ELFa(4$e4 ( ##$$$AD<  B00 R@9Р -Li eh emain() returned`h   ),@@(LQ 0/Ddh -0L MR0 40 @, *0"Sp! "00# 0T!oR 0PS 0 $0S`F!0S 0 $*0Xb0 R2p'0S  0T!oR 0PSv 0 $0S`F!0S^ 0 $0SL "00# 0T!oR< 0PS1 0 $0S`F!0S 0 $ 0 R2h)p'0X0S]J082p'0S  0T!oR 0PS 0 $0S`F!0S 0 $0S "00# 0T!oR 0PS 0 $0S`F!0S 0 $082p'XZ0Sh  0T!oRZ 0PSO 0 $0S`F!0S7 0 $0(S"R$ 0 $0S "00# 0T!oR 0PS 0 $0S`F!0S 0 $XZ0  0b, 0Რ qR  0T!oR 0PS 0 $0S`F!0S 0 $0S "00# 0T!oRp 0PSe 0 $0S`F!0SM 0 $0S<  0T!oR. 0PS# 0 $0S`F!0S 0 $40Y:0 ,0 , 0\0 ,0 ,2 0'\~0 ,k0 ,Ta 0\:0 ,!0 , 2 0'\0 ,0 ,0 , 0\0 ,|0 ,eyr2 0'\J0 ,70 , _- 0\0 ,0 ,F2 0'\0 ,0 ,, 0\n0 ,R0 ,;H2 0'\ $00 -LMP 0* Qp  / 0p@ 0TGT`P0 T@ 0TPp0 T p-LMP@.. 4\8` #8$ 0 p Xp -LM0@!#P  0 (  -LMP@^ p0`  hV M p-LM@P U!! `  U 0 Rp 00p -LMP@\ p0  hp  -LM@`<6V #Xp V * 0 RP: 0Q@-@%Qʔ000SS !0Q  k\`!0Q <\00000$D$$ -LM`,0KPp0 0PA, $@00K=;0 0P&40K 0(0PT4 (pA Ƞ,Ƞ4 08 X4 ( T  , Z Y4(0 80 4X0 $40, T, $@(, 0T, 40T, $P ,0T `Z -L Mp`, 0 P1<@T  0R PU0 R X 0Z0R0S 400000 R Z$0X 0S P0S,0S 0S0@ , P -PLM,8  Z09c`<0 p10@ 0@@"  0 @4@0@0xP 1U] |_$0( 0$0R$ ( $0(0(0(P(00 T0 $@  0 tT0 $pJ0 W p 0 T0 $ 0T0 $08 R <0R~`f!! 0-LM@0 0 0PP$G0 $Q0=;0 0P .0 00(P" R 0)(09 PX QT00P 00< $(,0  R<0Z480!! !MhM$< ! -LM -LM`@]pW0 P  @0h04p @d0T\XT 4K0 , (P 郇PP ' affNNN@  -SLMp`@P P0  F0@(K 0( 0,`0 0f`fffP0 R D0 R80 P $00sQffff p-LM P\@`' 0T 0T 0T0 T pp 00ph0Td0\0TT0TP05:H0T @0HPEWFW@@W@DW@HW@AW@CWBWGWJW S 00p000 d`p 0 00  (000C0 "!8"!h"! -LM0P10#0@8PZ 0ha0 0000 H1 ,0<1@hVYX`h"!hh0 -LM0p ` P_h0ST  0 PE0 @ @00$00$0 00/A#bJi6 9 i* 2 0 P(0 0S  0 vPh ,k000i? ?Mb$ -LM0` @2c1RP,p 00 HP 00 0 (0000  MdW 0 p-LM(0 @ 0P<0(0`0@000+  00    0  0 0 0Spho៛000000 00 00 -LMh0 80 PD1< p4 4PKR0 P8_P&0KP<@40K&l P, /K3K2K1`K.K 0 !0 0 08 0< 0 0'0 ,0S ,\ g"! M-L@M0 0@ 8H0 H `"(D %! %8X @68P0 < PL X%LDd ` d\ , \H &t4K`&4p"l PT0 8pK7K6K5K3PK2`K1K< 80K  @0Kh 1h  @ 0 0 0 0 0\ 0 0 0` 0< 0'0 ,0S ,ˠ g"! p-LMP0K`Pc @_ "0  0'p0@- @ 0S  4000$0 0$0$@@ p-0@LMP 000nP0P0C& R` 00#!000 x0C& p 0 "!0L 0 RV` p`h@hfhh0 - L00a P@>1p  $00$0 R 0$ 0 00  0@ Fp00C& R 00#!000 l0C& d 0 "!0@ 0 Rht\@h`hfhh0 -LM4@0S @440S -L M$X @R0  l0@ $@4 h."!"! - L - L6uP@۩0 0Q0p0P0`0C& R@P 00#!x000 d0C& \ 0 "!08 0 Rf@h`hhh0 p-0LM 0@00 `R0P00 00C& R 00#!|000 h0C& ` 0 "!0< 0 Rphu`h@hhh0 0-0 L@ 0T00 0P @TP 00C\ 0  "!x0 00 d0C& \ 0 "!08 0 R0``hf@hhh0 -L M`P@P 0T@{/0P T0T $020 T1 N0W $5 0T@8 0TPP!0` Tb 0T@c 0T0 $  pq/0 T$0W $00W T 0T@ 0T 0T0 $G -LM@(0SID 0S p0S`/ 000!PU ”(0S0 L/ 0S3' 0 `0 @0(0X0C0 hp0 0”(0S 0  00(0  0 <(t'! p-LM`@PPU@Zp -LM0PS`V 0  ;0 @@ pa0 0$# p0  00@ 01`Qw  Ru 0A?00 $0 0<<00 1•(0ST000( RB1@7 X!0L T10 $ q/0 T 0 T0 $ 1 0 $0 T0 0 `0 @0( 0  0,0(• 垷'! -LM0p $P` `V00P00S0b XR$0@c $\0@1D 0@fF(@ 0@#h $'! -L4MDpK@ 0 T0qS u1S MS< 6S 0 $  .0 $  q/0 T0? $0@ XR$@ 0 [80| !S0d $X 0 [800 QSK ASaS1S$0 $@TT ոK0 $`1PU ˜(0S,0S AUl T0 1"   0 `0 @0(bp0 $020 TX0 [80 匸0= $0`> $0PQ $0@d $`P@ 0 L f0< $0` $0P> $0= @$@B0@e $`P 0 H40 $0p $0` $0P $0@ $p`P 0 @0 $0@ $@  0 $0` $߷& }? " : 0T Sp S S0 $ 1 d 0 $U0 $0<<0 TE $0d@T0 $00 TTQL p{0 $@T ˜(0S 0,00[ *#4 0 `0 @0(0 $"0 $P@@? 0T0 TS4X0 [80P10 $@T ˜(0S0  p0C!A 1SAB0 ?0  0 `0 @0(0 $0@? $@AP`U ˜(0Ss@ 1V @T0 1 Ͷ0 0< $@$" 40 庶40S @TO: 0 0   ,0,1 1r 0 $@PP0 T 0T@0 TT0 $000 T0 $000 T,!00,, X40@T: 0 `0 @0(hS >S 0 $0@Q $0@ 0 T, %H,(!4(!(!(!(!H)!)!)!)!)!$ *!8*!@*!H*!|*!*!*!*!+!P+!+!+!,!(,!L,!,!$@KLCF,!,!SXP0= $0`> $0PQ $0@d $`P@ 0 ۵0< $0P $0`> $0= @$@B0pe $0@d $P` 0 @衵0 $0` $0p $0P $0@ $`pP @0 xs0 $0@ $@  `@$2XY0? $0@ XR$@ 0 [800AlQ 0T0 $P1`V ˜ P(0S @ 0  ,0,P10 X 0S SX "SD08 1X1  ,H ,P0$0 b!1317!10A0  0H0 R0 ? R2000 $(0Sk #>#[ 000 @  00 0000˜(0S%0 04 0@0Q T0y|0 5h 5 5,!lh ߓ0 $, b!1317! b00" 0(˜(0S (0  $0 (˜(0S 0 $0 (H0  !_4  cP @0() L -LM1`A p0 $P1U &0 $@1@T –(0ST 0< $1  j @/ 0 $ X 0  0T0 $0 20T0 $@00 T 0T0? $0= $0@> $!p00 #RAp ApBp@|K  0p@_ZF X@ 0 0@ @Y 0@ @?0@pPp1Z PUZ |Kf0b $0@c $@D1 f 0TXY 0A P  2(0 Q000 0 0`8\\(\ ; 0 0 P  0 P   |K0p@7|K  0 P  |0p1X! ,0 001 0 P |K 0@  0 PA  |K 0 @A0Tq0 $@00 T 0T@0 T0@ $ p 0T0 $@1PU –(0SU `PK i0@,@5 jX 0d{[! 0 `0 @0(0? $0 p $0 P $@@ 0@ T0 $`U@ULt 1\  R! 0XP@ 0 @w :00 $T 4 1  PU 1S3   D@Kp 0T0 $  q/0 T0: T0c $0@b $ @0D  0ӱ1  0  h2徱x廱p帱h嵱0 u00= $1Xp00C2 報tX  ᛱ Y 0 $00#0 T  L0 $1@!@ Xw 0TT@@   0 `0 @0(BX[N0 $00#0 T0 $AZPAB0 $p0 $1B1-!$P-!x-!0#!4#!<#!\#!p#!#!#!$!$!($!H$!l$!$!$!c"J#$!$! -LM 0X!00<6 -1LSP `p0b $0@c $@@ Q! *0S*0S* Q : Q` }WxVp% 1 q/0 T $0 0T@ 0T0 $@0 T0 $1  00 T 0T 0@0` T`V0  T@0 T8 0` TXY9Y-!-! -LM@0 T0 $p0 T0 $ 0T0 $ p-L MP` 0@@ T l40S @T:p,!00,, (40@T:-!-!.! .!|*! - BR0 01XAxA0X1LS S+ fPp T /,|0A_L P@`  `V@PZ0Xq/X 媭2@.! -LM`P@p!W 0   0S00\3Q 0Q%05  0i0 $0000 $0 0@-@ 0000 00#0P00S 0S(  P\ 0S 0R 0SR 0S 1 0S 0000P00000 D$l0 pR  \ 0S  Q 0S0p0QD$R 1 0S  0R !Q 0S0 0S0  R  100Q0R  0S0 0@- PU#>@'  0R # 000#>T0 0R 0P 0QU # 00PRQ 100000 -LM  R  `Y,0 4 , 0 p0 1X  \,  00,   0  5 ,SR Q. 14 M Y@ 0 @@@@0P/@,  0̠0 @0@#+X `\ 0X L2 0\4 rX  0 T1 0 T 0Y00@ 0 0 000 p0@@00S 0 $@0 0 00 T0#!p.!t.!.!2 -L M  X1p\P`  0 `R00S 0V00P0` 0̠@@*0X 6T妭 0y0 T.! p-L M@PK` %S*0 ̠Pb*p -L MPpU`3 @K M@01X4 3[1   p   @0 #.[ @@   B( R PUW0 $q 0 $<2p W0 TZ0 $ q/0 T0 T0 $PpU' B@0( R'U  0P$ @0 00 T0 T@0 T0 Wđ  l ( 0 T0 $ 1y 0 $r  n(Y2M -L M0@p $1,00  $0= `$0P> $p00#"A AB01  0< $0 1$ HR10QP:<$-B\ 00  0020 -LMX@ 0 @$/! 0-LM0  p0 CBPP0,BA ? 1SAࠣB࠳ 0P0 -LM1@   0 T0$ p-0LM 220@P`3   }/ 00 0 D̫0 $00 T0 $00 T 0000!2p0: $P( 0  0 22  002 2}/ }/0 2 H0 1 |' A0 ” @? 0}? "0  0}?#   0}?  "`O0 PJ0: $0 0?/!0#!4#!0/!H/!/!/! -LM0 1`X \ 0$0 \, 0$ K(0 0(0 (0Kt 0, SQ< (0 @S@  0^S  1pW@T  0T,0  ,0KpT ($ ,0M$ ,0  & $0RA-@ p`@SPE }}ό}}O}op  MPrP 0 Ѝp@-P b@}00}ό}}OP`0M0 bR ЍpG-M@P`p S}ό@PE `p}}O}_}o} 080}0< } 0 2Ѝ -LM01 22@ $ @00: T0W $00W TT -L M@K@0 $PU ”(0S0< $0p $0? $`PhV`  0@,0F 0 00UPPU A X0A ߩ0 $00 T: 0TV 0 0<0 o庩 }? b 0 $0 g0 b圩|ed唩_P፩` 0 `0 @0(j/!0!D0!t0!0!0!0! -L M8pKP0 $@10CSl, "R e T T  @0T4 !Q 0T40S.Q% 0BQ @ 0T•@ }/0… TQ 0T @0T2 " @0T@ 0T 0T`T`V 0T2`3 R 2S 2S01v0 B$@LP2@02 2bST|  0T0 $ $00#20# `$00 T0 B$@LP@p 2P02 V;0 $000 } 2pSr 0 T0 $000 T01r5 2S^ 0 $ 2S " 2R 0 $@000 0 $00 T !0T@02 $0@1!L1!l1!E- bPU@p*}?0^ 0CSW^ UP:2SPH0H 0SWZ 2SP2SP -L\M 0!XQp00,`@L@ #Po$T$$$TT<LTTTTTTTTTTTTTTTTTTTTTTTTTT$@Y00T00S0 2P40S`0 US }? @" 4 RP/ 4P @0 P, K00K, @4 P@  40KP]40` ,0 ` 06P@ 40P R`0L0 @L0S , 40 gB` R3 RPp3h#P00#X#X0 P00S 0H H0 0DP D0 H0\D @ < \ X0 0< K"@ KD0K\@< H0K@` 0P( <\  RH0X R 0L <0 D0 @0 H0 @0@HD @0 @4D0U0@SX  0X  0嶦<DP@ H0B BP<B`1T ZPH!0@8 K8@  ` 0P- 8T 0P8 0PLT \00 7 @B B=< 0XgT0 L 80 T8 † †T "T @ L 1!1!1! -LM0P $0Z,0  •(0S0 1@X S |$ 0 P@ 0@00 @B B0,0 B, 0P` X 0` 0` 0S B B,`  0P@| 0 `q Vb LŸHB"VX 0 @4@ɥ 4@0 $000 T0: T101 R 00000<00 0: !p0C!A  1SA B 0@?0 @[ kX 0k #@X 0 _W 0 ``X 0H 0 `0 @0(2!\2!d2!t2!2!3!<3! -LM0` $pW –(0S0< $   0; S 0 $ 0 $0 $@ $00 @D$00 H$0P $@ $00 @D$00 H$0 $ $0 $ $0,0l0 Q$ 4R*A 0`$00 T@(40 TP(80 T(< T@0 T*40 T@*80 T*< T0 $ 00#0 T/ 0 `0 @0( -LM0` $PU –(0S0 $@ $00 LH$00 D$00 000b,P00 P$@ $0@0 HD$E0 4 phP'< T@'80 TP'40 T0 T@( 0TP(4p 0TP0 T1  0 T@0 T0 T0 $@@0 TP00 T0 T 0 `0 @0(8 -LM` P 0PP p@ 0@h0 @pp@U0  p 0 S00Z00S  X0"3! 0-1   q?L@  q?Pl0U E 0 ZPE. 90$q? p-LM1P< S a@T PA1v1!APH20H2pA0v1 P1  `@T LL 0S AT 0R0S171!'001! 01t$(0 P PPt$\ 0-@XPPLXR0Z p-LMH2`S *^@@PXP@tZPUZXP PphhZfZcZ2 $" 28"8–4" 0 0-PL 0T@ 0T 0T @ 0@TYT0 -`"L@0  T0 $ 110Sv 0 $X"0@0 TpOD@T [ 0$ !0 T0 $1  Q= 6Q ϡ10 TXT0 $P@00 T0  TP@0 TQ10110X吡0 $@00 T0 $@P0 Th0 $\3!3! -L`p@P 0T0 T0 $P 0T0 $pW -!0P` p@pVLB 0B 0T@0F0 T 0T0 @TT60 T1# `0 T 0T@ 0T 0T`0 V 0T` 0@TTM -LMpH W Pe ! AA0 RU ˇ<"XbAANTB^A>@P@ P`P<ˇ  <"XbB>CNC 0@]@ P`fP" 0-0 0 壋o0 R 0S 00^0SX@M X0H 7M 4!N84!LH4!4! p-L MP`U5 0SlDHDT 0H4 0XHDTC,$ 4@ĕLvA$4$ĕlPpphWN -L$M⨠0SĚ1c  qVP <"XbP@P 0@ P`PBH4 01,  H b,R ^0 P@`0,P$00(<2,˜0 0 0,  P\L00 ,0P  0  0p 8p000 oWL4! -LM`0p1 !ṟB!P0 0> 0@e 0 P@嚟#1P e0 m錟| 0ep 僟H 0X  `AD u|$x-!0#!4!4!4!4!4!4!M4!4!5! -LMp< 0T@W 0T!1#5P '0 T0Z $&.0800 T1b 0T@ 0TP2@T1 `@@K?TPUP 1 PU—\(0S+P 1 PU1 0d0D T@&40E TP&80F T&<G T$b@0H T&40I TP&80J T@&O_@ PpPhOH2!0H2 $2?*0!@2 12`V 1:11H"< 14H" RP(4A P 1 |4B P < 0T@W 0T44 R1155Ã110Z $@  @01 0 X~1<1340 00 , , `p3V 1P3 1XQ!  L 㖇1 1 003 , 4`?V"00?"T0 $86#(pD 0S8 0p $00Z00Sp   Z000S1   0S0 1000 0! 0000 p0#2p p0@S00 S   R0000000 p0 03 $0@2 $@D@@4@ B 01 $0@0 $@D@0@ .0[ $@ 1 01X,啛 <5!MH5!D$2j5! 0-L0P@ $`q 00T 0 00 00T0 0-1L6@_1!0 T0 $ 1V0 $00 T0 $5 PU! P-  0 $  }pq/0 T0 $PU 0 $h16101 0 $0 $5! 0-@L}P U00$   0q0T -LM@24 p-LM`!40 P 0$?0@ T0%$  $@P0 PTp0 $P -`p!L 0  0$P?0 T@'$  0TP0 T -LM1`p! 0   0$@?0 TP'$  0T@0 Tp@-Q@P`/ 0p0C#A  1SA B \00 R P?  t00^P u00UP  V00Vpp -LM!0p0C#0?A  1SA B  0@@  -LMp@P 0  B 01PU b@0( R 1 @PL 00L TĞ  l ( -QLMpP9 @  @0 B( R,` 0B( R    @0 B( R  n(  ,(  n(0T 0-1L@ @ 0$ P 0T,0e00M $P -LMP 40 6, 0 @ 0 $  0T0S p8 1000 6 09 TZ/ !01`V •(0S^@VU 40, 00PC 0S? *0,0S ,0 0 v 0pW1@ %0 T0SYU 4 RQ ! 01@T •(0ST  0p!00`@ 嶈0 0$# 9 0000`01@p0 00T3  B01@T b(0S0  0 $0@ $pW2  0T0 $3` Rs1@T^ •(0S`TX 00400, 00PC \? ,:\$ W 0 T400 , 0S100CS0  p 0,0S 0,00   Η0 $ |xÕ 0 `0 @0(D屗8 0 `0@0(O 0 ᜗ 0 `0 @0( 0L 冗8 8@ 1 |zx 0 `0 @0(0M $jL5!6!,6!D6!,!6!6!6!6! 7! -LM 0\, 00 p!!000 4 40z0 00 BS0YiPU `@ P UY \100CS0 40 0  00P , R 0R4 0S4 :S <R00000 0  0,0S0,0 -LM@PA , 00 $ Rp4 cW6 0 T0 $1 QW*W[ 1@T b(0S90000@,  0P$ R  Gp0SW^ 4 0 T0 $p0 $p 0 `0@0(0 $4 $^>^ ZL7!,!\7! -`L0 P0 T0 $ 0@TUp0 T@ 0TA 0T -LM@0 T1B 0$00 T0 $00B T -LM0p`@ $@P0 T0 $ 0@TVP0@  0 T@ 0T0 TT0 $00 T -L,Mp 00 , 0000 $@ @P,  004@  PW zD 8P <  ,08 BS8 8  < 00s0 @  0S= 8< \-@` V$8 2@T R@0( RT ,0 0P` V8 <0 R8 @ , 00 @@5 08 \"0S<PU" 00 @ P0  ,0P D0 0D0 0,0S ,0   U4 0 T100CS0 D֔8 0 T0 $180@Q080  b@0( R0X0T00ST ,0 0P  08 RĞ  l ( ^đ  l (D1@ @"M7! 0-0@L $00 T0 $P00 T0 $㥮P0 T0 $0 00 T0 -0LTM0d0 d0DKp P#0 T0 $ 1 [0 $1PA@ A@B@0T $d0`T 0% T0 $ 0 TWf@20 T0 Tl @0 d @0h 1 0[0@ 1X!R Zl0S $h0 $ q/0 T``pK@Pd  0@I 0P` 0@0 P V0 $ 0 TW 20 T0l0 0 $< -L0 0$ 0 00b,0 0R$0S4 ( )7! -2L$M@< A00 c c c` P@ D  F~ DB~10`KS 000KL"?00[R 0@B/0KA1*K+K40 , K-K.K8` ` 0Tb 0T@c 0xTp@4K 80KWP@7T:Va a IP@ @ ` 0T<T2W) Z 0 !S!R Z0 KSpD1@SpD!`X0 R1S@ 1p !X 僒< 傐O#$D*$7!8! -頠@L TpP`*0;#;R @U3#P0@#5;#;00 ""A T*0;#;U D*$ -2LM1(pK0')[1`8 V񟗐||||||2[0[%[1X00 4 @* 0K 40K4Q@Q0d0d@T: Ph&;#;(( 08   20#0V00S  0SE023000 ,0  R0<<00a 00dY  0Ǡ0 +0$0,0 \ 0X Ǡ0 +0$ 00X宏嬏4$#$88!P8! -ML M0S1, P(KP`p@ 0R^*BKNN|!00 ‘V@ PU *A00 R0  PU:Z040$hh  Y0000[,0 S ,rS 0Z00h 冑@0U*Z0hH x00<1Y0000*P g|8!tM!6#!8!8!8!8!V! -LM0p $  0 $0 ? 0 $Xb0Pb $0@c $@D 0Y0d $0`e $0Pf $0@R $P@` 0  徐0 $0@ $@  嫐1P ,P ,K40 $2@ 0d-@0 $ 0(-@0 $ 0,@0? $ ?0,@0 $ 0t,@0 $ 08,@0 $ 0+@0` $ `0+@0< $ <0+@r0 $ 0H+@b0 $ 0 +@R0 $ 0*@B0 $ 0*@20 $ 0X*@"0 $ 0*@0 $ 0)@0 $ 0)@0 $ 0h)@,0S L P0o $0@o $@D kPUZ 8d 0_09 $US1@ 0 $ @ 0Th8PT 1X90@T@3<10@ $@T P0 T0 $  0 $@T0P Sڌ0A $@T P0 T0 $  0 $@T0P Sَ—(0SPӎ6@0S PɎ @0 SP Rh彎x廎0B $@T P0 T 姎0 $@T0P S嘎喎0%PUP<@0 T兎0 $ 0|%@0 $ 0@%@0 $ 0%@0 $ $0@4P Uh=;@PT,  Uh<P'0/0@$00$0y0#0o1 e\ @T0P@T  UhP0@TH `0S' X`ڸ!1<4ߍ00 TY 0 $ q/0 T@PT  UXP0嶍@T8屍0T\姍0 $ 0"0 $ !0免v0  0 <(0M $@18q0 $@@,K2P!0@]w8!0 T0 $ 19 0 $28!9!P9!l9!x9!9!9!9!9!9!9!9!9!9!9!9!9!9!9!:! :!:!L#L :!4:!L:!`:!E!V!t:!:!:!:!:!:!M:!;!;!;!$;!,;!<;!T;!;!;!;!!;!;! -LM 0p`00* pP,P@0 d90 00 04P@0` &0  0 P@0` 0 0pP@0` 0 ,鶌᳌V V 0  0V 8  0@00   p9  0 00•(0S0S 0  00 ` 0 011p0C!00 0`0<0 Ri 0@*X0 0C\ 0  "!`0 00 L8C& D 0 "!0 (0 RNP-0 7G0 0C\ 0  "!0 00 7C& x 0 "!0T'0 R0  0; 0  01`&0 T0 $ 1f1Z 0S T0 $ A 0p 0  f/0S" &F0 0C\ 0  "!0 00 5C&  0 "!0]D@K  H0@@ 00f?@q/0 T 0 T0 $0@ @pw0 0$# p0  00@ 01`Qe  Rc 0`D?00 $0 0<<00 1•(0SB000( R01@' #0L T1WN#0 T0 $ 1 0 $0 ~0 0 `0 @0( 0  0,0(• 2 2hBa6fY0  $0 (CWq0 1   0Ÿ  0`2 @000! 0  91Qh9f@00C\ 0  "!0 00 1C&  0 "!0\!0 R)(! 00C\ 0  "!0 00 0C&  0 "!0 0 Rwu2 $(0  $0 (k  $0 ([00 p0pc@h`h26hh0=!'!$Mb 0-@QLP ㅠ0 $@TX &0T 0(=! -LM0X(,0P @ R`0 R* 9v000$^ –0  00 P 0 0, 0ε ( ,  v q0,0 0000 10  0P 000! 0  91dQh1e00C\ 0  "!(0 00 1C&  0 "!0 0 R. 00C\ 0  "!0 00 |0C& t 0 "!0P 0 R000Fki@h`hhh0 -LM0   00@T hd @T -LM Ч 0' `p0P000  p0C!A 1SAB0 ? 0 0H0? $40S,  @T:0A/-–(0S0 $0  4 $0< @ $|6 T*1@T –(0STT 0 嚶08464τ0 00&0 S 06h! d0 $ ( Ep00C\ 0  "!0 00 5C&  0 "!0\%0 R阛q/0 T0  !p0C!A  1SA B 0 @?0@ : 0T, @0 T0 PO000 4hc0 $ ' Cp00C\ 0  "!0 00 3C&  0 "!0|#0 R !q/0 T 0 `0 @0(&–(0S0 ,0S 0 ${0@  00 @P0 堵0 t׃ 0,0 X0 H˃o 000 0  00 @ @1$ 1p0C0! ?0@ @0 ^嘃4 0 T? 0 T0 $000 TXq0  $0 (g0 $0 ([, 0 4xT40@T:FX\LTM@h`hH=!LV!`=!h=!$Mbhh0|=!=!0!=!=!=!>!\>!08XR 00 R Ѽ0006 -L⸢DM 2X  @DK  `D01XQ 8 ?O[q1   0#[000  0H H K0H @R H0 0@0T@ L0 L@ T H0SP P0 ? [ 1 P0P LKP K0`@HPT0K @T^P PL \ 0S0ȅ0ȅPT L0@  @X0@0X 00C\ 0  "!0 00 0C& | 0 "!0X 0 R|<0[  000x@h`h6hh0j 0-!LM0@: 1 _”(0Sc1 QPT BU<  1}Sڰ1!;0100 $@1P01 1 00 $q01 0T0 $@0 $P$0 0 ( -L,M1`  0H0 P 00L < D @ q80 03K03K03K02KPK02K02KPP > ".B 0PU80S080 U 0T0 $AP@  0T@ 0TU' o1  R U 0 200e" 00 $  101R9pQ0 $DP0 $PP0 $TPTp 0Pp $0qP@ $@T0D@YT0  P1P31PPd h -LM2&P`, Y p 0 p@191 Wp W1@ 87#,00,0 1  @0 8#0S 1| 000p T0   0 0 pT W$0!000!@<#41" @@@@<1"1711 1 203 S%S( 0Z T, @002 T, P"403 T0 0 T@)401 Tl2@ l"20@ 0"  0 8 #q2g -L,M0L0 00PSp` @0  0T!!  J, 0 4 8 s i @KD K<0KH@ !0H0 1@ @@W@\T HPO DQA Q P 00S @0L0 00S,0S L 0 000L0 040 S0000T80SL 00L0 LU0S 0 T1 \X0!@@ H@ D@ DH! p-LMP@`60 @ 0p -L@`Pp 3,0# /00   30#00  -LMP@` p $P000 T 0TP0 T0 $ 3 0#00 $  p-LM1@ U0SJ  0T_PU 0aS5 0 $30QS 0 $0S 0Tp 0\p0 ,0 , 1\0 $ - LR0 0T \ -1L0SPp< 1``0 T0 $p@`0 T $1@``0 T $1``0 T> `BR` 0-1L0SP 1 00 T0 $ $@ 0T@0> 0BR 0 0 Q\ # 8#8SR0SS00000 R0 0  0S Q0000S0 -L M8`,0K(pKP00*p` ` ,@T D=.8  ,  4@T <08@0 0`  @TP = 8<D P@ T}>!?!P?!?! -3bLM@1`p5iWHPfPy  p!0W@O Y}?! -1aLp P @ @H0H S1H0yyH@1S!( @p00C& R 00#!x000 d0C& \ 0 "!08 0 RhbX`h@hhh001 p-L M8`@1~0 0 02  P@ U |pp?! -010qLM @ `HHPH0U .P"V@00C\ 0  "!0 00 0C&  0 "!0l 0 R鬓Q1101!101`h@h @!hh0 0-1@h0PL 0[01P 0yτ1@0hv -PPLU` p1Ah0f P h@\111T01 0 PPU[ X0 Ba[1h@01 $[h[[$vMb@x -L,Ma@pTP 80K4K0* H0,P K008 ` H04P @ :H<0K0 0 P@ <H0P {<H 8  0 X{H 8  0 {{ e@!L@!@!@! p-LMP40,PY m) H`#0S00Ņ H $180mP00p{T T {{`{0Smmnmmnnnnn nnnnnnnn$ndk{\XTP0 ]{,\yHy@!@! A!4A!XA!dA!xA!A!A!A!A! 0-L@0PHPSnnpoxo 0,0!}> 1!DC!@h`hV!PC!hh0 0-0@LP  0 101NP0P0C& R 00#!p000 \0C& T 0 "!00 0 R00h餏`h@hhh0 -LM`8@QhpX$0S (0S    $0 ($16 0S $S 0,0 000iA 0S0(0,00 R 0S $00bS 9 S 0S0Sq4 mh06xivIhC!P 0S P0S -PLMH`pp `W2SQ 2SH 2S 2S8i x P ix1"2w•!0?0c0@lT0`@0f 00 @? @?0`606|p0tPd X^`0aiW  . .<D!D!*$D!gfff2$ p-LMb0P  B  0  0 }2 SK}}}}}x}x}}}~  0 0 2 020 2 020  0 0 0 0 2S p 0 Bw 0  02~ 020@ 00   0 @ 0 0 0 ,( wm w] eD!E! 0-P0LLvH0@  < 80@ 00v,E! ebE! -"LM0`, lB^ /@Ts 0@0\ -@  0,0  3ȠZ p\ pp0 , @P\  p0,PU@ZpZYx122 2S  R10 R9!   ? Y @,0S / 00   0 00 o/`v ? o00@@b 0Y @0ZP0 HLk00l? :vc e eE!DE! eTE! -LM0` Pp#0嬀0  4 ? 0 6\6,6/@#b  VU2 S  00 0@ pX&?@BcddP@@] 2W[2SSQ H0   00t 2[ @/0, , […20+ [0@42 S1 D0 (D%00 %0 5>  0 ,0K0./00$u$u0* [2 S0 2 S@ / ğ0 A 4 0A$XuIpP@ 2p@0p@W 0 ,=#=,0@ J002#10T00S` , , [0…+ [0@>2 S; ß0 ` 1B00 W "0 @00  90 0e"t0 =00 L`"t8P"t0* [2 S0  ET !0 C cC!tt0W !0 @00T1  F JLFp!t$0 B ? BH!t4@0 00 =<.#=<0S 0 0D@20  0  0 ph rtL @ ?Ac\IJ@/0`0 @`t@ e@BMb$E!qnvhE!WtE! 0- @P0 00L kP0P0C& R 00#!t000 `0C& X 0 "!04 0 R00h`h@h ehh0 p-,1LM Ra 1@ 0 00yj@0@0C& RP 00#!000 0C&  0 "!0t 0 RUL  _ D S 0 0 0pȊ g@h e`hhh0 -LMs `0@ P0U3p fP`u P@m 0 0] 0 0 0D @ S 3H `00000 @@ 0/0 00S= r`00C\ 0  "!0 00 t2C& l 0 "!0H"0 R P P <  /Xc0@0 < $0D0 7*P` |^x1T 0L1  000 R  0 00U` 0'A00C\ 0  "!0 00 0C&  0 "!0 0 RD BT1 `T21 P2-0 @0r 4r0 e@h`hhh0gE!E! -pL0@`P#U0P0? R PU08 r r eE!E! -L M, t0, ?Q,0堀Xn , 0p3`0 0  @ 00  ! 0 3 00W01 P/PP 30 Q   R R8 0S0  0S0 - 4<#0 0C\ 0 !3 0"C600" 00#!2  QX0QI \u P!0 S P P] 0  0J "0 0C\ 0 !1 0!C600! 00#!1  Q+ R 0S0000P0R00S(0 4qQ,0000 , 00 0, 娀o[ꖈ 0S Pږ 0S (PP |5]0O R  0 00WP 01 P8`q0ao e@h`hghh0E!F!F! -LMP1 `@ #pᬀ/PⴠF\ / 0 20 4 < 0/@0D  0Z00 1 P /0PS0000@0T 0 S00@@@ 0 0 0/0S ozop e@F! -LM@P `p0ᴠ3Z㬀 1 P /!0iSPH0(S\ ,0S H0X0 0@0E 0,0000\1  (Q6,Q488pN0U ,0S  ]000o酠0SPZ 1  R 0 0 0 (0 S 00ppH0>0SD0(0D0(0o%00C0 $op,kp eTF!4##dF!pF!F! -0p L@0P3U`" 0S000I0S J0 R0 0C 0 0 0R 00000 0 T1 0S 0-@P0Lp d d`0@@ 2SS 00h] pp0 eF!E! -LMQ@r Q"2p\02` S- PU 2@a "0 ,1X((o0 2PU:o2o2PU:0PU`PU0  0  0Pu0PUm e>"F!F!  0"2om .mQ20) "=  0@00 0 0 00 |=  0` `-mL P-mH <-m0? R••A Q$ Q Q0S00Q0  ?0S aSM  m0A :t<  0P0 @0 0 ? R 0 <  00 ;  0 0"00 +^m +Ym +Tm +Om02 R t Dm = 0S• 03଀"QthܭPܰܰܰ0 2S 0 " 0D (  ? u0 庞, al02 l0 j0Su S# 0 奞 l0 9  0l0 @0 E\ i.lX i.l0 \ l2 R00 000.0@00 0@" `(?@Bcd@["P@@! 2V2SS   0 0 0 0D@20 Q,  0 0 0 2S 0S  |R0 r0xG Pl0 00e0 000X Q07  00 @0 0 000 0 @" `&?@BcdZ"P@@! 2V2SS   0 0y 0 0D@2(&k&k000Z04 Z2080 %@4?Abc f 8 ADnZ0P` f8eZ0e 4 \k0002 R? շ0 ȵS00ȅ0$000 4  ,00 @0 0[p$kl$k4ğ0 k•x{k•0 2<0"D Lok0 <02D "$dk0  000"?R 0< 0Rk0XC 30@Sy S0 ,3  00 @0 X#.k D#)k0SB  S0 k0 3 ,2@@ _0@00 0Q1 P/I0S J0 R0 0C 0 0I J 0gD"j<j00 j000   0 00 j0 0 1jq0 8 j50  xj0 '  dj" R =Q<U0Z? j00 S R00R00S 2}joyjR eG!G!H!E!G!4H!hH!H!H!H!I!MbI!Ra I!o  00 +>D  0/00CS5мd0,0 P03@P 0S R0S  R 0 0 0 P00S1  ? 0/00CS񟗫T  gm娀  ? <Rx+t;/ 2 S? wPPfP2Sa2  0VCUG *0<<00 9;  0? AR#4@K2U00*0S00 =)C40 -B040 0 0 R<K< 40R  80S 0 1gN ))g2 2S*0<<0 gB0 P@g  g0F0 0S0 0 0 000f f0S_X  0嚠 P 3@Z $$0  9 082< ?"D  ?X  Q RBT pT[0@U0. 2 S' 7  8  08    8  0026'f.f9S @H  2 Q rC 0jf 0 af^f T J0@ B Of6TT  {T0@q jH7  0–,0K P, , 0+.0B 0< 00, [+ [0@12 S. 0 &F00 @5   ,\Ql%e,0SgoS0  0%e0* [2 S0 $ee00@0 $4  x<5  02X @$0K#/†0./00( [' [0@+2 S( 0  D00 83  o00 002BD#oe4#je0& [2 S0 @ /0 3  0t"Ee`"@e/@ ;eq0@$2S 1  3 @–,0K P, , 00+.02!ee0@lL!0000  X2  0B8|!dtdlb`!d I0S< 2S, ? Q00 000I Rr 0i bh1  00 @0-0 02 eK!@BK! K!K!@L!\L!pL! L!L!L!M!0M!C 9 # DM!    \M!, xM!I M!M!1 M!M!H J M r M! en m N!dN! N!N!N! N!O! O!HO!tO!O!O!P-#O!D=O!P!5G!3P!hP!P!P! Q!E! Q!PQ!lQ! adX \d00  d0  00 @0 4!CdH!>d00 0  00 @0,0 l!"dT!d00 `1  00 @0@ 0  (%-d@%-c00  x"c2G 2S 00 P@  PP@c0R )lr@0@ 0   0 0@ 00 7l#c #c0 #c0 2 BT 0@ c0c0  3@@ }FL$tc2Sa`nc2S 0@ `cT@D+ڈ0TcT@D0 00 ? A"R420 SH 2"0@@S$T 0 " 0D (  ? 02  ,5  0H%c cH cc"0c? bE0 X 0 岔Db 0 0 0#@0 00@6 b 0 bbMB|00D&b&b 0bb2S 0 6  0(0 @0 0 8l'bt'b00 7  00 @0 '{b'vb00p+ 0 P7PL? RH ^ 2SB0X@D| 0Ob52S3 B0P@?b\@@ 0 S00Ʒy–B/0 $ @#b0 0 @0@ p ) b0 0 9@@ H|? R  a0S1  *a 0, a u0e?l aGx _ - 0P@0} 00LU@ ? R h2? `R 0V 00B#h@  ?Accp0 x0  0\ 0@ 00 <8 a0 $ za0@BMb$ eE! G! -L,M` p P03ଐ%00@ D0H 0 ? @ @ 2P0 0" t p!ld $(6aT!@000 @- 4+aH$Q@00C\ 0  "!0 00 0C&  0 "!0 0 Ro x`0,0/0V0 2᱒P`0 0# @hQ!0#!C!`h D!hh0V!D! -1q!L000_L@`P 0SM0SJ RG0S< R 0 0 0 P`V@@Z@00C\ 0  "!0 00 0C&  0 "!0t 0 Rd0Ham?w00S1 g@h`hhh0$ -LM0@ "00 R0 00$0S< 002H0H  03`0 e Q! -L MX@)W   0#P@ $#R 3R:03 0P 0Z0ŸlPt0x | p0 0U 0 # P^ p0S]|0U0  P\ t0S  t0\| St  p0^࠱x Sp `,0K(pK0p0` ` ,PP0 0 ,  :4PP  _00`0   PPd :A PP40X, : \0\OR!O$R!\R!R!R! p-LM` @0Ty 0T@ 0T 0T@h0 T 0T@9 0T@ 0T@A 0TN 0T@O 0TH 0T@60@0 T#P020J TX0 0!0; TX0; 0O $@0M TX0P l R $0  1y@ 0O TM 0T@0O TX0 7 %0R $X0 p\@?#όL 0 0T0G $00G TX00" $0 00" TX0dxM T -L M `, 0p 0 P崠0 #̠#3B(0+)*@ I0PS X0 0 < <0 0P0SQR0 RD R9 0@ #@!@"@,0  0S  hI p(0TP  00h #Ġ##Lh0@0 0, l0"""Ƞl  p(0 PW0 0S0000,  0!00X0000000X0 000 0P 0S  0 d0p S00 00 00 v0 d0t l = #=Y -`0 RLᲠp P8 0S ,  ) 0 0 030 0@###Ƞ+)*(0 0T00  @@ "" ?0 0 030SL S  @ 0 0 @ @0 H] 00S@P Q@R@  0 0 030 0# ##Ƞ+)*(0 0T0 00d0p S000 X0 00 03R! -LMP0 R @p  \0  S0PQ0R00Sd0Pt0^|0^(`0 \ ( 0 0 l 0`R Z V0 `H P 0 \00 A 030?0`200>0 0?<0040 000`000 0 T P 0 T 0 T 0m\ 0( `0 `s0S0 0 0 4W\ 0( 0 ]0S!OhS!S!T!LT! -L M0 p@ d 0R , 00 QP X x0Up00ClXUP 0\ C Q,0 P 020@ 00 ?@0S @ 0# ##Ƞ+)*(0 0T 0 T0^,%0S, P@0U20 0>0X0 010 0 !  0?@?<0 0@0 0X0p0Ux0U 0?0 \Al 0\ Q,000 0PQRS 020010 0?<00 00o0S, P0U20 @0>0X0 010 0 !  0?<0000 000AO0@- PP @ @ P  0 0,,,,S QRP0-  00   00 ! @0T1X0  @1 @0Th@1 @0T X@1 @0T\ ?#/Z?B!P10! 1N N R0000 0 P@#0SP11@TPUX0)(0S0>, \p0 0:(8o 0P80 q # aXZ? 00|P@0!Y>!0@\TX0  @h @T0|P".@40|!.@0|ugO+$VVpU! -LDM0` $@P T .000J0S? 0 ,@T 0,0P*:P:@TpW , ( L 0H0 1D 000 X B X R:0B ( 0H$Ƞ 4 $4P8 4 ;0 0$ W 0 $@0 \04 $0P< P P 8 , W44 "50 0> W0P0 6 0 0, 0 X X0ST ! L 001P^ ,0S iT R0p0, \DH  0p0, \ TW4 W 0 # !" CWm4 & P Z XQ < 0, ,00C, \X0S <4,;8$˟W@ <0   W00 ,@@ W   0SS:@^ (:^ " ^ @ VY0,0ZY h:  Q00 0M < V 0p0:@QU :Q @TK TA T 00 0@S0P@Q0R0,0( ,0R c0?}00 =(P@ P " 0?e T  0, ( ,0Q c0P P  R 00C#,## K IJH0 ,0( ,0R c0=.00 =($IV0 $P Y 06V00 @0w,V0 S@ѵ@PѵPѥTL U00TP ,000D ,00p d0PtU00T  R"TU 0DSY 帇TU[U$pS,@0 (00 @I, 00 DY 唇LU0U46@ R{ e$6R` 6R4 000$0@@5 D@ $0 6 H $D@10L S,0  4 ,H10S00 ' L 00P 0pF?, \0, ( ,0Q c6 00 =(.LD H0iU$D H0cUaU4@\ 4\j0, ,0tcalJUud`5 000$PPd `!hh_E0, ( ,0Q cS 00 =(K @ U0 ,0@, ,0c4 `80UWoZ W 庆,$$T#000# 04 T0, ( ,0Q c0?00= (gl"000 0=>U0TW pT'_ n0 $P< xs T5 0@+& T0, ,0@ @c, 8oTW 0(! "$# (,bT~^TXTUTRTeU!U!U!"V!V!V!V!@eV!W!@W!dW!W!x-!W!W!X!e(X!PX!X!X!X!X!Y! e Y!DY!Y!Y!Y!`eeY! Z! Z!0Z!@Z!XZ!xZ!Z!Z!Z!Z!𫪪Z!0, ,0@ @c, XTw0; $000; TH ,p D L 0p c#4 1q ,0( ,0R cT 00= ( T0TpS 0T -L M p01 h!"3X@T T T 0,0 `V    (0S    $0 ( $ `V' V 000     0pp(oL(0S $ $0 (P,@? 0X0[YZ,`  0 " 0$ @ $ 4  P)(0S0, ( ,0Q c 1,S01ppq 00= ( $0 @( S0,0 0S0 0bR,@^ 00S0YTX '(TS000 0 0r0, ( ,0Q c0000 pp00= (T0**0(Z![!e -LM`0p @P 0\@(`( R 0XF 00 ! ,@( ,P= l(\ R4[! -LM4 tR440#0KS80 00 , < <0Su8<00Q8 <0 4QU @T00 4 01 0 00 PP0 P?RTP40QU @T0040 10  00 PP0  RTP0PU+ $0  0$0@, 0X0 σ xR 0p0CS00 00 , Q R0000 0P :Tp0 1`V0@00 0 / TʄQU 00 PP0 哃 Q@Y<0 0S40#[ 00<48000<0 4#JT|[![![![!\!(\! -,6L(M 0 p0`0 0, PU hR0000, 0 4 @  0묀X< 0 A0S P* 1=40   ,$ `$= ,A 0"""Ƞ[YZX 0  ğ @  $0P@(0S    $0 (0, ( ,0Q c00B00 PP00S00 0)C0 0C\ 0  "!0 00 3C&  0 "!0|#0 Rg@T 0Z 0 R6 T) C0 0C\ 0  "!0 00 2C&  0 "!0"0 Rg00 ,0S 00`S " 0QX0 4 0   00S, Q@DjTʣ00= (P qP0pA,00 0C\ 0  "!80 00 $1C&  0 "!0 0 RPg, 00@P <UP,  <;묀000,h 8<0P8, ` 0@@T 0Z,"`h@h   hh0P\!x\!\!pU! -L MX 0 p,0 00 (0S%쀗 0( 0P0Q0U  0 !01 R! PY0 R0Q00  , R X0)(0S 0T0 0:(0 0S $00` `1S `VV 0(`S 'X ʈ0(@X0! 0P@ 'X(X V000S 00  0 "00 `0 SP QR 0 S, 0 S0 000Sy R0 1r 000 1 QR@ X0  0FY@"010 ##Ƞ#00, ( ,0Q c8X0` 0J) ( 0S X0 0( XX 쀇J!0\@0X10/ 7< Qh^.!0\00= (!0\ R010,NX0 0PN 0 ,0!, 0 0 :(X L(,$$\! -@Lhp9.0P | 0N `000$00$0@(`0`0C^  00#!t000 \0C& T  00#!04 0 Re@h\!`hhh0 -L|M<  PD  *: }DP  :<@80K4PK 0P@ @ 0,P<  X<0D 00 8 :4P<0D00@  0 P<0D : P<  s@ @D0<@0 0  0@  P4@V@ Q< @ D0< 0H  0  , @ @ @009DH 0,  0,0 t0 0 !P0 T?00@0EPT F X0G0\ M `0 N00Q0R0S0P L 0T 9 : ; A B C 80<DLd0O0helfp g x0 ]0|0^` _a0b0c0dX0Y0Z0[0t \@11 RL8 $ #4"( 3#8(0 < d3 \<0L>1D3 /8ß!0S!(\  0D00  00D0  0" 0Ÿ000 @C\ 0  "!|0 00 h2C& ` 0 "!0<"0 RD@ 4 ^@  1 0<00 D0 0000C\ 0  "!t0 00 `1C& X 0 "!04!0 Rcc<  L<D0$<D0 <08 0DD<  L<  l}L<`xL< PsL]!<]!\V,$,$@h ,$$,$`hhh0h]!]!]!^!4^! p-LM1! 0SP[*aV R0000 0 p \P`% 8X09'10  P0 0/!1 0 1X 0)1(0Sp0 0:(! 0!0@0|80!@0 !?\pU+$ -LMX 0)Pp(0Sj`@4@X0! 0[0S@3 `VV` 1`0 1@1 R 0S @0  R0Z `V0EX0)(0S0 0:(X0 4 08 0X14  0  !0\!0\0,00 :(tI l^! 0-LM0X <P@8 00!#08 X<à Ȍ 00!X0)@:(Q0(\\ -LMP0p @Rn8` 0Sg: !30b0C02#1 11$0CRX*X0D 0X0! (0 uX0! 0 BdX0!0 BU10C0  101 0 # !X0$ B9!310 #PX!0 0  100P0 X0)(0S0 0:(!0\$0!00|!0\!0\!0\! 0\qU -LM0`pVAf00 0S QX04  0#X0)(0S80PP08 @08  800= 1P0C 10 0:(!0\ -p0Lh!Jd0dJ\0\JT0TJL0LJD0D J<0<hJe^!e^!`e^! e^!@e^!e_!e _! p-0PLM` P @09(@`00C& R 00#!000 t0C& l 0 "!0H 0 Rpph`0 `h@hhh0 0-L@Pl2h (  P}U}U 00hI<_! 0-Ll@h1 Xl2h (0l”08h#8 XPl2h (0l”08h#8 Xl2h (0l”08h#8 Xl2h (0l”08h#8 Xl2h (0l”08h#8 Xl2h (0l”08h#8 Xl2h (0l”08h#8 XPUZ0 p-LMlh2P@ `P1Xl2h (0l•08#8h X@D0D3  1 l2h(l•008h#8 Xl2h (0l•08h#8 Xl2h (0l•08h#8 X@pl2h (l•00 -4LMट `P 0 0PP`lp h4XlB0h Xl2h (0l—08#8h X d ` \ Xl2h (0l—08h#8 Xl2h (0l—08h#8 Xl2h (0l—08h#8 Xl2h (0l—08h#8 Xl2h (l2h P (0l—08h#8 XUIzl2h (0l—08 h#8XU ] l2h (0l—08h#8 X@l2h (0l—08h#8 Xl2h (0l—08#8h tAX0 0C\ 0  "!80 00 $1C&  0 "!0 0 RU^l2h(000@l2h (0l—08h#8 Xl2h (0l—08h#8 X@TZ`h@hhh0 -d2LM\r ` 0 00`l@P(2h Xl2h (0l”08#8h X ' #    l2h (0l”08h#8 Xl2h (0l”08h#8 Xl2h (0l”08#8h X00C\ 0  "!x0 00 d0C& \ 0 "!08 0 R]`h@hhh0 -LM7$pK00#0Q00SP`0@ w2"`K!