shutdownsome processes would not die; ps axl advised㿘#` C`  "` `(`2` C"GcA@$p( G## \1B%͓, ?@@?2$b0 """$@ ? @ ?" b0 ?b0 " "  ݓ, H֐ 1B"㿘@ (    *`2 ,-o %s: option not supported㿘@U @&X H@sa5L n L  o  @y = 2*@p "   "H @2    &*@& a@^Ƞ @?updateasyncunionrdonlysuidexecdevatimeaccesstimeautorwrogroupquotauserquotamfsinsane maxpartitions value %dNT:a:b:c:d:e:f:i:m:o:s:NOS:T:a:b:c:d:e:f:i:k:l:m:n:o:p:r:s:t:u:x:z:%s: bad sector size%s: bad maximum contiguous blocks %s: bad block size%s: bad cylinders/group%s: bad rotational delay %s: bad blocks per file in a cylinder group %s: bad fragment size%s: bad bytes per inode %s: bad track skew%s: bad interleave%s: bad free space %% %s: bad rotational layout count spacetime%s: unknown optimization preference: use `space' or `time'.%s: bad spare sectors per track%s: bad revolutions/minute %s: bad file system size%s: bad total tracksffs%s: bad sectors/track%s: bad spare sectors per cylindernewfs_%s%s/newfs_%s/sbin/usr/sbin%s not foundswap%sr%s/dev/%s%s%s: %s%s: getmntinfo: %s%s is mounted on %s%s: unknown disk type%s: %s: not a character-special device %s: can't figure out file system partition%s: `%c' partition is unavailable%s: `%c' partition overlaps boot program%s: maximum file system size on the `%c' partition is %d%s: no default #tracks%s: no default #sectors/track%s: no default sector sizeWarning: changing optimization to space because minfree is less than %d%% %s (%d) %s (%lu) Warning: calculated sectors per cylinderdisagrees with disk labelmfs:%d@Ĩ  ( H@'c  O"!x"a`@" H#@!` H#H#J! ! \@?/? ;'*  . . . . . . . . . . . . . . . * * . . . + +( . . . . . . . . . . . . +8 +\ + + + , . . ,( . ,L ,p , , , -t . - - . .0 . . .T . - O"!x O"!|@n"t O "alHՐ# O"t"a@n"tB "`hIȐ @n"tB/"`XI 0@n"tB "`\I H@"t Oa "a@n"tB "`lI `@n"t O "aI @n"tB "`TI @n"t "aI @n"tB "`PI @n"t O "aIz!@n"tB`" ``cw`Im!@nr"tB m"`pId!0!`  "tAcB4|_`I@aX "tBU" dI@ a` IBL" d@!hI`@nG"tB B"`HI9!@n>"t 9"b0I0!@n5"t O 0"aI'!@n,"t O "atI"@x"t"tI@֒b 2 `@n"t O "aI "(@n"tB  "`LI"@@["t`@Y`ϐQ#&* ` @  !`  @D!` 2@ @ǒ *I@b $$Ih@%$#IbxI@@".$bxI@@"$ Ib@"!` 'I@hb !?` @y!"' @' ''$''.7 77'' / 7@#  / O! N!hIb#Ib@m!h@?  N!hIbȔb@m~ N!h O!x N?@ 6  \@l"0I"@@D    \@l"0I"@ I"@ߔ  " &5I? r-I @ϔ ,@ @  @|L!'!` ! O! "@!| I#@e!v @D 6  \@lm"0I"@U@ 6  \@l_"0I"@G<   !` 2 @(I# `@md@@uw ?"IJ?`` `@M@ac  I#H@@!`   Oa `"a@’M@ac   M@* : 2 I#x@@M@  OI#@@M@ Oa  O"a O!  !`  I#@@M@ b0 2  O H "b0."b0 Oat 2  O 0 "atJ @@ Oa 2  O , "aJ (@@ Oal 2 B ( "alJ H@@B`P?2 O L "`P"`P Oa 2 B J "a "aB`T  `T "`T (c$ "!B X  X @;  $ XB T* @ "B h h 2   B@@`X? $ $ a BB T* "aB ` B#B`d !a!`J@`h!`J`@  $`dB`H?2 O @ "`H"`H O OB!`H "pB`L?! O B "`L"`L! O O O!@atB`L" $! 8  a!`J`JJ@^! Oa 2B X2 "a'P'T'X '\ O! O!la "!h@""$!l! O!@$!! O!p@ $!p! O!@$!! O!@$!@V%$ O!lb `&a<`  O""al! O@!$!! O@!p$!p! O@!$!! O@}!$!@y$@ O!hab@͐"@j $`&a@:` $ O!x   OP@  @w O!x @@!` .@۠J@k0a('p?'xB |  't't O!' O O!@)al'BH#`|@p   \@jo"0I"@W`@ ioctl (GDINFO)㿘e`e@ĉ 613 Oa b8 "b8@ I#@4a0 N@G"B @,1Ͱ#ioctl (WDINFO)%s: can't rewrite disk label㿘 "8 6y6 e`g@O N@G|#HN#X@㿘'H'L'P'T'XH @N   (  @I   @H@IJ@^Œ@z usage: %s [ -fsoptions ] special-device mount-point usage: %s [ -fsoptions ] special-device%s [device-type]where fsoptions are: -N do not create file system, just print out parameters -O create a 4.3BSD format filesystem -S sector size -T disktype -a maximum contiguous blocks -b block size -c cylinders/group -d rotational delay between contiguous blocks -e maximum blocks per file in a cylinder group -f frag size -i number of bytes per inode -k sector 0 skew, per track -l hardware sector interleave -m minimum free space %% -n number of distinguished rotational positions -o optimization preference (`space' or `time') -p spare sectors per track -r revolutions/minute -s file system size (sectors) -t file system type -u sectors/track -x spare sectors per cylinder -z tracks/cylinder 㿘!`  (a!`O`X@B !aa!`O`O@8!a!`O@3`А!`O@/`!`O@+a(!`O@'aP!`O@#ah!`O@ax!`O@a!`O@a!`O@a!`O@a!`O@ b(!`O@b8!`O@bX!`O@bx!`O@b!`O@b!`O@b!`O@c(!`O@cH!`O@c`!`O@c!`O@ߒc!`O@ےc!`O@גc@ mfspreposterous size %d preposterous ntrak %d preposterous nsect %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size (%d) cannot be smaller than fragment size (%d) fragment size %d is too small, minimum with block size %d is %d There is no block size that can support this disk With a block size of %d %s %d minimum bytes per inode isMinimum bytes per inode is %d With %d bytes per inode, minimum cylinders per group is %d With %d sectors per cylinder, %s to be changed from %d to %d This requires the block size %s to be changed from %d to %d and the fragment size%s groups must have a multiple of %d cylinders CylinderWarning: cylinderpanic (fs_cpg * fs_spc) % NSPF != 0cylinder groups must have at least %d cylinders Warning: Block size and bytes per inode restrictBlock size restrictsBytes per inode restrict cylinders per group to %d. file systems must have at least one cylinder %s %s %d %s %d.%sWarning: insufficient space in super block for rotational layout tables with nsectand ntrak File system performance may be impaired. inode blocks/cyl group (%d) >= data blocks (%d) number of cylinders per cylinder group (%d) %s. must be increasedFilesystem must have at least %d sectors Warning: inode blocks/cyl group (%d) >= data blocks (%d) in last cylinder group. This implies %d sector(s) cannot be allocated. Warning: %d sector(s) in last cylinder unallocated %s: %d sectors in %d %s of %d tracks, %d sectors cylinders %.1fMB in %d cyl groups (%d c/g, %.2fMB/g, %d i/g) super-block backups (for fsck -b #) at: %d, %s/''|'t@\9!` @ @'l _@}a@2P@MB!@ @ @ ? @ : @  @  # O! Oa@/!l Oa ?@@!l$a O O!@!al@  O "a@  ""@ ""< O!|  !?"%,"%(! "%, <"%( O!`4!P@gl!@А  O?al! @ [!! O!$  O!t`$ P@gX!@  "X`4 P@gN"@ aB X"`0B T"`4 " P"(@g= @ ! " P@g3"X@  O!al 6 P"@g' @ !o4 P"@g@ !!` 6 P"@g @u 08 "H48 "L ; :8 ::@  "P !`P <"`P !" T 4  !`T <"`T ! 0 T:@ " 8  " ` !`` <"`` !!耢 &P#(@@f×:@' ! !B p$%P 02 $ t2 $ x O 4@al$ | $ d !`d <"`d% BB t`x?4@?8@@%$@@?@{@$ $?|@p ?@l@ $?$  !`* <"` "T"T " x* "x 0* * ?: :0 :  ! t:   @ %0@ C<%0 ! O!"|`*@"X  2 : "X <  !cX: "cX <"cX !! O}T@al6`} @[@|ؑ* @ ?@@4# a? h P@: a @ l 8@ ?  @ې?@@Ւ@r$ $ B h   $%$  !/  !?#`* @ZeP*  ``,`: `@N`@`|`,`:  * @>|L0@* `,`: ? ; * %<cX* $cX.?@@z@$``8*`$`8`` `$`` !!2 `8P@eq#pP@en#@Ґ : $`8``?$```4* $`4`|* $`|  O@al@" @Ea?# a`x@=@ڒ$` ! !0,@1 ?x@,@ɒxv 8 ro!P#P@"@#c@e0: &08: &8`?&`>?@@&* @P*  `,`: @@|`,`:  ! * @~|L0@ۓ* `,`: 80   0* &0"d@c" @a? dĦ@@T d}  (! ! 0* @ ? x@@@ @:"@P# ``  Q @daQ (@d` Q  P@db\Q (@d  ` B!`X Q pQ@dy` B!`T Q Q@dn`@Ґ B \"bd@Z   O! Q! Q!0Q @dX! ! ?@D@$  O! # B" \# a@`" @0a?`x@+@Ȓ$`'  "h !) x* @ ?@@h@  "$@"@ !?@@$h!/  !* @P*  `,`: @@|`,`: $ *  @| | L 0@ٓ* `,`: 8 ! !  "@$@c" @a?x@@X$! @R @ |$  | `@* " Q@c!H@ "d6 Q!p@c@  B"d`\- O! `Q@c! `` `@  Q !`Q!Q!@c Q"@c{bd O!  @ڐ  !ഡ* @P*  ฐ`,`: @! ! @ @Q |`,`: @ !e$ * `@``|``@>* `,`:   !@ BL ;   $ Od: "$$@|@$@`$ 't "` 4 Q@c"8@~ ! O!"B P" O!p" "LD%hL "h ! "X##@~* ~@{\{,{@* #  h~  #\$`%` $` !%`"%T`"%X4   X* * X@  XQ"#\Q"hQbQXQ"@b?$"DL "h X+-  ! ! ? @6 - 5 L?,` @0P* T 2`@&L  !&  @a褒t ! !  #@|@mନ@iଢ@f@@`@@Z@P@V`<L?,`-  @@P* T R? L?X@*@?X@L?,`-  @@P* T  ".L?,`-  @@P* T 2 !褤 ! @ $ , @ `$ ,! ! x ` @:   $  ,? 8 4  !@``,@|`` $`& @`8$@`8Q#@aՒQ#P`Q@aϔ@3 !!ܦ?! O@X !" It??,@L?? >#  8*`  @? PQ@a#@  a@5``,@1`` @`8@`8Q#@a@!`|R@a `,?$`,`@w`$$`% O@`@o`|$$`$'tt!` 2 # b\ OT!@Р?@b\$b\R `@a_"@ a`"``,* eD `L "``02  "`l "`p !`p <"`p!  bL @bL$"4dF!T$dB l$B `$B h$ O!$ "0@ <$B d$$b8$`$$`($`,$`0,`4,`6 ,`5@$$!` - $@ #\R | R @a  $ 4 ($B F ("F #`#\'R ? ,@` !` R@`!@   !܀6/Ϊ !@` 2% #R@]``-@X```daH@`D, R@`!P R!X@`a@!  !܀Ԑ!` 2 OR@`!P O!x !` @ @|! !$  O@}alB`x@}  " -  "H !+ )  !< H@̗*@ " 0@4b4 @_ !l&  !܀  !%B@``-@```d,x@@ `, (  !!  `( `0!` l@> @@b @` @^ R@!`Panic: cylinder group too big 㿘! !@   $4 !@``.@`` %` %`?`4@  . "4@ P! !h @9P!h$ @"U$ $ ? `@`4 !h bf2  !h "h4 &$ l  @$ p# ah $`T "d"d*  $`X@M* $`\`\: @ $`` ""Ԁ   !h``;@6;);X!h`` "d"d@-?@?Ȓ`,`:  ?$`h hh` "h ""Ԑ *  "l `l;@;;X;<* @l`,`:  $`d aa̐?"@ "P@ Z@_d @Ȑ %h  bh ("   !h@"U  < ``:`@ \@@  `` ?$@+ @* ?``"  9  "h !/ O O!"h@: @& 02  3 @, @"`l a2  @.@d,0@8֢@   9  ! !h@"U@! `!@@ "Ԁ   : l l   ?$ *@  * $@W`|@`*  @T!@@ "@@E`|@`@`@=`@`@7`@@`@1eP@`*  @`*  b<@ @`|@~`@eP* X @@ 2@! a`("`( ! !|!|" ( $ (@^ 83  8"@*`@  "@  8$6( !h@"U !@   :`@ `@@    ?%+ @*$  "$ !& &-  ! !h@"U "<@ `!@@” "Ԁ   : l l   ?$ *@  * $@`|@`*  @T!@@ "@@y`|@`@`@q`@`@k`@@`@eeP@`* @`* @ @U`|@`@QeP* X @@ 2@  &@& 0 " a*  "  !h@"U !@ &:`@ `@@  ?$+@ @*$  "$ "Ԁ 7 !h h@ l@ @   p@    ` ` Ԁ@4*`@  #@  ` *  `؀@耋 `  "Ԁ@4*`@  #@ ! ! a a $    $   $   $ '@'`'` '` @  .@ @ @ d,@ 0@㿘 a" " " !` #!2a ! 4  O!|  B#@0 :  < B!@(  : :%  a@_a$ ( e @ C ` :` @ + 3`  3 $ h`0* @ʔh@ 㿘Τ!h @",`,   4 @ `@$,`@*` 2` ` @"cg 0: bad magic number first cylinder group ran out of space internal error: can't find block in cyl 0 㿘 a` `d*` @3h !l@"U@]/" !  ]'"  !|!] ! !h@"U) % ' `!@``@K@  |&`]"H@\H 0 "> !h@"U@ ` !@ !@ "Ԁ  !h  : l !h l    ?$ *@ * +  !h?" !Đ?" "4`?"`@ !  " "@ "@!@ |@ *  !h@"U@  T@!@?"@ !@p`|@`@`@h`@`@b`@@`@\eP@`*  !h @"U@ @`*  Ԓ  # ah! !@C |@ @?%P* `X @@?2@ !!E @  b4 "@ @ "  "  $  h$ "$4* `"  (  !h@"U !@  ,` :`@  `@@  ` ` ?"@( @*a耢撆  a` `d*` @Jhfsinit: inode value out of range (%d). ?c@~& l a` `d*` @h !l@"U@" ]@[-"@ !h ?" @"U@6` \@  <` *@  *! !  d*@  @h Ȑ?$  "4`?"` @ ,@ ! ^#`@Z@] !@> @  ,@} @ @@0 @. x `* @ d,@'? 0@@ x* @  0@㿘@+ getrlimitsetrlimit㿈#aX 2&@I @n?$aX * @A" @˒耢 6_@@0!? @D耢  O_@@%! O""a!X. O!8 Oa" "a@ 㿘   @@㿘@ @seek error: %ld rdfsread error: %ld 㿘!`   O@al O! @0+>  Ol @s;   "@  @ 6  _#0@Z(_@?#H@ !"@@ _#P@Z_@?#H@z "wtfswrite error: %ld 㿘!`   O@al Oa@@F0/ O!x +>  Ol @,;   "<  @ 6  _#0@Y`@?m X@B #"<@ ` `@YҒ`@?^ X@3 $isblock bad fs_frag %d 㿘 8 "  $a  a@ !`?*  *@>*  *@>@  `? * >@  `?!``ax@ 8 clrblock bad fs_frag %d 㿘 8 >  >a a.@>*` *`  * @ *@.@ !``bh@ 8setblock bad fs_frag %d 㿘 8 >  >a a .@>*  *   *@@  .@ !``c(@O 8COLUMNS㿐  `h@7?2  `@y#  @X" P㿘@O x p h ` P H @ 8 0 ( unionrdonlysuidexecdevatimeaccesstimeautorwrogroupquotauserquotao:kernfs㿐@%a'# \!a@? ? obt @A@)Q#&*  @@a!`@坖  @ @ @ usage: mount_kernfs [-o options] /kern mount_point 㿘a!`a@bp@ݐ ,-o %s: option not supported㿘@*  P $ D @VA  @E "2 4b\ "    @V. @3%Xb\   @ < Đ@ۿ &   b\ 2  4  @ <  4     0  0 @  @  "L  @ @y'  b\ b0 b"@3@ %X"0  b@ b %s: is a directory8`m 3 8!+ / \-b)  %<@ bH Mb\ 7  !b@U "@3J%"X   b\ "T b\c @29%"X  8 @  ", 8 @   @u "L @@x "b\ 0 "@2Ē%"X` ?c8`2 `@+  `<   @ ?#@ @`0   @ ?  ?c @$<@ d `@- |   @ߖ t `r ?#@ @k`0   @ ?  ?c @P<@ d `@ B   @ : `8 ?#@ @1`0   @ ?  ?c @<@ d `@  @    ""Xb"@1remove %s? override %s%s%s/%s for %s? 㿀 "P  a!`da@/a "` "\ < ( T@X  "P @ @ʶ @ O b 0d" #\a!`db@a@O!`a `? "`@lА a "  ` a5a `y ? & @l`& @` `y `Y "." and ".." may not be removed㿘 ; # @  ? /2 *@@8J@@  /`J@ .2 J`  .2 J` 2    d@12# $bX   &  usage: rm [-dfiPRrW] file ... 㿘a!`e@a@> 㿘@EweofretensionstatusrewofflrewindofflinefsrfsferaseeomeofdensitybsrbsfblocksizeejectTAPE/dev/rst0f:t:%s: unknown command%s%s: illegal count%s: %sioctl MTIOCGETP@v@@  / "bp @"bp "pe@ha eD "`d  @ϐ!%ee"%e! \@b? f t"t@Q#&* @D d   @`  `0? `@`@@\N : !D$ `@\G :,@`@ ` D@ D d C#@'@U`C#`%e  @@ "   @?D `  b@n @ 6  \"0  D ` e@0-"0@K  4D 7@ @W ' J  D eb8@ܺ@ 'D `  W@u   $D a@͔ 6D ebP@` ` @?,a@  e@ObX@7D ` @@ 76543210SCSI%d: unknown tape drive type %s tape drive, residual=%d ds erblocksize: %d (%d, %d, %d, %d) density: %d (%d, %d, %d, %d) 㿘D hT $fTV@f " @SVV f"V @1 f"V @, a?  " "  *"p@S " >*@7ϒ usage: %s [-f] device usage: %s [-f device] command [ count ] 㿘D d g a!`bH a!`gb`@p@א 㿘! @@  $"l@PȒ  ""l g@cx@, "h86 Lost connection to remote host.㿘 g@3cXshelltcpshell/tcp: unknown servicewho are you?/etc/rmt㿐!D # g#g@tc $  g@ c@[@D "` g@c# bl@Z# @ bl,@Q  @h  ""lD D D  "l` g#@k  ?"bh@O $'($'% #?!hc @^  <$'! "h?c@^ $'"h  @] invalid user name: %s㿘 ah*:  㬐  2  _- @-ِ!  N  O%s %d 㾘!hP@sۘD "`@HcloseC 㿘!D h"h@8b$ statusS 㿘D h "h@&b  "x@y . 7 1 "xI%d %d ioctl㾘@!h@sPh#X@?㿘! @r"h@@k@%s: %sProtocol to remote tape server botched (code "%s"). x@R ؐ? ؐ@I$i @-@O؀ F?D" O؀ Aؠ@1?N ".i @-&@Pfٰ㿐 "h@۔  OOProtocol to remote tape server botched. (rmtgets got "%s"). 㿘`,* :  , ` ,i@,!Hi!x@,a㿘@m:pinvalid file mode: %s%s㿘@{  i@[b(@ 8 ! 'i# \)i@{0? m p @Ûbt "8 @\bt@*!@Q#* @@ @@ - , -`@@N ? / *@@@8J@ 4 @@ 4` 6`  @@Z4  6`i"P@,y@ `@ @/%s: %s8j @Ē@L`?,@z  \"0 2 i`2.`.2 @# i"P@,C?<    /!j@N֐  @,'? /`, usage: mkdir [-p] [-m mode] dirname ... 㿘a!`j@a@7 㿘@\$OpenBSD: compile.c,v 1.3 1997/04/28 20:23:19 millert Exp $㿘! @!d"!d@A @!  !P*` @ * $!T!  !X @ * $!lunexpected EOF (pending }'s)0123456789/\$command expectedinvalid command code %ccommand %c expects up to %d address(es), found %dunexpected }extra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandfilename expectedw command%s: %s read commandbranchlabelempty labelsubstitute pattern can not be delimited by newline or backslashunterminated substitute patternextra text at the end of a transform command㿘 )a "@=( `j @ -b00    #*`:     L  `*`  L #"  @  &*  *@$ j"P@VL "`$ @  $@"L  2L#*`:   " L L  `*`L ,2<$ "  #*`:   "  L  `"*`@ l $@L `#L  "L L  `  $L 2  j@ b` ,D!DJ!D  L@L  ` L@  L@ 2` jbx@ tL`  jbL@ k`` 0 k#ȓ*`@ @ d 8   ؠ "  #*`:   "  L  `*`2` `*` * $ "$  2$#*`:   " $ L  `*`$L    `$ j@ bȐ@" "L  2L#*`:   " L L  `*`L ;"l L   jb@L "L  2L#*`:   " L L  `*`L \ jc@L "L  2L#*`:   " L L  `*`L  jc0@L@AZ$ "L  2L#*`:   " L L  `*`L  j@pchj@c$  !L ?,$& @w!?%$ \@L"0 jc@T "L  2L#*`:   " L L  `*`L  j@0ch j$c "L  2L#*`:   " L L  `*`L $ jc@C$   #*`:     L  `"*`j@$c$ @  j@ߒc@  L  \ j@Вc@ $@L`? k@’`?@@"L  2L#*`:   " L L  `*`L ;h $  @"L  2L#*`:   " L L  `*`L ;2L O ?  k@r`(9 \ can not be used as a string delimiternewline can not be used as a string delimiterunbalanced brackets ([])㿘'D  j'D \  m cDa D mc@8DJ S, : J@ [DD@NDDm @#c>DJ@ \2DJ` [&`DJ@ \2 DJ`2D`#'DJ@ \2 DJ` n D .@`D 'DJ@ \ DJ` \D`'D @.@`J".@D 'D .@`DJ@  [  *@`J^*@`J]*@` ; ]6*@J[%\J.:=\` *@`J]*@ "J!` ]*@ 2J 2Jn*@`J J]2 "` RE error: %s㷐, @ &@@&  &@@   @A@ n@^c@ @X @*"X123456789\%c not defined in the REunescaped newline inside substitute patternunterminated substitute in regular expression㿘   m ,@`$@@ e&`&` !\&` @Ґ  \, : @ <`\2&N n#@RN "N,@`N`    o@``&&` & \2,@ `" N 2o @ݒ`(,@` N $@$( ,@ "@͒( @ o@`Xmore than one number or 'g' in substitute flagsno wfile specifiedbad flag in substitute command: '%c'㷐'D &@&`&`?&`  #aD J `Dc J@   D`'DJ` ` DJ g"  p 9 ; 1 s "|DqD"xDmD wDgDo @WbX d&@ a&`o @LbX DD@M U&@` 'DJ` `DcDJ@   `'DJ` `DDJ J@  `'D @*DJ@ * o@b@-&` !L D& @t!? &`  \@H"0 jc@ D ob@JD Z'Dtransform pattern can not be delimited by newline or backslashunterminated transform source stringunterminated transform target stringtransform strings are not the same lengthN  \ p@a_2? p4ac?S  p)b?  ?a#*`:    ? N `"*`?#@@@ pb0@r 0@'  +  (+?#@O   +J &@㷐 @ 'a@P( 8@ O `& J  " J `  `\" *J  " J \2 *$(̐, @ʐƢ@Ԓ unterminated regular expressionexpected context address㿐N 9 \ 06  $ /   j`2&@ q@a &@ &@ &@@Ŕ &`q@ϒa@ whitespace after %s㿘L@  a#N     N  `. q@b & @_@undefined label '%s'㿘Hq#$! #q ?* :  :*  ǐ Ǡ ǐ Ǡ !P $!P & @N &  b@\ @  2 duplicate label '%s'㿘    `,` `*` "@ @'r 2  @\7` 2 @&  2 @ؐ $$ $ $ $㿘 ` ,`  `,` ` "*`@ "   2  @\` 2$   2  unused label '%s'㿘  "'r,` "`   @ @y2 ``,`$OpenBSD: main.c,v 1.4 1997/01/15 23:43:12 millert Exp $ae:f:nusage: sed script [-an] [file ...] sed [-an] [-e script] ... [-f script_file] ... [file ...] stdout: %s㿘@xW /rr#H+  ) % \' @\p?M? /8Da*  < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < <  < < <   < < < < < < < 4%aL%!p   @t$har!`@|4bx@x Q#* @ !p  ` @`@ `I@  @@`@ 0@ @Z !d@ a@_ !   \@E"0 r@b@A r%s: %s"%s" ..."㿘D# `   0#   䀢   "!\     ! F !   s@Fa@  "`  \@E"0 saH@     "aHD "c    sP@h  s!X !X* `* `* `* `* `*   "aH    "`D "c@F a\ _"a\L@ #[L` nW U"!h `"` @^r D"#. a\ "a\D!\   J@ #  J` nD  "ah D    J  ".  @W # .a\ #a\. ༐ "a\ #a\ " .װ stdin㿐  A ' % a ) t 耢 =  $%!H%!Hs@Ea@  $!s!H \@D"0 !H@`? "`@]B ?" ? @] $@}` !`  ! & i  "a`e   `"a` @u  @ !H \"0 " @D~ saH@@} a\ "a\% ' a ) t `? "`@\ ?" ?% @]  $ $%!H%!Hs@Eka@ $!s!H \@D:"0 !H@{@` 㿘@) " " "D"@"㿘@ " D "@" " $OpenBSD: misc.c,v 1.2 1996/06/26 05:39:07 deraadt Exp $%s㿘@ϐ  \@C"0 u@=` 㿘  @  \@C"0 u@'` 㿘  "@u@ # $`@`sed: %lu: %s: 㿘'L'P'T'XL!a!`u@ya( 4 !a    !`ua0\@yH!a!`@zI!`u@y֒a@ @ $OpenBSD: process.c,v 1.2 1996/06/26 05:39:08 deraadt Exp $%s%s: %s %lu 㿀 "!\)  ! 1 9 5 -  !   $!d` +  3a7 @ "@ `?Ƒ* : `Cu"*`@ ( ( (  ( ( ( ( ( ( ؜ ( ( ( ( ( ( ( ( ټ ( @ ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( (  ی T ؐ ( ( D ( ( T ( d (  ڬ ` x ( ( ۔ < ( ی ( (!4!P  *`T'!P*`@  *`&T!4T*` * $ $$`  !8 "-@u"(&`  )$ % @/! ?$ " $@ l ! ` ! ` `! @ϖ @`! @Ȗ @u"(` @)! @ !h    @ӫa@! ’  2$@ @!  2@ !h   !  @Ӎa@   2@ @ӂa@ 2@ @<! ?$%!  @ja 2$@ !h    @Ya@\@Ӑ !4!P  *`'!P*`@TT*`&T!4T*` *  $` $ @` $ !4 t&!4@)< n&<< "k@&<` 2d@`?! ` & @m!? $` \@B"0 ub0V` `! @  G \@B"0 ub0F` >@`  ! `ub8 @ ! ''' ''`%! $$ $ $%`$$$ $ 2@L` @,  @ u"@a\@B@`a !h    a@ҵ@B %㿘 "!8  2   2  b @"+  2  a a   @  2 h     !\@"  \ !` X  *@$   "a8 2  a a   @  2 ?     !\@"  3 !` /  2   !\@  "!8  $   2   a a   @n @    !\` `?!`  @`?\%d not defined in the RE㿀   !  !@   @  "a\  wc9   @/!   "!$ !    k# W?! -  ! ` !l@ @"@Ζ  @A!l@!l @!l $ !l@  !l` !l     @ !l  $    @Ҙ `. ! (# al $  @ ?al# al  ! $ ! !  @s  ! @al !  $ @g  ! ! ''' ''   "! `"`"` " `"" "`"`"` "`"     a@8 `0 ! 2- ` ?2  & @k! ? "`   \@@"0 ub0\   a  a @     \ @@"0 ub0H  rstdout: %s?c  !4@@a' )a? T,`* @  T)`T,`*  @ٖ!`,`@*` y @@`8"` @] @!@X` !4@Ta! @  \"0 " @? y`@  "!<"a4COLUMNS\ \ \abfnrtv%03o㿐!D#$?2Ny@! " @@$#$`h@  D`D"#$D <"c$N m %a \y!D#$y@@{!Ƞ  2$y* : a#@J  `\ ?`"@  `"*@ @% 7 y!Д?`"@ \`"*@@%x @HUN "J?`"@  `"*@ @%]  y!@@!  N Da!?`"@ $ " $*@%> a? " " * @%. a! @  \"0 " @> y`@first RE may not be emptyRE error: %s㿘   !@   za "!@ J? "? !l  : : !@ !X   @l@       a@ zȒa(㿘  , q' :` & \  ?Na#@  ?`l \2  N \ &2    & Y & &  , 7 ,` ? l  ?"/l,` `?2l` ?"$l,`@` `$ "? @ @& * & &  l,`  @ @X & , `   &   & &  ,㿘 ` @d&  & &"&  @@) & *@%s: %s㿘?'{% \?N  w"!  { s" /"* + ?" @     @=0  " ?"& @ "&  @=0 & 2N 㿘@㿘@o!{ {@ob@z"?Q@#&*  @@@> @ @@ usage: sleep seconds 㿘a!`{@sb@ڐ 㿘@if%s: destination pathname too long0@oG'{% #  @zQ? f i$$a$a$@Q#&*  @@@  "a. ?@h  <   $@@@@d`@. @@<~@PL / /,@`?# ){@@ / @@: ##@4@  @ @@4 "? ?`@Noverwrite %s? override %s%s%s/%s for %s? cannot resolve %s: %scannot rename a mount pointrename %s to %scan't remove %s%s  ! q@@ k !   a!`|a@rȔ0` ! )@@ْ  $@hH 2  @u@̒ @ O |!8|!@#\a!`|a@r` `-a `? "`@T a " ` a%a  ? $ @Tϐ  $ 2 `y`Y2h @8  \` "0 !|@vܒ 2 |!H@mN @ɾ @Q]Ԁ  |@\!`= !@b7 @gƒ <   @  | @_% |! @g |!@; 0<  @(@%s: remove%s: set owner/group; not setting setuid/setgid%s: set owner/group%s: set mode%s: set times㿈  @gt 6|!&@gk! |!@@  @/  \"0 ?Ð@-*  ax # ! @@G"ax $!|@Ր n # ) +|a|@!x a|@d"a|!@@^ }!@@@G @ \""0, }!(@ 3 6 ! }!X@@ }!p@' '''@Ț耢 }!@z@f |! @^J } !@g /bin/cpmv-PRp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status/bin/rm-rf㿀'@'䀢 2!~ (~`0~8@ |!@. (@ @v ? ~ @~@"`(K  ~ P~@`(B : ~ p~7`(@ 2!~ ~`0~@\ |!@ @ @D ? ~ @~@`  ~ P~@` :    ~ p~`:@װ usage: mv [-fi] source target mv [-fi] source ... directory 㿘!a!`~@pbh!`~@pb@֐ 㿘@Ҕ㿘@  2" @  " 㿘@   @. &  @  &㿘 @ @2  '"@& J-`?    a*8 ((J J 2 "@ 㿐 ̒  @ & & %d㿘 @  @  @]7  && 㿘 2  `?J   Ɛ "   |&=<>+-*/%:()㿘 !   3 a "aL`&L   =!@B  "L  L <   > ! 0 0   3 "a  "asyntax error㿘 @ib㿘 ! !  !! @! %sh ! ROM`@ " @! c@@   @ Ȁ ̀ ؀   *@ @"@  2 #H@G ! non-numeric argumentdivision by zero㿘.(ؐ Ӑ   @Œ`2` @d`&    @·` @`& @z`& y ! ? 㿘    @‰` ` `" & L !  㿐Ԣ A ?< :?` x"*`@\,tD@4a  0^@6[  0X@&U  0R@$O  0L G`?A DB?` ;#*`@X l@ @q 4"  0 @q84` @q2  @q $  0  @q`? @q@  ! m k? h? e㿘[ ! # Q   b }a 㿘 ! # ΐ b^a %d %s 㿘@i` @acH "! ! "@@ 2"0"8@8{`@㿘@ ` X P H @ 8 0 (         x p!h`XP"H#@$8%0&)(-o-a!-ef-ot-nt-lt-le-gt-ge-ne-eq><!==-S-L-G-O-h-n-z-t-s-k-g-u-p-b-c-d-f-e-x-w-r[]missing ]unknown operand㿘@h@@Kah 2??. @@Kap .  @ax&@?`V*`"@ 0 8 L  _ `JZ`?`J@ !A! J` >``JL@ `J@ !J` /! @4` ! (! R  %` @"a2`?`J@ !! J` `@`  ! ! R   ` `@"a@ ! `$!@`@(`?!@  `$!` @a%s: %s%s㿘 J  @c c@ 㿘@"! !`$!@` $  !`$!@` 2  ` a?"a㿘@! !`$!@` #  !`$!@` @ a?"a㿘 "" @ !"!@`?argument expectedclosing paren expected㿘  % ah %2 ! !`$!@i`!`$!@a` &P na0K!3 R /  a"a  Yah    ! ' ! !@#`?!@T@T@!@"  ! "  R   @ !@@ 㿘! ! $!@  !!`$!``2 ah?* : `y#̓*`@\p(@Tt 4@JV]`?@JPW@ @JJR2 @JE 4L  0I@@A`?@ސ@ې8@ @Ր@Ґ60  0-@ː@Ȑ4&  0#@@$  0@@&  0@ݒ @@8`  @`y 2n a(@`b e `U"*`@Xdp|<<<<<      @88`?+ )'%#!0&($$""Ȁ  ̀  @6@`?  < `? @ 㿘 " "! "!T @Iq     "! '%s: out of range%s: bad number㿐! \$"0@8 "0  c@Ja#@ ` 㬒 `'J`   J  `@ ؠ @_  @_8 X@4  ؠ @_  @_8 X@&  ؠ @_t @_o8  8@< `?㿘@fE"㿘`E @ @@o @2@E &allocate bad sizecannot allocateallocated object too small㿘 2?@kbX6  @. %E a@  :(&@ @@ 2@@2@a2@@kp2@""@""" c" " &@ @kqb4"@.  @"@"@ 2#" 㿘`@kXbX2  ? "  ?@V* ` *$? $?@freeing with invalid areafreeing free object㿘 @@@2@k` 8:  * 2?@k`Ѕ+`@2&` &?& 2?"* ?@2#  #?#LPrestricted shell - can't cdPWDOLDPWDHOMEno home directory (HOME not set)-no OLDPWDdon't know current directorybad substitutiontoo many argumentsCDPATH%s: bad directory%s - %s%s 㿀 J! # !a@qd!? L"  P ?" "  !*  J! "k!@<"@8"  2 @0"(@aE 耥@2Z$R"0 2 @G[bX L$@KE 耥@C`<"` 8 !(J 2 0"p!(@ % '"("@8@5 (@0  bq`(@6@ @1(@@@@+`"@Jo $' "`'S$' '@"@% '(@s@@s@~䀢 (``"@Jh;  \@1"0"@J^1 @<  !(J@ @?J /  @s젒쀤  E@sĐ@)`@s 쀦`` "@Jƒ can't get current directory - %s㿘 J!% #@pYa? L"  P ?"@ "  !*  @I"/  !(J@   @s !( @5c  &  @r8   \@0"0@I֐" "@Ji Rnprsu,ne-p: %s-u: %s: %s㿀 J e.   ` L@ - L` ` @ `n2L@ e2L@ E2 L@ `L@  @L@   ؤ  h! a@oʔ?n? 6 * "!h!h!h!h!h!h!h!h!h!h!h!h!h!h!h!h!h!h"!h!h!h!h!h!h!h!h!h!h!h!h!h!h!h!h!h!h"!h!h!h!h!h!h!h!h"!h"!h""!h"  p  @K䦒  x@I5   !L@   @J|䦒  @I  !! ?*  @EbX   ? $? a?"a !*  ' "`' ' 'j?#@@i Q \2P+@L@ f/` f r a"D  b 0"*  \ "66 \"7+@2 \ c"2 , \ r t n"' # \ v"!  \     @А , *: @И  `+@ \+@`+@`L@ `   +@` 2 +@` +@"` "`@GN 6 #@ !p   @  ) \@| 6@"0@"0 2 @t @$ " @ pvpvV%s is a reserved word is an %salias for exported alias %s= is an exported traced undefined (autoload from %s) function is a%s shell builtin special is a tracked %salias for not found%s is *GOK*㿘   J w`? ""+ a@n? p"  v ? V" "   !*   2 ? 2Ԫ Ӏ`հ    ! "@ @z  ! !x@@l " @8   `"@H ?`!*`@+ *++X*(* +Xy@G"u" E# @G # @Gߒ@n~ ZW@G֐#0 @GА#8 @Gʐ#H 2 @GÐ#P `@G#`@G#x74@"E# &# @G#   "E# @G#"  @G# #@GEE@G{ 2/",㿘L#R#UZ#fi#lrtuxponly -t, -u and -x options may be used with -ffunction %s %T %s: not identifiertypeset -i -x -r -t -L%d -R%d -Z -l -u -U %s[%d] %s exportreadonly%s[%d]=㿐      PJ r r s e"    t"   `   ! `" "0)  a@l?l? 9] * 0/////////////////// ///(/////4////////////D///L///X////d//l//t/|/// @@@! b! @  d`@` !  +,, - '@i " '@iv "  !! `*  `J - + ` ሑ*J` `J@" ?#瀊@@E hX  !*  !"*P @ , , , !*  A  `" !,` "` ,` @4@6k   *#,`!  @  `@' 7`,` Ӏ``1 " 1 -)@``-@"`- "!  @ @EȒ  ,  @E#  "  " -)@ "0"`@" `\`Y@E "@E  @E $@E  @E~ @ @Ev  @ @En @@@Eg!@@E`!@@EY!@@ER!!  @EJ = "@ED 7  `"!0!8@E7!(!H @E/ `-"@E* `-E "E@@E!P ""@EE@kE@E   2f ],U drtUx6(6 -taunaliasalias: -r flag can only be used with -t and without arguments %s=%s alias not found 㿘 !x    / -"% # @ju?M? 98* 8X666666666666666666666766666666666666766666666666667676668 b   !*  "`?  @Dj"0  !@i @" @1@ ``/-E 2 @p@DI @j @DE@ ` "x/ - @3 =$@`⌐@c@}`!`@~d  "p@D @j E@D F "x@D ? @~u  `$ " `2$ `  ?$ Ȁ  at @5  @"@cS$   ?$ `$⌐`  2adt㿐 !x  - +) ! @i_b? d"" t ? a" "">  !*  ) @}h@}Ւ2    ?$ A! ?$  2@~1# @~3"  ?$ &a ?$no arguments㿐   @B p0 @92  `?  lpnz㿘   ) '!@h耢? n"  p ? l"  z"?   !*  2 @Jn "   @Jf 2   2bgjob control not enabled%%㿘@>ђa`? J! @BR")  aE@h耢 ?  !*   @H   0"@Hْ   J!@? %*d %*s %s%*d %*d %s㿐`+ E!@`  #\`#`+ E!#\#`@q; bad signal `%s'--ls:Usage: kill [ -s signame | -signum | -signame ] {pid|job}... kill -l [exit_status] %d %s%s%s: arguments must be jobs or process ids%s: %s㿈 ``, L@ -)% ` "*@  `*: ac  #@~2`#  @>c $ "   % #! @gӔcȀ? l"  s ? @~a! ְ  !   ,@    "(@pcE@Ah  ,@ $E!#!@ @d  ' *` `b 0@Aۤ,@  0 J! E  E!'!E, 8@A’ E@A z   ' '@zK   ' E!,   @쀢@4', @w @4   ,  ! $@hs A #!@@ 0; 3 1 % @F ")& @d%  @@@ʒ ?6  @  !@ 6 ! \@'"0 p@@ ,@`2L@㿘 !    J!   ! @f!$!missing options argumentmissing name argument%s: is not an identifierc_getopts: no argvarguments changed since last callOPTINDOPTARG%s is readonly㿐 aE@f耢 ?  !*  O!P` H!pL@  @C J |! "  , 2 @@na  ? "  ,   "  , &  `*` 2` !  !  *@? @ !@@ 0Q !$ @f: ?   +// /  ?/// ? !  $!@! @a$! ! @ !@ 0@! @a@$!@?  J!    @} @6 lm㿘   ) '!@e耢? l"  m ?"* "  !*     @@/ْ ="*@`@ 2   2KH6K@K0,8K( K-TK2KFJ<J@xJ<J JJ-TJ-TJ:J'J>J>JHbind+fg+bgwhence+unalias=typeset*=readonlypwdprintlet+kill+jobs+getopts+fc*=exportecho+command+cd+aliasH f`?%s: bad numbernothing to shift㿐 "  aE@e<耢 ?"*  !*  @5e  6 #h@>     *"  $  " $ @>ѐ#x Sugorwx%s %#3.3o bad numberaugo=+-rwxugoXsbad mask㿀 % #@d`h? ? S"  !*  2;@S * 2 @O ,8  p =  x . .  *  #@< "` @ . ``  ,. .? @?  @>  "*@    А?Г*:`  А ,N "ő, @ * 2 @8  53# #`*`@.:` `N g  g o a" `I N u"`@N``N `" IN @.a w   I<<*``@.S:` "A ?* :  5 * PPPPPPPPPPPPPPPPPPPPPPPPPPPhPPPxPPpP    I"N N  @u-:  -", = +"  N,`N",N ,   @-N "NN ^N 8 @= ,@>2  %s: not found%s: %s㿘 aE@c耢 ?A !*   : at @/  !@=^, !* @  "  "@   `*`   2`    @Z   \@$]"0!@=3 㿐  aE@ci耢 ? ! !*    @B  @Bߒ   6 " prsu,-p: %s-u: %s: %sREPLY%s%s is read onlyp       a@c&?2 r"  s ?) p    u  @>Ԩ #ݲ !L ֨  @>Ԩ #@<  !*  ?#&@=S  @gȤ@, ? `,@t #@= `  ' "`'F ' 'ئ  ' "`'8 ' ' ?# "쀤` x"w  ?$ `$ @@jB`" `(`$  `@y}` $ ؐ?$@\f,?$@\[``   J!  @tA `  @R  "@R ` ` ,`\`  `  `* ` 쀤2 ``   2 ,   2,쀤 ? *  " ,? " , ?*` *`,@ $  @g#@;ɰ 02J!    @ @  N@g`  ,"` "`@: 䀤 @=D 8`?㿘! !E@aϔ耢 ? " @P``!*` " @Y  trap -- %s bad signal %s㿘 aE@a耢 ? C !*  E! %1 " @;@b !@;  ( @x(    !@;@? `"L@ -2L` "   @x "@y4 2 㿘  aE@a\耢 ? ; !*  # @^ab耢 2  $bch@:J r "`@?* 2  ( ``2@ ! !Ѐ  @B  $!Ф @Y@YK%s: bad value%s: cannot %s%s: can only %s %d level(s)㿐  aE@a耢 ? !*   @^D N  '`  8@:B "``@ * 2  2 ``` 2` ```@`" 2 ` `H@:e  ?4` `X @:Y# J b  @X^ ^-set㿐 "   Ð" 2 @\H*   *`?`@ZM&  &: ?$` * $`&    J!   !fv㿘  # !a@`W# ? f"  v ?"7 "  !* `"))@/ " $#@9  @*> [@ @ @* 2  `ހShell: %8s user %8s system Kids: %8s user 㿈@@W@:T P@Q!@:N h@K@:H x@E@:C h %8s real %8s user %8s system x# % $$b@ @$T@ݐ@$"! "(@ha" b@ "(@ha" @  "(@ha "(E@h`㿘1 !.? s.? . ?.?@a  0.@qߒ   ` 㿘 " !  " . R@  @z $  " . R@ " @#Ԑ  " ""   dQdKPdedx\tdhc dX\tdPYLdHbtd@[d8KPd([d ^$dKd`dYdRcScecKPcx cLc_$*=unset+umaskulimit+truetest+read+=wait*=trap=times*=shift*=set*=return+false*=exit*=exec*=eval*=continue=builtin*=break[*=:*=.-a-b-c-d -e-f-G-g-h -H -k-L -n-O-o-p -r-s-S -t-u-w-x-z===!=<>-eq-ne-gt-ge-lt -le!-ef"-nt#-ot$[]missing ]x' '!D'!'!'   `,` 2`@4Ēa؀  ,`@4a @8A!` ^  'ܑ,``T'ࢄ O ؟€  `%`  €  @ ؀ 2-  ܐ?'܀`    @  `?`?؟€  "   '@ذ㿘` !`N "" N@ *`: N`2`@4; 2 ` 2``?怢 (``N@ 2N` internal error: unknown opȀ  `#!4*`@iiijxjjk,kkkXki jm,ll4mjDl`lkjPj\mdmmmn n n n n n oooPN@ N`?N !`? 2@XI '4'4 !4J@ '4`?   @qf`?@e``?@J/Z`? @X S< D  @M H< 9 @B =< . @7 2< # @, '<  @J <  ( @ < 0 @   (@  @  $@  @  "@  @ Ȁ 4  ̀ ڰ  @ZD4  &'4 4@n'44 @’ @ӳ  @ @T@ `? @Z! @2`? @Z `?@2@ @22 @2ߒ 4  00@,ؔ  ,@,Ҕ   o&`-"p*`@nnnnnn0,\`?0,V@ 0,@6Q  0N0,0,@$G  0D0!, @I ;@I 8 6X@42  0/ @H )@H8 $X@&   0 @H @H8 8@<  `?   㿘@HΒ㿘@!Tunexpected operator/operand㿘@  2  €  2   @  `?㿘@2  2 €   2   㿘@"  2 €     @ 㿘   €  `?@%missing closing parenmissing argumentexpression expectedmissing second argumentmissing expression operator㿘 2j  €   2\  €  2U  M( €  2  ?:@-  2   *X€  2  ?p  2     @? tttttx)(!-a-o㿘  @ ``?  `2   ``.`@1 `?   $ 1   ` @" 㿘ژ%s: %s%s㿘.` @  @  `&@4i!0!@4d wtwfwxcwhdwXsw@lw0mwnwpprocessesnofiles(descriptors)memory(kbytes)lockedmem(kbytes)stack(kbytes)data(kbytes)coredump(blocks)file(blocks)time(cpu-seconds)ulimit: %ctoo many argumentsunlimited%-20s unlimited %ld bad limit: %s㿀     Ja a H*a S*@` a*@""  ` *@ `*@ f- % @Y? S"  a ?" H" " "" " L" 2L    c@3̔ !* @ "`  @3{# @/c !#? `@)  @k8: `7"" r+#  c@t耍  2c@32 2@3ؐ#: @L  @3ʒ 2C  #@t耤 2?耍 2? @耢  \@9"0@3 %  2 #2 2@3# : @Lz  @3 㿘 ?"`"`"` "`" "`F `@qF ! Eac "c  @"a@ ?*a   COLUMNSLINES㿐 a 4 "a "a-F!8`h@s %`E` !  "    @|a "@z      @|R @z㿘 ! @v  !J! J` @b  J! @-?@\ 㿐! \1  @Z| "0 `!4  @G @o @C  `?㿘 @^ "(㿘 "(` 2 @`0 b(`?"``"`*㿘  "(   ?*` : @`v N$  `$ *@ N P !Z ! O"! !!' ' ' ' ' ' "X"X'`'`'` '`'`'`'`'` '`$'`('#!$ $ $ $ $  'Ȕ w' !/// /F!8@v@ @<3   @ F!8 bX@v/    K@K` 2 ` ++ 8(8 2 J     2J2J4   2 `? J `2"@ 㿘@Θ / 2  " , @*`@z@  @@R 0  , "F J#     " J# * `J `? 񀠠"(   J "  &J  ?  # #J *  *  #*" 㿈n @h  @@;  .@@@2 .P`$  @@ J? /" `@    b* 䄒`''.    '%  $< , ɔ', ''`'.@@"@  $< b, 䭔', ''`'"@Q O @% "ʒ`fileglob: substitute error(r @5! " " @E7`"" $"@> ! $"@0a[  "" "  `'' ' "@$  $<  b, O', ''`'"@"@  =   .  2   @, @B J  @:  "N` "&&㿘 @`@,b  `"@FPATH㿈 @! @0 "$`" ㎒`'' ' @>ܐ @9x @4 "  " @*  , 2 @Kt@uؐ @w E 耢@="@>   & "ܒ` N  .  b* =` @',`, ,`&@  $  ,`@q ,`,`*  ,`* `@"  @(]̢ @  ,`,`@*` `@$ "㎒`-@T  ? % ?,`@@+` ,`.@&@ @n``@,`.,`@&@ . @' $<  b, ', ''`'"@"@   &;|&()㿘&'{  `& 'q  J?ac  J?  a#J?  " Lac    L   a#  L  "  * a#L   `g  0y7#-1= ?2*?* /.&.&_606162636465666768695U5u4L4l3C3c[%A"BCD㿐  "" "b ""   """b" .  ""@ ""L "" "" 1 "ؐ "bD  *bP# E! $b,! "B "b0 ""@ " "b$  b,"@"4 ""( @A  "H` " "  """@:  *@t"@ ?"bH%  P3  z@ I   "T*    * @*`@`  bP 6" ""8 ""<* $ *@ *`@@  `  00Ɠ* @*`@` ".bP0  "b "@gq g @HՐ 㿐 2/@ R 0 /1 @B"8??&"8 㿘 "  @ = 0>   "X**` @@ "J ""⸁ 㿘# b@  b ! "" @ @m"@m"@$"b@$b @  ?㿘 " "(@lِ  #?@ ""@ # 1 b" @`?"$@ "( " b 1 ?@tL"8?  "b$ 㿘  "b  @А 0b8 4"b8 ! ""8@)"@"8@  㿘  "b @ 0 b8 4"b8 "8@  㿘 i L "   ( "LbL""bL ` @ ""@"" "??  N@@3`??@! " ""   @l ""$@."  "0 b,"@ @4? @a ???  @W ??  "b$ @ ""@ "@ ! @N@"@㿘@  㿘@ 㿘@R  b@ 㿘@I { 㿘 " "  @ 07 "8??0#"8 " a# $ "8J@  `_2J"8 " J@  2`_`$"8  "8??#"8@E 㿘 " " @Ր 05 "8??0#"8 "a# $ "8J@  `_2J"8 "J@  2`_`$"8  "8??#"8㿘 "  "4@   @R""0" ! "?$"@J?" ?0 " " $"@UJ" 㿘@??@i ??㿘   *` @ : N       㿘 @ "(  " % # ( *` @: N b  ( 㿘  @W"0  2@ ^  ? @@㿘  "b  @ 0 b8 4"b8  "b8^" 㿘  "b @ 0 b8 4"b8  "b8G 㿘 " "@*! "8?? $"8' % ` @,   "8 @""8@ 0??$"8 㿘 @" 8??"8   @b 2J@ 0   8??"8 㿘@ @ S  b"b * 㿘 @5" 㿘 @/"؁ 㿘  "8* bD@%"@ 㿘  "8* bD@  㿘 "<   "  "8*`ؒ@ " * "@@ 㿘 "  "؀ @4 0 ""D! " " @  " "b% # @i"  $b$ @""@@{ 0@㿘  "  "D"@:`"  #"H|㿘  "b   "< {01 I-search: 㾐?/% @#@@F  bT< @ )1  2??,ܰ?! #*,@ Ҁ   , @Q  $ O`^ B?  @ @v @? 㿘 `"D? " % 3 @$@x 8 @hL@ ^АD?0 ?b:@d   b""D?㿘J@ ^ `@hڐ@h` @ƃ ?"㿘% *# b ۠$' b $@0  b $"b"   "b@* ""L@ 㿘 " 㿘 "  㿘@? 㿘 ""$?  @   "b  !  ""@@< "c  "b0   "0`," "4 @""@! " "" @    "b  ", C  "b    " b" &  % # b,?0@  @  b,  "b     "b   >  *  "b 8 <@?  @ ?? "  "  1 ?L"8?  "b$㿘  "b  @x 0; "b J! !   "b " ! "J?"J?"9J?"6J?" ? ?*?"*?"J?")J"&J?" ? *?"*"J"   ? ⴁ    ⴁ    ⴁ 㿘  "b "  ""  "<  ""8 8 4"8 "8@ < " r a  㿘 "! @E," " "\*`@ "! U"! " b\* "  @N, $" nothing to yank㿘 "    "b b"" b?"b b\*    b""L 0@#? yank something first㿘 "P 0   @ p?0( " "\*`@g*@ ""    "\b ?"b"bb*  "b " "\*`z@      """b""   ""@( 㿘@o  㿘G     " ""#"#b   "@*@H?  㿘 "@Dk`   ^^2 N >  ?`  **@`?*@` N *@   2( ^(  @ ?*@( "%s%s = %s '%s' 㿘  E Ȓ@$#(  E ̒@$#(ʐ@$#0 "T.    * @*` P@#8 ` "X.`. @#@@ @$xcannot bind, not a tty%s: no such function㿘 "T  @#ɐ (   P! *` *  `"    2 @$J#8  :   3  , bT     2bT   u )  "T @ ,   ,    ` `2N@[V 2 *   P *` *   " @͒ "   : `; *` * `P     @@#@' ې @CGb "T,     "X.,    xb "T,  * "X.,  "  㿘# ֩b ?"bH! !͒b$"T   T* ``T    + bT* ``$bT    " +   J  T*`@   E*@ ! & ֝b$"X  "X +  *```"    bT *bT  *bT  (bT (bT  $*bT(   L 㿘 "L  @ 0 "Lb  "bL"ܒ  ""L 㿘 L` ""Lې 0@t  㿘+ b ) "# b' % @8b" !"$$$b%b @d$%"F(@6%b %"$b$$@dҐ?8 @"  㿘 @a  㿘 @[  㿘 @U  㿘 @O  㿘 @I  㿘 @C  㿘 @=  㿀  "b  "#\#`  " #  @ 0 " ]@"@K  ?%E. @ ꀦ6 ڐ   㿀  `9  +  "b  "#\#` " # l$!  b @ @d" 2   b@AԔ耢  ` ` "   "b  "#\#` " # 1B`  `0<0$@c  "  ">$@S 0#젒 " @"@ *F J? /E; 0@B 㿘 b( "b(   "42  : "@" " @*" ""@ ",E Н㿘E`Ѐ ?"` ` `"J` J@" 4 㿘    ""0  "0b, ɐ     b0    b0?b0 "b0 "$   "0` ",?@㿘 "( # b( *` : N 㿘  #ac   , * ? `    ""8 ""<p ""8 ""< 㿐! &" # b" " ' " " H"  $b*   " "b"[    d  㿘 "D? "@  "؀@ R 0"< :@@bѐ?@&N   " '?8N(N*  : "N? N   "`'N   " '  0b *`:    " '  N  "8/""8 * : " N    "`' *`:    " '28 N 8`"8* : "N N    "`'N.. 㿘@ U㿘@  L㿘@ C㿘 " "  0g8??a 8 a]\c $  J@  `_2J L Jc@  a, *`c@  *`@ `**8 Jc@   U`_`$8 U Jc@   *`c@  a,*`@ `*2J8?? 8  㿘 "@   " " % # 4  N b 4 ""   ""@ " substitute㿘! " " @3`$@$`$"@-B ! @>c@ "" "M` "@P㿈 G " Ҭ`'' ' $<  b, ', '' '"@ 2  $<  b, ؔ', ''`'"@"@  Ɣ 㿈 " c`'' '@U":  E  "ޒ`㿈 " D`'' '@6" :   E Ē "ҷ`expand(NULL)%S%s: bad substitution%s: is read only%s: %sparameter null or not set(    @zb  @i   J! 2 J! 2 J! 2@ ' "`'ܐ ' '  '(@  ''Ԩ?$@@>0#-@|ՠըHXN Ӱ #,@(40P@|0 8H N   ˶    $,@` (,@?$@@=,@ N `1 )@22@       $,@` (,@`,@?$@@=,@ N ` ),@`,@}`"' '/j @ @ ̒  @dݐL f?$@@= ,@ L `T@   ؒ@@a  ,  @(@_,@"02A   2   b `" " %  5$@5 5 % 5       %" = #"   ?"  ""(  @`  ,@U U   %"U  = #" U B  ?"-U < @@dB @U' @$"U "H@`@@_? b Ђ`@ג@d @d$ '؀    @ @’"h"`@l  'N}  'y | 'u ) 쀤@ ؐ`'J@f_  ؐ`'J@[W䀢 2 ܒ ' H'E! W䀢 X ?W䀢 = : `" `  ?"` `"` @J-ܦ ` "`@JBܦ  @GW䀢 @! "a 2A,` *  b   *  b n2,@ i,@` $@ `@$@  @@ ? `@7 @``  `$< b, &`, &@&`@`&@"@`  `$< b, є&`, &@&`@Œ@&@" (@ ' ' b`'[ ' '΀  *  b  } ,߀`]!*`@088888888P8h088888888888888ۘ8P88888888888888888888888888808088888888888888888888888888888h8h܀A[`@9` @@3{`@0` ,@*`(`$ '  " ('@2  @2 Ұ `'`@ 2,@` ,@`,@` %s: parameter not set㿈N@ J$N@ #d N` aN 2?`@  [' *L` * @! *L` ] * @h @` @2 %  " 2  @ "  @`@aE @@ @\ J!  2 &2& @'&@:R  b@:c`$$ N  N :  N  N  b*   ?  b*  @ N N" 2&N ?&N@ * @"  %? = # "     E $ @  "  `$`$y @@ N [y L` * @s L` ]o  %? = #t " ͠`'' '@gI@`"1   $< ", ', ''@a''"2" :  E $L` @   "`9  $<  b, ͯ', ''`'"@`$@$L` @`?4   = @"*`@ F? A?@_@`$$   ", @ @2 "J E 耢@ + = - ?"     J! E 耢@  b*  @2  + @funny $() command: %s%R%s: cannot open $() input㿐 " @-`"" ! @R"в$"P 1V@ -` (` #`   "   @[`@"D   @C/ 02!6 #@@ @CR  @  @ @ZA@ 2 @ϒ@: 6 &  㿘@  %3%# P>JG.@<9 ?. (9@ 5.@<' -.?:'@ #@< 2 ?"&@8 @< 2  㿘@`"@< @* 2, @`  `$< b, a&`, &@&`@U@&@ "`@"@:`"@@= 㿀@`$< !' "`'!' ''䀠` @c@`&> &.@U.@2     2\  @*  $  @ ! L / < @(@ @*˒8  ? @<    2. @ (*L /%< @(@2   @*8  ? @ @<  2 /,@`,@  $< b, ˰&, &&  " $@ @7&"@ / ,@?$@@7,@`N /"@ / , @Yڐ@;+ 2,@$ @" $@7|@c@Y@&@<Q @#@F  @T<L  .  L  .2OL O .N .@:  @Y  @"@@73@X@?&@@ @  â@?2,*+?@!㿘@< *$@@Xi @ % (`2 @`L@ @# ` 2 @ @, , , `L@  @,@[㿈 ' "`'j ' 'L@ 2 *@ ` /:"*@?"@$ `@6 `*@`L@ `L` / `*@ @   @. N "& @?$@6 2, , N  &HOMEPWDOLDPWD㿘N  +@\}"P@]2 NN  2 N@\p"X@] - N  @\c"`@]@ E 耦" 㿘@P "@Q 2 @ʐ 2    @6a$  $ 㿘  @P ,N {#    `N { }  2N? ,2 "N  # g$0d    $< b, є& , && Œ&K" 0A= "& 4N { }- 2N? `N ,2% 2"`& ":`@V@V@@V,f2㿘 @ %sPS4%s%scoprocess already exists%s is read only%s: %sX'D'H' D 2H H  DR DH@Z?@3  !4 @R DR L "!DD ` *`:`' J! 3 .@[7"X@\h   "(@DbP  "("`%E#E,  @` `@D ,   @@"( @; D  ! DR DR  " @z`""`  @WC @D %D  #  %'E@ے 6 ' x$b  u q @Z D?* : `b!*`@,,|||PPLtdxDH@DH  `09H 'HH ?'H @? ! "` 2@" R @$  @2 "` 2`DR !! @` @ DH `@f @ @bH 'HD 'DDR ! "  @#R`" 2 HD`@@G H  H "' DH Œ aD 'DDR HD a0Ґ  b@V " 2 @m# "   @U @2@2M!|!|   @"h@  @ ! "` 2@ @ "` 2`@ @ @U0 !h" "    @  @ѐ ah"ah @ $ $   $  @U  " 2@H ?'HDH  b@lj DH  G`0`D B!'D   @ DR `?@DH , a0EH!'HC D "!:`? 'D 'ǐ!'ǐ"'ǐ#('ǐ#p'{0% 'D   D L 0"   ' " 2@ " @lh  "  ?  @2@1 ' 'DR &! " D@YD $D"@``' @Z@DH  a'  @"ǐ 'D@Y @$ D"@`@ZȒDH  a'0 " 2@ " @l  "  ?  @1@1* ' 'D t!@ DR@` `?  DH e a'0D  { D Z! D H D H L a0eD ߒ D 'DD \ DR W D '0ʒ @6  ' D DH  a01DH  a0+D D@aDHثD @]'@P8@1rDD`@S  \"0  \D@  @O"0"@' @1""H @T H!  J! @0x @O _builtin: %s: not a builtin:pcommand -p: restricted%s: restricted%s: can't find function definition file - %s%s: can't find function definition file%s: can't open function definition file %s - %s%s: function not defined by %sCFUNC %d%s: cannot execute - %s%s: not found㿀'H'P' J!   "    2 #(  @[b @Y? H [# "t 8# 'H  P` H X@ 'HH 9#@;H   2`P 'P$H & a@7 a@7㸀 p?    J!  a*   @ 'HH ` "( H H!  0 "!'H쀦`@VK`H H   H(   J! 2`  D '  "("`.`@R  J! (`2 !@W#"X@XTՒ (@@ "P .`@` E E @? .`@` @<(  @Z ` .`@ Ƒ.` H!H  J!  @ /  c@ @'HH    0&р 0!H@'H D H   H  "  H@  Òcǒ`H  @-M H \@"0 `@@J  @JƐ@I @  H `p@4 'H b'H( "b " "  ` ! " "`φ  Ja'H2  *aH "'H@""@" 2 @iN 2  HP ϒ a "b  "b !* !HH = "H &$2H  H@ ?"@HH @T`H"` ,*`@LXLXXhhX a"@.@.<@. `@0UH ! H   H@  `@ ~@'`@ 9' @c 2'J!  #(  @Ya H@W` P  @UP  J! "  E!X@N= E!x@N9   2" H` " " P@?'P  ""@-א EXECSHELL/bin/sh%s: %s: %s㿘@U"@VL  at @  L 2  " &  "@ " @@R \@X"0"  @shcomexec: %s㿘@I  @I ’b@S@㿘 "     @Iޔ , 2 , @I&& &  ,  㿘 @IQԔ  2 " ,  ?$$ ?$ @S `2`@J`?@R  $ `$V` h$ 㿘 N = * !2N +  @I   @I " " " FPATH㿘@H  J!@ߒ / `  o  @IX ` @2 .`Y   @T!H@UE 耢@& &  @ &   ` @2  ` 2 % `0 !  "@I #`   @     ?&  la ?&  `  Q M`K `  ` 2   "@I  "ܐ &  &`  " !t @~  "܀  @-a& &  &`@T !H@U;E 耢@  @]  bܐ & "b& 㿐 @I b% ?@I     J /  ?$ $8 @  $?@ ` \"0 <  2?I ?<     2&㿈&@ / Ɣ@?X@ " qQ@Oː  ' "`'  ' '耦`;@ :@O@$@" @-[$@N@ /,@`@"@@-H@Ny N@ Ȳ`Ʋ Y 㿘' @$% $  # @7הa!  $! !@3  @@8a$!$$ᄁ%s%s %Rcannot %s %s: %sopencreatedupcould not finish (dup) redirection %s: %s ?        J!   0' ' ' '''!' J! @R֐"X@T툒   Ŕ@OŐ @ ?`UŐ!*`@ 0H F"  J! A&  @>`@^ <  2`/-"  @ʒ `&L -  L 2 #     @ `  Ŕ@N b@ $?` J!   c@ ?@!`! 2x?    8 @Š H \@2"0 Œ` @ ^?" *R@   @  "` *2@ "@Mc?`@ <`@      Ŕ@NN \@"0 Œ`P@  +?@MC'?`@M=``` `` "t@ `  @ Z`@ y`    @6( here document missingherein: yylexerror writing %s: %s㿐 ` @ xa{?r "'  @5͖ 0' "m?@*I  " @d    @6 @*J"bV?" @ <`"  "b@ !Ɛ @ a @6' "쩒 ! "@ h "`@&@"`@`'  ` @2 6  \@["0"@ ` @9@6? @L' \@G"0Ɛ!0@ ` '@) @  &?xpREPLY-rreadPS3㿘  `,` 2`%ƀ` @Q+p@R\J !@?!@Q#@RP@ f"PƐ#M ےc\  @Q p@R=J@ ײ @ 4E* ?E %*d) %s㿘.`ǔ `@9 㿈   @M       @Cǒ 4 ''' "(ǔ@2 㿐   `?`? J@ "`J@`? `+  J@   : * `*`J@ *v``      a\.`@ `?   $ 㿘`   "`1E  耢   {㿘pdbteste_error: %s (offset %d)㿘 & ǒcP@ ?++--==!== *= /= %= += -= <<= >>= &= ^= |= <<>><=>=<>&& || */%+-&^|? , ~!():x"''ܐؒ@&@p''L''' c''"c@(>  " @b 쀢 *@"@(B   "cL 2 E@  @'@t1 #` ( '@q"`#"`@Ð @{ #  (Ԑ @F "@Q @P @Q @( "c end of expression%s: unexpected `%s'%s: bad number `%s'%s: expression recurses on parameter `%s'%s: %s requires lvalue%s: %s applied to read only variable%s: %s㿐 YȐ#. @$$$%%%4 #  '"  &  # ( ) ##  #@P6 ##  //  * @*`ǐ#@ # c  # c8 # cP #  c # c # Ȓc@~@' missing )zero divisormissing :㿘 Z  # ߀ 怢 #@ @! 88& " `?0& /  *& @yѐ  #  $ Va`@i #`@) @`   #  >  #  J@ @K0D #  ;) ʮ <,* ǒc  /@2@A @   뀢 v@.耢   #  $ ɐ ap * ))+(((()))$))*))$)T))4)t**x(((()))**+ @?  @@  @0   @  "@  *@  :@  @&    @$    @4    @6     z`?   t@   p @  l@  h@ #`  "` א@   @  R# #`  "` @v  2     7#` ?3"`  @ #`  "`  #` ?"` #  %  a@5#`  "`  #` ?"` "  $ @"@O@O"2& #  ̑,missing ]㿘 # Ma#   a# M  2  #"` (  "*`@ <   " M *  2 [ ! @T 2 `! #  # @#"`@@ "c ! " % @&@Läc"`"ْ` #e &  b*  <_ " *  2M#! M_ ! #?  " % @&~@#" }"" " @O  2  X"` #' '#" J#` #2 , @*`@`@H   , * J`퀤` # )"` #" 㿘@@J  ` $ @" @N@N2 "$ 㿘N` 2@@@@2 @. *ǒc  $ . *ǒc  㿘! " `""" "`" " * 㿘N  @" @b%@Nt 2 @!   #"   &@M'  *@&#" e:glnrs0,1,2,3,4,5,6,7,8,9,- $_-%c%stoo many argumentscan't use -e, -l, -n, -r with -s (-e -)can't use -l, -n with -e-16 %d %.*s %s cannot create temp file %s - %serror writing temporary file - %s_${FCEDIT:-/bin/ed} $_cannot open temp file %serror reading temp file %s - %s(        ̶#+  ̐a@+o8Ѐ C8 * 444444444422222;$22222222222222222222222222222222222224$24222242422244Da̐@OaX `@GL  "@$@늒a`  ̐!h@4a@!p  !* `Q `  2 ̀2̀"@!y `J@ `@ =  "@$`$@-@  2  @n!pP  @ @K `A@y<` ̀@N!0 2 22  @8!p  ̐!В @ @   @     @@  @@  @  `? <!̪!@ *) 5 3 /̀@$bؔ": !@3" @@0   !$@2̐!a@2"`@ހ@ @/! ! "@ِ "`@%"`@    \@"0̐!@  @ @! !@2@"`@@@.?2   \@"0@"k J!   ̐"@@Jz @Kj  "А@̐"H@  S""   @- 2 ̐"`@c E @== & ̔' # $'' '"@@0 " $" @#d @., @+$ @ @K $̐"@! @. 㿘@) )! ) '̤ @f  @, L " @@  #` "`@Ք @y2,! "@ e$"Ёsubstitution failed㿈` "@"`0T@EP@EM  ' "`' ' '@  $@"  @"ܒ@D4@D/@  @E "@@"@D $ j%s: not in history%s: invalid range㿐@%Ē 0􀢠   # "* b *`"ذ@ "`.@X4 "؀`#@3)& "؀"!L ?     "b" : ? @} 'ϐ!@(  *`"@no history (yet)㿘  "b  2  @ #(  "?"؁㿘  "b@#( 㿘!  "" %E# c  " 1a"ؐ?$"c $؁     "`: @&      *`"#   㿘  "b"< `? @D    . "@@ !1 ! ,`"؀@ @@Cߔ " "2 @@@ "@"&@> "@"ذ?㿘  !̀  "b"<`! . @DВ" ! ".  x$" "a ,`@"؁㿘 #  # 1 @  #  a&# @q#㿘! "    "a̐" a$" ?"b؁㿘 "ؠ % # ȃ*   @ haa̔ `@Dz*ȃ* ?  @!a@C|$  J "* ""؁㿘 "@Cj@Cg@J? "! "ؒ` ""@` , @B],HISTFILEr㻐 J! N  "c "#@F `@H& J@   ;"# @ a "c@`p0   /    $@X*;@   $` "` ^ $ ۨ`?@ݐw%s%c㿘 c  2"c  "b"<  !̀* " " # @裒aȤ "؀@ )' , @ !@  , @؀ , @㿘'H'L'P'T'X "!  "bN "  @ ! "(@/H @."( @+"(@ 㿘'L'P'T'X@n! "(@/L @.l"(@+ؐ"(%s: 㿘'H'L'P'T'X "!  "bN  @N  !!  "(@/c! "(@/_H @.B"( @+"( "@   J! a "!@: internal error: 㿘'L'P'T'X@ ! "(@.`x"(@/2L @."(@+"( @ %s[%d]: 㿘 "J- "(ђc @.b  "Ѐ``  $ "(Ғa@. "" 㿘'H'L'P'T'X! "(@.H@+C"(shl_stdout not valid㿘'H'L'P'T'X !   a !@.ӔH8@9.   <   `  㿘   @)   @)(   @)ȁtoo many files open in shell㿘@H  \"0 "㿘  @ v  ` \"0  ?̐"@@r颐㿘 ` @*Đ"(`Ŕ @@\can't create pipe - try again㿘@u 6  &  & 㿘@@=@@; bad file descriptorfd not open for readingfd not open for writingillegal file descriptor name㿘Na#@  "*NN  2&NА @  `+( (  %` `  2  p N  @KӐ &? !h?  "!h  㿘1 !h` @@?!h?&!h㿘! !l  !l` @??$!l㿘1 !p` @??&!pno coprocess  h p `ӄ"@?㿘   !l!l &1  1 1 !h &1 @?u?&!h1 !l &1 @?l?&!l1 !p @?c?&!p/tmp%s/sh%05u.%03x㿘 "Ӥ#@@T ,` & & -+ ' ) \b `$ @-.@!  @(7  & "0 bԀ  `& "& QHQ8Qargument must be %job or process idambiguousno such job㿘  P"cD "b b@?  "bb@ "@E#ےc@; )    !J!  *`  @'  "cL !J!  J  E!Ԡ!T. *`@` "`*  @; ?<.  J!  @J! @A 㿘 #, 1 + )  !%  bԀ@2$  2  2 M! "L 2@2  @qc  2 @q\  2 `@Æ @X  !bԀ  !E `F@ !8 @q  Ja @.*aj_init: getpgrp() failed: %sj_init: tcgetpgrp() failed: %sj_init: setpgid() failed: %sj_init: tcsetpgrp() failed: %swarning: won't have full job control㿘 J!  @Ao  #PF!8   !@@ "! #P  @rA  "cT \@"0 `$#P #P E# @: #F! @a8& !#T@ @=ʒ 0 ( \@"0 _ "#P Ԥ!TE!, *  @:֔ ?, ! #P 0  #Ta + @qO  F \@v"0 6`H$#P !8@`a  E \@e"0 %`h "#P cT"   a"#T #P F `F!8 5 @@bX01"#P J!  Ԥ!TE!, *  @:~ ?,  Ԥ!TE!, *  ` "?2` `@:i ?,  J! @A fork failedcannot fork - try again/dev/nullchildexchild: execute() returned[%d] %djw:last proc㿐}=` 懒6  b@=Ҕ@ $$$$` $  #0 c("#"c(@` `2$$ $$ $$$ $ "$ c@ "c@$$($0 "#0 "#(@ N  0@  + \) @b0 # ` "쀢  @,` @ ]@c @={ .#`?`"$ @< "b$  J! `    $  @pB #P  `F!8@W @``g@<`b   @=8 @8 J! `   Ԥ!TE!, *  @9~ ?,  J! `$@\ ` J! E!X @9e E!x @9` 2 ֐ @    @` 22` #P   ` F!8`4@=x  #P !F!8@` ` !8 bX@=f  @: !F \@"0ؐ!!8`_ `  ?$` c4@""c4` =``@m  7` \'"0` $` #P  ` F!8 bX@=1  #P !F# !8@cT    \@߿"0 ؒa!8}cT @: @߲ؐ" 0  #P ` ?$` @( @: You have %s%s%s jobs stopped and running㿘 #,(  "  !Ja ! ` "`"H 2 2  2 "2"ْ""""ٖ"!  jobs㿐   b@:􀦠   @d` @: Ԕ*א" D  #,``    # %  !`   @ @. ?   "$    2  #,  # "@6cP2  @9Ô  notify㿐  b@9 #, , % # L "    @ @b( ? 8 "$  L #,  % "@@2  @#D"( @9 㿐  b@9{ #4` ` "` @9o  #8asyncj_async: job not startedj_async: bad nzombie (%d)zombie㿘 #4`"  ` !!2  @bH    hbP0B"#4  , "c8  #<cD7# ! 1 c, #4 "! " @6  #4 !#< ڐ bp1#< &#< @ob #<#D@c,㿘  &  (@ 2@& , cH  "cH"@8  j_waitj: tcsetpgrp(%d, %d) failed: %s㿐 ``& `&  J! "`  2"  @lڐ"   `   ?& @4" & `" @32N  `倎`ဢ`  `s&  &  J! & #P #F  !F# !8@cT 6   \@ݝ"0 ے`X!8[cT  F  & F!8@: 4F!8`&) , 2F  2F $   @:ԒbX , ?& T F  ` a8 bX@:ʔ  2 ,  ;&  , ' J! "  2 `  *Ea    @3&   $"b  "b`  J!   ! @f"(@!ِ"(   J! `2@{p \"0 #,  "   2 2Y##H2@P+?@ L \@P" #,( "    2 2( ''''"@$@"$"@ @" ''''$   2       $ @ ?""0check_job: job started (flags 0x%x)checkjob㿘 2 ( a0`  `  4@`2`&  ,   "  , &  , : &    &  ?  a|a|"a|  0` !t!t@2  ? "  @&  J! ;`:   @  J! .    ( "` ` "`R  2``2` !   @#L @]#L@ #L     @t` J!  `  #4`  !& ?&  c< "c<@Ta%d RunningDoneDone (%d)[%d] %c %s%5d %s%s (core dumped)%-20s %s%s%s|%s%5d %-20s %s%s %s%sH /`   ,"  @#`X0  ?&    `ݶ p #,  +#,2 ( -/ ( р /E      @`" " :` x6?-:``"2/ :   ݒ  ' `%/  @@#:`  2 `2 `2      2  / `*`E@@``` ( ݒ` @#F`ݒ`@#@``ݒ`@#8 `2 O "`  ݒ`@#&   耤` ݒ`@#   ; 7 E ݪ E ݦ! *``   #\#\݄@"2  @"ے  "  27  E@"ʒ`㿘  b*  "'L@R #, ̀` , "  2 , #, `    2 ` %` &@L`?ސ" *`@{ | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | { | | | | | { | {,| | {T{T{T{T{T{T{T{T{T{T| | | | | { #, #, W` S`0U@ϐ #, J`  J 2 @` #, 7   ( " @  `"`2.&@-    2 (`@5W #,    (`@5# 2`` 2 (`` &@ 㿘 cX "cX ` qaȰ  ,`"& ` `@`2``"& 㿘 c\ "c\ @ NaȰremove_job: job not found (%s)㿘 #,#,  "@ " ax0)"@ ("    \"@"\ !   "Ԁ@  c<?"c< #X&"#X c0""c0 c4""c4 , ,`"` 0 ," ,, , 2"2 ""㿘 (   "@3U  2 %T㿘R  (R 2 `  ".@4`4@3i&@`. `.@4?no closing quote (    '' @' "`'w H' ' "#` `"#d Q'`  ,@` 'H' ,@`b` '' ! @N  \#`  "@N@  Ѐ "@ #! cd "cd' ! @N  \#`  "@N@ l   cd?"cd@ 3 "`  ?"`  J! a`,+ 3  7 b@N  \c`  "@N@ ; P   *  " D?$@@J b#T,@\ Ԁ [< *``9 *,@@<] ",@@ ! [,@`,@`?$@@,@` ,@ `L  "*`bbА @`$" "" b" 8%b @ + ? !" 'bJ@  \c` `"J@@ (  ,@`,@`  `,@z 'j ' \ ""! \ \b@N  \c`  "@N@ ?bА ,@  ,  \ \ ` $7b{,@"w,@b@N  \c`  "@N@a $  \ ""^,@  ` U,@?$@@n bC,@@N  \c`  "@N@3 () {b@N  \c`  "@N@ (   , * @  ,   ,@`O  ,@@`b@N  \c`  "@N@ # %,,@`,@bJ@  ` \c` `"J@@,@`,@`@ ,@` @,@`  w,@  p,*  " , ,@`?$@@Β,@b@N  ` \c`  "@N@ *  " 2,@`  *  " ?$@$ @ ,@`,@`,@` ,@` $,@`@:bЦ  , ,@' J! `@( bДJ@  '@ 8J@bЀ '  L ,@`d?&dA,@ " \LJ 7# -@  ("* ) " '" " \"  d  " \  "   ' d?&d"$,@ ( )2,@2,@bJ@  \c` `"J@@ )L,@`@ @21$@ / (/`   , } *LА  }ʀ |L ,@`Ɛ  ` \,@2,@b@N  \ c`  "@N@ $ $ \ "   ` ,@ 2,@ 7bА \,@ ) ( ?'bJ@  \c` `"J@@c )" 0 ' ' \ 'b@N  \c`  "@N@E bА D,@ "  , ,@`d &d25,@ B  " \ ,@`ۦ 2(,@b@N  \ c`  "@N@ $ $ \ " ` ,@` \,@`,@`,@` ) | ,@`L * ,@`?$@@  @ p" < >$@  >J  >  "*@ * : ?А >`?@2,@2,@ ;  > (">  &"083 > | </ 00/ "J@  \  #` `"J@@ | ; | &!,!!!  &! "  `$ "J@  \  #` `"J@@R <+ & >( &  >  $   26$  "J@  \  #` `"J@@+ -  $  > <  $ $    > $  |  @$ @ݐ$ $  ""!@`= @0J@  \  #` `"J@@ (!@0` $@  "b (t!@ " !@  !J@ ` @* ` !Ő  @/F$ 2,? !J! O` N!@'` "ܒ@'}`  ` !  } `  b"`1` `- !x a@'b&!@ " "Ѐ!`8` "` ! "А @J`$` "@"`"` ""`8$"  "` @!㿘 !H !p  # @) ap   !H"apcannot create temporary file %s - %s here document `%s' unclosed error saving here document `%s': %s 㿈' ́ ' "   !  ;!Ȱ a0& "a0"2 "`@&"`@ #  '   \@)"0"@ @ ʐ  " @E1  @ @Z@ \  %  cd "cd# '  J@  \c` `"J@@  а L  L K I@ $ @wJ@  \c` `"J@@ @H   @`?"``"`*   @ߞ``?"``"`*@@( @Ҍ $"@@ @@   cd?"cd㿘'H'L'P'T'X a8 "a8 " ?   b 8"b ? (b "!E "돐  "(@H㿘 <$ E $$ $ $ $ $ $ 8? $ $!$ 0 $$ 4 0А $ , 0 $ ( ( @- 㿘 "@`$@J@ #E E E % $@` r* ((8\|$@| @|`@` `$` @$@$` V$``  2$@$@$`M$`$` I$`` " ` `8$` ` @ " N J@  @ J?a#@ ` " `8`8$`  9$` `8$` ` @ " "`  $` ,`,``$@$`$`8"$$@``  "` Ӓ``8$@ 2` $`$@$` " @@! @"(@<"(@`$@J@ "u$@㿘 , J!    `?  @  (<$ (@ u,&` &  "E "a@^ ` !J!  J耢 Jꀢ  $ & ,E "@ ?  & ?#'  ("@@  @`$  "@4 " (@'g  ("  J "   ,$ ("  (@ Ҡ?  @  ` "" " E"!@]  ,&&  , @$  ,   29&@E 5&3 !<  , `  "*`@  "* " JJ  * *J  !< 2  ,蟒  & h  @  PS1%dPS2㿈 "!< R! 0V@/!@0'@+*   B@  !!`!  'K ! `K '@  ` @qK  @ې'! " '@ " @Bp   a, ""!  @ 8$"@@/[!@0$"㿘! @ǒ"(@"(missing ] 㿐 ) ' # ""J@  \` `" @@`l.` `Tlp, :  # [  *  U  *   M *  H F  *  A`, :  [; @O 2.m#H ?&@ .  L 2@ "`"J@  \` `" @@  *  ` `2@. , @^: 0 ?&@.q 㿈  ' "`', (' '' % J@  \` `" @@[?$@x,,`:  [  ,`:  ]"? ,`:   ,  $ H%`?㿘 c` ?"c` "E 耦 `"@`"@! "А `$* *  "" "" 8$" "㿘 #d   "J@ `0 c`   "c` "J@ `"*J@&"#` "@N  "@N \ "J@ `"J@ "   "c`MAILCHECKMAILPATHMAIL0@-ې @/ R@M  c| ""c| |" C"|@-Đ 耢 "    #h@-    #l )%<#   " $ @] 2$  2$ Ȁ 2 ̀     @$  2 8 #t "  a #l$  $ @)   <   $  "#x㿘! @=#h$#h @/aȢ3) ' @o :,@`@h %N? \ ?@) @*q   M!  @O ?. @h"`$h㿘 #   2aȐ/aȀ 8  aȠ$$ $  @ 2 $ <  2$ $ _%s you have mail in $_㿘 J! 2   @- @.    Nj  @1e IFS= ${PS2=> } ${PS3=#? } ${PS4=+ }KSH_VERSIONxphx`XP@0(hXH8 xpwhovishsedrmprmvmakemaillsgrepemacseddatecpchmodcccat-tUnewgrp=exec newgrplogin=exec loginr=fc -e -local=typesetnohup=nohup integer=typeset -ihistory=fc -lfunctions=typeset -fautoload=typeset -fususpend=kill -STOP $$stop=kill -STOPtype=whence -vhash=alias -taliasTMOUT=0SECONDS=0RANDOMMAILCHECK=600OPTIND=1-iPPID-ri-rHOMEPATHSHELL-xtypesetpdksh/usr/bin:/bin/sh-shPWD.$ # PS1-c requires an argument%s: %sCannot determine current working directory/etc/profile$HOME/.profile/etc/suid_profileENVhxx0@@  E! @"b#  aȠ @' D7 @*""& @+1@@! "a@۔  !xa@֔  "Ēa@є @  a@ʔ @# #, ֈ` ,  , !䀢  !, v` ,  , %  $  @X    גaȢ @X$  ""at ! * * ! @'}"?"@@s` "@mb "@g`  \ ! *  \"(   #`  @.   2`@&A!  "b$!!P   @. !XŴ @* @,,L /@P  @  P@2 T@ @* !(J@  @ Ȑ  !(J  E 耤"@,|a(@*Ð X@Z"@,@* (@1 @,@*!x@,eb !! L   @x !,  "@@*    @+@ԡ #   @,1a, !@Y 2  @Y@Y", , ! *  @%  @&͐ J!  " `,`@$$ `ސ ,`@`S ""P`@'  J! "  " ؒ`,`@$`  @@ 0  $   "b \@"0! ("b! , " `!$䄐   @L $ @  @    ,  $  @ "@$ @  <   @   aJa ?*a@ L  "  " ,`?@"`&"`` ""@  !J!*! !(J  J`  ka !J! !@  @U L   !P[   @I  J! " !`@)!x@*I J@    @2 @@ 2  @) @*@ ` `!| ! *  J!  j@! * @  include: %d`'''''  @ b 0 '?Ԁ   "` '` ' '' "'@ː  " @<2 ?@ "" @T 쀢   ""`"`?` H*`@hht B "̀  "耢 8 @- cԀ  3  "`" `" b `'" b@`"`@/ @} "b@ 쀢 b"`"` 㿘 " \`"" @ shell: %dUse `exit' to leave ksh 㿈'D'HD ' ' J!  H@ '@* 쀢  "! " @; ? DDE "@?`/""*`@(((88쀢  2 EⳐ  J!  D  3   D "`@@@  aP3  !4 @x D 8  J! D`  D` ?"` 쀢  LL DqD@? V +   J!  ?' V!0 aЀ  k  &aD" H &@*   J! D p  "b耦  V  쀢 aЀ 2&a@ @y "㿘 E J!     E!$ E ! J!   ! F!@ ! " # E!"R /* 8(((´((" @: J!  @!0 b?   .  @  @"@#b@"㿘# b D`44  b`$ $ $ $ @$b㿘 "` 2  @#"`@"` @&e`  ` , R@`"    $` ` R     @ ה(@: "`""A`㿘 "`"` "` ` , R@  @"M $` ``2`  "" 㿘 "  @ @   @!0㿘! "@ @"" @N 㿘  !  "Ԁ@2@  2 㿘@}ؒ / 2 @ r @b@ alloc: %s㿘 apEJ `  * 0  0   (  0  J 0123456789 |&;<>()*@#!$-? =-+?#% "#$&'()*;<>?[\`|㿘 a "*@  z2@  A "*@  Z2@  b` 2`"0 "@ "P "X "` "h @"p!0123456789ABCDEF㿘1 #.#h?@ .@2?㿘   @"e @ƌ㿘` `*@q 㿘   *`@&  ` &   &&@ aceikʸlʨXʠmʐCʈnʀfxphb`uPH8p(r shvɸxxtracevi-esccompletevi-tabcompletevi-show8virawviverbosetrackallstdinshrestrictedprivilegedposixphysicalnounsetnotifynolognohupnoglobnoexecnoclobbermonitormarkdirsloginkeywordinteractiveignoreeofgmacserrexitemacsbgnicebraceexpandallexport㿘   . @ۇ   .  . ?%-*s %sonoff㿘.`  !J@ ##@( Current option settings set -o %sx "2o#'آ    ء. J@ " @!> ,`" " ؀`'ذ .  .  !@4 0!@    ! #N  . J@ " +`  .  2NE" p    !*` J  J@ "`*`*` *`* "s`㿘 !N  .`4 2ᛞ฀    & !* * *  . ` @S@SJ@S@{B@S@SJ@S@S6  !* o:Ao;s%s: bad optionparse_args: `%c'-A: missing array name%s: is not an identifier㿀   J R# #* `,  `, @ p   ,  J` ` " * ,  2, * # #* `,  `,  `,  `, @ E   ,  J` ` " * ,  , *`  !J@ -   @zߒ / ",` J  -2,`  ,`  ##@  ! @͔d2 `A `A`o`?"ϰ?,` (`?  ސL䠒, LՐ  , R Ȑ# ~2 `s2  ,   , J`@2 R`@ ,  , ,   c0ex? %*  J - +* J` J@ -  !J! *` *` '   쀊 2  *  "& &  '* `2L@#H3? @'ݒ J  #`Ӱ?0# ,  2 *`$ @x *@*9  '*  J- +2   (   * (Ѕ+ 8 +  2*J- "@J `  %s: bad number㿘Œ!kX `+ @ؐ@Ր@@$ 2$@ "  `]@ط `?@j*+?@!㿘   U  N  * ? [E  ]`2A       !"   24   ]"/ .  `(21 $ "@Q  `  | )`02 `  2 *  ``?㿘 "    @ꀦ    ?"` [ *`̀ " 4 &_"˰ @ːİ I? @   @  "   ? 2 @ $  2  ~  y  @Ԑ@Ȕ "j   ?` 2] @ M  E 2B  @N@ E?B @ " 2 @ 2       @* `?     !`?2 `[     22 @?8  - 2  ]      2   4 @4   2 ]2   㿘% #   ) |?? |2  2 `b@ʬ ` 2  * 㿘.` @㿘&@:`2` : `[*`ƀ ?$$$@ƀ `@$@$2 `$@$$@ $$̤ݦ2?$:`&@: @``$$$㿘@Q "" " " " * %s%s-%c: unknown option: %s%s-`%c' requires argument㿘`` @* ? J 2D`@* ` @ -&`J` -`J`  `@ &@&``  &` ʰ?`-2`` "J`` "&`` 2 &`+2&`J`  `&`?@ &@-`   &` ` &`, : `??Ɛ  `, `#"N@ɷ2`N :2`.``R&`  p`  p x,  7`XJ@ : ;; ,@* ?`J ` @* XJ@ ;2NU&` :2`.``&`R :  p`  p x,  `; ` E 6 ?2 J@@* ?`' #2), @* ?`J   ` b*   &`@*  b*  &@ &`&`&`, > %s'\''㿘   "* !2L L  L  F h00 ( q% !`'`7$ 2 1x   2 L@  ?&  `&  *@ L  ` x%-*s%*s㿘  "2`E! @" @@` @$!E!E@'! "@@$  . 5/-E   @@6 @ @Z 6 Ḕ@Q  @&۠  "l`㿘@& @ @`@L@ "` @&"$@`@ @.@&@㿘 @_6@h.㿘 % \@  0 # 0@  $$0 㿘 @% ?    @* ? 㿘d "$``@L    \ "b0 "`" @    "  " \"b0  @  "’`㿘   `E N@ / .'r 2N` .``*`:  / 2    L  J@ :" "@`J@  :"@J@  `&  L /"" "N "@@"@C@J? /@ /,@`$@ '@"@'@J? /@ /,@` @c @"@@f "&JV/`? 2   . /J/"J .@2@*@*@`<*@,@J"/"J.!@J/@ @ @"*@*@`*@`*@`  /"͔@ 8J@ǔ"J*@`JJ/*@㿘   Β E @  b@ ! "b!( $!( !(@ E 耦 "`㿈@ǐ ' b`' '@'@ 2* /** " G㻘?&dK`N /"N [@h /$@@``N .H`2 N .2 N . ;?N /6 8?3& /. `" @g. @ #  \"0   *<O / " 2N㿘@詔  4` @ @ ` 2@  shf_fdopen: missing read/write㿘`"`` @   "`  " ``"````  ՟a`    "`&  d &  "0` 0& b " & ,&  & & & & `& & & && $`& (ڐshf_reopen: missing read/writeshf_reopen: bad shf/buf/bsize㿘`"`` @}   "`  " ``"````  9b؀       (6&  *b&  & & & & `& & &  &&`& $~shf_sopen: flags 0x%x㿘   `H   " 0}` "  & ,B B2 ?`$ @j ,?& & & & & & & & && $& (㿘   @b@ &?"$  ,㿘  @H@ &?&  & & ?& 㿘     &  @  ?&  `& *@" ,㿘  @"$  ,shf_flush: no fd㿘!" 0` 6 ^b( \ $"b0!?@ *@&   :   @ &  & @ @  shf_emptybuf: no fd㿘!   6 #c( \ $"b0y?@ `p *@&!%` $@$@2`?  *` ,  "@  &   "@  &   @ &  *&  @ &  *`& =& @5  "@ %% \ @ 6@0   (&0& $&  @@ & $ 4 `  & & *@&  &  &  &shf_fillbuf: no fd㿘!2J  6 ӏb@h \ $ "b0@ P ?2,? & & ! \  X   & "0 2  "  4  (& \"0& $&  &  & 㿘 6 \ ( \ $"b0Q?@  ?2E?@,2(& 6   " : `4& 2 8&   : 2 & ( &  "&  &  & *@& @ 6   \"0& $(&? shf_read: flags %xshf_read: bsize %d㿘 ג`耦`% aД` 2  /?@ @ 4@&@& "& `4 @$@ (` shf_getse: flags %x㿘 җb` 4 ` / 2 ?"&  ", @, " $@ 4@& "& `&@`2 ,shf_getchar: flags %x㿘2  Nc  2  ?"? ???&  `&  @shf_ungetc: flags %x㿘@2@ (c@(2<??"9?``@2@` 20?@@ ?"&?``@2@`@&`@!"@` ?"@?*@&@`? &`*@&@`&`*`  &` shf_putchar: flags %xshf_putchar: no fd㿐@? Ӓ`?">?@ "*`/` 6@ Òa@( \`$"b0)?! \` @  ! 6` "0 @ "` @(&@"0&`$ 2 `p ?" ?`?&```&`*@㿘 " ?@Ȑ@shf_write: flags %xshf_write: nbytes %d㿘 pb`6 bh 4@&@&"&`;# ?25?@ %`@;&@ &@# \ @# 6b0   (&b0&$&?$ 4 ` @m@&"&㿘'L'P'T'X@NLshf_snprintf: buf %lx, bsize %dh'P'T 'X` Ȑ `hȐ @*PCh'H'L'P'T'XȐ   BΖ@H/0123456789ABCDEF0123456789abcdef(null %s)P ` a @,W`"\:``%   ? ϒC&  `& *@<  N@ ` "* :  Ln* A?=":@9N@5 06/N@ +) ' *  &,: ?@, ` "-@*`,: @@, ` "N@ f` & ,  ۤ ۑ* : `S!*`@                                                               t \     \      \ X   L  \   \ Ϥ* : `k"*`@  $ $ $ $  $ $ $ $ $ |  $ $ $ $  $ $   @  0,@@ 2,:  u: -5 +0. +  04  ,@#'L@ 0"'!P!h  @4  ,@  X x,@ 0,@'?$@`!@F // @@c_%@ @"@? L@ + -  0  )?#L@3 0  ? 0 `&  `&  @*@`?  @` x 0  ?*`:  `&  `&  @*@`?@  0` %,  ?< ʒ`&  `& *@`,    `?  ?L@ `&  `&  @*@`?`$@,  ?< &  `& *@`4 @,``(?㿘! $# @"!8 "c#    $#G  "c#` ` ! #耢 ` @ $#`@o 㿘 @/* 0$  | "c@#  @X  @  @ $  c  "c# |  "c㿘ΐ $% #  $c $c!!  !@   @g  "c㿘բ L' %  $Ð $ ; &! 4 #쀢  & @"Ѐ + &! &  ` `@- $`@( ` @ °`@ $`  "ctoo many <<'s 㿘 c 2   "cs !"c #! - "## b   @?`?!@" b b&  J!    &  !p !p@  Ṑ"!p"!p" "& 㿘 c  "c# 0, "c@e 㿈@L @ @ too many redirections let%s: bad identifier forselectH ! " |`" @w`'' @' " @n`''ؐ @' #쀢 2   @"Ѐ    c  "c #͐ , "ca a 6xȀa! `{" !`( ! 0  s! !  3a !#  !!!   !̀!   "c! "`"`"`  "c@5 + 3 # ) T` @" :  2! $c 2c %ci&c!"! (`"f!c͐ Pې,% ئ%cؐ" :  " :  2  @&! "4" :   J! @bb  ܠ$< ", 'ܡ, 'ؠ'ؒ ' $< ", ', '' 'b"`" :  ؐ" :  " :  ؐ" :  "%c@"  )   "#  ( )ۤ { }֤ @  "# $<  b, ', '' b h@#`'"!r  $<  b, ~', ''`' ""@@C  "# '' !' #'  '  'p!  @'!7 @ "@  2  a   Ӑ p" !,`$Ȑ@@f@$0$@a   @!s@$$@0E@ !  "$Ȑ@̒@$@Œ@ܐ U@$$! @ɐ$!  2 @S  @    @  !ɒ  " @!} ,f P% , "~` $ % ",~$ T  @!  $<  b, ~', ''`'"@"@# b ~$ ܠ$< b, ~'ܡ, 'ؠ'ؐ`'"@ܒ"@  ~y $"~`"~`㿘 c  "c#؁  "c! {! }@ 7 㿘!1 @  & @ @& 㿘 c  "c#P , "c!!  0u@ @ l& &  "c 㿘 c  "c#)  "c! {!  }@\   '  %   $ $ @`2$`& Ē 㿈 " @}y`'' @'@  c  "c#  "c (  "c) ' % # !  $< ", }', ''`'"@ $c׵ $c |ݐ!  "c $<  b, }', ''`'"@"@  }p&  )T &  c 2   "c׀  "c0#!< %S%s: invalid function name 㿈 ' "`'| ' 'L@ 2 @쀤  @  ?    @ w"ݲ?$'L@ 2 @,  ? 8Ѣ` `, ̢`@Ր  $ |& `6  {ܒ   "c! "  ``2   & @ & " |`& "" |`& "` "` ?2`㿈 " @|n`'' @' c  "c#ڐ  "c! ;?  <"c# 1 ' % c $c#Ð &#! $< ⌓, |', '' '"  ;@ " :    " |`   $<  b, |i', ''`'"@"@  |W㿘@%" " " (x(p(h(`(X(P (H   (@ (8(0((( ((({'}'''''''' newline|&((;;||&&[[!}{timefunctionindonedountilwhileesaccasefielifelsethenif㿘 " a@C  ""܀ '  T` "`@@@`"" T`" `@ 2T`unexpectedunmatchedsyntax error: unexpected EOF %R?%dsyntax error: `%s' %s 㿐   ! "# #"   & " " c쀢 c  "c ""` !(  !8  Ȑ  X@  ""܀ " @R` "@`@ 2R`@  //  o` !hޔ "" "   " "   "` "`㿘 " zΒ`22 " " " " " " 㿘 "!8 c  `?"c""  !H"ap "" #aliasexportreadonlytypeset㿘 J!   a)    @Fc "  e r @<c  r t @3`  t2  @*`   "  2   2 8  2  ||&&!()-8-@-H-P-X]]<>㿘 c  "c` @ AԴ  "c #  a J!@ ``Ja`Fa `C   ":ad`8`(4`) (`a "  `  !x ! " @ ` N "   " ap@’`? / `,"#2 ` \.` " @ ``@`*``$<  b, z`"``, `"@`@"``""㿘 c 2   "c @ "c#! % "# @`*@`$<  b, y "` , `"@ @"` @"@ ""1E  㿘 `&  "c !"c  .` "  *`(8 J *`  * " *  *  㿘"" 2 `2 @㿘 V .`y/ ,  $@6 .`@ 6 6&  0, `"' @ "`V  * @@ ""@@2V * @@ @"@ ?6 2 y ֑, y|㿘T  $?*    N N@@2   @ 2   2T *  2N  㿘T  ? T ?*    N N@@2   @V * @2T * @@ 2N T  T ٓ*`@B x&& & & &  @D ?4 $@"R`"`"  `"` "@@"@ 㿘 @ `㿘T`  b* xJ`` T` "@  2` T`&"@<  !@, &Error handlerERRUser defined signal 2USR2User defined signal 1USR1Information requestINFOWindow size changeWINCHProfiling timer expiredPROFVirtual timer expiredVTALRMFile size limit exceededXFSZCPU time limit exceededXCPUI/O possibleIOStopped (tty output)TTOUStopped (tty input)TTINChild exitedCHLDContinuedCONTStoppedTSTPStopped (signal)STOPUrgent I/O conditionURGTerminatedTERMAlarm clockALRMBroken pipePIPEBad system callSYSMemory faultSEGVBus errorBUSKilledKILLFloating point exceptionFPEEMT trapEMTAbortABRTTrace trapTRAPIllegal instructionILLQuitQUITInterruptINTHangupHUPSignal 0EXIT㿘 E!\# *  2 * J@ 2"*  " "` "  " "`"`#c" !E! T $ T t $ t! @$! 4"$ 4" $" @@ `@ !@  @ 㿘E!!Ԓ`"!Ԑ!b@ )㿘#Ea @7  $a ""0@7 㿐 @ b*  k  * 1E!E!   "?@ ?  㿘. E!@  ""a4 @ """"  2  "  ""`@㿘 "쀢 @="@E  "  @   E  " " H2 @"   timed out waiting for input㿘Ea 2 E"a ta0  "! "!4 @ ""쀎" " E!      "  2@ 㿘  & 2L " @ "b ) "bຐ  " !   ! >& & ! "ߵ$"耤  ! va &  & 㿘 "!4 "" " E! $   "  " J @  㿘E!  `02` `@l  㿘 " vCaȐ a&  !` & N@ #    "@& `2 #    J!   ?π`&   &   & @( 㿘E"     @    @    @  㿘 E" @ 㿈 < ";     `@耢  ``&  &      J!  @!"&  & #  & '''@  setexecsig: unset signal %d(%s)㿘   ?ϐ b`z   ?ϲ`` & `` `"  0   2     & %S #no-vars# #no-args# ( %T) %T| %T%;%T%s %T||&&! [[ %S ]] select %s for %s in %;do%N%T%;done case %S in%N(%S%c%;%T%N;;%Nesac if %Tthen%N%Telif %Telse%;%T%;fi %s %Twhileuntil%;do%;%T{%;%T%;} %T|& %T& function %s %Ttime %Tcan't open %s - %s%s㻘 ?* : ` *`@ETF$F8FLFlFlFFG\GDH HIIHJJDJJJFJp   # @c 2 @ߔ    I# @єc 2> 60 `'@HP@  V #`#hX @  @p @x   #, c@   ,  , @v V 2  @l   @d   # @Yc 2@P`@J @?  `"'#@5 `   ) |@*  2`@````@ !%#    @#`@  `" R@   @#``@     @` @ J0V ` @ H8@ @ǔP`X@ ,``@ !hpx @  @   @ `P @`@`@ 2@ @ = @   1`  ".@ m   O "!$]_ !  \@"0  B @H  @ 2@  << <<- << >> >| > <> <&>&%s 㿘 ` ```  "     @`0`>!P*`@MhMMM|MM,H %P!X` @hp x @`2   ! #@㿘 `2    ^ $왒   @ 2   ^ $썒 ?슒㿘 #` "'a - #2 + ? "' ' *   㬐  ?А  ?  ?ɠ?  6? @) ?L@ ɢ`2 &@㿐2 b  & k &   "& "!&@\%0*s%.