@K1[ -L MpǗ@, T (K\P` Z2&@K%PKbK -LM@ l”hd0 XX Ql” 0h l2h$l”0h0 T 0-L@Pl”h (0  P`cUdU 0QF0\_! -LMhlBP p ;XP` Ǖ@0pV+?l•l•0?0 < 0hhXP` l2h( 0 $Y$0@ TǕV 0-Ll@h|0 Xl2h $LP 9 0l”h1Sl”h9 X0 -LlPh 81Xl2h $L4 p @p8l•2;8h#8 @XTڸaV@ `pl•h9 X 10S~0l•0h3; XV@`Zp4<4l•9h0 0-LlPh|0 Xl2h ,?0Al•h0 \lBh .;X0 -Lh2lP 2Xl2h (lB Ƞh 2,hXl2h ,? pL   X ?  X~ ?  Xo Xd ?  XT 6 SB X@ l•h1 Xl2h $l•0h0 TXl•l•h :h .;Xl•h0 \lBh H1Xl•h0 X2+_l•h 1Xl•h 0XlBh 0T`0vh T0v"&h0vl T0v"`|0vl T0v"```T0vh T0v"&hu``h 0 v&hT0"e 0-LlPh ;X7lB00h X7 H@ ^l2h (  @}T}T4 l•h ;X^l•;h X7`0h^l•h t0Xl2h (7 @l•0 89h X-D|^꠆_! 0-?L@ 2PSh 0DXD0h@0P R0 D$D  _!_!}_!<`!`! p-L M 0P`K`@![x2RS Dh2R+`2RX2R E RH2 Q 8C? p@ ?U  " Cp ?U  "1R11R 1R11R R ?U "1R 7ʀ1R, t1R l1R8 ? U " H@1R 41R,?U  " 1R ?U  "U? b R ʼ0R 0R2 ?U  "& R 0uڀ0RtV`U`WPUP`!a!a!WQWRde`ebeFv8a!U\a!P a!Qa!a!VXa!-2π< PP2 << 5 p-LMbO\̆'^,0/4<2N>"Tz/^0 " 2^̌ . 22%%p -鐢L`BP027P 7V,0q00 2`Vu -L4LdL M@ 0P0(0>9@0@0C\P 0  "!0 00 3C&  0 "!0#0 RU  h3! 0000`0!C \! 0  "!0 00 3C&  0 "!0"0 R$0p0 2pp!p p@ 0008$@0@0C\ 0  "!80 00 $2C&  0 "!1  Ql$ R 1 0+10 (p,p0 R00 27 0cS4;Ӵ4Q 0 S00000A I0C 0 LP  01$R Z 010w00 0 $,0S 404, P 0/- pb净 - ' LM 0`00? LpR  l–h ;X/1Wl–h 6X@_l– h0@TTP@l– h0X@TPZ7PP ,6 RI l–h/ 0T5lB<  5hX5 R* l–h 5Xl2h $4@ @@Hl–l–@$H9h X4 l–9h0 X 5 R ql–h :X'lB,0h8 \l–4 hX4 R l–h 4X2OSl–l–h :h .;Xl–h :X00lR00h 4Xl–h @0XlBh *;Xl–h 3XlBh 3Xl–3h X7S\l–h h3XlB 0hXl–h ;X0@0 p0 *,P ǖ}'7 4P >8ǖ=00p  0 Ptǖ'T7 P@H,#*^ǖ00Pp  0 P@PTǖ}> 00p 0 PJ^@Pǖp00Pp  0 P@PTǖ~>0p  0 P0<B" 77`SO@ 0z04?S5    5%L05$%05 ` R55%00@0 5T 000@ 'l–hp5 Xl2h (O4K 0pp>3[#202`0CP O$4&$?\"4$`2d"D  0psL"R "0&"&2PS ? ? 4 Rk %0&O0[Q"RG~x~~~#080 ? R! 7 # !#0H07l–h ;XlBh <X8&2 R %0?  R-0$0'0@6#080 2 T0'0=& 0$7&0 Q 0-.& 0|)&x2  h 0#& 0@&02 i $0&c`1@ 000"@0@0C\ 0  "!0 00 1C&  0 "!0  Q. M,O1!%?Pl–h 1Xl2h ('  8l–0@9h X!hM`h@hh&h0b!P 0ʎ0P P *0,P8<,d6" 4P<@> 00P  0 P@o<,5! PSp@< ? 0   0P11U8R<R02p@ڰ \N? p]@<@  0 P@2p0W2pPpW*Km 02[ 8#(# ??Pl"pt2|$|4 x p44@K0 ^ @`$` \$,4,$@p4 4 $0 @`  4H2 I3#423\@8"<2#3rU# 0$"R) ! $P!   $P #o#00iD#0< 02,b? "!0'# 30 >2[ 3[0 Kx[3x@00CZ PᶣK@#[0tŸPC b 0K6K0 \"[3[43 0 x3[[  BP0U3K@3Q@RU $0< @$=0C!L=lPP <0$< <0)8<, 0@0 R3@ 0<0< p 8<0,0<0< 8<, 0<0,0L,$ ,$ d!h8 ؆D$Xd!Dd!td!d!d!d!d! p-LM@\$2S @`\ #1;p鍟D$ -LM48p 0X``FX64P@@8 0X480 XM480 XMV`48 0X4@80 XL40 8( 0 48X`LV48 0XLxb -L M00 00 S40 `, 48 0X@pDY74@ PP8 0X480 XL480 XLW@xBT#4 ,0pDX74@PP8 0X480 XL480 XLW@4 P @480 XrL40 8(0 pD7048 0pDX\LW@4 80X40040 ML40 \x -L M4,=@S\p, ,0}S4;ô4,`PV( <  0PU`V 0 S00 00C0W ck`p`4P<<(0S/0(  5    (0Q0,  000   (0Q<(0S,00,0 \0 0<( $0 (& @@4@ 0400'$$@0@0C\p 0!!3 0#C6000 "!#0#0 RW 01l3 00\#00`0!C \! 0!!3 0#C6000 "!"0"0 R00$0 000001R0 0Bp2@ 000'T"$@0@0C\ 0!!2 0"C6000 "!!0!0 Rd$ R 1 01+00 ,0(0824H ,8”049H \.824H ,8”040H \824H ,8”040H \0h824H ,8”040H \824H ,8”040K 0-L8@4;H \824H ,8”049H \824H ,8”040H \824H ,8”040H \P824H ,8”040H \824H ,8”040H \PUZ824H ,8”040H \~824H ,8”040H \n8”4H 0\0 -L@`pPW5H x 824,8”040H \L824H ,8”040H \<824H ,8”040H \PE+uPRPEu5 V5H 2 824,8”040H \824H ,8”040H \824H ,8”040H \PEu824H ,8”040824H ,8”040 p-LM8P04<` \@1A824H ,P@Tpp -PL@p8•4;H \824H ,8•049H \824H ,8•040H \824H ,8•040H \w `I824H ,8•040H \b824H ,0 8#hU824H ,8•040H \E@R` -LM\p @P`K*K? \ 0  lY2[2[#$0$@ 0T? -LMQ88@44H H "::\824H ,8”048H \824H ,8”048H \ -LM8@49H \824H ,8”4H ,8”048H \824H ,8”048H \824H , 0-L84PH :\@@TZ0 p- B0LMB`Ppz@ -1qL ` 0@ P0@    PI9yP000@B@>00C\ 0  "!0 00 0C& x 0 "!0T 0 RZN<@>@TZ`h@hhh0 -\1LMTq 0 `P@ 00`X f b ^ Z V R@00C^  00#!t000 \0C& T  00#!04 0 R;`h@hhh0 -LMⓏ@0LQ`SPP 0T0 QppW.2 R T U U U Q!1 Q QQ Q' ,pK[0*@KS)PK 0S [8–4 00 \8240 ,8–470 \U4<DLT\𴠠824 ,0 P Y$긠꼠ĠȠ̠98–;248 \@>824 ,P@T}Me! -L M0KP@ ᓯ` T0BS00S0 SppW SK S# S.@K-`K庂K  0S 8•4400 \8240 ,4 4 8•740 \VP\dlt| 4 8•44 0\ #040 0 0 5;8•0248 \@824 ,P@Te! 0-? L0BS@}_R 0@00`2000S70`20 -LM@Vd2   ? ? R 0p 0  0 ^  -LMx\ ?tB#<0 c {`x,<兒,  @ +(t2Q ;|444  8240 ,8–04@00 \4 j8240 ,8–0400 \ATP @  0SI 1 11PT@40y? `1 z? ̖(0S10̖(0S 8–04 \@=040+0 0(0 0 +<(E 1 114<48240 ,8–0400 \8240 ,8–04@0s@'0]$ -LM8`41 \8B144 \4p p 8240 ,8–04@00 \4 S 8240 ,8–0400 \8–4 0\8B04 \4 ,QU@ P  S0S ? R /  P 0@pU@P8–4 0\8B40 \4<48240 ,8–0408240 ,8–04@0 -LM8P40h \8B41p \8•4h 0\8B144p \4p`  8240 ,8•04@00 \4 x 8240 ,8•0400 \4[ 8240 ,8•04<0 \8•4h 0\8B4p 0\8•4h 0\8B04p \4 -AT @ y  =S CcrT@8•4h 0\8B4p 0\8•4h 0\8B40p \8240 ,8•04<8240 ,8•0408240 ,8•04@0h -LM82`40 ,8–:400 \x\ ?tB#<0 c {x, p 0N0 p )*0,P̖3=, )<4P ̖> 0)0p  0 PX̖,)< P@, )tUPO̖00@p  0 PP@?Uڨ̖3=00p 0 PGNP@̖p00@p 0 PP@Uڨ̖3=00p 0 P@yE24P 0 L02"02$"02 "T00 4`0 T0[ /0 SSv 2"(22}O,"02|"|2Rc  0/0 SS–\d29d2,"0S00d2;d2p 0 –\6 ? R# k ? R! ? R _!0@8–4x l1\ "58–4x L1\ 5/0 0CSW1 R1N   d0 0d0h00h0 h00h0< h `x0!ↁh `0xT( R ̔(0S! $P|P̔(0S,?#< B0,`c 0 0 0(Q0|4 $0  (̔ou0S 40 R,0 0 0 0(iM{s -x2xr  L d2@ 4}oe  w 824` ,0 P0Sc 0SX 2 RQ Q0S; d2  1 R, 1Ap00C\ 0  "!0 00 |1C& t 0 "!0P!0 Rm.1(1Ba,0 000S 000 R  0  у |0  Ƀ0 824( ,8S ,0 40 <S? R ǃ`h@hN$hh0gfff -LM4p4P824( ,30S848 0\824( ,2`0S p 8•4( 0\@~a  ?0S SSm8240 ,h) Q@ d2    XX@X0T0S 8•9h2040 \8240 ,8•h"0040 \8240 ,8•0460 \8240 ,8•046 <S 8240 ,8B04:0 \8•4 0\}X@^X0Tu40So T8•0048 \0Sw -LMȌ̐@  0Pp(0PW`,,d2 x,U00Q00Sk<0   ,0 S ,D S @0HQ0Q p 0p00 0 lK H 6@TP0  @TTH"600  000  T0Hp0CH g,$@h`hhh0h! 0-0L 000p0P@  0p000C& R 00#!t000 `0C& X 0 "!04 0 R0`h@hhh0 -!L M0000x0ppt`p0t000C& R@P 00#!000 0C&  0 "!0l 0 R\\V @@W 0<`@e`h@hhh0p!0#!Lg! -PLM@E 0RA 2P 8p `堠 V VJ +<W0  p0 (BP00C\ 0  "!0 00 1C&  0 "!0!0 Ro 0 0L \P00C\ 0  "!(0 00 1C&  0 "!0 0 R$ V*АЀP0 x p0 0RTp0x 00 h P`" V:d0a0400 T@h`hhh0 -$K$$ -LM`84@P㈀ $8 ,   $pR <<30 l P 0S #0 0C\ 0  "!0 00 2C&  0 "!"0"0 R $ 0@~0Uh:x t0 0Rt0x Y  $pP $0PS %P+0  , 0  , p0 0p0| R,0HX, h0x!2 $t fh0 $P*L Rd00Rd0 yT 0f@T T2m0 TL0 0CL00Td0L 0 $SP  -LM4`0@P $(q 0\ )@00C& R 00#!000 0C&  0 "!0| 0 RT00 p00 0T@h`hhh0 -LM0@(PU,p 8 0@  0 B? P` <0 <*u080B0x0R/V`P 0 \D 0 @08(0S 0  0 B?(hj!J -LM0 @ S` pʲ0S0,0kPPu 00 0 01 0l1 ,,* 0 R *0@0*0<`0-90 E0$  $# 8 0 000 P@58(0S 0    0 (WP@h@ 00 000x t ?A3c 8 $ )T!,,=0Mb$j!j! -LTM4 0p "`0 l Kp,0 2`[]["\0000㔀@T ``4@PP@p,p8 00 0!   PBUp  0x8P  PPh0W0 @@N 0pT pip 0TF020p T_0[0<000p Tp 0T_0[ 0p TpU _@[$@0DB00pU Tp@` K0 *pW @ p  p 0T<0 ,0S 4,(  g-$ej!j!k!<0S8<07 0- @LP$ 0T0 0T $ 0- L000@T 0R00000 0 P00C& R 00#!t000 `0C& X 0 "!04 0 R0 `h@hhh0 -8(0S100B;0P` *0-@@0*0+) 6<0 90- 020  F< 0h ?A3c  0 (<0 %<F0  0 B?(8Mb$Dk! -LMP`p /P@ )0"S S 00)0q l1 ,  (p=P0S $(P -LM0Pp $hP`> $020 lAT0 L0 T0 !4 0j0 <0@T0 0s  '0s @D TT -0S 0S2Sia i +0S 01 00 (00 $ $000H ! { 0 v i ib ii-00CS񟗻`\\\\\\\\\\\\\\`\\\\\\\`\`\\\\\\`\\\\\`\\\\\\\\\\`\\`\\\\`\\\\\```\`\\\`\\`\\\``\\\\\\``\`\`\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\`\\\\\\\\\\\\\\\\\\\\\\\\\\\`\\``\\\\\\\\`\\\\\\``\``\`\\`` p-LM0@SP`0 00CS' ԕ0 @H$P p P P P \P"Pup -LMPp@`l0 T0S/ 0T*0 T+0S0 !  8p "p T,0 T 0T 0 -@LP`pl!0 T @0 T0  -LMp@P`00CS%lИH9 -0  d 0p 0S  Wpl! 0 $p p00 p -@L0P; S`p> $0S; 0S 4ԙ44D0  ( p :hX ;w 0p0 (0$ 0 p 00 Sp -LM0@` P,0 t$ d 00(0 $CW> $ $p8@g(0S.0) <ŸR0 S@ * @T J000 R:0@0 d 08(0S0  0 B?(0  0 B?($p $0<<0 T $0 l1 3  $p $W 0 0TꂠZ 0sp p 0T $  $pJ p-LM@`P0S,@T TT`x pp  o 00   [ -0LSp! 0 T@ .l`@P0S PUN000 0p 30S S  -P@ P`L -$0\0'0 A,  X$!p 0 \0 \ 0 T XC00 T00,0R/ 0,  X0aqJ -`L0p 0@P(0l \ 00\ 0p P$ 0T -`L0p 0@P(0l \ 00\0 T 0Jp P  0T 0T -LM0pP/p@*  `$T)? T $0 P)00S 0  T 0i? 0@S)00S 0p P 0 T 00 0  0 p-LM0@P` 0T 0T 0T\ 0S    php -4!4qLM0`0004@P0S8 S 3 PUNZ@PPU @Z@00C\ 0  "!0 00 l0C& d 0 "!0@ 0 Ri``h@hhh0 -Lp\P` 0S 00 $0 $@A@0  T0 T0@S  0S  00 S0S  0p  m 0p P0 \ 0p  $ @P 0p P0 \ 0p $0 `" @ z p-LM`@P $  0T0 \ 0 $#P_l4$$̩$$$$$$$$$$$$$$$$$$$$$$$$$$8000 0sp p 0  T 0_pP p M 00l!!  0F 0   p-LM0@P`,\ 0 p"p 0 T $ $ 0  -LM`@pP 0P0 k\ 0p _ $ PR XڈQ00RP6RQ.0l!P 0S%00  0P  i !  0i 0p i}P 0 \ 0P 0 T @- l1 d0 Q@   \000 S@505 3:S0 0c p-LM@`P0 T 0phG -L@P`0 p  05p \ 0 i0s h^ p-LM@P`0  0\ 0php p-LM0@`P 0T  0  d 0P 0T 0p@-@l0<000@0@-@l,00P00P0@c p-LM0lAP0 S 000<0`0 T0 Tp p-LM0PlA`! R 0t000S*Q0 2 0 <00 T0 Tpc p-LM0P`@ 0T $0 0}N@T $p -LM`VPp@2 V *0 T9 -0  d0000@0 T1V *0 T+0 T,00 -0LMP@`e $8S $ $0 00G@@p 0   0T 0T0 T0吀00  0T 0T0 T 0 0 i: T p-LM<@PT` h)0X0   8(0S     0 (8 $  8(0S|  $(0Sa4hHHHHHHHHHHHHHHpHHHHHHHHH)00S@HPHHHH<HHHHHHHHHHHHH<HHHHHHHHHPHHHHH<HHHHHHHP$0 (0, 000ph0,00S4 ?00 <000  0 B?(8xtk! -LM<@T 0  0  hk! -LM P0 ` 0@ v-0Ss 0S̡(@00C\ 0  "!0 00 1C& x 0 "!H1T  Qo0p4@0 T00P00C\P 0  "!0 00 0C&  0 "!0 0 R 2 00 0 0 @Td;@h`hhh0 -`L@ Pp$0@000 T p- LM 0@S00P)`p AB1!10d@2@d`0@$T @a2a3c13D@ /&b00(phk!Q!ʚ;Ck!Q! p-L$M8 (0K$`KP0  0.*` ,@Td .< 8  (  4@ T$ p.pk!l! -`LT $0 0T Tp @P &0P Up T $0 0T T $0xR'x3S %0P`*@D S : R#: ,Jc0 *@`p`B0 Xp0C$ 0P8 ,04 0  P@ 0P0PP`  0 0B@$B -L MX`Ur; @ 000X 08040 0 @0@0C\ 0  "!0 00 1C&  0 "!P1\  Q)0@K 0P?q 0000 ,0#  0P0(0(?^ Xڨ00C\ 0  "!t0 00 `0C& X 0 "!04 0 R~ |@h`hhh0 - @Lp0` 0P0S 8 0Xp0p0C& R 00#!p000 \0C& T 0 "!00 0 Rh`h@hhh0 -L Mp d— hl2  d2h ,) B9 @P0  mTU  f0\20\2 0PPU$0Z0PPU&0Z> 0'(0 0P@ p2 x,w[03[P @ 090QP @ 090GP@ 0P90=0E?0P! |0U90|"#P0>U 0 P2x"PUd—hl2  d2h , `G d—hl2  d2h ,d—hl2@  dR@h0 \Pd—hl2  d2h P,cUldBhl2  d—h0 \ddBPhl2 P d— 0h\d}d—hl2 P d2h4 ,dB ɠhl2 P,  d—h 0\,!, P d—hl2  d2h ,P ULN @P1|P>U Qd—hl2  p2dB ,0 0h \d—hl2  dB$0h \d—hl2  dB$0h( \dRhl2  d—h 3\dBhl2  d—3h1 \dBhl2  d2h ,d—`hl2 o `dB`0h \d—hl2  d2h4 ,, dR00"N>C 0C@0l, A, Ȃhl2 A$ @ d—h04 \,0dR!h2hl2  d—A0h@ \dBhl2  d2hH ,d—`hl2  dBh:H \dRhl2  d—P 8h\EdBhl2  d—h0H \P1d— hl2  d2hH ,P UP 0@T 004 PHLH塰0 D80?>H ZloYPUJA|VPU@DZ@4#l!0#!ll!l!-$l!l!@%I$-$lD$0 W -LMHTe | H0S8T| @8.HS H0 0-LMdR@ hl2  d”h 0\0 -4LM P P `i P(C0 0C\ 0  "!0 00 3C&  0 "!0h#0 RoLd‘ 0P0 0hl2 P d2 h,L(pR dBhl2 P d–p0h \2A 00C 0d–Lxhl2P d2h ,PT"d‘0p00hl2 p p2dB t–,0 0h \d–hl2 p dB$0h \d–hl2 p $dB0h( \P8SBL(Rp/ dBPhl2 P d–@p0 h\dBhl2 Pp d–0 h\2 0L0C0P)d–hl2p d2h ,pd–hl2 p P(dB800h \`h@hhh0=P 40 R(0 R0 R|0d= -PLMP x"RpW 0``00VdB hl2  d•a0h \3` T2X"0 T2X"XOI3@T2V0CT2dB hl2  d•h 0\303 2$Nh᥿| lt1@`l\dB hl2  d•h 0\N`T80T8 P`T(0T8d hl2  d2 h,x"`ad hl2   d2h ,`Q x"pLl!D$m!@m!Tm! 0- LMQP dB@hl2 d•h @0\0#dB@ # hl2  d•h p-LM$@P/0`   `0`0C& R 00#!p000 \0C& T 0 "!00 0 Rpphd@h`hhh0 -QpL@P`,8S  0 R`(8S 0$ $Rp0S`@` TP$p@p pm! -L MT20T25 00%0(8,H,,0 (00C\ 0  "!p0 00 \5C& T 0 "!$%0,%0 R?`T $PpU 0SSW`,P 4P$U  R00R\ Y T20CT23 `4 @0 p0b@0 L @0 倠0 `#> 00ZF 3Z5 0L0#3@ 000c#@0@0C\ 0  "!x0 00 d3C& \ 0 "!,38  Q i0Sp R000R!B6S0 !0^p@P⼽"Q 00c0 C20000#:2U0(2@ 00 "02@0@0C\ 0!!  0!C6000 "!1  Q $0S`I 04 0dB hl2  d˜0h \Z0 00 0@ 000 @0@0C\ 0!!  0 C6000 "!L0X  Q @$0S @h`hhh0 -LM`@(0 S4p8PP 0$01l00<@ ,0 00 00C 00$@202LP0080004 -LMhdBP l2`   d2hP ,V5 <0 @ȕ10C S1 !@o T 0 0 mTpd• hl2  d2 h,?> 0D <@0 Tp -LM p2b3c!#PP`0oF QdBhl2 d2 h,3 V00hE0S $| -LMd@ hl2  d2 h,3 h# -L$M`%% 0 0 < p D8PP, @ P@ $4D@08 8 2 00 $0880, T4  ,K4 <0 ,0P @, 4040<0<@  D240<0,  0 0 4 0 22$p<!,\10LP0,0,0, ,0 ,0,Q,0$p000808dBhl2 dš0h \0S ,1 R) A00C\ 0  "!0 00 0C&  0 "!0 0 RP@c| *t0 l0 ,!&  ,(0@h`h=hh04$Mb0 0  Q-L 0S S 0SQ 0 0 m!-0#1?$ˀR 4   R 0 0 0 !1?0P 0SP-(0,#1?&̀R, 600, R000000 !1?0P (0S,P0@-@D 0 hPR 0@W0x p0t0@7| 0- @LP0 00AP0P0C& R 00#!p000 \0C& T 0 "!00 0 R00h`h@hhh0 -L M0"`@0TP, 20@  ,0R Ppl Y4 7P0 _ 80 0$,S03( 00 0*  Y <!<00  % P3A!P000P0P0C\ 0  "!0 00 l1C& d 0 "!0@!0 R00S  kW 000o" 0@ 00P000, 0r00  o P 80(S"ˠ ʠw0SX0 SP000 | (.$@h`hhh0p.$X.$@.$-$.$ -0@L P0p0`40o P0P0C& R 00#!|000 h0C& ` 0 "!0< 0 R4hK`h@hhh0 -LMp`04 4,  R80 TRU3 R̃3@ 0P00L#@0@0C\ 0  "!x0 00 d3C& \ 0 "!,#04#0 R, 090 2@ 0 00"@0@0C\ 0  "!0 00 2C&  0 "!P"0X"0 RQ02 000, L0$ pR/ , 0909!0 0C\ 0  "!0 00 1C&  0 "!h1t  Qo>0 #>WPS  @ $0S U0, 0 (&r@ P0P00厸P0P0C\ 0  "!x0 00 d0C& \ 0 "!08 0 R | gm!@h`hhh0 p-QLM@`PpT 00 @DRT0  0 @DRTʃ0p -LM@P 0h -L00 S<0\< C00By 0( <25(  4p0< ^000P @<0 8@0*Q< `0!< 0PR < 0A,(0"A 0 P4p <0 @ 000` 0@00( 40 , 84 09000C\ 0  "!0 00 t0C& l 0 "!0H 0 Ro*0 $o|@h`hhh0 n!0 0P | -LM園P 0 @ 0SS* hB00C\ 0  "!40 00 2C&  0 "!0!0 Ro004p090L`40S_ 00C\l 0  "!\0 00 H1C& @ 0 "!0!0 R6@ 000j0( 90 @0@0C\ 0  "!0 00 x0C& p 0 "!0L 0 Rolk `40S @h`hhh040 <8dpph 88#0 pT4n!n!WEVP 0-@0P @L P 0000P0?e -LM0s@S* 00 0000 -LMⴁq`PU @!0@ P^PU $00<0$0@T0 P8:00/ PP 8<8PP (2P Xr!lr!Lo!\o!(f$!{"$! -L@PT`p@Dt @ PfP TP@Dt0P`ff -LM@$P2 P0( P) P0" P0 P0 P P P  P p`S P 40,P  f`ff@f|r!f(fr! -LM@P P hPP  P 00c0|r! -LMp KP0@ PS@6$`KzP. T $0   $PU! T T @Ⱶ 0 0@ PS@ P  00 况  噵 \$PX Pr!|r! p-L M`KPpa0@S@ PKPT T K 0 K 0C0 N0@S@D00)|r! p-L M`KPp60@S@ PKPh `RT002320 !0@S@00 |r!r! 0-@QLPJ`@TZ0 0-@QLPJU@TZ0 Q-LPp`@00eT : 0c00e000500eT:p00e0ff p-LM<@<`04Pc0c000pfff 0@-L~S(EDJdEEEJKJ FFJ FGJHJIJ8JJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJKF&0S}00C0|V|f 0Rq0 0CS0@6D&0Q3*V 0@R*0V0 0S0@:E5 Q*F005%0S*cUE 0Rtet# Qle deR00 PuP0 0 S0pP0  0 0 0dؤ^% 0S  0弄Rt00Q^ 0S 0^h4 0S00$T(d0 S D0 R 00Q300 S0QB ăs0 G0Qp3#0Qpcp dcd00 R 0 H P0 R 3 0c-Rs0b0CS5005@G200 050 ̂%@G"S 00CS0050005 0S RK0 dR 0 0DbR <p00 R 0  P0 R0a 0R С p A1Q`1 bp!hA0 0R:0RR0B B'%0S"0SQa 0R0R S  0R0R S0 Q 0@^S}P0Q0Q0A Q 0 000c0c0 0QWufff2$e2$f2$fr!f -P@L@PpP`P0P @D@PPP宒P  000cffff -LMP@ P  P@ T$! -8@LMxP00  0@ff f0 00f ff8 04S00 0 0S405 e ff0 e0e -$ L0S 00 e -L 000e e -L!0@]S@t T !0@]S@00D SA Da0DSR\T_T3\TS( @SA @a0@SR@0@\T 3@U@t T_P Q:P00\P0S0p P@$}0?SbhPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPpPxPPPPPPPPP`PPPPPPPPPPPPPPPPPQ Q(Q    .P@ -:<P@  >P@0T,1pP, a00/TU# 9T0pD UA DA Da0DSR `TWpD@T7pD0s" @00DR Sa0D_TS7ToPOPP tPTP P xPXPP@(0P(f)ffr!r!r!3$ fr! -LM||`P0Ulp@ڰ0T UPe PUP0U00 P(e e2$ 0-@PLP 0SސcP  P h 00C0\@P ސ0SU00ha0 qPP0s!$eTP@`2S@PT P Wp ehe -0L Mt`, p0 @–R\ ,0K@T00 ,0 S1051P5 fhe -PLPM`\p 0K@  0SV 000 f -L1L`MD0 PP(0 `pl KpKt KpP 1l R*t0S@hK 0@@ (0S (Ԟl RW xK| K0P x| P@hK0@@ 3$ g3$!t!t!t! 0-LM(P@ 0@?0 f-00 C f -L\ @f - 0L0S @f -L\   @f -L\@f -LM$@T@f -L\ @f -0L0S@f -L@PMK!P 0Q0SpH 0 :0 RX8PT]P[HX@U<<0 4Ohft!t!fcgt!0>0Up1 @TW 0@e\3$ -LM0PhS` /S+ bS` `$pK 0S A@x $ hs$ RPX @ @0f0P,`lSv!P[v!`ffv! 0-LMQ@<00CS Lrprxrrrss0 嶌0-0P0K0,0 夌PT Q 0QP0 R000(P$03$3$3$2$|E$8g@ed3$ -40LM @R ᒨ\)Ꭸ0d 00Cs0 -@L`0 SpP 00L S0 @0V0 0Sƈ0 S@A0@S 00SaCA C QRa0\S-@⭈@庹a@0a S_R@ zTh鮹Ꝉccv!v! -L4M(0 sS, `@HKT^  tA0@S00a @A0@SR0a SR0S  A0BS Q0S ^ + a AL00nL0 V L0SZ00V00S 0S  +P0aCACAB0 SR\00P0S A V1 ;V@q 0PS`LK0 PBTU@P ,!0001 ,0S , pX T KT@ wT0cP T K0T0 l0X P6U0:S000S 0A Ca0CRS0000S _0a0B`FrRc00C Z<: gffv!hev!s RA0 R0#0Z RA0 R0#0Z RA0 R0#0ZRA 0P0 ZRA0 0#P0 ZRA0 0#P0 Z RA0q@ R0Z RA0q R0`Z RA0 R0Z RA0 R0Z R-D0q@0# R0Z R-D0q R0#0`Z RA0 R 0#0Z RA0 R 0#0ZRA0q@00 q\  ZRA0q@00 q\  Z RA0q@ R00Z RA0q@ R00Z R-D0q@0# R00Z R-D0q@0# R00ZR-D0q@0#00 q\  ZR-D0q@0#00 q\  ZP -`LM0@ᤀ,0 嫷88@40 P0p40Th d#  8 Pp 0040匷,0 S ,AB_D` \ p}dO?-pp`Xs OK08q@qt|qq HP0@3S X30X3 K⩣PX#@3\# SK⠣PX3`3  X3  H\ \3@\X30||x]`3 <3`< SKpPX31 gV!w!,w!Xw!3$dw!lw!tw!l3$H!|w!3$Q-0 Q0 -0@LMd1>`<Q!`$000! BR! !0o2c|!1*PRdq`00C\ 0  "!00 00 1C&  0 "!0 0 R*IhF0PU ,0S PU@ 0< 0< @0< 0<4|@h`h$w!hh0xd`pdw! -L3Mp @PoK0 L3 040H RKPL L30 0 S   gw! -LMP pR, @ᖢP00厢P0S7 S 0 0S ( X0`ၑ 8 ,@ t0S, (0`X 00000 1S8 0A@ 00$ 480 00 0 0S ( X0`ၑ 4 ,@ >0S, ( `X00000 1S0 04 0A@ 00$ Q440 00 -L M@K 0 @  2 Q- L 80Q 00Q( 喵0Qw!v!w!w!w! -LM4@T0 \̠0pSP` L^ 0 L P   ~l -40 P0LS hQm0  -LM Ƞ` Ƞ,@\Pp/0 AT+ 1S*40S% 1 0R1 RP 10CS1or 0PR R 03$\p@-@P` \ 0p@;p\ \pp@ 0- 8@8L#T P&0AT" 1S10P1 P P10CS10oPP PP003$ 0- 8@8L#T P&0AT" 1S10P1 P P10CS10o0PP PP003$ -LM Ƞp Ƞ,d@^P-AT) \$^ ^P 10CS1o⦏ 0P^ ^ 3$ 0- 8@8L#T P"0AT 1S10P1 P P10CS10oh PP003$ 0-P@ L Č P!0AT 1S1 0P1 P P10CS10o40J PP03$ -P V `LPrpW 0 7!; 0 0( 0 8 9 : p\` 0-4PL@h \ =000\ =000  C0 Px0  C0t P 0C !/B!R00 0c0lx 0C 0a 0 -PLMU@` <000 Z040P`:X`d (, <0 0 <0 <0 0 <0U* @K w1l娐` !Ppx0 0 ` l t p P p 娀 ,0 s P`040 ,!=< <@BPD3$ p- @LMP$0004 4 R ,1S =00`P00C& R 00#!p000 \0C& T 0 "!00 0 Rpph`h@hhh0 p- @LM$P000 40$!40S(`P00C& R 00#!000 l0C& d 0 "!0@ 0 Rpph0`h@hhh0 -L M0`Sp0S0SㄢR "| $0, 0 00P SPd@H"0DR 2cd0埋1dS0 PP RU ,  00C\ 0  "!0 00 1C&  0 "!p1|  QP@ `` A0P@U$ 00 P%0 P   P@0@0C\ 0  "!0 00 0C& x 0 "!HT 00 RUd `h@h$w!v!hh0 -1LMq1$ 0A04P0 0S ,1S4 40 ,0R 00000`0 0S 0SI 04 ,000Z<0= 0 <0= V<0= 0 <0= P`,QXP00C\ 0  "!0 00 0C&  0 "!0d 0 RNP0S 03$@h`hhh0 -P7LMa, hp;0 P,1S=0 ,0SI p6P$ 000 $1@cT`d0 @07&^` @O1`@SY lx&P00C\ 0 !  00&C600 00#!6  Q 5P00C\ 0 !  0%C600 00#!`5d  Q#$50P00C\ 0 !  0$C600 00#!4  Q,, 0T@!$1P0$1,0 RQPm,Y00 R00S 4$ 000 R0903P0@0CP  0 0#! 000 3C& d3 "!X\#00 R\ 0 ,@c e0T@T@!\I, }0PU"2$ 0 P%00d0"P900@0C& R  0 0#!d 000 d2C& <2 "!48"00 R ,Y00 R00Sw 0  0P@UA0S7 !1R` `04 @1`@SY4 RS(1400CP  0 0#!  0C60 00 00#!4 TP4  00CP  0 0#!  0TC60 0(0 00#!3$h@h`hw!v!h0w! p-L!LQLM`$0@00 R `0`S?04 0000S d0dS.04 ,00@`00C\ 0  "!0 00 |0C& t 0 "!0P 0 RpphO0d0K0`0`h@hhh0 p-LM0S4PQl0@BO `h`P #3 1Rp0h3$Mb-0LS*ܠDDXXXDDXXXXXX0 RD R0ZU00S0\00R B0R0S00 -LMp0`KB@P 0 TQ 0 S \  Q#Q!@a {TP00Q00S gx! -6LMqᤀ;0, SP\ 1 `0 P 1 ,^=0 =0 P 0@(1S VP1P!0O e (10e(1\ P \  `$0  P$0U, @0Td $^d @W1d@SZP$0U$090`00C\0  0  "!T0 00 @4C&  0$ 00#!4  Q$0A`e 00TPc dP``@V`V`!0 .{0\`cx0 040 S %L34 %@<$ 08 0 0 0: 004R 00 P`cc/@+TL ` 9 : 0S80S< 8200C\ 0  "!p0 00 \2C&  L" 00#!$20  QV  Z00R00S* P 4 yH3Z `` 00 1~3]T`!`00C\ 0 !,1 0!C600 ! 00#!0  Q 0`00C\ 0 !0 0p C600d  00#!80D  Q#P3$@h`hx!v!hh0 -,6LM6Q4@G 6Q 5Q 5Q  2P0S 05Q00Up`E|5@$  P) Te@00C\ 0  "! 0 00 5C&  0 "!0$0 R i=0 0V0R00S8Y =0 0W0R00S'Ld@00C\ 0  "!0 00 4C&  0 "!0#0 Rr )p3Q 3Q`,1r3Q[0\W0h0fX3Q QL3QI A@3QGS#p$0000@ @c` @0 @S@#t00@p0p0C\ 0  "!l0 00 X2C& P 0 "!0,"0<2Q08 2Q 2Q1Q 1Q<000 0P\ <0S,Q0PU0SX X0S0X0 @ P$000 @lt |00b0P0P0C\ 0  "!t0 00 `0C& X 0 "!04 03$ A @A@A A A@@h`hhh0A@A@"A@}fA0@!A @A@A~fA A p-QPLM@`L`Qd@`@0S኿XPv phQp tS00 -|1|a$x1pL@AQ =0G $1RA@ =0 0RX^/T)@p00C\ 0  "!0 00 0C&  0 "!0t 0 R@ L  0R`h@h3$hh0 -L MlA04P,0 \M X0SJ `RF;0S ,00 0 0 X0 ;0p $000 R( 0 0C\ 0  "!0 00 t0C& l 0 "!< 0D 0 R B-3$@h`hhh0 0-LM4P@d BR\0 Ttx l00@dP000000tl @(0 0-LM@P0S04P`0S L00 0`P00000@ $ -LM<0PS4p@`0 0S0 0%0%k(0; 0R(0 `0S0 Pt1$00fS0)90S0:0$ `3` G80S0040000(!0 40(! 0 0 X0$ 0 % R0%`0S =0 80S 0S,Q`0S mNK080P $P  0 p-LM<0PS4`h@pH0 0S0 0%; 0%(0R 0(0 d0S0 P0(p08 R 40 0 l40 d0S ph0X0P (P $ 0S90S00 0 l000 R5 R, R0 0 R0 00BS88@@@@88      0S 00CS0SS 0S 0 00S 0 -@P 0 @0 PpL040`@@OP@00 @040@ -L$M 0 \,0 pD  \vʒ /=2D0 r6 0@ S> 0@@K04 <0 DP`PV8 $0PS U V L1 ,0S <, 40s@0  D  0P | @KD  0@ `004 @K<0 DP`8PH P@$0  4|@KD  0@  fPH00H0 PU@H^@0lD -¢ g x! -L@40P`pDP 00  00040DP 000 -L,MlŸp~, H T0 D G 0@ SO 0@@K04 <0 DP`P0U<0 8 $0PS! U D0HS0T  00 \T01 ,0S x,E0MT@`40s@0  D KH0KP | @ @KD KH0K< y004 @K<0 DP`0P<0 H D P@$8P @KL KP0K 4|@ VPDL0H P0` D H U@Z D 0HD0 H g,x! p-LMPa0R0 P0S 0s+ 00 \) 0B0$ S0,0 @0S PT 0 S 巈p$004 0K(0 @@0\,0 ( 0$0P( R (0S@ 0400K@ g8x! 0-LMP@0q0 00S004 , (0 ,KDP 0 S j0 0S 0P$ $0\ R0P$ $00 R gDx! -L|M4 ʟ 0R `,0 8 h 00 XKB/ @pKp0|p s | X0 80Psp0  0PsT0  0sl0 0PsP0 0sh0 0PsL0 0sPd0 UeX]U@PX | RH 0|0 0H0 D @0s | R7 0| =0=  0=0=  ,1S0=0 R- 00\ TpKXK T = pK0 X0KPp RT T pKX@Kl0Pᨀ0  r |\ ] Pp|  r |0S Pp| 0s ]Ox Kq0K q0[8Pp0s Nx Kq0K q0['Pp30S ]Ox Kq0K30x Pp30S Nx Kq0K30x Ppop0s 1s p04 @0 04K<0 8 @K@PpZ00S 000S0S=000S 000S0S=0t@t | R 0T|0 0Sl|  0s = 0S| R+xq 0 Q01S00| r 00CR01 x0s 0 0bQ04 ,0S ,dž|0sD4P$  kPp0SN =0 0R00S 0S= W =000\00S 0S+ P00C\ 0  "!0 00 3C&  0 "!0#0 RW ߻ppl0 S0Ppf_= Y0J|@F\t@5B"P$000tP0P0C\p 0  "!d0 00 P2C& H 0 "!0$"0 RW~A!P$000bP0P0C\p 0  "!0 00 |1C& t 0 "!0P!0 RWhI F 4C@'X0T p0 l L0P d0 h p0l X0 T d0h L0 P XKpK0|0 |`@ \ @XKPppKPp gPx!@h`hhh0 -LM 40 S`p( 8r 0N0!8 ]_10  10 1 0@1H 0k030 1s 04 <0 080 4 <KDP00[ 0p00@0  00b(00  c( 1,0,@000 0 00S010 2@ R 1 2@<00060<  6 070 7 0 0h 0t0x|=00(0 S ( g`x!\0S\ 0S 0 S00R[ -LM\@T  l@T - L3$ -LP@Q< Pp4`D $1P 1P @0S@ -Z\0\08@0P 0P0@00H 0@P@0ST0@ 0D3$MA0@}fMM, 0-1L q!; qP0 0800< $ 0P00 @ 00C\ 0  "!0 00 t0C& l 0 "!0H 0 R0靹(0D3$4$@h`hhh03$@-1$  < P0S0P0  Q0 0 0S00@00C\ 0  "!p0 00 \0C& T 0 "!00 0 R@L@h`hhh0<=0 $!0S 0S@-1$  < D0S0D0  Q0 0 0S00@00C\ 0  "!p0 00 \0C& T 0 "!00 0 R@@h`hhh0<=0 0SA-P耕@X` 0T280L0p0 ^\0*S^ ^0nAS0%者5@` -LM~O, ,0 !0!h -LMr@W41R2p U8`40< *>㳀Ϡ@4*.00 000E ?PPp  㔑0 S0 0x0@0p0z4Ë \UK͋ U*> *> X`"px! -L2 S   -0L"R"0 02S p- @LM`0P001``0`0C& R 00#!p000 \0C& T 0 "!00 0 Rpph`h@hhh0 -/0("P< 00 $`X" $`00`0 -2倂LMl2Q`@PpvH"Q]*@2QH 82Q* ,B0 0C\ 0  "!0 00 1C&  0 "!0!0 R 鑴$A0@S S  P4@04P404 0S82S Q 8ʉ4Pl8ᖈ0Q 0Qt0. @RL0SLX0Q~~/0ᾌx`h@h2i 1i i i hh05i i 6i( (0-"(L8@SPP X04 0RX00hu\00\00 -4L,p`0 <4 00 R0 RڸQU@ P4<4 ׈0S  0  U@P4 <400 R -5Le M@ 0 0(0 0"x0@0@0C\P8 0  "!L0 00 85C& 0 0 "!%0%0 R5U- 014 00000C4!\ ! 0  "!x0 00 d4C& \ 0 "!,8$00 R$ (K4 0  00!0 0p4W0!4 @& ȓ,0StW(,0S 0 000C b b(0"HT@! @š\  0 0 0d8#x400 P4P , 0 02@ 000凒$@0@0C\ 0 !  0"C600"0  "!d2p  Q$ R 1 0 +10 ,(_84$@h`hXy!hh0`y!R0S 0-x LMP@P0d 2@?@4cST00T0K400 0tH08P It0$4hy! 004 -LMP0 S@@ L0Sl0P\\ ,0 S P0 0LL0 p0PP0pxdppd Q- L⿔py! -LL 0!RP@0S 0 400 84$|y! -L M@K 0  @ {084$ - L R -$PUL@p `80 0\0 ` PU0SS$0  -LM@^  @-(0$@P 8 0S  P0S 0-@(0L PP04@000$3K$  !8M0<0 R0 0L4$ (0 801  A-(0@p8P$0 SQ` 0 S!R`11Q !80<08 0<0 -LM4 PR@p00Q00S0 4000@0@`&2p"40P(010S2@w 9ʐS* ʀS 0401 QP 0S0S 1 ;P 01   0S* S 0S 1 S S,0S0(0S 1  P  0($0S 1 P $\ 1 0 u,0ST4{`4$80 / b0@$0bRPR0B᫪*4$ R0-L@: P  \ʠ/9^0n0PP ^ ࠡ^ږN^ ʈ0/"b0xR 11` 1N0 P0 UB`8  dW00_ Q4$4$hYRA P00ZcR-D P0 0#0ZcR-D(0qL P 00 ZcR-D$0qP  l00  ZcR@- J0@0qL P " 00 ZcR@- J,@ qP00#0l 00Zc@-R (@UJ0^0#  RZeRA P00ZeR-D 0P 0#0  ZeRA P00ZfR-D P0 0#0ZfR-D(0qL P 00 ZfR-D$0qP  l00  ZfR@- J0@0qL P " 00 ZfR@- J,@ qP00#0l 00ZfRA P00ZhR-D 0P 0#0  ZhR@- J$@0\0#0  ZhR@- J$@0\0#0  ZhR-D00q@ \  00  ZcR-D00q@ \  00   ZcR@-J8@0q@ \ "  00  ZfR@-J8@0q@ \ "  00   ZfR@-J@0\ ZefR@-J@0\ Zhc -@LMA/0000(1$@00 ` 00 @ p0@,@ P0C@0 P`Y@ 00#!0 00 t0C& l 0 "!8H 0,0 Rܧ g@h`hhXfh0 -< L0S f0ahp g$f0  g -LM@~LHzDw@ 0-@PLT:0iT: p-LM`PU p@ o o 00 0   PP-|P*|H0   R00f@f f f g@fg g 88#PG-Ax= p0 0C`[%[0 bvb3. P+pg "+!U! ˠ  @ 0,ˠ . 0# 0# 0#0#0#0&, H!0x @fi -84LM RpdBP0K⸩ 0 ,K@.v4 00ca bP`\lQa P P!88S0Q40  4`@`4` 4 @ 4  40@040 4``4` 4,C4 $ 00bC2S0c0S 4  R2P@ b2`8` b0 0Ÿ0 Q00L"Q2Qc pP40|Ÿ04`0q-cpY @E*T:@& 0 D@h`h-ghh0`gg+g@ff y!Pf 0-LA@P (0( R P 0P04@f@ g p-LM1s< s@0 p800 <000`00 P 00C\ 0  "!0 00 x0C& p 0 "!0L 0 Rp閣,@,0D g5$@f@h`hhh0dg5$@-0@0 00Q000 0 S0  0S00@00C\ 0  "!t0 00 `0C& X 0 "!04 0 R@D@h`hD ghh0< 0 0P@-0@0 00Q000 0 S0  0S00@00C\ 0  "!t0 00 `0C& X 0 "!04 0 R@@h`hdghh0 - hh&$00R0LMSp0S 2@ 00P00P0 "@00C\ 0  "!`0 00 L2C& D 0 "!"0"0 Rr0SR&4SZ1  1@ 1 1 bB&! 02 S6ʬ1b1 R0PP00P\!@00C\ 0  "!(0 00 1C&  0 "!0  Q N?C S:#8#H XP 08#H$Z0S+  6BP]@h`h-ghh0 g`gg+g -LMP`%(@3pV 3Vw @3V p(LP0``#00TC000 0C43\p 0  "!0 00 3C&  0 "!0"0 R ġp2VLPtBt2P0  hvTP0P0C\ 0  "!$0 00 2C&  0 "!0!0LP1 ?R#p!00A000 0C1\px1V k:l10Sgg_LP Q1 00 0 R@09 000C\e000  P 00C\ 0  "!d0 00 P0C& H 0 "!0RR@R R @h`hh@fh0R @f gR -|"LM 0,0  0S PRPrK@0 0<00*K(Ÿ0 RQ"%1C00#050%1@00C\ 0  "!0 00 1C&  0 "!1  QTKKKXtu0[p[0 0[p 0 0[[P[ [p[0 `[0.@[P "`#p0@$[P[[` 净[删[剐[`'pU! , KKKKKpK@K@K K @`Ky d  s`  Q xK.u$0 ,0S 8,jk g@h`hLf@fhh0y! -LCM0KoK,0 1IK ȡAT@#!1 A00! 0 0 B␑0 p@P000w   0 0 0 P0U 00! 0`P0oC@0 0\ 1` 0  "!0 00 0C&  0 "!hx 00 R [PU$0 ,0S @,qj g@f g@h`hhhfh0y!@-0 R 0@0\ 0`  0N# P \0(S>d0CSR.0S B 0 -LSM 0`! ,0 `0\1 l `1 d 0\h1 4 < <`P0@p, 0P@@! L H1   <T0@  `00CS<\`!|P@6 ,0S ,i`!T1 S`1T! 0X1 P  0=S d1S(Q \0Ql`D ,`, P @ 4P[0MK/{P@r`4!H0@T,0 00,0, PL1SDQ(A0D ,04P`!0 dPP\1<8L,0@!R  @P2QS 4P@1MK/02P@~41@H `,DdQ$000l!70P00S,0(0l 800S+ 0^ l0 4 Po ^PU \d*!lD2!X0  @00@04   00U \F*!l1!e@X0P @00@04 000  , 0 0 0>.0 N^@PT \*l,1 @e00  0000  HD@\*!l0!X0  @00@04 00#,00S0c,00,i0Cԣ p-L$M@P0`   K0`P0Sp -LsM , `Dܡ  ! 1 儀 |` KpKPPȁ ́ @80S P10`4 ,0S p,T0 0PPT0@ 0 0qPP`@K 40PPoP  KPPC[B >*D 0@xPP#[@P2S@ Tw С 0J0C p Dq@!TpAkK1 0 jK! . . R l>K! \33 5 Ƞ LP!>Km kK1.0Q@ pb 00Cpp!@Dq1T#[@T; 20CS0ȑY: 01 bpnKoK  m?KPH\5 :0\*  b 0 0b$10#[1 @T0 0X o*ܡ  ҃P P㻃pH0!>0kK1 ̑  c. . j?K!#[ ̑ - g{! -BML M 0`3S 0D4 , KD\|4(KD$4$  _P 1D RBB1)p  0@kP@3 (K! !PP"0PS U3 410  3@ 4 @<P( Ph3(K R 0S2 B.K BBK0N\N  B 0C @P00T00ST2(K 0 2PU92 0C8$ @ < S)tttܖCKL C>KL N0C@4O 1s<$84!1 8!Q<4%000 0a00b 1551%2PU1(K0S@10$1x) ,0 S ,S  (P |(@BK@+@a44@QD1D$(K 2 0" 1 008A 1s<$84 !1 8!Q<4%000 0a00b 155 1%1) D$  @V \*B>K0C  0CvP@ B.K B B kP gl9${!d9${! -LLM@Q@D1U d0 ` 8d0K00ipW ((mPp@ `K ((0`0 0<X0 \ 0P0 T 0H0 L :D0 @ 080 04p < 00 0$p (p ,0 JLp0S -L MBpBP ,0 '` 0@P@"@2V*0S @T:@W (( 0 PP: 'p  0P@0 S 0R , \\P -L$M (14 @ @D Pp 0S W` P 0 @S@R*0 S  R:R*0< S S4  Q Q 0S8 0 # S S 00000 0S S SQ 00 Q Q Q Q Q < 04S4 0!H0;H0  D  0 0@ H0Q0 T0S08 ğ (10$(1` 0$00P00 D`00C\ 0  "!X0 00 D4C& < 0 "!0$0 R0 ?@ & `8 5a<0S 4?@ &< `'a? &(10+`M00 0P@0@4!(10(1 @(g(1! 0(1,H0 001D  H0 10 0X(10(1e 00(1 04fZ `M P ?3'0S0ŸP2, ` 0 b42B&! 02 S71b1 R000q`00C\ 0  "!0 00 x1C& p 0 "!0L!0 Ro ?L &L0 001 `oYۅ1 ?L %L.,K P@v(1, 0(100,0, $,0, (00(0,,00C,0,(0 ,I{!@h`h+ghh0@ug`gg+g{!O$ p-LM@P0c0? %Ad`A ^ 0P?z&`p p-LMPU`% *@0 PR@ U: @0\0 ?\&00@pk -LM0PUp*` @0 0000 P00X0#02SP` -LM PR@0:#:S'0:#:S"j&jV ͭPp  @ Ȍ qΌP00` }P@0  -L$M`@. .\0  , @ X}Pp@ 0P 0  00Pp ,0R   . . pɃ -LMP. .\ 0@ p`P ȌqΌ } p-1"LM1! @00> 0>0Q`P 1.*!a!00`G/ 0B!0b0!P PPP0Q*!a!00` 10G?  B0 P P0Pp -T5TL,MfLR$<<*mqV륜 Q><q(멇  R0 0 $0d80S 80<0  < 0DS004`4`D @,0t4Pph 10@pP]HDpD (L< $LP@.0 P24 $03t 0:pW0#3P@@0@A Q,@Q0@0pǏ@K3@K@cFPFPp00 0}XP`P@`*288@@,3 ß >C0 ,!J('Q^o.u0S P0SB"P 000OIDJP0P0C\ 0  "!l0 00 X2C& P 0 "!0,"0 R TrN :20SPQ @09@00 P@ 00!@00@0 1 @1  hZ@@СX0K0  @@?P,i$1$ ZPa1 RPY0 JPQ0@ gg@jD"2g`2g@g5g g9${!` g`g`g$g|hggg@hh$@h`hhh0 gD$e{!wgug|!gg gg0|!(|!4|!D|!4L|!X|!$`|!p|!x|!|!| |!g  P,404 P DiSꖂE @ KA8KI8K ]0 +o -@ LHM0, X 00 TK0P0 T ( EP0 S$ bk`kDp|!|!}! -1Lgg?B>ggg`g`h@hghh0 p-L M@ K  0PQ@c=YB@DB ]BT00U00S p|0T t0d`@GXPpD0`NXT 0@5X@c$$ p-LM@ T00PU00S"d|0#b!T# d0@X R!p<0 XT!0@Wc$$ 0-,0L  , 00S0 00P R 0 ,0@0 0  嗂@0@0C& R 00#!000 p0C& h 0 "!0D 0 R 0h$g g@h`hg ge ehh0 0-,0L  , 00CS00P R00@,0 000B@0@0C& R 00#!|000 h0C& ` 0 "!0< 0 R 0hg g@h`he ehh0 p-LM0!0S`B 00CS0pp1 R!V 0P@ @! 00 041V d0 !0d00S !000phM00S V 000  0@ 000,0 p00CS0l0@0 P8 4 000000Hm g e̹f`ge@ge p-\0LM`P0P PL0H @^ ,0K (P $@ ,` ;p$$ gg $@- 00P 000@00C& R 00#!t000 `0C& X 0 "!04 0 R@~@h`hhgh0 -L M@K⨁0"c11  -L M@K0"c11  -L M@K0"c11  -L M@K0"c11  -L M@Kp40 0 a0`=R C0  g@- 00P 000@00C& R 00#!t000 `0C& X 0 "!04 0 R@p~@h`hhgh0 0-@MLLPLL0 0P\400I P@\0@0HE$}!g}!gg@-A"@J1S RJ1S R2PP1S@P1S 0Q *0P (0   -L Mp @(`T& ,00,0g , K(PU, ,0( 0C,0 Uv s 1B ,0P  -L M`0  P@C  0S<0S90 V5*Y/ ,0(p0,0 0V, K PP ,0( 0C,0 U W* ' ,A,0V0  0P00` d$}! -L,M@ @PpL PP`f ,00,0 RI4dxLd0 S70S4,5 X0*(0P0 D K tP P  ,0( 0C,0P,AP   D0*P,0( 0C,0 ,kA,0( 0C,0,_A 0000  00000 8C80C (0B8 H@K 0 0 00H0  0P0x@0H0  0P 0 00H 0  0S$0<   0H KH00c0S P0`0J"P $1    0 $< 0 @ 0 Dz0S u@K $@Pm2[S 2[8SS C8S S_@  @0Kd PV@K @@ K 0S40S00@0K@K 8Ks @K0S@0S@pK $X@P(2[S "[R R0 ,0 0,0L 0  R0 0@@ K 0S40S00 8Ks 0S@PL $~f}fwt@vt -L pq@P? 0aV,00,00000 ,0( 0C ,0'V 0V@ ,0T7   1 2 1 1s 0T@1 21,@,0( 0C,0 ,? -LM0 ! @ Q 1Psbp 1 81 U J0!'! -LM@!pPW. ,00,0 b 0Q 1s 1 01 U ,0UiT   1 0 1  -PpL(`0S @ @ -LtM`p됀KP@  0 ,00,0,0( 0CP,0,U 0 &0S@P p ?PO? p-LMP`P@! ,0 0R,0 R0S<PP0,0( 0C,0p,)?-P$ P p -L M, p0 , 0! P!4  Y !Z PP0 b Vg0EEW  c03PP TB@Dx8 X0  R@0SB4  c03P- TB@ Dr0 R U  1 2 1 1s 0U 0PZ P00P1 2104 S@ Tp@ T @02020Tp@T$ -L Mp 1Qぐ2 A' O0a \SfN`  SS fN RH02 0"2 SA' S'', "0 00202a ,+S,0@fN00202c0 S00PfN00202S,00000''' -LM@`p PK 0S Szpp1 Q300T3Y0PpN0(0 0 R 0S00PP 0 0Q 0V  000PW 00,00,0 0S00PP@  0^ R1s 1 11 ^ Pl`)1 11g$gg`! 0-LPXI@NU(   @00@0 R @00@002L0020< 00 ,0 0g9$ 202 -Lp<XP< BR R@00@0 R@00@00\2f<0 `P0 20BT0Ҥ 0 '  3' B `@RB R!CR R,0s @` V 0S 0S ` V 0,04 0 8 ` V@ R 0s  ` V@`cVڌ Vڦ?`cVV'  0 g -pL2`0C(2P@U R ,00,0 PU@Z000S0202SP P0PH b2 @ 0 b2B&! 02 Sʂ1b R00 000000 0XR@00C\ 0  "!$0 00 2C&  0 "!0!0 RU8PhXa1 @ 0 bx1B&! 02 S7ʂ1bP R80 800080 8Q@00C\ 0  "!0 00 0C&  0 "!0 0 R w8w0}UP''F'0;@h`g`hg+ghh0g -PLMP`= Q ,0 0SW ( M 00CS 0,00C,0,0 S( p,@0L!p9,0Sʸ0  0S 0S@ R000 " 00C0X@p0K$8K @㲂Kp@ 0 㴂K+,0,0C,0;p0K$8K@@㲂Kp@ 0 㴂K}!gg p-LM0@P3 R.`P(0K$``0KaK`P`01K!K 090 0 p 0 0pp`aK0 90 0-p p (("\ -L`Pp@Pm P- P  00S# 0s 0 P 00 0101 1s 0V`1 21   p1 1  0q p 10 1 1s 0 V 0`U P 1s 1 2 1 U )1 211 21  p-LMP@` T0 @ Tp -PL(p`@0T 0@T  0-@MLDPD 0<PkT, (@0P@bT0HE$}!g}!g -4 L014 s$ 08000C$40$ 0S00 Q0 0 0S0040$ Q  p-LMPgP` 0@ 0\ P 14` 01! 0 00 10Q p,0  g(04 1S01 Q0 0 0S00 p-LM,P"@000R R 0Spd,Kf 1:0$2K1,` 2K$P  P000(0!0 (0p0 0 -LM Kp$ K`uPU0  0 00 0T@IP@ 0$@$  ,0S,P` (00(0 ,00C,0 (0,0j9glC$ -L$M`8 P 0S ,00,0P^P$< B @ P !!@4 9PP?4p P" @0 :0GPUp  0<S< ' 90 P _9 0 0 B 0 4@ W 0l !S <Q8 P 0 4K 408P0,0( 0C,0,80@K 8PP@ -LM0pS, @`PsJ $5Z 0S!4P 8 !4!0QU 8C(0Q PU 0  U 0,0 0 0$0d$p00008  P (00(0 Hp00C\ 0  "!0 00 4C&  0 "!0#0 R| 3 (00#00c00(  ( 00C\ 0  "!<0 00 (3C&  0 "!0"0 RD 5 (02 B"`0000( 0S ( . R`00C\ 0  "!X0 00 D2C& < 0 "!0"0 RX  ,s'ss WSPP( X`48 ,0( 0C,00,0 0  00P,    ,7 0,0 J 80  0V1RU 9P ,0 0 ,0 ,0R*00QU 0V PU!0S C$@h`hhh0g -LtMQ  $`儠 S ,8P,/A#bl p p@K\0 0  & :P p 7R'002c2c30 xK` t0p'x0P p  =9@ =C 0p d7d@0 0P0p0P\ R#00 0 '00F0"5 @00C\ 0  "!0 00 6C&  0 "!|6  QN RBp0Sl0S x@Kxp0\1 pKK| 0cPl=9 A = | |0 5Rڴ%002c2c30  Q0 j0 !! 6 l t0Sr00  #P ]r ` 0Z\0  h0K0`0K0 @hK R 0 0 00  0T ( 9  ( 00C0Z` R\0\0 00` \0 X$P00C\ 0  "!40 00 4C&  0 "!3  Q r1 0p01  (0t0(0  B d#P00C\ 0 !  0$#C60030  "!2  QT80 2 00P00JPyt|"P00C\@ 0 !  04"C600$20  "!1  Q" 610 0 P00P  p; K/K KT1 l <` dA 0@ 8@ XA H@ PPp4/^H0P @` D P P R   R?0@SD儎> P 0 bl>B&! 02 SH1b1 R0D00D  nP00C\ 0  "!0 00 =C&  0 "!0-0 RH00H0 D2`Vp H0#K`PPd7 42 1Pp?K` 0"R 4"4P42p@ ?WpWKH00\F < @ 0 b0#60`  \0>0#60P . "& X00T  Pp\42OK2cX2 T2( 2 KX"P2<$PL  0PF & n|1S0# 42 UE42 0> Pp p@00@0, p0)0,   R ,07,02 ,0<,00  0  ,0Y 'P'[$LL"p 0 y  <`,0S KP2<`X"H2 K( <;P&,0 ?l 0S H R <`S <`@0S,06,0`K <`  Bl? m,06,0騅%@(00040 00000 0  0\@U@00C\ 0  "! 0 00 4C&  0 "!0$0 R` ck^ PL ,0@7<,0L2` 0" 2 0 " 082 0S/KK 82 3_VPpH:i KgPpD 0@ )Pp#H@"D00D082帀8"82@"82$ 8(00(08",00C,08(0,`VŻJ/<M 8X@#0\F ̂2 @ 0 b2B&! 02 Sʐ1b1 R00000  \R@00C\ 0  "!(0 00 2C&  0 "!0!0 R]8PUF 1 @ 0 b1B&! 02 SCh1b1 R0PP8P008  4Q@00C\ 0  "!0 00 0C&  0 "!0 0 R KL"p 0\d'P!ZRjC Lj = u< 8F@ g9$f@h`g`hg+ghh0@ugC$>O$0R 0R0R,07  0H,0e.$b00C jw ? M -LMp$K4 ,@P  `@. PT4(  01 B10R,0 P@( ,K n.Q'00K@8,1P4( 0,0 B0RP,0 ( 4K  T.P@"`V@J,K I.Q'00K@,0P0 ,0`V0P,0 Z  3.@P  -LM40pGH,0,BT6A$ `O4g2g g g~! 0-\P@LTD08 S8008< @hh0|hD~! -LM@R P _ P80Q 40S $1 R Q2g 0-p-LM@0h K` -@ P@ p  ,0P?,0 0MVPg P0-L@4P2P04 `M gL~! p-LMP`  mP@  90 d@@pIKC$|~! 0-L0L@T P0 RP /@T0C$ -LM$P`p@80 00 00 00 p`pp 0- L  0000 1SP0PSP& @0 0C\ 0  "!t0 00 `0C& X 0 "!04 0 R0c@h`hhh0 -L M `@P <<.00 000 0 04 0700700- R  P0ES\)-13<,440 0S  0  0T]0`} 00 * \Hm 0 0CQ 00#!000 0NÃ0@ăG>0C6,0 2"L,00 OPPG "0 0cC61 Tp ,0Ų0 0 d R0 d 0S P00B0 0C\ 0  "!0 00 1C&  0 "!0!0 Rm_X* L\A0 0C\ 0  "!(0 00 1C&  0 "!0 0 R@_7F@Ppp\ P P ppV P p pR P  P P p pJ PppFPPpp@Ppp<!`h+g@h|he`gghh0! -P1Pq L1 bB&!<1`LP 01Aa  S 00S0PP@00`0P0C\ 0  "!0 00 0C&  0 "!0h 0 Rh^ H0&|N @`0`g@hg`h+ghh0e40S(0 !/B! R, R, ef p-LM`xPL 0K !`6 K$MH0@@<0 @00@ N0p?eeee`g*gg -L???!@T |1  dq002`P@05f8!rG6PU`V 00B- P"ʀP P P80B`PK8 A7@8  0`@ \@  @P Pʄ  P|  P P Pd  P\  PPL PD P-0egȀ!,g,g,gh-g-gH.g.g(/g P>0à PP PP @P@ P P   P   P  P P   P  PPP 0-0L@0000P 10 g 0-0@ SL@P0000 0S g 0 0 c-  1 00*00 -RLM@ R`$p0 P0000< P00 0S` pBD̀!Ԁ!! -L$M00 X5P00Qp6 Q< , 4 00 D%`0  00 4@005000$@h00000004`00C\ 0  "!0 00 t4C& l 0 "!<$0D$0 R0Dp40,p0 80 S 08 a R 0007 0D @0 @000$;T0 < 0H00<0S0 D HR00 #HP4 004;00L O,0#p0  00  4@0"@00  000002p00C\ 0  "!|0 00 h2C& ` 0 "!02<  Qu NH G00C00   4 R 4 <0 C 0l   40 l \S 0Sn 800S80 WPH!0@ < 01Q 007000400+ !@00C\ 0  "!0 00 0C&  0 "!0  Q4[00500A '[,0/G,[ P g@h`h!hh0! -LMP;t@0 00 qg!Ce -LM\0@Shl< qg<0S8<0 p-L M`a\?XAP# PPD1)@@0?# @ 1)@@ ?# @0)@`@@ 0R @`9 0H `9 0P `9 0 `9 00 `9p l0`P9p$2g2g2g`2g@0g5g`1g`0gHE$̂!1gԂ!4g!3g!2g!0g!`/g -2LM 2P !@Tp 0SP @TXFژ2`   0S@002 l`00C\ 0  "!80 00 $2C&  0 "!0!0 R 0S00@@pP Z )@AT 0P p @R0800 L1P 0 b41B&! 02 S31b1 R0@@00@@P00C\ 0  "!0 00 t0C& l 0 "!0H 0 R Z)~`1g`0g@h`h+ghh0!!`gg+g,00P 4 RHP g<0 40 P 40 S8P2g`2g<0 40 P 0 SP@0g5g -LPp@P`$ $1P   $@ RD0D0D0 $0S $a0S@0 @0D00PD0^4P P 9T` $1 000p00! R00!`00a 0 10P\9 0  ($1@ 2,00,0 @2g@0g5g0g -LM@ @RD0D0D0 $0S 0$1 -LM 0@ `R x0S0x0 R000 00CS0 hE: C:0g2g -H0P$LQ@p ` 0S T@T $Q 0S L@T100CSW00000CS0 R00000CS0 -LM@T  10S @@T@R    @@T -LM1`NP,@Kp0 @9,4 0> 0, h @ `2Ld p@000P<+Bk!T!!v 0V 0 V 0V P-w 0W 0 W 0W Pu U Pv 0V `w 0Wp,0<,0v 0 Vw 0W -0P`QL  @p &pT  `X  WV  -LMPup@`D 0UA u 0U 0 U 0U fP/v 0V 0 V 0V UPw 0W 0 W 0W DP u Pv i`wp,0<,0v 0 Vw 0W -L M|   0\   Kq@ T00 0 T -L M|   0\   Kq@ T00 0 T p-LMP`@0S ( T 0T 0T P0T P T {x@@@,0<,0p R0Sp p-LMP@ `0S 0T 0T P @,0<,0p p-LMP`@0S ! T 0T 0T oP0T fP @@@,0<,0p R0Sp p-LMP@ `0S 0T 0T <P d@,0<,0p -Lp`@'PPUK!'P P,0<,00 R*0SR:0 0S 000 >P -LMa4P@)003g 00CS053g 0-0LSP P @-000 0-L@P P-000 0R0 $1 6 0-LP@P0 0$ ?P,0  0"R   0-L0QP)@1 Q 0P P0@ )T 0D000Q^0 0P |0 Q P 0T@P$ P ( 0@T@PP2g -LM0SP`p5 S P@ T  <@S0S0 0@T 0 0 S @TW pP$ @T   @@TpP2g p-LM`0PQ \ 0 0Q \ p !UP0UP0PUP40@ PP0000!P0P0C\ 0  "!0 00 l0C& d 0 "!0@ 0 RpS p@h`hhh0 p-LM0(@KP `P0  p0 -QLMp@G P0 S  0R`0S  0REP,` Rڐ0V 0GSHjkkkkllL10S0S0P 0R W   Q0 PQ0ba>0>0  0R0ab0PP0<@0 /000B04 PC$C$$$0S  Z -L8C8$M`,PPKS``@KC\, 0 40  0  "!0 00 2C&  0 "!0x"0 RPK@K 0 @0@0 ,@4 00pR000 00 2H@K\1 pǏLpPKM20S@#-Q QPn`3% q(P KW/ l(0@PpK- P("M2 0S @##mSPU`!q p0奎 @K3' N( I(,@  -(4pW 8<@K  P à ]C@TPa`~ pà&&(@K0 !(4@@pK (Rl@B@h`hhh0 g$ 0-LP| 0\@ H 0hl00H@0@- @P0P=9@ =C 0 0P=9@ =C0 0 S  0 \00Z0?B p-L Mp`@PT 0X L1@ *0 0 pP/00e5g$!HE$ 00CS0)25g0@-P@Q9 P7 SM ,0 4 ^-rrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrr Q \ 0 Q \ 00 0Q Q \ \ 0 Q \ 0$!$ 0S -L M$$@ O 0@[/0!HE$6g 0-LP |0$O/@'*08106g$0$0$ 81081 0-$0L8!PR @$@0$ 810CS810$016g -L M@PD^`$P T T,pKX* !, 0 $ (0 1 $ 1$00$0 1$00$0  1$0@0$0 T  0000 0"PP P , $00$0 $0 0$0 A-P2Pr0@$01 0PAa0!000U8<0b 0110 010@ 1 10 0 10110 010110 01Q d1!4 Q20U 00101 1 0 1(A00C\ 0  "!0 00 0C&  0 "!0 0 RAP1 01 R 100,0,000,040S 0 0S ,07,0,07`h@hC$hh0D- 1B#20R00S1 11RC$ p-LM@ $PP `* @ 1 0 1! P1 01000 ! 1S0 1,07,0P RPpC$ 0-L((10 0P000S; 3S* P@00C\ 0  "!0 00 0C&  0 "!0| 0 R0\O0!8< !S08<1 10@h`hhh000 0-LM$@!1!010P8<1 J0PuP 08! 0-LM$@P1 10 1Q#P0 K P0 1101  !00 S 101 !01  ! 01 K 0 ! 1 0 rP 0-LM$@P1 10 1Q"P0 PK P0 1101  !0 S1%Fτ"0#1%( 3(F ;P -@LQPp% R5P` @ 0PT r 0 R b0h -LMPS`p% ,1@T 40S@TX, Ġ T\0P  V R$@T 40S@@T,  0P V 10 0CSP2g P-Lp`P$ $` P @T U  0 V V 00V U U U @@TP@ U 0 V V 00V U U U hh -PLM@y P h p-PLM`P @T U  ,0 E@@Tp -LM,A P` $@p 1 0q(,$am&0 <  < !p !101!  1V 0 1 0!1 0101C$ -LM@,`Zu t  +,$ 0F s1d1 10  "0S00ć $1 RN P03800%700, 0Z0 Y dd"00, 0010Sb S3 82 T02  Y( ",0B0, 00C\ 0  "!0 00 1C&  0 "!0!0 RoL,   V! U X 000l0S  5,0HZ000Z l0S010n.02S200ć,   20Z00S.10Z00S H0,0O/`0  +U 10SdC$@h`h gȹfhh0 -L`!,03P & & 0@ , , !> S` $0" 1 S S  S50 0040SC  $1 RHO?, 1 B"P0000eP0P0C\ 0  "!0 00 1C&  0 "!0!0 R L 4A41O0 P000, > HpC"P00C\ 0  "!0 00 0C&  0 "!0| 0 R, ] PZ 0@!>000UK$2C$@!@h`hhh0L!, H*010,  -1LMP@0  p$@  $1S0,0 ,1(00 0100 ,0 Y`a 10  1011  !1  1V0 1 01!1 0101q00C\ 0  "!0 00 0C&  0 "!0 0 R0 <  < $ Q001$1(1,1000,00 0 -Ko g@h`hC$hh0 0-P@L4 0(X24 3  0h`!x! 0-LT, 0*00@0, !@P0h$0$PP>C$ -#LIM0,  ,0 ` @06:D R @0S hß,0 S X,V0^ P 00Q D@K #0130K- 0 @ ` Pp 괐JK  0Pp80S p :0 @W \, $164d JK#P@CK0 0 JK 0 !,000R/#,00 pK|p $$tp $1|@K\0 (!Tp X 06P0 &L  Ơ0H Pp|0S'T@L0TJT@ P ,0  Ppp P`?Pp L0T@&@,H0P "b 0 pp`*p  0'rPpx, P@7[0  pPPp,,  (0 R$ g!! vg>D$ - L tN -LM@P`pT0EP@SԐܐܐܐԐܐԐԐܐܐܐܐܐܐܐܐܐܐܐܐܐܐp $ 1 01410 g4 1S01 Q0 0 0S00 0S 00 0 P -QLp`0S @PU 0 0C W0SUP!P P 0 e00 0@epe0 STP 0 0S  G  0-LM0PS- 0SC)@ 0R0 0S S 0 B0 0@0@ 00 K` P 00 P0-LP@T*@T:P 0S* !0S:0D00/묅! -L@`p PP0 Vp P  00 00S0@ R0000 0 p-LMP @T @Tpp@T ` R0000 0 V@T} 0- L@PP( 0 S600D$ $0R0000 0 YD$ -(1(qLM0 P P 3a@T @T@00C\ 0  "!0 00 0C&  0 "!0d 0 Ri!H0`@T @T`h@hD$hh0 -@ML0(( I@ 0I@:g!8gȅ! -LDM0`SP\` p 0B Sz!XK P@DX00C Shx̙ԙܙT0娡 S PF\  0P@`"X*\`0 \KA0TK 0 @Q X0 T  Q  @  3\ 02P@  0\K P@`\XTP-D@dP@xP:g| `5qw -LMQP`p @ 0B6S6tltlllllllllllllllllllllltlllltlllltltllltlllllttttttlt0BCStꔜ̜Ԝ0@TXdܞDDlܞXX $<DXXXlxȟ08@HXXX (08@XXX`xȡ5 .p5l5 IX5Tş 08ş4ş 7$K,0 PPX 0S( Q40S (qğ0 L@P00X00SPT4 pHD0,K , ,0P0 ᦶ'33 ß0 L@YP00X00SP |3 0t 0oP3bLßpHßnDßl@3 ̠,ßd 0Z 0U\0O2Q 2 R 0F A 0p@2 2 2"0*A 0pm_T"P"L"$2^ 2R  0~A 0+A0K 00 PP 0 0BSr A 0@p!l!h!d1 ϠI-A 0oA 0pA 0p 0 0PPeA 0p T!!L!$$$8g8g`8g`:ga  g`7g@:g!M$M$ e@fD$cga0`g`tgg hgD$($C$C$Deg`ig@yg`jg$ -L M@ \QP@@ 0L S(HPlxģ4<X1 -1!0 1!06!0 0b6 : PD10S<1P$1$!l0   A 0@@00S $KP $0-阀0S p0 pP0dSd00SV 4dHh9$f|he0#!`age:g8gD$ p-LMP@`  0STRPPP   0T0\00S p p p -PLM0 @ 0 SR0 \K  0 @0@-RM@P 0-P\ \Ѝ0Ѝ0@ p-LMP@`  0STRPPP  0T0\00S p "p p M-PL0@ 0 SR0 \  0 @ -LMP  -LMP -LPp` @U  0S*T S 0Z030#WQ$U T 0S: ;0W0P00S 0 00@SC %00@C -L@`pPPT 0 S:U T   p-LMP@`P  0S:T\P P  0T0R00Sp \ p p 0-PL@P 0 S:R 0\  P -LMP@p`& V00P P P`FU@ /V0 0`F P0@PU0h00h  002y?gg -RMLMŸ8% <5 8, \80R L% H5 Qx Ru0SrD5 2@ PU 10S Vc,<LhH40S! PU@\@ 2 8%R H 0b<%\0 1 ,0S ,1 H5<;0L%R D X\H5 0H5 OK%Y 1%.# PD%  BiD%  X*H5;RNK@D @DE R/PR/PH,0 $1 R$1 0S 40,0 $1 0Sl00 Q0 Q Q0SS`SppD ^0 g2g2g؅! p-LMP$1`   @P 0A1 0BRSo0 @0S0c 0($0$!014,C/R) T"00C0H0S40X2$1 &>\"$, ?  R; l0d2x0S0 1h2|0l20@S$1  Q020Q'(0 @@? -@@ xB0 @0+.@P P0p0d2,0-@R$A,A0A4ACUTB0#!~w -LM% D  0 @( 00@ 8 $0@ @$H 0PP@@1X@ ` (0@d0, h 40l0H0S40p0$1 0S40t0$1 |@x 0 @ 000 00040]0 -$11=, / $1 R* l00x0S00|0|0@`00 @ 00d ̊ h0B0 ^  .0@0 1!$!1(1 !,!10#03O/ M? 3 } Nx$1 41 0BRS01111$ 0 R`00`0$ 0 R`00`0 R P  =100CS> @0.00S0t 00K z_!08 K0 , 84001! 0nO 0rϊO 0vO 0~oO Ί 0O  $0冏O !(0O ,0O 00O 40O 80O <0O @0O D0O HP00 TL0L!0S,0 =9C =C0 ,0 , 00 2$"0 00C0,0 ,  (41 !01 !0@ ,1@1  00 00 >!` `0X Ql0V/@. 003>6?B12 -QLTMPQ0DSuP U 100CS,0   f  000  80K`0 \ H D T P0K p`KX @` < XKw-P`T  40 T T4,0p p0 8 0px x tP 1p  0APd l 0wSu*dKt P`rxP K0@@ h0K `0 `0KH \ X0 T D < XK7-P`[h0SS  PK: @ #: Zc`KX `p \P T HP D < XK-P`@P@*0S @T:0l00S0*d P`* d0 T h0d 0h0   `P` pd0A0 d0 p x0t0Qx0 t lR:0l S: ` D0dKt d0 `,0  TT070- -LM, @ ,0Pz0S} b PU ,PUPiPb2|"@`@  @P2  P@U`@ p ,0"S0f "'e,0 @ `14 8  @ 0H $ P ,0X 4 ` <0h D p0L PTpUV00PC00,0  X UT 0PU ` ,0 @4 8 0@ 0H$0P ,0X40` <0hD0p0L PT`U8g ag@agee`ag0#!! -LM7@-QM @`0 PL0\ 0S \ 0L Ѝ@Ѝee p-L M\@` Q 0 oppQ0 \"\ 0 1PU P P 80K00,0 #0080pp 0!pp`9$H9$ -LMHğ@4^P`@$4^Y 4D04`  T 00C\ 0  "!0 00 3C&  0 "!0#0 R(`00C\ 0  "!80 00 $3C&  0 "!0"0 RI=G=괂2p0 >  `lP0 S0@@0Y@0Z P ,0 0R,0  10| PUml0S`  1 @00@0; ap00C\ 0  "!0 00 1C&  0 "!0l!0 R1`1`!, 0 ,0# =U,0 Z U  R ,0 10 @PU $ E00P#Y p+<x`p00C\l0SD`010\Pp n0d gcg`h@h>ghh0:gh_g p- PLM`00@00l R 10S, 4,0;,0@`00C& R 00#!x000 d0C& \ 0 "!08 0 RpphN< `h@hhh0l0-SL 2?\ 00S00 0Rl0:g -1唡LM0 0P0t!0p`@T l0S+ @T4A0 0C\ 0  "!0 00 0C&  0 "!0 0 Ro; l 0`FS10S0S,0吀010 CP P000V8-`h@h:ghh0ȹf`fg -LM 1r1/AbP( $ (@Kʨ1 RQژQ0P\ 0P1 xb$hh!`(000 b0 0<cQ=9 @ =0 , ,0 0 ,01 Q=9A@ =C`00 0 C\ 0  "!0 00 0C&  0 "!0h 0 RP>;0QMb~!8ggg!@h`h g?Bhh0 0-LM0PKS@ SE 00! 0-LM@ P 0PK PQ Q0C0 0-LM0PSX@ S0 D0  0QK 0 00dPʚ;$ p-L,M `K@ P p 81(PK 0@a(0 $ :PA0S;P00P Pp0#PS 8Kٻ4 ,08c00Pc0 A00 , 0 ,0  ,0 c00PcX0 A@ 0@ < <0 @0@KS@P g>gh0C -LM0`S@cQ1p(  0S2 4KŒXAp00C\ 0  "!$0 00 1C&  0 "!0 0 R ]9T: ,`KP4@KP 0S#Pu<K[,0S(0S S8( 80, <0P=9@ =C, ( , (0 sŒ0$K $0 -P?B -LMP Q`^0S@$pK0  0=BR L0 00$ S ,K ( 0,cP=9l A( =, (0 , @Q 0R?BL0Q R 40RQ R 00R0 ?B$0S0 0R0$0- R \b =9 = L 0 0 aS 00S 00S0S 0 000 aQ 0=)0C -0 p-LM@ KPj  0 `0nRC(0 ( =$ (0 $ S` ^P 0K ` p $0S -LM@,KP?( ,0 `p0l=RC 40 0 4 0 \`P 40S00K p00Z`` V000000!0 Q00_g?g00  0-PL@E0  0|0  0 c0cR 0 0 PP$0hu00 PPD$g_g -LM@<00 0 00000hTD$ 0-L01 0RQ Q 0!01 P01   N\1\"0 0R  0!01 P 0 0 0@420&0K 0R  0!01 P0 0 0@8 <1 0R  0!01 P01   P0D$g?g_gGg -LMq0SA ܁a 0 00cSZSO S1"001 000 0bS9 Sl1"001 0000cS$ S<1"00! 0 00cS  S1"00! 0SoS0&0"< Ѓ!S0&!<0 Ѓ!S0&р 0!< 0Ѓ1S`0&\ 0!< 0Ѓ10 P00$0@Z_gD$?ggWg -LM@PT 0倐0c/a"|,K0K a a0H0\0  b,G$0.@T?gg,!T! 0-L0LD@<84PK@TP0h gl!|!D$_g?g -$L  \ 0h5 _gD$( p-LM(`0PS@ p 0@Pee -P0LM D@R80(0 h-eee$ _g -LM,@0(SM0e _ge -L M aPQ@ P$ P p0 pP@ (0S PQ ڴ00 p K00, 0P@U4p 000$p-eD$ _gee$ -LM@rP 叀 -Le먆! -LMq0@ #10#P0Q00 Sa 0Q 0R .4 0=T0T5i20!p-0 `(0@#T *L0T!DD0@#T:,D$!Ԇ!V!!;!0#!85!!! -LM@΀.!Pp  `T\0 T`\ 4TD0 T,iD$!Ԇ!V!! 0-8P8@L ,  $0hZ e@e 0-1LQP1 1, 0@00 0 000C& R 00#!000 0C&  0 "!0h 0 R X0X CaD D00hw4 g@h`hhh0$gfff`fȹf -3L M0"40 40Q000 2, 040 2@T Ȓ10 0CS0 002 h Q5h0 @T;tp2,oz```, 040dQ0hPd0  d4  `00r00h 0d0 ``00C\Q 0!!  0!C6000 "!0x!0 RK0 `000 1Q <1 T 10S* $1.`00C\ 0!!  0 C6000 "!0  Qu 3s,0 lP0#1!S /0 03 ghg2ghD$_g$@h`hh0 g p- LM0 P1R@0``00BP0 0CS0 k P 00CS0`ph\h p-0PLM`0 0 @0 . @00@0`0`0C& R 00#!x000 d0C& \ 0 "!08 0 Rpph-3`h@h ghh0 p- 1LMPaP;0@0 00 00.10 D00D04@0@0C& R 00#!000 l0C& d 0 "!0@ 0 Rpph2$ g@h`hhh0! p-L1 M PK`t 0PT 0  cR=9a  =  A 0  0!Q=9A =C 0P0 R0S @0S0S  000  @hɳp   0R 0R 0@ 0S gg?B|h( 11 R00 _g@_g -LM10@S$0A,0 1 0S,0  >0Sx x000hht,0  O?Q0A 10D!h_gȹf`fgD `0< 0 0S0#0(0 R0 h_gȹf`f p-LM`0@0$S$0# `0P00`00P0P0C& R 00#!000 t0C& l 0 "!0H 0 R01S,0 և Ƈp1@h`hhh0@-@@@@@@0 00 00@D$`g`g`gag -LM0@S`p>0S,0S00S7  0PS0U 0S PPpb0SiY0h U0TP0S <J4Gsp0B`et!!d!!! -QLMp0 4 ( ,  0  Q0$ ` V P0S 0 S 0B8S$P0S`V0 R ,Q $0S PP0,`@08JC8 1!Q4K 08SV`g`eԇ!! Q-Lp 0  Q0`V @0S 0 S 0B8S$@0S`VP08JC8 1 !Q 08SZ00`g -LM|P04 H0( 0 `00 ,0 $0 JPp0CHAA0P4K 08S,p$$ -@Pp L4`V 0 h$W  0[D$ p-LM @`PU 0 phBp! -PLMp 0 QP @@YP` Q0S00C $@@00 PW2  X  0P @0S S $@0SP d 0R0 S0 0R,0 S00`gw!`g ! -LM`@/PpU PPN ~0 S0 (0 @00B 0\! P7$` 0\V@@Tʄ@T@ P fAOV 0 !R0,0  u0V|tq 2S00S   1S Q,!@!x!!!!!Ԉ! -L P@p0`SZ 0S-QP V`0S S1 $0S R 0(10  0@  0A   T1S RR  0000S Q0 0Q B 0 R00$P  $`g! ! 0- 0L 0PS-(@ 0 0(0P (@ 0- 0L 0PS-(@ 00(0P (@ 0-$0@SPL < P0  0@ P0 0 0R03:00S 00 0 0P000 0 0 p-LM0PS`  0R:0S00p@00@0@-,M@ 0P000^03:0S#\ 0^ *00  0S   @00 00 00 0000,Ѝ0\ 0^ : 00  0S   P0@-0(M @00 Q \ 00  0S  0000 00 0000(Ѝ \ 00  0S@0 -0pS0`0C0D0< L0bD0 R000Q  0S00``80 0C 80 hI<h0p)@0P0  P0P0C\ 0  "!p0 00 \0C& T 0 "!00 0 R !@h`h`ehh0 -LM `@|V`Pp0S:000 0`00@0 0WpUP@ 0  40 Ph 0 `0L 8,0d$pT`DH000P0 RS 0 /">CXh05|%03h05 5P%(PB2|P5p% `(`0<0`PlP t0RxPPPPPPPPPP 0PP00 X@@XP0\0 @X (0 Pc<<L 0 P[ HE$@cg`e`cgD$D!L!`eT! -LMX @R\0T \0\00X \0 P PQ  Q4Q0 (00  0S00@eD$  p-LMh0|0P` p0@0 0000@0@0C& R` 00#!p000 \0C& T 0 "!00 0 R @h`e`hhh0 -LM`L HpP~ PU2bP@  PUT  H0HL 00T P  d00d0l` 0HL 000@Tc R0000 0 D H0 B0D H0 R00C0 R000  R 0PP0 00 S  R000 R 0P 0 P0^0D, 0Q0:*0S"0S 0S0P 4+HL P*a`D"p! 0-L(MT0h @ |0Pp0 Spa\h 0 0S0PPP 00C0D00 HD0d0P A H 0d0 R0000P!04 0S0T0  p0 R000  R 000彠<00CP 0 R000  R000<Kp 0 S:`P댌!z -<@LAPP`@-P@  kpWT  00V000`F400 R0"40%T i -LM0$(S00pP 0@`p `@ 4h0) xt 0Q0xxZ0@ 0j@<D00@pD0 0@0 p@@ 0@0 S80p0S800p -D ,0LR@p:PP  `VU  0D, 0Q0:U p0S000 Q0-LP, <@@# D ,0R0:0 Q0-PL <@@ 40 p-LMPH`Q`3:Qq 0L`` <@@4p -LM0`S~@0T80  @T,K ኟPU 8 00R8 K @,1 d@4 $0pLc^=9 =4p 0 00 40SKPX8P LqP R000 bh0p 8PUJ @0000@0@0C& R 00#!000 0C&  0 "!0h 0 R D0<,0lS:{D$@h`h`ehh0 p-0@LM P0Q00 0S0 00`PP00C& R 00#!x000 d0C& \ 0 "!08 0 Rpph`h@h@eD$hh0 0-@LP 000DP0P0C& R 00#!p000 \0C& T 0 "!00 0 R00hG@h`hhh0 0-LM@PT $ 0@T0鰌! -LM0SPp` cSlSpS0`S(h@ $0`@T,L<D H0V 0Sh 0SL 0S00S7X h0( Z% X"  0,`V  @P PU@Z`VXXH،!!!P!!!!!! !V!4!X!!!!! -L MT@0`VP  h0 Q d` 0`]pW 0`V R @N` 00p`EpWx-!Ȏ!! p-LM@PT`  P@T @T  P@T@T  P@Tp-$00 (0,04800  0-L@PG R0000 0 0 p-LM@`P ,08 0 B8 ,00C ! \0 0pP 0SP00000APP 0Sp( P `p -LM`pV 80080 0 1R 0 0`V 0SK`V,A,1P    P0P0C\` 0  "!0 00 0C&  0 "!0 0 RViL 40 040 00 ``0S`G@h`h`ehh0 0-$0LS@P0h( -LMP`Upb 0S 800C80 0B! @P 00S$0SM0SY> 400C40 R000 0 0  R000@ @0@0C\ 0  "!0 00 |0C& t 0 "!0P 0 RZ P(@h`h`ehh0 h: |X8 -LMR@p R0,0 v nR 0Z0QQP1! 0P00 ,00,0 P U Pxa00C\ 0  "!D0 00 01C& ( 0 "!0!0 R%Y00U00SP P ,K P `0 S %`%!* +RZQPZ00Q0S @h`hD$hh0 -LQTpL`0S C3 1@ 0 00@0@0C& R 00#!000 0C&  0 "!0| 0 RZ0S P @h`hhh0 -LTP q 1`   0@ @T d0 .X@T00@0`00C\ 0  "!|0 00 h0C& ` 0 "!0< 0 Rhmd @h`hhh0 -pLP`@XX^\0\0\00X\ 0X0 \\ 0  `\ VV000&  0 L  e|h0< e0   ?e@~h0/ ?e -LM@ 0@\! Iꐏ! --LMxP0Sp`A \ LH0 R $d@(@ 02@cg!V!|E$He -LM@0 HD00S S (Se@hha@꬏!Dȅ! --!LM AP00`00C 0ppP0P0C& R 00#!000 0C&  0 "!0` 0 R P0\ 0 dps`h@hhh0bg p-LM`0@< 4PK0 o0\ 40[S  c0S >\ 0S p g!! --1LAMP0` 0ppP0P0C& R 00#!000 0C&  0 "!0d 0 R T0\ 0 p_`h@hhh0bg -1`PP1@p  T00SL h10SP@p00T00S@%10V00S VV 1 R 10  0\0P` P00 0R W 0V0Q00Sh>d00 S000t/PW  0T00cgfbgcgE$ --L0LM,  $!0 \  g,0 $1  R000$!  P 00CS00g -p-LM@TP` 0S 0p )P P` --LM 0 --00LM Q0rd3$ -p-LM@XXP 0`@^00@ R `plE$xE$cg p-LM@\PX`o  0PP=00@ R PplE$xE$cg --0 L M@T@ K ( T0   -L M@@T ( 0 K T0   -L\Mϟt  Y  0R p h P l , 0 h p H X H0 %PP p H0W0H0 X0 0  X0  pX00Y00S 0 H0 0%SSRO HT \  pH d ` H L H L  0BZS1,gooXgoooooopggoggo`hxhxhxhxhxhxhxhxhxhoooooooooohoooooooooojooooo`kookooooooooo(`plhooolhoololjmn noolkooPpo\p0 x P`\  \ \  h`d `0V`S`T`T| \ @fT@Dp PX0W0  X0 p X00Y00SP } T@D`Q X  X p X00Y00S` e |\r dh @bT@Dp 0PX0W00  X0 ` p X00Y00SP F T@DhAqh  p P0W P0 X0 0X0 > pX00Y00S & h  Brh T0 \ @fT@Dp PX0W0  X0  p X00Y00SP  T@Dʯ:X ,0S ,20.\@fT@Dp 0PX0W00  X0  p X00Y00SP  T@Dm `  cT ` X0p 0W@0X0  p X00Y00S  XTX p X00Y00SL009L  D@Kx(0`x D0[ Sx  p X0W0  @X0 pX00Y00S v 0S ! x0@Tx0  D !0O0Y XPp <,WX L pX00Y00S O x 0@ TX0W0  X0 1 p X00Y00S@ 6 x0@ Tx x@Tx P X  >X p X00Y00S   OM  Ix 0 Sx0 Sx =D@K &bD@K&_`\H 0  H0 `0 HT T 0 0 SH\0 ܥ0c\0 H0T T H+0 H*QH L  L@00L S H L1H 0 L0 RL 0@C0Tpp0 @0Tpp000 HT0 0T0 @HL 10L 0 B0@C RH \@ }TT T  m 0`00 Vb WT0dp 0ãT0 d00Q0S-0KP0  R0 :R 3P0 ah l% >P &B`PbP P(K 0a0Ch0 1!`PP0aP T  00S000aP V0 nP00cP0 0 z`PV PP000lP  U- Pu`` TT @ 0 Po0  PoTT T  0` ` wT00   T@0 00  0 P`P`T00T0 T  0`  T T@ 0 P`0 0 P`Xl T   0`00 T 0 00S T TT @ 0 P`0  P`0DK P 0 h0 ` D KH0T @H lR H  TT0 0/T  0X0/ + g!!!!!$!3$8!@!T 0X 0 T@ 0X 0 0 X0 0x0Px0L0 8 PuoL 30 T0P` l 0x T0 L 8H  V 0S# T   0`00 V0 S -Pu`` TT@ 0 Po0 0 PoR, T!x0 l L0  0` T000S T Vn-0Pu``0 iTT@ 0 Po0 0 PoL R D0KD KP0 h ` /t0Y00S00P0 P 2R W P  P PaPh hp ` Ph l  w -LD" -@LMr! 0- @LT0TP000@, 000  0 0 000@0@0C& R 00#!l000 X0C& P 0 "!0, 0 R y@h`hhh00@- 0P^c: 2#80S$H*,0 9,00 0ȹf -LM,0P20#0R0Sp` 0Qc : <"K#80S $H:@@<0S 2[02KP  E-Ƞ@0Sp0 p `P@ 0@s  0R0 s$0@S$P10 R$0 @$0@S 00C0$E$E$$E$ p-LMh`@qP T0T Q 0QUqU@@0p0@PE$E$!!,0, 0$ Q 0÷HeE$Lecg -LM0(h h`k\@\ 0 0S<:`80 X000!cgLeE$cg000 Q 00LeE$cgHe 0 S-L< 800( S $S \hXꌏ!E$̐!Ԑ! -t0@LMA \G0Svvvvv,h:$8h4$!!ؐ!!+" -LMA0@Q!ڀ!0Qx @ ^d!00^G@HTHi 0S0CpP8c% U#P@,  ,<0,0 R,  1D 1 D 1,0( 0C,0   Z<0L@ 0S<0 L 0DkE 0-04PLS@ SP0/P l 0R0000hg p-LM@P< 0C0P04 A !P0000l 1R, ,0@@0,0`P00C\ 0  "!0 00 0C&  0 "!0| 0 RpphH10S D0(  @h`hhghh0 hg -LpMW,0 P`*0 S0!P@  ,00,0 ,0( 0C,,0 0Sp`VP:,0pDp 00 -LTM0d Pp0dS0!h XH0Kp0  Pl dl pPP *p0 R0:z 3 PKBa2a11J"c11L0 P 8PXKL T0PX0`#PP L =9@ =CP L0 t ,0,#@0`,0h0p nh0Sz# X@KXP0\ P K`K\ 0`cPl=9 A =` ` \ ` \0 2Rڄ"002c2c3t0 lRl2@0  , @ 80S' W0SD00CSD0@0 (0+Q @0$Q0S WpW Q @@  81Pt B@0@0@(|0@0<@0e Ҵp@ < @0^ <@0Y*0#p@@ 80Pgt @00@0|| 0Pp@0 p@0@0@0@0j<@0e@hg!!0Q$ 0Q |0Q 8000T0Q L0Q0800S@0@000@0}ff@ s@~fs -LM$@pA`|0 Q>x  0,0CS0 p||tf0g -LM`lpS0 O \I\9夠 P000K<P00C\ 0  "!0 00 8C&  0 "!0(0 R#  0@D  D @0言 $P ";p05z  R @mi0SW 0S `\)W}p ^W~p\W; A0GS p  @ p p  pWpW p 0Wm0!0<"p! uW ZXx W ZI0xW W W{Wt 05 0. (0r05WY   ^DAp09_(0S-@020W0S 5 %  x0ph 0@$  $ e@h`hhh0igig(kpd@ig -LM p0Pğ 0@d 0 d HP X X X X D a0HS H@ > 0; `0HS $'A0H\XS X #@0`HP``d0\0d0P "30 X00S =S  0@d 0 d HsPP"0?0SQA0 0(!)^  so  0@d 0 d  0=`H 2PPT JO  L-0c Z0 =P0`H j̐0Od  d `00C\ 0  "!0 00 l0C& d 0 "!0@ 0 R-5ig(k@h`hl"hh0 -PLtMUp`U=U *=U B=U *:=0S&$| 0S , x0\ 11F0S (-=@NP@ <U  `<U' <U M<U= <U  0`,0L00p +p 00C\ 0  "!D0 00 0PP HR @02UTP@  P  Jx Q}™$1| QQ,0N P 0Sxl2P l0U0 '*h0U` \\!`0唑00h "P@AhP`0#h0P`0y  41U $10U0 U1U 0U:0U00U :00St}trt^t ߀_gLK$ht@nt t t t @h`hhh0at 0gt@ot f@pdst@wt@t}ft,@K$~ftvtbtetf|!gtt,dL$tut t tt - 40LpA0MA, PPqP!0A0`0=@ .H0SYZ/T)@00C\ 0  "!0 00 0C&  0 "!0 0 R 3,, P 0 p0pd@h`hhh0 4 00-$!L0!@P1s; s0 0800Ppd -LM0@  (0 P0S0 -1aLMp @ P H0Spp% 0  0S H0Spp 0  0S p 0H PP @p00C\ 0  "!|0 00 h0C& ` 0 "!0< 0 R+`h@h\K$hh0 0-L@PP 0 -1aLp  P @ (QSQMp0 >;-p0.