*s%*s%.*s%-*.*s㿐@0@  "&   "j̒`0@Z @2@ a#J  "8J" @ #@ @ @@ @ b*  ## #\ " E ,N@a#@ `  `N@  2`@@ N@N@ 0"`   @3 @"L@ /a\J#@  *`@ `*J 2J0@L@ a]J#@  ,*`@ `*J 2J㿘    @@ސ  &@j & @ =,  $& @ה j ENVSHELL%s: restricted%s: is read only㿘@5 " L [ =@@ @6  " *  ޒ`@ &  L = $ "&@ϰ   J! @nb @hb @bb h"h6`ے `.@@@B$ " "j `@a _    @2 "2  "b ""        ?$"2 b"$  ?$@*b $ p$ p@2$ "  N`i   2 "" < 4& 5 b    `E   ǐ㿘 " i @` `"&  ` il ii `2& `! @ a&!@ސ㿘 & b*     "*` ` N ` N [@4 2J2 (+  J ` (2 `JJ [ J@ `[`]2J@2J@ 㿘Ȓ J`? 㿘 @  J@ J` =`? 㿈 "!h>`''!' " NT E >  2:ΐ ,   7" ,@ ?"@ ,  "  =&3 $<  b, hU', '' ' "<,2T $<  b, h7', ''`'"@"@  h%㿘o  `ے   㿘  " "0"0 >&@  `l"  >@&?*  >& a!&8Ɛ ?` *`@xxzyzPz`zzpyyzzz,y$zy8! $!t 0+ EL{"aurԐ  : 0q! "  ga$"L /c@  ^@r Y<  S ӆa M"b >&D7Ԑ"` 9ɐ!E. /$!  ,$! $ >&@Y >&# @ $$`l! &" " & "@ 㿘 ?`7#4*`@{t{{{{{{{{{{{{{{{  b"!tI 0#҄ E "a1 "  gHa &"˦ 0Ɛ 0 ""㿘@ @`$@4$`      2       @:` !f` @_`@ >&`& `& `& & $&  J@`][["J "  㿘@ [ ""@Ҥ㿘$`"AA   . V  .  @(#)PD KSH v5.2.12 96/10/29 AAA  Q AA A QB㿘d$@ǐ@Ԑ ! # %  !!,``$!, @``$!, ` !,@4a( (@@2 @@   g !$@a(     !,@x ?@* . ..group0 protocols,services,spwd.dbdisktab.shadow disktab fstabJ resolv.confT hostsJ . ..fsck_ffsfsckreboothaltifconfiginitmknodmount mount_cd9660r@ mount_ffs mount_nfs mount_kernfsr@newfs mount_mfspingrouteslattachumount disklabel . .. chown installbootwheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root bin:*:7: news:*:8: wsrc:*:9: users:*:10: games:*:13: staff:*:20:root guest:*:31:root utmp:*:45: ingres:*:74:ingres dialer:*:117: nogroup:*:32766: nobody:*:32767: # # Internet (IP) protocols # # $OpenBSD: protocols,v 1.5 1997/02/22 04:32:53 angelos Exp $ # # Updated based on RFC 1340, Assigned Numbers (July 1992). # ip 0 IP # internet protocol, pseudo protocol number icmp 1 ICMP # internet control message protocol igmp 2 IGMP # Internet Group Management ggp 3 GGP # gateway-gateway protocol ipencap 4 IP-ENCAP # IP encapsulated in IP (officially ``IP'') st 5 ST # ST datagram mode tcp 6 TCP # transmission control protocol ucl 7 UCL # UCL egp 8 EGP # exterior gateway protocol igp 9 IGP # any private interior gateway bbn-rcc-mon 10 BBN-RCC-MON # BBN RCC Monitoring nvp-ii 11 NVP-II # Network Voice Protocol pup 12 PUP # PARC universal packet protocol argus 13 ARGUS # ARGUS emcon 14 EMCON # EMCON xnet 15 XNET # Cross Net Debugger chaos 16 CHAOS # Chaos udp 17 UDP # user datagram protocol mux 18 MUX # Multiplexing dcn-meas 19 DCN-MEAS # DCN Measurement Subsystems hmp 20 HMP # host monitoring protocol prm 21 PRM # Packet Radio Measurement xns-idp 22 XNS-IDP # Xerox NS IDP trunk-1 23 TRUNK-1 # Trunk-1 trunk-2 24 TRUNK-2 # Trunk-2 leaf-1 25 LEAF-1 # Leaf-1 leaf-2 26 LEAF-2 # Leaf-2 rdp 27 RDP # "reliable datagram" protocol irtp 28 IRTP # Internet Reliable Transaction iso-tp4 29 ISO-TP4 # ISO Transport Protocol class 4 netblt 30 NETBLT # Bulk Data Transfer Protocol mfe-nsp 31 MFE-NSP # MFE Network Services Protocol merit-inp 32 MERIT-INP # MERIT Internodal Protocol sep 33 SEP # Sequential Exchange Protocol 3pc 34 3PC # Third Party Connect Protocol idpr 35 IDPR # Inter-Domain Policy Routing Protocol xtp 36 XTP # Xpress Tranfer Protocol ddp 37 DDP # Datagram Delivery Protocol idpr-cmtp 38 IDPR-CMTP # IDPR Control Message Transport Proto idpr-cmtp 39 IDPR-CMTP # IDPR Control Message Transport il 40 IL # IL Transport Protocol sip 41 SIP # Simple Internet Protocol sdrp 42 SDRP # Source Demand Routing Protocol sip-sr 43 SIP-SR # SIP Source Route sip-frag 44 SIP-FRAG # SIP Fragment idrp 45 IDRP # Inter-Domain Routing Protocol rsvp 46 RSVP # Reservation Protocol gre 47 GRE # General Routing Encapsulation mhrp 48 MHRP # Mobile Host Routing Protocol bna 49 BNA # BNA sipp-esp 50 SIPP-ESP # SIPP Encap Security Payload sipp-ah 51 SIPP-AH # SIPP Authentication Header i-nlsp 52 I-NLSP # Integrated Net Layer Security TUBA swipe 53 SWIPE # IP with Encryption nhrp 54 NHRP # NBMA Next Hop Resolution Protocol any 61 any # host internal protocol cftp 62 CFTP # CFTP any 63 any # local network sat-expak 64 SAT-EXPAK # SATNET and Backroom EXPAK kryptolan 65 KRYPTOLAN # Kryptolan rvd 66 RVD # MIT Remote Virtual Disk Protocol ippc 67 IPPC # Internet Pluribus Packet Core any 68 any # distributed file system sat-mon 69 SAT-MON # SATNET Monitoring visa 70 VISA # VISA Protocol ipcv 71 IPCV # Internet Packet Core Utility cpnx 72 CPNX # Computer Protocol Network Executive cphb 73 CPHB # Computer Protocol Heart Beat wsn 74 WSN # Wang Span Network pvp 75 PVP # Packet Video Protocol br-sat-mon 76 BR-SAT-MON # Backroom SATNET Monitoring sun-nd 77 SUN-ND # SUN ND PROTOCOL-Temporary wb-mon 78 WB-MON # WIDEBAND Monitoring wb-expak 79 WB-EXPAK # WIDEBAND EXPAK iso-ip 80 ISO-IP # ISO Internet Protocol vmtp 81 VMTP # Versatile Message Transport secure-vmtp 82 SECURE-VMTP # SECURE-VMTP vines 83 VINES # VINES ttp 84 TTP # TTP nsfnet-igp 85 NSFNET-IGP # NSFNET-IGP dgp 86 DGP # Dissimilar Gateway Protocol tcf 87 TCF # TCF igrp 88 IGRP # IGRP ospf 89 OSPFIGP # Open Shortest Path First IGP sprite-rpc 90 Sprite-RPC # Sprite RPC Protocol larp 91 LARP # Locus Address Resolution Protocol mtp 92 MTP # Multicast Transport Protocol ax.25 93 AX.25 # AX.25 Frames ipip 94 IPIP # Yet Another IP encapsulation micp 95 MICP # Mobile Internetworking Control Pro. scc-sp 96 SCC-SP # Semaphore Communications Sec. Pro. etherip 97 ETHERIP # Ethernet-within-IP Encapsulation encap 98 ENCAP # Yet Another IP encapsulation any 99 any # private encryption scheme gmtp 100 GMTP # GMTP reserved 255 Reserved #  !,   ? @@:  ` "`  .  /?㿘 !(`   Г*`@$DDD ! *   "a( ^@{ "  ? 0&  @A !(    `?"`!@@    "  ?π "`?"`  "a( `"`  p*@ "a(@ 9  "  /"      @  ߰?@ А  !( p @ !  " " @"$"$@ ʔ 0̐ b@      @ `@ܞ  "  * @  p a#    *` * ?;" `"`  pM* ?π "`?"`  "a( `"` `p*J`pi b@ 1 04a#    *` * ?" ` !   "`  @`$  `"` `p*J`p: b@  @o "a( "a(   "!(`"`  p*   @   ؀    J 쀢  @H "!(  `s*  @0   "a(!    ؀`"   s@ @ ` "@" "@ [ "!(@   !2   "   Đ "` !A  ؀   ra#N    ? 4N   rNa#@ `    r?   N   "?  ؠ?   s# @ ` "@?"  ="  ؀ ' `ؐ"`  s * J!   "   M*@  "   -*@       "   ^*@  "   @*@   "  *   ` "`@ ` k  !( "    ] _ ' [ "!(   @`p "  ?  0KB H F @cT!  "  !@ -@ 8 "!(  ` "    @Œ`䀠@ "  ۀ ?" @?!  J 䀢 s c C   @  @)l@   "!(@" 㿘 "!(% # ! ? $! $a$  "!  " " " @"!$@z @ ! @  @ .       @  㿘 ! K  ! *    ` @ @ 0$`Ԁ ?"`  "   @  ?"        *     `Ԁ ?"`  `?"`` "` `` "@ @AF! !    "   @ @-"  ` `" "` "`!- 1    F@       @ @"  "@ " "  "Ԁ@  "   "@Ԑ" "  "  ̀   " Ѐ a#!. @8  (w F"!\ `̀  "` `Ԁ 2   "`  a*`  "` J 䀢 s c C   ?@O@ \ K   @  E  J!   @ ’ ;   `?` @ 1?`Ԑ"`  * !  !    @ @o"  `  "`   "  *  !  F`` "` F"!\ ^y$%s %d%sfc -e ${VISUAL:-${EDITOR:-vi}} --㿘   @ b@ @" @ b@ @    @2 `2  " @ b@ 2@ !, 2@# `!  "@`@ ` ` " `" "   @ @?* : `ye$!*`@L `hxPDTH@ m  !F!``, e !xђN` ?  !, @;  J  JN`@ ɰ?@N   !,`!,"@"@  ' `Ȣ @J`,@  !,` !,@@?a,@ ,@  !,"`"!,"`  "a$  ! "a  ` " ` "`  "!$  ! "a @Y   `  $`@v  `"`@K`  $ N@N`@2``c  $`@`   H b@ `@Q &L?N@ c( N` w W"     Jac   J       a#J   2        N` %  N@ c@@ɒN@ y@  " N@ c    "a$  ! "a  ` # ` "`! ` @ 2! ? `   "a$  ! "a % # `@p  ?     ` ?"`  ?  "!$  ! "a  `@` H !  `@e`  `@`  ` ?"`  !      " "a "@ !$@y?  "!$ ?o"a  "!$  ! "a f"!  "!$  ! "a $`@l  `"` S"!  a!$@O  "!$ aD"a  a!$@@"@  "!$ a"5"a   w  "a$  ! "aN`  @ "    `*   "a$  ! "a  "a   R  "a$  ! "a     @4"     @     6 !  !$    *@ "` "``Ք    "  ! a" ?"@  Ā  $ $ `$(  @R $ Ȱ      "a$  ! "a     @4" !    @l    @       "a$  ! "a&!   @P"@  @j"@ `"x"`  `"q"` !$   !$@ja  "!$  !_"a  ! @ ?"  " FN@"aXF!X F!X ?`?N@ N `? !$a @v젒6  E?@>@֐ 0?"!$ "! )"!x? &5?m V a#*`: @  2` 2 J  7ac?2 * :     㬑*`:  " J   *` *`: @  2` 2JJ  J  J    L (3   @31}^(@@=<@`bT U3@@0?(0l@A3 x|34I34I ?A3n]3 "3 " BJA3{3n]3n] H 3sm3 3 ../../instbin 3(33 'ٝ3%3&-3&- gkd3-;3/q3/q V36v3:*3:*PM3 3n]3n]3n]../../instbin[b@!3+x3+x3:*Y].a3 3 3 z36!3 x|3 x|3 Ga3=03=03 }O!333  `a3d>3d>3 G!3.3.3 ta333  i>!3"U3"U3 fa3&-3&-3 ^!3(㇀3(㇀3 xra3-;3-;3 p!3/q3/q3 }Zfa3463463 ~Ɩ!36v36v3 }7.a3:*3:*3 !333 }r3a333 Xo!32323 }8T}a3 3 3 aw V!333 }p@a3n]3n]3 !3з3з3 };a333 E!3_/3_/3 }xa3!#3!#3 %C!3"3"3 }헫a3'Z3'Z3 s!3*3*3 }TVa3.@3.@3 !30,30,3 } 30a35g35g3 zF!3713713 }a3з3з3.@a3k3k3.@w!333.@j!3$j3$j3.@j3̴a3;]3;]3:,w 2!333:*:wda3Qn3Qn3:,y!3Ȁ3Ȁ3:*:'a3 3 3:,쒑!3B@3B@3:*:Z)a333:,D!3iN3iN3:*:xm[a3k3k3:,fdK!3ŀ3ŀ3:*:7Ba3!y3!y3:,E0}H!3#=3#=3:*:Ua3(J3(J3:, !3*K3*K3:*: a3.h3.h3:*ш!31;€31;€3:*:uea36v36v3:*kp4Z!38bЀ38bЀ3:*:Z  a#J@  2  `  "  J 2J  "a$  ! "a  `` "` * : a#  E#`   J    ` E  @0 2 ?@)  ?     ` ?"`  e"a    @] % #a!    3\']  J c    $!$ J `*  * Kc   $!$ K,*  +` ?``"`@# !  w * ("   @   J! J! "? @Ò @I  !    ` @" 㿘 @?* : `t (#*`@XPll |lXl     ?@      ?@ڐ    ` ` ?@1    ` ` 6?@    &ڰ 0FN@"aT N`"`F!T F!T f FF F!T a4  N@ , `?  @  2 0            ` ` 6?   `  4 0   ` ` ~?@ z   ` ` p?@  l    ?d  `a#` ?J  X  TJ    4 2H?0F   ` @    6 !   @gJ İ      % % ` İ  ??,? @GJ`"`耤``4 0?㿘?% # ! !`Ԁ @`? ? ?  ` ?"` "! 㿘 &@ "      @걒  ["  { ( )?  { } ] ?  ?   㿘# `! !d@  ` "ad!d*㿘  "` !d"` ` @vad㿘 # ZĒaȠ Za$  $  @  $  $ $㿘 `@]` ` & `& @&@㿘 ! [0!Ȑ[-!ȁ㿐   " "`"` F@"" " "` " "`"@# # ! "u #!<$a8 "" "DE! ? $a8""a@"#!< "!@ !T`E! ?@ ' E! $T! !L!L# Za$!LTZa$ !L! !L @!T` @!T E ! a<" ?"H "!X  *a\  "a` "!d㿘`7  `@` 6/?  `@` 4"` !  ` @` ! ? @   @ @鳔"  ` @"` !    @@駔 `@"` 㿘   "   @ @锔"  Ē&@ " "  & Ē Ā" ?  2?,?H 򀢠" ??  ]   a#T`( ` ` 6.` ( "'` `H 2`(2`` H 2`` 6 ` ( "H`H ` `㬀    J    Q a ??H? B`H  ? 4H 4 `( ?,* `( "# ?,  , `( 2 ` H 2  ?,  ( "H  ?  T a K  6  J "   &J . ( "   6"? ( "?  6? H 2?  6 ?( "?   7 ac??0H  㬀 6  J@ H  㬀    J@  ј?  1 `ac*?  H  ?6  -?c?!  @r$`   " !  @X  "  "! 㿘`"F? ! ?@">?"`N ^   `   !d@2 "? 0?!  @"$`   " !  @  " 㿘 !X !L*` @ @T qS qQ @)   !<"a8  *a\㿘  !`"!`@ # @6 aX$  aL* *  @{aX$$aX㿘   @     !    @T     !H@6  㿘         / - $@H2`@ :` Ħ   @' $@$@ !H2  :  ) !    @$@!H2  :    "㿘 `@g@ 㿘      !HY     ` Q `2 Āa<   `  `,@ H-` 2,@)  J!   M,@ H` -,@`  `H Đ `  2 ,@ ^,@ H``@,@`    Ha<H     !< !H6   ,@ aH`  ,@ !< !H% L@N@@ 8@=p"L@8 $8``       +     <  >% L\@  !<aH  @o a8 "a8,\ !8@㿘! !8*  "@ oܐ @  !<`@-$!8N@oѲ`!8`@$!8$ !8"!83 o a8@&a8  8!<"@@`@ "8! N@o`!8`@$!8 "!8㿀  #Fa\  !  `   $ $a\c !  " $   Đ#\#`  sO! @a?0H*?  "`F "a\o  "`'E. @@#    ڀ    "@ $   `"`  "!$  ! "a "! "  㿀  !F!\     @  $!\ ! #Fa\ 2 !  ` S $ $a\  `X$ `    Đ#\#`  rš`@԰?0z:@@̰?psKz 0i  .`sZ @ @ @,`sM @ @k "`@@0.`@@b  @rF "a\`?!   "` "`^ `?`F "!\@J? / E K r  "!$  ! "a "! " / 㿀#\#`    r5 or  @>?    H     M-㿘 J!   1nI!Ȱ   n- ^ @n*㿘 " !D  4a@㿘@n n 㿘 !,!,    TaȐ @ǔ 㿘@&-lillegal signal number: %s%s -soption requires an argument -- s0illegal process id: %s%s㿐@5  @4?`@1@tb耢 2=@? `@% 0a@Jac  2@@@@ @ J   1b@@4?? (,@@,b, 1#@ @k @!@g 1@3c 2@? `1@d.# @@1@#cH 3 @J@ -0 `&@J`ac   @R6?0@Jac   @ J   1b@@(?@W@?`  @ # '1%1@@u @J J  P@c@  @॒?2?h@c@ ?`@sig㿘2bx@ٔ  "  ,". @   . ?unknown signal %s; valid signals:㿘2"@ca@ !`@  㿘 )1,"%2#2, #h@i  @cH@^  , usage: kill [-s signal_name] pid ... kill -l [exit_status] kill -signal_name pid ... kill -signal_number pid ... 㿘!a!`2@-c!`2@)c!`3@%`!`3@!`0@e 㿘@ssethostnamegethostname%s 㾘@Ѡ #3@ݔ`Ѐ? s @@Q#&*  @@5@ " @@@  3@;n`@{<!   3@;e` 3@ƒ . 2*3 @@  usage: hostname [-s] [name-of-host] 㿘a!`3@b@ _HiStOrY_V1_  "    "    "  "    "  "    2  㿘 "@ @@  @`@ƒ @  "  @1㿘@2` @ݥ`"``` "` @`@ ?& 㿘@Ր & @i "`  "` "   "`  &   &  㿘  & &@    @㿘@ܩ `$ " " " " " " "" &㿘   2& & 㿘@܋ $ޒ 3"& 3"p& 3"& 3"& 3# & 4!& 4 l& 3#<& 㿘 3"@ 32 ?`6?  㿘` "" ` " ` " ` " ` " ` " ` "  `  @ !3"@~ 3"p& & 3"& 3"& 3# & 4!& 4 l& 3#<& ?3"@2`p`& `& ` & `& `& `& `& ` &  r㿐?4@Hc @D3b`@@  @C @.@€.@ @=w%s㿘 5@`H3?"`@j @ #5`P@ @ @㿘   @2 㿘   @2 㿘@   @֔   @ 㿘@   @   @ 'L'P'T'X `{L5"X.`@׌xּ֤֜dP<(  €\      @O @0J&AFO<Fn<y72- ''''''''' F?"bbf㿘&" &",&"$"0@^", ,@  0 (   *  ,(  (: ,@" ,㿘 (@  , 8"@ `"`"d@  ( (*@` ,@( @ ,"& ,㿘 (" $ *" `"`"d@ ( " ("*@` ,@( @ ,"& ,*?_-.[]~=㿘a#@   6@!Ȁ  a 2   㿘? ?0 "? *㿘   0 "  8㿘'#a@@ @2"@`@ "@ "@:c@  "`@*@@(㿘65ab@ @ @  @8@@@ @2`@`@   `@  2`2b@@:㿘"@ ""@"\&"`"@&"@"D`, (  " "D& (@v `"@  ` ` ` `&"  &" @* (&",&"(5 a# "    : " :   㬐  :  " ـ ?㿘@*$& $ @”$ $& ( $& , $#& 0@$&"0 @ܵ$&" &"$&"( $&",&"@ $&"D $&"H@ $&"4 @ܥ$ $&"<"4&"8"\&"`& 4& 8& @ & < ". D&"T?&"L@ (&"P  $" ( $" ,"" ""$""( $"",""@ $""D $""H $""<"\""`" 4" 8" @ " < "* D?""L""㿘@ $& $& 0@"0&"0@"4&"4@"P&"PՐ㿘@H"? , 0 ? N@`& (@*@`N@ 2 ( 㿘` $@ (@  ("& ( $ *& (㿐 /@В @] @ O 7    / #"*O # 4  ( $* $& , $& (" ?& (* (& ,.@?@0 .@  (`& (*@ (& ,@/O .@ ( $2 (  $ H " ( :H ("?㿘@ ,* 㿘`"X  , <  0 * <O   4 "$&"$"0 ( *@ "0"$*@[ ?  (`& (*@& 8@P) 4    <&"$"0 ( *@  <&"$"0"$*@9 < < < (`& (*@ <??& <@, 4 2 @)F  㿘 ( $@2 (  $ <6rԠ ( "4 @*` (@ &"8 ( "@& ( $*& ( 㿘 ( ,@"p  $@"  (@2 ( ?& ( < ( ,@ *  $@& (  ("4*@` ,*""8 (" , 㿘 ,& ("p 2  & ("@ "  㿘 $& ("p 2 J@a#@ ` " "@ (`& (J`  2 ("@ "  `(`, `$ `("`(`$`(  `(H(`(( 㿘 ( ,@* (  < & ( , 8& ("p 2  "@ " f 㿘 ( $@2 (  $ <6& ("p 2  "@ " K 㿘 ( $@(  <"@& ( $ *& ("p 2  "@ " 1 㿐@$n@ @$    㿘a#@  "<  8 " , D 32 < А"@@4-  <*` * ?А& <$   0 * 4  ""$&"$"0 ( *@ "0"$*@Ԓ   (`& (*@& 8@ɐ a@"  8 <@(  (Є " <" < " 8 㿘@@        㿘@ ,`& , *@ ,*"p  $&"H 㿘 ( $@   < ( <" & ( $ *& ( 㿘@,@  㿘  㿘&"  ,*"  " $@x#"*# , $" " &"" < &"@  @@<  㿘&"  ,*" <" &"@ &" 㿘&"@&"  ,*"  _&"2"" $@:#"*# , $" " &"" M "" &"    @ @  "  &"   `"@$" " $ , @"   , $" L @h 2`""  &"   " &"@1  㿘&"@&"  ,*" C " ? " &"    "9 @:# % $ , @؝"   , $" L @ 2""  &"   `"@݀ 2 &"@" 2&" @ސ 㿘ː (J@ " $@* < $J@ 2 <? & <@ :J@ < #  $@ J@ "`@ :J@` ,@ J@   ` @ *J@& ( 㿘 ( ,@: < ,J@ 2` <? & <`@ *J@ < `  ,@ J@   ` @ *J@& ( 㻘 $* $& , $& (͒  (`& ( *@ (`& ( :*@ (`& ( *@@ ؐ@*| $* $& , $& (@ ?  㿘@e"! @"V`& & @a&a!`& @t@ D@@Ӑ"@ @@ @ڐ&  㿘 @@x@ 9@@ސ[@@@ @@F@D㿘@!+bindtelltcsettcechotcsetty'L'P'T'X` |L<#`.`@@ 0g@x0c@E0_    ?& V  * `"?$*`4= <*`@Pp<#' @602<#' @0*<#' @0"<#' @Ĕ0<# ' @!0@\@ 0@V0? $/.editrcrHOME㻐`%=!I=@|ҒaX @ 21?=@!`"+?@#/@$"=@aH=@|aX"?@;l@   *?@?@?㿈' ' @U@^耢 @ @G ^D㿘 ( ,@ $@ =b@  @ð 0 @Z  ` < ( , 8& ( 㿘 ( ,@2 (  , <6˖Ԗ (@ "4 @*`@ &"8 (;"  ( , 8& ( 㿘"8"4@"" "8"4"  ,  0 * ( &"< ("8"4" "4, `"8@* @ < "& (  $"4*@` ,*""8 $" , $" ( 㿘"< 2"<)  (  "4 *@"< `&"8 ("  "<"4*@` (* &"8"<" "<& ( "<""<  ( "4*@"< ` ""8"<"4*@` (*""8 `$`(  `(H(`(( 㿘 ( ,@2 (  , <6 & ("p 2  "@ "  㿘 ( , <6Ԗ ( :& (a\Jc@   *`@ `* *J& ( ,8& ( 㿘 ( , <6ЖԖ ( :,& (a\J#@   `*`@ `* *J :& (a]Jc@  !,*`@ `* *J& ( ,8& ( 㿘 ( , <6Ԗ ( :& (a]Jc@  !,*`@ `* *J& ( ,8& (  (""<  ("<" (""<  <Є@4  " 8 <(" <  " @  4`?" 4 㿘 ( $@2 (  $ <6'Ԡ$@ : & ( ,@: & ( *@  `& ( 㿘""@ s  㿘""@ k  㿘&"&"@F$&"&" 㿘@_"&""""" 㿘" 2" $"@# $*#"""  $ & ,"p 2N ,L $ G "" &"   `; ""  &"   `"-&" "&" $@z# $*#@~ $ $ & , $@("pJ 2 ,& , ,J 2 ,& , , $ *& ,"p 2 , $ & ( %d %s㿘" 2"!?  &"   " !@"  @&""  &"   2" 㿘@Ц$&"&"@ 㿘@н"&"&"*"""""㿘@i"&"㿘"@key_add: Null extended-key not allowed. key_add: sequence-lead-in command not allowed 㿘N@  @@ђaX02 " 2" @@ƒa0 2"@SN@&""@㿘@ "\@"X  "X@ "\ @ @key_delete: Null extended-key not allowed. 㿘J@ 2" @@b? " @" Unbound extended key "%s" 㿘" 2"N@ " "*@"@  @ c0@]㿘N@N@2``  @&  . ` `&` 2.``2N@& 㿘NN@@"`   N@ J@ "  ` 2   2 @N@$  `N@ 6 " @}&   "    0     " @ϯ@J&  "0 0& @\& @4 2 @pN@&   㿘LN@@    N@J@ " ` 2 $ ``N@ 2 ` $`  ؒ 2  2 ` &$`$ @  㿘 # &    "    0    @(@@$㿘@ * " " " " 㿘"2?N@ 2N@=( @  "@  `N` 2?" "* "* "@d `д ?Some extended keys too long for internal print buffer "%s..." 㿘 ""*@"* B@`h B`@ "' `2""?@k@` " "* "* "`@``` ϔ``ɔ %-15s-> %s ""[]no input㻘2 F""t0"!F#B!B!@l   F  20@ cF cB@  ^( ; @a   ^( . ?,@^\ \( $ ^  \(  aH` \( \( :0( :0(  0( J*@`J2  ^* @*JGa ^ ? \c " J*J0* ,@^\2J*#  cH2* * (80* 00* 0* J J" *J** 㿘@{!&"X@x!&"\F#&"dG!&"hG &"l@l$8@%R&"t@$8@c!h@%L&"x@!h Z&"|@e 㿘@s"X&"X@p"\&"\&"d&"h&"l@j"t&"t@g"x&"x"\ a H2*㿐"\"X @ /   $ @ $/ @ /   $ @ $ "p   //  @ "  "  /l @   $ @O ,@ 㿘"\"X"l"h &"p"\&"`Y @ , , ``$ @ @5 @)㿐"\"X"d&"p"\&"`>  " , ,@ ``$  ///# (J @  @emacsvi㿘D@'` ʐ  D@` ? %s -> %s 㻘N N D("t @D  20  a0@0_%-15s-> is undefined %-4s to %-7s-> %s 㷈////@ "2"t<Be D@a01  B)D!@ 2  MH!@0 2@@ !B!B4@Standard key bindings Alternative key bindings Multi-character bindings Arrow key bindings 㿘 D@\c0  "\ @ ?  $"\"\? D@DcH  "X @ v?  $"X"Xm? D@,ch!D!( D@$c@!(%s %s %s: Invalid switch `%c'. %s: Invalid \ or ^ in instring. %s: Invalid \ or ^ in outstring. %s: Invalid command `%s'. 㷘 ?"\   R E!#EJ -L,  ?* :  8* @ P(0#"X!   Z s "t`@  2  E `@J , 2J,  5 , ,  @   EC` @,}?L`  @ @ 2 @ޒo  "k-@ ,   @$` b[    ", 0ON, @]   E`@AC? :@і, @1#@d?  Ea @#%? @ L`   3 @  -@ N @-@@Q 㿘"|` 2"x$?@, &"x, @"t@ʺ*`&"t"|"x, "@"t, @*`" "t " "t "  "t, * "@"| &"| history㿐@"j @"@'@"㿘`$.?@{ :",@   G @  G"  G", @@  ,  2, ?J"?J\z^ Ѕ(8FFd(TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT6 4 2 0 . , * (   JЀ* Ж??2J a㬄" JJ? J#㿘'HHJ \ ^ ".HH0 TH?2.  'H . 㿘 "t@ے 2   ?G"H㿘"@  *` @}:`L  "&""&"G8"""""" `2""G8"""""" `? 㿘"T "!@2&"T!  㿘` "L  &"L"P* "@@F@㿐@6 " @/ "& @?."` 2"XQ  0"X@ɍ"X  "\&"` "Ӑ А.@?㿐 @kbL 6 !* @J 2$ *` " .@ *@J " $@7 ! \ ` @ϔ ?2 .@` `"0 2.@ ?.@㿐/  @B@t@H"T i?F"|@?"x*@€O `.. D*`"""# ""x"""& <& 8@("?@֐@Ɛ& <& 8@?  , $"@@1@z& <& 8& <& 8@ f@?@@  `@&`2&@   $㿘a#@J  5`  ` @3 &"" ,&" a@) " 0!#@   @ ^` ?`@@ \>` `@`0>` `@ `0``0@" ("(""" H  " (( """""㿐&"&"?''Y  $"'"'L  ,* (?2""'"'"&"Ē  ,` @@  @@K H`"@$ " "@@ 4&" @ @   ,`@@ S *`" @"&" @ o@ 㿘@ f" @ @ @Ґ@`$" @4`@ @ ?"  *?*@ @ @  `  (     *@ @  @  *  *@   *` 2J@㿀''K@   J 2J M   J 2   *J /@K 2  : 'K? 2'? *K?'+M  L 0?JK@8 M 0-* : K@2$  &@JJ@2 &@*J&@" 6  *`#@$     *KL 0-* : J@2$ &JK@2 & *J&" 6 *`"@$   *J'@ %'$%@%& P  %%%@@ P䀊 &%%%@@&䀢 %%'$%@%&@ /-" H '@ c$䀥@ P%  H%$@ ٔ%%@ Ҕǔ06+ %@ ; @ Ӓ H%@ @ %'@ @ " 0i&@ @ @ @ %@@ %@'@ @ o" 1'%@.+@$䀥$ @ Ք%  H%$@ ^ %@ VK@&@ @ %@@"%@@ :  J@*`    *  *㿘"" $ (: Ha# ( J ' *:  2 * !   2  :   "*    :  J     $ `  `*Π @@P@ ~㿘@ r  *` &  *   H@ &   & "  &" @ \ @ Z 㿘 (J  ,@,`00: a#@   ``@ ?ʒ ^, :`,`: a#@J   \,`<  ``0<   0 ``0@ #" "  *`(` L@& "" 㿘 P @ܒ  @w@ K H " @m 0@j" @  @  㿘@@$&"&"?&"."&" 㿘@U"&"㿈@%f  @; 2    @; `?@㿘"㿘 D? ""p  "`"X `? (@ $" #&"#&"" "@un $""*@@p"&"*[]?㿐 (G "\ "" ,  0 Ϥ"  G :*b\"&"" .*@ "&"" **@   , & , *G "XG"P`& , *@ L  ,`& ,G "\*@"`"@ : , ,`& , *@ "" * , ,*ђ ^  "` @?`'JM!*`@6|66$66$6666666666666666666666666666666666d6p"#("&""*@  ,`& ,P*@ g  d " 4`0O ""  U MGQ IG@rM , ""  5 ( & (6 , Ԡ (J@ "& ("#"&"" ( *@  ,& , (`& ( @* (@*J@& ( ,*I ,@8& (L#@tIL  "*b`Ԓb`  , $@  J@  & ,*@ , $  ,*"?"  ]/"(""L [ ]2? / 8L" }O [z "2!"GJ"\ ?#&"&"` Z2  $ , (? & ("&"" .*@ "&"" **@ ""*@ ( $@  ,@ "`@  ` 2". D쓒   `  2 $ ,& ("`@"?&""*@ ` G@"" & (&" "= & (G ? :*b\I `  `GJ"\ ?2``:" ` G*"\&"" `&"א  `  & ([2 ` ` "(" `㻘 ./ */ $* $& , $& (&"&  (`& ( *@ (``& ( / ?*@2F  <3*<" 2 " $* $& , $Q& (J@ .8 *6@s9#/" .*" ** " @s- "* "  &""* "`&""* ""*@@  .*@  **@ *|"@s  "* @"&". D $& ,` & (붒  0  ̐  Đ ,`& , *@ ,* 㿘 (  $' 2 & ( $    2& (N 2 0 㿘. D $`& ,`   ͒  ^ 㿘 (" $@ J@"@ 8J@2J@ $@* J@ 2& (2`& ("@ 2 (  & (U 㿘 ("` ,@ J@"`@ *J@2J@ ,@*J@ 2& (2& ("@ 2 (  & (# 㿐? ' \ "b0 *@@' @̔  G0!G@ J"d"d꒒ "d@I GW"dG@$"dG"h? G"h*`  G`*` ?*`G"d"*`@ƒ  @Ó  @Ȓ㿐' ' '@ ' ' ' ' ' ' @k@H $&"G"h? ?G"h"*"@* ?2" @S  㿘@M"&"㿐' ' '@ ' ' ' ' ' ' @(G"h? G"hP x,`@@`"",`?,`G""d @  㿐' ' '@ ' ' ' ' ' ' @G"h? G"h",  " @ , ?2"G""d @ʔ cursor up multipleUPcursor right multipleRIcursor left multipleLEinsert multiple charsICcursor down multipleDOdelete multiple charsDCvisible bellvbend underlineuebegin underlineuscursor up oneupcursor to status linetsbegin standoutsoend standoutsenon destructive spacendend attributesmebegin boldmdsends cursor upkusends cursor rightkrsends cursor leftklsends cursor downkdinsert paddingipstart insert modeiminsert characterichome cursorhocursor from status linefsend insert modeeiend delete modeedstart delete modedmdelete a linedldelete a characterdcclear screenclcursor to horiz poschclear to end of linececlear to bottomcdaudible bellbladd new blank linealMTTab chars destructivextHas meta keykmNumber of columnscoNumber of lineslihas physical tabspt㿘& P! "  ` `@  ` " & P `  P "& P`@& P \ "& PJ 2`& P \  " \J 2 ` \ x "& PJ "& P`& P \ 8  J 2  \ 4 " \J 2   \ " PJ " P  P@& P \ h " \J 2   \ "& PJ "& P & P \`T" PJ " P`p`"  PJ@ "  P@{   ?& P \`TJ `\` J@   P@{k " & P㿘@(& T@ݐ(& d@ڐ @& h& X@֐ & \ @n @А & ` @h G "c@M @? 㿘@ T& T@ d& d& X@ \& \@ `& `@Out of termcap string space. 㷘 \G"&@>`.`@N R$@  @4 X@e90@`'3 T  ``"@" @  *8`J  *8` * T@(`'& X S@`0  T X $@d X & X㿘@> ` & H@| & L@㿘 H L @0*   L6 `@@' , $  `&@`* $& ` @*  @ , $  `&@`* $& 㿘 `& @  @  @ `& @  @   @㿘 @ \ L@X&@ ``  \ |` J@  @X'6A& @k  9&  \` " \J   4  \`h " \J  \  @WX@z.&  \ h "& J   6& %X  \ h @z & \& 㿘 @ H @`2 @ {& &@` ` \ ` `J@  @WE`1`$ P \ `"  PJ@  @W2 P `  "  ``@  `&   * @ @ @:&@ 6&   $ P \ `" PJ@   @WhX@y &  P  >``@  0  @ &  6 &  @  & 㿘 H  N@@`  & 㿘`R P N H@J \`x " \J `4  \` " \J   \ x@W . \ `"  \J@   X@yA \  " \J  \ !X  @y/" \ $` J@   X@y㿘~ P z Hv \` " \J 4  \`4 " \J 2 \ \ @VX@xm0T \8`/!XJ@ ", \( "( \J #  X@x۔ & N@@`2N@ \ <`"  (J@   X@xŔ \ ( X@x0" \ 4`" N@J@   @x"N@@ɲ`  &  \ <`" J@   @x"2 \㿘 P   \ ` J@   X@x0 6  @   @& 㿘 \ "  \J   ``X@xk0" \`0J ` J   ``!X@xT" \ ` `@xN"0@e @c 㿘 \ t`" J@    \ ` J@   X@x00@G TERMdumbCannot read termcap database; No entry for terminal type "%s"; using dumb terminal settings. 㷀'@' @`'V@!VN@ 2 dV! d @( d@V 40R?  V@a   Va8@ V@a` ` P"` `" " " ``"`G"" "= ` `@ 2 `@U!X `"@R@U  `"`R@U! `"` R@U  `"`R@U!  `"`R@U!8 `"`G"" " `@@UXZ`@  `` 4 ` P"` `` 4 ` "` ` & L ` & Hb@@= @ @% 㿈 ` & ` &@ `h@)?  2& 2&@ `h@耢? ꀢ 2&耢 2&@ ` @  @@  㿘 `"` P"` ``"` "`N"downleftright hW8    ( Q    ( W@   $ (( ,WH 0  4 (8 <㿘 h Gc  Gc  8H` < (H` ,H` H` H`  <H`( ,"p 1Gc Gc H` <H`  ,H` H` H`! <H`) ,㿘 h . @vu@  @"`"`  . ?㿘 h  . @v^@  @"  . ?㿘 h N@ , @vG@ 2  , @  @ S  $N@㿘 T W h"\ S"p 2"\"X2"d"h= , \* @ "<L 7  `A.L  "  @  `2 ,    , "2#,` , `,  ,㿘G@c㿘G@# Your terminal has the following characteristics: It has %d columns and %d lines It has %s meta key ano It can%suse tabs not %25s (%s) == %s (empty)㻘 X@{bH X@wbh ` Xb@p P @X"X" X@db P X"X" X@XbG""   \X#-D+X  ` J@  (c@9    @a  yessettc: Bad value `%s'. 㿘"? "? }G""  @u& "    b G## " @u  "   MG# )Y@t`h  G#$:  `*  "X@tbЀ Y `p@ɔ+?G#$:  `* "@ϐ `@`Gc$ :` `*`"  ` & L ` & H2   ` ?%s %d tabsmetabaudrowslinescolsechotc: Termcap parameter `%s' not found. echotc: Warning: unknown termcap %% `%c'. echotc: Warning: Extra argument `%s'. echotc: Warning: Missing argument. echotc: Warning: Too many required arguments (%d). 㷐  p' lJ@ -2 J` s v"   "d J _Y@tCb 2H , P XY h" @@K Y@t.bȀ 2 H , ` YXY@tbЀ 2 H `0@!/ Y@tb؀ Y@t b 2 H ` `0@ Y@sb耢 GH ` `0@  "$:  \* @""   @s G   @QL  2? Ybn Z"+YL %c  ?ۑ* :  MU* lkkkkkkkkkkkkkkkkkkkkkkkklkkklklkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkklkkkklkkkl` c  @HL L  %`"``") ".% J KV  2J . @^~J 5@P= Y c@  J @^_ J  2$? Y@cx?@^KJ  2? YcP@ ?@PX@r chars:lflag:cflag:oflag:iflag:timeminstatuslnextdiscardreprintdsuspsuspwerasestopstarteol2eoleofkillerasequitintrextprocaltwerasenokerninfoiextenpendinflushoechokeechoprtechoctltostopnoflshechonlechokechoeechoxcaseicanonisigmdmbufcrts_iflowccts_oflowclocalhupclparoddparenbcreadcstopbcignorextabsonlretonoeotonocrocrnlonlcrolcucopostimaxbelixoffixanyixoniuclcicrnligncrinlcristripinpckparmrkignparbrkintignbrk㿘  @!?"?!&!l!&!p!&!t!&!x!&!|!&!!&!!&!!&!!&!!&!!l&!!p&!!t&!!x&!!|&!!&!!&!!&!!&!!&!!&!@!l&!!p2   &!!t ##`?&! t!l*@&!l p &!l !p*@&!p | &!p !t*@&!t  &!t !x*@&!x  5&!x!Ѐ!$!@r!R  aR " "  a9 2*a9    aR " "  a 2*a   !l@s!   @묔?2 %?!l@g!  !*@&!  &! !*@&!  &! !*@&! Đ &! !*@&! А &!!@H!9 㿘&! ."H l`4@ H! `@ K:㿘@w @p *@ *` *` *` *` *` *` *` *` *` *` *` *` *` *` "*` *` !*` @*  `*  `*  `*  `*  `*  `*  ` *  ` *  ` *  ` *  `*  `*  `*  `*  `* " `* `* !㿈!9!//"\"p "X"l"h"d H!4!4?9@/  /*`:`* : @"$ 6O , /O"p , $O ,@ O"p ,@  ?2@㿘! 2  @D!Ā?"?!̐ ##`?&!K!&!H!l! !lB!! !l@!@!!@!@!!Ѐ!" !!t@"!&!t *@&!t  &!t!&! Ȑ*@&! Đ &!!!x@"!!@"!&!x *@&!x  &!x!&! Ԑ*@&! А &!!!l@"!!@"!&!l t*@&!l p &!l!&! *@&!  &!!!p@ !@"!p&!p *@&!p | &!p!&! *@&!  &!!p " P&!2  &!!ϒ!R  !R ! @ :  ܑ: 2   R @2*9 :  "*a9$ ܐ !ɒ!9  : 2   R @2*  :  "*a $ !l!   @!? &! ?㿘! 2    @Ԕ!l?"?&! 㿘! 2!> &!!&!!&!!&!!&!!&!!&!!&!!&!!&!!&! !Đ*@&!  &! !Ȑ*@&!  &!!!̐*@&!! &!!!А*@&!!  &!  @鑔!Ā? &! ?㿘! "    @~!? &! ?%s: Unknown switch `%c'. %s%s %*s%c%s %s %s: Invalid argument `%s'. 㿘  *?>`9 J@ -6J` 2^J d" q a  x"       c`J? J -J "J? x? H!! b ^#/D*" *   ^#( * *  @l ,* @ l,*  p  @ `  t  `+ -`"& @`   H@ ^ c@(,`: ^ c@  ^c@  2  ^@cv ^ c@?0m"l *" * *" * *" * `^J@ + - @`H!!   @n "   Α,`:  + - %*` *` *  p @ " p *` * "*` *   p* " p *` *  t @  *   p* " p *` *   t* " t "@"! (""@""D""$""("0 $*"(""( ,* ""  $"", $" , $`" ("\""` ""D""@ 㿘"$ " `2  ( ( ,@`& ( (ռ  (   , @    㿘ޒ 㿘ג  㿘 ( $@  $ <6z"& ("@  ְ 㿘 ( $@  $ <6a!& ("@  ֗ 㿘 ( ,@  , <6"& ("p 2  "@ " | 㿘 ( ,@  , <6!& ("p 2  "@ " a 㿘 ( ,$aJ#  & (]!,a#  "  ( (& (\ * * & (*  㿘   $" (""H ("", "" "\""` "\""` " 4 ""  ("",""$""( "\""` " 4 ""  ("",""$""( 㿘 <"\&"` 㿘 "\&"` 㿘 "\&"` "\""` (""H ("", ""  "\""` ( , " ( ,8" (   (""H ("", "" "\""` ," ( ,""H ,"", ""  㿘  㿘 ( ,@2 (  , <& ("@ 2 (  & (է 㿘 ( ,@2 (  , <& ("@ 2 (  & (Վ 㿘" l"   "  " "s  "  @ ,  ,( ," & , & ( $$p$" $   @ ,@`, & ( ,: @ ,@`,  ,6  ,@` ,  ,(  ,"& , & ($0$ "-  & ( @C $$$ 2  & ( ,"@&   @ ,@`, $ ""H""@""D" 8", (, " 2""$""(" 4"X""` ( $" ( 㿘 8  <"@@*`  * ?А& <   $& ("@  Գ 㿘"H "  ( <" "H@ ӵ  ( <" & (  㿘=b=  㿘 $"4*` (@* @&"8 ( $ӑ"  $& ( 㿘  㿘  㿘" "  㿘" 2"     췐 㿐-  &"."O <  հ 㿐 2 &"."O <줖  ՚ 㿐 O <ɖ  Ո 㿐 O <쀖  v 㿘N" 2"  N" <좖  N" <e 㿘N" 2"  N" <싖  N" <N Editline extended commanded-commandMove down one lineed-next-lineMove up one lineed-prev-lineSearch next in history for a line matching the currented-search-next-historySearch previous in history for a line matching the currented-search-prev-historyMove to the next history lineed-next-historyMove to the previous history lineed-prev-historyFirst character in a bound sequenceed-sequence-lead-inErase current line and start from scratched-start-overRedisplay everythinged-redisplayClear screen leaving current line at the toped-clear-screenDelete the character to the left of the cursored-delete-prev-charExecute commanded-newlineTty allow output charactersed-tty-start-outputTty disallow output charactersed-tty-stop-outputTty suspend charactered-tty-sigtstpTty quit charactered-tty-sigquitTty flush output charactersed-tty-flush-outputTty delayed suspend charactered-tty-dsuspTty interrupt charactered-tty-sigintIndicates unbound charactered-unassignedDigit that starts argumented-argument-digitAdds to argument or enters a digited-digitAdd the next character typed verbatimed-quoted-insertMove to the left one charactered-prev-charMove to the beginning of the current worded-prev-wordMove to the right one charactered-next-charExchange the character to the left of the cursor with the one under ited-transpose-charsMove cursor to the beginning of lineed-move-to-begMove cursor to the end of lineed-move-to-endCut to the end of lineed-kill-lineDelete character under cursored-delete-next-charDelete from beginning of current word to cursored-delete-prev-wordAdd character to the lineed-insertIndicate end of fileed-end-of-fileEmacs incremental reverse searchem-inc-search-prevEmacs incremental next searchem-inc-search-nextCopy current word to cursorem-copy-prev-wordSwitch from insert to overwrite mode or vice versaem-toggle-overwriteAdd 8th bit to next character typedem-meta-nextUniversal argument (argument times 4)em-universal-argumentExchange the cursor and markem-exchange-markSet the mark at cursorem-set-markLowercase the characters from cursor to end of current wordem-lower-caseCapitalize the characters from cursor to end of current wordem-capitol-caseUppercase the characters from cursor to end of current wordem-upper-caseMove next to end of current wordem-next-wordExchange the two characters before the cursorem-gosmacs-trasposeCopy area between mark and cursor to cut bufferem-copy-regionCut area between mark and cursor and save in cut bufferem-kill-regionCut the entire line and save in cut bufferem-kill-linePaste cut buffer at cursor positionem-yankCut from cursor to end of current wordem-delete-next-wordDelete character under cursor or list completions if at end of lineem-delete-or-listVi repeat current character search in the opposite search directionvi-repeat-prev-charVi repeat current character search in the same search directionvi-repeat-next-charVi move up to the character specified previousvi-to-prev-charVi move up to the character specified nextvi-to-next-charVi move to the character specified previousvi-prev-charVi move to the character specified nextvi-next-charVi repeat current search in the opposite search directionvi-repeat-search-prevVi repeat current search in the same search directionvi-repeat-search-nextVi search history nextvi-search-nextVi search history previousvi-search-prevVi cut from beginning of line to cursorvi-kill-line-prevVi list choices for completion or indicate end of file if empty linevi-list-or-eofVi move to previous character (backspace)vi-delete-prev-charVi move to the beginning of linevi-zeroVi enter command mode (use alternative key bindings)vi-command-modeVi undo last changevi-undoVi move to the end of the current wordvi-to-end-wordVi move to the end of the current space delimited wordvi-end-wordVi delete prefix commandvi-delete-metaVi enter insert mode at end of linevi-add-at-eolVi enter insert mode after the cursorvi-addVi enter insert modevi-insertVi change to end of linevi-change-to-eolVi substitute entire linevi-substitute-lineVi replace character under the cursor and enter insert modevi-substitute-charVi enter replace modevi-replace-modeVi replace character under the cursor with the next character typedvi-replace-charVi enter insert mode at the beginning of linevi-insert-at-bolVi change prefix commandvi-change-metaVi change case of character under the cursor and advance one charactervi-change-caseVi move to the next wordvi-next-wordVi move to the next space delimited wordvi-next-space-wordVi move to the previous wordvi-prev-wordVi move to the previous space delimited wordvi-prev-space-wordVi paste previous deletion to the left of the cursorvi-paste-prevVi paste previous deletion to the right of the cursorvi-paste-nextI J!`(`$2```"`$`"`` (`"`` ( `"`"``$"`$ 㿘@ (h#@5$$  $ @ ($ "@ݐ $  $  $  $ $ $$ "  "  " " $" 㿘@@ @ @㿘i!  L '  ' \ ""$ $4 $ k P $ ?, $ ? $  ?& $ *  , & & ? & $ `i!d*`@Lx&   ?& $ `i!*`@ y&  v&   &  *o& e& ?& $ `0i",*`@T@ $ & $X&  $ & $ `Ni"*`@ $  ?& $p  & &h f d )& ?& $ `)i#*`@0X@XoL "   `&  \*@&  `&   *@&   &  *3?   *!  " @$ @"  * "  &  &  & @& &     &  @*`& /etc/fbtabr /dev/%o%s: bad entry: %s(null):㻐j xj@O`gj j -j$@P Y@W #2,@ަ@j`@ߔ  "  @ޗL 0 j`@ߌ  ` a   @~ ` j  @,}@cԒ @hȠ@% @\Ƞ@g/*%s: chmod(%s): %m%s: chown(%s): %m%s: opendir(%s): %m...㻘@@j"@c .@2`   \"0  jb@,,@ = \"0 9 jb@Wp$*;@bJ -j jbȔ@, 0!+j@#@f  @cY @cTb耢 @WJ%0@cvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth Edition4.1BSDSystem VVersion 7Version 6swapunusedadoscd9660lfsmsdosffs%s%sr%s/dev/%s: not a device node%s: couldn't read disklabel%s: bad filesystem type in label㹠@yK 6 `nk!@*ڒ < @@ `0#@V$/@ $kk@pƘ @@@v ;@@ a ,{`;k!@*T @y ! \"0 `@@*{@y 6`k!@*5 k!@*. e`e@I  `k!@*s@_ @[. :  4  `k!@*U . :  4J#4*`@N` %sr%s%c/dev/%sr%s㿘&@x5 \"0 1 L@ /,@!  a!!lxl@p6!@x  \"0  ! @ ! a* !@x !&  \"0 L@ /! !!ll@p!@xg!&$Id: logwtmp.c,v 1.3 1996/06/17 07:46:03 downsj Exp $/var/log/wtmpl"0 @xH "@+p А@U ؒ@U @U @A@\ $ $@dݐ@$Id: logout.c,v 1.3 1996/06/17 07:46:03 downsj Exp $/var/run/utmppl#( @x  ) А@G $ $O؀ @R  @Kݒ @Kڒ @A??@ @ $ް @]$Id: login_tty.c,v 1.3 1996/06/17 07:46:02 downsj Exp $㿘@ٵ`a@$ ??@ @ @  $ @2 㿈 ' ' '  @| ?㿈 ' ' '  @h ?㿘` V@~V VV " @ @ 㿘  @ VV @] ,`:  (* @*`V *   *:  ?,`:`*` * @;"   ,: ? (%@2 $ ,: %,`:  (* @*` R 4,`? ,`,`:  (* @*` 2,`:` (*` * R%@: @&2`* : V   @= K  (㿐V`@H 2y  [ \  @a**@ @KіK (  [ "aN"R  \"" \ "bN"" """!"! """!0"" "!N"R   [ ["䀢 ?o@b [ \R!@ R`? [3 "䀢  ! [N"R  \ [!@R`! ["V"@V"`@6V"" N"`< ## `4 `?*! ["@* @"@  @"" [Ȁ [  ("* ?Ȑ㿘 N  ,`"* J 1,`"*  J ! %N"R`  c0 @eӒ @_ٔ,`,`$,   @  K 0"`  @9? " ,`"* * ``$N.N"R` N  NcX"#T @_㿘 [" Ȁ 1 [?" J` 2   " @ 㿘 [" Ȁ 1 [?" J` 2   " @ 㿘 [b Ȁ  ?* b Ȑ *@㿘 [" Ȁ    "쀦4P?`K??o . $,  # @S2b  @Lbb* b, @-.  . . . "@*`@` " 2 . "@*`@@  "@*``@" `@ . "*  *   [Ȁ ( ?㿘1 [" Ȁ`  *`" @ " @ ?㿘 @  [bh"` "N"R `  " "N"R`  R`@R`$$ ) ' ,`$,   @"쀤@&  ``, ! "耢 2`$   ,`"* " ``@```,` 6`@: `$   ,`"* " ```2`@``,` , $ @?   [   ?K 0 K0 0 K0( 0  [ N  \   \  $ [  ܁ 㿘@ϐ㿘! [ @! $" [N""` 2`2`?"`"`"`  *`* " * ?*`* * * a!"`@{*`. .`: :` @  \ Z"b$. .`: :` @ۖ  \ O"`  [" \"$" \` " *` *  K \b8"8b8 % .`: 'K8  "? 68. :  @  €?8 $8   [. : "a.`:`@  [` "! ["@"  v"  ^" "!"!$" "!"!"!"! *"! !"! f"!N"#P  @]`N"#, y@M  sN"q  Z#, ?Ց* :  Sa* ,J*`  "@    *,㿘@  (,`@*` V * - : ?$2 @7  $ - - : ,` (* @R`  (?,`* @2` (,`* @R@$: &2`V @?66  ?6 @8 㿘 @6Д `M.: .: ",: " (., * @,`V @@@v* ( 4 ,: &'`?,: " V 4 (.*  ( *"@V  (.@*` 2  ( 2  (   2 `J,: - : "- : " (., * @,`V @@@** ( 4 - : &%?- : " V 4 (.*  ( *"@V  (.@*` 2  ( 2  (  2 㿘N  `" V .V ,"@@ 4?  ?V ,JV .V ,V ." @ϖ @u 㿘 @ -`: V  4d?*: V  -`\?:  (* @*`V *   ?*:  !-`: * @*`*:  (@@5   ,: ? ($2 $ ( (,: %-`:  (* @*` R 4-`? -`-`:  (* @*` 2-`:` (*` * R$: @&2@ 㿘N  "N @]N  @M㿘 8 "<? 0 43`V @T  @4)?`V @T  @?@'& 0& 4 V  6 . (+ @ *` (.`* "  V  `  2* ?  848(  (((R   (* (P&04 ((((* (R R`2`R$48828 848( * (P`  4`(((R @&2 (* (4`(((@R R`2`R$(8828㿘  8  V 4V  0 @  8 2 8㿘T`T` `T`@PT` 2`I 6 @6`6 `6 `6 ` 6 ` 6 `& `&  `.  `.  `.  ` . `$& $ `.  `. `0& 0`4& 4`8& 8`,6 ,`.6 .T`, ,, `(@@C (@`( 2` (@`( 2`V $ (㿘  ["R $ `@  ["R &@ @  [bS  H  S @C@ < 9.` @zΒ  (.@*` "  @  (.`* @}@`@& (@w (@u  (. @*`  @ * "@` ( @*"@͐㿘" T  @47 T  @41 `T &@T T &T @/2& 4 & 0 &   & /  (+ @ *` (.* "   6 & 8㿘R R & ' 㿘 ` @zC Hi @z< & (@` 6 6?6 6 6 6 6 & &  ["R` R`@`?. .  . . . . ?& $. . & 0& 4& 86 ,?6 .?6 <6 >6 @6 D6 B 6 F? (*@ *` 2 2  ( 2 & ( [bR    6 R22`6  ["R @  6 㿘@ @ 㿘 \  . @@ "㿘 ! \"$  @  V  @ۖ "$ "`,:    V  \"$R ?@6   ?6  V  \ \"$ ?(`: T @R*` *  ( +: * @*` (@P. P@)(: + @:` " S`?+ 3`3`: S` + 3`: S` 43`* : P ۘ " 0P?@3`3`000 *`:`V @`N  2. N    \"$  2   2 xterm㿘  #?*` * ``2 !N" `v`X@  "&p  ?"b 㿐 "?~@ /K D2"   "K   K> K8 D 3"` D /"`K D*"` D A"` #@ #  K D` ?"` 2K D` ?"`@ K D*@" K D " K D " K D@ "K`DO?"O?" #`D #"@ [?1000h[?1000l㿘 "?.  "vv"# @W ["@< 㿘KD  `K @  . > D`   5 ?` ! KD   ?# N` 2 2 > "26 6`(6 6` ! &  &     & `?7  ) KD ' ?? #@#``V"W2 #V@"&` &` ` `&`   ``&` `26"` &`  `&`  ``&` `262 ` K 1 P@" D`D DD#2P@KD  P8@ 㿘 "? ! "  $"㿘 "? "   2?KD  "" "  " " ?0 㿘K`D" " " "  " #`D #"@@>!㿘` "&@ "?!   }#ߐ$"I@ "R   R  R  R  6  K@ @ [঄(অ(8$ [H [3?bHऀ [(bHी2 [(ॄ( [J`J`Hऀ [ ऄ( [J`J` [?*` [Hअ( $   㿘V  ! \@&V VV V   @ ?x cx@/3?xcx@/.?V VV V   @Cx@m#V VV V   @6 ["`?"`㿐L`   ["J Ā  ` @`@ ?@  ` " [  [6 ["J`Ā " L`J` 2 L`` 2L`@. L` % [`$  ["  [" ?*` *  * `$ ["J?  [@'6  [ǰ?"*  !L` ) % ['K@! *  !@@' E*   [!Z!U! ["J`?6 [J`?2 [ ["@p ? [ \"0  ["J*  " $J? [ * ["J`  [*`" ` *` ["JJ@ [?* ["J*` ` $* [" ` *` [JJ@!?** !4 `  ["J ŀ " ` 0  ["J Ā * @* : !!!ʐ ! \T`T@T` T`  @e ? `@/ `@/  @ @-㿈K H' ["J`?` J`? [2?"@Ք ? [ \"0  ["J*  " $J? [ * ["J`  [*`" ` *` ["JJ@?* [" u* ! [? q [ `     2  e [  "*` ``" $"* "* * k "@%쀢 ""J*` ` $*" ` *`"JJ@O*K"J ?*"@[ ?" \"0 "J*  " $J?" *"J` 2"*` ` *`"JJ@"*  ["J*` ` $* [" ` *` [JJ@?** 㿘N" 耢   N"! N ?"! @SK㿘N"!   N" 耢 N ?"  @S3R @4?`6 ( ?*` (P8@  R 4  (R ((@P (   ?@  (+  (00 (+  ( 00  & ( &?R 4?`& ?R @4 ?2 2  2  p@1e'Ԑ 'Ԑ 'Ԑ @L@`'Ԑ 'Ԑ @A '' 'ؐ @P@@l  @H @@1.@ @& 㿈?  '''@0 @)@ 㿈` &` @耢 2  耢 2 @  㿘 # 3.      "c c @0&#   c@ 0 #"#?$ ` $ {#`$? Ò {"$?    "c㿘. "* @c*  Dz㿐' [" $ ̀?NE?"J   "'@$F 9 N""  |# [" ̅ɢ#'   [*`% [:  ?`"@ ` `"*@@"В ? 4 ["@~  NHGNHI㿘N"@tq  [`?*`* *  22KKnn,,XX ` `%%KK㿘N"@tz p" ?0 ["  "` ["?"`̒ |"̕*` ``(*` [" ́㿘N" @ʒc 㿘N"  @> 㿘! [" *`""R ??@+ @$ "J  N"%  @Q?@r \ `  [` " ["` @!b ["@ @/p1 ["  "''А @$ "2`* ` *  "   @I Ѐ "@   㿘 ["R?@NR?@ N"J`i NJ`l <N"J z  ~ \? ` \ ?  "@!Rb ["  ?`"@  `"*@ @!  ["` "`N"#( " [\ "J`i  Nc@ Y [cD TN"J`i cD @PN"J z  ~ \? ` \ ?  "@!b ["  ?`"@  `"*@ @!W  ["` "`N"#(  @PW,` dN"#@ @PM] [ ["R R  @ `! [N"J v 2 " @ b \ " ! ["``@"" " +"R R  @ `N"J v  ! [ @ b \ " ! ["``@""" \"$R (*@ *`@R*  ?@  ?! ["R N"J l ?""N"J i  [""`` "`"`?"`㿘f  ["J '! \@.'N"!T  @ON" `  ["R   @T @O! [a" \"$ *`"* ! \ J` "! \@ߐ  f* "$J` @Ր "$\* @ Ű  % \' \I?R  Q [$ (, * @ R`?  ( R ?$@! $R4 (, @*` 2 ( 2 ( 2  R(, @*` 2 ( 2 ( 2 @{ ?   *  r \ ["R $R  @$ & ( ["R  \"$R  [ \"$?(, @*` 2 ( 2 ( 2  R$( ["R  \ R  \ ?(, @*` 2 ( 2 ( 2  R$( \  \"$`2@2* :  [" @ R`N"J v  ! [ @bb \ " ! ["``@"" "  \ ` " ["` @Jb ["@j Y  㿘N"J  @8b@  \ %  ["R @ [ \   P6`-`*  ( - "@ R& (` ["R @&   @ \ [" @2  `N"J v  ! [ @b \ " ! ["``@D "" " V  ( -`* @-@ F * @ -@ 9 ["R 4=` (-`* @- @ ["R?@NR?@ N"J`i NJ`l <N"J z  ~ \  ` \ ?  "@b ["  ?`"@  `"*@ @  ["` "`N"#( " [\ "J`i  Nc@ Y [cD TN"J`i cD @MՔN"J z  ~ \  ` \ ?  "@Bb ["  ?`"@  `"*@ @  ["` "`N"#(  @M,` dN"#@ @M] [ ["R R  @ `! [N"J v 2 " @b \ " ! ["``@I"" " m"R R  @ `N"J v  ! [ @֒b \ " ! ["``@%""" \"$R`(* @*`@ R*  ?@ 8 ?""  ["R N"J l ?""N"J i  [""`` "`"`?"`  ["R 4 [$ (` ["R V  @4{V @ | \ '  ["R @! [ \  P6`-`* `( -  (  "  S &`(` ["R @ 㿘N"J`  e @Lǔ ["?# @? @"!N"  %@L"J  [" @@0 [" R  \  ["  `(*` * *"@S & 㿘N"J`  e @L ["?# @? @"!N"% %@Lu"J  [" @@  ["  \  ["  `(*` * *"@ $ 㿘N"a  Na` a  N"!8 @0@㿘 \"$ (. * @ \` `(@  ["R ?@ N" ["R ?,`@2 [`@ ,` ["R@ sN"Jk + )@  `! [Jv 2 " @yb \ " ! ["``@ Ȗ"" " N" 41@ ["R @ [, [" @2  `N"J v  ! [ @Bb \ " ! ["``@ "" " @% [)N3 \-ӑ-`R?@"R?@ ""J`i "J`l 6"J z  ~` ? `` ?  "@  ?`"@  `"*@ @[  `" "#( Q J`i c@ McD IJ`i cD @KJ"J z  ~` ? `` ?  "@  ?`"@  `"*@ @  `" "#(  @K,` X"#@ @K SR R  @ ` "J v 2 ` @|` " ``@ ͖" " R R  @ ` "J v 2 @\` " ``@ "" \"$R (*@ *`@R*  ?@ ?-`R "J l ?"""J i "`` "``?"`-` `@& 㿘 \"$ (. * @ \` `(@N"J`k  `  [ "R  ["R - @ ?@2  ->  [" @2  `N"J v  ! [ @ܒb \ " ! ["``@ +"" y" "R ?  % [+N3 \-ӑ- R?@bR?@ bbJ`i bJ`l 6bJ z  ` ~`  `` ?  "@  ?`"@  `"*@ @  `" b#( Q J`i c@ McD IJ`i cD @IbJ z  ` ~`  `` ?  "@Q  ?`"@  `"*@ @  `" b#(  @I, Xb#@ @ISR R  @ ` bJ v 2 ` @` " ``@ d" " R R  @ ` bJ v 2 @` " ``@ D"" \"$R (*@ *`@R*  ?@W ?" R bJ l ?""bJ i "`` "``?"` R ?-  ["R  [bR -@@2 [ - ["R  {N"% Q  R , @    ,   ["R @'NbR ,` 'N`@ &,`'N@%@( [" @ ` J v  ! [ @Zb \ " ! ["``@ "" 8" "R @)@4 ["R @  [, ["R  ,\,N" U \   Q, [" @2  `! [Jv 2 " @ b \ " ! ["``@ \"" " - ̢"R?@NR?@ N"J`i NJ`l <N"J z  ` ~ \  ` \ ?  "@Βb ["  ?`"@  `"*@ @%  ["` "`N"#( " [\ "J`i  Nc@ Y [cD TN"J`i cD @HN"J z  ` ~ \  ` \ ?  "@|b ["  ?`"@  `"*@ @Ӓ  ["` "`N"#(  @GӔ, dN"#@ @Gɔ] [ ["R R  @ `! [N"J v 2 " @4b \ " ! ["``@"" " "R R  @ `N"J v  ! [ @b \ " ! ["``@_""" \"$R (*@ *`@R*  ?@r ?Ĩ ["R N"J l ?""N"J i  [""`` "`"`?"`,,@ A [" @2  `N"J v  ! [ @b \ " ! ["``@"" w" % [+N3 \-ӑ- R?@bR?@ bbJ`i bJ`l 6bJ z  ` ~`  `` ?  "@u  ?`"@  `"*@ @͒  `" b#( Q J`i c@ McD IJ`i cD @FbJ z  ` ~`  `` ?  "@,  ?`"@  `"*@ @  `" b#(  @F, Xb#@ @FSR R  @ ` bJ v 2 ` @` " ``@?" " cR R  @ ` bJ v 2 @Β` " ``@"" \"$R (*@ *`@R*  ?@2 ?" R bJ l ?""bJ i "`` "``?"` - d  ,,@  [" @2  `N"J v  ! [ @mb \ " ! ["``@"" " + [-N7 \3ӑ- bR?@R?@ J`i J`l 6J z  ` ~  ` ?  "@.bb  ?`"@  `"*@ @ b `" #( bQ J`i c@ MbcD IbJ`i cD @EubJ z  ` ~  ` ?  "@bb  ?`"@  `"*@ @= b `" #(  @E@b.  X#@ @E8bSbR R  @ ` bJ v 2 ` @b " b``@b" " bR R  @ ` J v 2b @b " b``@ؖb"" \"$R (*@ *`@R*  ?@ ?" bR J l ?""J i b"`` "``?"` - - @Ē$ \  ["R * ? ?  "@2b@$ ["R  b- '@ R- 㿘N"   @D ["" " N" + ["?" "  @2  `! [Jv  " @b \ " ! ["`` @D "" " N"! @D]0[N" V ["?" " R @. [)'N%# [  2   J v  b @ \ " b``@  b" "   @D(bR  ۔ [" @2  `N"J v  ! [ @b \ " ! ["`` @ "" " 㿘N"!``"QN! L  @C`='N%# [J z  ~ \ ? ` \ ?  "@[b  ?`"@  `"*@ @ b `" #(  @Cɰ N"! @C0N"" G`@Hؒ@C`'N%# [J z  ~ \ ? ` \ ?  "@ b  ?`"@  `"*@ @a b `" #(  @Cdɰ 0JI%N#' [! @CWbJ z  ~ \ ? ` \ ?  "@ƒb  ?`"@  `"*@ @  `" #(  @C!b!  @Cb  㿘N"" " ?@HA@C0? #N!b!8 @B"??b㿘 [" "a !@`@} @ 4  \ (@ ((P 4    ( 㿘  [! [ \ a (*@ *`  `C 2   [!   \"$ \  [!(* * @R` *`(@ *` R A2 &(  [!  \ ? [!`(*@ *` R` B2` &`( [!" + [ [!@E 0/ \3 \? a| a$ (a,* R ?2a ,afa$ ,(*  R R  @2$  $ (,* @R ,* @>R`B*  6 $@ a@,`- ` :僗:`  (* * 2  ( 2  (@  2` $(* * @2`  [!a A 㿈'1`"@' V3aK`$E [N  <A [@5 > :   >-c*`: @   $ &'#N . *$ N?'KPƉB2  " N >$ &쏡" ' [" Ѕ썡"' N 쏠''㿘 [" ̀`""W@~ #$ А "`#Nb  ! [""`b! ""`b!,{ ""`b!u ""`b!(o ""`b!i ""`b!0c ""` b `# " # @Fi R # [b"`!N""@F_ H b"`""@FW @ b"`""@FO 8 b"`""@FG 0 b"a"!@F? ( b"a""@F7   b"a"!T  @@ #N" 쀢 " @$$ #N"! " @$$ #N"!, " @$$㿘@"N" `  ["R   @E @@@)N"!  @@㽘   .Ф"@N""  " [@E͒@* ["!XN""`& [" 6N  @E@* [" N"!  ["@{`쀢6Ѐ 2.N"!J "  ["N"`!@N  @H@{!c@{`@\@*`@T""`&@ [" ؀6N  @E^@*G [" N"!0 7 ["@{g`61Ѐ 2. ["N"`!0@  @@{N!@{H@ @*@Ф"@А"@  ["J`  J` " @ŐШ"@N"!  " [@D@)ߐ ["!@N""`' [" 6N  @Dݒ@)Ɛ [" N"a( o [/" a(@@@zܒ@!Q@z֒`L@)D""`& [" 6N  @D@) [" N"a 1 [/" a@K@H@z@!@z` @)bЦ"@ Ѐ @)QА"@㽘 [@"r "R  @{Ē@k ["R @=`@{@kN"J i 2% [` 3'N!a "  @>b!? "!`$!*@ @В `  ["R   " &  Т"@ #@C#?@( ["?`؀` 2Ѐ?R`? ?, ,  Ѐ?  А"@% [  % [R`? NR`?@N" 쀢   ͚ А"@  Ԑ6N N"!     А"@  [" ܐ6N N"!, % [R    А"@  6N N"J`h + J`l ' #% [R? a  R?l А"@ ``  @    N  D N"@(` #@6  N"@( a #@ ( `N"@'a, # [bR` /N"@(`N"@(a@ [bR`?  А"@@ @= ?㿘N""䀢`"  "܀   @=  [""` "`㽘N"b䀢 ?b܀  ??     Ц"@ #@B) [@' [" "R`?@ NR`?N" 쀢  ?  А"@ " Ԑ6N N"!     А"@  [" ܐ6N N"!, ) ["R   x А"@ " 6N N"J`h + J`l ' `#) ["R?@ a  R?M А"@ "``  @    N  ?D? N"@&` #@?6  N"@&a #@ ( N"@&a, # [bR` /N"@&`N"@&a@ [bR`? А"@ @<㽘 2N"J`  J`t 76NN!N"a ?R`?"L "!@ @%$ [" ؀?" Ѐ?  A А"@' [  ' [R`?@ NR`?N" 쀢      А"@  Ԑ6N N"!      А"@  [" ܐ6N N"!, ' [R     А"@  6N N"J`h + J`l ' `#' [R?@ a  R  А"@ ``  @    N  D N"@$k` #@6  N"@$]a #@ (  N"@$Oa, # [bR` /N"@$Z`N"@$Ua@  [bR` ` А"@ @:N""N""      Ф"@ #@?" @$  [" ؀?" Ѐ?  & А"@' [  ' [R`?@ NR`?N" 쀢     А"@  Ԑ6N N"!      А"@  [" ܐ6N N"!, ' [R    Ϛ А"@  6N N"J`h + J`l ' `#' [R?@ a  R  А"@ ``  @    N  D N"@#P` #@6  N"@#Ba #@ (  N"@#4a, # [bR` /N"@#?`N"@#:a@~ [bR` E А"@ @8N""@> @8ݔUNN"!< $     Ф"@ #@= @" [" ؀?" Ѐ?   А"@' [  ' [R`?@ NR`?N" 쀢     А"@  Ԑ6N N"!     ɚ А"@  [" ܐ6N N"!, ' [R     А"@  6N N"J`h + J`l ' `#' [R?@ a  R  А"@ ``  @    N  D N"@"-` #@6  N"@"a #@ (  N"@"a, # [bR` /N"@"`N"@"a@}̐ [bR` " А"@ @7Ĕ :N%N#!< @7b -NN""耢 +`2-?     Ф"@ #@<Ԕ @! [" ؀?" Ѐ?  ך А"@' [  ' [R`?@ NR`?N" 쀢     А"@  Ԑ6N N"!      А"@  [" ܐ6N N"!, ' [R     А"@  6N N"J`h + J`l ' `#' [R?@ a  R U А"@ ``  @    N  D N"@!` #@6  N"@ a #@ (  N"@ a, # [bR` /N"@ `N"@ a@| [bR`  А"@ @6 N%N#" @6b N"" &   Т"@ #@; @  ["  Ѐ    А"@) [  ) ["R`?@ NR`?N" 쀢     А"@ " Ԑ6N N"!     z А"@  [" ܐ6N N"!, ' [R    ] А"@  6N N"J`h + J`l ' `#' [R?@ a  R 2 А"@ ``  @    G  =  N"@` #@/  N"@a #@ ! 2/N"@a, # [bR` N"@a@{ [bR` ښ А"@@ @5|N""@: ԒN"! &   Т"@ #@: @ ["  Ѐ    А"@) [  ) ["R`?@ NR`?N" 쀢    ~ А"@ " Ԑ6N N"!     e А"@  [" ܐ6N N"!, ' [R    H А"@  6N N"J`h + J`l ' `#' [R?@ a  R  А"@ ``  @    G  =  N"@` #@/  N"@a #@ ! 2/N"@a, # [bR` N"@a@zo [bR` Ś А"@@ @4g %N#! @4]b 0"J`   J`s `N N%N#Ӑ??  @4=b ?N"` * b쀢 Nb !N" @9[ @4"?? Т"@ #@9M % [@4 [" R`? NR`?N" 쀢  ?  N А"@  Ԑ6N N"!     5 А"@  [" ܐ6N N"!, % [R     А"@  6N N"J`h + J`l ' #% [R? a  R?  А"@ ``  @    N  ?D? N"@` #@?6  N"@a #@ (  N"@}a, # [bR` /N"@`N"@a@y8 [bR`?  А"@@ @30N""  @8\ @3#N N%N#" @3b  N"  @8Cl      Ц"@ #@83 @ [" ؀" Ѐ  7 А"@) [  ) ["R`?@ NR`?@N" 쀢     А"@ " Ԑ6N N"!      А"@  [" ܐ6N N"!, ) ["R     А"@ " 6N N"J`h + J`l ' `#) ["R?@ a  R  А"@ "``  @    N  D N"@a` #@6  N"@Sa #@ ( `N"@Ea, # [bR` /N"@P`N"@Ka@x [bR` V А"@ @1N""  N""  @7 @1-NN"!<  $N%N#!< @1єb  NN""쀢 D2F? N%N#" @1b  N""   Т"@ #@6ܔ @ ["  Ѐ    А"@' [  ' [R`? NR`?N" 쀢     А"@  Ԑ6N N"!      А"@  [" ܐ6N N"!, % [R     А"@  6N N"J`h + J`l ' #% [R? a  R ` А"@ ``  @    G  =  N"@ ` #@/  N"@a #@ ! 2/N"@a, # [bR` N"@a@v [bR`  А"@@ @0N" "@5ؔ @00N"!   Т"@ #@5Ô @ ["  Ѐ   ɚ А"@' [  ' [R`? NR`?N" 쀢    祥 А"@  Ԑ6N N"!      А"@  [" ܐ6N N"!, % [R    r А"@  6N N"J`h + J`l ' #% [R? a  R G А"@ ``  @    G  =  N"@` #@/  N"@a #@ ! 2/N"@a, # [bR` N"@a@u [bR`  А"@@ @/%N#! @/b  0? 㿈 ["   "`  *@? @. Q  'N!  @ N"!|  @/\ *@$   ?#@N"% @/L    N"!"" ' N`" ["6 6 6 6 6 6  #\6  #`6  #d6  #h `   @4V ` @/?#@@ N"!|  @/,@@ N"!  @/,@@@ N"!  @.@,@`N"!   @.? ?#@ N"!H  @.ה N"!L  @.̔ N"!P  @. N"!\  @. N"!l  @.@ N"!p  @.@ N"!h  @.  N"!d  @. N"!t  @. N"&쀢  @.t N"&  @.i N"&  @.^ N"&  @.S N"&  @.H N"' " [ @.< [" ?J  [c 2   2 2 ` @ [" 2"  㿘bNH NLNPN\NlNp@Nh@Nd Nt [H?㿀@DH !   @s̔ 6  *  *  "@jd#'@Z`#* "@*`@*`'   @%@D# " "@'" "@` '􀢠'А"@@' '' * $, , @j*#&Nᴀ ─ N82 ∀2 NḀ ✀ N<2 ⌀2 㿘.``  2  N" ".  .  㿘.`` @ .   \ 2*  \$( *  㿘. .`>``  @n *  㿘? 8 ?@ [" "` *`:``?" $" $ *  " $ 㿘.  N""H 2  *`  [N""D   @,ؔ ["@g|  [" ?@O 㿘. .`ב>`㿘 [".``* N""| 2  *`  N""x  @, 㿘 ["   ? N   " [2 [N"!4"!$!  @, ["" 㿘# $`0!N"#@\!\"#@X!]"#@T!^"!@P!"#\@L!b"#4@H!a"#@D!_"# @@!`"#`@<!c"!@8!V"!@4!M"#d@0!d"#h@,!e"#l@(!f"#p@$!g"!@ !U"!@!J"!@!H"!@!"!@!L"#t@ !h"#x@!W"!@!O"!@!N"#|@!i"!@!"!@! "!@! "!@! "!@! ""@! ""@!""@ܒ!"" @ؒ!""@Ԓ!"!@В!"$D@̒!"$H@Ȓ!"$L@Ē!"$P@!"$T@!"$X@!"$\@!"$`@!"$d@!"$h@!"$l@!"$p@!"$t@!"$x@! "$|@!!"$@!""$@!#"$@!$"$@!%"$@!&"$@|!'"$@x!("$@t!)"$@p!*"$@l!+"$@h!,"$@d!-"$@`!."$@\!/"$@X!0"$@T!1"$@P!2"$@L!3"$@H!4"$@D!5"$@@!6"$@<!7"$@8!8"$@4!9"$@0!:"$@,!;"$@(!<"$@$!="$@ !>"$@!?"$@!@"$@!A"%@!B"%@ !C"%@!D"% @!E"%@!F"%@!G"#@!j"#@!k""@!""@!K""@!I"" @!""$@!["#@ܒ!l"#@ؒ!m"#@Ԓ!n"#@В!o""(@̒!R"#@Ȓ!p"#@Ē!q"",@!S"#@!r"#@!Z"#@!s"#@!t"#@!u"#@!v"#@!w"#@!x""0@!"#@!y"#@!z"#@!{"#@!|"#@!}"#@!~"#@!"#@|!"#@x!"#@t!"#@p!"#@l!""4@h!P"#@d!"#@`!"$@\!"$@X!"$@T!"$ @P!"$@L!"$@H!"$@D!"$@@!"$ @<!""8@8!Q"$$@4!"$(@0!"$,@,!"$0@(!"$4@$!"$8@ !""<@!T"$<@!"#@!"#@!""@@ !"&p@! ["`0"` 㿘 tKJ X p  0 1  @   "   2  @  N "Q4  ")N@l] $  $ $N?! @lN $ 0 $ $N?2, K **`X,  4 N "#4 'K @l3 $2 $ @,X@lI@20$N?2, ,  4 N 4  [  x2d2d2dJ2d<2d,2d2d㿘N"%  @)~N"%  @)uN"e Ne N"R ? [#NbR`"! [R`@J- $!bR ?1 [1?#NbR &" [" *`! "*` @k* $ 8bJ "*   c`  ["* 8c0@n7*N"%  @)( 㿘.`>`. > @,:`.: @4. :`,: @&. :`.: @&,<`. < @@e @76\7@W 1 . :,:`" * *  *  :,:" *` *  * 'В"@ "@ @e7@,: . : 2- - :`.: "@*`" * ,:`@eu" $ x: . : ,.:`,: "@*`" * ,:`@ea"  :`- : "@*`" * . :,:`@eR" !h* : @UM!h6㿐. >   [!6L?.`: `  ["@ 6C?.:   + :?: [!`* @* N"e , J` #`#0N"唀 + .`:* * PR R .;`+` * PR #\R #`@-:` @(G 㿘N"% /. : `+ ["@6_?N"J N.`2 !h.2  d.2  dN"J N.`2 # .2 #.2 #N8?"J .`.. . :*@ +` 8@ : :`: `՚`N. :`  8*` * 222N"% . .`..:`::@-;  @'ٔ NH@ N匀 刀$NP஀Pఀ圀N堀2 N怀N愀2 N2 * :    [(?8  8((@3 82 82 * :   [(?8 [!2@!02 㿐N"% ) 0%"% *`: ҔN"& N"%@,|W @'DN"& WN"%@,n @'6㿘 [b * b "`N` :"`` <4"`` ?"` *`(* ) @8@?㿘 [" "`N` > "` *`(* ) @8@?㿘 [" *`N" " @͔8@?㿘 [" *`N"!"  "  @8@?㿘N" *@" @8@?㿘 [b* b" N"%"" "  "  @8@?㿘 ["" N"!" @{8@?㿘 ["* N" ?" @i8@?㿘 ["* N" >" ?"  @T8@?㿘N"  " @D8@?㿘.``N" *@"  "N" @*8@?㿘`? @l/@``@?? ʐ㿘       @d?? 6 6ʧ? @0?  "  @"  ? @0"? ( @ ("  S`S`*8 S@`(((+   " S`쀢  ``  ?㿘VV @ V V 46` 6 66  ?6 C?@2V` "  " `  ` @  \V  b@4V  # \@R$bb"V ` 4 V @R b"@  * :    *`: VV 4 6V @46 `6  66  ?6 R? @ ?6  V .  N  ?F 2   ?@ @ (, *  ,`@ R`?2 (2`2`, @*` R`@6 ( 2`, @*` R`@42` (, * @,`"@`V @$6   @6 6 6 ??V    ?6 `V .@ N   6  @"? ?y6 ,w v6 `a#@  " V@<`|?0gVV  V V @46 `6 66  ?S6 @ ?6  V .  N  ?Ȫ 2   ?@ @ (, *  ,`@ R`?2 (2`2`, @*` R`@6 ( 2`, @*` R`@42` (, * @,`"@`V @$6   @6 6 66 6 㿘VV @ V V 46` 6 66  ?6 D?@2V` "  " `  ` @  \V  b@4V  # \@Pbb"V ` 4 V @P b"@  * :    *`: VV 4 6V @46 `6  66  ?6 R? @ ?6  V .  N  ? 2   ?@ @ (, *  ,`@ R`?2 (2`2`, @*` R`@6 ( 2`, @*` R`@42` (, * @,`"@`V @$6   @6 6 6 ??V   Ő ?6 `V .@ N  Ǔ 6  @"? ?z6 ,x w6 `a#@  " V@`#?i?VV  V V @46 `6 66  ?S6 @ ?6  V .  N  ?P 2   ?@ @ (, *  ,`@ R`?2 (2`2`, @*` R`@6 ( 2`, @*` R`@42` (, * @,`"@`V @$6   @6 6 66 6 ?"?ǜ 㿘VV  V V @46 `6  66  ?6 Q? @ ?6  V .  N  ? 2   ?@ @ (, *  ,`@ R`?2 (2`2`, @*` R`@6 ( 2`, @*` R`@42` (, * @,`"@`V @$6   @6 6 6 ?"?/ ` KK `*   K`@ ?* K `㿘@N  ?N"*    㿘@͐N  ?N"*  R ?㿘@'v㿘@N 2 N"*   䀦 "  @@ G@h @ &@ 㿘@N  ?N"*  R ?㿘@N`  ?`N"` J h |No memory for terminal description㿘 ["!N"  d@ea !@!Ɛ  @[!N@"!N'L@B  $" @ia@]Y  N"   " @!"@@ 㿘N" @4` 㿘N" @y` 㿘@!@㿘K`@ @I#`㿘@!o@㿘LĒb @Iݘ#㿘N"@@^̒`4` 㿘N"@@^’`` ڸڰڨڠژڐڈڀ(x*ph%`$X!P#H%@8&0'( '&)"+tsٸrٰ٨ ٠ِ٘وـxph2`X PH @8u0 ( 0#kbok pظذ بrؠؘ3ؐ؈؀ x p hi`XPvH4@j80(z j`% w׸װרנטא.׈-׀x/pfh`XPH @80 ( l43n5 m+ָ,ְ ֨6֠֘0֐1ֈ2րxph`XPH@80( ոհըՠ՘ՐՈՀx7ph`XPH9@80(: O=SW;<@?ABԸC԰ԨԠԘԐԈԀxphD`XPH@80( EӸFӰӨӠӘӐӈӀxph`GXPH@80( H    IJKҸLҰVҨMҠNҘTҐP҈Ҁcxph`QXPH@R80( U>8ZѸ[Ѱ\Ѩ]Ѡ^ј_ѐ`шaрbxcpdh `XPH1@$8 0 ( vwxPJOIQKRиMаШРИHАdЈ Ѐxph`LXPHg@80( )*hϸsϰtϨuϠiϘϐNψ!πxp\h~`]XyPeH"@}80(q AB&()C*Xeθ|ΰ~Ψ+Π,ΘΐzΈ{΀|xDpEhF`GX@PlHm@n8o0"(Z -S[6hg/x͸.Ͱͨ'͠7͘y͐8͈̀xphT`UXPVHp@8W0X(q Y9Yf{}#$:;̸̨̰<̠=̘>̐^̈?̀_x5ph`XP H!@"8#0$(% &'( ˸˰˨ˠ˘ːˈˀxp!hazeromxvpaxtxsbxoncxonxoffcxmcxhpaxhpxenlwslwnumwingowindwidcswaitvtvpaulucu9u8u7u6u5u4u3u2u1u0tsltonetbcswidmsupcssumsubcsssupmssubmsshmspinvspinhsnrmqsnlqsmxonsmulsmsosmscsmpchsmmsmlnsmkxsmirsmicmsmgtpsmgtbsmgtsmgrpsmgrsmglrsmglpsmglsmgbpsmgbsmdcsmcupsmamsmacsslmslinessitmsgr0sgrsetfsetcolorsetbsetafsetabsdrfqscsdscsscpsclkscescscesascsbimsams3dss2dss1dss0dsrwidmrumrsupmrsubmrshmrs3rs2rs1rmxonrmulrmsormscrmpchrmprmmrmlnrmkxrmirrmicmrmdcrmcuprmclkrmamrmacsrlmritmrinrirfirfrevreqmpreprcsdrcrbimqdialpulseprotporderplnpfxlpfxpflocpfkeypctrmpbpausepairspadosorviorlorhiorcopocnxonnrrmcnpinsnpcnlabnelndscrncvmvpamsgrmrcupmlsmjumpmirminfomhpamgcmemumemlmcuu1mcuumcuf1mcufmcud1mcudmcub1mcubmcsmc5pmc5imc5mc4mc0maddrmalwlpixlpilmlllineslhlf9lf8lf7lf6lf5lf4lf3lf2lf10lf1lf0kundktbckspdksltksavkrstkrplkrmirkrikrfrkreskrefkrdokprvkprtkppkoptkopnknxtknpkmsgkmrkkmovkmouskmkllkindkil1kich1khtskhomekhlpkfndkf9kf8kf7kf63kf62kf61kf60kf6kf59kf58kf57kf56kf55kf54kf53kf52kf51kf50kf5kf49kf48kf47kf46kf45kf44kf43kf42kf41kf40kf4kf39kf38kf37kf36kf35kf34kf33kf32kf31kf30kf3kf29kf28kf27kf26kf25kf24kf23kf22kf21kf20kf2kf19kf18kf17kf16kf15kf14kf13kf12kf11kf10kf1kf0kextkentkendkelkedkdl1kdch1kcuu1kcuf1kcud1kcub1kctabkcrtkcpykcmdkclrkclokcbtkcankc3kc1kbskbegkb2ka3ka1kUNDkSPDkSAVkRPLkRITkRESkRDOkPRVkPRTkOPTkNXTkMSGkMOVkLFTkICkHOMkHLPkFNDkEXTkEOLkENDkDLkDCkCRTkCPYkCMDkCANkBEGitis3is2is1iprogipinvisinitpinitcindnindinil1ilifich1ichhzhuphuhtshthshpahookhomehlshdhcgngetmfslflnflashffevhlmethlmeslokerhlmeoendbienacselohlmelhlmel1elehhlmedechdsldocrdl1dldispcdimdialdevtdefcdefbidclkdch1dchdbdaisydacwincvviscvrcuu1cuucupcuf1cufcud1cudcub1cubcsrcsnmcsincrxmcrcpscpixcpicolscolorscolornmcnormcmdchclearcivischtschrccccbtbwbufszbtnsboldblinkbitypebitwinbirepbinelbicrbelbceamacscOTxrOTugOTrsOTptOTnsOTnlOTncOTmaOTkoOTknOTi2OTdTOTdNOTdCOTdBOTbsOTbcOTNLOTMTOTGVOTGUOTGROTGLOTGHOTGDOTGCOTG4OTG3OTG2OTG1TERMNo memory for terminal descriptionTerminal description database could not be foundTerminal '%s' not found㿘2 [@Z" ["!N" !N@'L@8O  $" @#b耦`N@S  " N""@̐   @ ccH@2&@4TERMCAPTERMPATHHOME.termcap /usr/share/misc/termcapp@ZX XL /#@ZO `@ZH p @ #/@]@ /,@`$@ $`x" 6$@ `/$ @ )*`:   :2`,@` @ *`:   :2L@`L@  @L@  $ Т`L@  @$L  /" 'l@ 6'l?'llp@l@  :'d@\Nb"`d"``! [#@  #I, ldJ `|"?@Y Nb"`d lJ` |"`d@ N" d*lJ |"ld" 4 ! [#@ | #, -l d   J@ |'d ld@`'d@dNb"`` :- L!jĢ"%N. *   "%.   . T 5. P * l@O : ` @* h. *  @ 7*`h* l@&h  *  (2 . *  *  j2 * l@d  *  " @d. ** "@Xd L! . ! [! " l@ #!*#!@ :" L 2, l ?@Xv? ?TERMINFO.terminfo /usr/share/misc/terminfop@X"0$J@Xܐ p @ #/@[ /, $ $b@" @  /$@` )*`:   :2 ,  *`:   :2L L  L " $@$@`@  L  $@@R 'llp@l@ B :'d@Nb"`d"``! [#@ O #J, ldJ `|"?@WŐ Nb"`d lJ` |"`d@ 7N" d*lJ |"ld"  ! [#@ # #, ,l d   J@ |'d ld@`'d@dNb"`` :, Ĥ !N . l@@  : "* h* h  +.  â"!N. l@@h "".  2 . @j2`  '.  #h#N. l@Ҕd b" . @d"` !. ! [! " l@#!*#!@{ :" J` 2*` l ?@WE? ?No memory for terminal descriptionLINESCOLS㿐 @W X [J@ /"  [! `J )`!N@"'L@5S  $" @'b `!N@"'L@5=  $" @b"`[!N@r" ["a0" [g" [b`" @ * [N"R`" \R`" \R` " "N" \"2`L D )N@`h@Y  ` ["!`" \" @W;#"@V ["a@W1# "N@L \"`N" [!2` \ 2`L D $<%d> $<%d> $<%d> %s $<%d> $<%d> #Nb$b 쀢 bV ր ?#@a@sb@n!Nb"`#Nb "!NR܀ ?#@a@Yb"J !!N"' "@H""a!N"a ##Ng b@:"J "#NRڀ ?#@Ӓa@(b@#!Nb"a#Nb \NJ 2#NRڀ ?#@a@ HbA!b쀢`BNRր >N ?#@G'/b@YK"!gN"Rڀ ?#a@??#N"`@'(/@Y,"a@C?#@Nb"bN"J` NJ`  N" 쀢 "N@UN"" #Nb 2NRހ ?#@Fa@⛐b@▐!Nb"bN"R`  !NJ` " 2`!N"! 2!N@~!""a!N"" 2!N@s!""b !N"!؀ 2N@h!""aN"J`  NJ`p N *`pN""㿘L" ,  䀢  @U=!, @U8 `@U6NbL""b  @  @ @("!P P L L @ ?   @ @*  P"㿘 !H    "  !P2+ `o aT"aT %*aT"aT P*aT"aT a]*  % g aT`"T*@T`"T*@T`"T*@0H!P   "!P  % p 0T`"T*@T`"T*@T`"T*@ !D & $ aT"aT %*aT"aT {*aT"aT 9*aT"aT 6*aT"aT }*aT"aT*aT"aT ^*㿘N \ ^"3 4 N 34* 06  %4$ $6! 2! \* : a c   㬐 * Ф  N        a#@  `,`'`\`: aT"aT %*aT"aT '*aT"aT*aT"aT5* T`"T %*@T`"T {*@ `c T "T @M d 0,   aT "aT @M @=}  0,! !T`$!T @=t  0,@!T`$!T }*@  ʰ "!@ "!P "!D "!H  "aL ?#"aTNac   a# N@  2 `*`."  j!*@!T`$!T*@!T`$!T t*@R!T`$!T*@!T`$!T*@!T`$!T*@!T`$!T ;j*@L :!T`$!T*@!T`$!T[*@L !T`$!T*@!T`$!T*@NNL !T`$!T*@!T`$!T*@!T`$!T*@!T`$!T cL !T`$!T*@!T`$!T cLy !T`$!T*@!T`$!T*@!T`$!T dI*@N!T`$!T*@!T`$!T \ *@!T`$!T*@? $!T* N `, aT"aT $*aT"aT <*a N㬐@  2T`*`.  T "T* aT"aT /*aT"aT >* !T*?#@/xph`XPH@80(                  x p h ` X P H @ 8 0 (                      x p h ` X P H @ 8 0 (                      x p h ` X P H @ 8 0 (                      x p h ` X P H @ 8 0 (                      x p h ` X P H @ 8 0 (     xph`XPH@80( xph`XPH@80( xph`XPH@80( xph`XPH@80( xph`XPH@80( xph`XPH@80( xph`XPH@80( memumemlOTGVOTG1OTG2OTGDOTGLOTGCOTGROTG4OTG3OTGHOTGUOTmaOTrsOTi2OTnlOTbcevhlmethlmerhlmelohlmelhlmehhlmscesascescpctrmrmscsmscrmpchsmpchdispcslinessetcolorendbidefbicolornmbicrbinelbirepsmgtbsmglrs3dss2dss1dss0dscsindevtpfxlsetabsetafgetmreqmpminfokmouscsnmzeromdocrsupcssubcsrcsdrbimscsdsbimsmgtpsmgtsmgrpsmglpsmgbpsmgbscsmcuumcufmcubmcudpordermcuu1mvpamcuf1mcub1mcud1mhparumrsupmrsubmrshmrmicmrlmritmrwidmsumssupmssubmsshmsnrmqsnlqsmicmslmsitmsdrfqswidmdefccvrchrlpicpisetbsetfscpinitpinitcopocu9u8u7u6u5u4u3u2u1u0waitpausehookpulsetoneqdialdialhupwingocwinrmclkdclksclkflnsmgrsmglmgcel1kf63kf62kf61kf60kf59kf58kf57kf56kf55kf54kf53kf52kf51kf50kf49kf48kf47kf46kf45kf44kf43kf42kf41kf40kf39kf38kf37kf36kf35kf34kf33kf32kf31kf30kf29kf28kf27kf26kf25kf24kf23kf22kf21kf20kf19kf18kf17kf16kf15kf14kf13kf12kf11rfikUNDkSPDkSAVkRESkRITkRPLkRDOkPRTkPRVkOPTkNXTkMOVkMSGkLFTkICkHOMkHLPkFNDkEXTkEOLkENDksltkDLkDCkCRTkCPYkCMDkCANkBEGkundkspdksavkreskrstkrplkrfrkrefkrdokprtkprvkoptkopnknxtkmovkmsgkmrkkhlpkfndkextkentkendkcrtkcpykcmdkclokcankbegrmlnsmlnenacsxoffcxoncrmamsmamrmxonsmxonkcbtplnacscrmpmc5pkc3kc1kb2ka3ka1iproghuuctslhtwindhtssgrriindscvparcrfrs3rs2rs1repmc5mc4mc0pfxpflocpfkeycuurincufcubilindnichcuddldchpadnelsmmrmmlf9lf8lf7lf6lf5lf4lf3lf2lf10lf1lf0smkxrmkxkcuu1khtskrikindkcuf1kppknpkllkcub1kil1kich1khomekf9kf8kf7kf6kf5kf4kf3kf2kf10kf1kf0kedkelkrmirkcud1kdl1kdch1kctabkclrktbckbsipil1ich1ifis3is2is1fslffflashrmulrmsormirrmdcrmcupsgr0rmacsechsmulsmsorevprotinvissmirdimsmdcsmcupboldblinksmacshddsldl1dch1cvviscuu1llcuf1cnormmrcupcub1civishomecud1cupcmdchhpaedelcleartbccsrcrbelcbtxph`XPH@80( xph`XPHOTkoOTknOTdTOTdBOTdNOTugOTdCbitypebitwinbtnswidcscpsorviorhiorlorcnpinsmlsmcsmjumpmaddrspinhspinvbufszncvpairscolorswnummalwlhnlabwslvtpbxmclmlinesitcolsxph`XPH@80( xph`XPH@8OTxrOTNLOTptOTMTOTncOTnsOTbslpixcpixsamxvpadaisycrxmxhpahlsbcecccndscrnpcnrrmcchtsmc5inxonxonulhzxteslokosmsgrmirdbdainhskmhcgneoxenlxhpxsbambw99988888888888888888x8p8h8`8X8P8H8@88808(8 888877777777777777777x7p7h7`7X7P7H7@h78g70n7(7 777 7i666j6k6666666666666x6p6h6`6X6P6H6@68606(6 666655555555555555555x5p5h5`5X5P 5H 5@ 58 505(5 555544444f444l4+4,444444c4xo4p4h4`4X4Pp4P4H4@(4@q48 40d4(4 4*4443333333p3e33z3{3|3}3~333x3p3h3`m3Xq3P3H/3@.3830r3(3 333322222r222 2!2"2#2$2y2222x2p2h2`2X2P2H2@28202(2 2 2t2u2v1w1x101112131415161718191:1;1<1=1x>1p?1h@1`A1XB1PC1HD1@E18F10G1(H1 I1J1K1L1M0N0O0P0Q0R0S0T0U0V0W0X0Y0Z0[0\0]0x^0p_0h`0`a0Xb0Ps0H0@&085000(0 00%00/ /////k// //////$/!/#/x%/p /h /`/X/P/H /@/8j/0/(%/ )/*///.../..... . ...0..2..4.3.x.p .h6.`1.X.PA.HB.@D.8E.0F.(G. H.I.J.K.C-N--9-;-?-T-P-M-<->-Q-R-U-@-V-8-x7-p=-hX-`L-XO-P-H&-@'-8S-0Y-(:- W-Z-[-]-^,_,`,a,b,c,d,\,, ,,,, ,, ,,,x',p,h ,` ,X,Pf,He,@!,8",0,(, ',,,&,g++)+*+++++h+w+s+t++x+v+)+u+xz+p{+h|+`+X~+P}+Hy+@+8l+0m+(n+ o+++++**#*-****(**** *!*"*#*$*%*x&*p'*h(*`*X,*P"*H*@*8$*0*(-* * ***)))i)))+))xtxsxrxoxnxlxbwswivtvsvivevbutusupulugueucu9u8u7u6u5u4u3u2u1u0tstitetastsrspsosgsfsescsas3s2s1s0rsrprfrcrPr3r2r1pxptpspopnplpkpfpcpbpapOosopocnxnwnsnlndncmumsmrmpmommmlmkmimhmemdmbmalwlmlllilhlelal9l8l7l6l5l4l3l2l1l0kuktkskrkoknkmklkhkekdkbkakTkSkRkPkNkMkLkIkHkFkEkDkCkBkAk;k9k8k7k6k5k4k3k2k1k0itisipinimificiPi3i2i1hzhuhshohlhdhcgnfsfhffeseoeiedeceAdvdsdodmdldcdbdadTdNdCdBcvctcscrcocmclcichcecdcccbbwbtbsblbcasamalaeacZzZyZxZwZvZuZtZsZrZqZpZoZnZmZlZkZjZiZhZgZfZeZdZcZbZaZZZYZXZWZVZUZTZSZRZQZPZOZNZMZLZKZJZIZHZGZFZEZDZCZBZAYzYyYxYwYvYpYoYnYmYlYkYjYiYhYgYfYeYdYcYbYaYZYGYFYEYDYCYBYAXyXvXtXrXoXlXhXNXFWGWAUPTOSfSbSXSRSFSCSAS8S7S6S5S4S3S2S1RXRQRIRFRCRAQDPUPANlNRNPNLNDNCMiMWMTMRMLMCLfLOLFLEKmK5K4K3K2K1IpIcICHUHCGmGVGUGRGLGHGDGCG4G3G2G1FrFqFpFoFnFmFlFkFjFiFhFgFfFeFdFcFbFaFZFYFXFWFVFUFTFSFRFQFPFOFNFMFLFKFJFIFHFGFFFEFDFCFBFAF9F8F7F6F5F4F3F2F1DODLDKDIDCCoCWCMCCBTALAFAB@9@8@7@6@5@4@3@2@1@05i*9*8*7*6*5*4*3*2*1*0&9&8&7&6&5&4&3&2&1&0%j%i%h%g%f%e%d%c%b%a%9%8%7%6%5%4%3%2%1%0#4#3#2#1!3!2!1h#Nb@=@#b"` L!P*` ( Z``*` Z`#2#2 A 㿈' '? 3aΑ*`:  $ ƀzNN <" ƀ $ƀNlNNc@  `.@ > 2ƀ $ƀ <[N* : c  !+'*: ?'엢"' N  N .' * Nc@  썠*'"L!腠čB'Nc    N  2 N *2 N엢"' N /" N 2 N ~쉠*L! -N N"R `" Z  *D  Z#*  $> 2  8:  ZR#L!ȓ*`R@'썠*L!čB'N"" " J  앢!'* LΟƀ> 셠*L"ʅ'!  %d%02d%03d%02x%03x%2d%2x%3d%3xOVERFLOW! 2  N  Ϛ"a#L %2s L  nۑ* :  Nh*  ?X????????????????????????????????????????????????????????????????????`???????t???  $   L @  Ѐ 4  L  %   * "?ؔ   ""آ |a(Ϫ!H5  "XϬ!P %@:t@,@ ?ߑ* : `][А *`@L MMMBIFxMMGG8MGMHXBhMCDhMMMMMMMMKDJKMMIMMMMMMMMMMMMMI|EMMMMMMMMMMMMMJMMMME$BMlMFHMLMMMHMMEMME\LMMMMMMFJ@ML<@ %,@؀  ?&ؑ* @@C͐@ϒ ΐ 8N N d# x`2 ؀  ?&ؑ*    ?&ؑ* ϒaX@@C@Ð2N`2 ؀  ?&ؑ*  a`  ?&ؑ* ϒah@@C|@~ N d x؀  ?&ؑ* @貒ap@Cc@e2uN؀  ?&ؑ* @蜒ax@CM@pO N d x؀  ?&ؑ* @胒a@C4@W62FN؀  ?&ؑ* @ma@C@A @<؀ ?&ؑ*  ,@#`؀ ?&ؑ*  @B@"@$@B @ N`0a#@  *`?  Na#@ ` ؀ ?&ؑ*  N*` "= Na#@  ߑ*`}= ؀``&ؑ*`"Ѱ  * : a c   #*@ *`Б*: @ N  ؀`4N`&ؑ*`"؀ ?&ؑ*  ؀ ?