( Ap00C\ 0  "!0 00 0C&  0 "!0 0 Rhmp0! <!p0HQHP%HP  ( `h@hhh0pd (K$ 0-0(  SL@P* Up0@0  (0Sژ0  P H* P 0 0S0Pp0@0p0p0@0p0DTp0@0p0 0-0@P L p00p0/P0P0C& R 00#!p000 \0C& T 0 "!00 0 R00h-`h@hhh0 -0LS0 -L  -LMp@  0 Q   m ̌1 0p1'P00C\  0  "!0 00 6C&  0 "!6  Q0S  0006 ,0S D,ܶLP00C\ 0  "!0 00 5C&  0 "!5  Q0#  `P00C\ 0  "!,0 00 5C&  0 "!4  Q$P00C\ 0  "!0 00 l4C& d 0 "!44@  Q0$|0$ R 0 XRd 0U 00aH0 S/X X!ڜ0PH &=P`0ß=p0Od P d eʤ0H0 SXf0 XR,H0C\"P0 B H0 S;ژ p"2HpP00C\ 0  "!t0 00 `2C& X 0 "!(24  Q 00S#0>P00C\ 0  "!0 00 1C&  0 "!`1l  Qv td!?0 PX_]P0pH|H0 SmxdR1d#pK iP ?  , ' x0P$ 0! 11F0S  x0@ t@1P0  q0 g@h`hDK$hh0! gig\K$(kLK$_g -LM 2P0S@ 50 -R" B?D0CST@0?0S | HHH HH-0B= ? z 8CRԡ!0p000p 50>*,Kmp =P@ , _P@0p 5*DA0p 0 0C\ 0  "!0 00 0C&  0 "!0 0 R-=`b0V``V=J`VZ0@   p0  :p0\(k!@h`hhh0 Q0-L@PA  UPE0 -LMPPc ``1 (`(pK  P@ (N P@`P@ (= P@p0@:p00 0C\ 0  "!0 00 l0C& d 0 "!0@ 0 R0>0=@h`hhh0 0-p0@ 0L50 "20#0 P0S @P 0P0PU00S P ^U?@0hU0 -LM@p0 ∭t hyxj0s S0s-t0 A!`?̠0 S S \h\ !h3 3#2 11>gfffON -LM`P,"0$"111;/"b111A|0St xQo @TPi zPP@@T10S4 S1 1R0 0l$K0, K HAN=0S 0 $00!0 $0 q?B6c$ (N=0S(0 ,0 0 ,0 ( (0?B6c, kh01c1 @R  1P2;P 0 <0(/0"bTP uDJhQD!T!p!!!!!?BHh!̪!ت!!P@-) 11@0NS00 DRP 2P# 0NS00 DR  R R 0RS,  ,0 4 40R,0 R4 40RP` `0RS -!qL`0@ 00p P( (R3 P. `A`00C\ 0  "!(0 00 1C&  0 "!0 0 R }@`00C\ 0  "!t0 00 `0C& X 0 "!04 0 R`h@hhh0 0-LMP  0NީP>T00  ig`ig -p1pQpq` L0S@ 0 >0H 4q`00C& R 00#!000 0C&  0 "!0 0 R  ( H t00 h @0T0 0@h'5@`h@h,ghh0ig`ig, p-!LM0@0C0 hQR 0\10  0 (H010 ` 0 b1B&! 02 S41b1 R0@@00@@`00C\ 0  "!0 00 0C& x 0 "!0T 0 Rpph>㩇`ig@hig`g`hg+ghh0 -0  Lᭆ0 Q l00  (00H >1>1=1p00|  x0S0 0h0$0(Q`igigjg -LMQP`/00CS 0\dlt000 PiH-p0l0h0PpT0T@ 0  p4igig@igig`igjg -P@pL >8޺0E/>1 `W>p 0 0P0  ź -LM0@S0S000A?⮺>娺> p-<1<LMP ` @T Q` 0 0c/.!1CQl 0S0000DS00 0@P00C\ 0  "!t0 00 `0C& X 0 "!04 0 Rp`h@hhh0 -p1pLMR`PpL0S 0\@l0% @l T@ ᕾ00S 00`d d0Vp /0SS@0 00 0C\ 0  "!|0 00 h0C& ` 0 "!0< 0 Ri40`h@hhh0 -1qLM @ `^ QU 0P e= ^N ?>1L 0S10`\A00C\ 0  "!0 00 0C&  0 "!0 0 R^N 0\` ^N 0 0H`F V0`bк`h@hhh0p@-H1HQ` Q000 0 QR @0Scc \ 0S00 ll 0Q  RR  @`00C\ 0  "!p0 00 \0C& T 0 "!00 0 Rpp@^`h@hhh0 -P"PrLP0@ 00 `R^ R0SP 0 0 0` 0 @\   ; ?>1 @  0 0Q00  0AP00C\ 0  "!`0 00 L1C& D 0 "!0 !0 R?>1 @  P0 @P00C\ 0  "!t0 00 `0C& X 0 "!04 0 R`h@hhh0!R0@-@( 0/.PQCL  10C00%0b 0R000 R00a # B0!000?>1 A! 0 Q-L`Pppā!000 R- R0SW 0 0V$ R! 0 @cR@cT@ z`dPp 9 00S 00 0V  R@0 0C\ 0  "!0 00 0C&  0 "!0x 0 R 0 AZD P0@h`hhh0!@-0@S 0 00\S Ch0P 0\Q 0 0c/.!1CQ<0 e@- `0R   00\ La/.!0AS1@ e p-@1LM8@ ` R 0S00C0 00B 0Q` 0n/.!1CQl0S0 0P@00C\ 0  "!t0 00 `0C& X 0 "!04 0 Rpa`h@hhh0 -!LM0p 00 RAI 0S 0R/ A0 0C\ 0  "!t0 00 `1C& X 0 "!04!0 R-p @D`KPDK@0 0C\ 0  "!l0 00 X0C& P 0 "!0, 0 R `h@hhh0 -`,0p$1P LP@U @ Rn 0n @]p -LM`,0p$1P HP@U 1n 0n @U8 000  1C0\1 0  "!0 00 0C&  0 "!0d 0 R $0 00  1 jh@h`hlghh0`jg -Qء@P0L "   00ƽq@0@0C\` 0  "!p0 00 \1C& T 0 "!00!0 R?V; 000  1C0\1 0  "!0 00 0C&  0 "!0h 0 R  @h`hlghh0`jg -!Q p0!00L 1@0C1N 8P<0<0< 81 0 10 `A_p00C\ 0  "!0 00 0C&  0 "!0 0 R (0S $0, $4r~$8# `h@h`jglghh0mg P-L@I a吡吁qP 000! 10C1O 8P<0<0< 82 0 10 $@P00C\ 0  "!0 00 0C&  0 "!0  QT (0S $0, $4}$<宽` @h`h`jghlgh0mg -DbLM<@ 0R 0"  0pZ @0@0C\P 0  "!0 00 1C&  0 "!0!0 RXUR 1x1 000  1C0\1 0  "!0 00 0C&  0 "!0 0 R`a1@``@ =)01$1`01Z 0j0Ó p f`@h`hlghh0`jg -LM -LM -LM`0 40 < JQ1  < X Vy 0X:cX`0,KZ,0 8 Ve u4@ 0\0"0剻P@0@0C\ 0 !P5 0<%C604ş0  00#!%00 R/U9 !4! 0004  1C0^1 0 !x  0d$C600X$  00#!0<$0 0 R 00  !80UP <\ 0!0h S 0! 0 \W0$00$ 0008!818P 80T#<`1 0S 5p1P1l0:࢟ 00cl0 S01V01R@1@! ࡲ 00 0 d dR0 0`d0 UX XP0"000~PXb@ 000Ÿ졟@0@0C\p 0  "!0 00 1C&  0 "!0t!0 RNW 1X1 000  1C0\1 0  "!0 00 0C&  0 "!0 0 R`a1@ ``@ `V =)01$`1 01H@jgng@h`hlghh0`jg -QLMp`1; 0+0S6* R3 0S 5P1`1pl0: 0S@1@! ɱ 00 0 pd dR0 00 VW W` L#000` W$$3@ 000#@0@0C\P 0  "!0 00 2C&  0 "!"0"0 RU 1p1L2 0 0082  1C0\1 0  "!0 00 1C&  0 "!!0!0 RZ1岡@ 0|0 0偷P!$@0@0C \ 0  "!0 00 1C&  0 "! 0 0 R!$ R 1 0+10 (,U8 110 0 00  1C0\1 0  "!0 00 0C&  0 "!0` 0 R00000010@h`hlghh0`jgmg 0-@0TLPooPP@ 0op000S00 P0 0 0S00 -LM@h 0-Q@@TLP Q Q0h0RP 0SP 0-PL @T0 ᐨ00 -`@LpPU P@ V0000P`U00 -@ ML 0@倭鼬!og -SL Mp2, @ ^P` 0S+0SX2XT2 @2  ㅮP£0 0 @0 R000 0 0  @ `@P@,1a0 0C\ 0  "!X0 00 D1C& < 0 "!0!0 R,0P0000P0 0C\ 0  "!0 00 |0C& t 0 "!0P 0 R)] g@hog`hhh0 p- @LMP 0 000 P0P0C& R` 00#!t000 `0C& X 0 "!04 0 Rp;`h@hhh0 -!LM䁟 p0P 00 @  0`P@) Qp00C\ 0  "!h0 00 T1C& L 0 "!0(!0 R 0S000U3 0UP0@ UPSp00C\ 0  "!|0 00 h0C& ` 0 "!0< 0 R `h@hhh0M$M$ -LM@Q0 0S| h?Pog -,",bLM 0P00 p @T @T @T u @T R! 0 X 0 B?BS  `6@L!F嚏Pp0 R00>00A00C\ 0  "!0 00 0C&  0 "!0 0 R0  0Wp Pp $`h@h$0lhh0Ĭ! -LM0  0  -$1$ALMP ` 0; 00    0 5`` 0`pP00C\ 0  "!|0 00 h0C& ` 0 "!0< 0 R嘳`h@hhh0ج! -LM0@EQ!` 000 1 0 * 8p@`00C\ 0  "!0 00 0C&  0 "!0p 0 RUYP  0p-@h`hhh0 p- @LMP 0 000 P0P0C& R` 00#!t000 `0C& X 0 "!04 0 Rp`h@hhh0 -1ALMP  9p 0  0%p p`P00C& R 00#!t000 `0C& X 0 "!04 0 R`h@hhh0 -L,M0 00` , 08 0P0RH0 8L>4 00ȟY00S D  0000D0 0 S40040 `0:00: ` ͟-=P 00000I0P 0 0    00V0S0000  C@0N0S0  @0 ;@0 H0L S 0@YXV@/0ORQ8Q00S H RF0@0PP@<<@̟P0 0CP 00#! <  0 C60 0 00#!; Q@,0K f<0 @ 8^` ,pWll;@ 0t 00"RD˟H@0 0PCPK 00#! ;  0 C60 0 00#!0* 0 R^U7 01: 000 0 0!C P! 00#!D 00 C60 0 : 00#!0* 0 R*$00 pppppY00@ Q00S@@W00@HT@dP@ , T00R00S 0d0  8 往8 P @<0pP, 000eY4;70770L `00C\ 0  "!0 00 (1C& 0 0 "!P1P  QZ u0x7ḇ#v@ @X 0L 0@@4 0   @Pp Q! ydpZ00W00S@ PT  -LM@`P p  0 ` -L4ML@2 @022P02[tat!p 000K2022GPPK0㢗2[02,0$0@p00C\ 0  "!0 00 0C&  0 "!0 0 R 0 00S<0,2@h`hhh0 -LMX`p,0 P \ 0 S*U ,0K0 0R ,R "R RU 0S0 R00000 \ 0S ,0K0 0 P R R@R1R7 R R  RU 0S :G@0CT@S0Pdd1P| 7P01PL0T@0P0T\@\00RU 0S@000 00坙04  ` ▙Q!l401#8S#00Sl0W  P0WS 0S 0S S eM$M$$$ -LM^P@p \ 0S*p 0R0 T` 0 &T T T 0 00`T@T  TT  T 0 0000T2 0T 0T 0 P 0T 0T 0T0tP 0@ޘP0 3 003\ $$ -LM@@ D0<sl@h饾 p-LM!40r$@ r p0L@0080 0`00$ P 2$0200C\ 0  "!0 00 t0C& l 0 "!0H 0 Rp(0|@\M$lM$@h`hhh0|M$0@-14 @0$00p0S0p0  Q0 0 0S00p0PS707@00C\ 0  "!p0 00 \0C& T 0 "!00 0 R00@`h@hhh040$ L 0  191# 3S,000\0Q0@-14 @0$000S00  Q0 0 0S000PS:0:@00C\ 0  "!p0 00 \0C& T 0 "!00 0 R00@*`h@hhh040$0  C0LS 0 Ŷ  191# 3S 0 ,0 0 0S 0R40$# P0 00   0-0P; 00  UL@  0S 6La0S |0hXLP0S 60h鄃 -LM0@00 68 |3L00S  -LM0@00 6. ʃ|L0S  -L ML0H 2cC0Q0^,0 j3#0 ScʘϞPB  0@0@@ P00 <@`@DpC P0P(1 C<@` Dp"P@`PP@P@ @ , . @ 0PY L0S6O0 00 , # ᡟmgQogM$M$R33  00330(0 (, 0 Q 0\30C3( Q,0,0,00(,0   0\30C3 | F -LM0@ 00L<0S  -LM"2 " @F׀8l p-LM2@  ,P`02@ @F0`忀P2 02p@l 00-@LPϻ202"00 $t$ 0hN0< $p2Ꮒ p-LM|`@PP LP \0 S0\00S;0S p$7pQ@-L  0@Q  0$R @ SM$P0H L07Rmg -LM@00 0Q R 10S   -LM @00Q  0,0 0100000S0Q0 ! !101 ^Q-Q 1S( S  0,0 01000000 0R0Q ! !101 00Q -LMRp`  10 PZ 0RP B 0CS0Q\騂2@ 000Ϝ, @0@0C\ 0  "!T0 00 @2C& 8 0 "!"0"0 Ru,0Sp !  000 00"C \" 0  "!|0 00 h1C& ` 0 "!0!08!0 R;,01000,  0 Up,0Z,P  0,0 010000P0S  0,0 0100000S,,  P,00黼,鷼$宣@h`hlghh0`jg! R0-L@A 0R PQ 0\  C 0LS0^00S  0,0 0100000S  0,0 0100000S@@@0X! Q-L@`Pp 1 0\pW0S00j@TW U 101hh.0SP !1R U. 1 \  00c<;  80S/ \!1R U@ @ 0   1P00001010@0@0   0  0 00$00 00a\U0 ! -LM0@S0S -LM@PT0`,0  VYT Q 0,B0a 0100 0c0p 0`a00!3 10C1 8P<0<0< 8 0 10 唣@8p00C\ 0  "!X0 00 D3C& < 0 "!0#0 RVTi QWȂȒТ 0,B0a 01000c0` 000!2 10C1c 8P<0<0< 8F 0 10 ,@ߛ`00C\ 0  "!0 00 1C&  0 "!1  QT Q T@,00 @T 0S@@@,00 (0S $0, $4[$卛?ܺq (0S $0, 7$4[$r$!0 f0 0  f Q,0S,@0,0 I,@ (娡@h`h`jglghh0mg$! -LM0PS@[ 0qܑܡ܁0  0,B0a 01000c0` 000! 10C1U 8P<0<0< 88 0 10 <@`00C\ 0  "!0 00 0C&  0 "!0  QT0S 00: (0S $0, $4[$<К@h`h`jghlgh0mg -L @M Tp,0 ^P`Q TAdAd1P  X pH$P0P0C\ 0  "!0 00 0C&  0 "!0 0 R#$ R 1 0 +10 ,(<`8`1@ @  ޒ0 0 0 ,00髹(垢@h`hmghh0,! -LMp`(P[(K, K?P@0K (0 ( 00(0 N@T0 (0$ ((00(0( ,00C,0((0,,00[},=(AdF$ 0-LM@ KcPUK0 0PP  ,00C,0(0, }0$P 0-LMP K;P@ 00$ @,00C,0(0, _} -LM0`S  ,K}PP0 KPP#0 < # #000$@0PT   3S#PM 3S0P3G p P@ 00 ( 8 7[0K4 K>PP40pt0 pH80 00 0 00" 00$pV@PP QN ,  0R,0  .}PP? 4<0@/B([< 1 00C\ 0  "!0 00 1C&  0 "!0!0 R ,0( 0C,0,|c,K |PU0 (00(00,00C,00(0 ,|@@0603 0R3( @  (00(0,00p , |3SI3SG x 6F 0 szPP3S83S 45 50#0$@h`hdF$hh0(l! -LM0@( K,0 PPo( $`0A?AS ,K0PPQ,WPPK0A?AS` 聟! 000  3Sp6@!F0pzPP 0 3S U0S3lA0 0C\ 0  "!80 00 $1C&  0 "!0 0 R000( ,00C,0((0,Pu!,{ꇷ(0,  B, ((0,$,{,00C,0((0%,{@h`h(lhh0 -LM `P ,Kp&P@  0KP@t( 8KY4K i=P@d804 D0 0040 4 弑<K, 40$  T=P@G<0 < 00<0DK<00 $ 80,0@0 P@+0SF  {P@!4 (00(04,00C,04(0< (00(0<,00C,0<(0 |Y,9{,6{9;<D?000 D1;4K)>P 0 g vg!ʚ; -LLM @T`PD0 H0 l p LP D` PI pKeP@`P80S&@ 0 0<P@|pW- 0R)@ 0  0! P 0P0  p 0 $@, 0=@0TS (ʚ; -LM@ 0)R  0S S00K F"렭! 0- @LT P P0S S 00S00 @S 0S00  0000s P0ho밭!0 R P0SA 0-@LP0S0006u0hO -LM0 4 0 0C#q!18  `N40 0<0 (&QZLZ<@ P,K  ۇ!3P@)0 P,0U1W<@ P0PU,0   B A8 <弇8 0 4000 (Q|O PUJ2PUZZ( (P'4PU<@P0,0 ,PU g pg -L Mp`0S 3R 0 S 0A#140  0a 00c<  80S \OKB2P   "㩍|$P0P0C\ 0  "!D0 00 02C& ( 0 "!0"0 R$ R 1 0+10 ,(<`8`1  p 7 0@40X 00P (,K , /0`K\(q 0 PE2 0s 0s 0  0@D0 00000 40 X  PXڜp0`K ц0 H 0X0C 00@00C0  B  P$00 00a\U@h`hmghh0 pg -LM ROqa@0T0  0:0@T@T  ` * 00C0 0*S E @TPUh1 &fM@`TP R Q@@@TPp  0S @TZ@WP5@TZ&(N00$0S 0R0 @, 0 0 0, $Q \0 R0 ` < Q  0Qogg@pgg(M$ P  P-L@p T 1S Q@T 0 S\0 R0S0` 0C#1V P`X`VP   0 S0*00 * @pgP-,, 0 0C0, 00C05 pg -QL  ^* 0S  ^: ^# 8 R 00C000 p.0 B6C00 T0T08 . BAQ00000bpgpgrgrgsg! -@ ML$Ÿt0 @墊  0Q* Q:聟1 Dc@P1  ׃pể`V@vP!t0@!0| D00 V8H0:80 8pp 8 :R00? <.0 B608 0. B600`0S 0000@tP0 S00@@ 0V 0  ?C`? 0P0 000x S 0 S<0X X000ԭ! qgpgf sgf@rgrg@f!Cefrgpgrg`rggfff rg`pgpgpg 0-LM 0P[00@  @0h%00600:0 ,00,0 g -LM 0`p:00P ' @TPo \0 @T!00  006000:H0 ,00,000600:0 ,00,0 g -LM K0, 0   -LM00P\ \ R T0S @0@bR 80S|0T  R Xx0t000x0t0000HA6*=@!00`000A 1 00000\ qp00p0`00C\ 0  "!0 00 0C&  0 "!0 0 R00400-:X X@ڪ! @h`h ghh0 p-LM00DaP E4!41a Q0S 000000 ,0 phVphB00 000@000 @0@0C& R 00#!000 |0C& t 0 "!0P 0 R@0 00000t@hԈdtd`hhh0 g0000090000000 0000000 -3cp @ 008 ; S00L;0000" 00:00R00  p0S 20S|0000000\0So8 Rft.0 B60`80 >0PŸC& 0S0 0000@00"R 0 0SAŸP 1!0Q1Qp00C\ 0  "!0 00 1C&  0 "!0t!0 R 0000500hnΩ0@ 0m n00!000z00 .0 B600 p08 . `B000000 @\08 . L`h@hpgrgrgpgpgrg`rghh0pgpgpgsgpg-h0`0"#X0 P P0 S P\0S00 䝂S sg@rg -DLM88P,Å , 8 0 40 $ʃ#30aV 　P0SO `V,Q, K4P,8`0C0S0 8t3`TPPPP 000HP0P0C\ 0  "!0 00 3C&  0 "!0"0 R0\0r S|2@ 0000 \00 # @0 0CP   "!$"000 2C& 2  00#!0! 0 R{ y000000@0 0CP   "!x!000 d1C& X1  00#!00n`LMVP80Sg 2*r,K , 00:00,0Q ,00,00p, 880H@lHT@! d %8 , 8 800d80,<08 S< ,ł80S:S1q1!@0P00, )a@00C\ 0  "!0 00 |1C& t 0 "!0P!0 R<頧, 00000@00C\ 0  "!0 00 0C&  0 "!0 0 R,0H8 H fઙ80, 0f80,0<, 8`00:00,]$Trg@h`hpghh0! -0L Ms吓, 0`||#|ßP0 0Q0XXß 0RCH3H#0Q= 83 Q9 ,C$#0ii2P @ C\ 0  "!0 00 2C&  0 "!X2  QT` \2@T5PŸ`@ 0` "-iP00C\@ 0  "!0 00 1C&  0 "!l1  QTs 鵦00\ 0R00@P00C\ 0  "!0 00 0C&  0 "!0  Q0\h0P0T0X040@0<0d0`0l00 000 D,@l+Lj,@hh`hsg`pgrg`rg gygqgrg!h0pgpgrg -2LM 2b̒̂r  0R0K' 0@0T0P t00|"000P00C\ 0!! < 00"C6000 "!"00 Rg00 [p0S1 00.\ KP' 00300 0008 h1. Bt!80 P>0C8100 @00000@Te 0R8K"', 408b00Pc A=9 =@ @ < <0 @0So0 P   P0 P ꠥ0L H 0gW gqg@h`hpghsg`pgh0pgrg rgrgX|! -4!4aLMp0@000 < P0 Pg00  Pp00C\ 0  "!0 00 0C&  0 "!0p 0 R00 00  40S00;007`h@h !hh0 -LM00@ +00p <R00 00S00 00@ 00 h00500hRi00@000X00\400]pg(! -d4L MpP4PQ` 0SP A2q4$00 AT 0S @T#000 P0R 0!Q PT   Y@0 S00 H#000\ 0, 0 0 0 @"000\ 0 0 00 0 R000  0S0 20  0 @  , P0RT" 00 0Y@00@0 0 b  30 60 fP@0!0 R? Z8P0, R 6! 00 00Z0Y0S0!0 R  0P060 00 R`P@0  <  0P U@ 0-LM@0< P   &< <0<0 | 0P | 0S P<0 <<0 088 T00Q0S <<0 0 ` g!8 - L0; S !@ug 10S080N$@Q1 0 ! 0-- p-LM0`PU Q \t0 \ !0SpH@ B>Pr0P P$ ug!!,! -\ 0L!R @0Q1S0!!0QP$ ugH! 0-`P@0LS HP@0S0@1S@1SN$@-0S 1 1SL 0DS  @  0!0R0N$W$ ug 0-LMtt@ 0dP{ELH0H T@@P@@T(P0逯!HE$@ug vgN$N$ -L M$$@ 0 0@{鈯!HE$vg -L M, 00 0P40 PQP `P`V 0 6p,PY 01| 0`0 ,0Y000 0 40@0 Y |}8P`}Yo @0ppVU`vg -L M0SPIJpP`a Y @ 0@  lQ 0CS.  @T# `(p 0 (, #P0p7_@Q ( R,0,0,0$0( ,0 pT P}00@(0W 0@  0R lQ 0S0^^} Y}#(pK'`@0K 0MP0`P dE E E DF $G lG T,0P0  0 S 0 0}00S5 0 0S  0R 0% 0R,0 P@00 0S0, \ ( R,0,0,0$0( ,0( P(0,0 00 \T00,  ,0P00@ ,  0|00S0 @0 P0  00,0 @kT,0 P0 @0 0 N$vgN$ -LM0P@T`K0&$pK  0pP@ $0DS 4H XH H H I $0 0 $|$ 0S C $0  0R 0P@ $0 $0@c|@0$ $0 0 @ @0$ vg -Lp(P@A 0@1A 0 Ps `@0PU`P``0@004 0 0 s@0 p-L M0PK0%@ `K 0`P 0S 0 Sp p -L M , P0 ^  0R 00P,0  0R r0 S R :t Xʄ0S00 t0 0 0S0Su00Sb X00S rV tQ 0SR:X00S :t> r07 SRX 00S*0S$R"*r X00St0 0 0SRr 巁sus0suu0sXR0S0 uq000 0scgꐯ! -LM 0R ( 0 `R y 0 Psp`0@  ( P0S@ 0R 0@ 0 R@0 vg 0-L @\ P( ^,0,0,00(, 00^ \0 -L,M,0$ 000 `P 0S 0++aP@ R@@T z000 0pCW :0S/S W0g 0c #0% %0 0 R2  0 /R @00@0T0S P@s f 020("S\ 0S0 0U0SpLP0K P@KH0 @00HK00 4 ,P Pp L D 8 (P@380[c  R?@# *\0× 0000/S @0 r:zpR 3zy00(z xp>@ ( ;0 pzd zPzpGWc:0/S Y0+Q`6 x)@ugug -LM$P$ 0` 0#40 @` Rp8  Q R 4` 00  ( @d0 < %, 0 /S k  , $6R  /R  2R0 /R, KR, ,0 lR ?`i00b0 /R076 00S09940S009900900S 0:00  0T (5 T <0 0  0@ T0@@00@0 T%00@060 %P`8 P<0 T0@  0@ 0T @ 0@00< @0-%0v 00`<QT0@  ` @00@0< R R0 i7ã000b0 0 i00 `0 R090@8 R^ RL R ` 00X100CS6< R5T0@ 180S, T0@  `2"0S <@0S 7 &P  @00@08Q   &20S 0 0 i 0 ( |X   0 0S  8 R|X   &00K `V0@@ @ @@@00@0q 0.S0.S0:, 0/S  0b0i007, 0/S 0 b0b080S` 0S8 0Q0R00S`@090?ug @ -LM80@0 p,0  $ `0SdV 0 R 8$PP p V00ZT0@  P0  @00@00`0CS ZT0@ ,0S T0@ 0 @00@0,0S 0  %30@ < RP ) % ~!! -@ MLll 0dPTuX0X @T0@P@LLL L0@@@@h HE$د!@xgwgwg ewg ygwgxg`yg Q-L Q ^ Ȍ 3P0 22 -1LM` 1V@p lP $`VV }6P@}dk0 Po20 P ` 0@0 P0 00@0$(0@0 j/Y 0]@N$ g! -|0LM0Sh0@T 0S$@TP0 $ XeN$!H- P h0S Pl 0Rwg p-L M 0@004h0l0 S000t ` 044 P 0  PK P 0 0 0 0h0ptdewg0S  0"S  L00 \ @0D0<0804000,0(0H0$0000 00 -LMăS@40 3T,0äs0Ŝ3`0  T , tC RRhC R 0SK PC`00C\ 0  "!0 00 3C&  0 "!0"0 R#uPNj 000@8@D@"0@O1,040040P0@0@@vPR <0 3 /"P0 XPUA`00C\ 0  "!0 00 1C&  0 "!0|!0 Rt6|40P<U @0S=XQ\0\0\00X\ AH00H0`00C\ 0  "!0 00 0C&  0 "!0 0 R 80S 0|0<0iL}D{@yg$e g@h`h ygwghh0@xg! !! !T0S ` Rd0d0d0 QT0` S`00d d  -PL`Mu 0Kp d P0@0  P8p 0P 0 P Pzg -LM800CSh2h"p2?0P`@T | 0VW @T$r$$2  0 S |000@ 00C\ 0  "!0 00 1C&  0 "!0!0 R|0p `| T0|0| p|0pP < +< <0;<0*3 >4|8 80S@0S&  4PT Y80S  "  ⨐ 0p /40 840 n g zg@h,g`hhh0! -LM@<0PX `   <<00! V@ R?H0< pp!000L RM X R\ D1E \0\0\04q H0 0H000C\ 0  "!0 00 0C&  0 "!0 0 R@ 0@0  PP @00CS@0 x X X R\ $04!@h`hwghh0 ygp@-8!8AP000H L81P \H 0 0X0 X\ 0`P00C\ 0  "!0 00 0C&  0 "!0d 0 Rpp@0SX0 X0X0\00\`h@h ygwghh0 0-@ @0P0CSL@@0  0h!0hq! g 0-@0L 0CSPL@@0 0( x0S0hX! g-H0 L R@0SXP^\0\ D0\0 X\ 0X0 X\ 0L 0L0wg yg -`LPp @T T0S`@P T -LM 0P@  <0 D0S 80S @0S 000 800CS0 4 gzg -L M@0 K  0 @ P@m -L M@P@U0@0<0`p48<,<0 ػ`<U5 V-  P#U @00CS@0L0S0t 4  @!<0, 0< <<0iYV\ y 0  0u0wgwgO$!@yg-|0S<0  0 R | 0 S  R8 80R0S -LM\P\@@0  0`004P 9h 4 @0 <@0\fd010@ /`pcX\ SP@( \0R\0ń0d R>@ T@ 0\ 0   0V0P@@T@ 0004P g0401/0 R 0S  R 0\7@ \ $ \` RP@d0 Rd00Dz jg -LM@0  01/ p-LMP `@4T  (q/00`VPZpD} p-LM0`@P  0p80P@0<@0@0<@00 0-@0L @P R  01 R P 0\ 0@0  0-LP@P P 0S  9P @  0S 0@ 0S 0 @  -LM⨠`p@T  0P R0 U@X LvY @v 3 P  v gwg!Ա!! -0LM @000C& R 00#!000 0C&  0 "!0t 0 Rdv`0` R 0SDDhvI ꊍ`h@hhh0!cgg!$! -1L M 1R ,  + ȁ đ0 !0p!c1QtPEU:a0 10S00p0tPEU*W , R 00 000 吐0 'R@$4v1@ 00000000@0@0C& R 00#!000 0C&  0 "!0 0 Rp XH,0SDu gg'@ff@h E!`hhh0,!0@-QMP0 @-PT \ ,P^Ѝ0Ѝ0@2H8gXO$ -LMA\-P   -LM@pPp `pPH00H0 0NPp0S P- L p00Csp0 H Sp HhPs8! -LMP`p`dd5 000hP V P0SR @R VP P0S00<000000  Z00:00U@4T0 0C\ 0 !  0`$C600T$0  "!04$0 Ry!005000#0aNP@ S0 0C\ 0 !  0|#C600p#0  "!0P#0 RlQ  V P0S4RrVQP r2B0 0C\ 0  "!0 00 2C& | 0 "!0X"0 R髋 R P0S R P0S/1 00! @00!l0S㴑> 1娑@00C\ 0  "!l0 00 \1C& T 0 "!00!0 R@0 +P@0 0@00p Rl0S u@00C\ 0  "!t0 00 d0C& \ 0 "!008  Q $"@h`hhh0P!\!t! -LMr嬒P 000l@T 00 ` @RZ3 0X" \80S@ 0 @0P@|PU  00S(K T|PUT H`0 @T(`,F 0-LHM D040 X \ 8 0 \KP7P@ 0|L00 -LHM`Ppb-@TdK   D0`@ @@ d <0 8P P@  0ST0 0SQT@00@0T  p-LM`P P@ P@8 0R@ !p K@P  -LM@(p x$ KK4 PP 6 00 `  @0 0 P \ P p  000 kK  PP PP \ R0 P PP (uP1 Y$* 0@0 \܀ 000 $#  0K⤐K0 )K9KK  @0@O 0 @PP' P- 090@T4 0 00  P T0@ P80SP Z PP   @Kd Z p0K 0PP  0 (00(0 ,00C,0(0v ,Es O$ vg -LlMp0`$0 @5,PUK $0 S $K D0P dP `0 \@ P@KUx@UT0h0T 8K0$PU E g! -LMC0,0 pP+P@ 00  l( E#K KP@` H`K DP@ptPF@ 0@K K P@p 80S-@ 20S 80S@  P@ 0 P@   G0 @Kl ( `d Yp`K 0 P@i 0 P@` D0p0D000 p0! 0$3  X0K``K0 $K4K DK @0@0 @9P@ a,0 S ,J  090  @ (00(0 ,00C,0(0",dD0S" alP  0( P@D g vgO$! -LMԀ0p$0 `*P@ $0 S $qJ@PK CP@~PF 08K K P@PK  @Tp GD g! -LsMp0`$0 P*P $0 S $5JzOK CPCP@F 0K{/K PsKT@0 P@048j/1 D g! -LMP`n*P@0 R`0K@ 0 尠 嬐 ` 1P@pW@ K P GWYUd KoX 20:#: Q0 D - % Q @T0 0 X PK 2P@ K K0K @00  Q   Q㌐ 0 vg p-LM0P@0  0K 0  @ P0|`KSd X 0|0 00:#:x0 0U K K0 pK? 0R p vg -LHMd@Kp `@0<0 ` d @ 8` PU%T@80Q0 `P @ <0 d 8` tPPT R0P  0 0 @ KP{ P@KP P T0R sTP -LMP`]p0+|E@TK&0 @  ` 0 ,P@0@KSd yW 20;;|0 0 0K Kpr @L^K 0R #@53@ug vg p-LLM0P `K`80 \ ` <` 4P P@'P0S80L<Kv LP0P PPp 0 L0@㄀K0sXO$ vg -LMpKP`Td 4SP@,@K| 0K40040  @0K0  ` P@ P0 0b yT0@ @ (0 "c1, ah $ 1d0 \ ` 0@,K =P@,0s0,0 $0s0$0  vg -LxMpK`Ptd RPH,@Kb| 0K40040  KP@  0$` 0 T0S @0@(0 "c1, ah $ 1d0 \ ` 0@ 0,  B, (0 ,=,K h=P@,0s0,0 $0s0$0  vg -LMpP @0K0  P P@0 `  80@S @T0 匀K ?@T@d =R p0K 0P@ vg -LlM`P K`P@,0  X "00  @$P0 0^ u80S@ P@  },00C,0(0,=@K4d Qh0K0 0@ vg -LM` KPPx p  0$@5 0 h P? ,00C,0 (0, < -LM0"P`D0 hK0@ d0 h <` JP@AX18!Q K0@ 0 ` 8P@]PpU 80SQ 80S@ X@X@T$ KW AU>DKTTNLJ |X`P4Xt<90 0TP 0 0U ҥ0 0@KTXD K0@ @80S@DKToT  ,,@ug p-LM0 `P0 K0 0  P P@@T|@Kd Q0|0   ++x I0K KP@ pK,P p vg -LHM0`@0 0dK< `0 d 8` tP@ TP8pWP@ @KPP PP@ <0@@T0 00 0PT@ K@ -L`M0pSH KP\ gH0 Y $0X0 X80SHQPPP0K P @ 4 L D0 ,P 0P ( H<`K `0  T0KDKXPPH0\ 0X \P6 40R4 P0 40RX<0 T @0   X @00@0XH $H0 0 `K;04 H0b0\ ,00C,0H(0\,?;H\0PU @K \@K@XKD0H P\$e0<2 p-LMP @0K0 P P@|K0 p` P@ 0p \ !P@@0S<0  \ -LM@pP  0 S,0 0,0 -LMp@`XP  0  0S$ 80$PKS %,00,0 Qo -LM`@P,P  0  0S$ 80$KSp ,00,000.P}o -LM`@PP  0  0S$ 80$KSp ,00,000.Po -LM`@PP  0  0S$ 80$KSp ,00,000.P p -LlM,p0P0`0 20 S ,  0(0L0(0$P@0Ss@KDd N 0㌠ 刀 $$ 0P@Pk 80S-@, S@)  H 80S@ kP@ 0P@  80S 0zP@D00D0b 0 @K d N pK0P@  0kP@ $0P 0 00@Pl< 0D0$ (0P@P vg -T0L@  80 S <0 鹢P <00<0 0-LDPLD@0 -L,MpP`@3 @0K0D0 0P KUH P` 8@ 40 L@ 0P , HK 0# @R800 Y   g8 P00R00S@HK 0 = -LM$Pp@`0  (08 R 0,    ,  l P` ` , -LM$`@8 RpP. PT0S @0 P0    0 p,   ,000c P$ -LtM0 K@ZP@x0t 0 800C S6t < L \ l x ) @ K@$;DL  p@K8P|`DphHd K \0K(T K0@ P@`pHL P  090 @J@   *09@J -LpM$@P8`ApQ   1U 1U 00S 0 p(0 K0P l00b0 0 pT0PU $! 0P @@00@0}$!f@zfat $  -LM@`@@p< H 0X <p5H P!-$ 0 C$ -$ LM  40K,P$ -L(M    40 KXP$ -L,M   0 40 KP$ -L,M   0 40 KP$ -L,M   0 40 KP$ -L,M   0 40 KQ$ -L,M   0 40 K4Q$ -L,M   0 40 K`Q$ -L,M   0 40 KQ$ -L,M   0 40 KQ$ -L,M   0 40 KQ$ -L,M   0 40 KR$ -L M8 0  0 $  0 ( 40 (K@K TP@ @>8`0f8 X!X 0, 4K08  J< 48@@0<0cS@1@!\ Hl 80S< 4&< R0ST4}ꍿ<04 0S  R80 PpdtdԈdhd! p-LM0@| 8 P1 0Qa Qp` 1n\a D0!n1 R 0 p0SpPpdԈd! - L80S |0 hf|0 0 1pd -0L| 0 !001$ (pd -LM, 80S; P 000l@T a00 6 R@,  0S) AP00C\ 0  "!X0 00 H1C& @ 0 "!0!0 Ri 0X00. m00p000P00C\ 0!!  0l C6000 "!0@ 0 R|h O@h`hhh0!! 0-@Lp0EPS 800S(0!e10pgԈd  Q00Q00 R00 -L MP`8|0Q p* QLP P<0  '40 0!*0 0S $1 U0$!0 0 @ 0@@ X P<0  '$  0!b1* MOpdԈdԶ! -0L| "88 #$8Q!00CS   0 0  $ 0  400 0 < 0 -L M@|  0 P@  -LO!G-p堑`aN`M\0[ xx1&V1d1后ETX1""ᓆ L"b l A N AD%X$1U`; P ! 10UPc "*0P  00U: QPc0 20\00{.L B40Zx000\ | 0Q0Sd00@a00Ѝ8 e {gųE.@{gP{gnmHl`l0{gk_k P-LPp>;T!52c~HaȀ2ca10 0\რ+ <@4TP *[O[O @@R: 0``( AP*0 P@:00@C "b"b0#l00X d2111H"c#b1 `130$PQp{g`{g`lHl e!@-0PSpU0 0 000@ S  p`U 0 0R0@0 Sb0 S .000@ S  LpL`U 0 0R0@0 S00xmxnE-` M@p 0 0 \0 0.\T.0V0 Ѝ.\ D\ 0 S.S\Z\RP J0 S .S RP \ZUv R0`@e@c\ 0  0S Wpp0S 00Np ^\\pPEP*0  0S Wpp0S 00Np^00P0#02SPp3^_000S00W V @V^P 6!10F000nR^`VL 0 S 0n0 lS0d~0^ 0*0^ 0:bP0u S .S PR y0.STWVMxl0@-P| U@B .U@ 01 c0 C  0 R0Z  0  01 PJ0 R0Z PJ0 R0Z P J0 R0ZP0@0000  0@000|@ S .S A-@pP@  0Xx= ?0 1 C@nT0 7#30 T00SP-@T`,J 0P$0S!^Z@TJ 0P0S^Z@TJ 0P0S^Z0S0S xnp@-@?\00\0AS`P>@01 P0 0RPu1 0?0 1#0C000S7 /S& 0S!QZ000S$ /S ^0SQZ000S /S 0SQZpp00Np00a0C0p00a0C00a 0C 03  QZQ p R .RAQQ 0Ғ?AcON -,0L;0 0${g{g -0LM0吐pP`,0 ࢂx 0  AT 0U @ 0V0W,0S  , P g{g{g@- @  0 201 R 0\ R R  0^0T,0S {g{g0S R00  -LMt<0 L4Qp0@0 <  PP4 ,0K_P@C3`  0 S P00 s`00C\ 0  "!0 00 |3C& t 0 "!0P#0 R@808(#@,0P, @ @4@00 E@ ,YP@ ,T 0 0Z ,0t t0sn 4K  00K P@ \4 <40 h 40 i 4 0464 0464 0464 0474 0474 0t4 04 8 PMTQT1T ` 0 b<1B&! 02 S61b1 R0@@00@@`00C\ 0  "!0 00 0C&  0 "!0x 0 R:a=+=0 04e@h`g`hg+ghh0з! -0LM PRp@ @0S%\0`S ,0S \0S  T0@  0`e0`\0 re! -`hPLg8l408 !$0gS0! Xp@pZT hC8 -L$Mß @  YS00@p` D0  P t\0 %h0 Tx0SY\0< 0c# XP T0x `#BR  X \0@ 0c2# XP`0( KP0P"00K,PeQx"x"4 010001P*0t000 s0 780K  F,P7t0 qD0 4Ht0T$p T q! (01$ (0K$p Pp( $\ W (0SD@ Ǭ<0T$p<0Rx!! -LMQ@p``#T\P 0@30e^X05< 070 0`4PP X 0X H 匬00\T D a0N 0-LM P0@0  @0 -LM,0$P0C0`p,0 P(K,KT PE5 0P@40K(, 0P@-0X0H0 R $0U  P 0 PE AX0 0S 0AP@ 0X 00U00S#0  -LM00<0 8 @ 80 @0PG 0K , K0Pp9<04K,0 0呪Pp*40H@ `0T*PU  0 @ H0 `0T: ݫW@ +P 404p̫4ȫP@\ -LM0p`P(K,K 0AP@(0K(, 0=P00,H 0R *@T T 0S H0 0R:Pꈫ ᄫ -LM⤐Kp  | PP@@  0S   K@T8@0@-@T2PQ @0(0$ ,pP@|`80S|0" 0Q}0 Q @0 LM0  0P@ o @0U 0V@ urT40 08  0,0000 05t0s/ KP@  0@*P000.@KY 0GZa)0Y =Za) | E.00 03@ KZ 0 Q10R`\ 0  0P@  o td -LLM|` p< PPH -P49 VH( X0@ 0@@4P _U @00D0  0PPx04 8 5 0 K0p#PP0 ,0(H  P 0崠 OP|0@@4PD^0 8P P8;lA<g ZS4K,0妨PP4 00;00040gH@hg8 )8 P0 $@ ! 041   042 0 $" 04400 $" 042 $ x08 !`  PQ` 2S2?S802QL0  0488<,0 0$(,0 `+80Qd P s8 "R8T 020$L0Sg840Sc0 4S^82 t0  048<40 04800020x080t0\0 ; 8 t r\ : @0S1 @0C-`HP)0@&PQ# L+P ,0@X X0S8H@!4,08 L0` @ 8Xd ,24 X 0 8\p8 84 0@`$T08h @<@+8@D@@8d D@`*h0`8 p0HL x0 3P Z Z 83 \0 8 t0h3\P`8 808h0h08`@h*8l-8 @1@ 80\80BX0` -8@` 0RT4Ԩ0840 xQ 4K+0aPP40H@  (P2 80x04帨040 8 L<8 <0`08PPm@08010D^880010d08  0!<h l |0y 'P 'Pt 'P{/`0\!X 4 88<|020C8S^81 \0 t0^\0S[0R80 \0 t0O80  t0\0 F4" !0h #4,$ 88<<0D& %04x0P0 840,0wghd!!xo00 -@L pP`0 A|`PQf`Z<C;@@0 :@0! -LM0K"@P0   p-LM@`0P0` ` H0 0P T P0Z 0H0T` :+Z 6+B| 2+ D c&p p-LM80@SP0 0<l0S 0\S `V p 00S0  -LMQ`0(  $0 ,` d0@Sph, K 0S TL S 0P$  ]$8o ! -LM0@ 0K;P0 00  0000   0-@P L@/P00 4 0 0 -LM䑟0 ,0 @`t0 pS$ x0RP#N*K &\ KPPC00 K0 !P0 PK  DP @P d0  < 0 0/&00  K0NPP0  0  ,0 S ,1p1 LKN KO0KJK00FKH KP0[ 0P0K g!@ug -LM 0@1@ug p-L M@0@SpPP `K0 000 0  0 00lj i000n00rp h0 0h0 -LM 0hh0`0  0 $  10 !   0Zm -LM0,KP0@1`r0 000 0 0y0000h d tT \D `0L\  h0100 h0 0 !1@00#!  "  000 000 0pH x0 @000 (8 Dh0@ 8D000L` $ 0x0X 00@ 800(0 }i 80xT \D0L `\<0 0"lj i00~0n0v0rp h0 0h0fm -LMP@0S` p0s 0s0s$0sH0sL0L s0s@0s 0s0s80St 0ql  0P(0s] 0 0R P \00 P 00 (0s (n0s00s 0rp 0kh0 0 h0 p 00 Q mPh0h000h00 00Dp 00 Q WPDh0h0 0 0h00 00h00s0s -L,M@@ 0尠S0`Y D 0Sh0ڥ080 xD T ', X0P@`0x<0  a0cRp1p!Qa80QpSI00ST02 \ a4K@05,0@04`0@ 0bSP1P!T< H U@4凤T0SU80S@T0@  000tT X\ a14K@^0K , K0P@4K,0 0@ -L P.\ K P'@ PK K 0@ PKD @ P dP0  50  0 ,0S ,* *;[0 [ 740w 5 <0QLKN KO0K 0O0 JK0F0FKH KP0[ 0P0K6 g[$!@ug -LMP` V$ P 0@ B`T۶ٶP`ᓦͶ 0 F@`ᆦԶὶ -LM@ *屶- -|LUMH 0 ,0 \! \A L! h0X! 0` d! h! l  KKW`!0p1 P 0@0 7 ,0S ,`A `H0P SI 20 Ph1 P Pp'P80BdGd7P   Rd! 00 4P00C\ 0  "!0 00 6C&  0 "!0&0 RH!dA0@Hh \1t 1R2T1  t0s  `X X>K/>KT V!XP@l\X`0x a0iX!\A\ 1K\N/KO?K?PL 5QK8@!0;PL D@1@ H0bS1 P0U*0S Sl  0S  l! 6 H @ 0 ` P pU:x`0SHA R0h0l0p!`0PA00\NKx `VpvQH0 0LPH0 ^ t0 qĂ0 4Ȍ\Lq? 4 (@K 4 l!R-  KKi(@KA?A/(@K0K0000`0 Sl! :MK PL d1S hAd@D 0hA T0d DDA?(K K?K <T \D0 `A2T T\D0` L1<T \D0L\ `T <0T H0(K0cŒ2 0Ol!MKl D͝tX!NK? S<0R@@0@TX SXKA_t0s4 B 1 (@KX 5 X+ (K00000`!0S:MKgPL @ 0`d1pS hA@DhA T`d1 Xڴ @>K@@0K 0(@KKK,0f"0(KKK,0\ <TD0b@T!14! G|d R @P? P  P:  P7 P Pp  P0h  P-PX P(P P% g!,g@h`hhh0+"!,g,gh-g-gH.g.g(/g 08   08 08Q 0-LM0 P\0@ 0  ^ \  \ T bQ P 0 -LM`P\ p80@0CS\TP0\@ | | 0L!D0400A0!P000P0P0C\ 0  "!0 00 0C&  0 "!0 0 RF00T \T0`\p(P0T0T|pH<T@ -V$@h`hhh0Ĺ! 0-0L@Pt 0@/ 0"P  0 0.$/0ܹ! !0#!Ը! 0-LM 0Px @ 40 00  B00R꬝ p 0     ;0 0 0 -LM, 0 40 Q( ,    ( 08 4 0, p Wcܣ@ 00"0%@0@0C\P 0  "!0 00 t3C& l 0 "!0H#0 RU8 01 00000!C \! 0  "!0 00 2C&  0 "!0"0 R| $00   8 0bW0?@ 0(0"0Y%$@0@0C \ 0  "!0 00 1C&  0 "!|1  Q;$ R 1 0+10 ,(@h`hhh0 p-LM <@ 88# @0 000 `RP:0S 0S @00C& R 00#!t000 `0C& X 0 "!04 0 Rp>@h`hhh0 -LM@`TPp 00000 0(/\0 @TM<0SpP R-L`Pp U @V@1 `VPp]%x! -QLMp`P " 0 PR@T 00000 0(\0 @T<0Spн -L M Y pp0Wp`XP4  R400400@0 @ @`0K@@000,0 j0  尡 4:0S$P X 00S* P0  $  g -LM@ P 70  0P00  70 -LMX0@0CSX0P(P,PhP P  -LP`p @00P, d 0 `0q$|g! -L@T 0` S V@0400`PU ,0S PUQ dp0S S l0SQ 6h 0||gxd< pd|g 0-LMQP-P P@K00, 0}P0S000-0T@K00, 0hPQ0 Q0]$]$,0 P h0SlP|g 0-LP@T t 0P@t ( hP@0lSl00p@p |gl \p0p0p00@- P Q:lP7 Q*@0\ : 08 <40P 0 00aS a00R R 08 08 08 000- Q:lP Q*0\:00 0P00 000 -PLTM@`P p@@ @0SX ` h x P h h h h h h h h h h h h h h h h h h  h h h p | h h h h h h h h h h 8 H h h h h h h X l h h x h h h h h h h h  h h  h h h X h h h h h h h d h h h l | h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h DpB `0K> `0Kq:070A4 p200 c-0\ 0@&0  g \ 000S 08< 4 Ud Kd0S 0 0\0S0 āUh K \P*U 0 P: cR 0P*0 0\*W \*0 RUl KCl000 0 RUp Kqp0z {0P:U 0 P: cR 0P:0   `0K} `0Kqy0àvǠt0<àq<ǠompkligP07*0q`U[ 0 P: cRS 0P* 00A S@-@**\ *!00S   0 00@S S SX!0S * R:!0R0SS `S0SS 0@S S S 0SP `S PSpS S0  Q Q Q00S*00S:00*S:0Q @Q]$ - @LM \h`e0 -LM☢ Qጒ0`0 tt 0 R1S P2 R 0,R0!R0r40S 0S 0R+ԑ\ 000R00R00 A  PPMp1 l1AP PvP7,1PpPpP P@ 000C S 000C S  6 R00 00P@0 aQ0 0  RoA  q  j0\0s g eeee,]$ jg! -LM,1SA PI0Z0J0@(@`  [p(@000 (d0I$H00` q l0R0 000  0,AV@ @@ p `F0V ed p-0LM` 1PS. 0@0 0080,1@0@0C& R 00#!t000 `0C& X 0 "!04 0 Rpph8e@h`hhh0 p-0PLM `@0T00 3@T@`00C\ 0  "!t0 00 `0C& X 0 "!04 0 Rpph8`h@h }ghh0 -1qLM 0`003 0PU ,0S+PU@00C\ 0  "!0 00 x0C& p 0 "!0L 0 RiF8@A0`h@h jghh0 0-00P@SL 0  P6PL  0PS00@ 0h e }g! 0-00PS@L 0  P 0S@0 P0P00 @0he }g! -L M<0S 0 0 4L 4PT# -# 0L00$40+S$2"0 2"`0 rPAT  (#P P UHz|tl R0 X20  0 P PgU; 0S8 U0S6 0@T :0S  @TuPT UP\ x 1`?Bc00L` S g0 U R0PC\XP0S @egfff, ,00S0 000@e}g Q00 00C0}g -LMЀ`0 V$0  " P0 @PPPTU 4pK  P`PU@00T00S$0 S $z g}g@eк! 0-L@0L0P  ($00a0he $Q00 p-0LM`PV @T 0  R @T`Vp P 4 0S 0 S Pp }g p-0LM`PV 4 @T 0 R @T`Vp0S i Pp }g -LMX- 0pW @T 0S @TpW PU 0`\ *0 0#\:Z '(P  P 00 P$0  Q 0  }geeeH0Q P 0 RPQ }g -LM`pV0 @T 0S @T R 0PP*0 0#P:P  P Q  P P-L`Pp @@T Q P P@ @ 0S0C 0 @@ 00\ 0 $0\   0d 0-4P0L4Z7 @T ?T@TQ 0 S00 00C0W0h)< -LM4@0467<hs 0-@PTL @WT00000 -(1(Q(! `@0T0L0p $4R0C/@T@`00C\ 0  "!0 00 0C&  0 "!0l 0 R\0hd 4(40S `h@h }ghh0$ 0-@0L@PT X P @T00 }g -L`TM, VpP 7V 7V:GV7V PE 7$Vt ' 7Vt 57V7.7V*x7V p7V \ \7@Va jL7V] D7D7TY 0   70S T \ T \ \ T \ \ T 01$t0"   x6 ,0S ,F&P000rP0P0C\ 0  "!P0 00 <6C& 4 0 "!0&0 R W30S0S0Ǖ00Ǖ 5Ve 5Ve5Ve 5Ve-2P0P0 )P4w D  H%q< 00\4   zD$P 000P0P0C\ 0  "!0 00 l4C& d 0 "!0@$0 R42D$P 000.P0P0C\ 0  "!0 00 3C&  0 "!0p#0 R4 2P0Sd  V3V0 *3V 3VPtPMyPlPKp0K@ P@ @ @ l2Vh2[PsL@PP0S  L0S z1V1V*1V 1Vu!1V1D HP001V 1V x1V]l@K@  p0K@ >vL0<1Vi 41VJeLq PkV @f%c3_ gi$iyi zi xi Jii 2i Ii 1i i i i i i i ?!@h`hhh0i "i i !i i #i i %i qi$i i$Fi@FixHi Gi i i i 5i i$~i i 6i(Ki -L,M0"P P0U,0  # 2 X 0S P @Y0 0 SPB@ PTXP0P1 ,0S ,P0pt1XU3 LK  0SD U@#<1`Y <K3 0 Sc<K$ PULKZ 00pZ@ PETUXUP0 0eP  0 n LK  pf 0LK 3K<KLK P PE p g }gi! -LM@Q 0 S00 00C0S -@LTp` PYP @T P@  0  0@  p-LM@`T0P T +P @T0p R0000 0 pPp -LMȀ 0R$0 0@T 00@T$0 S |$,P`UR@ 5R: R1 00C B 0 !  80S$00c  Q@T 1000 ) S0 0C 0 0d0d$0C0CbS i|P$t000dц4P0   0Sn P00C\ 0  "!l0 00 X4C& P 0 "!0,$0 RFT `000 0R1000S@0@0@0`00C\ 0  "!0 00 t3C& l 0 "!<3H  Qr iq-000P0Se-000 00 -2UK 2U"r040|b=x2P0   0S) PP00C\ 0  "!0 00 2C&  0 "!0!0 RQj-000 00 -4iF;4H!Hq0704a01P0   0S) P00C\ 0  "!0 00 0C&  0 "!0 0 RP,000 00 @- Pt 0]$h@h`hhhh0g5݆hd`$@-@@:@0\#" 00  @Z00e8]$ 0-.0LP@0 IL0 HJP,I 00140 0h00@0  8000E  /m?0  -LM!@R \07004!R\@-@ *,  0!\ "0! ":o@-^p`*#!^ ",!1 #: po 0-0LSP@/ S /0  0S0S 0S0S0S 3000  00 00l d0ST L 0^ 0 000  0 U]$[]$I]$O]$ -t4LpM P00`K8K0p 0P@) 0dP00C\ 0  "!0 00 3C&  0 "!0#0 Ry+00[ 80[A)lCP00C\ 0  "!80 00 $3C&  0 "!0"0 RH+T 9 30S   @*P0xb00P00C\ 0  "!<0 00 (2C&  0 "!0!0 R  +7 P@@  !  00 p10S!00n?A0!TA !P00C\ 0  "!0 00 1C&  0 "!0 0 R4*@P00C\ 0  "!t0 00 `0C& X 0 "!04 0 R7*`h@hhh0 -t3LpsM P00`K8K0 0pP@A) ,cP00C\ 0  "!0 00 2C&  0 "!0"0 RP*T q ;0S  @2P00CS0) (BP00C\ 0  "!0 00 1C&  0 "!0!0 R * R0700dA 10C1P00C\ 0  "!0 00 1C&  0 "!0 0 R4)@P00C\ 0  "!t0 00 `0C& X 0 "!04 0 R)`h@hhh0 -@LMh]$ -1QLM` 0 S @00T pq`00C\ 0  "!<0 00 (1C&  0 "!0 0 R,T(  0 0 L0$0 0 0 XH0J I 0@ 4 0) 4) ?@`h@h,ghh0 !ȁ  @}g -<0LM @P0 E0@}g -LCM `, @pP 4P 4U@ 4 30S`0p0`0 p Q QßSs 000 0R000`#S`0`00`010㷁,30p   0S_ Sp00C\ 0  "!0 00 2C&  0 "!0"0 R7X0l 0X0 l 00C\ 0  "!0 00 2C&  0 "!0!0 R ,0 S ,[(Y(000  (000HAJ00C\ 0  "!0 00 0C&  0 "!0 0 R7 (  J/4J40 3A0KK<01  0 0 P 1   B0^ 0 0 0b 0 0Sڃ=LHPG-@TpPpP1^`ᶀ&^@\ ^ !000 \ \ !000000T p \pP QpP ^  Ų000t G-M 0Q  ZP C 1Z00\1 ZAl~dep@0dQ.ڰ010   !0 0c^ B Z^  Q  00 S 0Ѝ 4 010\~ \" 1. HD0nPk40($000 "$ 0 0c\à3 B J3c@0d^@ڰ3 3. 0 "$ 0 0c\à B DQ8ßJ0 10 #0#40 0bP B2 yŸ J010q2 2. Ÿ0   ZKl2Tb@0d^:@P2 02. 0 "$ 0 0c\à B  QJ0 10 !0#40 0bP Bl J01Td1 D1. D1$a@0d^:(1 1. 0 "$ 0 0c\à B  Qژ J0 10 p 0#40 0bP BV< J01Z$<0 0. t -LM@+, +&(uD01>0 R@P 0000q -LMR@ \`pڈ,A0 B<0(0#40"(0aR# A  R PtF000 0#40 0bP B Q \PڤG0<0 0#40 !0bQ B PU"<0a0 P$0 1>0 0 0"$ 0`\à @PU I& o0 1>0 ` G0<0@0F   00 "$ 0 0c\à B 3 0S:3s`P0fU\ß+050 0 "$ 0 0c^ B  3 #Ѝ+0 50 0 . 2嬢` 1+ 0nPڰ0000 "$ 0 0c\à B <2^ ,2  nPPaoڸ0000 "$ 0  0cP B pGW113<`ӗ`Ӆ!0tQ0nP?ڱ0000 "$ 0 0c\à B  1^V P1 nPpaڸ0000 "$ 0  0cP B 60 0 000   0 0 00   v%eHp &e#ep&e- 8Q Z y8Q ,8Q .\000 0A Q 0@-@0SP Sp 0 0"$0C0 00 0"$ PP0x00t S00 "$0 04 4000S 0 0 -L@`Pp0 T  0 &Ġ`00  0"$ `Fv 0 `Fv00 -PLM0 @\ K @@@ 0S0000 0-PLM@ \ $PU 0 KS(  000$P P-LP`+ (  P pp0V p 0`f 00FS0 `@P 0&SP `  P-L@p 0S `P 0SW W 0X X X Y hY Y PZ Q 0 0A \0 ` 2 0P0 #20S 200Q  0A  00` t2l"c0#22cP` D200  9Ws ~k ^_   0S00000SL  0C  00 <000Q: 0 A0 080 PQ) 0 A0 0400 0Q 0 A0 000 Q ` 0h00W  00000` 0000S0S 0!!!B(!@! 0S p-PLM`  Rp0S00 00\/ @Q Q0#S Ra\00Q00S0 d0Q0 @PW 0@P0ppSp 0-80@S<0L0 P0BSR 8P0(U 00 0$040<  (! $ -LMPp(@  P@  ( `P0@ <(` ,0080 ($ -LDM`4T 00L PP ,0%T%0`0$p PC2a \ q] _ ` a b c 8e f Hf g U XU 0uPUP H@0 0R ^ 0^ ^ ^ PE@0qPd7t00K4 K80K,KL,04 80~P   0qPE0 $p PL0 0c P  T 4 LP j07sPE) 0qPE0L $p P$p PL 0 0c L0 T4$p PL L0 0c 0P0  T4LP 8U X& 0uPUP H 8"(#8RR00Pp 00L( $p P0 0c 0P0  $p PL0 0c  T4XO Y, TP> Y @ T@! T @! T0 0dP 0ST00dT0 d0S00CT 4 P LP 40T0 0TS, %T%, 50c0C2l P Yh(0Q ST0 T%0c0C2a 00(S QT T%0a0C2a $p PL0 0c  T41 U X 0uP UP HI $IR@2P0L@TL0@(  P x 0 @0 'wPE#50Y*U XO 0uPUP H  !0#50\qPE: Y p0 S000L0  ,P0@0(" 00<0YX@ '*@U *X 0uPUP H:ğ 10!@P 0 Pd7t  @" 00<0QX@ :L@0@K0 HK@  LDK<0K < P@tL<@D H0P@W L (!L0 $D0H  @0 $p PL0 0c  T4P LPP O LLL4 T 00P R,0%T%0b0C2a 0LS$p P U0PEJ0T 4 P LP 40T0 00T S500$p PLLHjLDg$p PL0 0c P  p $p PL0 0c P@ dL (! L0$P@ P U *X8 0uPUP H:7tPd\!X@ " 00< 0RPl7| Y00PQ P  1 ^  00 L0 $p PL$p PL0 0c  pP L (L0 !$ 00$p PL L0 0c 0P0 0 X!l! _$q!! 0-P@L,0  C(($(@ $0 -L M0 40`Rp<0S7,0b$0,0 0XP00  80Y @1@!S   0P00,00PU(Pde0PX,0$000 00 0c  4P<<0 S00  -WMLMh , h d ` \ X T P L H D @ < 8 4 0 l% p5 =K hUp h@K1hK0PU1h0hS0@5 B hK1S@T|E Q1 Ph K1SPU5xU S0!5 004T5 *hK1@^ JT:hK1% R% JEUK0LhK1 L@PU `E dpK 0PU@@QKA ApP @T! E0Q00hPU:|x%PPdU P ubU |Eh0K10Cst5 E| ^\t x%| j% 0@j$ P !R  t|0a CTh0K  *@T*0 R c@T:`(  0 P ` 0 0Y0K !   <$%  `5B%05 Q=K  E| ^ʘ%|hE1hW <$?0#0#% 5 % *l%QL*QE` 0 %  p5H0T *K1@T:|%0BC P%@8P%0C !0S %EbI80C !0StN~t P|xP| Cx%E0R0T00S lE0np!P  % 15 Y PP 0-LM@P 0 P @xp p 000000̼!! -LM`P 0pD SP@ p0 p 0@0 x0 8P@ pD0 p 0@0rr!Pl@ 80080l0S 40  0p0  Z h@K@p 0 d`  , 00 0@h ~g`hhh0~g -LM@ R <0S 40 -LLM gg_$_$_$L R Q@k P@p0]$g|`$``$! -LqMPR a䑟䁟@ 0T00P 0 S00 00C000C\ 0  "!d0 00 P1C& H 0 "!1$  Q9T9 16 0 S):@ "48<S V0S@ 0 00 Q : "48<#8 S  SPPPP d`$@h`hhh0! -(L H .L   H@3P3 0TD DP @ Q"PD `VA 0PU>  R<0H S 8 R 80S D) uH<0 PP 0  N$,0 S ,叽  T0S 2 0 T 40P040 PQBP R@P3 P P `@  0P  T X@KX 0̠0:K L4K 2 2K0; K<0K< KH0@  L  0H P P 40 <0H S D H<0 <tD\ H0 \ 0T0uDP H0  \wP  0@@ s  JPDe CQ 0R\ 0R\ g@g!!g\`$!L!x!!0]$! 0-LM@Q  80S0\ 0PS 0 <0PP400400$! -PLM R 0p0 p`P@% 40 8 A R800 R VT &80S4 0 0 H:e0!- -@LMH> 0 <0 P - ^ "48<S C0 000^: "48<#8 S  S p-LMP@ "48<#80CS phph|0 R p0 h`Q0S e0S< ( 00嬵9e9e9eg g -LM0~,0 q0P`, P 0@0@:K e=2K00<0<<004K V PQ M0 ;0K< K< K0 ,0S ,妻 g0]$\! -0LM`P'0 p` P@0?0| PC#P@DtD P0S D  , 39e9e9e$ gl!g -LM K P0-LL @P<T,@T$ T0ht!|!!4#1P P .  b T 0@ T@d @T 00 0 "4 40i8#8#$ 0$  0!0i 00 0i0  BD孲1 <1LW 1 ,0S ,0  00 0Pp  0 0@Q"T@@K 0< K;0K8P d@ R X0@@0X0@80S0C80hf0 T00T0*@ g@gb$!`g -L M 0@p@A`0d` 0p0#!dP>0 0d0  0pp  -LMKX? B8c0@ 2c2c@2`ϠAl  8 #, E.Mb -L MQ@`*0S S 0`邔*xp0 p/``P PU6P/Pb$b$:e p-L M@PP 40`00 @K@0SL LUP808 jPpIpFp;eV 0- L"48<P#HP1 T P"48<#HTQ00ADT@Q<0L@| 00 T@ RL 0hJT:<0L T0L0P0SSP@0b$ c$ -LMp0P4`K$0 ) 4P0S L00P0 $0S $峢 0@P  0=D0<0. 10 S  g! g`$(! - 0L Pb$h:eg - LMR 40 S 0 0 ־T! -(!XL"x H` P M hHU H -L0!!Q#7011A!1 Ƞ/1 /0A0 x!0hp00 cT1(0000 c( / ! a c0#7%c!c1c X@008 #HT 00 0 R 900T| ?A7c%c!c1cW XEن@;e:e:e:e;ey:e&sg:e;e:e ;e 0-P0 LR0 0Qc@0 0 0? B7c011@x0 l000!T 0)L0L " 0:e/ug ;e:e:e;eEن:e;e:e:e 0-LM0P [[@[0[ P@0;e! -L$M0pK@ 8K0 @ Ÿ  0@ Pw Q eB!2b2c621b1c \ڸ0P*0 RO 04P:1!1!@P @@7dQG3[S@ ` B1 2P13[ S @,@"!@00Q@0   00\ eB!2b2c621b1c1\ 0T=tt!`g`$ gb$`c$c$@gg@gg!g!(g! gdc$;e! -qLMQa@0 T00 0 S00 00C000CQ 0 "!000 t0C& l 0 "!<0H  QT g@h`hhh0 -LMi0@S y000 RVP 0@SX00X0 oW0X000 0X60S+ 0S(  t 0 00t P000 "48<#Q000 R000 0S  bT8Xf P\P 0$0S q Q 7 R(00(0 oU00S 1ǟ 0  Q  00C\ 0  "!P0 00 <7C& 4 0 "!'0 '0 R^6`V 0QI `V`0#$0$ h("( "4 4Z0< "48<#8 4 L6 0DƟ00 00` C \` 00 0  "!0 00 5C&  0 "!5  Q !$)-"("4 4Z00S dd5  Q D*P 000 @PP@U $@00@0P "4 408#8#$0$ 4 0ğ00 00C`0\0 0  "!@0 00 ,4C& $ 0 "!3  Q40#040 ß0 10 O3 0|ß00 00CX\ 0  "!80 00 $3C&  0 "!2  Qo"  0P00 00d C d |"^ 0  "!`000 L2C& D 0 "!2   !  000 0d 0C \d VD A 0S 0S 0Sd00CH0\0s P@PY 00 0 RB 0S < R; 0SR6 t R3 0S  R- 0SR( 0 t00t00$p00p0P@P000P@@g`g;et;e@h`h ghh0@g;exc$`g g`$@-0@P H0^ 0$0S" 0 R T 0\ <P4 X0^ 80^ 00^ (0^T 1<1400 0R@g |;e -L M 0p 01 cQ  0  0 R| 0Q0R  Rf P, U  "48<#0!$(,"P:,P PU, R3 0 "48 <,$#8(!8 ,"hCV ڲ "48<#V5  "4 408#8#$0$  "4 40f8#8#$0$ UA 0@ $(,.4,8 <"(!(#8R`c-ڲ0#$04V `( R000P 3t%00C00f8#8#$0$  "4 408#8#$0$ z,0S , 0S00p,00p PU,  ,P "48<#X P"48<U#, `V0P00 001S Lt@ `,`߲0V0C0P  @`Բ00C 0VP8#8#$0$00S 00  000  R000 3@ 0 bt3B&! 02 SLP1b1 R000$c@00C\ 0  "!0 00 2C&  0 "!0"0 R0 0 0! 0 0 0!B  @ 0@ T  r$" h00h0 0S0 0p 0 p04! 000&8!00C0Q Q00|\Q\1@  t P00B 8a@00C\ 0  "!0 00 0C&  0 "!0 0 RY 00S0<0 0 0 0 0 0  00 002 =q`g;e@h`h`gg+ghh0`g,g@g - @LTp a P R0p00@ 山0U0C0 DAR0<00 01P 0 b1B&! 02 S41b1 R0pp00p`P00C\ 0  "!0 00 0C& x 0 "!0T 0 Rhq;e`g@h`h`gg+ghh0 -RrLM 0娂00 0 0R0 00C\ 0  "!L0 00 82C& 0 0 "!0 "0 Rk1 R a00C0@Z T  000 0A0C0\0 0  "!\0 00 H1C& @ 0 "!0!0 R( 00C\ 0  "!0 00 0C&  0 "!0 0 Ro 00 0000C0\0h@h`h ghh0@g`g -dbddr 0  QL ( @00C\ 0  "! 0 00 1C&  0 "!0!0 R霁00C0\0 0  "!`0 00 L1C& D 0 "!0 !0 R;A0S Q000a0S 000 00C0\0 0  "!|0 00 h0C& ` 0 "!00<  Q mLK@h`h ghh0@g`g -LM|P0S ppp00/"?CQT`1@000 0S 00/"?CQ@T@gxc$;e`g -4LF0[0F0K)0iPaSF0[G [0SZ| ,l<P F0[0F0KF0[G [0SI8` T0 P H  gt;e!c$c$`gx;e! p-|@LMPP`D 0U`D 80S0C80 <`000 (P0 P@pDg@g p-LM@0`+TP pئ0D #10P;e;e p-0LM $0 (K0( K'K1KPP+ 4 10 S 80S0C80pO00 R0`V @T 00 Q @T`V80S0C80p-UP80S0C80p }g -PLP& P` 0@10 0 pD00 PX@PE0U :0U0*00;e;e p-LM` 001PC@ c9 0!0e 000e00 000p -LM1` P@,`  #(00(0oP 0S0C⌃0pW  0R 80S0C80Xs000 0 080\ p 0#$(,"(DRD 0mP < 0Rv "0 S0!0" 8P"(00(0l"Y$00$0Y ,00,0XM APAp h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h `  ,0L00`L0X J400 0P Z00Q00Sw Pt@Qq 4 000Sk4000P0,P ,0 `a 0 u1pH2,  0 `gDg@g|;eXc$ p-L MQ@`z 0BS(T U l1 Rp T 0ph*R 0,`kp-p  0Ppḣ @ 0 @ 0PS `0S @T`Pp l@x0d@ 0 @D0PP  (p8gx;e|c$g(g`c$;edc$ g --)L4M0 ,0 X 0 QL X`H0 P p D KD `H @001H0 0 0S+ \ @+\ 0 WP  P 40  0R 80S0C80 00P0 0 00 0S r P P T  0ꄤ t ĥ ( T 0S p@T 3R ,0 S ,G5e@0 R  3Q H0S <Q H0SQ P U 4SP1pP-pT 0S0  T 0S0 R ƕT 0S00S R; 2Q5 H0S <Q/ H0SQ P) U 4S@ T  0S @T T0pT;p 1P7pw 000s 0RP@ 0 <0K; K0@K80 <@Q 0S 0R D 000 S D1 *0P000 0`S 4!0 ?0LⶃU t1Laᧃ U U1Laᘃ |@}0P0l0 M"0?0 }⪃ Pl0csPU  0R D1 0c0cS000 P V0 R *000  6@#06 8CR 6S$1&0$1U0$FP!|P(1`]4Q0&|0$!\@0< <2(!0, 0cS$`k 000 $0L$?04p0`0`Sl tDtT 000p07ddp000C\ 0  "!0 00 4C&  0 "!0%0 R8 0K 0  p07p000C\ 0  "!0 00 5C&  0 "!5  Q00C0YNL6&&S?60<6@_05< 00 0 R000 0 0 ~0 0y$0O&U T!0X0bSP(h0,0/H' 0S00cS 10cS 0 0  1 01 Q @  00cS 10cS  Œ0S\ \  0 0bS &00[6p S6 $10T01p 0 0 0bSڨ0 00 &(0)?04́p0`0`S J -LMx`L"P@&P d!\Ȍ -LMO? @0A9=d 1\  Q xQx< 0?0m&6 R06 坌>d$$|! -@ MLZ 0@߃ 0@׃0 x0 t0t?yd\c$ p-LM6pS0x 0@`@P0 <U Sph40 RP7!p00 0CP   "!p!000 \1C& P1  00#!(!00! 0 R?P 1P@ 0 000p 'p 0 0CP   "! 000 x0C& l0  00#!D 0L 0 R0ZҡСWh@h`hhh0DFh44 0\0!0000 SQN -LMD@@6S S6St0 R`06eL20S|h+ 3QAQ @QJ -L$M0@S`P r 0S R 0S0S0S R 0S0s VVq 0FSqdV V` 1 R U R \F  0R:<Ku  <0K[#[0$V+ P 8@<4(<"4\!, DQ 00cS 10cS00 R 03PAP @P < KP3 0<` p}(P0 6 ,5 \zdWhBh -LMtŸ0pS, @`XR;0S8 P6@2P8R 0@S,RWP[ TRR TP X$ VL 00 0VP" @<4<("4\!L D R 00cS 10cS \1 ,0S `,(kD1 R 3PAP @P<@K?u0 P<0K;K` cK8P > 0偿0 RV @P Ġ̌.Č 0h$LPP D R 00cS 10cSF(P g0 d$6 ,5 D8 Wh!Bh`c$7 D R6$1 -L0Mp0<`K@ 0 t4KPd$$`c$hh0!J -x1xaLtqM ,0 0 ,0 O?L (=Ɍ LQUP1 Q@0 0n0 0n0@00C& R 00#!000 0C&  0 "!0 0 Ri酝h00`0l <^*L0  ^:00000L`h@hDh>hh0Fh@Whd$ -1qLM`  40 0 40P\Rx0@ T \R\1@TP1P!00l0Q>*80@080t 0L @!0 ?04le@`00C\ 0  "!0 00 0C&  0 "!0p 0 Rh<00<<0 `h@hDh WhFh`Wh$Whhh0 p-$!$ALMP 0006 S< 0L\ 00  a R1 0 ?0 e`P00C& R 00#!000 t0C& l 0 "!0H 0 Rpph鞜`h@h WhFh$Whhh0MЍ -LM QpP`  \ 0S'0 '0 W 00@T  RTD,@ 6,0 W|F J G G (H DL J J LJ dJ tJ M J X DP @0 2 @Rp00C\ 0  "!0 00 2C& | 0 "!0X"0 R  2 ,0S 0,c鄘5ZX: @ 0 2 000 @ 040 Ap00C\ 0  "!0 00 1C& | 0 "!0X!0 R/ K\H040 00 0(K 0 S S X?0@0c80 !<\ P!TP 8PtU"\@P P<?@1p@d Zp: T@P U \:,0 l oZ ,{@0 SP,0 Z,0@k -L4M0!> ?P@Pe`!8P 'pmvmz0fk00 0#000c= h 0 "   b-p 0i0D  0#000c9` j 0 "   b* 0g{0| 0#0009  fk 0 "   - 0h0` 0#000c9p i 0 "   )`0j0  0#0009  g{ X0 "   , 0fk0 0#000=h 0 0| 0008pi 00 000=`j 00X 000c< g{ 00000: fk 0 0 000c9h 0 0 000c9pi 00, 000c=`j 00 000c9 g{ 000 00c= fk 0 0 000;h 0 0` 000c:pi 00 000;`j 00D 000c: g{ 00 000= fk 0 0 0008h 0 00 000c<pi 0' 0#00c<`j0&,  0#00= g{0(0#00c: fk0)X 0#00;h 0*0#00c:pi 0' 0#0 0=`j0&|P 0#00c9 g{0(0#0 0c= fk0)0#00c<h 0*` 0#009pi 0'P 0#00c=`j0&0 0#0 0= g{0(0#008 fk0) 0#009h 0*DP0#00:pt 4i 0'P 0#0 0 lPnpP  xlP : `j    -LM@ , S, p `b b$,0  O 4 P'e eTP hP!?!0@?PP@ eidM@Pn ^Mt?0S:@Pk?0S: -Lp M0`,0 @4K  b!H@T  ~0 S@( `P 0  RS  Z @$1  b!1@T(,0 S ,n>T g!P! -@LMT $ L@(H 0 TG-(M$$ $0 ```( 5j# "< "0  0#   D 0AiP i;,  0 0  ^   `00` 0 0Q%j3 0# Ƞa,0# ,e). @ @$ 0Q." p  aƠi! " 0 @ iˠ "! 00`@P?Q  ` $0 ` `@`P@` P0` 0$` 0  @P(ЍT -RLMp+ >?A @` R,: (, L,!P`(` pl?W `\ @pG0@?W@W( K0@(K0@ -PLM, pX 0 @0K- M >}. Np >.~~΍.1@QS@@`aq  ␀!N01`$P~`Pa.(LQxh ,00)&$a9%G%ᨀ.,Qq匀円(nx%Th0vP.#^PLl G )ጫ7᎛ '(P!`"p`p`P , 0 0Ll\$1l(C|@厏 ='pp*C(`~P%`&`P`Pa0#@$^.T= }` 0`lppPCq(,ΠHD@l| 0q<`^ 0@N0lQpCpa`3` P``` P%00`&! "= p P `.M.  .0@~>. N~ ~0@TO^t^0@10  a0@N~ Q0@^  0@00 ^ߍt -RLM`pG @>0A! c RX:P pH!0@ R: @0S*H0P@ P p`i VHP  0@ `FRp @0 S*@0 VVP 2H!0@ R:@0S*H0P@ PH!0@ R:@0S*H0P@  -@LM, 0 0@K 408@_`pP`4%$\'&dts?s_`  0 @ #Ƞ8!(0p$HP``,4H[0@UP` !4%lT"$ K?K_`@8`p0!#^8'$Hxa ) ,0 p\P0\,@PPP~+C,p00@ ,oA,0l PC PplC, PP,`pPP C0P0 -PL M0 , / ^0,40 P`0p  @ 0 !ĠP`#L"$40@ 0@#Ƞ8!(P40$H`0S40 `00`00 Z,oB -@LMT@ , GPBH0@  -PL M0 , / 0,40 P`0p  @ 0 !ĠP`#L"$40@ 0@#Ƞ8!(P40$H`0S40 `00`00 Z,ogBA-0PpP%%Ǡ% %,1d H!̒00# 0@0#@$$Ǡ$ $,1t h!̒0 0# 00#P%%Ǡ% %,1t h!̒0 0# 00#@$$Ǡ$ $,1t h!̒0 0# 00#P%%Ǡ% %,1t h!̒0 0# 00#@$$Ǡ$ $,1t h!̒0 0# 00#P%%Ǡ% %,1t h!̒0 0# 00#@$$Ǡ$ $,1t h!̒0 0# 00#P%%Ǡ% %,1t h!̒0$ 0# 00#@$$Ǡ$ $,1t h!̒0( 0# 00#P%%Ǡ% %,1t h!̒0, 0# 00#@$$Ǡ$ $,1t h!̒00 0# 00#P%%Ǡ% %,1t h!̒04 0# 00#@$$Ǡ$ $,1t h!̒08 0# 00#P%%Ǡ% %,1t h!̒0< 0# 00#@$$Ǡ$ $,1d Ȟ0 0#@D 00#@$P%0A-D0P@pP%%Ǡ% %,1d H!̒00# 0@0#@$$Ǡ$ $,1t h!̒0< 0# 00#P%%Ǡ% %,1t h!̒08 0# 00#@$$Ǡ$ $,1t h!̒04 0# 00#P%%Ǡ% %,1t h!̒00 0# 00#@$$Ǡ$ $,1t h!̒0, 0# 00#P%%Ǡ% %,1t h!̒0( 0# 00#@$$Ǡ$ $,1t h!̒0$ 0# 00#P%%Ǡ% %,1t h!̒0 0# 00#@$$Ǡ$ $,1t h!̒0 0# 00#P%%Ǡ% %,1t h!̒0 0# 00#@$$Ǡ$ $,1t h!̒0 0# 00#P%%Ǡ% %,1t h!̒0 0# 00#@$$Ǡ$ $,1t h!̒0 0# 00#P%%Ǡ% %,1t h!̒0 0# 00#@$$Ǡ$ $,1d Ȟ0 0# 00#@$P%0 WDtH0@-@P!0\#0 0(S"Ƞ0 -L0 M( @KP"h0dp 0 8#x "W 0@2K,0 (0 p,KL,0 0("x(0W0p@d;08 (#H,0T108#xW -LM((KpPj@"h8  8 08 #8 "S80 02K40 00 80 4pK z400# 40 s0 0#080 40(0"(8 R00  8 80@ U400# 40 N0 0#008 0#H40T18 08#8S80  p-LMH`P&$H ph; (-"xPUL`@:08#XU@: (-"xPUL`@:08#XU@: -pL MW@)*0K0 8(<, 4$P`  0P `b0P,`p%<%(%& &Ƞ&W0 P`@: -pL MW@)*0K0 8(<, 4$P`  0P `g0P,`p%<%(%& &Ƞ&W0 P`@: -pL MW@2*0K0 0#0P0 8(<, 4$P`  0P `0P,`p%%<%(& &Ƞ&W0 P`@: -CL0 MX4 @CpC0K20K0 8(<, 4$P`0P ` 0P,`%%<%(& &Ƞ&0 P`0 0#0QHXpG@D0 8(<, 4$P`0P ` 0P,`%%<%(& &Ƞ&0 P`40 0#0QG-08@ <4@ `|Pe%L%ȠE q%0E吕aP@8 < 4f `D0`&! 0cqS%,,E%̠ 1%E0n 00#H*j apQ% 1%Ƞ % 0 0#0a L`& apQD% 1%ȠxxD % 0#0l0P* apQ,% 1%Ƞ  % 0n 00#T`&f apQC% 1%ȠC % 0 0#0aX* apQ% 1%Ƞt % 0#0l0\`& apQ,C% 1%Ƞ  C % 0n 00# `*j apQ% 1%Ƞ % 0 0#0a$d`& apQB% 1%ȠttB % 0#0l0(h* apQ(% 1%Ƞ % 0n 00#,l`&f apQA% %Ƞ %40A1!c \p*R0 p0 0crSl% 1%``A%$ ! 0#0`04t `&! bqR%1% %$ !0l00#8x *j bqR%@%%$1  0!0#0b|< `& arQ%1%h%$  0#!0`0**<*(*& &Ƞ&`0 輰G-0@P`p8 Ƞ<̌ W4ČP`pሕՈU< |0 0crCpş$ 1$(dT $L!0#0l08x P%e bqBş$1$$$  0!0#0b4t `&! bqBğ$1$$$ 0l!00#0p P% bqBlğ$1$`$$  0#!0`0`&, l0 f 0crCğ$ 1$ $$ ! 00#0b(h P%! bqBß$1$$$ !0l00#$d `& bqBpß$1$d$$ ! 0#0`0 ` P%e bqBß$1$$$ ! 00#0b\ `&! bqBŸ$1$$$ !0l00#X P% bqBtŸ$1$h$$ ! 0#0`0T `&f bqB Ÿ$1$$$ ! 00#0bP P%! bqB$1$$$ !0l00# L `& bqBx$1$l$$ ! 0#0`0H P%e bqB$$1$$$ ! 00#0bD `&! bqB$1$$$ !0l00#@ P% arA|$1$p$$ ! 0#0`0`&&,&8&% %Ƞ% P0`輸G- R8M0 00 1 S`@Pp0 q 1ѷ< 1 R Ե@ 18 1 P յP 14 1 ^ ֵ` 10 1Z0 S$ Y Nt |!|!|!#|!|!|!#|!|!|!t 000PTGTg#Ġ#, #<,!q 1,A.-Q0#Ga. "  "P0# "0# A !04 f"Ȇ",(1&)V0# !0#0#05 41*+|f !0#0#0# 0 Y '!("("(""("("(" #("("("h#  F 10# 1Pe  0腟0#0" 1ş " '0 !! Z ` 1 !0 1 00 0Zj( 0 1 1 1Z8Ѝ   10#% 1  0E0#0 1  " 0T!" `弄 1'0# 1  0D0#0 1  " 0 `` 1 0#P 1  0@D0#0 1  " 0( (4)@S#,8,̠ a!ßC04p!A!P GPe @8($ @0<  0A0  $0 0,L0L P@h`h.ghh0| -LM0@, $P c娃 P 0嘓 b0B&0! 02 Sʂ1bh R$0 $000$0 $0sP00C\ 0  "!0 00 2C&  0 "!0"0 R<PD P 0 b0B&0! 02 Sʂ1bH R<0 <000<0 <P00C\ 0  "!0 00 1C&  0 "!1  QH P0 b0B&0!01 S5ʁ1a4 R0@@00@P00C\ 0  "!0 00 0C&  0 "!0  Q,KLK<LKf$L< ` p\`g@h`hg+ghh0 -LMQ`&R"Q W 0\: c\pGPVWpG @lV@1  `d$VP22! !(!@! -LMQ`&R"Q W 0\: c\pGPVWpG @lV@1  `d$VPc2`2\!x!!!Q@-@  P 0 0RQJ PQ00P00S 0@1  -LMR`@p/Q,P  U$010^c^PT UP 0  nT 1@bPT1 1!! !8! -LLMǟh h, p Pl0 l"Pt `l Rt  0 `  p`K@ nQ lK0`Qu g\! -L M`0 40  PpʀP P~h&P80B``P 000P0@0f ,P00C\ 0  "!0 00 5C&  0 "!0%0 R>T) 40S4 0t 0' , K dşPD p 0Lş b0B&0! 02 S  1b1 R0@@00@p00C\D 0  "!0 00 4C&  0 "!T4`  QU 0P 0P 0UM$4ğ , Pğ0 b0B&0!01 S7ʁ1aß R0 ,00,  P00C\ 0  "!\0 00 H3C& @ 0 "!3  QGl4Ps ,0 U*40`Sd 0eCPQ0!0@Q0a005:c0PQ0C0TŸ82 , @@Ÿ0 b0B&0!01 S7ʁ1a Ÿ R0 ,00,  @00C\ 0  "!0 00 x1C& p 0 "!@1L  Q/Gl!5m,0 lG&l, K0nlGl @ @P Pʈ  Pz  Pw P Ph  Pp`  PmPP PhH Pe,g@h`hhh0`gg+g,g,gh-g-gH.g.g(/g -QPLMPi lv Rd \0Z* 1S Z:0S 0c 0Z_ 0U ag @ 00Q0 5 D @00C\ 0  "!0 00 5C& x 0 "!@5T  QP .00CSLĞĠ̠Ԡġ08@D ?. !0@0 P0U`tDpDlDhDdtl @H@0So l ?0Sf 0/>P 060#0 ?.P ?.&"(  ?.!@ b("(|0/>P 0j0#0 ?.P0 ?.&"(  ?.!@ b("(0/>P 0\0#0 ?.P0pr 7pr~lr|hrl @@0S l? 0S 0/>1 0 ?.! 0 ?.&"( 0qA"ql @0P Pq H10@A P(q#$q! q\El g00l ^P`d@ P@0`  !`l.0 S00qtl`g@h`hg+ghh0 (-"(L$ (-"(L⫹ (-"(Lb (-"(L (-"(L (-"(L@0 0  -LMP`XK00  @G0K@T Z<,ZXP 80 4 0 T`  VV V,V80B| @ 0000S0 00 \@00C\ 0  "!(0 00 ;l tT"@Va VD" V\<" VY V V$" VR" VOV "VJ"VGA TVTL TG!T80Bq1P 0000S0 00/ XP00C\ 0  "!$0 00 1C&  0 "!0 0 R0S 0@ 0 =x;l @T T  T  T T Tt  Tl  TT\ TT T,g@h`hhh0i$`gg+g,g,gh-g-gH.g.g(/gi$l Jl, -PULMo<p` 08 [<$K4,@(< "4&< 0%$o< 0 0P(@ 0SPaP@7(  000] 順 -LLM@T\ ` d0 LK 0 P k P`Dt[T  0p 0`pP*LT0(x P`1Q ^[T  0 0pPLT0 xP` N\T 0 0dz0`:@@ 0L 00"<ʟ@0@0C\P 0  "!0 00 9C&  0 "!)00 R_U7  9! 0|I000x0"C \" 0  "!00 00 9C&  0 "!ȟ(00 R(00岡0 0 0L wP`x@ 0l00"\(@0@0C\T , 0  "!0 00 8C&  0 "!0'0 RTPU: 017 000 00"C \" 0  "!L0 00 87C& 0 0 "!0 '0 RT0`T `T00T aTP0 00 TL8k`TC\VtFt @0"00XƟ@0@0C\P(v0 0  "!0 00 6C&  0 "!0%0 RZU5 5 000 00"C \" 0  "!L0 00 85C& 0 0 "!0 %0 R%00a``0 0L0 vP`Yh 0h@ 0 OGZPp0<0  g\`0P d@\`0` , Ġ \P̌$H d 8,#$X \0.$%Č`@S&,#4`$ 0)̌4#Z 0 84@T P 0P@UTP  0Y@0l0 > D# 0|\PPT L 0hmP`lT \l ՎlpWPPTP}H8@ LPKH KT0KX@KX @p#P`pG P 80HcTW 00S 0<`hY )[Z &[PPLj[TP ^0S!<4<("4!<P0S2P <4<("4 l\!^@: 0S 0,$,!$#, @^^@T0PT0P0 0P ^PPT 7` 0,$,!$#lPZTP }ZP w0("#!f! 88p!8P888/@h`hlghh0`jg 0000  <)@@@ 0S ^Y 0KK 0@RK: 0S*  P0@K00` ?` 0@0CO0 @ bßK$ $@  @;4 @ 0hR !   0P` <0<@_0 S:0S* b d0S Xʨ` 0S,2PH GP@jd R`@d@ڨ`0@S`0`Rd %d@5l0Sd ` `Sd dh ^Dhl T0! 00000' 0T ԉ@0S\sʼz ^00X00,000`,P@ K_00 /00 000x/QhhPl%l0500;00 00 Sm0Sj@@ gm00K  0xP@0 @@  0P;P@  0Y6@Zh -LMTAP0p@` <幊P  \0 0妊P  0垊$ -LM, Tp0 P@,0pW4 @̠0h18 80  `<`  €0<4!00SW  << 0<8,04 01P W  bP,04 0`P<0<<0<<0<<0<;P $! -p1L `RD \X @1S>Q004qpW4(A(!P0003P0P0C\ 0  "!0 00 0C&  0 "!0 0 R9300@0040000 0`0Ao=evh[h@h`hhh0 -L4M\00X `P0Kp\ H0 D 4 ,` h T00O<H$K4@ K8 L P M (% 0HK0 00 TZUe 00Td;004X08 S@ 0@ 000姍@0@0C\ 0  "!0 00 l4C& d 0 "!44@  Q 2Tm,T K,X0K, HK0 T W00] < H0L P0 8 0 8Q Q |#40040@ K@00HK IRT08SO$K4@ K HKC&  0 "!.0.0 R/W< x^0hΟ1 0l00040!C \! 0  "!0 00 =C&  0 "!-00 R$0 00  1 8P(0SS8P00 e0004p 0 0!440h<  80 S$00 00h  @ 0"0, 04<̟@0@0C\Pl弌 0  "!0 00  -0LM( @A0S00@jvh[h -LM8 TP@ @ Lb<0 D T ,K0@@ ZP@0,S D(<4(<"4P!<'p`, 40 H@ $8 ,#$ 8,,#l6` $,q$%lT0 80尠S W$68p 804 0CS3400:#:(`0(pHP0 KX0@0T Sh00 D<4(<"4!<0 tP<4(<"4!< 0<4(<"4!<0 <4< !4"< ( "@, @0 <$0 <4< !4"< ( "@, @0 8<4(<"4 <0<|<4(<"4!XpQ4  T !<00P 00c<  80S U< 4KPP8K\P0<@K@PKT @ P0P X^ T<0H  @0aS0@0 0,$,!$#<Z<0X@ ^0a 3SXP400@0 00 0R 0X Rv <0<4<, 4$!< , !$@,,@0p; 0 <4<, 4$!< , !$@,,@0p;0 <400`00` 000,0 0,0 0,00,0 <4(<"4!< 0 0,P$00  00aU^$00 @00aU0 x(@Zh@h`hlghh0`jg! p-LlMP@8 `0BRS]0 PU !0000 PH !000<!  0 P <#008 R 0 |KⱂPL0000p0  0|KែP L0R 80S 0 dP  #0 om p -LM@`8PUp , T0   0 t<0<0,00㨀<0 P' -L,MT0!0 \;<P@pFUD,pK D 0DU`0 !<00P  00c<  80S U(< 0K<PP@ 04K8PK<`K P `P@ A0@K @ P@4O1@00c<  80S Uv5@ 000"ğ@0@0C\p 0  "!0 00 4C&  0 "!dp$00 RaW8  44! 0(ğ00 0$0!C \! 0  "!0 00 3C&  0 "!#0#0 R* 00!  U00p00p 000,0 0,0 0,00,0  <4(<"4 < 0 0,<?$00  00aU_$00 @00aU1@00c<  80S 0R02@ 0$00"c@0@0C\p 0  "!0 00 1C&  0 "!0!0 RMW6 d 000 0X0!C \! 0  "!0 00 0C&  0 "!0 0 R 00!  00p00p 000,0 0, 0 0,0 0,0 ]vt$00  00aSt(a@Zh@h`hlghh0`jg! -L MP`D0sp,  p T0@ Oqa 800CST0@ :0 0 0 .P@ ,D   0 UP@ 0s , D0   v ł0s00s 0 (0s0sp0s0s00s 8\ 0 ۾P@(0s0s{(0sx00su0sru- -LDML TOH \HP ,@K D T0 <  L0X vX0 P L  !<00`  0 0c<  80 Sx V < 0K`P @qX\ 0s& 01  00c<  80S lnl@ 0`00"P~@0@0C\P 0  "!$0 00 >C&  0 "!0-0 RU5 01 000 00!C \! 0  "!\0 00 H=C& , 0 "!0-0 R 00!  00P00P 000,0 0,P0 0,,00,0 <4<("4!<0 0s 01@00c<  80S l@ 0 00"B|@0@0C\P 0  "!0 00 ;C&  0 "!0+0 RU5  000 0@0!C \! 0  "! 0 00 :C&  0 "!0*0 Rn 00!  00P00P 000,0 0,P0 0D*,00,0  <4<("4!<00s 01@00c<  80S i̩@ 0 00"y@0@0C\P 0  "!0 00 p9C& T 0 "!00)0 RiU5  000 00!C \! 0  "!0 00 8C&  0 "!0h(0 R5 00!  00P00P 000,0 0,P0 0',00,0 <4<("4!<00s\ u 01  00c<i  80S] tgt@ 0h00"Xw@0@0C\P 0  "!,0 00 7C&  0 "!0&0 R*U5 01 000 00!C \! 0  "!d0 00 P6C& 4 0 "!0&0 R 00!  00P00P 000,0 0,P 0 0%,0 0,0 \0,$,!$#, <4<("4!<0(q5 (5 Q 01  00c<  80S d줟@ 000"vt@0@0C\P 0  "!0 00 4C& t 0 "!0P$0 ROU5 01 000 00!C \! 0  "!0 00 3C&  0 "!0#0 R 00!  00P00P 000,0 ,P ,0$ 0,0 (<4(<"4!<0,<4<("4!<00q] 2 Q 01@00c<  80S pbp@ 0d00"Tr@0@0C\P 0  "!(0 00 2C&  0 "!0!0 RwU5  000 00!C \! 0  "!`0 00 L1C& 0 0 "!0 !0 RC 00!  00P00P 000,0 ,P ,0$ 0,0 0<4(<"4!<04<4<("4!<001@00c<  80S ` @Zhgthuh@h`hlgh0`jgh(@ 0400"1Dp@0@0C\P 0  "!p0 00 0C&  0 "!0 0 RU5  000 00!C \! 0  "!80 00 L1C& h 0 "!0!0 R 00!  00P00P 000,0 0,P0 0,  , "00P4K T08`KC&  0 "!0 /0 RLU5 01 000 0L0!C \! 0  "!0 00 ?C&  0 "!0\/0 R 00!  00P00P 000,0 0,P0 0, Ο , 00$00 @00aSu$00  00aSX01@00c<  80S~ n@ 000"~@0@0C\P 0  "!0 00 =C&  0 "!0-0 RKU5  000 080!C \! 0  "!0 00 V( V( Q UR R  sQQ 70V00S T0@ ``Q  0;0000  0S 0SX00 FA`0K  PP @  0aP00 Y0,$,!$#LT@TژH`0@ l P0 P0 3 0P0R00S   <S T 0K^P`x0 0R0 f 0 @ aP00 N0,$,!$#<<0崀  aP00 %0,$,!$#<)0 ;R0  0s060K  0P㴀 b0K  PYK  0rPP 0K  PDK  0 [P9  9Pt <S( 0   r060T 0KP`00\0 0  aP00 k0,$,!$#P~01@00c<r  80Sf [ @ 0 00"<@0@0C\` 0 !  0*C600*  00#!0x*0 R3V5  000 080!C \! 0 !  0)C600)  00#!0)0 R0000`0` 00,0 0,P 0 0,0\  0R,0 dP 0,$,!$#, L  <4<("4,!<. O0 L04K8`K0@K pP@@P80@K cP@@P80 HKH P@Hwu$00  00aS:01@00c<  80S `eh@ 0P00"'@@0@0C\P 0 !5 0$C60ğ0 00#!0$0 R[U6 $  000 0x0!C \! 0 !D4 00$C60(ğ0 00#!0$0 R&0000 P0P 00,0 0,P0 0L0< ,$,!$,4 , < , 4  *<0?,*$00  00aSf1@00c<  80S Vvڴ@ 0"00|@0@0C\P 0 !d2 0L"C60DŸ0 00#!$"00 RdU8 !  