&ؑ*  8@؀ ?&ؑ*  ؀  ?&ؑ*  ؀" &ؑ*{"؀ ?&ؑ*  ؀ ?&ؑ*  @7 ؀ ?&ؑ*  ؀  ?&ؑ*  @8 ؀ ?&ؑ*  ؀  ?&ؑ*  @(ْ ה؀ ?&ؑ*   ؀  ?&ؑ*  2 ؀ ?&ؑ*   ؀  ?&ؑ*  2  ؀ ?&ؑ*  ؀ ?&ؑ*   @؀ ?&ؑ*  ؀ ?&ؑ*  v@؀ ?&ؑ*  ؀ ?&ؑ*  a@؀ ?&ؑ*  ؀ ?&ؑ*  @J`?؀ ?&ؑ*  ؀ ?&ؑ*  @4  2؀ ?&ؑ*  ؀ ?&ؑ*  @&  ؀ ?&ؑ*   `?؀ ?&ؑ*  8؀`4^N`&ؑ*`X"А 'Ԑ Q'؀ ?&ؑ*  2FN   ?`%2N N ? ;2N$1N e2N")NN 2 N 0   `%2N N ? ;N  2 N N 2 N a@,@ϒ! !.@ `.` `.` `.` `.` `.` `.` `.` `.` ` .` 㿘'H'L'P'T'X aXH㿘a!?` "@ . :  `"*@@˚ a! @` dumbAUTHV0.18\`d` h@ "  2v @c@n (  Ж@ 2]  Д@  2S@Œ$Ӓc8@O t@K '@' @' @823 /@A    \$#@7  \"0x@6#\p@-l @' `    㿘@> $ @0㿘 @> @&Generic kerberos error (kfailure)(reserved)Bad Kerberos name format (kname_parse)Read ticket file before tf_init (tf_util)Bad ticket file format (tf_util)Can't lock ticket file; try later (tf_util)Can't access ticket file (tf_util)No ticket file (tf_util)Reserved error message 75 (get_ad_tkt)Reserved error message 74 (get_ad_tkt)Reserved error message 73 (get_ad_tkt)Reserved error message 72 (get_ad_tkt)Don't have ticket granting ticket (get_ad_tkt)Generic error (get_intkt)Reserved error message 69 (get_in_tkt)Reserved error message 68 (get_in_tkt)Reserved error message 67 (get_in_tkt)Reserved error message 66 (get_in_tkt)Reserved error message 65 (get_in_tkt)Reserved error message 64 (get_in_tkt)Protocol error (get_intkt)Password incorrectWarning: Not ALL tickets returnedReserved error message 60 (send_to_kdc)Reserved error message 59 (send_to_kdc)Reserved error message 58 (send_to_kdc)Can't send request (send_to_kdc)Retry count exceeded (send_to_kdc)Null ticket returned by KDC (gt_pw_tkt)Error returned by KDC (gt_pw_tkt)Protocol error (gt_pw_tkt)Current password incorrect (get_pw_tkt)Current password is NULL (get_pw_tkt)Reserved error message 50 (krb_rd_req)Reserved error message 49 (krb_rd_req)Reserved error message 48 (krb_rd_req)Reserved error message 47 (krb_rd_req)Reserved error message 46 (krb_rd_req)Reserved error message 45 (krb_rd_req)Reserved error message 44 (krb_rd_req)Unauthorized request (krb_rd_req)Message duplicate or out of order (krb_rd_req)Message integrity error (krb_rd_req)Illegal message type (krb_rd_req)Protocol version mismatch (krb_rd_req)Incorrect network address (krb_rd_req)Time is out of bounds (krb_rd_req)Request inconsistent (krb_rd_req)Ticket for wrong server (krb_rd_req)Repeat request (krb_rd_req)Ticket issue date too far in the future (krb_rd_req)Ticket expired (krb_rd_req)Can't decode authenticator (krb_rd_req)Reserved error message 30 (krb_mk_req)Reserved error message 29 (krb_mk_req)Reserved error message 28 (krb_mk_req)Reserved error message 27 (krb_mk_req)Ticket granting ticket expired (krb_mk_req)Reserved error message 25 (krb_get_cred)Reserved error message 24 (krb_get_cred)Reserved error message 23 (krb_get_cred)Can't find ticket (krb_get_cred)Can't read ticket file (krb_get_cred)Permission Denied (kerberos)Reserved error message 19 (kerberos)Reserved error message 18 (kerberos)Reserved error message 17 (kerberos)Reserved error message 16 (kerberos)Reserved error message 15 (kerberos)Reserved error message 14 (kerberos)Reserved error message 13 (kerberos)Reserved error message 12 (kerberos)Reserved error message 11 (kerberos)Principal has null key (kerberos)Principal not unique (kerberos)Principal unknown (kerberos)Bad byte order (kerberos)Service: Incorrect master key version (kerberos)Principal: Incorrect master key version (kerberos)Unknown protocol version number (kerberos)Authentication expired (kerberos)Service expired (kerberos)Principal expired (kerberos)OK/etc/kerberosIV/krb.realmsrKRBCONFDIR/etc/krb.realms%s %s@w 2@i . *""@  א"@Tb,@;] @9#`@ג# @b /@@ `@8 "  `@8  "   `@8 "   @8& "  " `@ #$ `@8 "   ` 2  #$` #$ $ #$ #@, " #$!,  %P"T  !@c$ Realm: %s %s %s %s %s %s Ticket->length = %d Issue date: %d Authent->length = %d idl = %d, tl = %d 㹨'T #( @:ϐ @:ː  .  . O "@ . P"P ِ!@@>@ 2@0  O@ 2@0 2 "P"P  ِ!Ȕ@O, @ޯ `-`@:~  @" @@:w@` &P"P ِ!@2@P"P ِ!@) @ފ@:\ ' А@ށ @:Q' @v @:F' T@!Ҕ  '!O"@ Œ `'@O "*``" @! `'` ,` ?'! @ .   @ -  @| ` @! & ,@m$P"P ِ"@P"P ِ" @ߺ  O Clen is %d 㿘 @9 @9 @9ݐ @9ِ @9Ր @9Ґ @9ϐ@  # `@![   L `!  @Ɣ  4`  P"T ڐ!@zkrbtgtAbout to do decryption ...h   ! "t #`@%'@ 2.O"(@ ! $@ڐ"@ݖ( @9^ ( ڐ"ؖ 2ڐ"@Ɩ( 2ڒb "@ G`@ @  @  $@@*`@ @@݂@ @9R$@ @@x@ @9H$@$@) " Ұ " Ͱ ?  "LOJb@  "L  ? 3 2 ?@9$ @9  @9@9 @9 @9 @9# `P@    L  `P@    R@ $`P  P%@( @ @ xP"T  @ެ"Ƞ x@  @A @> @ d  P@@8ʐ @(@@8 @@@8 @ @L`L`%@`@ C`@@@ 2> F@ 28 F@ 2 F@ *   L  А@ @ '!O"(@  "(䒢@, a,$#\ %O"(#`P(@  send_to_kdc%s: can't get local realm lrealm is %s kerberosudp%s: Can't get kerberos/udp service krb_udp_port is %d %s: Can't open socket Getting host entry for %s...%s. Got itDidn't get itTimeout, error, or wrong descriptor %s: can't find any Kerberos host. @@XPX@  P"T ?Oa!`ےc@< 9"T ܐ @XO"0 $ܐ @B`0 2OP"T Oa!`ܒ`8@<O" "b0P"T Oܐ `@ݚb0@9 @4H  ذ 9 @鿔  P"T Oa!`ܒ`x@<Ű 9 @  1P/aO"0X@ g"T ܐ @e@,O@s"T   ܚ`@R @,<"ݨ  * @@47*`,, ?@@ @3 =@ @3  4&" ",* @@Ò  /@ `7@ "T @  @+ P"T Oa!`ܒ`@<# 9!  @  /@ @z  2   $@ 8@6`@   "   @3@3   2 @3Sending message to %s...Sending message...sent only %d/%d Sent Waiting for reply...select failed: readfds=%lxrecvfromreceived packet from %s Received it packet not from %lx %s: received packet from wrong host! (%x) send_to_kdc(send_rcv)XP"T  2 '@Ē@X!a@T!a@+=!  @茚 @  P"T @?! "T @7"a@+ !ؐ @6~ 6*   *? &? \""0  O@f"4 P?:  P"T cؒ@ؔ a!`ݒb0@&@"PV '`$ @K  P"T F@"XC "T  '@Ē@"ha@*̐! %P!P57a3a1 @z  "T ! @ʐ@*  a` "@  2 P"T  a!`ݒbݔ@̰ 㿐\@f`@  #\#`@8@㿘 @5ɐ @5Ő @5 @5 @5 @5 @5@  㿘  @А@] $@ѐ@а`@پ@ٹ@ 0?"  0@٬@_/etc/kerberosIV/krb.confrKRBCONFDIR/etc/krb.conf%s`4? ސ#@2c%@4; @2w#`xޒ#А @@ /x@5D "@\cؐ@c ޒc@> @  @N #@? /etc/kerberosIV/krb.confrKRBCONFDIR/etc/krb.conf%s%s %sߐ @ڒa%@3 @2! `Pߒ!0 @ /ϠP@4 "@a8@ڷa ߒaH@Ѐ? $ @  'ߤВ$@͔ ВP@jZ  @ " @ 㿘@6@f 2%@ڐx2 @堠2@@ (@ P@ @j ?2KRBTKFILE%s%d/tmp/tkt㿘O"HJ"H 21O@1#x@c# .#@gnO"H$ߔ@w1O"H㿘!O"H@L#"H,#tf_init: illegal parameter 8`` P  "T Ja!`@`HZ M@  \"0 P MN L@g- `2E M<  2> M $`"`X @!P "bH1P"H@h  6* @  "H@`     @s!P "bH M1P"H@M  6 @ "H@E  6 @2"H?&"H Ntf_get_pname called before tf_init. 㿘P"H  P"T a!`@b   P@ ( $   Otf_get_pinst called before tf_init. 㿘P"H  P"T a!`@b  P@ ( $   Otf_get_cred called before tf_init. 㿘P"H   P"T a!`@\cPR P@k ( 4  ( "I? ?A (@^ ( 4 P?;  P@T ( 4 x "2? ?* x0 x0%'?@|   @w   @r  @m  d @d  %t@_   @ O㿘!P"H &  @z @2"H?$"H  `@z$tf_gets called before tf_init. 㿘P"H P"T a!`@ ߒaH* Pհ 0&%&@   # +P) %  ``X#bH `@1$$\$`X`X\@`X $`X .  ? `X?㿘`!! +P) %   ` X#bH `@1~$$\$ X X\@ X 0  $ X .` tf_save_cred called before tf_init. 㿘'T'XP"H  \P"T a!`@ qbR P;PbH  @1 @2 bH@1&2B @2v bH@128 @2l bH@12. bH@1   2' bHT@1  2  bHX@0  2 bH@0  2 bH @02  bH`@0      ##%%&&))**,,//1122447788;;==>>@@CCEEFFIIJJLLOOQQRRTTWWXX[[]]^^aabbddgghhkkmmnnppssuuvvyyzz||        0 0 0  0 0  0 0  0           0  0 0 0 0  0  0  0          $$   $ $$$   $ $            $$   $ $$$   $ $                0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0                            ((  ((  ((  ((  ((  ((  ((  ((           """"    " " " "((((((((    """"( ( ( ( ("("("("   *(    ` `(  㿘 P"\, @֔     ,  㿘P"X "֐ ư?ߐ "? * @ * @ * @  *  *  * 3  Ð# @ *+` 33 @ 2@+   23  UUaU @ *3` ?  *@3  @ * *`?# @3  @< @2 <+@ P"#!"# !"# ?#( 3`+`@3 + 3`+`@3 + @ @  `?*3` `3` <@*`@3` `3` 0@*`@3` `3` @3` 8@*`@ ?*3  `3  <@*`@3 3  `3  0@*`@*  &@`2? @*2@&@` 㿘+㿐` * @ * @ * @  *  *  * #$ * @ * @ * @  *  *  * /   * * tdXL<, ?* ?* ?* ??* ?* @?* @?@@''@ @  .@`2`.@`2`.@`2`.@`.@`2.@`2.@`2.@`' * @ * @ * @  *  *  * n! * @ * @ * @  *  *  *  ''@ @􀦠.@`2`.@`2`.@`2`.@`.@`2.@`2.@`2.@(` $@* , ܲ2.@2.@2.@.@2`.@2`.@2`.@.@@''                              A@@A@@A@@@@A@@@@A@@@@@A@AA@@@@@@@@@@@@A@@@A@A@@@@AA@@A@@@A@@A@@@@A@A@@A@AA@AA@@AA@@@AAA@A@A@A@A@                              @@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@                             libdes v 3.21 - 95/11/21 - eay㿐 * @ * @ * @'  * @ * @ * @'@.@2`.`2`.`2`.`.`2`.`2`.`2`.`''㿘 7 Ä(6?(7  ̄3(6?(7 UUU(/ 7 @.6h XXXXXXXX(`@ 6.?(6 6 6 ?( 666@ @ @6.?(6 6 6 ?( 666``g/` XXXXXXXX(`@ 6.?(6 6 6 ?( 666@?@?@6.?(6 6 6 ?( 666`/`7`/ 7 7 UUU@(7`?(@7  ̄3@(7`?(@7 Ä@($$ 㿘 / 7 @.6h XXXXXXXX(`@ 6.?(6 6 6 ?( 666@ @ @6.?(6 6 6 ?( 666``g/` XXXXXXXX(`@ 6.?(6 6 6 ?( 666@?@?@6.?(6 6 6 ?( 666`/`7`/ 7 $$ 㿘 [!!    㿘 [!!    [!Ē`*` 2`@  [!, ?, @ #x㿘 ``  "`` *:  :: 2@   㿘   ?   b    8   b   S @ & F` @  & & `@ & :`  @ʒ   € @` €  ` : @ & F` @  & & `@ & :`z ?s #@? ?#@  2@  @  @2   W U " . 2 * 6. 6.    @ @` @  `@ =` : @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@82         b 㿐P8? )@  0?@ `㿐?P@P  0jHPP PD' P…B' @      @, . @I  `6`@ 6  @ @>@P@?&'PP PD' P…B'   @ f0PP7PF' P…B'   @ F  ` : #ddPXBP` B B#dd`PXBD# * 22 2@   㿐   ?   b       b   U & F`  & & `& : 8 @Ӓ    @`  ` :  & F`  & & `& :  ?}#@? ?#@  2@  @  @2    f[" . 2 * 6 . 6 .  @ "@B@ `@  "@"@@ `"@:  :  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@@@ b f. 6 @6  ?   b ?㿘>@ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@@*@&㿘S @ & F` @  & & `@ & :`  @t   € # C ` €  # # ` # :  @ & F` @  & & `@ & :`z ?s #@? ?#@  2@ "h @  @2   W U " . 2 * 6. 6.    @ #C ` @  ## `@ #;`  : @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@82     㿐U & F`  & & `& : 8 @`   @ #@ C@ `@  #@ #@ @ `#@ :   & F`  & & `& :  ?}#@? ?#@  2@ " @  @2    f [" . 2 * 6 . 6 .  @ "@B@ `@  "@"@@ `"@:  :  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@@@ b f . 6 @6 ? &  @   @    㿘  Ȕ@$Z $OpenBSD: setlogin.S,v 1.2 1996/08/19 08:18:11 tholo Exp $ 2 cd@ [ a㿐' `v@"5㿐`w@", ?㿐` ``   \  \ ''' "b0? `@"" (" $ " ( " $ " "  g"  ?"  ( $$OpenBSD: swab.c,v 1.2 1996/08/19 08:34:30 tholo Exp $2":J  *@ `*@`: DJ  *@ `*@`J  *@ `*@`J  *@ `*@`J  *@ `*@`J  *@ `*@`J  *@ `*@`J  *@ `*@`J  *@ `*@`$OpenBSD: strspn.c,v 1.2 1996/08/19 08:34:26 tholo Exp $  ( + 8: " ( "$OpenBSD: strcspn.c,v 1.2 1996/08/19 08:34:15 tholo Exp $   (8J2J "$OpenBSD: strsignal.c,v 1.2 1996/08/19 08:34:25 tholo Exp $㿘 @V`h$OpenBSD: strmode.c,v 1.2 1996/08/19 08:34:20 tholo Exp $< "$ b(" c p ? d ?" l0  - ? s ?*@` r -*@` w -*@@@`@  - @ s  x S*@`  r -*@` w -*@`  - s x S*@` r -*@` w -*@ ` "   - " t  x T*@` *@*`$OpenBSD: strcoll.c,v 1.2 1996/08/19 08:34:13 tholo Exp $㿘@ۆ$OpenBSD: system.c,v 1.3 1996/09/15 09:31:52 tholo Exp $sh-c/bin/shx#'#'' '5 '@S@U?'ܰ?  @S$?@R \#@{(@" @Β  @ʒ @i @Rܐ @ @??$OpenBSD: strtoul.c,v 1.4 1996/08/19 08:33:52 tholo Exp $㿘a# @  ` - +  L@` 0 L@ x XL`` 2? 0  ?@?@  )a/ \#  # ?А   ?ɐ?8?2  ?? "%0 @ @آ`4 `&@$OpenBSD: realpath.c,v 1.2 1996/08/19 08:33:47 tholo Exp $./8!#@ # #. . @#.#@{E /@` #@(*`J@ /"*`@S ^ \@  < (  @$ &G \.<   @Sڐ : \#@o@t8$ / \N / N `?O @ 0@ - $ \ ?"b0`@fc@c@S  \ "0@ 0  \"0@St@ \""0 $OpenBSD: random.c,v 1.4 1996/09/15 09:31:51 tholo Exp $㿐Q"耢 Q"R""" Q"쀦/Q#Q+|#'Qb. ?#@c@T*@ *`" *  * "* * "@*`"  "b䀢 "@"@ 쀦bQQQ"* b "Q"" Q"*` *  !Q@ "*` * random: not enough state (%d bytes); ignored. 㿘Q"Q"耢 "Q"Q"" : * @Q"@" a!`c@WP  ?Q""Q""Q("" Q "bQ "bQ Q "bQ  QQ ""Q "bQ "" "bQ ?"bQ "b5Q`&QQ"*  "@Q"耢 Q "?"Q"" : * @Q"@"random: state info corrupted; not changed. 㿘@ǒ @Ò Q"Q"耢 "Q"Q"" : * @Q"@"`a`Q""QQ"4,`@"QQ"H@"a!`@’aQ ""Q"耢 Q,"b!QQ"Q@b* $"QQQ"* b "㿘Q"耢 QQ"q@ bm `9  * $$ Q"@ "@2 `"Q"@ Q"""  #"Q "Qb Q""$OpenBSD: rand.c,v 1.2 1996/08/19 08:33:44 tholo Exp $㿘!Qq"@Ȓbm `9 $"1 *Q $OpenBSD: getopt.c,v 1.2 1996/08/19 08:33:32 tholo Exp $%s: illegal option -- %c %s: option requires an argument -- %c 㿘 [!   [Q# J ) Z ["!Q# Q* @"c J -Q 8"c ? J` `" J` -  ZQ#`"# 8" q? ZQc "c J`:"@ߐ 2!J  Z# -Q\?# J QQc "cQ# N ?N :J( Za!`/`@ :  \""tQ# J 9 Z3QQ# J@  \&""tQc "cQ`8"# N :Q  :#  ( Za!```@ ? \Q#* @"btQ 8"c Qc "c Z#$OpenBSD: bsearch.c,v 1.2 1996/08/19 08:33:26 tholo Exp $㿘>@ޒ@  $>>> $OpenBSD: atol.c,v 1.2 1996/08/19 08:33:26 tholo Exp $㿘 @ $OpenBSD: atexit.c,v 1.2 1996/08/19 08:33:22 tholo Exp $㿘 \b 2 !h $@ 2" ? \b ""b  "*  "  㿘a!@}㿘 @? @€㿘  @x  x@''a8' ' '' 'a!@耢  ?㿘'L'P'T'X@{oL㿘` ` 2 `@m  \ "b0?`?` &``@ . :  " @ &@* `@㿘 ? & `& @@$OpenBSD: auth_unix.c,v 1.7 1996/12/14 06:49:40 tholo Exp $authunix_create: out of memory Р@  (Ja@!DR & & $ \"d"d$` `$``$`` & `& `& $`H@ H''''''0P!@β @ 24@ @0$` $@@Ґ $`P@c@&`& `& @͐0a!`@+c @ ?@q@v/@O{ @O_ @d  * > ">x㿘 $ ` 㿀@ ' $``@L   "@$ @ "  & &   '@ $ & &  & @f `$ @2 8  $ ''  @ @@Q '' € @"  $ $ $@1 '@ْ `@㿘 $@5   @/@- $  @'@%auth_none.c - Fatal marshalling problem㿀 $`!@ @r @m 2 @#`  @$a  `@`     $ @ @@F@: <  ! ` &@: >(` @:`??@ D@ +`` >   ; +`>: `@*@` "`@`  @㿘 +>/;#-$ .@ @@@ % @    ,@  ,@ $ ` , 2  .@ @ɦ@ @"ò`@" @"`@@7@Y@"@@@"@7@0@% "|Z@@@ 5@@ .@ @ܘ" .@ .@  .@  *  &@: :  .@  *  &@: :&㿘  >' % #a#3$`@ .@ @"6@@"A`@ ך @L @ Κ @"@ǀ`Ě &@P(@"}` ‘, N: @   ` * `  @  2`` ``: N? 2 @  ` `` ``:{ N 2w @  u`p `2`` `: `N? 2`@  2``(X N?@  2R `_"O `:K N@  H``_E`@ 2`` "``: `N 2`@  2``:( N@  2" `_" `( N?@  ``_` @ .@@  .@  ```2 @ .@> @"\@"f`@>0@"f`0@">@>0@t0ˠ,`, @`?2`` ?" `,    $&8 `,  `   @ 2 @ . @   . 24 2>, /` " `/` >`" , & q 2ef[>,!>3$#%"U 2I@ .@ L@ .@ .@ ",`,  ` &: : + `, &:@,`, ` &: : `,  :  㿘 @ N * @<   )a @ N@@"    2        ,    `    `    0   ` @? ` #  _ #  2 _ #  `_{`  #  {_  {  @3@  @  @u` &  `㿘 0 @ N * @  )a @ N@    2        ,    `    `    0   ` @V? ` #  _ #  2 _ #  `_{`  #  {_  {  @3@ 2@ @  @u`㿘  ى(>)' %#!$ . @"~%@"h @"I(@J@N?~@ @V @@@m@ (@^@ꀠ@@   @Z"@p&@(@ v82rm   2kf e b( 2a\ 2]X 4YT (  Q `J G(( 10>; &7(( 0(( *(( (   5>3$ @(@2 ((  ( (( 5) `     $ @ @@ @: <   ` &@: >(` @:`??@ D@ +`` >   ; +`>: `@*@` "`@` @@`$ 㿘 +>/;#-$ .@ @@@ % @    ,@  ,@ $ ` , 2  .@ @ɦ@ @"ò`@" @"`@@7@Y@"@@@"@V@O@D "|Z@:@3@' 5@@  .@ @" .@ .@  .@  *  &@: :  .@  *  &@: :&㿘  >' % #a#3$`@ .@ @"6@@"A`@ ך @L @ Κ @"@ǀ`Ě &@P(@"}` ‘, N: @   ` * `  @  2`` ``: N? 2 @  ` `` ``:{ N 2w @  u`p `2`` `: `N? 2`@  2``(X N?@  2R `_"O `:K N@  H``_E`@ 2`` "``: `N 2`@  2``:( N@  2" `_" `( N?@  ``_` @ .@@  .@  ```2 @ .@> @"\@"f`@>0@"f`0@">@>0@t0ˠ,`, @`?2`` ?" `,    $&8 `,  `   @ٔ 2 @ . @   . 24 2>, /` " `/` >`" , & q 2ef[>,!>3$#%"U 2I@ .@ L@ .@ .@ ",`,  ` &: : + `, &:@,`, ` &: : `,  :  㿘 ( , 0 @ N @ ,@ @k@ +a @ N@@ؼ "    2        ,             0  @?  c  _  c  2 _ c  _{  c  { _  {  @ߚL@ @@C@>@Țd`& L@ ` 㿘 ( 4 0 @ N @" ,@ @ +a @ N@    2        ,             0  @f?  c  _  c  2 _ c  _{  c  { _  {  @&L@ 2@׀ @@@}@d`㿘 >%' #!$ . @%"r "J) MS?~ʶ „@ b @w@"@"n 造 @  h"~@&(" 82@   2@x w@r  2r@k 2l@e 4f@_ (  \  U@P  @.  @O@@ F/@("C&> @.  @@@3/@O@/ (   5>3$ (  @ @.   ( "@@@/@@@( `㿘<"e@  @4"E@2 `( "`    "   '*** unknown regexp error code ***invalid argument to regex routineREG_INVARG"can't happen" -- you found a bugREG_ASSERTempty (sub)expressionREG_EMPTYrepetition-operator operand invalidREG_BADRPTout of memoryREG_ESPACEinvalid character rangeREG_ERANGEinvalid repetition count(s)REG_BADBRbraces not balancedREG_EBRACEparentheses not balancedREG_EPARENbrackets ([ ]) not balancedREG_EBRACKinvalid backreference numberREG_ESUBREGtrailing backslash (\)REG_EESCAPEinvalid character classREG_ECTYPEinvalid collating elementREG_ECOLLATEinvalid regular expressionREG_BADPATregexec() failed to matchREG_NOMATCHREG_0x%x` >@3 R!h!h  !@ !` @  !"`@ @`@c@ Q @B*?0%d㿘R!h!h " @4  "  2 @v`x1 p0123456789ABCDEFabcdefxdigitABCDEFGHIJKLMNOPQRSTUVWXYZupper space!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~punctABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ printabcdefghijklmnopqrstuvwxyzlowerABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~graph0123456789digit cntrl blankABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzalphaABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789alnumDELtilderight-curly-bracketright-bracevertical-lineleft-curly-bracketleft-bracegrave-accentlow-lineunderscorecircumflex-accentcircumflexright-square-bracketreverse-solidusbackslashleft-square-bracketcommercial-atquestion-markgreater-than-signequals-signless-than-signsemicoloncolonnineeightsevensixfivefourthreetwoonezerosolidusslashfull-stopperiodhyphen-minushyphencommaplus-signasteriskright-parenthesisleft-parenthesisapostropheampersandpercent-signdollar-signnumber-signquotation-markexclamation-markUSIS1RSIS2GSIS3FSIS4ESCSUBEMCANETBSYNNAKDC4DC3DC2DC1DLESISOcarriage-returnCRform-feedFFvertical-tabVTnewlineLFtabHTbackspaceBSalertBELACKENQEOTETXSTXSOHNUL(    " @ a@ؐ!S4v *`  $`@͑* $` $`` 2$`@f $@$`$`$` *`" `` " H!$ $ $ $ $ $ ($ ,$ 0$ <$ @$ D $ 4 $ 8 P @ >!$ H@  `?$ @:  @o @ @ ʔ `?$ $@ @ '@ 5@ $ L4"E$ D& & <"e& ( @  ` "`@@`㿘  @  @* :  |" :`" @H @:  @ |*  2@ޒ  @&J@ |!` & "@    @ c" @ " "@ X   @ " $@ J"㿘 `& @?ܑ* : `X  #*`@*8+L+L+L) +L**+L+L*+L+L+L+L+L+L+L+L+L+L+L+L+L+L+L+L*+L+L+L+L+L+L+L+L+L+L+L+L+L+L+L+L+L+L+L+L+L+L+L+L+L+L+L**+L*+L+L+L+L+L+L+L+L+L+L+L+L+L+L+L+L+L+L+L+L+L+L+L+L+L+L+L+L+*l @ @6   D`" D  D ,  " @Ŕ @J@ ) ) ,  " H@ @`&J@ )"`@ [@  `( "`( `, "`,L @  `( "`( `0 ?"`0@ ;@ݒ 6   @- @o (@$ @ @’ `&J@ @: , J@ac  @ , :`@ @  @?֐ , :  ? {ѐ` J`ac   &@ , :  +"%  ? *"  ) {G"@& @" "@  "@ @"k "@  @" @%""@ڔ  @ $@є K@* @J@ ,`&J`ac   !@@ @d @ J@ }2 `&@    J@ }`&  @ @ @  @  @?֐ , :  ? {`  J`ac  @Ȓ 㿘 @ @  @   `&@J@   㿘   @ J@ ^ `&@:  `( "`( `, "`,  @ @  `  J@J` `@!   ` ?& @   `( "`( `0 "`0 @] 㿘  &J`\a) @ @L `& @aa)ya)a{`." `[`*`!a("( a{ a}a9a1 ~0`[0|  @dy @ t@Ip@ k D`" D  D ,  " @ @ `  J@ \J` ) \A ) ,  " H@ @ ` J@ \ J` )`)&@ʒ %?Б, `H @^` `@D`H@U @    "`H@ @ƒ ~ @:"J@ *2`& "@N @/" "@B @#"|  @ r` p`$J@ \l`$J` {h`$`&@k J ,& @aJc   !@R@O !@ @ `  J@ \ J` }2 `.&  @ @  ` : J@ \2J` }"  &   @ @ @  `$   㿘   @! J@a#@ ` ` 㬀 . * ?Ж #J `J   `  @Ւ [:<:]][:>:]]㿘@Ր @   b@x  2& @  b@i  2 (@I  & @: J@ ^2`& @:J@ ]2 `&@ ] ` *] ` ] @:J@ -2 `&@ - ` *- ` -,`  "J ]"     J -J ]"@ @ : J@ ]  @:J@ -2 `&@ - ` *- ` -,` @`&J@ ]" @.   t ` ,`?,"` %a @ `@  "?@* :  @ ` * ` ,`? ` @$/  ?,  @ `@*@* `" ` * ` ?,`   " ` @ ` *@* `?,`` @@  @@@=0@[@X 㿘 @ J@ - [2  @  @ 0* :  : ="40e &  @ J - ]@ @ @ @y  @  `  J@ :J` ]3`@f 0u &  @] J - ]@S @ @ @I  @ ` J@ = J` ]`G&@3 0B@  J -@ :,`J ]",`& @ J -& -@,`:`, : @@ ,`: , : :` @ ` * `   .`㿘 a# J@  `& "R"t"t @@ 2` @J "@` @ @ 2`@ 0 @ ` * `.` L   `@@ L 㿘@K = @ `@ * ` .`㿘 @ @  @ ` :&J@ [ `J` .``&`&J@@ . @ ` J@ . J` ]`&@V , > 㿘 @   : J2J ]"  &   @  "R##  @@ܔ 2`@J "N``@   @ 0L@a] ,a\* : * H㿐 && / ]//&& 㿘  8  a#@   ɐ* : ے0@g`    4" 4,㿐 &&  ^/ / ]//&& 㿘     .2``@`#ԓ*`@D$D8D8D8EEEEEEDE`EEEEEEEE$ " p&  "@%`   @" @C""@  @: $@ 0K "@  @" @$""@ٔ  @ $@Д `@   "@ۖ @"0@l0@b0@  ""  ""  㿘 ` "`     M & 4 @    2 @9,   @s,  "`   2 @+ "` @d  "`  ,   @:``  $ ` "  ``%@  @    - @  @ϓ:`  &   %  * . . & &  ` (    (*   *` 㿘`  *` @  (  2    @` @ @ @ @ @   *   &@>    @ `  " * :       @ `  2  㿘``@ې&`` @M&` @`&` ` @ 0?@``  *?  8 `         ` 8 `          㿘  (`8? @ 2   " `4`&`4   ,@ @ 2  ǔ 2,@  $ @  $ @㿘  @c   * .` @Y. & 㿘      `2`@:`*`@E  `&  *`@" 㿘  ' ߐ ,  *`  "` *`H "`H *.   "  @* "    (@> "@㿘   @.` 2&  0& 㿘 &`  @*` &`  &`㿘  v ` >1)'%##$" @ "2 @ )`@"- @ ") @  `@" `@" @*  @  2`( @   @`@$ &`@ @ @2`@ $@  &`<&`@ &`(`<`@`> @  @ *`*   ! `>     4  2 `("`($OpenBSD: rcmd.c,v 1.20 1997/04/05 21:13:15 millert Exp $RSHshelltcprcmd: socket: All ports in use rcmd: socket: %s connect to address %s: Trying %s... %s: %s %drcmd: write (setting up stderr): %s rcmd: select (setting up stderr): %s select: protocol failure in circuit setup rcmd: accept: %s socket: protocol failure in circuit setup. rcmd: %s: %s 0''@ @ِ! !(@ Ēa0 .`2 `@@Z9 !(@ a0-2 `@  @6p@w@:2@@6d?%@1.  #'% \'a@Y0 #!`@Ia80G@ 0`@B!X0@ @F@  / ` /7`@` @  ?@<0 0 =?'2 ``4`@=ó.`  0'@{`@ ap$0@v ``$``@` '@{`@a0@0`a@@0쀠a@ '@ `'@1  @@ @@ @"  \@"0a!`@ٽa @ 6 *   * "6`*  `* ? "? \""0   @Ę  6`* `?:  \"0 " a@Ma!`@قa|!`@|bv@2'?*  @@@|   \@'"0a!`@\b0X' 7ـ  a~* 2 ! a!`@HbH>@] @@W @@Q @@     \@"0a!`bx@$O @   @ؔ O @/А0  @@@/Đ?㿈@z  / /'  @ &? 7#47@,   \"0 0 7@3耢?$@?@9K 2 +?)   h " . @ @c    .  "?p . ?p  @; ݰ  ". ?/etc/hosts.equivr/.rhosts.rhosts lstat failed.rhosts not regular file.rhosts fstat failedbad .rhosts owner.rhosts writeable by other than owner8`  "@Ob @c @VZ @R 2U?S" 2 `"M? @IF@@b@W@/@bФ@/ڐ0 @’ !"<  #T@ # ` @#8 #P  Z"#@??x@#!x-a+]!@ @ڒ 2  ? & @0 `& @ 倢?2 * :  #"ܐ :   a,*   ,  L   *`L  2, L "  " J@    L  L,J@  Ox +xOy  @6 @/ ` @P%x(#`L@ -L`  @?@ ` @Px @O` @JL + -L  @ &  @Ox! L  @" ? @Oזx @.@?@(`? "# " ? ? $  ?㿐'D@7y "D  @Zx     2DD'@xl@`?rcmd: address %s not listed for host %s㿐'DD @8 /! "@֔ ", @7B2 # !" DD@Z9  "1  `& ` 2D'@x+ a@~V %lx.0.%x%02x㿐   7 7! #b@@>#    @` @ @@2 @ @Вb `@ɒbЀ@1L 2  @`@"؀@*L@@b@ 1 #  MTυ(85@( e<e<e<e<e<e<e<e<e<e@e@e@e@e@e@e@e8e8e8e8e8e8e@e@e@e@e@e@e@e@e@e@e@e@e@e@e@e@e@e@e@e@e@e@e@e@e@e@e,e,e,e,e,e, *   J ` H* *`@@ 1/@Ӓ # #@̒ .@Ȓ :  *  . : . ' . ( #4#44(`4 `4 `4 `4 ` 4 @I  2(4@ 4` 4` 4` 4` @  * c2@0  c,@+  #(#(4@`4``4``4``4`` 4` %d-%d-%d-%d-%d%x.%x.%x.%x.%x.%x%x:%x:%x:%x:%x:%x%x,%x,%x%3x%3o%3dx  N - #\c(@0#!#\#`c8@/!!Ք#\#`cP@/ښ!!ch@/˘ '''@! @ h!, 0ӑ* :  KY`*  jjxjxjjjjjjjjj\j\jxjxjxjxjxjxjxjljljljljljljxjtjxjxjxjxjxjxjxjxjxjxjxjxjxjxjxjdjxjxjxjxjxjxjxjxjljljljljljljxjtjxjxjxjxjxjxjxjxjxjxjxjxjxjxjxjd  ,@  ,@L@  @ #x+` N 0#"##N  L@ `" 4 @Q  ,?ܐ @/ ,@?@/!@㿘`    @Œ, `4  @&@/ /&/㿘`@@   `@ .`!hА  ?*`: &? *`: ? *`: ?N   2    8  % ,  mmmmmmmnmmmmm?,@` ".`,@`  ,  ,@` ,@`@*` @$@$@.`.@㿘 #@  @   @W    :, @S ."؀",   @` ` ` , :` @ ,  @ , @ 뀤,1 #@㿘 #`  @ #А *`: ? *`: ? *`: ?N 2    ,  pppp$pPp8p8,@`  ,  ,@` ,@`@* # $@ *#    *` .S0 *@ `*`8*@`*@` * *@ #%8xH.%02x:%02x:%02x:%02x:%02x:%02x.%u㿈*` *   *     #\ #` #d *`  #h1S#`@H #`@@ 1/@ɒ # #@’ .@ :  *  . : . ' .  # #, `,  `,  `,  `,  `,  `,  `,  `,  ` , ` , ` , @a  2 ,@ ,` ,` ,` ,` ,` ,` ,` ,` ,` ,` * @o  * c@<  c@7  # #,@ `,` `,` `,` `,` `,` `,` `,` `,` ` ,` ` ,` ` ,` %d-%d-%d-%d-%d%x.%x.%x.%x.%x.%x%x:%x:%x:%x:%x:%x%x,%x,%x%3x%3o%3dx  N - #\c@,Ԛ#!#\#`c@,!!Ք#\#``@,!!` @, '''@! @ h! 0ӑ* :  KY`*  w8w0w0w8w8w8w8w8w8w8w8www0w0w0w0w0w0w0w$w$w$w$w$w$w0w,w0w0w0w0w0w0w0w0w0w0w0w0w0w0w0ww0w0w0w0w0w0w0w0w$w$w$w$w$w$w0w,w0w0w0w0w0w0w0w0w0w0w0w0w0w0w0w  ,@  ,@L@  @  0+` N 0 8" @#N  L@ `" 4 @#  ,?ܐ @+,@?@+!@㿘`    @뗒, `4  @&@/ /&/ * ?*@#d?*  @ ?*  ` #dd#`? *@0 @  `?# @㿘 \@-"@-@ `  @   0耦`  \ @Ò  \" @-r㿘 [@-!@. [@  [  @   0 [! @-0'ش  ?c    $`  $ \ @ @  "  "#? E  #@@ۘ9@.א 3/@ *     *      2?@&l @ f$@3 @ &&?€Q \$``  C1  c"c;" ##"/  J .  N .  2  J 02  "` b` @`*@-``Ԕ @q^ "c1 #  &  "b` bf0.0.0.%u.in-addr.arpa0.0.%u.%u.in-addr.arpa0.%u.%u.%u.in-addr.arpa%u.%u.%u.%u.in-addr.arpap \   @?ؐ@ \!Ȓ@2 O؀ 2 bH@  @J7 j f"_4c  b2` `2]    * 2"?"( $$P@~$h@u$ #\$@b  @Y*$&    `"" 2```" @ 2  $@ 㷈 \   @9?@C? \!Ȓ@ۢ O耢 2 bH@  J7 ' f4   b2 @$/  @Y($& V     @  Ǡ  $ِ 㿘 \@,"@, \@˒  \  @   0 \" @,㿘 \@,x"@,  \   \" @,zLC_MESSAGESLC_TIMELC_NUMERICLC_MONETARYLC_CTYPELC_COLLATELC_ALLPATH_LOCALE/usr/share/localeLANGC㿘@L  ! "X 2   @# $"X "XJ    #"bX ׀`   ԑ. 1T"Ӱ  T",`@@i@``$,`N@ J T!. @U@TJ@ `T@K! J@ ` @A#Ȓ J@ .  #С.   @  z,  T!'   ,`@%"J@ ,`,`@ ``, ^  .   @ܔ R, @ /   ,`@̔ ``, ? L /"L O  $  ,``@,`*`N@ /"`  `/"N@L  N@ 2ސ$` ,`    p@`  @Q @L 2  2` ``  @ %s/%s/%s/%s/%s㿐 !pT@b8 T"8T") +!T"T". @T@  !p#\#` c @@f `1   . 1 !pPOSIX%s/%s/%s㻘,`  Tb @/ +,` `  @%cЀ "@`x   ,`1T"@ @C@ 0,`  Ta,`$"X @!  㿘   0 41  U 8&!<  T .` `(>`/``?$`      P .  ..@@(``?)?$   T8 @ ` .(.?$  Tx _ ذ .(.7$ T (/$  è ˦U +  Ӥ ۢ+U @.&&&& UU @  (@ '@' ( !@ @``$@ ɇ. +   + `. & &  @  a8a8(@'@('``$@. & & "  @  a<a<(@'@('``$@.^ U ($  U  . .. ' U@@(&``$@.$ U  ☁ 4 4 0    0@"0*2`㿈''      @ '7` Æ*`7` #@7` `/`@6` DŽ/ 6` Ȅ6` Ʉ` ʄ.`@ ˄@@@@ τ@ Є@ ф@ ҄@e@/-~' %  0        ž`.`)>@0 @)@0 @)~@0 @@0@@. @(a(`(@0@@ 6` (o@ ( 6  ( /(1 1 Ӱ"*`1 $ #@1 (  ,/`@0` ׄ/ 0` ؄0` ل` ڄ.`@% ۄ@@ ߄   @% 㿈U" sϐ/ / / / / / / /ј''.@.`.`.`.`.`.`.`㿘U" 2>    "  "Ā "" ""ģ0 b,`0b !@ 0d @(f@2h(@2j a@@2l !@*n  @ bb@ dfhj@ln      "   "   " " "+Tc (@ %@0@ .6   %@,`) 2 !2 + b+ `@2+ b@ *@2@2 a@@2 !@ *@+ a$+ b@$@"  $  &  (  *@  ,  + ` $  $@ 㿐 U"+      + $$+ $ 㿐U" ^  U"+ "? +  @ `*@"$ @  + ` ? U" + +  *@ @ .    㿘 8 8 D @  1  V Ḅ&!  U .` `(>`/``?$`    @  ʹ .  ..@@(``?)?$   U  ݆ .(.?$  U   U .(.7$ Uh T(/$  @ @V9 +  @ @+V8 .&&&& VV8 @  (@ '@' ( !@ @``$@ ɇ. +  (@ ,@+ ݇. & &  @  aa(@'@('``$@. 0@& 4@& " U @  aa(@'@('``$@.^ V ($  @V8  . .. ' V@@(&``$@.$ V  @ ᴀ     ᰄ@"ᰕ*2`㿘V"@ 2    8#@ 8 8#D 8"#@ 8"#D0 (c@,`0b !@ 0d @(f@2h(@2j a@@2l !@*n  @ ,c@b@ dfhj@ln    2!@ 2#@ 3!@ 3#@ 4!@ # " 4#@+UcX (@ %@0@ .6   %@,`) 2 !2 + 0c@+ 1a@@2+ 1c@@ *@2@2 a@@2 !@ *@+ b@$+ b$@"  $  &  (  *@  ,  + 8a@ $  $@ 㿈''   @    '7` @*`7` #@7` `/`@6` @/ 6` @6` @` @.`@ @@@@@ @@ @@ @@ @@e@/-~' %   @ @ @ @ @ @ @ @`.`)>@0 @)@0 @)~@0 @@0@@. @(a(`(@0@@ 6` (o@ ( 6  ( /(1 1 #@*`1 $ #@1 (  ,/`@0` @/ 0` @0` @` @.`@% @@@ $@ %@ &@ '@@% 㿈V"@  / / / / / / / /ј''.@.`.`.`.`.`.`.`㿈N@ $VN` 1@1?@+%;"@ 2j* *  " (ϐ 2" N@ _   N@ z*`:  `?ő*`:  Z *`:  @?ˑ*`:  9*` :  - ?Ғ*` * *ڤ  N@ z*`:  `?ő*`:  Z *`:  @?ˑ*`:  9*` :  - ?Ғ*` * *ڢ@N #!  A   N  *` @*"  W 2 N ! "Ȓ@ ", @ON` z*`:  `?ő*`:  Z *`:  @?ˑ*`:  9*` :  - ?N@ z*`:  `?ő*`:  Z *`:  @?ˑ*`:  9*` : `- ң*@ @*"Ȕ"N`  "* "ߐ   2C 2`2`VH , 2` ? , 2` `? @ ,  ? , * 2 ? , 2 ? , 2 ? ,  ? , * 2 ? , 2 ? ,  ? ,, 1 "Ȱ $OpenBSD: sigsetjmp.S,v 1.2 1996/08/19 08:17:45 tholo Exp $`O" (0 (`M0($OpenBSD: setjmp.S,v 1.2 1996/08/19 08:17:44 tholo Exp $  0 " 5H P """  """㿠   @" &  g @$OpenBSD: _setjmp.S,v 1.3 1996/08/19 08:17:25 tholo Exp $" " " @" `&"`@6 0`㿘@?@M?  㿈`2@ '`'''@㿐 !А@Ȓ"@'@Ē"@* "@*`@*`'@lԒ /var/run/dev.db@ h @ 29 <  +0 "   @ #P @藔 7P'T'X '\` X` 2 ``W`@d`@1W @@/dev/8,@. & @2@" `@!W @Ԕ?@ @@`@@H @8 E* , , # @גc&* , , @̒c& ?@ )* , , # @޻c& * , , @ްc& @~ 2?* . . @ޟc?xph`XPH@80( USR2USR1INFOWINCHPROFVTALRMXFSZXCPUIOTTOUTTINCHLDCONTTSTPSTOPURGTERMALRMPIPESYSSEGVBUSKILLFPEEMTABRTTRAPILLQUITINTHUPSignal 0 I @*`2`Jg" 8o-"M XO+"KL* D`H*  u2D*  !00    ** **  *  +  +  "   *"* 2 㿐M@ O?' @棔@E ,`@A2 8 @昔  @t 8,?M@ac  / @{ * 2 #` @  А `M@  @ @㊓, $@ ,` =/@ 3 0@[ -#\,` M@ g"d8 o a" m  u"iM@`` +` - =*`:  =" }  *`> @?* :  * ,xxxxxxxxxxxxxx<xxxxxxx<xx<x$4$`"Ъ``"ɪ`b II @, $@ ,?>@6` =" + @, i$@ ,? X@d6`  @͓, R$@ ,?M@>@M6`<=="  @⫓, 0$@ ,?>@+6` @ⓓ, $@ ,? X@6`5`M@  ,`,@R`g"*`o`= -`X`+`-0=0:`u05*2 -2   +* '2  $2 *2 2* ?2  * 2 +-  =  *   - +  X@2`2 `7 J@+-X   J@-+`8  X`8  `( `** 2   ** 2  "J@** 2 ͐ longjmp botch. 㿘 /`@Ȕ 㿐 ' '   @f8@?㿘@@ג%u㿘 ?*  8cH  # 9N  2# # 9cH @3  $cH@2s2&`1 9 #L /@#L @@ʔ .  㿘 ?*  9c\  # :N  2# # :c\ @   $c\@ n2&`1 : #` /@#` @@ .  /bin/shsh-cx''N@ r w \K`  \ "b0g @ '` @@ @V?` ;K@@g@e@I K@ r2  @? @U  "@> @L@I :#p  '`@@R @`'/#/c /(@= @  r2@"@@!#`#` :cp#@"cp㿐@ :#p      2  % \? @,\ ?0 " ` :"cp$@@???c  @` ??˰?#@⚔ °??@ ?# @! ?E??#@!=?#@?@ ?# @! ?0??#@!(?#@?@ ?# @!  ???#@! ?#@?@?# @?#@ t??c@ ?#@?#@?#@?#@?@?# @?#@! ?#@?@ ?# @  ?j#?#@ b??#@?#@?@ ?# @!  ?G?#@@ ! =?#@? ?c @ ̀@?.?#@@@@ ̀@"?#@? ?c @! @"?#@@@@! @# #? @@ @ @\ #@?#@?@ ?# @!  ?H ?#@@ ! >?#@? ?c @ ̀@?/ ?#@@@@ ̀@#?#@? ?c @! @" ?#@@@@! @2    ?# D?#@ b  \ "b0m??#?% #\    @ߘ    , , 4 $    2J@ז ? Հ =?3  @ /%)@"" ` 2J@ "@- 2 `$  `, `4  `? ,   2􀤠ۢ` ˀ@ߒSF ӄF @   "  ?b   @h ???#Ȣ@@ࡔ 4 4װ?ɐ "?ch@7@ ?#?c@  ?  #\  @' ?```*` *   ?#@ ?#@* * `  * @\ #\  @а    , , 4 $    2Jk   @ ?  ]?[?7@?#ڀ@K%E@`"> "9@ J@ "3@  `@3 2" `$  `  "       ` ,  ,  ` 2  24  , 4 ? ,   2` @ђ㿘 X $, €?  (, 㿘 @k ?@㿘! \$"0 @  "0  ? @G㷐`"@`"`"`~"` "`"`d    \2 2   \? 2  `  2 *`2@0@㿐 {   }  @r {@ @ 㷐@@2@`@`    )`[2  ] `" `]` "  {2` }2 ` `܀`[`  @R&@M@ [" { ,#`?` }`9``@ ] `"@`@`]`@ "' &`#``@ ,2@ ` 2@ 2@ `R&``@(@& HOME㿘 ~; (7.?   "* /" **  /*N @ޑ 4@ΐ" @@-/ "!  @+ݐ 2 J @2@`@ 02@ `@*2@㷐$@ a  [  !  - ?"?`  [ *"?` K I  !" @D ] 2 4@ [4@ !9`7 !`4@` 4@ - ` ] 4@`4@` ]` !&`   ]!&`   ?!&` @    *@"  *4@` 4@@. "@!` 2 #"2` @  `* ` ,@ "@ 5@ 㿘@@㷐 @  8 5  -  @`?`2`@*`2 `  ]@ @ 2 8 ``( `" @*`2` @  ʰ @*@`?㿘 ` *   `@??2@@ .㻘 7 P7@:` @2` @0@㻘@* @2$@0€㻘@ @2(@0€    *@ `㿘@@@ @offonsecurelocalrtsctssoftcarmdmbufwindow㿘 ; \  ! ;@u #a #a :# @ \ @ 2N \`? "`@   \" •? \ :c    N  2 N " : #" : ;* X :#x"#x@ڐ$ N $ $ @ϐ :#x"`N "`@Ð :#x" " N  :#a#x7a@B   7N c  7 ?|$ a@0   7N c  7  j$ a@   7N c  7  X$ a@    N c    F$ 7a@   N c    4$ 7a@   N c    "$ 7a@֔   N c    $ 7b@Ĕ   ;N  =2  ;@r$ @)N o7 ;J X #" N #  : N "  "  :#x"`N ""`@ 2.1 :#x JA ;"`6`2 J\2 J ""  *`'# *X&*  2 *X* J "   "   J "  "  " 0 Jŀ"*㿘@L =   /etc/ttysr㿘 ; \ "8@>A 0 #8@,c ;"`\@ 㿘 ; \ ! ; @2 \8$ \@ /dev/ttyr+ `9 9@ `a!`P'Đ 'Đ 'Đ @ڽT @ҋԦ   ?'T @@f@= ; ` ;  ? $ @B?`$ @? : . .T9`@ٚ Ԑ 'T  @єȐ @} a 1 ;@Ɛ1 ; `㿘! ; 쀢   ;  @   $  ; `  ; @ ; "`-  ; ; * `@! ;% ;# ;! ;耢 " @E  * @ $` $`@ ޔ $  * `@ ; & ; 㿘 [!   ; @    [ "a ; J  㿘 ;!  @G   @ 1 ; ! 㿘@6   @ ;!  @X  ;!  㿘@  @i  ;!  @?  ;!  /etc/groupr㿘 ;! ":@= =" @ = D " =@ֳ =" D   :@` ;"a@ 㿘@ 㿘  ;"!  㿘! ;! @$! =" @ = D " =@ւ =" Dgroup.byname%dgroup.bygid: ` ' =% =7 =3 < < @Ш+: ;! @ cH @@5^H `$@@T @  .`JDH =L#\#`:@6@8D &D'$@&D =& L:D =L@4耢 $@"$@@قH:@5֚$@@  @ @`@@@*'̐`@$ ;@c 2' @5 N`@ ;`? "`@   ;" y? ;v@ +rM :S  O@4 b H ^$@ @4H W@ @H: :b@~\@ H:b@5a蠒2;@`@@@Ֆ*'̐@6ؒb  ; @6Ӓb %@6ϒb "#@"B%@~*>%@3 @6b  " @В  @ $@@bq @6b  ;  "@ @@6b %@6b "@@} %2̀@̀ ے  ;! % ")" < <J , ̀` *" J    ``""*" "̐  '" BLOCKSIZEGKM%s: unknown blocksizemaximum blocksize is %dG%s: minimum blocksize is 512%d%s-blocks㿐;#;@j#Ȥ`"L \@͔ &P<" J@ J` 1;J M"(; k G"; K "&! ;;; k m g;; ;;#ؠ 1;#! $#$1#@Y" @< @Y @H! 1 =< (@Y;#""1 = P <H@%&@ P.