000 00!C \! 0 ! 0|!C600p!  00#!<P!00 R-00V#00 P0P 00,0 0,P0 0,00,0 P<4(<"4!<0000,埰drwu$00  00aV\$00 @00aV!@Zhuh!@hlgh`h`jgh01@00c<  80S ``X@ 0p00"㷶뀀@0@0C\P 0 !0 0 C600 00#!0 0 RMU6 !  000 0H0!C \! 0 !|1 0!C600 00#!0!0 R0000 P0P 00,0 0, 0 0,0 0,0 N$00  00aSt -LTMT T10NP S`P X \ l dP H0,$,!$#80< l P0 <0 T D0KT ǡPyD00`0 l0S 8 <@0aP0<0 ŻV 0,$,!$#lV`Q >`` \@\  0LK TJPL0P0`0 l\$ 8@<@0aP0<0 Z '0SA TP  0<aP0<0 *0,$,!$#Ld@ 4kU `@Tx =u\0 `XmT` ,0PK PP0T0  P0@K +P@ 0< bP0<0 Ŵ0@K P8@0@K P@8@`HK 0H PH`  0,$,!$#<^ 8 < 0aSPT0<0 T0T PM 0@K ڿP@80@KпP@0@K ſP@0@K 庿P@9t7@$00 @00aSw+)$00 @00a SK01 00c<  80S~ j吊@ 0 00"z@0@0C\P 0  "!0 00 ;C&  0 "!0D+0 RKU5  000 00!C \! 0  "!0 00 ;C&  0 "!0 ,0 R 00!  00P00P 000,0 0,0 0, 4 , 0\$00 @00aSv01 00c<  80S{ l@ 0 00"}@0@0C\P 0  "!`0 00 t=C& | 0 "!0-0 RHU5  000 00!C \! 0  "!(0 00 <>C& D 0 "!0h.0 R 00!  00P00P 000,0 0,0 0, 0g$00 @00aSy$00 @00a Ss01 00c<  80S~ tot@ 000"F@0@0C\P 0  "!0 00 =C&  0 "!0-0 RKU5  000 0l0!C \! 0  "!80 00 $=C&  0 "!0,0 R 00!  00P00P 000,0 0,0 0, 4 , 0t[Y$00 @00aSv01 00c<  80S{ k@ 0 00"㯭{@0@0C\P 0  "!0 00 ;C&  0 "!0d+0 RHU5  000 00!C \! 0  "!0 00 :C&  0 "!0*0 R 00!  00P00P 000,0 0,0 0, 0g$00 @00aSy$00 @00aSʪN$00 @00aS$00 @00aS|L$00 @00aSO01 00c<  80S hĈ@ 000"x@0@0C\P 0  "!t0 00 `8C& X 0 "!04(0 RLU5  000 00!C \! 0  "!0 00 7C&  0 "!0l'0 R 00!  00P00P 000,0 0,0 0,00,0 $00 @00aSu$00 @00aSʤ01 00c<  80S ,f,@ 0 00"=v@0@0C\P 0  "!0 00 5C&  0 "!0%0 RU5  000 0H0!C \! 0  "!0 00 5C&  0 "!0$0 R\ 00!  00P00P 000,0 0, 0 0,0Q 0@$<$,0 00<4(<"4!<00  0h0 (<4(<"4!<0, r  3BBa<4<("4!<000,$,!$#, 4 r x X3Ba<4<("4!<0l  l$00 @00aS1 P%1 00c<  80S Vsڬr@ 000"]됂@0@0C\P 0  "!\0 00 H2C& @ 0 "!0"0 R`U6 !  000 00!C \! 0  "!0 00 |1C& t 0 "!0P!0 R+ 00!  V00P00P 000,0 0,0 0\0,$8,#$,00,0 !,0 0\@ 僤][$00 @00aVa$00 @00aV ?Pth0O$Mb@h`hlgh`jgh0th!1 0 0c<  80 S Vsppp@ 0|00"㖪대@0@0C\P 0  "!0 00 0C&  0 "!0!0 RbU6 8!  000 0X0!C \! 0  "!0 00 1C&  0 "!0!0 R- 00!  V00P00P 000,0 0,0 0,00,0 T0 <4(<"4!< 0 T@0,庣+$00 @00aV_$00 @00aV 1@0 0c<  80 S DcD@ 0P00"`s@0@0C\P 0  "!0 00 3C&  0 "!0#0 RMU5  000 0(0!C \! 0  "!\0 00 p4C& x 0 "!0$0 R 00!  00P00P 000,0 0, 0 0,0T  0,0 ]$00  00aSt0NST50A\KXT6-t԰ 0-LM@ 0KPP 0sY06 -L\MT TT X L  T0\ !\0T@0d <p0 @Q``@ h l \\0 l p0` `@ ` S0p00L ( \<  X,0Kcp^0 A X!< 00P@0 0c<0  80 S$ Uu < 0K,K͹PP `\e 00!0P 00c<V  80SJ U `@0K 0,K⬹PP p\ 01 00c<  80S [@ 0 00"㧨z@0@0C\` 0  "!0 00 :C&  0 "!0t*0 RS V5  ! 000 040!C \! 0  "!0 00 9C&  0 "!0)0 R  00!  00`00` 000,0 0,0 0l0+,00,0 S 4001 00c<4  80S( X䈟@ 000"x@0@0C\` 0  "!0 00 8C& l 0 "!0H(0 RV5  000 00!C \! 0  "!0 00 7C&  0 "!0'0 R 00!  00`00` 000,0 0'0, 0 ,0R0&,0 H00&00000`  08pK4K@Zh@g=e'@uguhthg@h`hlgh0`jgh \0s 01 00c<   80S xPx@ 000"ťp@0@0C\` 0  "!0 00 0C&  0 "!0!0 RV5  000 0T0!C \! 0  "!0 00 1C&  0 "!0!0 R 00!  00`00` 000,0 0,0 0X",00,0 \p<4<("4!<001 00c<i  80S] RĂ@ 000"2r@0@0C\` 0  "! 0 00 3C& < 0 "!0`#0 R*V5  000 00!C \! 0  "!0 00 3C&  0 "!0($0 R 00!  00`00` 000,0 0,0 0,  , 0001 00c<  80S T@ 000"㪤u@0@0C\` 0  "!,0 00 @5C& \ 0 "!0%0 RV5  000 00!C \! 0  "!0 00 6C& $ 0 "!0H&0 R` 00!  00`00` 000,0 0,0 0,  , 0001 00c<=  80S1 W@ 000"" w@0@0C\` 0  "!L0 00 `7C& | 0 "!0'0 RV5  000 00!C \! 0  "!0 00 (8C& D 0 "!0h(0 R 00!  00`00` 000,0 0,0 0,  , 00\(q 9 Q 01 00c<t  80Sh DYD@ 0P 00"㒣`y@0@0C\` 0  "!0 00 9C&  0 "!0)0 R5V5  000 0 0!C \! 0  "!T0 00 h:C&  0 "!0*0 R 00!  00`00` 000,0 , ,0$ 0,0 \(<4(<"4!<0,<4<("4!<0\0qA ; Q 01 00c<  80S [ȋ@ 0 00"{@0@0C\` 0  "!0 00 $<C& @ 0 "!0d,0 R\V5  000 00!C \! 0  "!0 00 <C&  0 "!0,-0 R( 00!  00`00` 000,0 , ,0$ 0,0 \0<4(<"4!<04<4<("4!<0$00 @00a Se01 00c<  80S} h^h@ 0t00"I~@0@0C\` 0  "!0 00 >C&  0 "!0/0 RJV5  000 0D0!C \! 0  "!x0 00 ?C& 4 0 "!0/0 R 00!  00`00` 000,0 0,0 0, 4 , 5_]$00 @00aSw01 00c<  80S{ ^@ 000"㳡}@0@0C\` 0  "!0 00 =C&  0 "!0-0 RHV5  000 0,0!C \! 0  "!0 00   80S2 U0K,KH  0CPPzL04K8`K{1@00c<  80S Urwܗ@ 000"㤖@0@0C\` 0  "!0 00 x7C& p 0 "!0L'0 R^V5  000 00!C \! 0  "!0 00 6C&  0 "!0&0 R* 00!  U00`00` 000,0  0,0$,, 08#$,0@0,0 $,0 0 ̏ꦶꤶ$00 @00aUc$00 @00aUb$?P1 00c<  80S Uru@ 000"䤟@0@0C\` 0  "!0 00 4C&  0 "!0p$0 RaV5  000 00!C \! 0  "!0 00 3C&  0 "!0#0 R- 00!  U00`00` 000,0 0,0 0,00,0 T0 <4(<"4!< 0 T@0,$00 @00aU`$00 @00aU01 0 0c<  80 S ,R,@ 0 00"8r@0@0C\` 0  "!0 00 1C&  0 "!0!0 RMV5  000 0H0!C \! 0  "!0 00 1C&  0 "!0 0 R 00!  00`00` 000,0 0, 0 0,0T  0,0 \KI$00 @00aSt@Zhuh@h`hlgh`jgh0!1@00c<  80S Uslpl@ 0x00"㒔눐@0@0C\` 0  "!0 00 0C&  0 "!0 0 R]V6 8!  000 0T0!C \! 0  "!0 00 1C&  0 "!0!0 R( 00!  U00`00` 000,0 0, 0$, , 08 #$,00,0 *,0 0P ọ/ꕴꓴ$00 @00aUd$00 @00aU1 00c<  80S Us4s43@ 0@00"P@0@0C\` 0  "!0 00 3C&  0 "!0#0 RbV6 @A 000 00!C \! 0  "!P0 00 d4C& l 0 "!0$0 R- 00!  U00`00` 000,0 0,0 0,0L0,0 <4(<"4!< 0 L 0,Z޳ܳ$00 00aU_$00 @00aU;1@00c<  80S V @ 000"*(v@0@0C\` 0  "!\0 00 p6C& x 0 "!0&0 RMV5  000 00!C \! 0  "!$0 00 87C& @ 0 "!0d'0 R 00!  00`00` 000,0 0, 0 0,0L  0,0 \=;$00 @00aSt( -LDMPT T0PP SL TP L 0 @T0ϟ|  L| 0 0 D X  ,0KݙX R0  !<00P@00c<  80S U< ,K0KHPPX0Ss 0QXP8 80D  <aP0<0 ő0,$,!$#ꈧꆧ$00 @00aVb$00 @00aV ?PC& p 0 "!0.0 R 00!  00P00P 000,0 0,0 0, 4 , 0mצզ$00 @00aSv01@0 0c<  80 S{ tot@ 000"+@0@0C\P 0  "!x0 00 ?C& x 0 "!0T/0 RHU5  000 00!C \! 0  "!0 00 >C&  0 "!0.0 R 00!  00P00P 000,0 0,0 0, 0gCA$00 @00aSy53$00 @00a S}01@0 0c<  80 S~ \m\@ 0P 00"㉅@}@0@0C\P 0  "!0 00 P@꽜h껜%$00  00a Sk01@00c<  80S~ f@ 000"| w@0@0C\P 0  "!@0 00 T7C& \ 0 "!0'0 RKU5  000 00!C \! 0  "!0 00 8C& $ 0 "!0H(0 R 00!  00P00P 000,0 0,0 0, 4 , 0&$$00  00aSv01@00c<  80S{ LiL@ 0X 00"z{hy@0@0C\P 0  "!0 00 9C&  0 "!0)0 RHU5  000 000!C \! 0  "!d0 00 x:C&  0 "!0*0 R 00!  00P00P 000,0 0,0 0, 0g꒛ꐛ$00  00aSyꄛ~ꂛJ$00  00a S01@00c<  80S~ kԋ@ 0 00"z{@0@0C\P 0  "!$0 00 8<C& @ 0 "!0d,0 RKU5  000 00!C \! 0  "!0 00 =C&  0 "!0,-0 R 00!  00P00P 000,0 0,0 0, 4 , 0$00  00aSv01@00c<  80S{ 0n0@ 0<00"AzL~@0@0C\P 0  "!0 00 >C&  0 "!0.0 RHU5  000 00!C \! 0  "!H0 00 \?C& d 0 "!0/0 R 00!  00P00P 000,0 0,0 0, 0gYW$00  00aSyKI$00  00aSE=;$00  00aS ʮ/-R$00  00aS!$00  00aSw01@00c<  80S m帍@ 0 00"uy}@0@0C\P 0  "!d0 00 P=C& H 0 "!0$-0 RLU5  000 00!C \! 0  "!0 00 }Pp^0 A !<00P@00c<2  80S& Uu< 0K,K⪆PP\f00!0P  00c<W  80SK U 0K,K 0዆PP 04K8`KHK DK t}P0kH@+$00  00aSh81 00c<  80S~ ,b42@ 000"Fm @0@0C\P 0 ! 0!C600!  00#!0!0 RKU6 h 000 0D0!C \! 0 !1 0 C600 00#!0 0 R0080 P8P 8040 04@0 040, 040 h[Y$00 @00aSv(!@Zh@!!@hlgh`h`jgh01@00c<  80S Vvh`@ 0"00l@0@0C\P 0 !0 0 C600 00#!  00 RfU8 0!  0H00 0X0!C \! 0 ! 0!C600!  00#!!00 R/00V%80 P8P 8040 04@0 040040 P0@ <4(<"4!<0P0,eꚌꘌ$00  00aVZ$00 @00aV1@00c<  80S PcH@ 0`00"kp@0@0C\P 0 !3 0#C600 00#!0#0 RNU6 $  000 080!C \! 0 !l4 0$C600 00#!0$0 R0080 P8P 8040 04 0 040 040 P0Z$00  00aSs -LM  T 0  Q  0;#;S r 0,$, $,#,0.O0 x t \ \ |0Krp !<00P 00c<O  80SC U< K|K{PPx1 00c<l  80S` ]ȝ@ 0 00"j렍@0@0C\` 0  "!p0 00 \=C& T 0 "!00-0 R-V5  ! 000 00!C \! 0  "!0 00 \`L K9 ]P%@0 0@0 )0K KKxP@H0K K =xP0 KK 1xP0 KT xP@@ 0a^00 @<4(<"4!̃0 a^00 0 KxP ]0K K wPS@0K K wPFZ@ 0 a ^00 D0 KxP1@;H -0 KK wP"0K K wPK  K0:zP  q0K K wP] $00 @00aSʔP \!@Zhx!0O$@hlgh`h`jgh0!1@00c<  80S Usld@ 0|00"bg댐@0@0C\` 0  "!0 00 0C&  0 "!0 0 RdV6 0!  000 0T0!C \! 0  "!0 00 1C&  0 "!0!0 R/000001U%0`` 0|0 0|0 0|00|0 <4(<"4!< 0 0,`^\$00  00aU]$00 @00aU -LM(p`#ß 0P  P, 0@0 䒟P00C\ 0  "!0 00 2C&  0 "!0p"0 R D2A@08 0R@0000   P40$"1p 0ppPW000 zR 0 21P 1 1 bB&! 02 S5|1b1 R0@@00@P00C\ 0  "!0 00 0C&  0 "!0  Q0隆' P0 0 ,K,0@逆s  &@G@h`h,ghh0!`gg+g -LLMTlMLT0  ` d P  X  \ H $ ,0KL %m`0pS0  !<00P 00c<  80S U< 0K,KvPPY0d!0P 00c<  80S U0K,KP  0svPPT04K8K1 00c<  80S Uvڨ@ 000"`"@0@0C\` 0  "!T0 00 @2C& 8 0 "!Ÿ"00 RbV8  000 00!C \! 0  "!0 00 l1C& d 0 "!4!0C2"/P!008BS@ CP?#404p$@WDtCY8 ,0 <  004,  `PT@,PP@1@#W<PP@1T@XP2@p"S 0 S08 SL3 R2PPP2@p"S 0 S08 SL3 RPX P"00 SPPP#00@ SPDp,@PPD `P"‘\00pS04pS ࠡ`P PP ‘\00@S04pS ࠡ`P  - PL\`@pOP 10SBt0 0ZO8 0 T 1P-O@ O`,@O`OVP3"0 SPPP#0 SP8 0O`X8 T`0l!`!R @ R D0| 2a O@O`& -LMPp  P,P ,@`VPUPa 0 P` ,@V,0YO`VP 0 PP`,0UPV -LM @PP4  T 0cSP\q8 0 B0C0 Y0 0 0! d ,K0P`,8"HPQ@ 8  3S *2  N0 T0XP<0 0!8?\>`0 0/ ?> 00cR#`[ P80iW00\!8?\>`0 0/ ?> 00cR#i P<PX!@!400C40 g!40040T0XP%0 @?Q>`0 0?>0 0c$00C$0 P B 40P 00C 00@0 00,8 ,|,XU g -LM @Pp4 PP0 00Uz 0 0 ! 0d 0,KPh,"H`0S 3S sY00U 2  00U T08 UZ P !40 SPUUA 0 0GPp7 ^!?Q>`0 0ς?>00c  ^$00j$0 P j 40  0Z0j 0 40 j0C40!400400,x$,Y, 0 ,?pM0 8 Z00 ?Q>`0 0ς?>0 0c8 ^$0j0$0 P 4  00 0 40040,^0 ,pU g -LMR pH @M 0Pd ( 80P(X`0ZC 4R`0 3  0*00C0 P B 00C0| P McM@PwM0 YM0` UMPEiM3 RX0  200000C0 l3 RT000T0 0C0 0員 800c (M3 R`0` Z" PXQ0 P%R4 |080 < $M 2@ @!QT000T000Sj \28Q4 X0 20 0<,0 , L@PM0 L0` L4 L40@P`,P0S4 @T40TX P, 0S30 L` 0`<`80LLq4 T52000?00s2 q4 T52000@0@ PR`0  0PV.L5sX50 0S`0 RQ0@@0 0 l]h[`00 D]D@T,P0S@TPU !$!L! -LM `Tp 1S0 0 ! 0d 0,KP, 8 80"H@0S 3S 8Vh$% 0WP0SPU 0PG0UC0SPEUT3 Q, 8 Uʼ000 !L P@ l?p >14 PHX P0 ^ 0 S40\4 \` 0n0rP02U8(@8  /P80PU,080 , 8 8x80`K`0P,080 /[U t! -LM P`P@P00 0 0 0! d ,K0SP, ,倂HpZ4  3S  0S H2T  080  8 vK@>Z!\000/ > 00cR#= 081 a4 ^Ϡ\0.A00/ GP  l1@R\0/ GPI <1 Z\0`000?0A0@ P@\Z0.Z\0!00> 00c# 00 0C 0  P B 0 P0C0 ,0F Y0 00 P 2 020 0d\U gL!!!! -LM p`0PR 0O0  0dD\\FZ8T 0A0U2Sʼ@J0 $0X: /\%00 00 ! 0d  ,K0cP,,$H@T 3S 4  J00U 80A040 ?80 <448T`0.!48000?.a 0 bS1P4 0< T0USZ% #@?T>`0 0/ ?>1LQ l3T`0 0?>0 0cZ$00 0$0 P R  0 0 0480 24R`008008?.a 0 bS1P< 0f 2 `R4 `0RA P00,$08 0a$08Pl 0l  000 P 000| 4@PII@PI0 I0` IPEIX1 RX0  2000000 1 RT000T000 0[0` T`0PB P 0 R`0 x  0A000 P 0 000| P0 Z !(!@!X!U gd!!! -LM @p,0 Ws*gI4 0 0 4 ! 0d 0,K P`, ,x!HPX 3S bL1  /I01aY\000?0p0S9. 0X\000/ 0900 0W0p500 0   P4  P000 ,00C0 P B 4 20C20< fZ=S0 `X^XU g!!! -RLM`, p{ @H?Q1 Q`000.,0Ae8崁/.  b  B020!1FPp1 @R, `08P/.  b  B020!FP5 00`,,08P0 eS0Y`0.!00/ > 00cR#0@g0P 0 S P Q,0` YXW, 0@ Y8,0, @/>QU Dp$8@!T!t!!G-M$PP0gl0h `Qpb?>1 E   @$?p > 1^ࠡD T! 0  S \ d@E? >j1^࠱D T!@  LP \l0 \ 1 Q0 110b1X10l1$5S!0SL\ T3Ѝ?>1 E -0LM 0 W! -LM pP@P I8500  Y ] R00ZU00 P@ D P PP P ʤ04 OR59:Q5:0 @T00 T00S Z 10 0PUP@R P@ 4R:0S: Q0   0!P` U/ 8%0@0L 0P@U R   0  J  0xKP P` 0x 0 04 R:20S/*@5L 0P0   xK 0uP` P  0`! 0d x02T0 0<H'D 0@`0P |0Kd KP` |0` 0C!|0 Pt KU   0 0 dI0 K0P`R`@KH|0  \Q U Q xK00  P`4xP0dIP 0 ` d03 T0 d0KH<@C0@`P` ?P00SQ 0 B  $0tPKU@ *0 |00 U@:P00 TiD 08!0 d00!Q0Qd0E0 K0P `0KH  b  02 rJ PU@ 0!0!xK 00 xP` xPPP 0 0 `! d0 3T00 00!0Q 0<HC0@` Py  0 K 0P`Z0 0g0 0  d03T0 0 xK 00  P`:xP0tP 0 X` d0pK3 T0 H<B0@`P`!` !P0 0 00 xK0   0@P`P0/› 0 Sx0 0   l85@%0L00@ TT!! -LM0`K@0 @PT0@0 000  00@ 00R00S  T000T0 U000U0H0P@ N  ,5SAڸP` 0pD0 0 0$@DxD`0dCA0 00c0Q3@T TX0X  0S  R1 018ĠDp$8 -80L0CS%0Xl0S0 #Q00 L0 R0SO\! -80L0CS! L(LLL000 10B0  2 R0  00Oh! -80L0CS!000 10B0  2 R0  00fOx! -80L0CS!hT0S1 S20#B1  0S 008O! -L2O! -L)O! -L#O! -LO! -LO! -LO@! -L Oh! -LO! -LN! -LN! -LN! -LN ! -LN4! -LNT! -LNt! -LN! -p1LMhQh!00`P@D1DqP@ ,PP   KP@  P@  0 0 R  0 00 0!0@Y .  H  }  00C0  jꀤdg gheg!!z!wg -L|M` Kl Pj+ P@ p@&4$0S Q 10 pҝY 0  @0@3@00@  =S3@0TA@0T<Y$ @0! 0 Q=S@0  P0  0 P@ ,,L;Q @0(0$ ,P@p80S@ |0" 0Q@0 Q @0 LMg0  0@ qT@0K 0X | | 0S@T0KY -Zad;TKl ?H 00S @0 p=Y YҐ  0 Y @000000LpY@K0Y -Za&;0Y {-Za; X@ D KP@ iGO@d 0  0h@ T R0 l@  @($O@03@0@!td!L! -L M@@T,/0 %\0  0P4P尀`p=0 0 0$@p=x|=`0dCA0  ,K0'@T 0x[=,0 H >90,{ Lx! -L4M@0@pH D@  1`N 0H @@,P WU0x@ K.P@0L(@  ?q:DK 0*չPPwD2H\%R0 R1Rh0 S)1PT3h PT3>h0 SD 00:00D(5D02H 40@<P PUL #8 P R4 i0@d 0 DK冹LP0P L0 +D0H_>D80P Y 0$%R ,0YT ,0Y$%H0\8 K4 00 8 ,` ` H0LhdTc0! -LDM|0R `0pPP OP6 V z@0 @@WP U @00L0  0PP000 KpLP00L(@ ? 4 < 94@K  0*@PP 40H0@0 \5Q" 5Q OP|0@@4PL 0R <0S <A.,yM@0 R5Rh0 S@0-0R0 0L0P0@0" @ YM@@LL5s00 P P aea< 9@h ]<@0\%44R0 0@<@40h Hb=@h0 S4 00:004ݹ<4P L @ 4@ @;@H $5S,0 AXP /XH@\D P)8 H@ @R4 l0@@ 4Kd  0 X DDPP D 40H=4培@4P 80X H0\@@$%R ,0D\T @,0\@$%< h!@@0S 0Sl0 0 l @@0(%:D @0<@`t0$0d <( 80,0\@Z|0@LP@LC] @80K!*8@a\8@<S΁S?`K@ 0P K Q0O`0@\4 O PKP@05SP KL0S@@@0 0 @0@0000< 0%P@P PJLG@ ,L \@@,L8@P@046LghdTT!c!!E-0 LS03R %5p00P5,5S ڬ4S9Ӭ4հ4S@0Ӱ400tA/SpPo5@"p%$\ZH0L0SO/͎ -L M@0Qp `: P@ҍ X 00#00 P@р L|  09 0Q @P@0:@0  -@0L Pp  ,P@`@0 S@`V P@P @ 0 0A@   -p`P\LP0d -40( 8$@<( %7@`@, T0C0H0VZ  d;Z `;Bl \; D 6)IT! p-LM0@SP  80S 0hl0S  *`V p  00S0   -LMq@@ -R`P =S@ 8 K8 4` , 0@ .8@0<K#=0T00 \ P S  <0 PP ST 0@ @ \  00S  Pe- @ =SPPJ H/L!! -LM4 qP8 8 Z4,0K<Ÿ @T,AG`?60T"0J p@00@0, `,001 1PP@ ,sT P 80 0 0$ @8x8`0dCA0 0K0勵P@ ,908  x 800 H \:900ض0 ,0K4EP@1S ,5S9Ѿ)1 !,080`0S01,0T @000,80 xh wh !hp$xh@xh@-@1T0, T:F@ 0000!  -L MP, 40@q80 PPp#8  R4 g0@d 0 d H`9,QE I80p W 0\'d0T   cy9@000h 0C`00h H9L5H sP5,5S,S?QS. 030P0 SHŒp011pGW 00P000 g 0-LMT@PTGD 0 0((@>0h >e wh!HE$@-QM@ 00CS 67$747 P0 Ѝ@-@Ѝ $  r$r$@p$0-0<`L0 h0ckPl T l !!r$! -LM80S <<4 0 00Ql pp`0,0 R@ 00300@Tl R@ 0 3P0S~ U@Wl p 0Sr0 #S`00C\XC 0  "!P0 00 <3C& 4 0 "!0#0 RD P=2 0`00l R ,0S0C£`00C\ 0  "!t0 00 `2C& X 0 "!(24  Q  0S00 ]]Q00j W P0Sx 0S p0S 00 10SHP00300eW00PQ3000`00C\ 0  "!0 00 0C&  0 "!0 0 R, R a 0 ` lP+ 0SqP \ |00S @0 (C@h`h !hh0pg! 0-PLl@T 0 06=@0 wh -LM@#h -L M @^ 0    Q -LDMT@d ` d0 h P`P尀 P3@h pTXpKU\PK  0P@q R\ "1 (`!R0 0  R` V` 0h S0, 0Q0 0 B1RP\ p; X@i T3 U00d0P  0 妲00P @  H\@0X0T00S 0S $0`V * h0^1 ,1 S 0DS\0 pU~(0` 30000$ `V*h SH,!0 0Q (00 3&T00 L0 ,00,0$P@ O (P g -LM00 T0, 01P<0 00 \b0 \8 D0 Dp@ L@  ɯRe <$0@' "p X Q@  g B@ 80SG@0l0`  c4 @ ,0bR 0 4 0 D0 , .@ 40 @ 8 S% <0D $@ PD 0 0p0  00 /0OW@ Rc",0'&4 Pe P 04P ,0 00SD8@ 0`0l0bc4  -,0 L 0 0 0 $xhxh`xh-X0X  00P0\ P0^Pxhxh -0LMxxpP@`0 0P 0T P0U$  P  gxhxh -0LMTp@ 0`P0 0!R 0U R00 R 0@@0V0  gxhxh0S R00  -81LM PR`@ @0S?9S 9S0  Q  a 0T @0pP 0 000)00yp1   e0! 0-h0L PR @0SH@ζ 0P0eP! -LTM4 0d @t h d l ,0 p 0400@ 80 `\ 9 : S` 08@h PP  8T0@  00CS8d ִPPl 0QQD <0 L H t 0<  00L0 8 l0TS1 PAx Q x  x 0@_Sk0Sgp0P0 px0?T  $4K TX Q0\ @,PF,0K/00PPp<0S;;S<@ H ,0H @0S 2 R< R P  8 T0D R00000cCQL0Q @ D < P 8T0D 0R  R T 000 XRX p Q0PQP 0〠 BP 0,Pml0SS S 0l#70P00Sd 8 04 08St  0S 0h 8PP#< R'xxP0@;DX X ?0/;?0|0 \0+S  8\p o060lQ @ DX0QX x@ ;;S @Tx0ax0R@>el!!`tg-Pe8T0D R0S@D@ @ @40P X 0A8< P 0\ P0 S0 00800T D0xS00000 0 S:0 S*!F8xT D0S00000 000,tl 70R00S0?00l0S `l0P0Q00S t  dt  /0S$ 8 T0 K0PP \0S t p 806000d00 Cd 8 68@00@0dp 800 K6080T0PP\P t 00d 0p 8uP0P60 0<8p gP0600h 8PP0S 800 KT0PP0 d\ 0P;0 8p S060t a 08h PP ;;STx0ax00S% 8 T0 K0PP9  h0Q 1Q 00!R i\d Q8\p 08 @00@0d0 <0SH0@ 0rH0 H L0@ R0@  00b< D0 8 @P %$; ;!! -LTD0S;;L@DK 0 `@3P*D0S'\ P P`YX0T DQ  R 0.SR 0.SH0P 0PX -L8M0`\@ p@: \@7 P@0< K8\08 pPPP@@T0D R)0[*0[S""[0R0 0R@ R @00T@ K0P@ @P T @P=@..$!- -LM@ KP 0 0 0-@DP L@P00 4 0 0 -( L0S 00=`>e p-LMP` KP0@0 9S !0R &F@ p 0- D0@L PP0s00O$ -p0 @LB 0  m PP0s 000H r 08PP0O$0D 0  R  0S  000  0-LM0@ PR0K0 R 0 0000 H@0 t0  000 0000 H@0 0  g -LMDpP@ 80SiiiiiiiiiT0@ PW 800S  ! 03 -LMp0P$K`(0 RY 0T 00$00H H 0$@p1  0000  9:0  1 0 ! 0H0 0(0 , 000 4 080 < 0D0!@ 80S; ST0P $  1LO$K48 T0 8$0H0 00$00H H 0$@0  g -LM@P0S` p0s 0s0s$0sH0sL0s@0sD0s$ T0@  1R P R0 2 RD00000D Q  20S q T0@ q 0Ph0s4 s 8 00KRj gR` 40pPN4, 0S:00 S*(qC T0@ = 1R XP \0  0cP(q00000(s00 000Pq T0@   0.u  00sT0@  R0s0ss~YD 8#8ST!880$0Q8g -@P1 LRp` P! R 80S   P  9:9): )<0 9  oO -L M`0q00 AA0ppx Sn PP A 00T000 1Y,0 00000 PP 00,  0  qPP,, 00PP$ 0 PPP<YT000T 0S9;9Y 0S9;9, 00 AP 00,J0   W X  P"8D!E p-LM080S 00S 0 \ `T p 0 05u` t  -"LEM0`,0 8 Rpq T T0RhW  hP[P1 PQ0QG0 0 0   0P' 0 0CA  0U1v nw iW  C፽0 ,0S ,MOK  0P  g@ugX! -LMq 0R 0 P@`' R K7T0D R- 0 S R ' 0u0` p00;0(!  A?K  K H)4PK J/K0`d gd!!@ug -TLOM`0 P,0 KP`P1 p 1! 1P` P` - 1 P' %\,0 S P,0I00P1 8  )0)0000 00) 0P`XT0D 1RSK@0L1  U?K@! 0@ <P`90 0 0 PzT1SKH % 0P`1T!P`MOK TP 0`V y | P10`X-y000)0A B0)0 P吹T g@ug !r$r$ -LMPp@` Vf |0S vt00S Bu 9ca &P 10S 10S 00C0  B  0P#w )0 B00)9 0C 9 T0 @ @00 000   ' -LM0P@ 0  rPp0s$T0D`P 0 @%  0     ppp -LJ/\:4J ?` @TL T  TG  TD T Th  T=`  T:TP T5H T2,!,g@h`hhh0,g,gh-g-gH.g.g(/g`gg+g -LM@T0D0Q S1S 0h9 T 0T   0T 0T -LM`@\80P0CSTP0QA q 0|0 2D 4 A!P000sP0P0C\ 0  "!0 00 1C&  0 "!0d!0 RyIT0 *PpTq<H"T@p00@;0004P 000*P0P0C\ 0  "!0 00 l0C& d 0 "!0@ 0 R0I '0V$@h`hhh0H! -LM@P0#Ƞ Ƞ0,4 2 9T2 1!<180S T1\!!!V! - L 0000 Q$zg - L 0000 Q$zg p-L M0`@ PR1!0p K0 R 0 00 00 H@0 |0  000 00 00 H@0 0  Q$zgg - L 0000 Q$yg - L 0000 Q$yg p-L M0`@ PR1!0p K!0 R 0 00 00 H@0 |0  000 00 00 H@0 0  Q$ygg00CS ꘗ̗ؗؗ @00 0 ; < 0 0-LM 0P@ P0`0 -LMPp@9#68Q@4 '`V 0 | 0040ʵP`0$KS<00<0H$@  0P4 N$zg -LEMXŸ` , @00i N?KPP (( p1 ,0S ,81 p  01PP PP x( 1 8H0i00D1*"818)  80000 0PPMOK _ 8 0PtPP 0  810t'd' 0 00 )818 8  P P9;9 g@ug!N$ 1s s 0080<00 s00(s$s$s$< 0S00 Q0 0 0S00<0@Q` 1  40  aR ,0000 0S@Q1 0 ! 0,00 00@Q191 0 S  -LM @` PRp$ Q 0R 0V`#V($@`l6 P  0$00  .0!D! -L0M0 `P0Sp9 : S? (@@  0P@& T0 Pp0@Q +R"0 0S0050500 L D.(@0ˆ .,ȣxhg!!! ! 0-FLPv\ ,0Sq 0 S R 00 -LMP @ 00Q ^ 0RP 0SZ(@B 0" -LMPp  P,P F`VPUPa 0 P` FV,0 `VP 0 PP`6UPV -L M @p,凒0PP 0Ɣ&0,K囙PV$,0jH`PPUI j?>1 1@R#P P; j!0bR0S- PP0S$ P ]PP?>1!E , B 0H 0C0,@$0"Q ,姚 -L M P,劂@BP00  0ƕ&0,K$P^,0TH(` (`T>1 1@R#@  d> aq P/ 0lA0 P@-+.!1D0,0C000*  R0C 0,& 101,ʙ(0J"p `P;  $z- ,(L!(!P!p! -L M @`P`$ U0: [- , &$K嗘P$0$`Hp?> 1@PR#  0,0 00D 00$j$ۙ; #-%+!X!d!! -L M @PA \00\0SC(,6倢0 Ɣ&0,KF0S-,0(H`zQp Q ;  ' 0,&0 00 00 Q,& 10C1X0,,< R,y; * *!!! -RLp`$P@ $P`4A0Qd P 0l1 P0P,L*P @P; , L!!t!8! -0LM ; *X! -L|M0   0 Q0p  0 Q0 Aa@T &xK0囗PPx00x 0x|K 0PP 0| 00 p &0Pؙ0x &|02T0 x0<Hx0@P0Kd KPP0` 0C0 !@tKT P   0dJ& xK0EPPNx``K H0QA T   0|K 0NPP/ |@dJ@ |   0&Pz 6d K3T0` H<0@PyPP0SL 0A xjxxX0t@KTpJ:Q! (0P ʀ0dKA`0&0`:x 00: 00x30 @PW 0$B00 :0Ad0D& xK0屖Px `0KH xx啗6Tp:T=0! 0{|K 0PP |@@0| 0 pA x0P&0PӘ 63T00 00<H0@PxK꽗0 &K0KPP S& 0夘 63T0 0 |K 0UPP|@X@0t@ &0P兘x &|0pK2 T0x H<x0@Px僖PP`|  00 0 (! -L M @^ 0    Q -LDMT@d ` d0 h P`P尀 P@h pTXpKU\PK  0P@q R\ "1 (`!R0 0  R` V` 0h S0, 0Q0 0 B1RP\ p; X@i T3 U00d0P  0 00P @  H\@0X0T00S 0S $0`V * h0^1 ,1 S 0DS\0 pU(0` 30000$ `V*h SH,!0 0Q (00 3&T00 7L0 ,00,0`P@ ዖ dP g -,1LM PR`@p @0S;9S R;pST0@  0S!$K$0)00  P0S 㧮 00 zp e! -LM@T`@  0pKP 00 T00 P HV@0 1 0 0P 00@(` 0@Dp,V0R$6&4K0vP@ 4ؕ000$@40 H HY 4Д4M g -LpM0 X` M8 P 0@S@@T P- 0@S  0@K X 3W1ƙ&0G P000 @K 0 @]P  pmm {000  05R6Pp( &0 @@K  0@ @,P pFvmPm0eHOx Bƙ@0 &Y @4 6P@#!B0 6#1 |K a, 6< 4@D0 @ P 4@K1S4KPU BZ PU ,0@PEU 0C00 0 0K< m|K< iXa"0 尲 @ 6 #1 c< 6P35@ a B8 ` V&4K1@DSPUZ PU ,@` VPE 0@DU@ 0 d00p 0006 $ &@0K4K"1K ;4K1P  S0  00  fWnHT000  0 T0D0Q:S0Sz000@ g -L,MH L 0 40 8 \`8 < @ p PFF$1@P U@ 4X@.0  0 000D ]D@ $5 ,00,00 <80&Q0 ;T` P@.4H\U8 QʀQ  Qʨ$Q80BќT4@   R< 00 ld@00C\ 0  "!80 00 $4C&  0 "!0#0 R8 &<O8&"!h! BN В@TL<L 8 6@ #1PCU bpaPEV@Up4 RP@aV\< RS R3 @ 0<2 bB&! 02 S;1b1 R0<<  <00lb@00C\ 0  "!80 00 $2C&  0 "!0!0 RHL= 00 :00D80&L0,K"0PL@,0HL H 0^08&",KH @,0LT L H H0D 00H0 ]e=780p< @Q Qʬ  Q  Q Q Qʌ  Q  QQt Ql Q 0PL3$ g,g@h`hhh0`gg+g,g,gh-g-gH.g.g(/g! 0-@PLB/L  0000 l000000 -LUM\0 ,0 08`1 Q`0p h 0l t &`1 B@000@T `UoK TW?KT1 @ P XA DA T T $T80B4P 000P0p0 TX$P00C\ 0  "!$0 00 4C&  0 "!#00 R0S  0 \q Pd -D1P0c0Wx1 $*@TMoKPd  T`!>K0\ Pd l1ğS t@t Pl1 xU:h!2 2@ 2 b2B&! 02 Seʐ1b1 R0pp00p<@@00C\ 0  "! 0 00 1C&  0 "!1  Q/0h! 0 @PQ`0S:  R d1Spt0a0 d 1 ,0S <,~0 0;$t  l 0t!p! :;5 p @T T  T  T T Tp  Th  TTX TP T g,g@h`hhh0`gg+g!,g,gh-g-gH.g.g(/g -LTM0 \ 06p0  d 0`0 \0h  , l @4 0` Pd@Pd8 T X d )t  4T0@  00CS4\ hP@hPP< D @ t R0 00D0 40hT\1 PAQ Q`H `p0@ppL P Q0^@ ,P0,K/P@D`Yp0A 8 @ ,0H @0S 7 RY#  Q00 000cSDS080 < Y@8|@ 0@D80 \008 0b<0 Q  0R| 0L0 0L00 PRP `Q0HQH 0p BH 0,P[h0SSFt\C ;S@ 4T0@ 90` 4P@HY%p@)p0x@P0 0p P@.p 00| 0 T0+S  4Tl )0608< P0\P x 0h#70\00S\ 4厖'P}00 ,0 000Sdh 70R00Sp0 l00hP Xh0\0P00S tQed /0S$ 4 T0 K0P@ T0S t\l 406000\00 \ 4 24@00@0\l 400 K604T0P@T R t0S00\0l 4qP0@60 0ʦ4l cP0600` 4P@e0S 4 T0 K0P@X0 \T0 S0;04l P06tQc 04` P@;p 0LL0`x00xS+ 400 KT0P@&9  `Q 9Q 00)R gT\ Q 4Tl 06004@00@0\  80 000 0 4 (P< %p 0L0 0c ` iߎ` H ,K/h0P@@>e!! 0-LM0 \P&@tl  00\\ 0SP 0S<P00 $@!! !4!X!x!!! -LSMh! H#hA0  ,0 ,3(@K 4 L0pS㰀 `0 9#60C S񟗯$L,L4L<LDLT A?(K h1KK  hAx 0R 00l1 :@0J`4h_ 0KSK0谠lAMK`UK \ WKXA DA T @a 8 Pa K)P@`ax0 0R@Ppd0S0@ 0`p@d P pvx0U`0MKS >K>Kp @`l!ed0P0@0|Q 0Q*h1/ 0@ d b ` ^ \ Z X A?(K V g!!! -L M@0Kx RK/P 0N000Kb0K/P(0009000 -LM@$K_` 0K pP#0 0 L0S+ `0( 9 #60C S<<$<,<4<D00$0000000000 0  -L L!p! -LM@ b HP$ !a0 $R01 0$0 -L@ MT, p$PnP1``0@Sd\0!10 l1R0011  0S@SM !R1 B 0 0 T@T+Q1``0ASdQ00!a11\00!11`  J 0T V00!11`Q @T, 00QP00!11 000 !! -0LR@@``TPp X$ !@RT01 0@\ 1  ! 1 @ 00CS0  Q00Q0S@ `FR00 -p@L`@PAU0$ e  A0 0$bp K0S b0 C0S0 b ;P0 b b0@zh$  ?#>C@0|h~h>e -࡟LM|0x 0PbU|0`2,0 1, Pp` a1   P 0@0L l00C\ 0  "!80 00 $1C&  0 "!0 0 R$ P p0S00@@ , x 0 0Q0x  p0Q0p  " b@8 4 |h?e@h`h+ghh0>e@~h!! |00`|0|h-8p0P0 0Cp  0  @~h|h 0-@LTP 00ST 0S 00 0C 00TTp  0pP0002 02066@@~h|h -LM 0@SG0 S p00Cp0|hP0 R0S2B "0 -0L@pT` PU  PR00R00SU@TP>e p-LMP zP` P p@ G `202G0 -(0AL0$1@TPop 0S @TP \+0@S000@`p@ 0S {h p-LM0P@ R*p0@S 0a!p R P 01U`P V000V00C00S R000  W Y {h !ex!>e!u$ ?e!!|h 0-LMl@hP0TdT 0LL@H@@P8 440P@?eHE$ {h ?e@?e !,!|h0 0S  p-LM P0S* BR &,`Q000000@T  0`2 @TVph000p@ 0!64p M-LM0 00@K, @ K ,@00 K6pǏ8  r 8 R,0Po `80U00S <8X 0!@@W Y 8\B $ 0`RP 04S:R 0S* @ 00CS88::H8800SQW.,0S00S2S2 02 0,!6oB4@ K@:XW@0K,}-`U0@K0@K0@PK,o-P0,P0 @0K&0p?@PX0 W,06pǏ0K,P0W@#&: DFɯ#oZQ8 NYK8 Hf4!l! -L$M0@a p W`P8 ,p 1s@:Pp` W80,S  -P@ 2! 0W  8 02A,  , 0%& < %0@S 0< ^0  P1P@ 2"A0 2"T 3P<01 \ p`P 1S @:Pp` W W 0 %&:40   ,P@0  !L!0Q  @@@k1@T= 2 02Q0 0@S 04$P-2@02A tDP0 2  4 6D20230 4P40 17!! p-LM@`Pd 0!6V0020  @T  p - LPhC -d0L@pT`  PU,0@T ?e -L@@\p`#(^$PP 1Q  Q R \P^Z0P P U 0!R00R0SP UP 0-L MP@0K K/@@ @ @@mP0  S /zC 2I026,0 000?e`?e -L MßA pWP@`, 3W 3W UV  , 0p @ PjVP@T 0, R @T(s((` 00P00P0 `00C\ 0  "!0 00 2C&  0 "!0"0 Rk@T 0, R @TP2 00@ 0@,0@0@0S 0  0$0P$T 1 @1 bB&! 02 S3ʴ1b1 R0PP00P@00C\ 0  "!40 00 1C&  0 "!0  Q[ YԽ (PeTU  0 00 000 0d0X 0/pdę`?e@h`hP,ghh0u$`gg+g?e!000 p-LM@\!0` | R$0$0$0  KHQH1H ` 0 b01B&! 02 S4 1b1 R0@@00@@`00C\ 0  "!0 00 0C&  0 "!0l 0 Rpph:,|0L0p!?e@h`g`hg+ghh0M0Ѝ -LM4, 00 (p` ,00!` 0`P|14 1 00<0 p ^8p p0#20#W@@ T @:0Pp`WZ ! 0 04,  08|  < p& 08 0 P h 0 0H44 P 0 ׷pd g! 0-LMPR P0 4 U 0 0t 0 0h鳷@ 240 U 0   40圷 g! -L⠣M0p00 0RP,0 t0,0! 0!@T 00ST "!  "000\ U 0 h"0~U` 0  U  0R0`00 0 F`X "KC "2 2,0S)V U  0HcP000 0  @0 0c/V U 0  kV U 0 000 "U 0 ~` 0```X-P@ U 0 ζ000  q@, cU 0 ὶ0H003Ua@50,4! 4!'|h g!!! -LMϟ@ϟ R/0 *0P < D @ 0 @ DKP1 0@8P0 S,80  D0P  4S R0 0 0  (0S  .0 ^DKΟ000( LQ00YP R`@pP @ $0 0l ` #6P`1`!0CS00L0p0 Y  KH a 0 0@P0S Q P@T3 D0 KP0 K1) @TZ0.P00S  0S 0,^00S0 5 0@000̀ ,0 0K@40 b 000P0@ `K 0 0 0S  P@ P1sS@TZD0 R 0 aDK P@ P00 0R 0 P P  0S U 0SDx000 R  04 D0 Œ0@7P +80 w:p h0R  2 \ '*8@0 `D0LI'202dʟ@101P` 0+ ^VV*80 1V h0p R0 00 000' 2 A020@ 0Hc000C0~ 0+P  'P 000C000@ 2022"0A 2"`H(80 ޴|j TK P`  ` 004 ``@T! 4x0,0! 0!Vȟ0 10140  00S    PD00 4 Œ@0SP 2 C0280 ㍴P7p h0R,2\ '2 C028@0 pD0\2U&2  0!6 0```*P " '2H0222020 @+P0 + D2202&80 şp000,eP` @| 0@@~* Q00V@@T( p 2t& 20280 V 4Dp h0R C0x00dtğ 000pH 10 1 4101&022@ 028&0@ 0 cH0*js ,4104180◳x#00000 P0K ,4 @0 0a0000P0 0 0K P@ P 0"280 \840 S000 0 M 0Y0P00 @%ST~22  0000 $% 202?0@ 0HcyP T@80 T0 I %L0 00040 D04 0Q 00!202, @0p  K0DK P@tY 1S0K1T0K1  aP 00S2! D0?eu$!!!!!(!4!_g|h g@h`h hhh01%4000D0 00RD4 \ 00NY PUPPUPv 00v , a@P 0PY fpN@T 200S2S$$t!0 U!80 Ln1!0P 0U00D`K L0Q:P0Q:PUA 00C\ 0  "!00 00 D2C& L 0 "!0p"0 RU  P Q-Lp@`: 0OPPJT: T    -LMHp0@P` ڱ 0 iб g -L M, K@}P F TP8*0K LP; , $0U %, %D0S/ 00 "Q4pK` @/1l1 0^:0A^`:?0sd c!401P#Z U:W0b0 0 F@!fhl! -LM0 P 0 X^ @ㄡp`=  P$ 0$  cR 540 X(@ 0  0 @E 0 00X 0 0 + 0 p 0 0d P000 `) 0  g" -`LMPΌ@pTn@@0 `0 @0 ܰP 0T0Q00S 00X$ 08V@3?e g?eff- ^  0>0>0 S   -L MRP,A`  |*00΄S D } 0oP0 0B?e! p-LM@ ,Q:,00`0,0*|*0,1p?e0 00@- @58 0  0 @2(  0P 6@|h -RLMb, 0@00,0( tB00C\ 0  "!@0 00 ,2C& $ 0 "!0"0 Ri4́,000C\ 0  "!0 00 1C& x 0 "!0T!0 RF,@1*0Pp?,0`  10S0 ,004,0`00C\ 0  "!0 00 0C&  0 "!0d 0 RX p000lg$]@h`hhh0?e|h! 0-LM@P Q 10S Q\ 0Sl, - 0P P,0 0 1C0S2g|h!!g -0P@LT`p , 00S @TV 0 R@W m!@U0S10S SL0 Q* Qp `0SP2g"|hu$ -1Q,@ L , `(a@00C\ 0  "!p0 00 \1C& T 0 "!00!0 Rh10 S, 8 p@00C\ 0  "!0 00 0C&  0 "!0x 0 Rh 000,H0* 0hm`h@hhh0|h?e -|0LM\ d \0+ KK! 