㿘 \ "b0@B (~ @ؔ (& `& $`& $@$$@@ f<b0@K ]?42 @ -  @ן@K \@9@6`2&``@&` $@ 6`4* 2  "6`4 &` &`% `@ ؤ@<b0@  &"  2 4 $ <"8 @ה &  $  & $ "b0@@@ @ 㿘`&6`$`@ @1@1 /@`N`A "  @0`@@ 6`& &`&``,& 㿘 " ` @Ӱ T 2 6 @Ӫ  " @  @Ӟ@Ӝ  $  @ c   \"0 @ @ӌ $ 2  ` \""0? ..㿘 - $")  8`6 8@ϔ 6 4`2( 4 4?* 2   @ 6 4* 2   $ <"8 @1 &  \"0&  6 4 6 6 6 4 2T`"  6$ @" , @" 6 "@Ռ  " @O$ 6 4 " $! >$$@A$ @~?  \"0&  6 6 6 "X$  &   2 @   $$" A$  V@V 2 2 8$ @  2$$ 怢 2$ @. 6 4* 2   $  <"8 @ &  \"0&  6 4 6 6 6 6 8 R`2  `$ 2 `J / /  $ /* & @@H$@ґ V 2?2 $@ҋ \""0$*@V 2 2  6$ 2, @ H" " 6$  @ = ! \"0@ $"0@   2 $ 2  =@ O! " $"d$$   6 4$  \  0 2`8 㿘`a \ D"b0 \""0 $"2>  4  8 26   a@Ga  $!& $ T 2   J / $ @& <"8 @ @& @Đ 2 @S  x' $   @( ?  44 \"09$2 $ ` 2 ?` 0 ''܀'2'@* 26 \"0$6 46' \"0'@  '$ " T2  `2$J / $ $  /  . T2`     @  $ L` . L` ?`  `@m `  \ `@$ `@  \ 0@V@~@ \"0  $ " ? ` 4 $$ 4 2 `  6 4 6쀢  4 4$  4 47$ "  $܀" $ `    $  @ $  #4 4 $   @ $  &@h @$ @k  4 4* 2  *`2  ``$ %k @% @% $   @8 .䀢%2* T2   $ @    =@!   44 $"& $ 2     44 @~8 $ `<`6   @  `84 d  $ `@\ 5 \0`@e 2 &`&0N @]   \"0&` @ `A  <  2) &`, &`( 6`0N`@ .2`N`A  ?`@c  2 `! 2``,"&@`R`2 6`( < ( 2     <    㿘  (&  @<*` & &  `"    @  "`" 㿘 $ D@Ӑ  @ @D $ 26 & I ?& <6 & & & 6 6 6 8& & 㿘 @  㿘 a@& @ & `? " @""2  @"""R26㿘 @8  8 $ ,  ` @h  ?@I ?`,@ \`(@ \ "b0?@8 \ "0@Ő \""0 : xxswufsswap ,rwrqro㻘7AA"x5 > > l9A;A+AA"A" = > h$@xhA @vbp E@% &lJ # = @&  @ & @x"  = & @qb A"A"&  @x@w&  @x|@w& { m& k& i& g& & d`@b &lJ # = @ؒb&  @Ԓb&  @Вb U& & &  @Ȓb@wr&  @b@wi&  >@vJ`x A@b,A"A"A"@ A@ @ @ @ @ A @b`J =  @v OA =㿘 > h @@   # 1 >  l㿘@0 1 >   l@  l 㿘@ # > > p  `p@ ? /etc/fstabr㿘 > h "B@4u 0#B@w`c  > "`h \@"0  㿘! > h @b$ hfstab: : pB#'А 'B#'ؐ 'B#' '@v@Z''B#' ' @{ 㿘'L'P'T'X@Lvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth Edition4.1BSDSystem VVersion 7Version 6swapunusedadoscd9660lfsmsdosffs/etc/disktabb0b1tyremovablesimulatedsfsentnsncdtscsurmilskcshstsbssbpxbxfxoxtxdx > C!''Ē@%  >  @u !'Đ@ ,J |J@ :`'   *`J@ | :*Ca@(vCa@(qCa@(l  C@da耢 2X    C@Ya X $XCb@%] : "X $XCb@)A?"$(Cb@)7$0Cb @)0$,Cb(@))$4Cb0@(& X@ c  4Cb0@)? 4Cb8@) ?,@d0$8$8Cb@@(?28@V4$<$<CbH@(?.4HCbP@(? 4JCbX@(۔? 4LCb`@(є? 4NCbh@(ǔ? $PCbp@(? $TCbx@(?$Cb@(?$C""7 `/C""7 `/C""7 `/C""7 `/C""7 `/ʢ ` a/////Ē@(z?8&&Ē@(p||& Ē@(jx? x & Ē@(_t 2 t@q . . Ē@(Rp? s  . Ē@'K X@1cD.  * :  p ,`: ?4C""7 `/\ 0/Ē@('l? l& * :  4  !W$$@˵İ㿘@t@ "&@`@ Nac   > @tB㿈 2 \ ''   @B ? `@\찒  @0 ? ! \"0@l$"0?@|Ĕ*?@b  "b0 $OpenBSD: assert.c,v 1.2 1996/08/19 08:21:46 tholo Exp $assertion "%s" failed: file "%s", line %d 㿘a!`EbȔ@@x'''' @؀ ?  '$OpenBSD: sigcompat.c,v 1.2 1996/08/19 08:19:39 tholo Exp $㿈`  @'`'` `'@ &㿐'D D@ 㿐'D D@ 㿘'D@D$OpenBSD: killpg.c,v 1.2 1996/08/19 08:19:27 tholo Exp $㿘 @  \ "b0?$OpenBSD: getwd.c,v 1.4 1996/12/21 22:23:37 millert Exp $㿘@"$ 2  \@r"0@{#.# $OpenBSD: creat.c,v 1.2 1996/08/19 08:19:18 tholo Exp $㿘.`&@b2$1 cd@$ cd@$ cd@$̈́ cd@$< cd@$$ cd@$9 cd@$ cd@$ cd@$ cd@$Ä cd@$` cd@$R cd@$S cd@$ cd@$ cd@$ cd@$ cd@$8 cd@$ cd@$7 cd@$ cd@$ cd@$ cd@$ cd@$ cd@$j cd@$  cd@$ cd@$ cd@$u cd@$d cd@$' cd@$Q cd@$O cd@$/ cd@$ cd@$+ cd@${ cd@$| cd@$# cd@$  cd@$) cd@$ cd@$ cd@$" cd@$  cd@$ cd@$OpenBSD: sigsuspend.S,v 1.2 1996/08/19 08:18:15 tholo Exp $ o cd@$OpenBSD: pipe.S,v 1.2 1996/08/19 08:18:07 tholo Exp $ * :"cd@"$OpenBSD: Ovfork.S,v 1.2 1996/08/19 08:18:01 tholo Exp $ B cd@"` h`''' ''''' '$'('`'ДȲ```  \   \` ` `@ʽ "b0?$OpenBSD: __strsignal.c,v 1.5 1996/09/25 13:19:01 deraadt Exp $㿘 > "$?@|  0,@w  4?@p  0,libcUnknown signal: 㿘H"@uג \ .  @v @y .` ?H@vȒ@y .`@˄ "@y@vĐ$OpenBSD: strtok.c,v 1.2 1996/08/19 08:34:28 tholo Exp $ 2 J >0 2J'   "JH? > 0 J   >H  2*? #"0 2HJ$OpenBSD: ldiv.c,v 1.2 1996/08/19 08:33:35 tholo Exp $㿐@@'@ݒ  '``'"@'$$  $OpenBSD: setenv.c,v 1.2 1996/08/19 08:33:48 tholo Exp $㿐N@ ="`@@"l @*6@,`  _  \"( ` 2 >"8  ! \`"(@nj*` $"(H? > ""8`@B* ! \"(@T,`$"( \"(,` " '  `=$ L  $@#  \(*` "  \b(* @L =  = ,   =, @,`   㿐! \@u * "( `"  " @'L'P'T'X 7'@`'''I#'''@(֔L㿀'@''' '@E耢 &@P㿘 (  \ "b0;?@ @2 P (     ?2 2 $? "  : @ c  0 "  < :@ c "  `"   "@: @ C 㿘<"e@' #4"E@&$  " @w  " @q  " <@k < @e@c$OpenBSD: rcmdsh.c,v 1.3 1996/09/15 09:31:17 tholo Exp $/usr/bin/rshrcmdsh: unknown user: %s rcmdsh: socketpairrcmdsh: fork failedrcmdsh: dup2 failedrcmdsh: fork to lose parent failedrcmdsh: setuid(%u): %s localhost/bin/sh-c-lrcmdsh: execlp %s failed: %s 㿈`J"@ a!`Jb@O?@ 2@?&   @# J "@& J"@T?0uo@?@# J @#  J@T#@ @& J@T# @ @ @#  " \@m"0a!`JcH@ @ J@c` @  J 2 J#p@# /  Jx@"  \@# /  #\J〘@"{ \@m"0a!`Jc@”@ɦ @@6 No address associated with nameUnknown server errorHost name lookup failureUnknown hostResolver Error 0 (no error): x N "  \'@ȡ'K"' ' \@ "`@ȕ$$  K"$ $ ؔ$ : @Resolver internal errorUnknown resolver error YK #p0YK#* /etc/servicesr㿘!Y"x  YK#K@n,c$"x@+8"x \b"b㿘!Y"x " \@0$"x \""# ,/㿘!Y"x  YK#K@nc  $"xY >"@$@n)x2LY #L@l!` ?.""DL@l`Y, L "  " L@l`Y. @m@ ?bD* 2 "`"`  ?"T"`L@k` ?.  "#LN    $ @kے`.  2N$1 ?"D/etc/protocolsr㿘!Y"  YL"hL@mbx$"@*" [a"a㿘!Y" " [@$" ["!# 㿘!Y"  YL"hL@mfbx  $"Y ?"$@m2LN #L@kc @.""L@kzcY. N "  " L@kjc, @l @b"` @""`  @#x!LN    @$@`@kH#.  2N$@1 @"/etc/networksr㿘! @#   @M M@l`$#@*# \b"b㿘! @# " \@$# \""# 㿘! @#   @M M@lԒ`  $# @ @#$@l2L^ #M@jaP# A.$c@ c* M@jaX @. N "  " M@jҒaX, @CF Ac"`  "` A#"`    B !MN   @ $@`@Ʀ 8. @j!X.  2N$@1 A#gethostby*.getanswer: asked for "%s", got "%s"-_/㿘*& #M ( (А (:`ch@tI 2  .2  N .2 *`߰  gethostby*.getanswer: asked for "%s %s %s", got type "%s"p''' B"!P   "  2  ?# @  B!'$'耢`  \ @\貒Ml쀢 ` \x  B@   B"!P@'"'' B!d"!d B!P"  B`"`"   @,*@\d貒Ml쀢 " @^* 2 @]* 4 @]* 2  q4 1  B쀥@@\6$Ml %@`@ŭ '"'@Ť 耦@4Ϩ @iȒ B P#&#@\$& @]7 " @Ł 耦@4 @i'Ԑ'"' @9 @9@9 %N` @H < B09 B0|@jR쀢  %Mc88@[貒&l @\쀢 e  B P B쀥@%@`?T @$ '"I'P@j쀢   %Mc8 BP@G> B!\@29  B@ P  '" '  "@'@ C!@  B !D ܄'%@r'"'@ "  ݐ(! B%@%!P  \@ľ 耦@ \@h$!P'"' \ @ B!P@N \""`1 B!P \ "b` 㿘 \    \@X? \@ 0 @@   @ bf㻈 \   @X?`@Ւ ``  \   ?"b` \ /"b0  \ "b`  B!P" " @r( . 2L@@*x2 L@a#  I4L ."DL@ C@>ɔ ! B!@r  , !'#' B!P"!P Bad""ad B` C!"`"" \ @ @ \""`1 B!PJ@a#  `.2 L@J@ 2J@J . CL@ac  D@qǒ : 2L@L@ :DL@ )L .< C@>o ~! B!@qƔ , !'#' B!P"!P Bad& "ad B` C!"`"&  \X""`J@a#  D2`:. `J@ 2J@J . C \!Ȓ@/ O  Oc@q   J; * f" y b  2 `2 @ @($ %@Ғ   ֐%u.%u.%u.%u.in-addr.arpa%x.%x.ip6.int㷈 \   @W`? @˔`Q`@!  Q`@!       \  /  \ "b0 \?"b`  0)Q`(   @hJ # )Q  H @h@2?@Q P P,@ `,` `,` `,` `,` `,` `,` `,`@ \!Ȓ@h O耢  Oc@pĔ    C!/ B B J7耢 E f"9 y b 7`25`22`@ِ-  @'$%X & & @+%ༀ% \ @@  &  &  \""`@`` /etc/hostsr㿘!Y#L  YQ#Q@h>c$#L@%J#LY"#P㿘!Y#L` Y#P @@ $#L# 㿐!Y#L YQ#Q@hc $#L \ ?Y B!$@h:L2L \ "b` #R@f/`@.R@f(`H \. @    C@<   ! C@<!  \ @!@     B` C!"`" B!P" " " N "  "  B!P"!P B!d"`R@e`H B.  !#RN    $ @eΒ`H.  2N$ \ @  B!'$' B!P@Y \""`1 B!P㿘 \ @@   @ 㿘# G @f   @f   0㿘     @Д  㿘 B!P"!P B`" "  "  B ( B!d" R@eG`H2 , B!P 2V$@W  $@Y{LL "  " S@e(` "  BL " ,  BaP  B"aP!P@{   B!쀤@ $@`   B!)RL    @$@`@d H,  2L$@$1 B!P%u.%u.%u.%uhosts.byaddrx B!L!L   @ * Sb  @f  B ' B@T$# B@aLSb@܀  Qന \ "b`hosts.byname㿐 B!L!L  @q   B % B@!$! B@!LSc@֚   \ "b`㿐@  .@  ` .@`.@`@ 㿘  - ) &  &   ! @ $ 6@&&@" &@@&@ &@?&  2@./ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz01234567896789:;<=>?  !"#$%&'()*+,-./012345 *`2` AT0(0     / ,( 00*$   ` ( `<0*    `(* ǔ%2.2u$㿘 $. 2. .   T@. @ݕ6㿈   . @. 2 @*? * 2  2` ( 1 C" ϖ "OrpheanBeholderScryDoubt?#Tc@s `N@ 241Y`N` $2 1Y@d *#?1Y#Xc S` @C?#@/ @  ?#@?#@E @@A `  ?#v2@ ?#?#v?#x@ @@, @  "@ ?#?#x@@@   ?@ ?#?#x?#?#?#, @ @ *@@ 2 "@ *@@ 2 "@ *@@ 2 "@   *@  C" $*" 2. .   T@ ?c  @  @Ő?c @   *2 /T(0@ 0 *   (2 *    ( * 2 *  ? * ِ *@ (`0  2(2 @2  ( `(0  @@D@"@"@  (`0  2(2 @2  ( (0  @@""@1 ߵ/r߷j&~|E,$Glⅎci qWNiX=~ trXqXJ{TZY09*`Ѱ#(`Ay8yܰ`:l>w1K'x/U`\`U%UWHbc@U9j*\4AΡT|r铳co*+]t1\>ֺ3l$\z2S(w;HkKĿf(!a !H|`]2]]u&#e#>ӖmoB9. D iJ^!hBlg aӈjQT/h(Q3n lz;;P~*e9vfY>CEo};^ou؅ s@DVjNӪb6?wrB=7$ HISrɀ{%yPyL;lO@`^\j$cho>lS9;RomQ0,́ED^ 3Jf(.K˨WEt _9Uy`2 ֡@,ryg%̎2"߂\WoV.iB(~ìg2ƌOUsi['X]=!Jl-[SyEeҎIKڤ~3bA 6wL~+MꭎqkՠЎЯ%<[/u+d O^h񑳨//"wu-otΉ♴O|;ҭ_fws!w ewTB5ͯ {>AӮ~I%- q^"hW$d6 UcYߦxCZS }[Ń&vbϩhNsJAG-{JQRS)W?+`vtoWk* ce!4.ŅVdS-]GnjKzp鵳)Du .&#nI}`f쪌qiVdRl±6u L)Y@:>?T[Bek֙?֡Ҝ0M-8%]L p&c^ hk?><kjph5R↷SP7>ޮ\}DW:7P  uA8͙;/2>1NT8OmoB  ,$|yVyrޚwٓ?.Ur.kq$P柄͇zXGtK}z:ۅc CfdG2C;7$ºMC*eQP:q1NUw_5Vףk<;Y$ ,*wN=)eܹ>Rf%.LxjxEⶣlOOBBjeO;A!yMKGj=bPb[&FǶ$itG V [Hbt#XB* U>#?pa3r𒍓~A_l";|7Yt`@w2nPUaٗ5i Z ܞDz.E4gsUg_ygC@4eq>8=(m >!珰=J+ۃ=Zh@L&i)4A vk.Ԣh$q3 jCԷPa9.$EF!Ot@Mpf/E m1˅'U9A%G (Px%S) ,mhbHih'O?臭zֶ|7_x@k*B 59׫;NKmV&f1㗲:nt[C2hAx NE@VH'US:: kЖKUgX̩)c3*JV?1%^~)1|'/p\(,Hm"H?A@Gy]n2_Q՛A5d%{x4`*`cl2fOсk#3>;$ b" r -(xEd}bTIo}HÝ'> GcA.t:on7`Lnk {Umg,7'e;) 9i f{} ^/Q[${yv;79.Yy&.1-hBj+;uLx.jB7QKcPk=%DBY  nի*dgNچ_dW`x{``MF8wE6̃Bk3qA<^_wW$UFBX.aNXt8SfȳtuUFٹz&a߄jy_FnY WpUL ỂbHut f- 2F3Z J%n= ߡ(hiܷڃW9ΛORP^ ''w?A`Laz(`X0}b#8cSݔ4V}Yvo K|9r =||$r_rM[ӞTUx=|MP^alQZ4ח,+Qլ:}}>|}-(%ϭZִrZL)qGč(;Wf)y.(x_u`UD^mԈma%d{Q!dwO2~)=FHSid怢m$i- !fF dEXl Ȯ[X@kݢj~:YE>5 DrΨdf~of,"#W2v#51VbZun6sޖbILPqVǽ2z E{ɪSb%5qi"|v+S>@8`%G8 Fvw u``NzL~H\ji\ޠ? %-柷Na2w[W:r$?j.psD 8")1.NlE(!8wTf4 l)|P?յG ىyP?#V`#@`H@`H  *`2`*0 : * *0 @  2㿈7 .#6, 2`@@ "@ * 2  7'' 3 C, 2`@"@"@ * 2    , 2 ,.`2 &" `* 2   * 2   㿈7 / #7 , 2`@@ "@ * 2  7'' .2 % x@'q@', 2`@"@"@ * 2   .2  , 2 P 'I '.2 &" * 2   * 2  ش 㿘.:6㿘. * 2 ` * 2  `㿘. * 2 ` * 2  ` Y `?* 2`$1$$# C$c!Y@#c@#䀢  C@#c $c C Cc"# @  $ C C C#  @   C`" `  $2  C% C# "@@7@@7!Y@#@7 #@78@6@@6@6@@6@7!@耤  @6?   @ @oY @6͔ <   Y! C"@\c C"c@ft"[@\a@6 8@6 8@F @6@   C8c@6@   @,@6 8 @ @6 @68#! C1 C@""$#**`   # $#**`   # $#**`   # $#**`   # $#**`   # $#ޔ #`$#*` @ݔ %s: 㿘(!a!`\bp@`"a!`@ a!`\@bx@ِ㿘@& 㿘? @ uuuuuuuuupuhuXu@u0u uutttttttpt`tHt0ttssssUser defined signal 2User defined signal 1Information requestWindow size changesProfiling timer expiredVirtual timer expiredFilesize limit exceededCputime limit exceededI/O possibleStopped (tty output)Stopped (tty input)Child exitedContinuedSuspendedSuspended (signal)Urgent I/O conditionTerminatedAlarm clockBroken pipeBad system callSegmentation faultBus errorKilledFloating point exceptionEMT trapAbort trapTrace/BPT trapIllegal instructionQuitInterruptHangupSignal 0㿘N  @P " @@u $Za $ "a  @` 㿘Z! " @p 2   2 㿘Z! `" "! `@@@@>2`Z"! 㿘% C4 D#'Z$4` (J@ Z  ?@  4@"@4 Z!"``ZJ@ Z  ?@o  `@Z!" @f` !" %Z`"`` "` `"`]#"```ZJ@ Z  ?@J  `@ْ" @B` !" ``ZJ@ Z  ?@1  `@Z!" @(` !" ` `ZJ@   ?@  ` @Z!" @` ZZ!" Z!`$"`$ C C#h"c|: 㿐'N@  J `:'J '!^@Ȓ!&@Ē!& @! "r @[& ^@a "h @[ & !^@!& @! "W @[& ^@a K @Z& $]#& & & $!^@!& @!& @!& Z!`"/ Z!  C` 2&  C#|  CZ! &  C#| Z! & Z!  2& Z!  2& Z! 2&  master.passwd.bynamepasswd.byname` C#\ @h < @@! C#l  C C#t#t   C@"  C$#l#l "~Z "  C؀ "M#p 0 C@= "^^## C! C C#\#`ct #px@@#p   C$#p C"#l܀ "'@'"cp Ch"cx@#t ^#^# Cp Cx@؀ U CI"#l@p̀ @Q C J  C@#t ^^##@ЖИ@؀ $+ C!$ . C@̢#t "^^##!Z@!$@!$@ذ C"#l@;!$  $!$܀ L@2H Cc@$@)' C;"#l Cc* 1 C#4 2f#4 C#``"#` 2/#`@ ' '@ RM C#4J@ +  CJ`  @ C   C "cl "cl C#4@ 0"cl C#4@= Z"a$#4J@ -&1 CJ`  @ C@`Ԓ@Ồ  Ѐ`J@ L @8Հ#4C Ѐ1 C#4 __YP!+p`!(' ' 1/`!0@ '  '1 C#\   #\ ؟   㿈Z!(?'@  Z C#t#t  C@  C#t^c@ݚ耢  Z@dZ "a( Z"!( p C#\ @ "4  ? C  "c`1 C3 C% C/^-^+ C C#t; C C# 2/`@- ' '@͐ #4J + -#40ct @ect  C#4J   @pN p @ $pct @hMp @$p2#4@ ܒ@Ԧ@`? C "pJ pW @<ؘؖp@cx )p "$p@$p"#4@$p#4 7'؀ @ؘؖp@qcx  p "P$p@L$ppc@cxcx*#4 ><#4 %#47J ``@2#4@> ܒ@zԀ  ؀`J@  @#4 #4@lђ  C#d ! C#\ @$#\#4ZB"!ap Cc` "c`   C#d ! C#\ @$#\ Z*"! 1/@ဤ  @2' 4  '@͐ C#d  `! C#\ @$#\` C#4 %umaster.passwd.byuidpasswd.byuid` C#\ @~ "8 V ?ac@W C  "c`1 C/ C% C) C C#t9 C C# 2/`@ޔ ' '@~ #4J + -#4 Ct @ t  C#4J   @pT p @$p3t aa##@Sp @$p2#4@Q ̒@Ħ@ ? C "pJ p ^^##@ȖȘp@;#x ,p "$p@q$p"#4@k$p#4 'Ȁ ^^##@ȖȘp@#x  p "O$p@NK$pp#@A#x#x*#4 =#4 % C6J ``@2#4@ ̒@!Ā  Ȁ`J@  @ C  C#< C#d ! C#\ @$#\#4Z9"!\p Cc` "c`   C#d ! C#\ @$#\ Z!"! 3/'@ޔ ' '@~ C#d  `! C#\ @$#\` C#4 㿘 C"#` C"#d C"#l C#p " C@ Ct"#pZ"! 㿘 㿘 C"#`! C#\ " C @$#\ C"#l C#p " C@ CS"#pZ"!/etc/pwd.db/etc/spwd.db%s: %m㿘 C@ "#l c!c!   @o  C "c\  C#(  C ca@3q C "c( 㿐 C#\  2l  C,@ a",! C@m#0 $#0\  C#0 C"#4,    C"#8,    Cc<@+   Cc@@%   CcD@   C"#H,    C"#L,    C"#P,    C"#T,    CcX@  &@ Cch@   C "ch $OpenBSD: getnetgrent.c,v 1.5 1997/02/03 00:10:08 millert Exp $*netgroup: %m㿘@ 2&  d@ `&  & @ P & d@ `㿘   2 & @ғ*` & d@ `  & * "@㿘`  .`@ ` @*@@㿘  , @i   * 㿘 @ a#   ` 2`L@  @a#  J`  @   "J * :  a#   ` 2 L L   L & "``&@  d@ `@@*? & 㿘@ 2 d@ ` $ ,  ,   )    "@ @@ netgroup: db getnetgroupnetgroup.byusernetgroup.byhost㿀% E / @1 @,@`@9?''  ?e0@@8耢 .& d@ `+ @1 X@ #2" e31e0 e0 p  @*@@ D䀢    netgroup: Syntax error `%s'㿘J "g aJ@ #"b J " @ #     &J  2 @J (23 &e"@0;?9 L  ` #J@ "`&J`   `㬐   "" @ &@ d@`@@@*? J@  # netgroup: Cycle in group `%s'㿈i  @e#@0U0.. 1 %'5Zm耢   ?0 0@0 8"` &8@_㿘 ` `@h  `  @h      @g   㿈  @e#@/R Ȓ 1 F '耢 8 ?305" 2 "@]  "@V  @O@M  ʐ@? @; @%s.%s㿘@  d@` dN d x`dN@ d xf@u(%s,%s,%s)㿘f# f#`f#f@us㿐` @R" @L @ؐ   ,㿘ז  Ж  Ɩ   # @7g@ "NN? ,2 N`@Zؐ਀  @ @ 㿘ZZa4`""!8#Z!Z8` $a4@ "!8@v!8  "!8@o!8  @h@f!8a4$!8 ! E#  @$#/etc/netgroup.db+㿐v'Z!4 ! E#   Eg"   @j $# E#   gb[ 1 @*0@$@6, d@`ZZa8"!4n Z8" "8"@8"8 8 㿐'! E#   Eg"   @jt $# E#  @`gb  1 `@ܐ@`  `  3`  2  2 @5  /   `  \ "b0#@t#ְ  /,@&@0 \ ".#@^#$' .-- h!X@|M '' \""0 @|P "͠? / @q' .,,,@d}@@  v /,  @hEb \@/ `@h:W \L` .2 `L` ?`   ``@ @{  \0 \"0 ``$ @ ` @`j$&.@ &@ڔ`2 `? /, `$ `@ϒ@e,k b0 "b0 "b0@Ð@` @d 㿘  E# " E@ E"# E"# @  E"c! E@  $# E"# @O+  \ "b0?K:  J (82 J" J  JK JK@:  K:ۀ  2K K@` 㿈#\?@ %s.dbtch'''Ԁ \v? E# @  E#@$ Q' E@Nc  E# `d@$ @'$      @ 5 i @r   @h "@@.&@Y@ϐ@b@    @z &a 􀤀 @$4 @ @* ?, L  @($,@L \2 ,@,@`@ ܀$@%d@ɒ  '  \ 0@Ұ?Ţ@,@ `J`"`#"@ 2`@  2   d @s?  :ibܔ =v  `:! L  ?$#\쀦 耦? @@C0u,?" ?2,??ʲ   `: L  $$L? :"$,$%$@%$$%@2  ' \ "b0@j3@@$@@@@?@P$@?܀  @$@ ' \ "b0?@0 @԰?0 @ 㿈@.''  ? "??J@ `'? &@J `? J2 JJ|: ?  ?J:|?  㿘@@㿘1 E# " E@f&# E"# E"# E"# r㷈 Ec ""c! E#   E E#k@Nb@ $# E#`  E ! E "U ! E#@ @!# "@f# @r Ec"c  E 0#k@Ncb@ E "c0]*? aL@#@  2 `:`# E# J? \ E E "c E"#J? \ E E "c"# ' E `: :J \ , J  ,,  @ В㔀 " @f @הK?0%*?O J |  :*J *#\?]    &㿘  =?@r d d \ "b0?  :l"̑*`:   ^2 N N`: ` x* \2t N`: `}?А   *`?N  ?А *`Z*?* :  2N *  * * * *  *  * :*?**  "  @`dg dN :k*" `? @" "?&㿘I =3?@ d d \ "b0)? @ : "*@*@`? `"@  @ؒ d dN@ :@*@`"@ ? @ǒ"@ "?&㿘 #2N@2? 0  `N@ x X `  @А *`: ?А *`:  ?@  *`: ?ɀ @,`& 㿘N@ :2``.`@`.`㿈   `2,`@l,`  @H & ,  &  &㿘'L'P'T'XLӔ  \@,(! \"0@$"0?㿐'L'P'T'XL@! \"0@ $"0?㿘'L'P'T'XL @)! \"0@$"0?㿘 \@(?PATH/usr/bin:/bin:.execvp: : path too long sh/bin/sh㻐  N  \ "b0@T /  G'n@C Hn P@/'n@``tL@  n h@@ $n `p@  @n `@ n@|@ /*| @s@,| \@{( \"0 "@ n<` & 6`   `,`@ 2``@2* $n $$ ` @A,` \n @K(@@`4 \ @) \ \ b0 ` "b0`@(?㿘'L'P'T'X@'bL$ cd@$ cd@$ cd@$ cd@$; cd@$Z cd@$OpenBSD: rindex.c,v 1.2 1996/08/19 08:34:08 tholo Exp $ *`:`J "J $OpenBSD: _yp_check.c,v 1.3 1996/08/19 08:34:57 tholo Exp $㿐 [J!  @     [!& [@,!`?$OpenBSD: yp_first.c,v 1.5 1996/12/03 08:20:03 deraadt Exp $yp_first: clnt_callX  N "t @ @ `"m N@ "i @ߐ @('b &'@&@*K̀ \W !$''?ؠ @ܔ ''` #\@` #  `` `o@3na̐?"`h@)ఒ2#&@  &  @*@'@@  '  @@@*@#@X@+d́$OpenBSD: yp_get_default_domain.c,v 1.3 1996/08/19 08:35:09 tholo Exp $㿘& [!J!   [ @(s!  [ !& $OpenBSD: ypmatch_cache.c,v 1.6 1996/12/03 08:20:06 deraadt Exp $㿐@>r E#      2  2 @ ' @8  E# 2$ E"#  " @$  @$ @  $ @ $ @ $ " $ $  @   @    @]  Z@ @- $ Z"\@$  㿐 E#  ) & '$ @> E# "  2 @] 2 @k 2 @$  2  yp_match: clnt_callX L@ " @ @`" N@ " @ @2' '@@(̀  [ !@]x !\쀢 '@@  '@*Rf @s@@*@@*G[ \!$''''''ؠ @d ''` #\@`  "     `p@1b̐?"`h@(@谒2#'@@  ' @,@@*  [!@]  @ " "@W@)́yp_next: clnt_callP\`  N "v @ @ `"o N@ "k @ @($d '$'@@(OĀ \Y !$''?''ؠ @ޔ ''` #\@`  #  `` `q@1paĐ?"`h@'ఒ2#'@@  '  @@@*@$@  $  @*@#@V@)fā$OpenBSD: fork.S,v 1.2 1996/08/19 08:18:06 tholo Exp $  cd@"` $OpenBSD: strstr.c,v 1.2 1996/08/19 08:34:27 tholo Exp $㿘N@ `@H, : N   *`: 2N@  2N?$OpenBSD: strsep.c,v 1.2 1996/08/19 08:34:24 tholo Exp $  J H  2* " 2HJ$OpenBSD: ffs.S,v 1.2 1996/08/19 08:17:58 tholo Exp $r "2 J "2 J   "2 J  J $OpenBSD: bcmp.c,v 1.4 1996/08/19 08:33:57 tholo Exp $2J  "  JJ@`       9a;@``#@  `%  4@^Đ 2 #  "@  ?&  &2   @`xײ`s `,`@ϜϜϜϜϜϜϜϜϜϜϜϜϜϜϜϜϜϜϜϜϜϜϜϜϜϜϜϜϜϜϜϜϜϜϜϜDϜϜϜϜΘϜϜϜϜϜϜϜϜϜϜϜϜϜϜϜϴ Ϝ ϜϜϜϜΠϜϜϜϜϜϜϜϜϜϜϜϜ0ϜϜϜϜϜϜϜLϸ   ΨϜϜΰϜlXϜ(Ϝ ϜϜ  4@^$ 耥   ?&  C&h f d @ l2` `] ,* WТ "x6   `P1  -`P"* ( @ @!  @ "  `P  2 @ 2"#@     "x    @@]Ð  @#` #  `%a  ? &  &@] m   2 `8@t ,`@Ь\(\"    @:$@&@] "  @ "& & @T -"? ", J>   ` ?&  &  4 @]G "` ` J? 2``"b J> " ?& `& @,  4 @] "ۀ  @J? 2 "հ,*"? &#    !a` ?&  &  4@\ 2 #  "`    #a ?& `& @,  4@\ 2 , c  " ,$߮8!%Z" Հ M* u | ֐֐֐մ֐֐֐֐֐֐֐֐֐֐֐֐֐֐֐֐֐֐֐֐֐֐֐֐$֐֐֐֐֐֐֐֐֐֐֐֐֐֐֐֐֐֐֐֐֐֐֐֐֐$`$ "$" < :-`R <-`R`` %! <  ! ?"񀤀!  =, ? &  &@\ !2s! (ݰ @>ذ `x`X @2 ,  2  : 2"8!'lu# Հ :d* ؜$؜ذ$ؔؔؔؔؔؔؔؔؔؔ$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ > "! ?"! = %$ 9!, ? &  &@[x !2!$5 @- `e`E@ @ ,@D  :"$j? ^      *$* !? * -  -]"?0 ]6  -* 㿘 @ 0 2 4@$$& 0& 4  @,& ,` 0@@ @&& 0& 4 ?㿘?. ["耢 2` @` 2`0 "I?`  @) 2@?` ?6` &`&``  6` `0  ``4@& @ "@(?&@*`! ` ?6` ` "`@@( ` 2`&@`  &`<@&`8`@&`0 &`4.`B`B&@ &`㿘 @   ?6  \""08 ["耢 2 (@ ( \M  A \0C> \0@@ @2 P     ?2 2 $? "  : @ d  0 "@ < :@ d@ " @`" @ "@: @ D@       "b0  2 @z (ˀ$ #2 V  & @ 2  <   (6 & L $6 2V  >`@ >`Ȫ@ B 2$ 0 @"  P    ?2  : @ d  0 " < :@ d 0 "  :@ D 8 "@ @ d  < "@ @ d  @2( L4% L@8 L @ D4%@2 L@%@ @&$ &  0`[ @@"X& 0@ T& 0 L :   @   ?2& $&  & 0` @@"& 0@ & 0 ?ߤ@46 @YJ    & "$& @ 2 ?>`   ?2 0"? 0` @@"& 0@a & 0 &&  ?6  㿘@2& @Ē" &&@&$@@X $@@"&@&$OpenBSD: fgetln.c,v 1.2 1996/08/19 08:32:29 tholo Exp $㿘 H* D  @. "?& D& H 㿘  4@X 2F&@ @ $&@  4  "$ 4$  Β`P 2+&@ D@S$@@X  @  @$@ 2&@ D@6 "$ $&@ D 㻈 ?$ \  2 #\@/-2#\ \B""`#`$#d  @  \ 1"b`@+і6 \ &"b` 2   `y"*`@LX@4XX \   \  \  \ "b`?㿐'   \    @. \ \""` \""0 \ "b` N  J@ .d?`J@  .@ J .`?  \@Ɛty \!t2  ? @r 4i \"``  \    \ >`=` \ "7 \ T T 2 ; \/ \- \@@L 4Cb0 =;`      2    2  "" `@  ֐`  @ 4 \ ""` \  ? \ "b`?%.*s.%.*s㻐 \   @.$` \""`)?`@?"N .2c @~ *; za@$$@?+HOSTALIASESr㻘 \ @z@"0@ 2 {z@?b@v @$ /'a E#$@? dO 㬐  2LO   2La# L   " L C,@> Ր L㬐   a# L  2 L )L   㬐  L     a#`L@   "`@GD$,@.$@W30@W0 H` \   d@-U \""`? @= @,Ϩ \2@4 `*` * $*` a > ?$ ?''`E```?_?2]?? ѐ@/Ҙ ɰ$.2 @1' .2 @1"  `B5  ??@/  @1 .2 @1   @1   @1  #5 ` .. 2 @0 .2 @0  @0 /`2 @0` @? 5 &rjeechodiscardsystatdaytimenetstatqotdchargenftp-dataftptelnetsmtptimerlpnamewhoisdomainaptsapfsbootpsbootpctftpfingerlinksupdupnewaccthostnamesiso-tsapx400x400-sndcsnet-nspop-2sunrpcauthsftpuucp-pathnntperpcntpstatsrvprofileNeWSsnmpsnmp-trapprint-srv%d㿘`4| ȓ*`@\|`|l|x|||||||||||||||||||||||||||||||| |,|||||||8DP|||||||\|h|||||||t|||||||||||||||||||||(|||||||||4||@|||||||L||||||||||||||||Xd|||||||p1{"1{#1{#1{#1{#1{}# 1{z#(1{w#01{t#@1{q#H1{n#P1{k#X1{h#`1{e#h1{b#p1{_#x1{\#1{Y#1{V#1{S#1{P#1{M"1{J#1{G#1{D#1{A#1{>#1{;#1{8#1{5#1|2 1|/ 1|, 1|) 1|& (1|# 01|  @1| H1| P1| X1| `1| h1| p1|  x1| 1 F#|@>HEADER<<- opcode: %s, status: %s, id: %d; flags: qr aa tc rd ra UNUSED-BIT-ON ad cd; Ques: %d, Ans: %d, Auth: %d, Addit: %d;; QUESTIONS: ;; , type = %s, class = %s ;; ANSWERS: ;; AUTHORITY RECORDS: ;; ADDITIONAL RECORDS: ;; ...truncated ;; ...malformed 㻈 \  @)?i  \!p  (2 ! \3 [ `< [4+ ~a(@  @p{? & & * @  \!p ( \?`&@ ; & ;*@ k \!p "@ \~@pJaX @~@pBah$~@p;ap"~@p4ax!~@p-a ~@p&a @~@pa ~@pa ~@pa \!p ! \~a@p!?#~a@o ~a@o~a@o  \!p +"? & & * @q \!p  "~@oϒa𤄿 e@) \ !p  @~@ob@!p   @ @+@$ @ `q@k!p  " `!~@,ؐ* @ԑ2 @o"`@X!p   @,Ɛ* @ʑ2 ~@ob!p ` "? &`&*@ @!p@/?#~"(#\  ܚ$@~"8#\ @Κ@~"P#\   0 ~bh~b@o1㿘"㻐@@*$O ?`&@ . & .*@@㿘"Ֆ.㿘@*& @@J? ."`  !@ !@.  *`㻐 ؘ$@`0  %lu %s %s ; proto %d, port %d " "\"?" ;; *** Warning *** OS-type missing ( %lu ; serial %lu ; refresh (%s) %lu ; retry (%s) %lu ; expire (%s) %lu ) ; minimum (%s) %d %u %u "%.*s" %u %u %u %u %s %s ( 0x%04x %u %u ( ) ; BAD BASE64 %d ; LABELS WRONG (%d should be %d) ( %s %u ?%d?;; packet size error (found %d, dlen was %d) ?c \   @'y \@""` A$8@ɒ@+l* 2  @+g* 2  @+g @+^* 2   \!p $ \b@n \!p   @L@nb@=@mb`e!T*`@ ,t xt x `, x4 <<  2w?!T@z-   ?!P$@b2a?T?!P@ "@@@  @* * b  @mY3 G?`&@  & *@\o2/C "8@В`8 `5' \0@@@  "?`&@ \`&*@@- ?`&@  `&*@ @? Ҁ?`&@ " & "*@L `G "8@z`5% \0@@? "?`&@ \`&*@@ے ?`&@  `&*@ @ƒ? Ҁ?`&@6 " 2"H@2@lbP?`&@  & *@" ?`&@  & *@i"x@@) b@lX@)@* b@lM@)@ b@lB@)@ b@l7@)w@  b@l,@)e* b@l"2 K2  @)T* b@l2 :" ?`&@  & *@"2 "8@`8 `5% \0@@> "?`&@ \`&*@@ ?`&@  `&*@ @˒? Ҁ?`&@ " & "*?`&@  & *@| "+ \?`&@ "`&*@@`6 `30b@@>e "?`&@ \`&*@@r ?`&@  `&*@ @]? Ҁ?`&@ "`&*@@I?`&@  & *@5  ?@  b?   @  .b?` @ޒ b@(4* 4  @(/*  c@j2 !#@j #@jږ #@jҖ2ϰ @(* 4` @'* 4  @'*  c@j3 ݔ2 ?`&@  & *@Ô" ?`&@  & *@2k ?`&@  & *@~@R 2P@'c @jX F B!?!T@@v  ?!P@$@@ ϐ@|c(@j=  + '   `8@Ē  @?`&@ `&*@@-``, *?`&@ ) & )*@?`&@  & *@@'% * c@@i2 @iےcH @iՒcP?X"@ @ ܖ✢ 1?!X ?@i#XJ?`&@  `&*@ @ 䀌 ?}@&ܐ*  @ב2 ~@i` @icx @5@c@i@&Ð@" cH@ix @&@D @inc@&@; ~@ie`@&* c@i]2 ?X"@ @ `✢ &1?!X ?@i@#XJ?`&@  `&*@ @A 䀌 ?@i#c``@ich@c@i? & & * @&c@h ANYHESIODHSCHAOSIN     x X P 0 (     x pX P80xphXHX@0( xpH @ !"h`Hd@ ef#"any"URN Naming AuthorityNAPTRgroup ID (nonstandard)GIDuser ID (nonstandard)UIDuser information (nonstandard)UINFOmail agent (deprecated)MAILAmailbox-related data (deprecated)MAILBzone transferAXFRincremental zone transferIXFRATM address (unimplemented)ATMAserver selectionSRVNIMROD locator (unimplemented)NIMLOCendpoint identifier (unimplemented)EIDnext valid name (unimplemented)NXTlocationLOCIPv6 addressAAAAgeographical position (withdrawn)GPOSmapping informationPXkeyKEYsignatureSIGNSAP_PTRnsap addressNSAProuterRTISDN addressISDNX25 addressX25DCE or AFS serverAFSDBresponsible personRPtextTXTmail exchangerMXmailbox informationMINFOhost informationHINFOdomain name pointerPTRwell-known service (deprecated)WKSnullNULLmail renameMRmail group memberMGmailboxMBstart of authoritySOAcanonical nameCNAMEmail forwarder (deprecated)MFmail destination (deprecated)MDname serverNSaddressA㿘   @12  2 2 &   2&㿘   2 2&   2 F#|@1R`2&1 F#؁㿘   2 2&   2 F#|@13`2&1 F#㿘! 㿘!8 initdebugaaonly(unimpl)usevcprimry(unimpl)igntcrecursdefnamstyopndnsrchinsecure1insecure2?0x%lx?㿘 ":1"/1&'1=1 G&'161 G+1@"#1+1 G$11"1 G11 G1"H"P"X1"h"p"1"" " " "" @0bȰ 0 secs%d day%ss%d hour%s%d min%s%d sec%s㿘  G( *( `.  `.  `.  `.  `.  `. @q= <@9 <@q6 <@2 <@q/ @+  G  (  8 @`(@0U L 2 `  , ` 8 @`H@0= L 2   `,  8 @`X@0" L 2  2 1 G`21 G21 G  `2,,  8 @`h@/1 G (%ld.%.2ld㿘 2 @p   @p  `[*`@@ @ d@p d1 G Pb@/Ҕ P㿘  @* : a c   c+ @ *`Б*: @`L@   @L@ .+ `L@a#@  + Б* * `L@@  + Ж ` *  *  [ ,  *[  , [`,  @C 4 * $ 㿘   (8a㬄 c(`(Ѕ.8NNa 㬴N2(8a㬄"c) (Ѕ.8NNa 㬴N2(8a㬄"[c.`(Ѕ.8NN.2'NNaaЅ/ ((NЅ((Na?иNa2 N㬴N"Na 㬴N2(82\(,-l-l-l-l-l-l-l-l,-l-l-l-l-(-l-l-l-(-l-l-l-l-l-l-l-l-l-l-l-l-l,-l-l-l-l-l-l-l-l,-l-l-l-l-(-l-l-l-((` (.  (.  (( ' (` (( (( ((& (82@(.x.........l.....l....x..............x.........l.....l....x # ##Na2 NcN"Na" "cN2"㿈      ''@'@a]@ 2& `   2 쀢 2  J@ - +?`'J@ +`'Ja#@ ` ",`* ?Д 'J J  ,`J .,`'Jac  'J?Б. * J  ?'J,`@*`@*`@}s@&%b Ja#@ ` 㬒 @ `'J`   Ja#@ ` 㬒 @ `'J`   :t.@aJa#@ ` 㬒 @ `'J`   Ja#@ ` 㬒 @ `'J`   :=.@*Ja#@ ` 㬒 @ `'J`   Ja#@ ` 㬒 @ `'J`   :.@.@.`.`.`4.`4.`4.`.`5 .`5 .` 5 .` .` 4 .` 4 .` 4 .`.` ?; error: unknown LOC RR version%d %.2d %.2d.%.3d %c %d %.2d %.2d.%.3d %c %d.%.2dm %sm %sm %sm@  @,`80/ /߰ /װ * *  *    " * *  *   " * *  *  &%"&%"" ??ڐ!   N S @m#'@}#@m <'@} <@m <@} <` W  E@m#@}#@m <@} <@m <@}{ <@mv d@}r d@|@U[ @M[ @E2#\[ #\#`#d#h#l#p#t#x#|##`X@+[ [@[ @[@[ @㿘@n   L ." `@ &L L * 2?J? .2 %04d%02d%02d%02d%02d%02d㿈'@&`'l#`` #``#\@#`1 G \`@``` @+` \ZONEREFZONEINITUPDATEMAUPDATEMUPDATEDAUPDATEDUPDATEA8765NOTIFYCQUERYUCQUERYMIQUERYQUERYNOCHANGE14131211109REFUSEDNOTIMPNXDOMAINSERVFAILFORMERRNOERROR?Ѐ 8?Ʌ(8㿘 `A %a'\@< ` ."6 +"3 /"0  `/   *  `@  D" А   *  @  D"  ,  .@```Ű   Gp   6%* . @0 07* @` 07*6*& @* 㿘    \@ @W /"b0?0123456789㿐  /N (  @@3 . @* @*`"@`#2,@  ,@2 `,@ N ް  .@.`.`.`  0123456789abcdef0123456789ABCDEF㿈 @ N :   N :p I   NB ?#!H@2 !`@2  ",O &N:. `DN`>4,@`,@`  6 `2e + Nİ   ` 4,@`,@``@$@   % # @ * -@ @  @   㿘    \@ @$ /"b0 %u.%u.%u.%u㿈c  @) @( \ "b0 %x8 @_   4`@: *  * $@#* *@@``"?''  ?,` ?  ?'' '??Ā@$''''``,`? ?Ā@''?Ā Ȑ?'Ȣ  :?#@  Đ@@ `@ 20`,, ``,  ,`Ā  ,`,`Ȗ$  . _" "* @ ,``H@)`` Đ@ 2, :, , Ȑ$ 8 \@'ɐ "b0 %d.%d.%d.%d㿈'#\1 G#p @K0#p㿈 N 0   N x X2  * &'a:`㬐   @x?*: 㬐 `D` *??  *`:`N .2 N@ $@`  a#  2$@?$@$@ :  @ **` ?``@  ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/=㿈`D ! @/` @/` @/`2`/ `*`2@/ *2/ ? ?/@ 逢 ?@ ?@ ? @_ .  .  .  .`° `F //񀢀 / @* `2 / * 2` / `*`2 @?/@逢 ?@ ? @a .  .`  =a .  =. :?.?㿘  L@`Z`'!a#@  2ML@`=N@0: "`  `09 ,`04o"@* .@/   f"@:`@ .@ `*`*   `  U"@:`@ .@ `*`*   F"@@ .@  @QL@```=5 L@  `  `0- +)?` a#@  `=L@```=2?L@`` a#@  "?L@```@ ?  + @+@  @0(@( @(     +  @  ( ( ( @     : H";j" &."  v" 㿘 * 2 2 `? 2`*  *` @ B >  @"   @@A  ?@=@ @ ?    @@{&㿈` '`'  `*`2 2 `?`7 x 8" [b k  @T XP   'q @5ک x@. @/`7`@@:1#V@. . 6@  ۶/ .6@0os"/@ Đ/ 7 @=_#@. Ȑ@/`7`@@"*@. ̐. 6@* "/ А.6@?Q!/@ Ԑ/ 7 @`& غ@. ؐ@/`7`@@"=#@. ܐ. 6@?֐#/ .6@"W5#/@ / 7 @!"@.  @/`7`@@?f!@. . 6@)P#8   .6@m !8  / 7 @=!b@  @/`7`@@0,#@@  . 6@ "Q/@ .6@:m#. / 7 @5Đ ]@. @/`7`@@ S@/ . 6@6(y"/@ .6@9#ȸ. / 7 @xs!@. @/`7`@@0#ִ@/  . 6@=5C!/@ .6@V . / 7 @*x!@. @/`7`@@?;#@/ . 6@"ٶ/@ .6@#J .  / 7 @?!B@@/`7`@@!}"@. 6@gX!".6@?yN  / 7 @)/"D@@/`7`@@#@Ȑ. 6@=Ґ#`.6@/ p/ 7 @ &ߐ"ƺ@@/`7`@@:I#@. 6@5;̐ .6@"!/ 7 @6u4 9@@/`7`@@9!@ . 6@蟐 .6@1+"e/ 7 @= H"D@7@/`7`@@ʿ#7@. 6@*#6@ .6@?$ 96/ 7 @V֐!ú@7 @/`7`@@#3 7@. 6@? }6@.6@!a!Ѹ6/ 7 @"O@7@/`7`@@?9"7@. 6@(P#6@.6@!6/ 7 @=ߐ"@7Ȑ@/`7`@@/N"57@. 6@ "6@.6@:ᴐ#6/ 7 @@& &  &  &  @~@ @%s: : %s 㿘 \"0(!a!``@X` !`@Yg!`@X`@"a!`@X`@~0㿘'H'L'P'T'X@nH㿘'H'L'P'T'X@|H  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~\* R 㿘'L'P'T'X@ Lsyslog: unknown facility/priority: %x<%d>%h %e %T %s[%d] /dev/console p< #`0Ӕ#\  d:  \#"0\ `@Y((X@E3(6'@$@*@9`6?@$\ X 2\`\ \( "`\\ \ @E p6?@$\ X \@{@Dx6?@$\ \   :,@`?  ,@`?$@* $':` % N` m `@!d@D̔p6?&$`,?`@*`:`,@ϖ6?@\ X $@ '%@ &' ' ' @9  G#  \\\`X \`@/ \ T@%i \ X   @L @*? > 'А$@&' 'ؐ 'ܐ@9 @{M/dev/log㿘 \" \\" X1\\" `1\ T?23\ G# *  `H@*( \ X    @.! ?& T @D 3\`T G#   Gc@~ ? G@{ `T&`T "c㿘!\@{ T?$ T G"#\ d d㿈 ''@ 㿈 ' ''  @|3 8@?$ cd@$OpenBSD: xdr_ypresp_val.c,v 1.3 1996/08/19 08:35:06 tholo Exp $㿘@; @` $OpenBSD: xdr_ypresp_key_val.c,v 1.3 1996/08/19 08:35:04 tholo Exp $㿘@  @a` @` $OpenBSD: xdr_ypreq_nokey.c,v 1.3 1996/08/19 08:35:03 tholo Exp $㿘@X @T` $OpenBSD: xdr_ypreq_key.c,v 1.3 1996/08/19 08:35:03 tholo Exp $㿘@9  @5` @H` $OpenBSD: xdr_valdat.c,v 1.4 1996/08/19 08:35:00 tholo Exp $㿘@1$$OpenBSD: xdr_mapname.c,v 1.3 1996/08/19 08:34:59 tholo Exp $㿘@1V @$OpenBSD: xdr_keydat.c,v 1.4 1996/08/19 08:34:58 tholo Exp $㿘@0Ӗ$$OpenBSD: ypprot_err.c,v 1.4 1996/12/14 06:49:47 tholo Exp $  $(f`fXfhfPfhfHf@f8f(f f0             $OpenBSD: yp_bind.c,v 1.9 1997/04/29 21:25:20 deraadt Exp $/var/run/ypbind.lock%s/%s.%d/var/yp/bindingclnttcp_createYP server for domain %s not responding, still trying clntudp_createfcntl: F_SETFDH'D  "@K ?e @ܒ ? \"0 #@ymX @yi@y_\!(? [!؀ ""! `" @ @v2 ` ["!\`"!(&@D "/ @zE  [( !؀  D@46    D 2 h@v l  @z< l?& \& h  h 2? h$D@B- @J ?". h@l  \"0 #' 'Đ'Ȑ '̐@Q ̒@ @x& h@xm@x"Ͱ @v}ɰ   А @y  /А / 'Ԑ?'ab  @o 2 @ "" @vW # 2 \  @" @vG !$'''' #\@  D#ܟ耢 " a!`c@TsD  @?d& h  @//#쀢   H"Z @v V  @y  . H . I . J . K . L . M . N . O J6 X & h D@'K @. D\!$2  : '' `? @ ?& \''Đ Hab @( \ & `@#8& h \ @A ?@z#H [a&"a؀`2&@ 㿘 ` `@& `?& \㿘 㿘 [!؀  % [@2  2 ` `@`$@$@u0 $OpenBSD: strftime.c,v 1.6 1996/08/19 08:34:18 tholo Exp $㿘@U G"# G`"#@  G #* G#&@%m/%d/%y %H:%M%H:%M:%S 㿘 ʒ#]`%2 G N E O2N N`y#,*`@quuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuqq`qquuur,rDuuuruuuus0s`ssstuu<uXuuuuuuq@qqqruuqurprrrsususHsxssuttu(?` "`t`*   ` `t`* @` `t`*   h` `t`*   8`'l@n d @E 0 `t < "6쀢 `  @3 0怢 `  @-  ` @' 0ڀ `@^ "  @ 0π `  @ 0Ȁ ` @ € `@^o "  @  ` @ 0 `  @ 0 "`t` ``" `t ݒ @ @ڔ 0 @ "͒ }"``" @n*  @” 0u ` "  @ 0l ```  $ @n ```  " @^    " 5 @ 0G ```  " @m  @ 07 ` @~ 01 `t u+ `t o% `'l@]ђ d @i 0 `'l @b 0 ]"` 2`@ ]"` 2`@@v    Gc??"c Gc"c* N ; G#h' ' ' ' ' ' ' ' ' $' ('@Ȱ G # G# @]t  0,?@mn @, 㿘 G # G# @][  0,?@mU  G#  G# ,? @  G Gc (  c"c" $OpenBSD: strdup.c,v 1.2 1996/08/19 08:34:16 tholo Exp $㿘@vZ @rѐ@uc0 㿘a#   -+  L0 L x XL 0  >??P7 \ ??Q    #ac  c А  . ɐ' "8?2 @  @  ??? " &0Oߕ> <@ F ɦ ``` '@㿐'a# @  ` - +  M@` 0 M@ x XM``  0  %?%  >N L $ %D    9a7 \ "#  # ?А  T ?ɐ?M H$4?   @ ?1  1&0O@> = @ f% @?2 @  @  ?1#? &0O> = @ F @`  #㿘`&`` ` 2@@h 2&?@`" ` @i 2? `?&`@`&@*@``  @i 2?@`"7''''@P*@?㿘 @? @$: x N   \'@t'"' ' \"0 G@c@t$$  "$ $ ؔ$ : @1㿀@t'''' '@Yw$OpenBSD: clnt_tcp.c,v 1.14 1997/04/29 08:52:31 deraadt Exp $clnttcp_create: out of memory `@pҐ a@p͐ d2 a!`@O2c [aȐ "a \"0}" 2@" *` 26 @pΐ0t 6"$`  @&$ &@%k  @    [aȐ "a \"0"?O`@s K`$`$@$` $`$` $` $` $` @D @==`L''Đ '''А`0 @&< @'g 2 `P` $`@r ``L @$`H`P ``L@`L"@'a$\"$@%o$$ `@p] @pX X'H''\`L`0`  &`&`    2  "$ $&`$?&  `0`H "`$  €H "`$ `€ ğ  `$  &`$@J o`$@F  &`$f 2b      &`$W $/ \ \"dȪ!d'`'`'''@ݐ C@&Ȁ 2`$ d09d@'`$`$ 2$? `€Ԁ  &`$  &`(  `$ ؐ &`$؀  $@& `$?" `$ ` @ 2g$`$ $"@("`,"`㿘  " L L@` ```" "    "  """" "  㿘   " P@q P `@ L@oQ@oOP2 ! 4 * @o? ؐ  @r+ \@C!  ' 'Ш"@2`* ` * @  $@    @$b0@C Ȕ"@'̒"@`'Đ'@'"@'Ē"@`''@'' ' ?