벳_(,#0 8|h@~hh! -LM8 04 S8 p0CP}:wp 0`ZC%Z0>0>0S1#~0Zp<0  40,K P<   X00 P00S 0 X3ZP<@e, T @!8 ]!< P d0p` @000 `!00  P0000,l 00K . X00 0P<\  $ 0 ڭ?e g" -2LM ,0 0`p,@p夐PLA P 0c,l^,K 0  n PP@ 0 P00(a hh@~h@e@e?e|h@h'?e ! -LM>\0ǠȠŇ@`P'0 ` p P` P000IU 0 0 00 0P( PP P!!! -0ap #6RL`QP: P@ 2% " ZU:s%@T  P PU@  0S:P 0S*2 "!6yL% -0a #6RLP Q@: PJ6% T: R p$`QV  @P 0S:Q 0S*% -LM.0 L (0K^ #̌P#@ 0p` @P< ,0, UL0`pc!  0#@T  ~0 04 9jzZEUDj,4j),0 ?e!@h 0.  z -L M0@ࠟ`p P000 `f00 AP0000 . .,0K p H0 ,P  0  g" -LM>L0‡~(K0p!l0 @ `P `@SPJ<1, WL04 c P` 0P@  4 `W00S,,4P `0 @@@J"@Th40 44 4 zGp(}@~h'?e!!! 0-LM΁LL0K! (P@ 0P0@~h' -LMPNPA@Tp`Ll,K, T0   \$ 0,L@~h'(!0 p-0@LM P S00*P0P0C& R` 00#!t000 `0C& X 0 "!04 0 Rp@h`hhh0 0- @LP 0* 00P0P0C& R 00#!p000 \0C& T 0 "!00 0 R00h`h@hhh0 -`L0S0 !,B$R0 00@T \p\P 0@0 T0,  S(<@0h~hf?e@h`h}0 ѩ}4! -LMXXqXXX 0RF@ vT@P`TP P1 0000@0C 0 ^  0!!  0 C6000 "!d0l  Q,l" 0(4 f`h?e@hh~h`h@hh0@! -414qLM  a  P@0T!6U @AP00C\ 0  "!0 00 0C&  0 "!0x 0 R h 0S, 0 0C 0`h@h@h`h!hh0~hp@- 0@ 00`000 C \P  00#!x0 00 d0C& \ 0 "!08 0 Rpp@x @h`h@hh`hh0 -L Q Mq @`@\, 0 0d@p`00C& R 00#!000 0C& x 0 "!0T 0 R0  ,00# @h`h,ghh0 -`@LM,P00LP (@DH@@P@!0@ɨ@@@0@00 00R 0PP`@0p0C& R  0 0#!t000 `0C& X 0 "!04 0 R i H!h@h h`hh0 -L M0@Ā`p P000 `00 ǨP0000 ,0K 0 ,P 0 㬨 g"000 p-LM0@0CS0pLP $Q$1$ ` 0 b 1B&! 02 S31b1 R0@@00@@`00C\ 0  "!0 00 t0C& l 0 "!0H 0 R ph @h`g`hg+ghh0 -LMPU 0S 0 0`0UpU @S 0SK 0S' @0 R 0` 0S0@  0V@@@`vPUPU 0S i0SP0a0S0  0UPR@T@PH 0@T 0S 0S  0R ` 0 /0@S0@  0V@@p`@T 0SP00S0  0UP@T@pP -LpR 0Sc0R` @T` PRd R 0S 0S 0S p0 0Q 0S!@ T0 0R0 0P 0S0@  0U@@@PPU*@ P 0R 00  Sp00S0@  0W@@@pPU R0 0}0Q 0p r0S0@  0W@@p`c@T@P{ZP `R[ R 0SR@Tu 0Sr T 0S  X0 0R0 0P 60S0  0UP'@T%P@` 0 00T Sp00S0`  0W```p@Tx t@0Q 0p 0S0P  0WPPpP@TP` -LM `R 0SPXPU  0SY   @pT p@TPXPU  0S@\PTp 0Spp 0RppU @~@T p-LM`@PP  0@Q : RP T0 0P \PPRpP  0 Q: RP0S 0S0SQ  0PR 0P  R 0P P0 Q0P ,0RP $0 $0cc0S  0R 1P 0R 1 0-LP@@T0 0-L@P(0Z0,PS 0h0 p-LMP@(`,0QV php 0-0L<1PU9 0010 0x@0T00Qx000C\ 0  "!0 00 0C&  0 "!0 0 RT0 T00h0 P \E@TPH?0@40d@h`h@~hhh0?ehhP!@-T0@`p0 0 0x00 0P0C& Rx 00#!000 |0C& t 0 "!0P 0 R@z,, @@h@~hh`hh0hh -< 0 Q,0] Q[:D RQ 0SD 5$50 5:J,D 0F ,0RD $0 ( -LMLP`p V `1Wp!V`!, KPdP,0@n 0, R0%0%0 T0,0 A 0S>*$ WW:D0 S`aK40D (00 R?s0 $ d`1 $ L0( cc440 040( 0S0000C0  0 0, 0h V0 ,@ @ 0S:I,000 $ L0( ccN$ }0D0r  J$ ,@ 0V0S00 @h?e P0-L@P L0P40 ( 00S0@-T0(c$ BH"& -LMpL`\4`5@P0 0 8P  -LMP$ Kp`@P* $ 0S $0S(0SLQW# 0 S p0P 0$^$0U @p 000C0$4@PTU0 S 0000C00$ 0$3 -L R0ԑ00đ\0 0R010201<0 0R*0000002g|hu$NN -L$M0 0 4 S@P` 0QT, K{P`>,0 $@0\A 0 S:2\7*Z`!>20K0  0 @]P 00 >2Q2^:40`, R ,00C,0,(0,Z ``0K "0 0,0 @p` -L$M`4 :#:S @>0. Q< "&0D P@  H 0@ Hǒ0 KzP @ 8 0,@PL@  1 0<S-*$<0Q*0 Sb 0S_$04 <S1( (0 $Q#0V)0K*)K jVp:00L00 S  0<S: 0H 〒4D @L V8 (*80S0)0K 00 HaP 0S)KZ )0[ S  )Kjp೺V:0 , 000c P ) K @  g -LM  0  S0` 0 p @ 30S0@Q * p>0~p PU`W j:#:S 0S Q:Q:F r  `PS 0 "    0 6P 0SR R ,0( 0C,0 ,  0@`` 0K P0 00hwP q ,0 0R,0  $ 80SS SPS P9 RS@@S-  0     : K0 0偂P1H 0S000   0@|0 \=P80 ,0( 0C,0J : R,k VʦUh ^  6  0^1* c - -LMP`@53 0S0 *"*@S>0N`b@P $*T p  00 l 0 , KP,0$ @D( ` 0 Z  g -L Mp0*"*0>0>0SpbJZD WB: W@ @0` P000 `00 ῐP0000 0P ,0K 0 ,PxD 0 㜐0  0 㐐 g" -LM ! ^>0.@  aR0@  YP@ P @@ -LM*"*>0b^@0  P@ P@ -L0 *"*0>0>0S b^  0 9  00  0 -LM*"*>0b * 0H ,6S# `p0d,$#&@PQ : 0`\:lP  |h -LM!>0 a 0* PP   -0LS   0 ` P P # -L  -L$M00 R0, P4 8 0@000S ,0>0>000  #20#0 Y030"8S8 p`004$&0! 08 0, <  P@<^0Q: 㼂`p0 @000"`a00t <P000@/ D2 H)&R R ,46S @ ,  4!0 ,0 0P@,p!0 \ 0 80S 0@ oT 0 < d <\ Thf 80S   |0@ 0 P 4 00 T|0 0 , :#:S ! g"|h 0 00@h`h @-@00C& R 00#!l000 X0C& P 0 "!0, 0 R@;@hhh0 -$1$qLM @`Ph `%60AT 0 S, @TP00C\ 0  "!0 00 0C& x 0 "!0T 0 R 0S0S`h@h@~hhh02S,2 R 000  0 " "00C02 0 R l0 000 202  B 00 0202 R  0|h`~hh~hp~h2-0C22HSD000   202  B `~h|h -LM2@ P0 00  202  B 2 0h0h0   @@2402   m" @002|h`~hh~hp~h2 03 R 0+ 000 202  B 2S2 R00|00 0h 00  0<02 0   R  0h~h|h`~hp~h -"L "h -"L "h0@-04 "QP h@?!l!0 ^:0A^P 01:?01c10@fh -LM , 0 "X00 ZY"0@0ŸT0d0l h`x ^ `Y0  a0<"6AB4  8 0YCQ< <0 b40Zi8 1P0@8 04j Xf4 "*p@0&04`  8pj0>00 00>0 0 0P  P00( ,0d 0 @\00`T@@0DPXL@L  00 0 c84@~h`~hf@f!hB}f|h f~hĘf !8! -PL R: 00B 0 0 P |hH! -LM,a> 0R^PA0 pW 0gS*@`0S:>0 N@ T *$PK0S J $T:|Ph5*DD@0>0>0 0ff fx!h@h!! -LMℒ0SP&J1l `!db@0SP> 0p`S@`0A8 PNLZ0S J1` @ 0R:P@DLZ60 0 R    R  B1PP @P0UT* 0R( 0R0S*0B60 0 B0CR0  R  B0PP @P0U 0R*60 0 0R0  R  B@0PP @P0Ufh@~h!$! 0-LP@KP@ T0 -LM,  \00 4 W 40SbX%Q*!p WN `Vx!0S`VT!0VZ: R`4A (A0!X:`V!0P0fUq څ1eAD PEU @, Z 00  00O0 0040t 00Z00 oX]TW @P 0<0O4oL(M|hH!p!fhh!!!8!T! -2L M0`V"` 0C`V PUPUTBd1D">0> ,0 `p1,0P0,0 { `V!`0V0ؑ1 0 ` 0E V `h0dP-Q^& Q 0 0 00 0 0h `0! 1 h `01 0h` !60!^` V00@0000C\ 0  "!0 00 0C&  0 "!0p 0 R `0W 4 , oe4ofh@~h?e@h`hhh0@fx! - LM z0\ , 0` @,pP 000 p`8 00\,W(U$0$doPf!h!!!@~h(! -LM0K`C <04 R8 @0R D0RX 00S, 0 Q00S(0QP D3@3L Q 43 Q 4p pV V 0!PU R0000 0   B 2 $00C$0Z 2 00` 008 08` 04t"0KY 0 "0I "P2 Z 280Q21XK 1a @ h0`"& 000 0 |P@0@0C\ 0  "!@0 00 ,1C& $ 0 "!0!0 R  0P " "000j1PUfV`JL0!PU0XQUTQ8|h~h g@~hyg@!h@h`hhh0 -LM`^pR B2P   0 h` #6\0! 0 0 00 0`P00C\ 0  "!(0 00 2C&  0 "!0!0 Rm R 000 0 0 " "00C0"0 0"WR 0"LP D1"p P @h0`"& 0@0@0 0 `P0P0C\ 0  "!0 00 0C&  0 "!0 0 R @ 0` " "000@h`h@~hhh0 -LM2@ 0` V022P  䂟 0 h` 6\0! 0 0 00 0rP00C\ 0  "!h0 00 T2C& L 0 "!0("0 Rr R 000 0 0V " "00C0"0 0" 2a aR 010  0 " "00C02 0: R H12 000 202  B 2S02 00C 02<2y0P0000@0@20$ 0R00 D ie R d0V( 2 0 2@h`h@~hhh0|h`~hh~hĘfp~h -`LMVp At00TPPU `V2  "  0S 0$"Ů2 -XaXqL0$ R0D0 2@ TPR1D@h R0000 0   B P 2<20 0S0@@@ 0$ 0 0$ \0 R 00S0@@@P 0 00 |h@~h`_g p-L M K0 "Q `KP @/1l1 0^:0A^P :?0s8 c! 01pV0b0 0@hfh p-L MP`@ 5@@@|t0l l0@@QX0X ET`@@1@0STp~h?ehhh`ffv$ -LMp0 0 4 00 P0,P Ǡ,K 0 P\`0 젟 @L T 0  @@ɫ\x0  , X,@ 0P4D 04 4 00PGjVJ0x,hd!`ff g@~hl!hh -`!L M0P0 I @@04`p P000!`}00 XP000000 ,0K 0S 0 00 t,Pt( L 0 /00C00@@=,@ `fh g"h@hf -L U00R0S 0̠ W0U0V00S 2T 0  TV U0P0UA  V 0!6 ;P0 U00R0S  0 0  0 0 -`0@LTpPP P W* 2$"  2 021 0@T0 $C02 !202깫2  0 p   0!6 000 X0 0,A0 0 0喫~h -LM800CV!   bp ` 4Z00@#:0#T7H@T 0Z0!02 02 @TrX 00 \P РnZ2@ Z00S  !2022@02H@T qg$P, -1qL!MQL 0Q 0@0`1 H 0P@00C& R 00#!000 0C& x 0 "!0T 0 Riti40 a`h@h g@~hx!|hhh0$pp 0@-d@0/C2b,S03S0#S<0<<0bQ/BR@ H@0|hVUUU -1LM|!xQ000d!C`A0\L0 0  "!80 00 $1C&  0 "!0 0 R0PPp `@ 0GpQ1019 0V`0  @ ?CSD00D SD0\4 ,0PR0S(`h@hh g@~hh0|h!VUUU|h -L MDrDDDD <00\0@y P\"001 @00C\ 0!!  0!C6000 "!|1  QLU, 8 0 08 @0B6C Wp  402"  Q  G  Rg 2d0 `0K$ T  TKH8202r08! W8!  2  0a h0K @0 0@0!6 fk K ? P 202 @@ T  K 0 !6D 0 P  ' 0!6~ 0P P~@ @@ 2(10(1o,10,1#|h -8RL101;@C@0T1A d0SsqP1d0Sf@D 0 ^pc@dlh0PN 1@T ZW ڸ X@ ZW"0S00 0C00"`Zھ" 0 P  WO<1pG0<1 0!6 P 2J02 J `2"02p T00R00 S n8,P101z|hp~h`~hh~h - Y3 LM>A0 0 噺QQ:34 (0  0aS < 8 00`VԢ'PQ B/ 1b10 ^:0A^P:?Pu &Q` TB?!l!0 ^:0A^` 01:?0S p,1c(f1P12" Q4 0*R0#  R <P, P\ , 4pABP2#40,!0Q!0000 00C0" $00C$0" rppp" 000 PP,00S ,0 8 l0 < RP@0RD 0S@哦48,KP0lP,0 e|hfh@~h~h -LMp@T' P`Q0000 0002+00&0@!0$ 0R@0$0 D @Ti@~h|hĘf -@0LM@T 0( T  @ꠙf! p-K0C+P@= ]T1`|$KP@T0SABKAG>KA0C+P5 1` Y( PU! WpG 4 O#J6; 0QP@An'$IP`@DTU WpG Y$@<0@d 4 gh!le(!g!0CFT0 0P`d0 P 0K 0*kP@qp KT$;H PP@cT0P H0L$4 R00P4qgԈdf\!|hugh!!!!!wh p-LM0@( +($00PrP(0; (塻P` 0 00p@80S$ J0@ P0  jt$h00bh0@7P ]L0(,$00#\|~p墈@ yg|hf! -L M @ 6@(HPB -L M@ 0@HPB -LMT0O$K4#&:@QPI ($@@b0O&8#J6$Qkt7 QoA!P000@6ST`P0P0C\ 0  "!h0 00 T1C& L 0 "!0(!0 RiLl @0 040@+00 P 0007P0P0C\ 0  "!t0 00 `0C& X 0 "!04 0 R i@h`hhh0$! -L6LH$M@08 0(Ɵ< 0$P& @ @0@0C\ 0  "!0 00 5C&  0 "!%00 RW@ 00  <0O8僄< RH @ H D 壛 80L$@D ?4 :4K 00K, KkP"00s, 8  LD ?Ű4`Pp40D, 0 ` Pe฻T\$p0p0CH0UP\@ 0!! 0$C6000 "!3  Q<h8#44 0p0@0+,"@h`hhhh0 hK!Ce@! -LM @P4 P xQ 00$ x$\ Ąp00p0GjP4P000 -tP< 0B@ @ c@ 0L0C 040S0\0S#劻0S 00;00 4 0 0S 40C4h8s5@0S0P hh -LMld0STX1`VN P@T 0DDT `V0Y0PP00 $ R0p0Ĕ,K p pֱPD$RH4H40H4H4D$S D$DT0H4 R0@DD@ 40 4 l00l0($,0|hf -LM@WP$40$4 p-pLM@` I(Pa0 0㢲P( 4 0f 4l  fl p&h!|h00  -Ld@Mtq 0Kt p00L6p PPp00p0|h -@_p#:0#$Z0'LMF, 40 4K8 ,0@ 6PT pp@ 080\0P4P$L0Q  <M8@00C\Pd 0  "!0 00 3C&  0 "!0#0 RU 3#090003, 00pT3THpp@ 0hß00\pO@0@0C\ 0  "!0 00 2C&  0 "!0"0 R4, Q6<0801 d0h2`p Ÿ000p  p 00C\ 0  "!0 00 2C&  0 "!0!0 R_8Q 1!L00 Q2@0@0001X0ih8 RI300 ;,``01@ 000\ R44\ \P,容@00C\ 0  "!0 00 0C&  0 "!|0  Q8LNb@h`h g@~h qghh0g!CegL -@1LMp4w$K CPU \ x `\x@ ɬ00$0 @4pQ0 \4x $0Ć傟PP $A@hE\fy\cy $g`pe! g!!! -LM0 `>0^$ P0l$ R': 0S#:06>0. U$ % @0 b$Kp @P$0 0c#& $ a8  e$0 0e#&B!A- p0Q:>a2 &#l"b0QPop*H00p "F!V: U p -L0HK 0 _0P@/ U8 W00W00SbP R00Q0#02SXT00 0C0 S U⸖X0 aᚦ a0HK 0 _ <^PP TX ! g p-LM0 PU@ p0 S@`@0P0@0 `  ^ g -L M0 p` 0S 0S0000P p-L M4a0P $1n 1 @0T0 U+ T0S( (@T@T 01 P0S <0@T0 phn0  (Q,0,0, 0<0000S @0 0@0000S0@ gh f`f0S@-*@,  0 000@蚺!@v$i,!Ni0WiHPi Oi Ji(Ki -\9LAM`VP0p, P 1  4 -0S S/cH0S U8 Q1 HPWP,蜠K D 0[S -0S h@ 0 SRh8 RU5 H0S |0SH|0[S\ q'0000q'00 00 0@P  =d00d 7@ 0 0Y0  p7 ,0S h,̔ P0004S Y  P d0 CkKޞ4$#Ġ0Č6xK7K4p0 0K0K0 .Kl 倀KlKt0 P 0FS0 000$1 0dK⶞\K0HKc0KdK孞@Ɵ.D@KD0HKCKHKG0KP@  ⩤P 80S0C80Ų@T 80S0C80Œ0 .K00 P@ 00S 00$10h5 H0K P[ 4} DşHKP@7  pP 80S0C80@@T( 80S0C80 .K xP 0S0 00$10Pp4 R(6  0  `帰4GOK@&H0K1 d0K1 (4(  0  P   .K<P 0S0 00$103 R   0|i@K@T3(0 H0K0 d0K 0 P  U I2 R a 0 Y hK P 000 ` P0 82 R 08L 0Pp 1 R0 1 0%  RUS  hPP7 ~00( 0 )0 X1(  4 p0`00|00 RP 0S  0SP00 0PR X 0 R ѯ0 R 0[S0[0S[Q4#$0$)K$"48<#Q 'S gfgh!|8g`8glx!!!T!h!! p-LM@ Pj0 `0S R Q000C Rph P0`00 0p 0 `f! p-1QLM` @  R0000 0 T00 0S S 0S SS0080SD0@ R9 \00C\0 0@ 0 s 0S0C 0( @`00C\ 0  "!0 00 0C&  0 "!0d 0 Rpph8 `h@hhh!hh0! 0- LQP 0 @R T0hp 5 -LMM$0YZ,0 0P X1  4Q x4Q -`4 ,0S X,0S^0S[F/0SSV0SSRQO3XS O3X0P p@/`Kx  g KcU00  3  R0TK\0KPhP 0@ X !xK EU0h0  d  .P` 0@QP@0pS0S 12XKOK㶛0)v2Xq  SK 0T1 `V OK0 S `VT\ T< PU p ` 0S0C 0 00 R 0PV PpPj0ST PU p ` 0S0C 0 00 0@0S00PVPpPHC f!@-|0\ 0S \ Q @ 0 0R 0 0^@0 0 f p-LMp`@PT 0S @T 6!e@Ǚ0 0P0 S00@@ p f -p0LM@T 0S @T P ] P R0600 he f -LKMğ0ğ,0 0P! 00P1 \` 0S\,6 dPp 0 0 PU 0S:PU6DDe0 0C\ 0  "! 0 00 3C&  0 "!0#0 R P1003 ,0S ,v0SU P 0 0 0R 0OOKp0p0 T! T\MK00 3 (K P!00jP0S+MB0 0C\ 0  "!0 00 t2C& l 0 "!0H"0 R R0600 e 0S0C 0) A0 0C\ 0  "!0 00 1C&  0 "!0h!0 RhDS/KT1PA0 0C\ 0  "!0 00 0C&  0 "!0 0 RP700/0S\p W P 00 0S p g@h`hhh0!1i -LIM✁0a!$0 0p P 00CS 0/ hAp00C\ 0  "!40 00 1C&  0 "!0 0 R $0S $ݍM M R000 P 0S0C 0 MOKKK00X0 K LQ/K 6d g@h`hhh0(!2i -pL@P 6 c`V70 0 #@T6@ c -LM@P6cY P RP0S0S 00S0 0- @LTP 0S@T00S P@-`p000 @0:P^0) S^0S \PP\00A000P0#" 00  0#" 00  P0S\ꀚff@vd -LM0@S S  WPP P 0P P P0P P\ -LM@P P P 0-P0L@T P0 P0@T00h-P* 003P: 00 ? >-RALQBp`L6 PUe 0 S\D@ @\P0 S  gl!! -L M`0 X, 0 2PU8 O@KT1 PU0 R) 0 P@ 0X0Ÿ,Ÿ 0 0>> Y 0 0>>P@ 0 0 0>P@ 01 @T p0S @T00 R YDJ P?J8 $1 R 0 0 \ P00Q00Si"QPW,p 0@ 000, PʿP, p0bSʳX0 0 R PZ0 }g hh(yd! -LMw, @pT`P 0S$ @TW  @T 0 R @TU0 0 R`0 h0 RP6,0SW y  Pp0(yd -LM@  @0T0  0 R @T0K a$H0SA  AR 0 RQ R\0400SL LS:00S S* S00S S:00S S* P }g@f 0- LP  =` @ 6`ܔ /`Ք)M0 -LM@EM a ` h` -LpMpxPK0@X 0 峔:x0 p`K: ; 0 00   00#0 Q  h g`8g8g! p-LM P\ 0S \pQ  R H00G\`@\ \Z %P QP ;PTT@ ᗔP , ᑔP T# T 00#0  p  }P00 0  00  0 00   ᗘ#PT0S !000   P GPT@#HfXvd -LM@pPvPT T oPD P1@T T dP, @T+Pa0S i0S 0 @ ` PpP@ P`pT 0 h`0S h 0 B@`0S 0 < `0S   }gf!0"d"""" -LM\`0@KP x(0 吓 -4$#000K 2 8K4 KK |0 h qPPK< @0 X0KWK,@ < 0@ PF@,P 40 000K`Sa P@K@KKKK 1 !0 1\ڴ0[00K [ K  IhP (0 S ( WhP/P t0 R0 T囥 KP ,0 R  匥 g "f$"x" -L|MPK0`x@ p$0  ㉒LKhKK8@0 @P 0KKT0KSKp0KoK,P (P 8@ OP $0S D$嘈80 0\0A g\"f" -LM⸁QR Q$ p`[\ 0\ RY .R Q 0ll RL .RJ Q?QDKPK [ " [000[S  A0BS 000S |@KXm8K 8 [PK88\00t0 0 $"4 4  0 㶖$0 S ($l g" p-LMXQH 0R@0 ` K5R= L0 S*$1 R  0S p顤648J0 R   0 R ]P\,KhPP  H9P'0/S9S0BS gf"@"P"Tvd\!" -L(MĢ0p(0 N+L PU 0` RP U PU `0S4 VPDPKL㫑0Ÿ.D pp 048<@x 0  @O( K0@0D@0 0$L@ 00L@0 @  0L40`(0QD0 0@ D0 0S"@ R@T 0 00SZ @@$ XPP9 $㤌 048<00 <$ 0\0  0@4<2DL   800,0#2P,6  0R0P00S@T  0S@T Q  0cPT  0cPP000D ` VD @ 0SX0@T 0"R@ 8 }T8P w0S P0Sy_XZ @0`CWX0(0C8#88#$(," @"(  x( t8 0Vw* g80 0 B0 8 BD 00b'0"X00C080! S P 0P U8 X'H0@\ 1 0@80Ɵ4 6` 000 00C0\0 0  "!|0 00 h6C& ` 0 "!06<  Qж8 /PP 8%ş0D 0b0W%00C0H R 1 0@ş@08 34ş45 0,00 00C0\0 0  "!0 00 4C&  0 "!4  Qjd$ X4Tğ 0T00 00C,0\0 0  "! 0 00 3C&  0 "!3  Q4#3  0tß0x0 0@0CT0\0 0!! 8 0$#C6000 "!2  VLR R:07`PV@ @PE( 0 0@8 8 s@ D 0SL0@ 8e(꾊0S( pPmWm꿵O!00C0\0 0  "!|0 00 h1C& ` 0 "!00#08 HQW 1 0@M80HP1D20  0噎1 \P E,0K8 OP<080 { , 0R0% t*LL넜ff8h@h`hfhh0ydhhydhh@hVZ P$4D 00b0V 00C0hh0 0   00 80<808 8<<80808 < -`sLM T0, Hß00 0 0R0 #00C\ 0  "!0 00 2C&  0 "!Ÿ"00 Rb8PU U 00C08P<0 Ry U\\ 0RSKpA @a0@RSD0SA La0LRS00L S:WA @a0@RS `A@0@ \-P+^pG`PP@W Y @*0.S@00U* T:8 00 S*80S0C80  80 S800C80 00c 0X 8 4 0 , p@ 0,00[$@0@0C\ 0  "!0 00 0C&  0 "!0  Q$ R 1 0 +10 ,(<81ꨧꦧꤧ@h`hlghh0`jgmg -QLMP`pb V00UPT0 SRJ00SSFPES`FJSH0SBj0S>0S:0 S6?Q3 ?R0Q0E\) R0FP$ Q$ @R" Q 00S00S 7|P0pi0\0jS\ 0jS |P -L Mp, 0p  4p 0SAR0 > 0`V @ T 0 R @T40S` pV,0 `Y0P |P P  0   P  000P {P040  }g -LPRM40 020 pP 0$< 0 W8 `x U @T 0 R @TWPU0X0`P`80#2   X0#00 PK EP<  0 <  4 R- R0' 0R0"00c,$,!$#,,  ,K  00S 48 A 4 8 100S00,0 08 04<#$ 0P<0 <  <0  }gg -|#L4M0Pp,0 Pp 0R0% :Z- HKz0 H0KG K0c HKT0 m@T: h0 A@TW2 h 20S'@HKLP0 wPPP |2 ,0S t,|p@L@0S  PK 0v l2P@ r0:S,0S00S40S80S , zP0S 0S$0S(0S T zPQ 0"0 # W (!0@PX  h 00S!X@P0LHKX P XPP0P0 pi@L @0S  PK X0 L0K RPP7 L 0R0% 0*P g`h? @"phʚ;0R@t!0 0 h 000 PUvP 0Sl P 0Sa 0SW 0SM !@( B("("48<##80@@ 0:4( ^ 40 0@@P Y 1 0@Y 1`P 0@ 0@1P@ 1 ,0S ,j00S000 00S0 0 000S000 00S0 0 0ar mbAli00ST\R 0SO 1 0( I *px`hBWU P000 L0 ^xL@00S L .,r*; ghhPf@h`hlghh0`jgmgh" -LM`@PT :Rp/U U S*` T  \(`P Q` x`S*`0S` ᄿ @x`0T0U00S - 0L fPDydf f p-L M@ܙPP 40`00 @K@ϛ0SL LaP808 vPpUpRpf= - LMR 40 S L00P00 0 嚛l" - LMR 40 S 0 0 傛T" p-L MQPPP 0@S0 `ph5P 0<PYp*p 0 phZpdyd h -LM@00K p" 0@ 00 "@0P ,` U0@K!!  t0K  ?@0@K s p0 -LM`9ku450@!0c48/0!0c4<)0 0c4 D#0 0c4 D@!390Q 00R D ;upZP, @01uPP A0 R ~p0H, 00 S0 L 0C # 0 0 R  uYp@ꫪg -LM, 0PR* L0Qڂ, 0S*@Dp`@40x t@T4<@0 ,0H 4 800 _,gyd -Lzd -LM zP8 @ dB!2b2c621b1c00Sڬ0P*0 R 04P:|0|  )#bh0 h\ dB!2b2c621b1c1\ 0`vd hxdXzdh`h" -4@LMq -e0h-ehx$ -qLMQa@0 T00 0 S00 00C000CQ 0 "!000 t0C& l 0 "!<0H  QT 頜h@h`hhh0 - LM(080 0 4 !  0 S܋'=Ћ'=P@ 0S ! 0@4`P0@ 'R`00`S L+0@0S1  0@4 ! 0@@T  R0S 0S$0S *0@0S 1 Q 0S0s R0S 0s Q 0S0S0S? R0S 0S$0S4 0$  R' R  R R R R R R 4 \ \p Hy0S 40ZP 9P@ 80S0C80H00{p0 0tȖQ 400S 8 R  04,0 PU 4, (0AS:(Q 0S a(40Sb Y\ `0S 0S0sN 0S0S 0sE ǟ0@Z 1 @ 0@7@U wgHL0 S4K8K @T480\ Tǟ011 ,7PP0@0S1 0 @04 & Q6 RYἽ  P4 |Ɵ@04  ,04 (00yD&0@,K0K4 K80KP4` 04%,0S"%0@0S 1 8 0@40S 1  0@4 0 0)S0(P 00Ps" 5 R5P@ <0K( P4  < 0R0% *$40@0S1 8 H<0H R@04 1910 @4 R; @ 00?  ioP3P@ 0S 1 0@40 P 0SPT3 R X`Pp@ 0@0S 1 8 0@0SP@ T  oP@T400SANP04 C 40h00S+ !48<#,#80 4 00S 00S !48<#,#8 0 4 00S00S 04 d1P@ 00S 00S 04 00S 46(pP4 V!0@Wc 1  0@0*0Sl> @ 0T  # 0@04S1#=#= `净 hhȜh@hhDhLhPfphyd`vd hh@f`h(hhf"hМh0h@}g000:00S4 00S,0 0 0( 00S"00S!0410 P 00S 00S 0410  00S } RchA@0  gxh "`h@hlghh0`jgmghhh ydeh@f@}gȜh "1<^<1<0    000S0 U 0S Q0  0S U 0s000Si P  R 1 P0@0S 1 0@4S8!0@\ 1 X 0@3# P 0SP1 R U 0S 4 3 dP 0SP@ T VP@P 0S   R X0<0 X0| P:00SvQ 4 200 l"`P30@ X 0@_}c  VP _  SLKLK  EV8h-\K  Z0S@ Z " BZ\K B@Dlhd`~p8#8#$(,""(  pKPpp~ `K ! P_  dK !PS  hK !PG  lK !P; "h - RL M, 0 b@ 000`r@0@0C\P 0  "!0 00 2C&  0 "!0d"0 RU 01 0000$0!C \! 0  "!0 00 1C&  0 "!0!0 RX0Z0岁 00 S 0 Y,0P@ 0400`$@0@0C\ 0  "!0 00 0C&  0 "!0  Q$ R 1 0+10 ,(c*a0  [ʚ; -L`P@\ )R1S*P 0\0T00S T T PP0p 0 :RpW 0 :RppZ 0 0pT \ ϝ -@0`TLpP) P$`U` 0S{UX &P P`@ឝ{lꙝ @{@ g -L4M00pP,0 5\P W`@/ 0FS=p\T R 0\0 0S$0S \,0 S ,E0S@T5'@PKQTP4P R @4 P 4`S100-0T RTK4TT 0 Sr3T0[ 0 T RXK!TX0SX0[0ǕT 0S@0S0S0S Qc 0S$3 R3 P Q`0SI 0HKL0 O0 H0KG K@KLKuL0S <`vV 4S0S$ PU 0\  PU\ K⌷PPU 0S0 000P0KOPU00D00S4#$0$ 00S1`{%P 0-T* 0S'@0S0S0S Q7 0S41 RD$1 aV? 0S PU7 V 0S PU, 9OPU$  R000 B00S1#$0$ +%P  58Pp7 $0P 0 0P g g yd "ee@}g p-LMP`@᪚ U  U U -p0 0V0 0pL0 0 0V00V 0 Q40 yd -PLM@  R Q000ֶ R5h -L$ML0QPp,0  @pN00 Rp 0S ` Rv Rs0)S     0000cS 0,0 S ,D00CSY0` RO 0S 0S> ,2 Q6*Q 2 Q/ 0S0S0S 0S HPKN@0 H0KG K@KCP Q 0$R 00S  100S1#$0$ *R  LR00 SY R 0 0R 0" 0%* R  0 10R f R0S 00j < R 0 10R0S0S g "ee 0-0LP@ ㉜P4 1 0'S(,P)  P P P P  00hO00S00000S 00S0 0 0 00S0ʚ; -LM 0P(S0,0 P8r8@ 0,00X@0@0C\` 0  "!0 00 1C&  0 "!0!0 R\VV 01 000 0d0"C \" 0  "!0 00 1C&  0 "!0 0 R$@0@11$ =)0 1@@ @0@ 00( B (0( 0P ,P5Qtxᡚ7 x@h`hlghh0`jgP0 S00!0S00!0<S00!P00! -LM`P 0R@ K:T 0S20 0q Q0%@ :T   MP000 @0 ,0K ᛤP@` , 0R0%@ *#0S00q 0j0 @P0 0(0K vP@` ( 0R0%@ * t^(hh; h:Zꠢffhh$ " 0- LP|88@G00T0@  0'0?040: "# ? 0 00uMb|! -LMH0@S #SL t0 L00h0QQT0 Qh= 00YR 0L 0@@fD "v p-LM`@(PEG0V00@ 0`p -PLM \ Q @T0 S *01 0 S00@ 0(GUY " " p-PLM@PdW 0SS 0SLapP: 0BS( 1S 0S0P U 0S p@0 \ [YYY0S |  1S$0SL `@0P`(`Fp X "f "{d`h ", "ؚhd " -1aLp Q@P $60uI $0 00 :@p00C& R 00#!000 t0C& l 0 "!0H 0 Rhq :`h@h$ghh0 -"rLM `000 @ R )ژB`00C\ 0  "!d0 00 P2C& H 0 "!0$"0 Rm^qPUq <Xm H1Q  QgZh 1SL|1 Q Q 0 0<   R700P1 H1Ba5  0 0S 01 00 0S \ 00001 0 0Ba0 h0 Q00LW DW<W`h@hhh0 "{d$Mb{d{d " " " -2LMr  91!0 81@T Q 1 Q`:@T1@T aPq 0 0bSLq 0 0bS0000U0@$1@T 8| 1H  a R+@T@00C\ 0  "!0 00 0C&  0 "!0p 0 RiSp@@w`h@hhx{d$hghfhh0 p-LMpaPP $0@SO TP $0@S@T1 R 0S@2 T  4Q' 0 R0 R@0S S P 0 R 0S \ 0 \p 4RsZ 0S  0ShfhPfTf{d -L0M衟0D@K`p(0 DP00C\ 0  "!0 00 0C&  0 "!0 0 R  P0@ wkOn<F gPf@h`hg$h{dh0< " -PLM0@) 4 00 S H^ 00S 0S1ST0t 00S0 S! <0H  0hQ  0Pf$ -LM40 , P`0Hp< ,0S ,w87P40 V V V40 #50W00S X$lH00W040 40 40S T0SH0؅0ʅ4؁0ʁW< PpH ßC0 0 0< RB$P 5V0a0 0140X#;40p0p <⫪P@) _`00V01 I FI002 Rq 2@ T< k 0S0C 0 00 0@@aMi40 \ `Z0@14SR P,  $``PL "PfTf${dl " -p1LMhq \X 2L1@aa241PU 1@ R 0"%>CSd0+PU@00C\ 0  "!0 00 0C&  0 "!0x 0 Rii\0  0L ?0#3 0`h@hh$ }ghh0 |dMb -L Mp0`S, P@F PC V 40 40T 40 }PqTZ!1  ,  0  0⋦ 0 4@P@Y ϋ4G 1!S:R+ 8C8Sڴs 01P0 S @T 00!1 1 Ba  0@ꙋ004!410  !01!1 0 ! P@ H0PA@P\0S @40cd@0c\@P\c P@` 80< 0CR80H "$Mb{d{dH05S S S#SS GSS S p-LM@!`\ HP P p3000  00  00p#P00pQ 0 0S L]QPU⨥ (SQ zAp " " -SLMpP@` R00Q00S3R`U-  FP$ W W *`X   0X0P00S` U ,`   -1L M0P40 1, 1`000 101`PpU0 @W(0 S(:PV(`(@U(W ,0X 0 4 0A 00C\ 0  "!0 00 0C&  0 "!0 0 R0g_<0 0D D 00!!00 $!@h`hhhh0 -3LM0P@0 34 2, 080 20 028 pW<  ,0S 8 ZMT@PT @08T#X1e< 18 < pXW,0S< 00  < 40R00 8 @ 2B 00C\ 0  "!0 00 1C&  0 "!0!0 R8g8; @ ^P?L00X  80 0< $ 0438 r0 H10aR001#(0\000P , T@PT 1e 0( S`"X@TS|0 0   08#X , N@h`hfhh0$" -LMX0@,0 `p XK? hK? 0R60帐 0 弐 Đ 0% P@ h:T^ `xK ?0S@ u0S.0Sş@0 |,0 S x,1XKⶣd M0S hK⭣D M$50S xK⣣  M✣P♣ @ 0MX0ST0SP0SL0S&[4R t0S uMd0S`0S\0[Sx0[S S pG@K P R010 0S  0S 0S 0Y0R00Sh0[ xKSpp)P`z K0P@BY I0 00 S 4s0S[ xK' I0@0MPXK :PL T;X0ST0SP0SL0S 0XK@ @002Q0@0 XKx K-dŸXK$P"Ġ0 0Č2 XKx KKX0ST0SP0SL0SzXKɢ LH@K2:xK@K0 H0KG K`P@ 40  00 R T#aVf qP` 0  p0S 0 R Lw0[0S4#$0$'Kp0S0P@ 0K PĀ@  0R0%@ *HL gPffhH"X"p"""""|H"p"""@h$@0@0C\ 0  "!0 00 0C&  0 "!0 0 R$ R 1 0+10  P HP 1S``ӑ`h@hPfTffhh0 "hfT"" -# 0L00 `dPp Q@U 0 @0Q PR PR00pc00 0\c pW @T3pWp00 PP C00C\ 0  "!0 00 2C&  0 "!0"0 RVW  p 0PPl0 X0 `.9|0 R (lX0 \9<0 RX0  9 gfD"fX""" -LM!X@0PK,0 ӏǎPM eT` 0Kx0 ]& K%0K 0K00K*@ KP`p    000 400 80TK0 <0 00\0K0 [0K*@0<@8@0K 0@ 4 @0 墆P@ K⎎0 ,0S t,h0 RK▎0H @8,0 R $` 0 g$"f0"h" -L<8 Q q\ 000|H D000 0@0,0 R 0 [8gf"p, 000 0p 0000g -!QL@ 0 00 p1R`( da@00C\ 0  "!00 00 1C&  0 "!0 0 RhP0`V4 #0p (@00C& R 00#!X000 D0C& < 0 "!0`h@h ~ghh0lu -L M0 @R 0S  u%P4 0 0 PM P-L`0 RT0!R< 0S P!$0 0 0eehf l`h -L4M4`@0P, `p`PLP 0P ST  0S0s 0S0S 0s HK$0 H0KG K  HK X n` VB h0 m` VU: h 30S/P0v@HKLL0 wPrLPx3P@ P,0 TS L,uzr@Lx@0S  LK 0o`P0@!   0@T;\ P0S 1 ( 0@00c ɜX2P@:rr0S TS,0S00S40S80S , $Py0S 0S$0S(0S X n$Pg0s T0@P 0 0a P  0@JU& !0rP@ h 00S)P Vu@L0LHK ὑPqLP 0P@ 0L0 Pq@LĐ@0S  LK 0Ỷq* h g`h? Hh"8hph(hʚ; -LM0PS`@p 0SP0@S6P4 P 0 R T p # V00R00S@ 0xP0\ pP rP P p @\zd,5 `h --((LlM0` ,0 0t p |0 0 P   Yp@ lKPl Kt h 0 :R 1  80S $00c ( q`V 10(00@ ' @p0K  oP;H0 0 @,tK0兓P  'H0S <0&0p l  000 !̠` !4! 0r00p0 0 :R_ q9 |0\"*0t0 Vp l0KR Y pş,0 tS ,T0S PP 80S0C80Ix0K( zP70t0  Px@ |0 ( 㠑h000 pKt 0 :R5 P@ p0S 1 B 0@\ 񟗗ꌂ(@ȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂȂXpЃ0p0S 1 0@0S <210Jp0S1  0@p0S1p0S1p0S1p0S1p0S1p0S1p0S1 p0S1Bp0S1p0S1p0S1p0S1p0S 1t0S10 70'SC 0( B(0 0B  0f0f$0C0C 0S0 00 !sP`00  ge"Ph h p-LM)RP`@ :R@ph遭P pP niS$eS S  0@ph@phU UP p P ᡸPP nk0CS -L,M@, PPL ^`p ^Ȇh$XU 0 L0 Y nL6 ,0S ,ЦV@ 6 ՍPL ' V@00C\ 0  "!l0 00 X6C& P 0 "!0,&0 R KgPL %@00C\ 0  "!0 00 5C&  0 "!ht%00 RL0rp0@ 0H000S0006 %@00C\ 0  "!0 00 4C&  0 "!4  Q  R0 0SLi 0G~K  vKX( $4 VV PJ أ4 @ 0 b3B&! 02 S<ʂ1b R0 0000 \S@00C\ 0  "!(0 00 3C&  0 "!0"0 R00iK ꭸ 0@S 02 R 0S 10 R 0S0s R 0S0S0S &P 0, 0@S1 R 0S /0 LKH0,P P L0S p00090~} S80wH@Kd0@K G0KHK#  0L hS 0SHKH@KG0[S1S-0L(|I>|E 0`}C g ""@h`h4yd8ydhh0`h,g$"@f`gg+g }gL" -L|MğPp, @ @S 3  l`K yP `T 0@S 00 lX  lT3 ,0S D,0S/00S 0S 0S$0S(`V 80K0K@K0 [0 P ,H0@K@P 3Sv 1k  80S $00c[ 0 lpWR 10000#0Y"(`0#0 81#81#$102$1 1 ! l@  000 !40! ` 0! 0HQ<0 " " 0( >8,0h 0,000H  T70O0S: 00 B00 0  0g0g$0C0C xP 90S61030S  0S$0S(0S90& #,0 0 h g g0"Wh -p|`LP P @\t  0S $Ġ 1 0 @ ehhpd -LMPp0P` 0@S$ K?P $pP0 $Ġ  <@0 A000hhpd -h0L`PX 0S 0S 0S  0 1fhpd -t0LlPd 0S 0S l 4080 00P fhpd p-LM^P`@ P  0S 0S l 40!t0 0pPp,@0S |P00pbtfhpdH0HP< 0S0T0S0Sfh -0LPt  l 0S 0S l 40!D01$  (P fhpd -$0L0Sh 0-HPL0@S P0 T 0 h 0-`0L @R LP0@0C000PS T0000hf -@0LM\0 @T hO- Y I* b$\(  p pgQMW@PФP``$($,Q@Qx       x         @Q@ Q x        Q0@cA@0  0  0  Q@A 0Q@Х@PP484<  b rP[0  -RLM@ "8 -RLM@ 8 -RLM@ 8 -pLMDaDqP P 010 RDL @ 1@0 0 0 0fs@0@0 C B\  00#!0 00 0C&  0 "!0\ 0 R,L  F7d@hff"h`hhh0 -\0L0TS 0S p00R0S s)P g@h -LpP`P@U U UPEP PE0R0@hp/pp00" -0QLMp <0 4 8 ; P, K00K/PP ,  XO XI;01%j 46RFcj8l!0 T @!X1T d 0@T0X X 10!Y4<08,00 R, H008  0 R 0, Ht /0:n#:QJc` 080 D0 80 $ 0S 00H@hh`h"h -0LMPp`:0P:X@PH P PE 0R08@8i.iM#`h" -SLM@2~s H00H0 00s@f -LP/t|ġ̡ԡܡ  $(,04@DHj," 0- <LM00CP@ SNꄢpppppĢĢ``1? ?0 0 01 K"0 0 ,1  ,x; ,$0 SH8T`0 L  K20C0 10 ,UU330" -LM\@  t\ u\\Q10` R`` J@`z, 0 V. @ kp  _p| l,0q6S P Q q0` QJz Q sY QPF @04  @TZ00e/C1"/ 0bl Sx Pd ,0T,1D,`h0~n0`pf3PP* 0f0V@0*` 2%V( K,0K JTZ:\")^,P,D0 <0 R 0H ?e@hhh`h -L) !" -L)(!"00-@P 6 018#811  R R  -0LP -LM`pEPQ 0 0S @QP|%> p02SN H%%>!D @A0AS= R ;%4 0 , %00 #0BWS @xxxxxxxxxxxxxxxxxxxxxxxxxxxxxPxhx|xxxxxܰxxxЯxxx,@xxxxxxxThı̱xx$0xx@LxdxȲ 0ts0A0CS Q X@@0S $% , R|2xl2D PL4 8<40$ 1?3?3  0  0x0!pn x ell%10?30 @U0P%  0?200  024PP #"8!#"#85!V!#"$!T##"d"p!6""$!!!`pl"p$"#"#"l##"<"#"$"$"$",$"4$" 0-@PL> `Sl h0 $$ à 0 < 0 $00p$"H$"P$"\$" -pL`@Pu$ T 4 Z DU pP@TXD4(4Ph$"l$"t$"x$"p$"85! -L0 Z\@`%Z' !00St 0t  rW\PD  e/|$"0#!#"H!"P!"X!" -O8@LMpOSP!b$ $00S 0 hdX@@  f|$"@0#!#"H!"$"p$"X!" -@$40$&S !PL$pdxl dVH$"$"|$"#"0#!H!"X!"P!"!(l" )000 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 2 R 2 R 2 R  2P00 R@A0P0A R-  &bs_notimpl_bs_mmap: args at 0x%08x - %bs_notimpl_bs_r_1: args at 0x%08x - %bs_notimpl_bs_r_2: args at 0x%08x - %bs_notimpl_bs_r_4: args at 0x%08x - %bs_notimpl_bs_r_8: args at 0x%08x - %bs_notimpl_bs_w_1: args at 0x%08x - %bs_notimpl_bs_w_2: args at 0x%08x - %bs_notimpl_bs_w_4: args at 0x%08x - %bs_notimpl_bs_w_8: args at 0x%08x - %bs_notimpl_bs_rm_1: args at 0x%08x - %bs_notimpl_bs_rm_2: args at 0x%08x - z%bs_notimpl_bs_rm_4: args at 0x%08x - m%bs_notimpl_bs_rm_8: args at 0x%08x - `%bs_notimpl_bs_wm_1: args at 0x%08x - S%bs_notimpl_bs_wm_2: args at 0x%08x - F%bs_notimpl_bs_wm_4: args at 0x%08x - 9%bs_notimpl_bs_wm_8: args at 0x%08x - ,%bs_notimpl_bs_rr_1: args at 0x%08x - %bs_notimpl_bs_rr_2: args at 0x%08x - %bs_notimpl_bs_rr_4: args at 0x%08x - %bs_notimpl_bs_rr_8: args at 0x%08x - $bs_notimpl_bs_wr_1: args at 0x%08x - $bs_notimpl_bs_wr_2: args at 0x%08x - $bs_notimpl_bs_wr_4: args at 0x%08x - $bs_notimpl_bs_wr_8: args at 0x%08x - $bs_notimpl_bs_sm_1: args at 0x%08x - $bs_notimpl_bs_sm_2: args at 0x%08x - $bs_notimpl_bs_sm_4: args at 0x%08x - $bs_notimpl_bs_sm_8: args at 0x%08x - $bs_notimpl_bs_sr_1: args at 0x%08x - $bs_notimpl_bs_sr_2: args at 0x%08x - v$bs_notimpl_bs_sr_4: args at 0x%08x - i$bs_notimpl_bs_sr_8: args at 0x%08x - \$bs_notimpl_bs_c_1: args at 0x%08x - O$bs_notimpl_bs_c_2: args at 0x%08x - B$bs_notimpl_bs_c_4: args at 0x%08x - 5$bs_notimpl_bs_c_8: args at 0x%08x -LMp,`@PL T8P$1( <0D $00H,!000wwww -LMY  `Q00SpP @ZJ $0 0T@TZ S@* $0 0@T T: -LM\  Q@@Tp` PYJ@ ( 08@#8 XPUZ TP*@ (0@8#8 PX U: -LM\  Q@@Tp` PYJA , 0@ \PUZ TP*A ,0@ P\ U: -L@p`P R ,0 10 \ 0.0 R,0 >x p 00e* R ,0 10 \ v`fh_g g 0-0 L@  ,0P   H0 RH 0h0,*|h g`f@d2-@@Pr?0RW` X4@L` B`p Bp` B`RE0C`R9`` B`p Bp` B`p Bp` B`p Bp` B` B`p @R B`p R BRR `` B`p Bp` B`p RpPP2-B@P00O0RW` P,8D` B`p Bp` B`RE0C`R9`` B`p Bp` B`p Bp` B`p Bp` B` B`p`p@R B`p`pR BRR `` B`p Bp` B`p RpP2-D@P?O0RL` <$0` B`p Bp` B`R:08`R/`` B`p Bp` B`p Bp` B`p Bp` B` B@R BR BRR `LpdX` B`p Bp` B`p RpP% $0000% $00000& $0000 -L R l\000Х000 R 0 4 8 <0 R  R000Х000 -L R l\000Ѥ000 R 00#40#40#40 R  R000Ѥ000R 0 R0#400#8 80 RR 0 R 4800 R## 8##,0R0@-0#88@$HHP%XX,ȠȌ8 R0R0@-0P8$#H$8#0@8%#X%8#0P 8,#, 8#08.