`? ?  @& $@nߐ+?b0 " & $@& (@nҐ?؀@"@nʐ@p 2 6& ( & $? \"0& ( & $㿘# \ @p?$b0& (& $? @$OpenBSD: clnt_perror.c,v 1.8 1997/02/10 00:51:39 millert Exp $㿘1 H Ȁ  H@na!&  H ȁ%s: %s; errno = %s ; low version = %u, high version = %u ; why = %s (unknown authentication error - %d) ; s1 = %u, s2 = %u 㿈̠w   €@!@9@q耢`W@#*`@|||dd||<||||||||$@!$@/@9< $@!"@ 1@$@!&@ @9@@qh  @$@&@ P@9w $@!"@ X@9m $@!"@ $@!"@ @9[ . . 㿘a!`@LbP`@ `@ RPC: Unknown protocolRPC: Failed (unspecified error)RPC: Program not registeredRPC: Port mapper failureRPC: Unknown hostRPC: Remote system errorRPC: Server can't decode argumentsRPC: Procedure unavailableRPC: Program/version mismatchRPC: Program unavailableRPC: Authentication errorRPC: Incompatible versions of RPCRPC: Timed outRPC: Unable to receiveRPC: Unable to sendRPC: Can't decode resultRPC: Can't encode argumentsRPC: SuccessRPC: (unknown error code) #* 㿘a!`@KgbP%s: %s - %s %s: %s 㿘 [5 !!Ȁ  " [Ԑ `!@8t  [!!Ȣ@ !@8c  !Ș!@8X . . %s㿘a!`@K`hH(Failed (unspecified error)Invalid server verifierClient credential too weakServer rejected verifierInvalid client verifierServer rejected credentialInvalid client credentialAuthentication OK  Ї* $OpenBSD: authunix_prot.c,v 1.3 1996/08/19 08:31:22 tholo Exp $㿘@$> `@& @#ے` @#֒`  ``  @Ka   \ h\ l#` #d #h #l  \  \ ?` d \*`  2 ` ` @ *`#㻐 $@$ @?@* 4 `@* 2  ` @]   ܤ 㻐 ! # !?@$ @@]* 4 `@X* `2 "  P'D'H' \  @6? ?' \   H"$'''' <  \ Ā  )\  \@6ج9 \;\,` \ @'-@\h $  \hDH ё* ,@\HT   )4°?`\ \ #\   \#d 2#\  @  @  %#\'"0#\@   \"0"#dJ@Ғ' 'D'H'#\@+ H` "0 7#\@mIޠ ސ"7ޑ*  @ @q"0 6-* @i'-@@* 2 ' 77޲ހ *#\@m2 ސ"7ޔ*  @ "0@A`! \"%"""#\@lސ"7ޑ*  @#\ \#d  \\#d  @  @  %#\'c` \ c`` c`  #\@f  "-@'c`#\DH@ H   /'7#\@Q 'c`'"0#\DH @ H  \-@  *'@d` '؀ $''ܠ @m۔ #\2 * -@ @ "   @Ƙؠ"0 0e2'"0 a'Đ '#\ @Ԁ U' '@Π \ $ \  \ (2 DH @ 4   ?   \-@@k \!p F \   " @\'s-@ \   ` \ !\@I\l "   \lDH 2* \T   )4%?`\ ` \@0,` \ &" @  \Ā \ ="b0 <"b0""0?㿘!\#\  @k?$#\\"#`\"#d 㿘.`` .2  ,`2 . @bA2`@S,4 . 2`@b7 @S ,`6 㿘@6 # H`$`% H?# '@Rْ4 H, 4 @62 Ғ$` H ?  2֓2`  @  H2`# H`֐@R *   4`@5# H$`@Rc4 `&$`! ,2 , 2`@R@*   * 2  (, , 2  , 2  @S4c` , 2`{ H2`\2#p! H @<  H  "`\r  ` ? @2r㿘! H @< \#p!/@ H  ܀@! Hs! H  H@5$  H` 2 "`\#p@!/@ ]4\# H) H' H% @a`֐ @Rܒ 4`\cp2cp H H ` H`Ұ\#r. 6 fLOCALDOMAIN/etc/resolv.confrbfdomain lookupsearchnameserveroptionsconfRES_OPTIONSenv㻐   \`   "` \` 2 \ "` \`  \""` \ $  ,  54  $ !d<*@ $!d$!`!a`@ @j 2B@hԐ!h; `@ ,!_ `$ D HL `   \ l : @J@   *@ "`&   `J@ ꀦ @*  :  ( *@` @J@  *@&!x@Ca6 \!a@^ ! \ \ p5 \ \! \ $@\ O ;" #a@k$  )O  2#OJ@ "` "`J@ "ؐ Ր@$ -@-a2*@Ǥ a@j  ?O  9 @z  J@   N y b f*  , N y b f2  * " Ӓ`a@j  XO  2RtOJ@ "` "`J@ "f c p@ .a_ p@ 2*@ p"L p   \ l : @J@  *@ "`&  `J@ 퀦 @* : " *@` @J@   *@&& a@jU ,O  2&`#OJ@ "` "`J@ "   @ ,`@"` *` 52``a@j$  O  @ja` \" @(" \ pJ p @t  @ .@N`) \ T " T & @  *:  .d?`J@  @ \ p \ `   @ܒ . &  ?&@h  \  @  " @g!@a \`` "` ndots:debuginet6㿘 J \ #*`: N "  " b@i  @  4!d* !d < $!db@i   b @i|  2  $ * : " N N  ` N 㿘?    H  . \*D?@@:??(@`@/ ,- `. `\2 (@@:)?(@`(@`<  ?!?(   &@&  ? (@!㿘@    @ 2` H "?@u A:`?,  ` ` ?"@7* ?@$@`$@  ,  .\ $ "? >**,2$? $      ? * " ?  a],* P㿘C`3 ` & `?7?, .+ \" ֦ Ҥ< ` "&`." *   @ `Ѥ & ¦? .J( J.  .`.`Ѐ   Ѐ -2 @2J 㿘N * N  .   㿘N   ߀ ]`. `\ " N` `. J߀](J    (  ( ( ( 2 *@*`2 *@2 *`2 *`*`㿐@ ?㿈'a*: 㬐  s 0   N x X % `*: 㬐   @\?`*: 㬐  D  + @ . 􀤀: $*: ` = a#@  6$:` `+ 4*`@Hd?#* ?# *`* @  * *` *` `2&@ @80( xph`XH@80( %I:%M:%S %p%H:%M:%S%m/%d/%y%a %b %d %H:%M:%S %YPMAMDecemberNovemberOctoberSeptemberAugustJulyJuneAprilMarchFebruaryJanuaryDecNovOctSepAugJulJunMayAprMarFebJanSaturdayFridayThursdayWednesdayTuesdayMondaySundaySatFriThuWedTueMonSun%s: 㿘(!a!`cH@Ak !`@AԔa!`@A`cP%s: : %s 㿘 \"0(!a!`c@AO  !`@A!`@AEc@ a!`@A=c  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~],* R 㿐@6T  ?&㿈 ' ''  @f 8@?$x cd@$ cd@$b cd@$OpenBSD: xdr_ypstat.c,v 1.4 1996/12/14 06:49:45 tholo Exp $㿘@ $OpenBSD: xdr_ypbind_resp.c,v 1.3 1996/08/19 08:35:01 tholo Exp $㿘@ " @  2  @`@`$OpenBSD: xdr_ypbind_binding.c,v 1.3 1996/08/19 08:35:00 tholo Exp $㿘@Д  `@ʔ  $OpenBSD: xdr_domainname.c,v 1.3 1996/08/19 08:34:58 tholo Exp $㿘@W @GMTJ( ( ( ]] "   H H J<] O<* ( (  x*   H I J<] O< (( (  z,& /etc/localtime/usr/share/zoneinfo/?` @c  N : /N  /"  N /@ .   2N"P " ?N :" N /`?`""`"?@d@d $@@Œbx@’@T . 2 `@ o  2?@4 ??` @c @cU 2ڰ??  =95&@1&`-&`)&` @ 2` 8?`!r2  2?`@`2?? $ & `* @`* * @` @@* @@@ o  `. @"` `  *%ؒ ``@Y `@ , 'L@Ӑ&@ $` E $``@` @4Z? `.  `  @#L@ *  ` @cL*  @#!L. @&@$` @ * 'L  @L"` ?"`  `.  * 'L` @L"`  ?"` `.  mn ( 8+  (:` Ѐ Ԅ:` " JЀ   +  (Ѕ+`8   JЀ  & "@ 㿐 ܖ $* "@*`@*`&@N :  ˖ ;*`" * @ &@N :   <2@  &@㿘N -   + ’  @ &@㿘N J M&@ `+ 2!N &@ `   "1 N .! ` w "% N . `   ?Ѐ   &@` !m`2N  / u` &`㿘 ` @IJ d 2  @ID! 2  "  " *` * "@*`" * |;yTv!*` * "@*`" * n ?c,*  **` * "@*`" *    @H  @X d@H d. * * ? @X     < @``: @,`"@ @HҒ &` ,  #,@*` *@   6+  +  * "@*`" * posixrules`  &8 N:?@aڐ!N ؒ! 2&@N  ^& (?N  , ; 2N ?1'N , ;2iN ’ذ"?N , "?N ? &` &` &gL &gP&gT &g`&gd&gh`eؤ ' #$ $$ .$ . .$ .` @H d 2  @H! .  . *` * "@*`" * `gȤ} 2?   ?gL gL' ` `@ %ؑ* * @gP   @  ` `@ %ؑ* * @gP ݘ  @  + eؑ* * @ S*e\ 2* + X + "@ "@ @ " * * @'L'P     `Ւ@  &gL&gP&gT &g` &gd&gh  &` &`&` &gL&gP&gT &` &` ` "?#L@@@.@ `@.@ 㿘!!(ݒ !( 㿘 Wc ?"c ! Hʒ  zTZ㿘@]# W#  W"@l 5! W@`j (  $# W"@L@  H`"`" "'L"'T O <@|a(0! H L@ : Z  H 1㿐' H ` "gP`6 gP # `  * * @'P 2* ` * @&@  *@ %ד*@ *`gL@ @ @K & ]* cL @"   @&(㿘j 1 W##㿘 Wc 2 "c O5#̐ O@`]" V#&(㿘 1 W##㿘1 Wؔ##㿘  L !L!P* @&>@2=  4  * @ &$*  *   @ @2!L * `   *   @ *#T@Va@Fa&@TT! T! ?"T! @U.&@E.@U <&@E <&@E  & &'# @Eے d 2  @EՒ! ,  , /@Uɒ!m?&* @*`@*`?@ < ?@U d$@U!,< @U d$@U!$$&&, @*`#@&@*  $  &* 6& & &$㿘ې@@"&  2` 㿘@ &8@Ui@Ue8@T@"@&@`` ` ` `@ 0&' ' ' ' ' ' ' ' ' $' ('В < 21?Ԓ  2*?ܒ 2#?'l 2?Ԁ )!n#? ؀`4    @D d 2  @D! ,` ,`@`'Ԁ!n*#؀`4    @D˒ d 2  @DŒ! ,` ,`"@'ԐA  Ԁ!n܀  @D d 2  @D!  #,`@*`ؕ*@@ Ԁ"'Ԑ ''ؐ  ? 8 2?ܐ'l'Ȑ?ŀ 2?Ȑ ; ' p'n''Ƞ '  @Ȓ ? `?',@" ',@ '耢`D A@ O H #?,K?, * 'P耢@2*?? %, * ,`* P耢@L L" '@Ȁ 2耢@,`?Б, ?@&  5`@ ''@ &?㿐  &  " S &&  @ O H #?,C?,`* 'P @27? 2,`* , * P @"$?LL"  & `?& h Ñ, * 'LL"@" & `?& ?֑, Ñ,`?㿘J` 㿘?" 㿘" b 㿘" b| H L( `( 㿘'DDD&㿐'DސDD 'ِ"@D@ 'ΐ"@D@D ??'"@D@D  SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec???%.3s %.3s%3d %02d:%02d:%02d %d 㿈`  `* @ @@`  `* @ U@`#\@#``'l#d1 W#`` @\`#$OpenBSD: strpbrk.c,v 1.2 1996/08/19 08:34:23 tholo Exp $J H ? 2H  J  $OpenBSD: strcpy.c,v 1.4 1996/08/19 08:34:14 tholo Exp $ @(`  @*$OpenBSD: strcat.c,v 1.4 1996/08/19 08:34:10 tholo Exp $H" @ J2  @*` $OpenBSD: bzero.S,v 1.2 1996/08/19 08:17:56 tholo Exp $ `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2*$OpenBSD: strerror.c,v 1.2 1996/08/19 08:34:17 tholo Exp $㿘 X@aȁ$OpenBSD: strcasecmp.c,v 1.2 1996/08/19 08:34:09 tholo Exp $  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~   @  `     @  `   "  2  $OpenBSD: atoi.c,v 1.2 1996/08/19 08:33:24 tholo Exp $㿘 @J @'L'P'T'X"7''#''@5L*@㿐 Y? @OZ 0`" &  @@"& 0@W" & 0& & V @W  3\@Np `@V ?@V`2   6 &  C&&  & 2(" 6 &&   &  "& &   & &  Z  "c㿘'H'L'P'T'Xa!@5H㿐@& @Nz @*! 66 6  6 & "& $#L& ,#& ( &    @W 㿘`6 "@"&&@Y+,(  @@ 2,  @AJܒ`"&&@Xڔ@ܤ,$OpenBSD: xdr_rec.c,v 1.4 1996/08/19 08:32:06 tholo Exp $xdrrec_create: out of memory 㿘@V" D"a@$ <@$ @@@V  $ a!`@4yb0&    $  @$ (]#& & $$ $  $ $  $   $  @$ $ $ $ ($ 0$ ,$ 4 $ 8㿐 `4 `,`0"  &@`4?"`4`,  "`,@%   &@ 㿘  &  @ & & @7 2  & @" 㿘    4   8 2 @n 󀦠  @B @ 4"$ 4&㿘"    "@  @X   $ @ @ &$ @  2  㿘`   @XX  ?@  "  0 ?  "  ," &㿘 ?("  " ,!  "  @  @ $ "  4  0@  (@  $ , 4" $ 4    " 40@"@  ,@0" "4,@", 㿘 @U  @U㿘 @ 4 " & 4 8 2  4@ 2 4   4  8 & 8 㿘 @ 4  $ 4 8 2  4@ 2 4  4  8  , 0`?㿘`   2 "  *" @ " ?  "" " 㿘`@? @  " ?"@  "  2  &   &  㿘 ( 0   $ " ?" & ,& 0 㿘$  0 ,@    ,@V͔ ,& ,@&㿐ݔ   2`& 8 *@& 4  㿘`$  0 ,@ @  `    ,@& ,&@  c(/  ?$OpenBSD: xdr_array.c,v 1.3 1996/08/19 08:32:02 tholo Exp $xdr_array: out of memory 㿘@ @  "C  2; @L   "/  ( @S &@a!`@2#c  @WL : ` @  @S@&@㿘 :     @ 㿘 @  $! cd@$OpenBSD: xdr_ypbind_resptype.c,v 1.3 1996/08/19 08:35:01 tholo Exp $㿘@ s$OpenBSD: __strerror.c,v 1.6 1996/09/25 08:17:30 deraadt Exp $㿘 X "̠?@=  0,@M}  4?@=v  0,libcUnknown error: 㿘"@ޒ ^!. $ @ @ .` ?@Ⱂ@ .`@V "@@Ȑ$OpenBSD: strtol.c,v 1.4 1996/08/19 08:33:51 tholo Exp $㿘a# @  ` - +  L@` 0 L@ x XL`` ` 0  `' #@<@L` $ %   3a/ \ "c  c ?А  3 ?ɐ?,'`&?2  ?1 %0 @K[&?  ?#%0 @KH @Ģ` 'NLSPATH/usr/share/nls/%L/%N.cat:/usr/share/nls/%N/%LLANGC㻘 "?N @ / @@T 2 @Rܐ"2"@RԐ"8"@#@ `*`:  :[ %O  ?* :  (F* DDDDDDDDDDDDDDDDDDDDD\DDDDDDDD\DDDDDDD\J@ :  @*`J@ :  @*`:  * L  *@?2 L 2 L ?0@% ?*@L "#\@T "?  ̔  @T@T?2???#@ @Q && @S̰?㿘 \ < 0 5 @4-@08((@ @@@08((Ѐ66׺ո㿘?  \ "b0 ?" @Sx @QE $OpenBSD: errlist.c,v 1.3 1996/09/15 09:30:59 tholo Exp $hX@(x`P8(hH8(`@ xX@ h@ x`H pH0hInappropriate file type or formatFunction not implementedNo locks availableBad procedure for programProgram version wrongRPC prog. not availRPC version wrongRPC struct is badToo many levels of remote in pathStale NFS file handleDisc quota exceededToo many usersToo many processesDirectory not emptyNo route to hostHost is downFile name too longToo many levels of symbolic linksConnection refusedOperation timed outToo many references: can't spliceCan't send after socket shutdownSocket is not connectedSocket is already connectedNo buffer space availableConnection reset by peerSoftware caused connection abortNetwork dropped connection on resetNetwork is unreachableNetwork is downCan't assign requested addressAddress already in useAddress family not supported by protocol familyProtocol family not supportedOperation not supportedSocket type not supportedProtocol not supportedProtocol not availableProtocol wrong type for socketMessage too longDestination address requiredSocket operation on non-socketOperation already in progressOperation now in progressResource temporarily unavailableResult too largeNumerical argument out of domainBroken pipeToo many linksRead-only file systemIllegal seekNo space left on deviceFile too largeText file busyInappropriate ioctl for deviceToo many open filesToo many open files in systemInvalid argumentIs a directoryNot a directoryOperation not supported by deviceCross-device linkFile existsDevice busyBlock device requiredBad addressPermission deniedCannot allocate memoryResource deadlock avoidedNo child processesBad file descriptorExec format errorArgument list too longDevice not configuredInput/output errorInterrupted system callNo such processNo such file or directoryOperation not permittedUndefined error: 0$OpenBSD: index.c,v 1.2 1996/08/19 08:34:02 tholo Exp $*`:`J   $OpenBSD: strncpy.c,v 1.2 1996/08/19 08:34:22 tholo Exp $ @(`  (02 @$OpenBSD: strncat.c,v 1.2 1996/08/19 08:34:21 tholo Exp $J H2 @ @(`($OpenBSD: pmap_getport.c,v 1.4 1996/12/10 07:46:41 deraadt Exp $h7֐?' o6 ^!$!$'`'ܢؐ!#\ab @|!/^''''!,!,'`' #\ Ôɘ!$ր   [Ȑ "  €`  ր 2  [ "a  @䀢?"6 @Ph6 ց$OpenBSD: pmap_prot.c,v 1.3 1996/08/19 08:31:39 tholo Exp $㿘@ǒ @’`  @` @`  $OpenBSD: clnt_udp.c,v 1.12 1997/04/29 08:52:33 deraadt Exp $clntudp_create: out of memory X\@M  `a!`@,`b [` `d@M@ ``a!`@+`R [$ X@!    ^E *` V^6 !D$$$  $  $  $  $ $ $ ?$ $$ ($ T@$ \''Đ '''в 8 X@ @H -  < @$ P 6$  '  @   ' [aȐ "a \"0"@  b~@O $ @K$$  @M9 @M4 㿈''b`#\b'H'D\ `(? @'P``$'P`('T@!  4 * @LN ؐ  @Pw'|'x`8&`8`< €`P`X@ 2@`< €H  `€ D 2 ؀@ @LҐ &`,   @@`X `@2` \"0&`0؀@ @L &`, P   \T  \|@"d"d'`'`'''p@  Ш"??/!% \ @2`* ` * @  $@ @   @`?" 2\'Lx`@'`|` @@'d'`@'d`'xd'|P@xT@&@6@0 O@h@ O hp"@'`lt"@`'d'`А"@@'dx`@'X|d@@'\'X@'\X'x\'|P@xT@&@@ @L+ &`,d @```\ @L0 "'L0 #"@@&`0@L &`,G (u@`X``@2o@``@ @ *@*`,`,  `€  &`, &`0  $@@ ` @ ئ`8 &`,؀@"`,@KƐ`, ,"@0"`4"`㿘  " 8 8@* ńT(h|" $" ( $" ("" "  "  " " " " "   㿘   " <@M < `@ 8@Kn@Kl$OpenBSD: bindresvport.c,v 1.9 1996/09/15 09:31:30 tholo Exp $x ` '`  \ ."b0D? @N/ /`  '  @ఒ, 'ܐ  @ "@ذ` % \  0  @  &$00 耦@ @؀  \""0$OpenBSD: auth_none.c,v 1.3 1996/08/19 08:31:20 tholo Exp $㿀 X"؀ 2  < @)/ @ X/ "" < * \"d"d& `& `&  & &  & ^!l&  ( @~ @0@-  @& < `@㿘 X"؀ (` <   $a cd@$i cd@$ cd@$] cd@$ cd@$v cd@$  cd@$h cd@$OpenBSD: xdr_mem.c,v 1.6 1996/11/14 06:33:13 etheisen Exp $`"^^" " " "   "  "@ "     "  @  "    "  +d+e+f+gd"@ "   # " @#d d( e( f( g( "   #㿘 "  &  @L_ &   㿘 "  &  @LM &       @  @4 " "     @  $OpenBSD: rpc_prot.c,v 1.3 1996/08/19 08:31:49 tholo Exp $㿘@  ``@˖!㿘@ 㿘 @t` " `    `€` @y`  @r`㿘@S " @   @]`  @X`@<` 㿘@K @.` " ` 2  `` ^@  㿘&` &` 2 @( @ ` @`  @` @`  Ȅ*  \  , 8 D P "@ "@ "@  "@ "@"@ "@"`"`    "@ "@"@ "`"`㿘   "    "&@ @ݒ@&@ &`@ "  " 0 " 0 &` &`&` &`$OpenBSD: xdr.c,v 1.4 1996/12/14 06:49:42 tholo Exp $㿀 ' 㿐 "     @'  € € &@  㿐 "     @'  € € &@  㿘            €㿘            €㿐 "     @'  € € &@  㿐 "     @'  € € &@  㿐 "     V@'  € € 6@  㿐 "     @'  € € 6@  㿐 "     V@'  € € 6@  㿐 "     @'  € € 6@  㿐N@'Ȓ .@  㿐@'ڒ .@  㿐 "     @@ '  €€ @ &@  㿘ɒ㿘% "       X  b2     2    ^a `?xdr_bytes: out of memory 㿘@c "3  2,  "   "    @F&@  a!`@$`  @F&@㿘$㿘w " @ "  2    €xdr_string: out of memory 㿐 @ 2  "8 @I' .8, ` ` ` 0!  2@F&@  a!`@$ybX ,!@F!&@  㿘?$OpenBSD: qsort.c,v 1.4 1996/08/19 08:33:42 tholo Exp $㿘  `@ `< @>@*@0$ )@$&@$6""? $ **? $ղ$͢@6`@>z`@>s`(v6`@>l-    4  $@@    4  -%@%@    4      4  @&$@6""?  **? @=/ 4\2( $$6""?  **? Ґ0/ &.2($@ @$@$6""? $ **? $$@Ґ(@$$@6""?   **?  $@ ;@=@@0$ )@$&@$6""? $ **? $ղ$͢@@<$$ 4 $2  ""? $ **? $%@"@  %@" %@2  ""? $ **? $( $@=M͖$%@@=BƲ㿘@ union8@ ΰ @>{   \<   \ "b0 @ ?@Cz @$#"`@ؒ  ͒`@FÔ          # @Cy%@ $뀤#``@E@8 2 & @CO@CMg &   `$@   ,`$`* @,`$   ,`  @|  "$  2``2$`,` ,`@C & `@B*  &  $& & @Bא & @B@EQ  & & && @& 㿈 X""  X ' ' '  @F ? X?"㿘@v ?&& @B @B@E$ cd@$OpenBSD: strcmp.c,v 1.3 1996/08/19 08:34:12 tholo Exp $ (8J@ `   JJ@`  $OpenBSD: merge.c,v 1.3 1996/09/15 09:31:50 tholo Exp $P''쀦 \ "b0B?'`?'@;"@BA  '0?'@*@;Ԑ'' ?Ā   @;'̐` ?'ĀԐ  ?Ԑ' ̶Ā   ?Ԑ'̲@@ ? 䀠2@@N@J  2@ '@ %@(@$@4(&'- @@(#%@@;V2 @:@@4@@%@@@48= "܀" $ $? ,  ,?z܀`" $ $?h ,  ,?Z܀" $  , ܀`" $   ,  ` 'Ā '''Đ ?2Ԁ@ @9@E'@A/԰ 㿘.@` ?@9ݒ@$`&@9Ւ@%@  ?@9ƒ@$ 4  @9@  ` `` "@"@  @, *@`$ S+& 2" &@"@& @, *@`"@ * ې&$& @, *@`"@ * $   &@"@ ?"`? 㿘$@ $ , *$@@8$@㿘@㿘@@%  Xb "b" " "   X"*""?㿘`*` X"@  @   2  )  @2   @" :   @B  & &  $ @ "  @$@@?㿘  @&   25 &        @+  &   @2 "   " $   &  "   2   2  $Ą cd@㿐@Œ @   ``  @ \ "b0 @7K" 6  `26 !6 6 & "& $#L& ,#& ( & $y cd@㿘  ɔ@C 㿘@ " ??& `& @㿘  @7s㿘 ["耢 2& @7J&  2S? 2 0   \ "b0G?"  @7S 2@? ?6 & &   6 ` @@"& 0@? & 0 < &  8&&  2 @64 @@ " & $  &  ?Ȑ*@6  `4  `2&    @6  Jrrwa  \   \      & "  0 J+b  J+    "@㿘V 2  \ "b0,?  @6А `" @  &? " 0@>  0` @@"& 0@> & 0 D "6 @>& D6 & & 㿘!ɀ@8  \n6@t@ n6@@  n6@C@  \ "b0 ?҄" " " " " " %$sniglet^&8`   \ "b0@{!ܢ?$a$a  d  \@   \"0   \b0 ""b0  @?$a \"0a @ e   @J \_ 2$a _#t$a a@@ !?! \l"02j O@!a@2d O`?  a "ȟ€ `@ "`U O`(@7@$a@ 2U ` * ` * D` :$aa8 @A<* `"@0@@ $a0  a @ $a4?$a$@= $2& ! \"0@ِ#$"0Ӑ"& Ր & Ӑ",& Ԑ#X& Ԑ#& Ր#T& Ԑ!&   &`@?a@= \""0 㿘?@ @=r " ? ? \  0?8 $ 8 $ $  $ !$  $ $ @$ 4_#t$!  D @@Ɣ  Ē @@” @` @ 8 @ A$ $ - " @ 7$  *@@@$  2$ 4 2$!  2` ဢ@ d" \ "b0  $ @@?㿘@7  4  & @  * *``" D" H&  & $*` `@J ?& 0& (.`?& ,! 2  & <  @6 @ ܐ  *@ @4& @㿘  @ !4  \"0!؀ !?&!!ؑ* @@<!??&!@<!@F `   \"0  !8  @<!, !?@>@<` \ ""0?㿘` \ "b0? "? !4  @ Ȕ  2 ?@  2?&!0 㿘!4 :!a& & ! Ґ"ȟ€ & @!  @?2 ?"$?@>W!?! \ O"b0&!,? , !8` , Ė @IƘ  2?  ,  㿘  @@  \ "b0#!,?㿘  \ !  \ "b0#!,?  @ 㿘  \     @   \ "b0",?㿐 @ @ & ?K ` -``  @B`   $ 2   @ ?`  `2  ․@@L(2i `'@L*` ē*`2`@ޖ W   `` @GÖ G `K ?`'` ``207 ` ?-`> ,`   @L՘ " ,` & " !&@E 2 `@G  ` ?@Eߔ  ?0 @; ` ?-`? ` ?-` 㿘    \ "b0$!,?!$  $!$ $!($!   ! 2! !$ @W "z?$!  2 $!$ $!( ($!$ (?$!$f  !(*    2*` @2 $! $!(     $! !$ $!$"!  "! !*+`     @M  2 0?! +`2* ` &@  ? " &`! +`2 ` & " &`* 2  (+`$! !$ $!$ 2 $!( 㿘 ( & ( 0  4!& (   *!ؒ@2*  ,`&  @ !ؓ,  " "?! &!! &! (@`  **`@`D" D&  ,(& 0& ,@E?㿘@: @> @=&@:0$㿘! € ,  ( 0㿘 @Y   &! .@@R   ! \"0C$"0?6 !ؓ* ** " ! &! @, <'`'d'h 'l'p't'x'| ?"@ \l   \t 'lt  |!'tx |!x'x| "'||!'t'd'`'| 'l!x'x'p| ဢ@dT \@9~"$U @="$?$a|$a$at$ax$a$b@9m $C$` @= $a"&b  $b && ې#&  X& ِ!& ِ!h& ߐ"&  (& ې#쀤& `  \  "b    \ $b @ 5 $aaА`  \@X?$ab  $b aВ @ ?`a@4 `Ȁ 2à rpaВ@;Q  ހ  \L!b@b ?@$b  $b '\_/^/]/\/'X[/Z/Y/X/'TW/V/U/T/'PS/R/Q/P/'LO/N/M/L/'HK/J/I/H/L!b@ \  O?"@ \_2| \'pb  $b $a$b `؀!'p"'pp@ 8'p` 2$ab  $b $a$bb  $b p$ad` p? `*  'dp* @d *'ddaز@1?@1l?4aܑ* 2   4aܐ aa@+$@b  ْbHڔ@ܖ@3?b  $b  b  $b @b  $b  \  \ O"b0` ` "a@8@aЀ?@:@88 㿐 @ ,  \"0 2+? \""0@"#?@ 2?$$ $  4 !4  $  @;!@[  @V 0?TMPDIR%s/bt.XXXXXX/tmp㻐@:7 @8s ٖ  $@[?' @:ה@j? @ @:ʔ @#d d$  #㿘  `"" @ & "  \!А "b0?㿈  `@ $  \ "b0'?@O? 2#\@@ؔ    @!Ȱ" @"@@@Ŕ 0$ P" `2@0'....'....'.. . .  '. . ..7..7..?2   J *  *`2 *2  7* *    '. ***'**** '****'***** 2  ‘*0f  b*` _ *`2 *2  7* *    '. ***'**** `1`'****'****`'****'***** 2  *P" `2@0?2   N *  *`2 *2    '. ***'**** '****'*****2  7* * * 2  *l  2g*` b *`2 *2    '. ***'**** `1`'****'****`'****'*****2  7* * * 2  *'....'....'.. . .  '. . ..7..7..#t w* v*  u*  t*  #p s*  r*  q*  p*  #l o*  n* m* l*  #h k* j* i*  h*  #d g*  f*  e*  d*  #` c*  b*  a*  `* #㿘 ``@@ $`@. ?")?@@?2`"? "a@5$` $`a "a@5$a$aaȀ "a@5 $a$aa@5@5@7e` 㿘  ``@O $ ` \ "b0?"   " @? ?@`" ?$" 㿀 @ L!b' '!'!'"'" '@9 @  ?$  cd@$\ cd@$OpenBSD: memcmp.c,v 1.2 1996/08/19 08:34:05 tholo Exp $" @`  ?  2  @'P'T'X`"7''''@.P*@?㿐@ ?㿘@  ` 㿘8@6L 2  ?@e  0,?@._ L X`L X?#@ @ 4``G`A,?L X #<% /L /2?,@ @ : \,8L`*@! &@- , \"0 $ @  \"0 `? aaL  z2,   ސ a  , "b0 /dev/arandomx@ ݐ @ @5 x@6!x?.  .   @@В .   *` * 㿘 \   X#  * ``$ ** \ "` X#㿘 \  2 X Xc c?*c  ,   @@,   *` * 㿘 \   X X(   *  *  * @ `@ `+`(   *  *  * @ `@ `* @(   *  *  * @ `@ `* @(   *  *  * @ `@ `@  (  `? ` `:2ބh(xyyxxxxx*  *  *  *  *  *  *  * ؐ  㿘   "   "   ?@ 6@!ؑ* @-  ?  !0    2@$  `?@?}  - $  "` "@!& !&$! "㿘 a a  "@20 " @2+` & @2F a x?v$a "` "@ 2   "j&  @ *  ?    @? 2f   " `? `2@aؓ*` a0  ** * " *"  5 $   2/&  2+&  @ *  ?      @?y 2' $ ,  "` "@a $ a$a"  "  2$ & & &.  . a& a&$a " @ :@`! "!  㿘! 2!5 !"1 !   `    @?# 2?`"   @4 @1~  "` "@@1v!2  "`"` *`@` `@ !"`!"@! ` h ``"b @@ $`b  \ "`(   \ `   \ "b0?`a܀ 8 (`@ Ԁ?' '@5z ܒ`@5v  ` a܀ @ ҔԀ?֐' '@5a @5]  ` a܀ А2 a@`@  "?(`  @Ц2 @ Ц? Ѐ @@+  Ѐ "b "@V?2 @@ ?`@ ?  "    #\@ b0l ?* 2 *` " `@4*  6 -`@ "6 2`  `&  $ , @@4``@4`(@  2 a`@2a`  4`a䀢 2@  2  ?2 ?@2@ $a 4a쀢 2 @2@ $a4a$a@@   2b @@ b  $b  㿘!@  2& G&!!6 `  ?  "@  @*5&!!䀢    2-&! 2 ?@2&&!@  &&!  6 6!6!  2&! 2&!@  4&!6!쀠 `?& @ @  㿐  `"" @ 4 $ "  \G " (? \@4> 6  "< @ x .' ?2   @.  2)? @; `?2  2  2 @  ?@ `?  \ "b0? "  $" 㿐@@ ؔ @ ? " @@" ,` [@ Ô  !?&! "9@  "  `?2 ?@2 @   !@"@!2 ! &!2  @`!"!2 ! &!@  @  % ,@ y @ ה " @@2`@@l@ e @̔ 2k @@"\ ,` V@ O  !?&! "4@  "K   2 @ 4 ?!@"@2  @`@ $ @  ", `?2 ?!"!2 ! &!,@  @ h " @@2`@  @ X &@`?㿐 @V@?   @ ޔ u`?@  2[" " `?2  2 @a \ Z?@  U `?2 @  @ g א `?2 @"  ?#@`4 ?#@ P @ ?"  "  @`4 `?2  @ ~  @ v ?@ q  ?@ }?㿘?# ,!@&! "s@@  "? , @  @  ?"g`?2  2@   4`!4` H$` @ 2d?@  Ɛ ,\? `@  @2$ `4`*` `` ?# 2 *   `?2 "?*     *2*  `?4`@  @   @ ߔ  @ ڔ ?@5 2  @   㿘 (@  . @.  .@q 2l?.   @ B ?"^?`  @` @ 7@ ?2`Q?`@@`   @1$ 6. .  ?#@ 2@` *   ?2 "?*  " ` *2@*  `?6 (@  2   @2  ?6  㿈  ( . ("  `'7  #\  @_ 2 `'7@Ԕ 2 ` W,`?2 ?'7@  ` C,`2`"@ [ %' ?2 ?7@ 2 `" @  ?2 ?2('`"$'@ 8 2'/?7@ 2 ` ,`@ ” $@4` @  '7` #\  @ޚ  ` ,` 㿘``"`@ "?`"`@  ``" @ 2`?"`@   $ cd@$ cd@$ cd@$t cd@x^7@  @ @`"?ޑ* `"@4`2 `" @ $@ `/@`'@`'@`/@`@0)@@0$@  ,"  @ ?@  N@/?"Y ,!@&! :@Z "E  7  " " 0< 8 : 06 4 ? ?! ,  2)`` 2 ހ (!` ? ? '` '' '!€ ?:  @+``"  :`@  @] @`Ԩ  ?ޑ* 2 *`@ " `@/*` 4`   "  0 > _0*`"4`2* 2 @@/]r* `"@ 4`2 *`2`@ $@ '@`'@`  /@` @/=  T@ ?"{N ހ * @  @   `@@'@'`ޓ*`@`$4`2`, 4 @@%$@ * @  @   `@ ?2 '@'`ޕ*`"@ 4`2*`2`@ ?2 $@ '`@+- "@ 2" @?@?@˔ @ǔ  ,@ @  @ @ @ @  ?㿐@z^ $@ 4`4``$`@$`` $` ` `?2 @ @&` 4`7&?&@*ؠ2@@t 4 $@$ `$  4 4 ` $ ``@ 2@@* & @S @Ú@.H؀"@)&&㿐@@ $@$$`@$ $ $` 4 4`!4 4`` $ $` @&&㿘!ڐ?6`6``@ ?2 @$$ `?6`6``@ ?2 @$$  6`` ? &` @  㿘!ڐ?6`6``@&@ $, `  % 4   `" 6`6``@  &@  $ ,  @-  @< ?  ?  `" 6`6``@ @- $ @) 6`` ? &` @  p'' ڐ* 2   `?2 * 2 t *`2 ''ԑ/`2 '- 2 @2` 6  ",  ,0*  ,0$2  @ @2  @ @   ?  ,2  @   2  @@  ? @)w- 2 @-2 ܀ :%?- 2 @ *  "@6 2  @-* 2 Ԁ    - ,2 䀢  - 2   @6  ( @@-   2,2 @:"""2- 2 8 "7,2`/`2 @N /`2 ,2 `    ",  ,0&  ,0 2  @ @2  @ @    ?,2  @  2  @@  ?@(- 2`@"62`@,, 4   - 2 @/`2 6`6㿘@Ӕ " ?`  "` @h   `0(0 *0(0 @(0 (㿈  `"@@ $ `  t*`@ ( @@& \ "b0? @@h#\!@<!Ȱ" @@ 0$ 㿐`f!*`@xx  \  \ "b0L?@F @2 ">?`?2  "` 2 &@`@ @ )6`@ &  @ "?`?2  "` 2&@`? ?@ @ @ `?2 ?6` 㿐 (    @WS@ D "# D&@  "  ` *`2`?2 @25&@ @b @ ! %&@ "    , &@ 6``2 @E 2 @ 2??2 ?&@6` 㿐@"}  "Y " q' '@  @ ' ' 7  2&  +@@ @Y 2$@2C? @ =??2 4  ?4 @ "@@є & ?2 @2 @ `2 @ 24 ?$& & 㿘  " (@&L& &  ( . (& 6  ( . (㿘 ,&!   @ 2& k ?2 *   ,`2 6 @.   "A!&Q,` ,`2   ," 2%&, ,  @Z 21 ,2`?2 @2&  @# 2 &6  ,  2?!"@!2 ! &!, 2   @! 㿐`@z ' 7@Ĕ @   @ & &  & 㿐`@V '  ?2 ?7@ @ߔ   @ٔ & &  & 㿘\@`*   7 `  ` @ 2m?( 2@" @"@@@ @%-  @%h@ "R?&@&` @)@@&&` & "A ` @` @  @` 3?/@ 2`" @#` `@(@@ 2`@$  @%-` 2'@?` '`@` @@ @)Y``' @' @ @' 㿐    1    *     2   *       ''` !@A!̀ "!?'!€ `8@  "2  ` `` @@    2 ``@㿐@(ה `@(Ӕ & :! @$M  @$ &#?'!ظ?@ 8@(@ " '@' 㿐!ب? @` @h&?&@&`&`&` 6`6``@(}` @$`@t @&ۢ@g  㿐@(` `@(\ @ 2` ? "!@L  ?`'@ @ "' 㿘"`!"`@&!@+ 㿘!Ԁ` @ "!&@ $!@B8@ & <   \ "b0  @$( && * "`"` &$  &$&$&$"$"$ "$$mpool_new: page allocation overflow. 㿘$?a!`@Òa@$@ 2$%  &$"&@ *? *  ""` 2@"`" "@" " 2 &" & 㿘$@  \l @SF? *   2""` 2""@$$ 2"" "2 &  "`  2 &"`$ $ 2 &" &   L,@@$ $@%̖ 2< @29 $@%$$@` \ O"b0* $ ,? *  $$ 2"" "$ $ 2 &" & $"$$   * 㿘`2` &   "` ` 2`&  "`@" 2@" 㿘   @d?2  ? 2 @$` 㿘$$ @*A$"=$  25  @A?"<  ? *   2 " "`  2 ""@ 2  $  "`  2  $ "`2 $@!  & $ $$ 㿘$ "$$$``$@` $@$ 2?@2?$`@$$$ ?` .` ("    2  $_ cd@$OpenBSD: calloc.c,v 1.3 1996/08/20 17:42:33 downsj Exp $㿘@}@! @%3㿘'L'P'T'X@hL$OpenBSD: vfprintf.c,v 1.6 1996/12/14 06:49:43 tholo Exp $㿘` @ &`&`&` @ ?7 7 ' ,'̐''$'''@0@ 2? @  @4 InfNaN0123456789abcdef(null)0123456789ABCDEFbug in vfprintf: bad base0.㼀@''    2  @*  \ "b0.?   V   ' '''''@ϔ  %@@ $$@'  'e ' ڲ` ' ?/'N@``X  \*`@hhhhhhhhhh         hhhhhhhhhhŌhŌhhhhĈhhLhhhhhɐhhhhhhhhhhhhĴŌŌŌĐhhĘhǬPĬhhɔhh$O' 2N@ /'`  *  : * ?Г*`:`  L?Ѐ , L $2 '@``- @ `- @ 6_N@ [` +X/'N@*;`  *  : * ?Г*`:`  L?Ѐ , L $2 '@`- @ `- @  ? * ?РN@`Ѐ (, $   ?` , * ?РN@Ѐ `$2 '@۔N@``@N@ l2``` @`- @ *``  `''`@ `- @ *  : `- @ :  Z ` -U/'g  G" `- @ ''Ĵ@ޒ ``?  -/'"` @ "h a#\#`@8gGe?$ gg E e ef'@q' `  `O`@@ ` O `` $@  O 9 -7/'`  `- @ :`:```@ `- @ 2`- @ "``  `'' `@ `- @  `- @   `- @   "p'`q x`- @ "  @ } "@$/'@!``  `'`'d` `@ `- @  `- @  1 ""p`  ''@'D@` `@ `- @  `- @  `   2``"/'`/''  ``W'`1` `70G ` 0,, 4` 4  2`2`<'L 07 04,  `0,   ` `0, `,, 4` 4  2`2'"@!L '?Ħ@/@ /'&O' `2`2O'& . `@$ $ '  ' ? `@$$'  ' O' '$ $  ` 0/8/98$ $ '  ' k ` 2& . `P$ $ '  'ɒ N? `P$$'  ' 8  - `P$ $ '  ' ? `P$$'  ' ae$$@;``? BT"$ $ '  '^ @`` $ $ '  'D ɤ? w `P$ $ '  '* ? `P$$K `"$ $ '  '   $ $ '  ' {  - `P$ $ '  'ܒ a? `P$$'  'ƒ K$$@' M$$ '  ' 0"@ - `P$ $ '  ' ? `P$$'  'z `"$ $ $@'  '_ "$ $ '  'I Τ$"@$@l' 4 `"M$ /8 ./98$ $ '  '! ``? B3 $$?) ? 2 `P$ $ '  ' }? `P$$ $ '  'ݒ b$$'  'ʒ O`/& , `@$ $ '  ' 4? `@$$'  ' 2 &'耢  '耢 ~ '`@" @   @?' '   @t   N%_  N `XU l*`@@@@@@ۨܨܨP$ߠp۬ܨܨܨX۬`$((hdߤऒ  N * ?L@ `L@?Ѐ *`L@N*2   N * ?L@ `L@?Ѐ *`L@ $ @* 4f`@ * 4[ZNЀ XNЀ  Q * * ?Ж NЀ  $C> <:@86 耤@ܒ* 4"!N 耤@˒ *@ 4N@ *@ 4N@耤@ *@ 4N@* 4N耤@ *@ 4ѦN@~ *@ 4æN 耤@m *@ 4N@] *@ 4N@耤@L *@ 4N@> *@ 4N 耤@, *@ 4qpN@ *@ 4a`N@耤@  *@ 4PON@ *@ 4BAN耤@ *@ 432N耤@ߒ *@ 4$#N 耤@͒ *@ 4N@ *@ 4N@耤@ *@ 4N@ *@ 4N 耤@ *@ 4ҦN@} *@ 4¦N@耤@l *@ 4N@^ *@ 4N2N@j* & >" *"@ /*  Ph@'`'`@'`'`@'x`'| `@'p`'t``$쀢`@@A 㿘@  * @&@+@@@L&@* @$ &@ 㿀?\`f`  `e`E  `h聩 9/? -/#\@ `g`G`f&`fN 02 @`h聩 B  '@@`h聩 B3'   0`'*@@ `"$`,`   -,   +. ` @ے  0.@֒ ` `0.􀦀.   & 0. `0. &㿘``"    2 @@  \ "b0@ ``" d$ ,$@`" &` P ``" " @*@ǔ "& &- @@ @&@R 2  @  , $s  @ "& &$@`" &`a  ` ` ``@ @ݔ"@` @    @ @b&@ 2-    , $    @G "& &2@ސ   $@`" &`   @6 ?;`` @  ?@2 d2 #;`` ( d`?#@(#)divrem.m4 8.1 (Berkeley) 6/4/93@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  @(#)divrem.m4 8.1 (Berkeley) 6/4/93@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   & &  $OpenBSD: memchr.c,v 1.2 1996/08/19 08:34:04 tholo Exp $"  `  ?2  $OpenBSD: bcopy.c,v 1.2 1996/08/19 08:33:58 tholo Exp $X@V+  2     " *@ `2" "@ `2 *@ `0* @  "2 2  "? *@2" ?"@? *@$OpenBSD: strtod.c,v 1.9 1997/03/25 17:07:30 rahnds Exp $㿘 Y ,`@   "@ ,, @n & & & &    Y (" ( 㿘   ?# @ /@4 @ )4` 2 *  @$ &-    *  @Ŕǐ- "  & 㿘 @_   *`  "` "``   N   ж       В&N ?  * ?<* 0*  *   @, 0"@& 0"@" ?  0 0 0 02 "@0  "@㿘 "  " 㿐 `@6  `  `  .: % *% , `,`@'@E ?#@  @@ @  44`@ 74  4 44 $@  @ ! 444@  @   4 $`@  . 2' ' 㿘` `c0*  >``$! Y Ѐ``j"q$ Т$@`" >`i>`` @ 2Z$@"㿘>` @   *  ]  "   * `@ " @* "@`@ 2  " @"`@ ?$H`(`@" ?8 㿘     D       +``* @ ?# @ "@@ : 22"  ` :`33 @  ?# @  : 2`@  :`33   ?? " ;hh?0 $ #`#d:  4?8#` #d #`   ( #d`#㿐  * @?# " &@ " 4 ' ?,  " 2 ?,  "@ 3 @  ' ?+  " 4@'''㿈?\  ?*@' *@2  '' '씒  "@ *  $@2 '$@$`   &  ڐ$@ &    ΐ͐& 5"  &&.`?.`"@&㿀p?l?"@ `" * * '*" '?@$@Y@@@È@jA.AcAׄAeB_ B7HvBmB0@BּC k&4CAy7Cv4WؠCmgNCX`=Dx@DKPDMՒCAy7FnM8O?ZwH02uOs<<Ҳ؉9I#ը32D=%[ό (doC`@ '  ''' ac    a#   2L - + '2LL "8L 0  L 0"L *    ``,*   ?4`+  *  ?Т`L ... ... . ..misc  (3   @31}^(@@=<@`bT U3@8(((0lA3ր33=0|C3338! q?A3.3_/3ŀ mtyD33333X`F$^l3Z33/tmp/disktab.shadow3'3'3'/tmp/fstab.shadowB,3.@3.@3.@/tmp/resolv.conf.shadow%;Q 34I34I34I/tmp/hosts:$(8h71CDvd{jnYRey+D~uל.c\%SYLUd{Vk`PAһD+aE;/뀢9*: E`=L0ϦL0`π 6e  )`    `,* `4+  *   `,*   ` +  *   LЀ (ӖЀe EG``2 `2"L+ -І LЀ ,0ϦL0"π  *` *  ?ЦL/9$ "@" 2 ` `2 %@`w܀u`s`` '?`cHB? !p- @D?' `cHBD?`1 @ 3 2-$@`A` !-`@"@$@%@ a* D?-` D$? !*`@?$@ G !*@D??!4$ <  \ ""b0a#(o? y  "p * D?<  ?, '"p*@D? @(8 \$(#'N? K' I  !*@??;<  &  " * D?<  ?"* B`c@F?D? DF?'' \ ""b0 0B?' ')#;`  *  @Ԕ_ `      쀢 &$@@?d3 6"@ @ 44& $@ $   o  ے`U % 6   % 02  @?  @ ''   ?@@'?' р Ld`c@ B9?0 `cP@  /?Ȁ `cX?^`* 4 4\34\4\4$4\4\4\4\4\4\4\4\4D4\4\4\4\4\4\4\444\4\4\4\4\4\4\4T4\4\4\4\4\4\44\4\4\4\4\4\4\4\4<4\4\4\4\4\4\4\4,4\4\4\4\4\4\4\4L 4* & 4 42 & 4$`$`%h%h%cp %cp %#l%#l`$` !$``2L@k Z#l  Z "cp! Z#\   @??$#D !! Z@ /2 ?$#< Z$"cH Zc8 "c8b`4 2b "`4b 4*` " 4! Z@ $#x㿘 /0 Z#L * `""`"@  """2 6 4  Z#<" Z#D* "  @  Z#D  * `@ " Z#p  @֕. `  Zcx "cx@㿘 (  ?>  2` Z#D,`@ p Zd 2 2 *   *,   @ @P  *3 3 23 3 #  `  ?2*  "  #@ 2 6  2*  (  @  "  26   +@2* +@*@" ?3  ?3 $ 6  Z#<"@ Z#D*`" ,` #"    Z: #D,`@    "   *`@  @" ?6 *    Z#D,`" &": *  , Z#p   @  allocation failed. 㿘 Z#8  Z#d @  (+Ӑ Z#`  2 ZE! Z#l   @ٔmalloc() has never been called. junk pointer, too low to make sense. junk pointer, too high to make sense. modified (page-) pointer. modified (chunk-) pointer. chunk is already free. pointer to wrong page. 㿘 Z#d z  Z#8 4` `" Z#<"@` X" Z#@@Q" Z*`#D@@ 2oD" !   Z#h 7@50@20? (* ?@$# o 2@2`*  ` 2 #8 *  Z#h 2`@ 2`@ 0#P 0" @@page is already free. freelist is destroyed. 㿘 c Z#8  Z"0Z#d W6  Z#<" "0M Z#@y"0E Z#D*@ Ҙ  k!p07 e#P01/_"0+ Z#D+  "  *    Z#D  * "@ * @   Z#p *  @! Z#x  $#x Z#x"`"` "` ZL L"@"`"L P##x Z#L "  *   Zx" " $  "@6"x 2 @$  @$ "* @2%  $   $  $" 2 @$ $    Zcx"" $"cx! 1%b 4@*# Z ct@&@ ct@  4 $ $ @  $ct 2  Z#<# Z?  "#@ Z#Dc@* "p0l/ 4@ ?#0c4`*  ` 2 #80W Z#p  @ 4`* ` *  "  4  Z *`D* 2    " " ` ` @ 2$""  @2" 2  Zc<"  ZcD*  "  in malloc():recursive call. 㿘 Zc@"#|! Z#   $##$# #P Zc?"c  in free():㿘 Zc"#|! Z#   $##P#?$#] Zc?"c in realloc():㿘 Z`P"#|! Z#   $#ې#P#?$# ?`2  Zc?"c$OpenBSD: getenv.c,v 1.3 1996/08/19 08:33:31 tholo Exp $㿘L   J@ = \`J@ ` \"(  ' \@˔ 2 @L@ =2 ($: &@   㿐͒$OpenBSD: abort.c,v 1.3 1996/10/25 03:09:15 tholo Exp $㿐 Z# "??' ?' @R @@  @7  @G @@{ @Ӑ 㿘T @`>  P@ B < P ?Đ*@4 㿘 !" V   @  ?Đ*@6 V @'㿘V  @ ?2  2  ?Đ*@6  6 >P㿘@VV 㿘a! ? T` "??`X2x ?`' *`@I,I@I`IxIIhIIIIJJJ0JDJXJhJ|JJJJJJJKII ' ' @耢 ? d 'g  ' w'  ' p' ' k' 'R  ' b' ' ]' ' X' ' S' ' N' ' I' ' D' '@' ' ;' ' 6' '  '  '  '  '   '   '  ' ' ܖؘ @ ? ܀ ? \ "b0 ? ܖؘ @ٚ ??܁x'' \"p? ' \ "b0? *@ @ @ ` '@؀ ?؁$ cd@$. cd@$: cd@$ cd@$I cd@$% cd@$6 cd@$ cd@$„ cd@$ cd@$ cd@$OpenBSD: bcopy.c,v 1.2 1996/08/19 08:33:58 tholo Exp $Y V+ 2     " @*`2" @"`2 @*`0*@    "2 2  " @*2" @" @*㿈'XX#\#`#d#h  Ŕ@d㿐#\  ǔ@Y  $OpenBSD: sigprocmask.S,v 1.2 1996/08/19 08:18:13 tholo Exp $@2@  0 cd@2"$OpenBSD: brk.S,v 1.2 1996/08/19 08:18:02 tholo Exp $ba@4   :bcd@ b$OpenBSD: strncmp.c,v 1.3 1996/08/19 08:34:21 tholo Exp $2J  J@`J 2J $OpenBSD: strlen.S,v 1.2 1996/08/19 08:17:59 tholo Exp $ J " $OpenBSD: memset.c,v 1.2 1996/08/19 08:34:07 tholo Exp $($OpenBSD: exit.c,v 1.2 1996/08/19 08:33:30 tholo Exp $㿘 \" ` Z`?, @,  ?, @`2` Z# @/usr/bin:/bin:/usr/sbin:/sbin㿘 @uh  a \`2] \     " b@w L    D "?  ?`6#ؓ*`@T$T0T<THTTT\TdTTlTxTxTxTxTxTxTxTxTT#?###    (","  " \ "b0?$ cd@$ʄ cd@$Ƅ cd@$OpenBSD: bcopy.c,v 1.2 1996/08/19 08:33:58 tholo Exp $Y V+ 2     " @*`2" @"`2 @*`0*@    "2 2  " @*2" @" @*$OpenBSD: sbrk.S,v 1.2 1996/08/19 08:18:10 tholo Exp $b   : cd@"$OpenBSD: cerror.S,v 1.2 1996/08/19 08:18:02 tholo Exp $ \ b0??8W"V?ߒ &P?  ՂȦ , D?3" ƀ    ?Ԑ `$@ 4` ,`    .  &?  NȦ ,͑. "?  &@㿘@ `rΔ&Ѱ  ? \''''''' ' !ؐ  !   "  "&  & . ``& i& &`G9 \'"0  N ?2#` `"0 2``2q \  & a h&  @"& #!@&  T \  & x M \ ܐ ؐ !& #@&  &  x& "& $ &  &  &  ͔ & \`  2  "`   Z"  )€?? \0 \ "b0 \ "0İ` \C \""0 㿘  `"" , & " ( \" "b0?㿘  `" $ `7!*`@]@]]x]]]]\]]@ % \(" ( #  $    ( " "  $?2"I " )2"!€??>?" \ "b07?" " )2 "!€2&" ـ8  ?@[  ( , ($ $@" @"@@֦ $ 㿘  `֖ $  \@ 2" \ "b0-?" )"!$ €2?@ ?  @" @"@@a $ 㿐!" !Ȁ ؐ  " &!D?"&!!'"'"3"!!`? "`~!!" ?2,@?2,@"A@  Φ?آ`*"*"  !&"  㿐"O"!!!`? "`?!!" @!'!Ȑ$' (@ p  ,?2,!ʠ$!̒!&!!Ȁ !O  !̀ &!ȑ, 2 !Ƞ , *!Ȁ*"  !&"  㿐!" !Ȁ %  `" &!3?!&" / "&!!'"'""@"" :" " !Ȁ *@ `  "@  Ԣ`@ 〤&" 㿐"" "@$" " !&"   ' " * $'@ ז `?@  &" 㿘  `* $ " (" \@`" \"@ @$  \" 2 $ @ $?$ $ "b0 ? "  @$" 㿘@ 2?@  ܔ 㿘. @   k ?2@E?@  `@  $ `6`.`: ?*  ` ?#@ 2@` *   `? ? @" : ?*  "` ` *2@*  ``?6`"?&" 㿘` `y $ @$ ?"?" $ "D"` " ( @Z! f" 2?ɐ?"?p  `` J $ ` 2"  ~  "" v !2 "!€??"l?"   2d?`2a? $ 'ܐ'" " ؔ  4?"䀢 G ؔ  """?"' ' ؔ ''") ` ' ؔ  "?$ $"  e  "?  "  ?" *@$"  ?㿘'L!Ā ! >  y  "K?&! &!!L  &!& "= @`*    `  ` !ѹ!̀ 2+?'!" @ @ !̀@!Ȁ 2@  A` 2&!?@ &!!Ȓ`o@@' !' `' 㿘 ,&!  Ҽ L \ &@& 6 q  ?* 2 *2   * 2     8!!"!2`! &!  ̒*2   ?*2    "     )"0 ,!?&! ` \@\ `*    ?*     "   ! \""0 㿘,  `$@,`2 @` , 2 6$@,`2  , 2 66, 4 ,  , $@2 2 㿘`.  @G.? . "@ # *  ` *2 @# ` 2. 2`@2`@2.,*  @4 @`@ 24 8?& 8` .` 㿀  Q   J 2 x?-.3 @q3`  .   -g .   - '  @   ߧ,@ '% ',%+  ` , 2 @@  % .``$6 @2`, `@@' " ', ,"6* 2 * @ * %2`* 2   ?.   ?- p* 2       #\@ 2?܀؀  ),`2 @  2#  `" 4* 2 *  * '2* 2  Y   @\  ] ,`2   (W,`  ' %@ ' '  " ' ސ2  @`*  @ @ǒ";?j .  @`*  @ @2?M .`* 2  ,`,`2  *W @ 㿘`  5 *` 8.  & *  @ *     Y *`@ ږ "R?``2 ( @`*   @8 `@;"6?` @`*   @ Д `@; 2?` .` 8   & 8 (^` 4 $  @ 㿘 4@@ `2  & 4 & 4` .`@r,`2 `j  &` ` ` *`*@`2`*  ?2`2`2`4`㿐!?N K < *  @6  *@  <*@  *  @ :@     ?"U??   \ O"b0F?2`2   2  6@ ?6` 66` ဢ@1`  :  + *@ '.@ @*`*` *` 7**    * 7* @  *` 㿐!? @ѐ 2q?  ဢ@+!   :  $*@ '.@ @*`*` *`@ *@ 7.@ @ *` < 1*  @6  *@  <*@  *  @ :@     ?"? ? \  O"b0?㿘 !! &!<  ,  \  V"?* $ $.2 đ."!8      (HASH: Out of overflow pages. Increase page size 㿘` -  D?``=@ ?` * ? `$: 2. !8@H2` * ? ` * ?`$  :  ? ?j*`` *` ӑ. - `D$`$`D "`D `@$'$`   $ $`  ac 1 -  @" D @" @ ` * ?2%`` - @ J i - @`D  '""`D  Ր $` -  @" D @" @ : *   ?$ *@ @$ :- C  : *    $  *   $ ` 鱓*` `$?$`$  .  D  .  . @ @$'4 . . 6  㿘` '2 *  @@ $@&& $  :@ * ? @*!8 @d   : *    ?$ *@ * " *㿐?' !c" `?&!Ӑ `! ה   !8@?㿘,```%4, 2 @`$6, 4 64`4`*`` $2* 2 㿘!@6 $ .`@ "a8.`.`!8Ė  <  .`!8,!8  ?*@   *  2@*@ 㿘`e*2 4*  $@,`2 , 4 P%@*44*2`@* $@2`* 2 * 4 x`/*  %4*  "*4* 2 .4 %@ 4*`@`"2`* 2 * 2?`` .`*  `?F*2 @4*2  "*  $, 2 ,`4`۔*44*2`@* $2`* 2 * 4 :2`?* 4 ` .`*   ? 㿘 ` ?* 2  (   *    2*  ?` .` `@`` 2+  ?  22`$$?$?2+ 2  *` " 2*`@  ?2`  `,0+ 8?& 8 㿘`. $* 2 ( . @  ", @ A2 ', 2 &. @` "?` " * 2 ܰ , 2 2 ?. @ ?㿘@   `*`    2&@*`@  "  &@   㿘`.   .*`@ ʖ "w?`  .   2*`@  ``B * @  2 " 0,`G?*  &" 9& 2 &! !$ &!$ .&!(*`@ | (&!  &!(!   2! !$ &!$&! ,`2@?&   \,`! ]2!&  "b0?㿘`  "@  /`! ʐ D&!2 &!( 2&! !$ (&!$*`@( -&! !   2` !$ &!$&! *`@ $?`   \! `  "b0?㿘 @ ?&!& ?㿘`` " ``?* 2  ! ~\ .&!  "` $?@*`@ И$?`   \!``  "b0?㿈'P\ 2d?@ P4 * 2 ` P $ L?$ ` ` *`"``/`  `*`2 6`*`2 66*`2`@2`* 2 $$ P` ` *` *   6* 2 2 * 2 P ?6P`"$ $ 㿈  `"" ( & " ""*" "%8Z \!̀ !Ȁ 원  " L&!"&!!!" "#" !'"' 3'$!.@8888 8 (  \! $@2"  @ \"@  \" Z  \ "b0U?"<" )2 "!€?"F?" ," ""'." '"'""'" (" @( 2#?"`" "+@ 2 "& $"  &"   x! ˔䀢?/' '''  "@     ""@b?2 2 L?`   " ` ,`2 #\ 25 " &"0  ?,`2`* 2 *` " `*  4 ,`2`@ "4 2`  $  * " &""  &"   %W% (Erasmus) %G%T...\0.a .r. .h.h.H.! .p%.hX.`X.XX.P.H.@.8.(. .(.(.'.'--&-&-&- !- $- 0 - L`- N- T- j- -p -h 0-` 0-X (-P yx-H -@ -8 -0 E- K- K- - !X, !X, `, , H, , h, , , ,,,,,,,p̰*P+@$OpenBSD: args.c,v 1.6 1997/02/14 07:05:18 millert Exp $$OpenBSD: conv.c,v 1.5 1997/02/14 07:05:19 millert Exp $$OpenBSD: conv_tab.c,v 1.3 1996/06/23 14:19:46 deraadt Exp $@(#) Copyright (c) 1991, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: dd.c,v 1.5 1997/02/14 07:05:20 millert Exp $$OpenBSD: misc.c,v 1.4 1997/02/14 07:05:21 millert Exp $$OpenBSD: position.c,v 1.3 1997/02/14 07:05:22 millert Exp $@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount_cd9660.c,v 1.6 1997/04/19 20:10:13 deraadt Exp $$OpenBSD: getmntopts.c,v 1.2 1996/06/23 14:31:10 deraadt Exp $@(#) Copyright (c) 1980, 1990, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: df.c,v 1.14 1997/04/14 20:25:37 kstailey Exp $@A/@A΄BmeC Ck&4@$@Y@(#) Copyright (c) 1980, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount.c,v 1.16 1997/03/10 04:27:42 millert Exp $@sssps`sHs0s(s sssr rr@rr r{{$OpenBSD: getmntopts.c,v 1.2 1996/06/23 14:31:10 deraadt Exp $@(#) Copyright (c) 1987, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: sync.c,v 1.2 1996/06/23 14:21:55 deraadt Exp $/dev/ptyXX\^:   }) 0$OpenBSD: cchar.c,v 1.5 1996/08/02 12:10:03 deraadt Exp $$OpenBSD: gfmt.c,v 1.3 1996/06/23 14:21:50 deraadt Exp $$OpenBSD: key.c,v 1.6 1996/12/17 19:09:30 tholo Exp $ttxphH`tXtPHt@(80(T  Dt$OpenBSD: modes.c,v 1.4 1996/12/16 20:04:41 tholo Exp $$OpenBSD: print.c,v 1.5 1996/09/15 23:13:03 millert Exp $@(#) Copyright (c) 1989, 1991, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: stty.c,v 1.4 1996/08/02 12:41:10 deraadt Exp $@(#) Copyright (c) 1987, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: ln.c,v 1.4 1996/12/14 12:18:01 mickey Exp $@(#) Copyright (c) 1987, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: disklabel.c,v 1.31 1997/05/21 16:02:33 deraadt Exp $%%x%p%h%`%X%P%H%@%8%0%(% &(& &&%%%%%%%%%%%%%%&X&X&X&X&X&X&X&P&H&@&X&X&8&X&0&X&X%/tmp/EdDk.aXXXXXXX$OpenBSD: dkcksum.c,v 1.2 1996/06/23 14:30:05 deraadt Exp $$OpenBSD: ar_io.c,v 1.13 1997/03/25 09:30:19 millert Exp $$OpenBSD: ar_subs.c,v 1.6 1997/02/27 23:32:57 michaels Exp $$OpenBSD: buf_subs.c,v 1.4 1997/04/06 06:11:10 millert Exp $ $OpenBSD: cache.c,v 1.4 1996/09/15 22:34:06 millert Exp $$OpenBSD: cpio.c,v 1.3 1996/06/23 14:20:31 deraadt Exp $$OpenBSD: file_subs.c,v 1.8 1997/04/09 01:59:00 deraadt Exp $$OpenBSD: ftree.c,v 1.4 1996/10/27 06:45:11 downsj Exp $$OpenBSD: gen_subs.c,v 1.4 1997/01/24 19:41:21 millert Exp $$OpenBSD: getoldopt.c,v 1.2 1996/06/23 14:20:36 deraadt Exp $$OpenBSD: options.c,v 1.24 1997/04/16 03:50:23 millert Exp $abcdfiklnoprstuvwxBDEGHLPTUXYZ`Ш œh  DLX`ŒœXh  Dn`l|œXh  DnPl|ʌXh  D(f0 hc lhcc  gP(ppTq<cpvcc  D$OpenBSD: pat_rep.c,v 1.8 1997/04/05 22:36:15 millert Exp $@(#) Copyright (c) 1992, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: pax.c,v 1.7 1997/04/05 22:36:17 millert Exp $$OpenBSD: sel_subs.c,v 1.3 1996/06/23 14:20:41 deraadt Exp $$OpenBSD: tables.c,v 1.5 1996/12/24 03:44:13 tholo Exp $$OpenBSD: tar.c,v 1.9 1997/04/05 22:36:19 millert Exp $$OpenBSD: tty_subs.c,v 1.3 1996/06/23 14:20:44 deraadt Exp $@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: ping.c,v 1.16 1997/02/04 16:44:14 kstailey Exp $8. Ad@@@@@@@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: cat.c,v 1.7 1996/12/14 12:17:33 mickey Exp $@(#) Copyright (c) 1988, 1993, 1994 The Regents of the University of California. All rights reserved. @(#) Copyright (c) 1983, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: ifconfig.c,v 1.6 1997/01/21 18:10:39 deraadt Exp $7@@@@@@,,x,pĬh XP@ڌ0(0 00070@@ @@@@@Lɐ՘ i@ixذ i@ixdh i@ix4,0iti$dD$OpenBSD: cmp.c,v 1.3 1997/01/03 22:36:07 millert Exp $$OpenBSD: stat_flags.c,v 1.2 1996/06/23 14:20:21 deraadt Exp $@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: ls.c,v 1.7 1997/04/01 22:59:38 deraadt Exp $P.H$OpenBSD: print.c,v 1.6 1997/01/03 22:36:08 millert Exp $$OpenBSD: util.c,v 1.2 1996/06/23 14:20:22 deraadt Exp $$OpenBSD: map.c,v 1.3 1997/01/17 07:13:43 millert Exp $$OpenBSD: misc.c,v 1.2 1996/06/26 05:41:55 deraadt Exp $$OpenBSD: set.c,v 1.2 1996/06/26 05:41:56 deraadt Exp $$OpenBSD: term.c,v 1.3 1997/01/17 07:13:44 millert Exp $@(#) Copyright (c) 1980, 1991, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: tset.c,v 1.3 1997/01/15 23:43:25 millert Exp $$OpenBSD: wrterm.c,v 1.3 1997/01/17 07:13:45 millert Exp $VVVVVVVVhV`VH$$$$8888LLLL e j   ky JKYdu f   bvz!w"F2R r u'g<<p%{{}}{}(())()[[]][]#$G>>P30123456789=:f/?/*?*n+n,N-N.m'E :e  :n:p:x&-/:ttso_|%v !+ HhVq:q:QZZ  lhbwixX  0 $ k j  is a directory is not a regular fileHHa(b 0МBxc`@dPefpPg0hHAhHi(j߰kH lH͔m$ߠߐ߀n" hP0oh OLpHόPqިސr!h@s!L(S!Tt\Tu"(ݠ݀hVw!8x$XAܸܘy܀Xz@ ?T8 (press RETURN)... (interrupt to abort)?n?f%f .?m(file %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?m(file %i of %m) .?e(END) ?x- Next\: %x.:(?pB%pB\%:byte %bB?s/%s..).%t?f%f .?n?m(file %i of %m) ..?ltline %lt?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(file %i of %m) .?ltline %lt?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%t0 290@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. $NetBSD: mount_nfs.c,v 1.12.4.1 1996/05/25 22:48:05 fvdl Exp $  @(#)getmntopts.c 8.3 (Berkeley) 3/29/95$Id: dfa.c,v 1.1.1.1 1995/10/18 08:40:17 deraadt Exp $,),),*(,p*\,`*,P*,@*,0+,, +`,+,+$Id: grep.c,v 1.1.1.1 1995/10/18 08:40:17 deraadt Exp $GNU grep version 2.0$OpenBSD: getopt.c,v 1.2 1997/02/17 09:16:31 niklas Exp $?$Id: kwset.c,v 1.1.1.1 1995/10/18 08:40:17 deraadt Exp $$Id: obstack.c,v 1.1.1.1 1995/10/18 08:40:17 deraadt Exp $$NetBSD: regex.c,v 1.4 1995/04/23 08:36:17 cgd Exp $8xhP8 $Id: search.c,v 1.1.1.1 1995/10/18 08:40:18 deraadt Exp $  l   l   l   L   L   L   p   p @(#) Copyright (c) 1991, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: basename.c,v 1.2 1996/06/26 05:31:37 deraadt Exp $@(#) Copyright (c) 1980, 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: umount.c,v 1.5 1997/01/15 23:41:45 millert Exp $@(#) Copyright (c) 1983, 1990 The Regents of the University of California. All rights reserved. $OpenBSD: rsh.c,v 1.12 1997/03/26 19:41:59 deraadt Exp $$OpenBSD: des_rw.c,v 1.5 1996/11/11 05:59:44 mickey Exp $$OpenBSD: krcmd.c,v 1.6 1996/11/11 05:59:46 mickey Exp $$OpenBSD: kcmd.c,v 1.7 1997/04/12 19:54:50 rees Exp $@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mknod.c,v 1.3 1996/08/02 11:16:47 deraadt Exp $@(#) Copyright (c) 1988, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: slattach.c,v 1.5 1996/11/13 07:17:20 downsj Exp $% T T T@(#) Copyright (c) 1983, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: route.c,v 1.18 1997/04/10 10:09:02 deraadt Exp $0123456789abcdef {  x H h 8  pksentrttvarrttssthreshsendpiperecvpipeexpirehopcountmtuUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CLONING XRESOLVE LLINFO STATICPROTO2PROTO1UPBROADCASTDEBUGLOOPBACKPTPNOTRAILERSRUNNINGNOARP PPROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD ( @ 0 (               x h ` X P H @ 0 ( ! " # $ % & ' ( ) * + , -$OpenBSD: cmds.c,v 1.20 1997/04/23 20:32:57 deraadt Exp $     ,( x$OpenBSD: cmdtab.c,v 1.9 1997/04/10 00:17:08 millert Exp $send account command to remote serverappend to a fileset ascii transfer typebeep when command completedset binary transfer typetoggle mget upper/lower case id mappingchange remote working directorychange remote working directory to parent directorychange file permissions of remote fileconnect to remote ftp servertoggle carriage return stripping on ascii getstoggle/set debugging modedelete remote filelist contents of remote directoryterminate ftp sessionexecute macrotoggle command line editingset file transfer formattoggle metacharacter expansion of local file namestoggle printing `#' marks; specify number to set sizeprint local help informationget (set) idle timer on remote sidechange local working directoryprint local working directorylist contents of remote directorydefine a macrodelete multiple fileslist contents of multiple remote directoriesget multiple filesmake directory on the remote machinelist contents of multiple remote directoriesset file transfer modeshow last modification time of remote filesend multiple filesget file if remote file is newer than local file nlist contents of remote directoryset templates for default file name mappingset translation table for default file name mappingview a remote file through your pagerenter passive transfer modetoggle use of PORT cmd for each data connectiontoggle preservation of modification time of retreived filestoggle transfer progress meterforce interactive prompting on multiple commandsissue command on alternate connectionprint working directory on remote machineterminate ftp session and exitsend arbitrary ftp commandreceive fileget file restarting at end of local fileget help from remote serverrename fileclear queued command repliesrestart file transfer at bytecountremove directory on the remote machineshow status of remote machinetoggle store unique for local filessend one fileescape to the shellsend site specific command to remote server Try "rhelp site" or "site help" for more informationshow size of remote fileshow current statusset file transfer structuretoggle store unique on remote machineshow remote system typeset tenex file transfer typetoggle packet tracingset file transfer typeget (set) umask on remote sidesend new user informationtoggle verbose mode ` x   4  @ p X p < Ր  հ   ׈  x0 p h `x d X֨ P H @ ` 0 (0 р  P | X ( @ ¼ p ר t   l  Ր (  ڀ  H p h @ ` ؐ L ؠ  ` ظ    ǘ  8 x(  pX $ hp  `ڀ  X٠ P H٠ P @ٸ  8 @ ` 0 | (H  X ڀ  ڨ  , 8 X X Ԝ ې  P p ۸   X ( @ ¼ 8 @ ” ܈  0 ܘ r8 ܸ h @ x P p  h( `P p P  Hx @  8 ̈ 0 (8 H  ` H x ޘ ް      lR$OpenBSD: complete.c,v 1.7 1997/04/23 20:33:00 deraadt Exp $$OpenBSD: domacro.c,v 1.6 1997/04/23 20:33:02 deraadt Exp $$OpenBSD: fetch.c,v 1.12 1997/05/19 05:36:56 millert Exp $$OpenBSD: ftp.c,v 1.18 1997/04/23 20:33:13 deraadt Exp $@(#) Copyright (c) 1985, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: main.c,v 1.31 1997/04/28 20:35:59 millert Exp $$OpenBSD: ruserpass.c,v 1.8 1997/04/23 20:33:21 deraadt Exp $      $OpenBSD: util.c,v 1.9 1997/05/11 17:12:57 millert Exp $A.A.A0@@(#) Copyright (c) 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount_ffs.c,v 1.5 1997/01/15 23:41:20 millert Exp $$OpenBSD: getmntopts.c,v 1.2 1996/06/23 14:31:10 deraadt Exp $@(#) Copyright (c) 1980, 1986, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: reboot.c,v 1.7 1997/04/11 09:06:42 deraadt Exp $$OpenBSD: buf.c,v 1.6 1996/10/12 19:38:28 millert Exp $.$OpenBSD: cbc.c,v 1.4 1996/10/12 19:38:31 millert Exp $@ $OpenBSD: glbl.c,v 1.5 1996/12/14 12:17:53 mickey Exp $$OpenBSD: io.c,v 1.7 1997/02/01 12:03:07 tholo Exp $ x$OpenBSD: main.c,v 1.6 1997/01/15 23:40:23 millert Exp $ H$OpenBSD: re.c,v 1.5 1996/12/14 12:17:57 mickey Exp $$OpenBSD: sub.c,v 1.5 1996/12/14 12:17:58 mickey Exp $$OpenBSD: undo.c,v 1.4 1996/10/12 19:38:43 millert Exp $@(#) Copyright (c) 1988, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: cp.c,v 1.6 1997/01/15 23:40:20 millert Exp $` y$OpenBSD: utils.c,v 1.6 1997/04/05 04:37:40 tholo Exp $ h x p ( h p  ha Xc Pc @d 0d (f h l L n N q q r S t T v V 1 9 Z b  8  x H P  ` 8 #3 0 (   #3 0  ( 0 (  p p p p       /@9(84=,>            #+3;CScscc !1Aa  0@` ?? w0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: chmod.c,v 1.4 1996/12/14 12:17:37 mickey Exp $$OpenBSD: dir.c,v 1.5 1997/03/27 16:28:51 kstailey Exp $ K( ... ...$OpenBSD: inode.c,v 1.7 1996/10/12 03:06:54 tholo Exp $@(#) Copyright (c) 1980, 1986, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: main.c,v 1.7 1997/01/15 23:41:46 millert Exp $$OpenBSD: pass1.c,v 1.3 1996/06/23 14:30:30 deraadt Exp $$OpenBSD: pass1b.c,v 1.2 1996/06/23 14:30:31 deraadt Exp $$OpenBSD: pass2.c,v 1.3 1996/06/23 14:30:31 deraadt Exp $$OpenBSD: pass3.c,v 1.2 1996/06/23 14:30:32 deraadt Exp $$OpenBSD: pass4.c,v 1.2 1996/06/23 14:30:32 deraadt Exp $$OpenBSD: pass5.c,v 1.2 1996/06/23 14:30:33 deraadt Exp $$NetBSD: fsutil.c,v 1.2 1996/10/03 20:06:31 christos Exp $$OpenBSD: setup.c,v 1.3 1996/06/23 14:30:34 deraadt Exp $ Ƹ ư ƨ Ơ Ƙ Ɛ ǘ ǐ ǀ p ` X H @ 8 0 (    Ǹ ǰ Ǩ Ǡ $OpenBSD: utilities.c,v 1.2 1996/06/23 14:30:35 deraadt Exp $?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@@(#) Copyright (c) 1991, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: init.c,v 1.9 1997/03/25 23:12:23 deraadt Exp $ $OpenBSD: dkcksum.c,v 1.2 1996/06/23 14:30:05 deraadt Exp $$OpenBSD: getmntopts.c,v 1.2 1996/06/23 14:31:10 deraadt Exp $@(#) Copyright (c) 1983, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: newfs.c,v 1.14 1997/02/23 03:51:25 millert Exp $ #p #` #X #P #H #8 #0 #( #  # # # #@ " @%s: can't read disk label; disk type must be specified$OpenBSD: mkfs.c,v 1.7 1997/03/27 17:15:27 deraadt Exp $>......@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount_kernfs.c,v 1.4 1997/01/15 23:41:21 millert Exp $$OpenBSD: getmntopts.c,v 1.2 1996/06/23 14:31:10 deraadt Exp $@(#) Copyright (c) 1990, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: rm.c,v 1.4 1996/12/14 12:18:15 mickey Exp $@(#) Copyright (c) 1980, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mt.c,v 1.17 1997/04/16 04:19:07 millert Exp $              p h h X X@(#) Copyright (c) 1983, 1992, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mkdir.c,v 1.4 1996/08/14 03:49:14 tholo Exp $ {}abcdDgGhHilnNpPqrs tw xy !:#=@(#) Copyright (c) 1992, 1993 The Regents of the University of California. All rights reserved. 0&t&t @(#) Copyright (c) 1988, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: sleep.c,v 1.4 1997/01/15 23:40:28 millert Exp $@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mv.c,v 1.8 1997/04/12 17:30:23 michaels Exp $$OpenBSD: test.c,v 1.3 1996/12/14 12:18:27 mickey Exp $ / P9p9`9X9P9H98909(9 998888888 88 88x 8p8` 8X8H 8@808(88877777777777x7`7X7@787(7 7766666666x6`6X6@686 66&x _@(#) Copyright (c) 1988, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: kill.c,v 1.3 1997/02/06 13:29:08 deraadt Exp $@(#) Copyright (c) 1988, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: hostname.c,v 1.3 1996/08/02 12:40:55 deraadt Exp $$OpenBSD: history.c,v 1.4 1997/03/14 05:12:51 millert Exp $ 1 ' ""   !,-5/"""""""""""""""""""""""""""""""$""""""""""""""""""""""""#&"0"""""."""""4"%""""""""#&"0""""".""""""4"%"""""""B=   !A;""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""" "" """   !"A""""/""" """ """"""L"RYK"""Q"7I: UH""@""NG"PTW""D"""" ""6J9<>C"? "M"F"OSVX"E"""""8""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""<g(c d {? fwdbck:HHHHHHxHpHXHPH8H0H HHGGGGGGGGGGxGpG`GXG@G8G GGGFFFFFFFFFxFpF`FXF@F8F(F FFEEEEEEEEEEEpEhEPEHE0E(EEDDDIXI@I8I(I IIHHHHHOAOBOCODffnmmmʀmn@mmm manmmmm =,A"'B" """"p@p8p0p(p p p@ppooooo oo ooo@oooooooxop oh@o`oPo@o8o0o(o oooonn@n@n nnn nnnnnnnnxnpnh n`@nXnPnHn@ n8@n0n(n nnnFGx`I0 JDEx80 9@O`PP8 ST:p`?H@67<>hXU0(X;Y=P@BARxQ`HMNCpH@0VWKhPL'&h`58(,-%pX)(04#P@.1(3`P/(2$*hP+(pP@ (  `P 0 pH0"pP@(!  pX(h@0h0 H|x8T(l@08L8HP@X`ph$hpd, XHlX\,L84HDTHxt,hh$OpenBSD: tokenizer.c,v 1.3 1997/03/14 05:13:07 millert Exp $xphphXH80 x$NetBSD: getrawpartition.c,v 1.1 1996/05/16 07:03:33 thorpej Exp $$NetBSD: getmaxpartitions.c,v 1.1 1996/05/16 07:03:31 thorpej Exp $)r8&@$^x$OpenBSD: tigetstr.c,v 1.1.1.1 1996/05/31 05:40:02 tholo Exp $$OpenBSD: tigetnum.c,v 1.1.1.1 1996/05/31 05:40:02 tholo Exp $$OpenBSD: tgoto.c,v 1.2 1996/06/16 08:56:56 tholo Exp $$OpenBSD: tgetstr.c,v 1.1.1.1 1996/05/31 05:40:02 tholo Exp $$OpenBSD: tgetnum.c,v 1.1.1.1 1996/05/31 05:40:02 tholo Exp $$OpenBSD: tgetflag.c,v 1.1.1.1 1996/05/31 05:40:02 tholo Exp $$OpenBSD: tgetent.c,v 1.3 1996/12/09 01:18:19 tholo Exp $$OpenBSD: reset_shell_mode.c,v 1.1.1.1 1996/05/31 05:40:02 tholo Exp $$OpenBSD: reset_prog_mode.c,v 1.1.1.1 1996/05/31 05:40:02 tholo Exp $$OpenBSD: findinfo.c,v 1.1.1.1 1996/05/31 05:40:02 tholo Exp $$OpenBSD: findcap.c,v 1.1.1.1 1996/05/31 05:40:02 tholo Exp $$OpenBSD: def_shell_mode.c,v 1.1.1.1 1996/05/31 05:40:02 tholo Exp $$OpenBSD: def_prog_mode.c,v 1.1.1.1 1996/05/31 05:40:02 tholo Exp $$OpenBSD: setupterm.c,v 1.2 1996/06/02 20:19:29 tholo Exp $$OpenBSD: getterm.c,v 1.13 1996/12/14 07:18:47 tholo Exp $$OpenBSD: fillcap.c,v 1.3 1996/12/16 16:53:41 deraadt Exp $$OpenBSD: del_curterm.c,v 1.2 1996/08/31 02:40:30 tholo Exp $$OpenBSD: captoinfo.c,v 1.2 1996/06/02 23:47:01 tholo Exp $$OpenBSD: tty_init.c,v 1.1.1.1 1996/05/31 05:40:02 tholo Exp $2Kn,X `%K$OpenBSD: tputs.c,v 1.3 1996/08/07 03:23:07 tholo Exp $5MS7) @$@?$OpenBSD: tparm.c,v 1.4 1997/03/28 00:39:08 tholo Exp $$OpenBSD: outc.c,v 1.1.1.1 1996/05/31 05:40:02 tholo Exp $$OpenBSD: globals.c,v 1.4 1996/12/09 01:18:17 tholo Exp $%O0O0P2^^^^h^8^]]]]h]@]\\\\x\P\(\[[[[h[8[ZZZZXZ0ZYYYYhY@YXXXXxXPX WWWWWXW0WVVVVpVHV UUUUUXU0UTTTTTXT0TSSSShS@SRRRRxRHR RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRQoXC0AAA@$OpenBSD: truncate.c,v 1.6 1997/04/26 08:50:13 tholo Exp $$OpenBSD: tcsetpgrp.c,v 1.2 1996/08/19 08:34:44 tholo Exp $$OpenBSD: tcgetpgrp.c,v 1.2 1996/08/19 08:34:40 tholo Exp $$OpenBSD: tcflush.c,v 1.2 1996/08/19 08:34:39 tholo Exp $$OpenBSD: cfsetspeed.c,v 1.2 1996/08/19 08:34:37 tholo Exp $$OpenBSD: cfsetospeed.c,v 1.2 1996/08/19 08:34:37 tholo Exp $$OpenBSD: cfsetispeed.c,v 1.2 1996/08/19 08:34:36 tholo Exp $$OpenBSD: cfmakeraw.c,v 1.2 1996/08/19 08:34:35 tholo Exp $$OpenBSD: cfgetospeed.c,v 1.2 1996/08/19 08:34:35 tholo Exp $$OpenBSD: cfgetispeed.c,v 1.2 1996/08/19 08:34:34 tholo Exp $`ǐphp?9gt>QNPaPkqj,jH6T7YqϑI 7RǤq)>Oq9NNL(Kɲ@KCS[kAFlF`F`Fx8۸$OpenBSD: vprintf.c,v 1.2 1996/08/19 08:33:13 tholo Exp $$OpenBSD: setbuffer.c,v 1.2 1996/08/19 08:33:05 tholo Exp $$OpenBSD: puts.c,v 1.2 1996/08/19 08:32:59 tholo Exp $$OpenBSD: fscanf.c,v 1.2 1996/08/19 08:32:45 tholo Exp $$OpenBSD: fputc.c,v 1.2 1996/08/19 08:32:42 tholo Exp $$OpenBSD: fgetc.c,v 1.2 1996/08/19 08:32:27 tholo Exp $ (P$OpenBSD: regexec.c,v 1.7 1997/04/30 05:51:10 tholo Exp $$OpenBSD: engine.c,v 1.4 1997/04/28 20:44:57 millert Exp $$OpenBSD: regerror.c,v 1.4 1997/04/28 20:44:59 millert Exp $`P0 pP@     pH8 $OpenBSD: regcomp.c,v 1.5 1997/04/30 05:51:09 tholo Exp $XxpxPH@8#########x#p#`#X #P #H #@ #8 #( # # # " """"""""""""""""x"p"h"`"X"P"HH "0!" ""#"$!%!&!'!(!)!*!+!x,!p-!`-!X.!H.!@/!8/!00!(1! 2!3!4!5!6 7 8 9 : ; < = > ? x@ `[ P\ @\ (] ^ ^__`{{|}p}h~`P$OpenBSD: ns_ntoa.c,v 1.4 1997/04/05 21:13:15 millert Exp $$OpenBSD: ns_addr.c,v 1.2 1996/08/19 08:29:30 tholo Exp $$OpenBSD: linkaddr.c,v 1.2 1996/08/19 08:29:27 tholo Exp $0123456789abcdef$OpenBSD: iso_addr.c,v 1.2 1996/08/19 08:29:23 tholo Exp $0123456789abcdef$OpenBSD: ipx_ntoa.c,v 1.2 1996/08/19 08:29:20 tholo Exp $xxxx.xx:xx:xx:xx:xx:xx.uuuuu$OpenBSD: ipx_addr.c,v 1.2 1996/08/19 08:29:18 tholo Exp $$OpenBSD: inet_makeaddr.c,v 1.3 1997/04/05 21:13:12 millert Exp $$OpenBSD: inet_lnaof.c,v 1.3 1997/04/05 21:13:11 millert Exp $$OpenBSD: getservbyname.c,v 1.2 1996/08/19 08:28:55 tholo Exp $$OpenBSD: getprotoname.c,v 1.2 1996/08/19 08:28:53 tholo Exp $$OpenBSD: getnetnamadr.c,v 1.7 1997/04/14 04:25:02 deraadt Exp $$OpenBSD: getnetbyname.c,v 1.4 1997/03/13 19:07:26 downsj Exp $$OpenBSD: getnetbyaddr.c,v 1.4 1997/04/05 21:13:06 millert Exp $$OpenBSD: setlocale.c,v 1.4 1996/09/15 09:31:14 tholo Exp $xhXP@CCCCCCC$OpenBSD: morecrypt.c,v 1.8 1997/03/30 20:24:47 deraadt Exp $:2*" <4,$ >6.&@80( 91)! ;3+# =5-% ?7/'91)! :2*" ;3+# <4,$?7/'>6.&=5-%      )4%/7(3-!0,1'8"5.*2$                                                                                                                                  @ @ @ @ @ $OpenBSD: crypt.c,v 1.10 1997/03/30 20:24:46 deraadt Exp $:2*" <4,$ >6.&@80( 91)! ;3+# =5-% ?7/'91)! :2*" ;3+# <4,$?7/'>6.&=5-%      )4%/7(3-!0,1'8"5.*2$                                                                                                                                  @ @ @ @ @ ./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz$OpenBSD: _warnx.c,v 1.3 1996/08/19 08:21:38 tholo Exp $$OpenBSD: _warn.c,v 1.3 1996/08/19 08:21:36 tholo Exp $$OpenBSD: _vwarnx.c,v 1.3 1996/08/19 08:21:35 tholo Exp $$OpenBSD: _sys_siglist.c,v 1.2 1996/08/19 08:21:27 tholo Exp $$OpenBSD: _errx.c,v 1.4 1996/08/19 08:21:21 tholo Exp $$OpenBSD: _err.c,v 1.4 1996/08/19 08:21:19 tholo Exp $$OpenBSD: valloc.c,v 1.2 1996/08/19 08:27:29 tholo Exp $$OpenBSD: utime.c,v 1.2 1996/08/19 08:27:24 tholo Exp $$OpenBSD: usleep.c,v 1.5 1997/04/25 04:20:42 tholo Exp $$OpenBSD: ttyname.c,v 1.3 1996/09/15 09:31:07 tholo Exp $/dev/$OpenBSD: times.c,v 1.2 1996/08/19 08:26:43 tholo Exp $$OpenBSD: signame.c,v 1.2 1996/08/19 08:26:11 tholo Exp $$OpenBSD: setmode.c,v 1.5 1997/03/07 02:15:18 millert Exp $$OpenBSD: setjmperr.c,v 1.2 1996/08/19 08:25:52 tholo Exp $$OpenBSD: sethostname.c,v 1.2 1996/08/19 08:25:48 tholo Exp $$OpenBSD: raise.c,v 1.2 1996/08/19 08:25:33 tholo Exp $$OpenBSD: pwcache.c,v 1.2 1996/08/19 08:25:29 tholo Exp $$OpenBSD: popen.c,v 1.4 1997/04/16 21:59:04 millert Exp $$OpenBSD: nlist.c,v 1.19| h  | l  < ( @  # ZP [ ZH ` _ _ _ ` b` c< bX g e< ex e i j` j jX op m| m m p< q q q v s s s u wh x w` 0 | |P |t lp`ppppp p@0pP 0p`$ X , P x   \ l (  0 X  ( 0   X ( x  d Ch = ? = = ? = 1B?? 1CPU@*U@*U@*U@*U@*U@ 1CDDD|DDD 1D0|@@x@@@ 1D8D@@@D8  @ 1E@@@@@@| 1E#aaq: 1E 1F`DddTLLD 1FDDD(( 1G@ 1G 1H  1H 1I 1Ip 1I 1JP 1J 1K0 1K 1L 1L 1L 1M` 1Mxx 1N@pp 1N?111` 1O @ 0`@ 1O 000>|? ?1 1P 1Pp 1P 1QP 1Q000` 3ff 1R0?ff`f>``f`? 1R8`DDE9  2 2 a 1S>wc`aaa?` 1S   1S 1T`0  0 1Tf`vvf` 1U@ 1U   1V  1V  1W` 00` 1Wp00000000 1W6? 1XP?a@ 0  1X @````@``@? 1Y0 !? 1Y ?1```@```0 1Z 00`gop``````p@? 1Z?`@@ 1Z000  000 1[` ``````p?```< 1[   1\@    1\`xx` 1]  1]`88` 1^9  1^p?0```g ollg`0? 1^ ? @@`@` 1_P````a`````````` 1_` `````` 0 @ 1`0a``````````````````@a 1`0@0@000?00000 0  1a0@0@000?000000x 1a` ````a`` `0`` 1a`````````````````````` 1b` 1b80 1c@acflxx|ngca`p 1cx00000000000 0  1d p`pppY`Y`Y`M`N`N`D`D` 1dp` p x X L F G C A@@@`0 1e ````````````` @0@ 1ep00`0`0`07000000x 1e `````````````0@8@# 1fPa````|ngca`p 1f0`` ` p<@`@`` 1g0F  1gp` ` ` ` ` ` ` ` ` ` p@? 1h`@000  1hf f f v w@3@7@;; 1hp` 0@8   @` 1i`p` 0@  1i?   ? 1j@ 1j``00  1k || || 1k1` 1l 1lp 1l0009 1mP ```gop````````p`xO 1m1 ````p@0 1n0`````1 ````````p9`p 1n0``````0` 1o   1o 1```1?`? `@ @ ? 1o0p00790000000y 1p` 1p 08 1q@````acf|x|ngc 1q 1r nf`f`f`f`f`f`f`p 1r'y0000000y 1s ````````p@8 1spq``````````@p```` 1s  ````````p`8```` 1tPs48000000x 1t00@8 0? 1u0  @ 1uy00000009` 1vp` 0@0@  1vpf f f 7@;@;@ 1vp@8  1w`` 0@0@  xp 1w`A8 p` 1x@ 1x 1y 8    8 1y >`6gC 1zUPUPUPUPUPUPUPUPUPUPUP 1zp 1z 1{P 1{ 1|0 1| 1} 1} 1} 1~` 1~ 1@ 1 1 1 1 1p 1 1P 1 10 1 1 1 1 1` 1 1@ 1 1 1 1 1p 1 1P7%dlhx90 1 000>|? ?1 10` w@;008.@` 1p` 0@ ?? 1 1`0 8 1`p`8A@a 1 1` @/@YYX X YY/@ @ 11?? 1@ @3 ` 1```` 1  1 @?@YY_[ [ Y9 @ 1?? 1p#aaq: 1 1P  1 10 1y00000009>`0000` 1>~~~> 1 1  1` 1 008? 1@f3 "D 188 `?@ 2dG 1 0pp0 0`013`2``A 18|L  `L};@ 2dG 1 000@9 1p ? @@`@` 1 ? @@`@` 1P ? @@`@` 1 3 ? @@`@` 10 ? @@`@` 1 ? @@`@` 1  @'&@>&FFF 1` `````` 0 @  10@0@000?00000 0  1`0@0@000?00000 0  10@0@000?00000 0  1@0@0@000?00000 0  1 1  1 1 1pa````````````````@a 1 3p` p x X L F G C A@@@`0 1P ````````````` @0@ 1 ````````````` @0@ 10 ````````````` @0@ 1 3 ````````````` @0@ 1 ````````````` @0@ 1``00`` 1`!!c`c`f`l`l`x`8@0@8o 1`p` ` ` ` ` ` ` ` ` ` p@? 1p` ` ` ` ` ` ` ` ` ` p@? 1@p` ` ` ` ` ` ` ` ` ` p@? 1p` ` ` ` ` ` ` ` ` ` p@? 1 p` 0@  1x00?00`0`0`0`0?00x 11136663104`6`w 1p0009 10009 1P0009 1 30009 100009 10009 16@&``?fffg`? 11 ````p@0  10``````0` 1`0``````0` 10``````0` 1@0``````0` 1 1  1 1 1p01 ``````p@8 1 3'y0000000y 1P ````````p@8 1 ````````p@8 10 ````````p@8 1 3 ````````p@8 1 ````````p@8 1 1!c`f`f`l`x@8 1`y00000009` 1y00000009` 1@y00000009` 1y00000009` 1 ` 0@0@  xp 1````oq``````````@p```` 1` 0@0@  xp 1p 1C8 1C 1D 1D 1D 1Eh 1E 1FH 1F 1G( 1G 1H 1Hx 1H 1IX 1I 1J8 1J 1K 1K 1K 1Lh 1L 1MH 1M 1N( 1N 1O 1Ox 1O 1PX 1P 1Q8 1Q 1R 1R 1R 1Sh 1S 1TH 1T 1U( 1U 1V 1Vx 1V 1WX 1W 1X8 1X 1Y 1Y 1Y 1Zh 1Z 1[H 1[ 1\( 1\ 1] 1]x 1] 1^X 1^ 1_8 1_ 1` 1` 1` 1ah 1a 1bH 1b 1c( 1c 1d 1dx 1d 1eX 1e 1f8 1f 1g 1g 1g 1hh 1h 1iH 1i 1j( 1j 1k 1kx 1k 1lX 1l 1m8 1m 1n 1n 1n 1oh 1o 1pH 1p 1q( 1q 1r 1rx 1r 1sX 1s 1t8 1t 1u 1u 1u 1vh 1v 1wH 1w 1x( 1x 1y 1yx 1y 1zX 1z 1{8 1{ 1| 1| 1| 1}h 1} 1~H 1~ 1( 1 1 1x 1 1X 1 18 1 1 1 1 1h 1 1H 1 1( 1 1 1x 1 1X 1 18 1 1 1 1 1h 1 1H 1 1( 1 1 1x 1 1X 1 18 1 1 1 1 1h 1 1H 1 1( 1 1 1x 1 1X 1 18 1 1 1 1 1h 1 1H 1 1( 1 1 1x 1 1X 1 18 1 1 1 1 1h 1 1H 1 1( 1 1 1x 1 1X 1 18 1 1 1 1 1h 1 1H 1 1( 1 1 1x 1 1X 1 18 1 1 1 1 1h 1 1H 1 1( 1 1 1x 1 1X 1 1234567890-=` qwertyuiop[]asdfghjkl;'\ zxcvbnm,./ !@#$%^&*()_+~ QWERTYUIOP{}ASDFGHJKL:"| ZXCVBNM<>? ( 8 8 Ҩ Ҡ Ҙ Ґ  ҈    d     @ d  0 x ̀ ͠ @ @ ߔ  L  N OD H a< a a  $ , t  Z ] ]X ] ] _ ^X  x         `    % (\ ) ) 4| :p *Hl t@ t t t t uQRtRUDT @ ΐ  ߔ  L 0  0$4(l(\ jh j j k _ _ _ ` { | } }( }0  s s s u x ̀  ͠ N OD O O a< m| m m p< 0 t    | |P |t l(T    X  x  z  11x1 x h P 8 (  p ` P @ 0  x h X H 0  ޭ @ @ @ @ ????OpenBSD2.1RAMDISK#15 @(#)OpenBSD 2.1 (RAMDISK) #15: Mon May 26 10:56:34 MDT 1997 deraadt@sun4c:/usr/src/sys/arch/sparc/compile/RAMDISK <