#.8#0 R0RC-R :08PHpX hx R R:x08PH R R:080 R R:0 R0#40R}A-R:#H#8##H$%h%X%%h&''x''(,,,,.Q R R :#h#X#%h&$$x$'( R R:0 R#X#H#$X%0 R:0@ R480 p-LM0@S`P: S S00 S S R/ !R0 R R R =R 0 R R R =R=S Q ` P0  R R R 0  R R R0Spp@d0-2P? @P4@54?3P0p-2`? h@@PPP`5P65?3`pp-2`? @@ P dKP8\00S 0,!X0T  P L  HD  @<  8$4 ( 0,, 0 (4$ 8 < D H\  d 1 100 1`08<100g p-LM0 @P0 "!HN 0L`, @000ph Hph g|h001 -L,M \Pp d\ H0C 0 HdfV ` V` V0Vᆡ0僡0# X@(  0PKP0 L  pH00CH0 p 020 0P0LP 2  A HKDH0K@ i8! PH@K PK\d6FS -L4M \p f\ H0C 0@ HdfV ` V` V0Vᆑ0僑0# ZP@* cTPKPKL@ P@  pH0@0CH0 p 0@20 0P0LP 2  AHPK T T@ l8!@\d6FS@-,!@0 H@ -1A `L0 SP0 0- p`00C& R 00#!000 0C& x 0 "!0T 0 RB5PP`h@h+ghh0$ 0S00`h p-LM R00A00( $1P 0 b 1B&! 02 S41b1 R000`P00C\ 0  "!0 00 t0C& l 0 "!0H 0 Rpph4@h`h`gg+ghh0 -` LMT ^LL @Q Q\ 0 @ gg (1 R 00f`hf -LM0` 0 !HAHP1UP`!p000PG4 1 UPR,1`t1AT  0P= @Tp4 H` 0`W R ,0 10 \ 0.0 R R ,0 10 \ d_Tp  0g `m gg|h`h`f@%"^p   ,  0   -`,1LM 080@0K(PUK  !PU Kp0(  PP  蝾PU K0@ @ P_0刾P00P0GH 0-tPtL0n@Q011!!PLP@0,!0*4  40L0C0lJdGhfhg`hhh@h gL!f%"?e%"ff%"fff|h&"@d &"X&"&" -LMQ300CS'<X0 z0\ 0S- 0 uX00S000  0K-0 鰤f@hh@-0S0 P ?@A1c   ?2c0p0S0S000 L0R 00S1b1,  謤ffgfff,dQf@f -L@A,@` pPP 0  0 P0 0   $ ( 000$0(000 -L MP S$(`p@, (KH,K @:P,00$`p(0 -LMP$(p Q)0W80 0 @ `0K 0 ,K@ @P00T00SP00 $0 0( p0 -L$M$(p 4 80 0 R8 P0 UQ0 `! 0@ 8T@!,K040K PU 00`V00S P P00 $0 0( 0 -L&"00$0(000 p-LM@P` D5T 0G0S>Q&T T @Xp 0@D@@T@H|xt 0@ 0@@ 0 Q 0Xp&"`hh'"('"<'"d'" -LMPpU' `V @ `\  0V PPP  @ @N@@P@ LL@N @@ @hh -0LM0KSp8 <0 00 , ? `00V1* P&Q @Ϡ/ 1b10P:0APPϠ$:?0s1c4 1!00  0j 00V:< 80 R< M40KS0n40 0fh ->0LMnl`p4 ? P@N 40 R08 &8 P00U* V 0:    0Z UJjF:804 0S80 @X, K00KhP\00 P0 RH a?e`h@hhh'">0 >0 ?eM0@- 0@^0 0@T 0 P^0@ЍS0@P ! -LM8 \` 0p 0 0c@0 P 倢< Vh 0d2Z, K00K o, 0S} 00 Rq 2*"*4  0808@0S  4^@>0T:00Q ^ RD 0 0c4 :#:  cP!\4 4@  000aP0S@@< Q 0Y ,040`V0<0 PV<0 000 ^\ @,0<@ 0 S0\0,("("*4*6004   4 K@@hhhh 0-LMP 0 .@K PP@ PCKP*40 0\ @4:Q0 : @0 \0 0 0@-P@P`p. ^  R00\:\*R:^ >00 0 bS0!>0>00>000 0S0l0l@-^@>0.  Q:00R^  -LM@`TSp R a :@TVPbUP!W W `e L 0D@WH`hh -LM`0VPp R a :VP@bT@!W W `d L 0D@WH`hh 0-`@L\0P 0  ,0R 0 0S0h`h`hD'" -LM`PV r @0S  2S @2lS2S~ X`T;P80JS llll0  &0!0@0 K1PAA0S 1 R$ 1 ?#+0AB%@ Z 11@T pp!m` TL1L ?#+B%000 ?#+0A00 0X z" 0|  hm,Hh"Y!,",","-"-"-"V!h`hh hhT@h -"H-"!t-"-" h@h-"."(."D."T."`."p."|."."."`_g_g! 01 ,   ! 00 2l 01   g@d`f`h@hLhh`!`&,68`@d`03 6 !03! +@-p` PDq!03 `aPc_BCHd$MQ`pp50q0q1 0S2  0S'P U ,1P R0S  0S@T00S |1 ,d!HP!@ 0S ,P 0S  0S D 0S 0P 4$0C 4$ 0 0S  0 S  R P@j8 H 0S 0Phh@hh`h -P@LM`pg 10S 0QPP 0SK SI \W- 0S! 10#VR0 Q S 1D0@S0H 0S 0PT 0S 0S|0< p 0S \0Lp `V  Tp@p g@h`h -LM8PU` 1L D H 0S 0ppUB X@ Ta !T^  *(":1("(Q 001 R``(40C(4 :#%,40C,40 01p R T, 0 R( 0R%  e0PU@X8@ 0S 0S| l0,@0S L @, 0S $0H g@hhhf`h -LMlE0 @000 ( 0 0$,4p( C0S0404@4$進ff -L,Mp P4 @# 9",KQP li/ 1b10 ^:0A^PE:?0si1c, 1! 8WL   8 8Q  804P : #5 @ QH D H@( >0S @# #T8@Q Dh/ 1b10 ^:0A^@:?0s'c!001@ZR @0 L 7R 40P @0 7 Pt7Z P T  J< 4S44SSD0 SH0H0S S 6!aV@0`0ó @0` &W  @0`00@0<0D 0`H0 00Q00S H 0S H0 10#R0 S (6D<  0W 5 Y5 PD R8000($ ($D Ub 5W 5 R{ 0R0w @SP E0Sid5 YU 0)$80 H5" 0S  0SKH0S? H  0S4Z+ 4S44SSD0 SH0H0S S t4!AT@0`0ó @0` 84W  j@0`00@0  400S 3 3H@3H0 3@X 0SU l3PO &`P< D  #W 8< \ ]0  [H 0S2 `02 D0+ LQ( 2H"L04St2 p2P PX"W d2 YL2 PT  < 4S44SSD0 SH0H0S S 1!aV@0`0ó @0` 1W9  @0`00@0<D  `00R00SH  0S H0 10#R0 S  1D< 0@ 0S 0P D00KS0l00 0 [])*(":1("(Q 001 0RX0l00@hfh@h hhh`h hhhh`hf2"2" -L0S7<K1 Q V$ 5 R 0R P0@T:TPP  0 SP 00dX HW:4L000S < KH P 0S0S 0@(4$0C(4 0Q\ `0 (DKP C/ 1b10 ^:0A^P:?0s#c!D01B@TA  4S44SSD0 SH0H0S S 2!QU@0`0ó @0` V  D@0`00@0Y 0S 0 0S00 \0 ` ` X<0S V 2 R 0R X0z0X0 0S !HPP \@0K !< K‡P XzX P0S$ 0p0 R0S\0S 0S 8 ` R 0S  10  H 0S!0S@ <K1@T 0SP00P0 00 x Hh 00PL daY0l00$ P d@hhh`hfhf - :8PLM#ʠ (Pp#8 001 0R0*"%`Q0000 00  0 d0 RH0H8@@0@h hhhh`h -LM PP/*%:8#*!%( f V `!R#8 001 0R :#U@p*0SZU@:00g0l0 R U:Xh<0H,0@00p0@hh`h@-0$,@0S!*4*6 ,<1(P 001P : #P 0S ( 8. :(#8 #:T -LMP0 4 `04  0@eS4 T0#03U<0 8` *%:80#*!%( 4#8Z!R 001 0R  R Px : U#s*@Tl 0h 2$pQ b/ 1b10 ^:0A^p:?0s"c!,01b0`@p2@ RVp3 @00 @4pS44S@SD0 @SH0H0S S 1!AT@0`0ó@0` 0!QN 0 -@0`00@0<0S,808 <0 Z U:4 Uh:<0S 80S 8  00S1,00  0 0S 0000S  00S 000 0S 0  X0Hw,0KS0l,0 0a(0Hwhfhh@h`h A-LQ GGGGGGGh2 -LM@0@0@ -LM@00@@ -LPM!(Q` %J 0 010 P40 B :#5p W8 ; R 3 5 . 03"F Q Ϡ/ 1b10T:0ATϠ:?0sH#c!,01" R 8\ 0V \ 0U\ 0 @00@0 2 2802 R㘂K04$2 " 0S  P2 R2Z<<2 R   0SW b0 l18@ #>0 @ 0H`8H,0KS0n,0 0u,1"@Q / 1b10 ^:0A^@(:?0s c!001" Ra 8P^ 0V PW0UPR @00@0 80 ^0KQ0l00 0hhfh hh`h`hhDf g2"83"h3" -,0L ^  08 g`h -!*(":LM1p(Q"( 001 R0*"5P#F(K` PϠ/1n10T:0@T`Ϡ:?0sT c!(01P  0[Z0a00fh - 0,Qp@Ltt1 T ?= ?0SN HH!00`00  "! AR00  00#!0S  S0@ 00 0C\ 0  "!0 00 t0C& l 0 "!0H 0 R m0Q g@h`h`hhhh0 0-0LS@P 0SP200T* 00S 0 R 0T 0 R 0S 0S  R00h00 0T   0 0 0P00`h@h g̹ff -LM 0@S000L00`h -PLM` 0S 0Sz00$00CS$0. V( 10S 0 R V 1 R 0S 0S  R00x00 0d   0 0 040s1$!V,q& 10S 0 R *I0  0 0$R444444 i_@00#!0 hP0 0  "!0000~@h g̹ff hg@df`hP-0 R0P  0S 0S  R00L00 08   0 $00$0̹f@hf 0- L40 @ 00 0l 00dPSXP T@0n @0H hhhfh`hf 0- L4x0t 00H0` 00XPSLP H@0A ,0hjH hhfh`hf3" p- LM40 @0 00 00PS`@0|| 0 SPR0Up@ `H hhhfh`hf`_g -LMa 084@4 0  Ԡ 0pSp' 0`0000 @RP00 D@HH hh`fh`hhfff -䀟 0L84@4P00H0@0 嬠R㠠  000H00 |`Rxp 00c DmHH h`fh`hhfff3"0 0 h`h -L⤁MZ\1!0 1, P l%"*d`w\!P@T LqLa 0$0"*!>0\;@T060܀ S:<,, 0@ 00C\ 0  "!0 00 0C& | 0 "!0X 0 RHh`h@h`h@h f`hhhh0 0-0 L"*("1("(@  \! 0 S@0@:#0X0XP T0 R4P 000H h@hh`hh@- 0 0 0 21 0 0s#0@$ ! 0#:8#*!(#800Q! 0 S@( 002000 h`h@-`Pp !:H$$X 00S (| $:1(P 001P:#50 000!S$010 0-0@P$L 00 0S0ڀ0 R pP ` `000@0  0@0$0)$h6@h@h ff3" -3崓LM00p 00P$0, 0 ppp p0S P U:YZ @:4s4C<,c00#S* 0"" "0"0"00a3C?6C#Z!"00#Rea!\"0T2@P"@L2  @@U4Ÿ4 0,,P 0 "R@ŸP 04T0D@ 0@0!@0 @0!@s< hPJT:kto`P@) E1? (P 0 01  @`P 1 000R ;P= K9W 0p(Ā B@f@h`hh`f`hfffhhh ff fff3"HE$f8fp!fXd3"f3"ffL!3"ff 3"<4" fx4"4" p-!:LMP`0S@# >P@+ 0*0" R 00 00SP@`p`PHL0L 0S 00 00Sh`hh`hhh4" p-LMS@P` ,:8l#*( #800R 0 SP*  ^0"5060p @h4" -80L0 00 Ơ 0 鈿f@hhf@h -d0L \R00#P00*0 $0h;@hf?e`f00 R 0  \05055-@h`ff -L,M(1"0P, 0 0 S S @ 8 < Z4 % 00Z 3 #@46S``V" ,2 0 88 00^..,0)!0S0ƌJ0 Z4, 1H, ): R MPPE 8#8ZS#00@)`p@V ?>0U.!$!Q 0@ST0ȌJ0H0) 000! <000< 0! R0 0 J hHh z`0` 0 80 T0@ 0<0 lD0D 0 80 804ghh`h5" hh5"hh`h h hh6"0@h -``LM0pS P0  @P@#00 R@hP0P0S  \:00Q0S@h0@-l0@P 0S P  T :00U0S000@h0 H 0R0 0 0  0 00. 0U0. 00 |0t t0t p0404 00`hH hh hhhh`hhhhhhh`h hWhTh -L$0 0 0`hhhhp@-0@ @0 L0  `0 0 PP0  |0| t0t @l0l d0d P`0?00?ph hhh`hhh h`hh\XlUh hh hhh hh -LR<6" -1LM PR:  P%4*%:8#*!%( v W p!R#8 001 0R  :#U@*`L0HS @000ZU@:@ 0S U:hH h`h@hh 0-80L@T (PT 0DT0f@hV! -d2LMP, @ L,D, <0$ 080 00 8 ,1( R 0S 0040 < R<4 &Q< 4 8000S80 0 X 0@S@T1S ?@4 Tf?p P@0F 0(01P.P I \ uuuu8vuuu@vuuuPvDP0 R 0P\ ?#=?00c?S g@Tjڠl_,@0Y0@0 BP@CPmPFP(M@h6"6"6"6"@fhr!6"6" -LM(p`1S`>V#1(KPQ @/ 1b10 ^:0A^P%:?0s c!(01B@T H4$4D\8@T W 0 *4@TX0l00@ffh$7"P7" -!LM!:1(P`U!0 001 `R8pJ$JT( 000p帀00 0+; 00 :P 0 R 0Hp@:#:S P@*:#:"*S:(21@(PX0 P 40 P  f@f`hh`hfh -41LMP@pP@5 K PT%: 8 #!( R#8 001 R 0 000! 00S*\0H 0` `!P4 @~h@h hhh`h0  ")0 )Р)0 ) ) -LM@p P 0SPTT0 R0 00b81Q00@RleDff@fp7" -LMqB2< r R0S tRP "88 #$0LH2`PP 0S@ th P0Up7*!A06T&*46!SAQ  x1 :Pp`UJ1 16T:0U00 pW0#02S0ES8~@~~P~P~P~P~P~P~P~H~P~P~P~P~P~P~P~X~\ZLI "88 #$h@(0S} dhle`h@fDf7"h7"hE!@h7"7"@B7"7"7"8" 8"8"08" 0-LMPK 1P@ 008@`h -LM0@X`h -0LS S  -,@L,`P. p,!.@ ,1:404,1L@H@,!L 0V800`H`0 0 04  -LM 0@  hg8 -:#:LMS`@PR pK Dp  jVJZ@hT8" -L M00' H ~p@g0>0L ^| PWU@`H@ $@K,0  ;$ 00ZZUzje뤤f@hl8" p-LM`00l H0N@0d0>0^P 0o,0 L 0L0H p?@hft8"A- QQQQQQQQ RA- 0@P`pQQQQ R -0LtP 0-LMP@`hD80<0  @00S0 00 0h V!̄8" -LM@Q"QdQQ?qp?q`\0qTHX<d(x 8"8"8"8"8"8" -YMLM⠒8 0pP<@ @%  ,0  0p"8% D (K0`d4 0X4 0S! ?K ?K! D 2% 0S7 0S-[nK`F`F0 P0S  1) ,0S ,0 |\0ST0 LO0 8I[KHKH/q0S30 P 0Sp"0R  0Q`/O0p2  0 0S0H 08 gf`e8"8"9"$9"<9"`9"9"9" -LP $ 9"9"9"9"9" p-0L Mx` P0 P K0S@ p@ T 0 @d1 \ff -0pL M00x` V0@ P  KP `0 04P`?p 0 (@o^0{ff 0M:" -L Mx0@`SsP`X1s /0Ss? r`,Pp 0d1` 0x 0$0K`0 0P (0Kd0 0Pp $ 0$( pl( JP $( 0p`UP 8`$ ( V 0:" -LM0pP0` 0X0L Tp@`PP0` 0 0  0p$ @0P KP0 d $K0S < H<P` 00$ `0  0 괌ffV!D:" p-L Ma`P@0P TP@]0S0 , ,1T ph0!phtk`:"L-$:" -LM@ $00S   P  -LM@0P $0@ P 1U0Ё!P$000 0 @T @$ $P, `1TXAP00C\ 0  "!$0 00 1C&  0 "!0 0 R! @P00C\ 0  "!|0 00 h0C& ` 0 "!0< 0 R '@h`hNhh0 p-LM 0@S`\PP?0 T0 0 `p00 0E p-LMPP $ $0S p -L0`p $.(A(!P$000 P0P0C\ 0  "!0 00 0C&  0 "!0 0 RP P$0@@  T0U0 TV @h`hhh0' 0 :" -LM0@ $0l0 -LMx0`aSsX1s dQ? r? rp(0K@0 0P@E,0Ka0 0P(0 ,$@@ 0$ ,T0 ,$P $0, p T0, $@$p @0( T W 0d1a 0x 00,  0-PML<@ @800@ 0@0P 40a00 P@ LHT@\@X@8@KAP$ 0 P0:"V!4 -LMC4 p TP, 00  `0S\0S, R00XYT0S X0SZ `00 00080T?@0O$L0PDD4@80 T0@0 8T"`0`0C\ 0  "!0 00 2C&  0 "!dŸp"00 RZ004 $00040 T0 P@XTP5 ,0c`1< |4  00C\ 0  "!0 00 |1C& t 0 "!D1P  Qo`P<,0 \P!0@\@=0X040@400 0C\ 0  "!0 00 t0C& l 0 "!0H 0 R<0<`0@h`h4hh0$:" -!ap0P0000@`PL4 $0004 T\0STP(@p00C& R 00#!|000 h0C& ` 0 "!0< 0 Rh,s`h@hhh0-(0$0΂0"#S00$Mb0 0 ꀸf -LM\0 I:"H0 @0 808 40$ $0$fff ff@f -RLM@   R⊠y! SY0p`x0`0cQW0`cRD0@ 0S o0 Bff|d p-@ALMtP0` a0BS  0B <0BBS񟗑 ğ0ğğğğğğTĠ(ğğğxğğğğğğğğğğğğğğğğğğğğğğğğğğğğğğğğğğğğğğğğğğ4T1  0+S#SO -SL 4 R 0Sf 0S0c/!/BR0 0f0 0AS0c/!/BR0 @0C00T0`000C S 0!@D0T0C000C S0A?S3 T0.S @DtP_p@DTP 0.S @P@Dt#0S0C0l3 P#0S00H00<0T0000C S 0 1 @D0 BT 000C S00C?S00T0nSNSP@D  lSLSP@D 2sSSS2  P@DT000C S 0!@D0T0C000C ST 0.S 2@@DTP 0.S T0nSNS P@D 1lSLSP@D t0T0000C S 0 1 @D0 BT 000C S0S00rT000C S 0!@D0T0C000C S0 AR`x05T000C S 0!@D0T0C000C S0A?ST0 T0.S @DTP 0.S ꠸f\d f@fff$f0P`f -LM @ 0 0V!f`f 88 #40-LH0HP R @T   0 0`f`ff p- 88LM#4D` @ TL#.PP pꀹf - 88#DLM 0啥0 @逹f`f 0- 88LM#4'0Q 0Q@PK P 0S 0Sn@b00P`U0SS 0Pᠹf -p0pPL΁@0p` T P0 ($04 000 YhXd;"f 0"(, l0 $, 0, 0 -L Mx1@Qx`p, K 0 P U, 0P9 , 0P/ P05, 0PP! UP 5, 0qPP UP, 0T, 0TdQ儀,  f p-0L Md0`\@Px Poh0s Yp 0 4@V0pe00e0 ;"lv;" -L-h4h h -QLM@ 0k$P aw!@;"D;" -0LP -2L"Ÿp$Mp4000&0P @004(00P4 (00@4 $H1X$H!@T@%XUXh04c/0\0@4/0\!1 pt!Lh1 p\!PL1 pD!T01 p,!X1 p!0\ p`@`@PK@  00 8@ 4 <` , N0@40 @ <@ @8 4 0@ ?|0| Q Wd`hhXdL;"eh;"|;"H;";";";";"hh @;" d0>00lP  10?e -L4<"0%($-!R!$S ^  -LM@0K KK0S(00550 4 0-LM@P K0K K0S(0055 0!4P0 -LM5 @R4$ R R @0BS 0BS X0l00 @4cR R  P<"<" Q-@ L<0A ^  0   D<"f<"<" p-L MN \@ `P0`PTp `p=̹fȹfN  0O   ! -- -i`@0P @!1 ! ,Oi<ЍG-qԁA 090 1C&   Q 40#QY l  030Y P000 0& P0P0$0(@0,@04$00 00 ` 0 04 P(@,  0R  000 X0C&   R 40!QYfh`h 0000@h`h @-@00C& R 00#!l000 X0C& P 0 "!0, 0 R@=@hhh0 0-0 @P00C& RL  0 0#!t000 `0C& X 0 "!04 0 R0`h@hhh0 -LMpW!聟00@00#!a P00U00;00!00p 0!!0`00 0 0  "!00#!000 0 0  "!k00#!060 0 0  "!U00#!0X60 0 0  "!?00#!f@hh`h@-0  "!X@X0  0 "!, ,00Q@ZhT@h0 -0L Md C\0@T 0Q @0 ZE0  "!@hhhf -PLM Up<` +-0@!T  000,`004p8PP00#! 00 @@X8 @0 0!! f="ag=" -LM8 \!0@  "! R0000 0 0!!f -L "Mp"0W00 1C&  ,  0@0p0`00 W|0  Q 0@!!@0  "!0   ! 00   0  "!PU 0, P,`V @0 PUV 0!!L0P000 @0C& 0 , 0 0C60p@hhh0f|h -D0LM@/040\{|0AIhg -LM܀004/0\{'{W 0`0P40@/G$,| 00`pW@gp02.040\ @,~W &~hh hh@=" -0L`fppP*Ppp3:5Wl@ 004\0p0 40\0 040\Hdh 0-L0@L2P00Ϡ(0Bl@D 00hC hhh -LM q0\ P S  0`w @< <0 00!A  8@>@@0Sp 0SX0 T @+HH0S0I gg$hh="Mb="о=",,!=" -Q@LP <0Sa!p00/0004,X!0<0a80,0S0 =9C =CS 0\) Pp 00C\ 0  "!0 00 0C&  0 "!0t 0 R k0S00 R@0 0 0 h@h`hg?Bfhh0 -dL 00Ba 魋hff -PLMP? 0S  1P@, ,00C,0 , RUPEؠ/004,Up` 0/04,W0`05/0`000P`p0 `0@V:0`U04\꠼f|dhf -LX  0 P0$0B(0P S 0/@hh0#!=">" p- LMQ0`00@0  "!\ R0000 0  000  "! 0  "!p@h|h p-LM0@P`S@  D0P!!00P ` p@@@@h8>"-0!! R R0000 0  0!! 乜 0- L00P000 0C 0\@0 0  "!0 00 0C&  0 "!0d 0 R 00h^X%k@h`hhhh0 -LP;" 0-LM0@00 P<4   T 0\X00` R0\0\0 0P ,0 S P0t 0440T/P-TH H0 PP8 0($ hxd@pdh`>"V!l>"px>" -LM (p("$RS0QUO @TH p`V4 p414! `0 lp   0 Q0p0h 0" 0-x0 (L("Q@p0 0h <02p㊛t㇛0t0p0ꘅdK$ -40L Ƞ Ƞ,10h2阅dK$ -40L Ƞ Ƞ,10h2 阅dK$ -LM @.q@hŒ`PP0 PP0V H0V 7P0`0`00ꘅdK$]t@\t0 (("1ᘅd -LLMl x4, t"l4 !$004`0P0p0a0 4D00C\ 0  "!0 00 3C&  0 "!0#0 R3 ,0S ,d0lp000C\ 0  "!40 00 3C&  0 "!"0"0 RB^/, @T2@4 000^/,ph"@d"00C\ 0  "!80 00 $2C&  0 "!1  QfH0lK@ p0 WH!@0  p00p0p R3>Rp0(X@00C\ 0  "!$0 00 1C&  0 "!0  QF0p0pj0p0_p0 lK0.\@^/, @Tp Wp00p0?N gd@h`hhh0>" -L Ml 2"`  $(0QS0@4p$ R RK S KS S d2d"#8C@4, R0,0   R@  R`    . 0\[/,0\Z/0\! 00 !400` d, lh \0 09900( P0 P 0.\,0[/\0Z/\00@00C\ 0  "!0 00 0C&  0 "!0 0 RF80 @tK S ʖ Sh Sf阅dHdN@h`hhh0 -,1LM$ ` P!1p @x|px |P00C\ 0  "!0 00 0C&  0 "!0p 0 RU@ TPh02@T00 `h@hhh0K$f -0@4P儀Lp^/,.!,`Y/,@V X p0  | DRx0<`|0 Sٱf -LMl0hhp@P&0pP` 0 0 v̅d h@hdh>" -,0L( &0 h@hh K R-L`p@0 6KR- R+ 0 #8 C< SP P  S@P  S`P P P BD0.@P\0[/\0Z/\00  @K R ʖ R RHdN -,1,a4 p 1!@PL^/,.,0Y/P,@p00C\ 0  "!0 00 x0C& p 0 "!0L 0 R@U `h@h h@hhh0 -8184 ,1(!P` ALp^/, @T0.\@^/, @T@0 0C\ 0  "!0 00 l0C& d 0 "!0@ 0 Rmq`h@h h@hP`hh00 -LV>" -LO?"0R R | 0\q 0 Q  -LDM2x0 \ t3\ , } t0"40t0 0_  P;.XK  @0S S P@0'\00$tt 2 0S0H1H!\1  |50|51  |5@0|5|5F@0 1/@ H_50%0P100\0\00hL1d! 0߬P Y @1 ,0S (,@\!0`/͊_0@@%0P0`@#Hh P 8`p@5͊P%00\`m gP$hy!$?"(8?"dD$T?"`?"~?"JHFD?"?" -1ap @ $LP P00$ ;004P$ P$PpAp00C\ 0  "!<0 00 (1C&  0 "!0 0 R3쀟 0PUb p@0SP 0@ 0UP0U p@0SP 0,@ 0UQL-,d*d`h@hhh0td8ԈdxdpdD$0 -LMD`!88#|!Pp02QE/+b212b2c2cSE!{nŸ` 0002c2cU P 0002c2cSEP0 0 S(2   002c2cU 1!02c 2c"bSE"bU1Ϡ Bl02c2cSE5O Ed2d2cRE!1`/"b11b1FQE!0K% K&PK$@K!["K#K K$@[%P[&`[#[" [ 0['K(K0A `!P(0 000(K4P0P0C\ 0  "!0 00 0C&  0 "!0d 0 R`f@f egy-nm4dE.ųQ,E"@h`hhh0 -d3LM\pp80S8c8#P(00000K8P' CP00C\ 0  "!0 00 2C&  0 "!0"0 R ]lBP00C\ 0  "!80 00 $2C&  0 "!0!0 Rp(0[,[1)[a-[1a`.0[+ [vL@ L1"b0"bS#JB!00*0[t!SMDJ1QpZF0 Q0818!0 Qp$02c2cP C0"b>CA 000X0@0Z <0TWp @h$ o0f5f#/@!bP Exf` lW`1CADLs  \@2@fg@h`hhh0nm4d e`fųE.«*\E" -L M8@4T 0 @@ꀽf`hF" - " LMp0P 00 `Rtܡ@0T!D@ɪ0S TP@/ )00C0`tQp00C\ 0  "!00 00 (1C&  0 "!0 0 RC4@p00C\ 0!!  0p C6000 "!0D 0 R@`h@hhF"`hh0F" -LM @P 00000Sh4`h p-L,M,@K`P 㚼%x 0K@,K[ PP @_0S 0[ [[8[<40p| p NG" -LM1(KJP`0p d,0 @p(@K@ @.0' -L M$PK@p`K0:$0KF  㹻  㵻  㱻$  㭻8k$P0 P ` PK' -LM1(KJP`0p 40(K $`KPp@ @0 -L M,`KpL0PH@X@0 ,K@+PK(KP P0u' -0L@ p60S hbPu0P" P 0`V U004P< (0;4P00@ @00 0SV hAP 0,0h -LM0$ 0@0(X , 0 PPO KPO0SB 4a4!p000 0 P0!P0 Pp00C\ 0  "!0 00 0C&  0 "!0| 0 R 00Sp P 0,0 t@h`hG"hh0(G" -Lp`PP` Y@ Ⴟ` 0`$0  00 @0 000 020V9 app2 @ P0001P0P0C\ 0  "!0 00 p0C& h 0 "!0D 0 R @h`hhh0 -LM,0@S4x  0 x   00Cs0 0 00, 0S 0 0pl !`p ,0S0,0 ,$0S _gPG"@BXG" - PL0`04pSa0@0p0CS0ו Q.h!h!!!!("<"t"|!!!|"|!"$0( R0(0Q 0  S0000@ R 0S R 0 @ 0S0,00 @ 0)S 00000@@@p@@B -LM0 S 0 ,G"G" 0-PL 4@ @0!qT p@DT4@ 3S05 00hmx0; 08< 4 0<S8! 40S 08< 4FP᧽PQ <P᝽P 0 S0@ ld\0,L0,ؐ"0#!E"E"E""E"E"$F"8F"PF"dF"|F"V!F"F"F" -8qLM@PN 0Uă`9 U 0 U <0?R0S0ASd&P&d&d&& 0@0p| P0c0T  0D 08    0ꈽfdd""" ""0" -@LMMT`pP1 )@T 0 S 1S 0S0t PY0S h鰾< 0 hHpT 0 xH"`""" - LB BP@寸0 0Q0p0P0`0C& R@P 00#!x000 d0C& \ 0 "!08 0 R@h@h`hhh0 p-0LM 0@00 `R0P00 00C& R 00#!|000 h0C& ` 0 "!0< 0 Rphoy`h@hhh0 0-0 L@ 0T00 0P @TP 00C\ 0  "!x0 00 d0C& \ 0 "!08 0 R04`h@h@hhh0 p-LM0`@V8 P/ P0[0X Z ,0S++++++$0  B0[0$ ph= 0Y0X 4($0[0P0,<00 ph ""L"h" -LM`jP < 0A^0S  R0ˠʌ ʌ00ɌH0 `FP<Q!p0000   @0!@00  Ap00C\ 0  "!|0 00 h1C& ` 0 "!0U >U>U*>U>>U>5|:T 0_ L> ,0S \,P>UN D>U W8>UP 3>U, >U 0Sdh 0$*=U =U0d 000d00 d0d=U :,=U L=U0000d000000d0<U, <U :<U <U0< X<U :<U <U 0;j x ,<U Y <UF <U <Und1  s;U ;Ua d1f e/ܲ6;U ;UN 0dAN`;U X;U<Q d1  ;d1 P 0+:U=:U"*:U :Ud1 P:U0SY00 "  d0 0@P 0 )0009U 9U= 9UyɟP 00`0P0@0% P00C\tY 0  "!h0 00 T9C& L 0 "!)0$)0 R0FSL8` 8 8 bB&! 02 S61b1 R0@@00@|ȟ`00C\ 0  "!H0 00 48C& , 0 "!7  Q4y 0PJ '7 `7 bB&! 02 S4d1b1 R0@@00@ǟ`00C\ 0  "!0 00 6C&  0 "!6  Q YJy0S6 0! 0#$0$   BR !˜&,6 P6 bB&! 02 S1b1 R0@@00@şP0y0 0bJ10000 1 0,$,!$#, \@Z  x@0S@t@ 000P0P0 $@00C\d 0  "!t0 00 `4C& X 0 "!(ğ4$00 R]  0@@@P& #3 @ 3 bB&! 02 Sʰ1b1 R0PP00Pdß@0x01 <4(<"4!<001 0#$0$ 0 S0S0002@ 2 2 bB&_ jwPq2U 2U  @0D,S 0\PKP@.PZ0[Y [$ R !ớd1 P@ 0P@`@K P 0 /P0!  6[#$0$&K *U0U| 0410Uv 1Ur 00U0k0Uh 00Uc 0 gd Q@c c c c c Q "c@c c c c c c c c c pd sd ccedA c@rdAc c cmdqdgdfdhdcmc cc@h`h0-ghh0`gg+gddQ @QQ` -L$Me0 `40 Z4 W d0( 00,%820< 40 0@0 0 e  ߪ  ٪0 <0K?X $4Ῠ<0@,PK0@@0  @vP)0[* [0b0S80 ڃ1 @ TʀT T $T80BѸt4P   P00 P00C\ 0  "!T0 00 @4C& 8 0 "!0$0 R  0&PE@ 1  0 48L8 Xp*ʰ1  P 0 48"U0  0dU@0@ <0s0pWpW<0 8XWなW0!038YD r2 @ 0 b2B&! 02 SP|1b1 R0000R@00C\ 0  "!0 00 1C&  0 "!0!0 R<0@  0  0!(0("4400$ 0 40 T#_ Pv08< 4f08< 4@KG2 Ru @T Tʸ  T  T T Tʘ  T  TTʀ Tx Tp yQ"n!WEV,g@h`hhh0`gg+gPF,g,gh-g-gH.g.g(/g" -L,M` 0 ؀!4pKP@ .%4K@(0K P P@qP# [$['0[(["[(,&[!P[8<%@[$ 40 RQ  0cP  N -L M0pK@` n$PE.KD$h$t*0K0 -`K,pK+@K)K(K P PP,@  p-SLM@P`/ Q+KP2>K 0@T@c@cPUJK!@0L\ 0 @p0N^J0D@T;pp -L M0`KP p G0KP*K @(K8)K0 -K,pK+K@ @@ N -L M(`KPp @K}(K0 pKP @@ -LM@}̠ 0@ @ -L M0@KP `pỨBU0K/[@/K&.K)K4 Π0 -pK*K`(`Ku -L M0PK` p@ᑨCV0K/['Ġ/K)K8'KP0 *Kp (pKM p-L M`  0@PU 0 pP nP -LP -L;R`0K(K&K0K0 KP 'PK)`K@pPPK  $0 S $| g0uؘ" -LMp0P@K`+K  0 R,K%K0P@,Kˠ @$@KP#PKP@ [0[4 CRK 0A 0 S  墛 g0u" -ML M䀟@0nKpP`F/K $0 幥ᶥR0K)K(KP0K 0@ '@KwP@  04 SK 0 $0 S $_ g0u"0StttttR(j -LM(@KP`piBf<(KP0 &pK $K* N -LM(PK`@pGp'[(K'K,ʠ0  p$K N -LPMpd`KP 0 @PP0  0 S 0 V[VKV@[@V@K g" -LLM␐`pPKp 0, @`P0  ,0 S ,,廚\pKVKZKXK g(" 0-LPMxP@ \K0 WPG [E[C[A0[ 0  0S 博0 g<" -LPM⤠l`KP0 ( @P/P0  (0 S H(kp@P`XKVKW@KUPKS`KQpK4 gP" -L,MPD@Kh`p 0 P0 .K4pK2K0Kz N 0-L(Md@P0 K0@P [[[0[ 0 0 N -LLM⼠DPK@0 `piP` KN0 `P0 O[P@d M[K`[Ip[d @ P3@K1K/K-PK$ N -L$M,`KP @pY0,K0 (K$pKP @@@  -LMK 0$ -LMP`P0pY?!10@ `0\X1!0S11ؠ11S1ա91š0 0 000dQd ..@Y [ _  T@. ȷT' !T 0P m鴷 PE@A0|P@夷T`執X 1  @HdDd ԇdV!x-!D$`?"h""" -1ap @ $LP P00$ ;004P$ G)$PpAp00C\ 0  "!<0 00 (1C&  0 "!0 0 R3쀟 0PUb p@0SP 0@ 0UP0U p@0SP 0,@ 0UQL^]=[=`h@hhh0tdԈdxdpdD$0H - 88L M#dp&, ğP@} 0 Ԁ嶡PPq`V8 0P Z 8Z 2 RPQ0 000 ᛡᵟ-_,  R0 :0  R0 :0 0 0偡ᛟ-PP( U0000P00 P 0P0P00-PP0 6Pa0d 0 !4-#LP`4P@> 0p'P' U0 60  U0 600 Q0  10S00 000 !  0<0-0d -D`!88#L\!Pp 4pK 00&((*&<&%4K20K1 K0K/`K-K,PK p0Pᙟ00 0 00<H0 @ 0   P@0S  0S2U6 !p2U t2U l2S  0 00<01U 1U  ?K e/F1UE 1U 1U00 "   QL10S 00p2 彞P  0 P0U 0p00实|&4400 0 00Sh 0S00000]D0U^ 0H0Q0dQQ @pd Q@mdedAsd rdAQmqdhdk~gd$Q` -LM⼑@ `e, W T0@pK(0 [_0 0P,0 Q8d0804 Y? R88 ڞY?0 !P屳P8 ᗣ(0 4< n0*0X000  8d᪜(((0"4400$ 0  0 T ,0S <,͔ Ҥ g""E"WEV$" -0L  10S -L$M(K@0PKpϞ̞(KP`0&$$X$t ʠ,K+PK*pK)@K` .K-`K 0- 40 L04@ p0CS00S 00S 0S P P 00  dŲ0PP忲H {P0 (峲寲"D"\"|"@KL 8 8-#DLp$nPP) @0d 0  0S(0 4 @V p*0 P@*0sP@ 0d -LM`P8 Pd,88 #$"Pt00pU0YQ @( РP< K ؠ 2P` 0SX`p.4PK (D&,&Ƞ&*040K2 K1K0K/`K-@K,K0:00 0 x 0 0 P08 $ (<0,000 0P<< f0df'R \ 0L_S BR\00 -L\M⤑lPK0p ,0 喝# @lKpP `0Kk P`ePKd@K@XP X0[\K0S BS 0 480S 0.< 0 08 <40S0,0 S ,-@T K&0@P D[C0[0[/ [H[G[4$  0@ 50 0 0S g N" -LM`(PKp,@&#@(KN,P0 &KP @$PKp -LLM P@`]0(pKS0 ?(K&K ,$KxKT0K @PJ0[K [I[480S 00@ 5  0p ->L4M0Y?P\ 0TpKX0   0POQ`[4@[ 03[4  80 VJ0[K[4I [80 00 S 0S 0 S< 0P0 [01@XX 帰嶰 < 0@ 00 P00声0X0   0+P$Q`[+ [ ,[ 0@4  VJ0[K[I [0ޕ ޕ4804 0   S0 0S< 000X0   0PQ[` 0 8< 40@ ^0 J0[K[40֕I [ ֕804 00@S P0}괚"ܚ"" -L$MPp0@0Sڰ1,Kl  5,KT0L @` `0S0@00 順" -LMK 0 p-LMP0@LP0DX0Q`   < 30S0S ٯ A?1!!000pdί`0TSɯ00D@0@¯4忯ꄈdV!"ԇd0#!Ȝ"М"""X."""(" -0L MX@ KL080S X 0h0 4 0@0 -X0L`lP@p K0h00 p   0000 @S00 P00W - 8LM0 8#Ă,"RA0QU= L@,!0 , p 3W  P`!0W00 D0, S  00  0 S00000 J,0D00  000pd 0- 8 8#T%2AL00A?S  0Sꐟԟ L0000L  pd - 8!LM8# 2A 0 ` PLp 醀@ 00 1lh 4<PP  40@0sPPPP001t d0< <00 0 0 01p R08 00PP l匮-%0 @ +0 0004PPPPpd4" -LM0p P@@0 KL`U@ -W@ 00!=00  L 0 ^P R T0R00<P <0LS7̣̣̣̣00` 0R008 0LSpppppp00;0000;<80Q 40 ` R  R  R 00 000R00000` 00` 0R00<ſ< -D0!#p0<!4#2PLaL 00T 8@RP:tAt!P000( $( (0$0p(U4P0P0C\ 0  "!0 00 0C&  0 "!0 0 Rh 儭04000<;00`@`0@ P000OP PT0S P0hT0pd@h`hhh0T"" -LML`p0S 0QU $ R(0(0(01(0 00   00< ;000@ 400S    00 0 <0+@400 000000 P00 7(Kј00000<0 ( K(0K0000JK '0[80'0K<垛 8 $&0K% K$K  0 < P0 0  Q 0 0³00 0 004`F0?<` -QL M`@p% Q00? 00$PK㚕L@$K`&&T0 "K!PK `Kp@@ @\00 0<0000#> -L0@ ^`Pp ^ 0000 P00V00Sa0 C 0^0 -`Lp$MV, K0@ 0P 40(KP V 0 0)0L(K0 $`KPpP P -L$M`0p, K@P(KU0 00#>00H0LW@@@0 (K@`'pKP P00u -4 40L@0P0`p p0CS W ꄷ|||||||||0S 0ҵ޵8ҵ<ҵ 400$Y 80 ( 0@ 00V 000(0@00B  00V 000(0@00S/40 0800 80 -L M@` p4PK 0g1`V00 0TT0S 4 00rcp`Str00"c1a d 2 -L M1@Ϡ PNlpa4PKV8\0p  h!8 n /T40s 4!,!?L3cS 08T0S$ ,0S0\ &1W< 0<0  ?B3cS!3$0J0$008 b0 <(.U U080S$gfff gMb 0-LM0@(()0K[ S 0K )9(^ PU 00++ 0KK%$0 0(()KP[\0K  )P ( 0- @L aP,00 0dS0@00@00㉿ 0 T0 0 -0P2c1RL@,p ` (H!D 0,0T (0 0S0T00T0P"h -LM` @\ Ƞ!$C"a,Ƞ@Qp 0 @ @0,P@0009$0T0 0`0 S00( -LP(0 P R000  0@ 0S000  0 0 > 0!0 0T  00 #(0 0 00   0000@00 `d 00 (00000d(0Qc(00@0I\0SdX D(0XS 000<㺻$2S餠"C""DĠ"Ԡ"ܠ"D"0@- @,PU @0T00\0#(# 0$ 0 T0PXP0D -LM `,Pp 0K NĠ@ KKPK000  0T0 p-LMP`!"a,@  \40T0p 0 0 00 T0}.? p -PL0 aR@,p `  40,0 0T0L(00T0"40 ( 40(S"4S|d40 ( 40(S"4S|d 0|d p-LMD@`P} PP U @ppd( 0 PR d -LM#P@ `删\0@T 0SD S8 @T(vtr0 "`g"!V! Q-LP8 `Pp@aFQ00`V00S00@0@T 0S S @T`颌P00꜌P0|P 02$04 4+`g$"r p-LM@0s |`|P#40!cS!0S0spp0 0S S000petdԈd -LM♺ 嗆0 @000C 0 0\ 00#!0 00 l0C& d 0 "!0@ 0 RǶ "`h@hhe0dh0 -&LMf0弆 ,0 壟0 6 r "4"@ !$"R@pK0`&P͟PPH ,60(&@T G 0K 5@Pn n0: eܥ܅pKⴐKdQ R a YW@ 000EnlP?n@0@0C\ 0  "!<0 00 (5C&  0 "!4  QU$QU0 S*R  0~P l40SQ  Pd R R b @@ 000mPm@0@0C& R 00#!000 3C&  0 "!|3  Q~U 0K8\[*P 0SQ   p rS S@ 0R@0 0D0 dp0S  0CSSp0D 0S 0Sx  P00SR 0S 0SPx x  0S 0SPx x   00  0! < Q08 0000,0S0?0,080S00, 8x"""WEV"̣" -80LSP`p (0S KKT r> 1R0S tPV# q(@2@R0`! 0R 0R: 0S  P 0 0 V08He/e/WEV -LMp( @D@8PfX, `L T(0 "<00 @ C P@jHo@  0S 0S`v  P00SR 0S 0S`Pv v  0S 0S`Pv v 0 01,0 0T0,0 @0(0<00   P@H( @0e?C\ 0R 0e?C@T e/㍈000  @00:000SP (HWEV -LM(`< @PtD8/\") T0S`Q@ 4<0(` 4# S0 S00Y0 4 8嚆0@4000;0000 0 dd0d0ᰧd00 -Lޕ" -Lؕ" 200 R 200 R 200 R 200 R 200 R 200 R000 200 R 200 R 200 R 200 R 200 R 200 R 2 R -XALM 0T!  0T! 0T! 0T! 0T h0T  0T 0T (0T 0T 0T 0T h0T  0Td-4 0,^0^ 0%f "$"0#! -LM܁ Q 40#QY Z  030Y P$0P00 0 0(p,` p0@` $40 0@ 0 0@ 0 $4P (p,`@  Q 40!QY 0SYQHPD@000! T0 Tfhdh p-RLM@P9  `!0\0\00S\r pQ< 0S  pT0S 0Sr00V0S` f8" -@LQ`< MPPH T00T0SV|1!qP((T`0HM.$04 V000M.TP8 0,048@岁0@!! 00 PP@0  "!鄠 $04 V00T 0V Pꠠ@ᝠ 唓0dP"fdagt" p-LM80@S  S R 1Q`00#! R0000 0 0!!w^M0S0p]f" -TLM@ 0Q@0 Zr 0 @ 0ff@0 0h -0Lp 0AS`0t 1QU 0P,`V @0 PVU0f" p-LMP`@U*T @T`p U*$$8#8&@p鰧d0P@f -LM @۔ 0 0V!`f@f 0\ J@f`f -LM0@040 T004 $ p-LM0`@040P T0P40 Tp 0-PL @ U   0h 0-L@P        H0 p-LM`@``P }Hvp00 0-LM@040x 00PU   0g c KL H DD( @ (K0  $@ P z0""V! E"l   -LM`xsP@Qsp 0p 0$  0Q< $P< <800S@P 40PP<00S<0   Xx @ <4<8  4l h0@K4 @P 0 , /zP $000S$ 0040$0$40D@(00(0 噑4(" sr-LP`p  0 $@T uv u 80U 0@Tv D0VW W{P i eP"|"" p-rqLMP`  0 $ R uv0@ u 80U T pv D0VT404040@z6뼥" -QLM@8 0C?. B"0 " " - 0L0\ s0 00 0-$@0 TLP,00  LP0@T0 0-$@LTP  L0@T0 0-$@0 TLP,00   L0@T0 0-$@LTP  L0@T0 p-LMT`@0  001P0Y$888$0T 8p8$ 40  X0  ph p-LMX0P@`6 V @ $8T@40 Ĭ}TppX0 p0l@X0 q0q0t X00X0d `k\08<C3$0 T8$8 T<8$" p-LM(0` Pp0@000XT08X$4T L@0@0C& R 00#!l000 X0C& P 0 "!0, 0 R ph@h`hhh0 p-LMTP 4& 0` p8 $48@T0$ 4@@h R0h0 d00Sd0d@.ppp p-LMX0@![Y$80T 8`$8T0 4P ` cVH0S X0  p8$;T8 X0lXp -LP 0-TP 00@RL $<000, 0, P00Q0S p-LMT0P, `@ @@0十K0TT0PK@PPTUp@ P000P0P0C\ 0  "!l0 00 X0C& P 0 "!0, 0 R ph@h`hhh0 0-X0L @TP| \0 p d Y M C`0   3 %   \00H  00h1H 0h00 0'H 0h000 `0H 0h0+0 `0H 0h0+0 `0H( 0H0& \0H0& \0H0# \0H0# \0H0"{HT囀Q- -LMX0@loT  (RL#R!&R$0RA0R#& -LMTp@ 0`00,@8T0 $4T0P8 $4P,0 0,0T0$84 00 0,   00300 0 000008T0 $4T0@8$ 4@ 000 006 000@006  000 @5 3S ?  p-LM` P@ ֏(0H0 l08 h L0P TP 0 X0h  $8T4 00 \0pph$"D" -(0`LP g 0FS @  H0"S  H0"Sp0$ 8T0 $4T0@8$ 40@d0h 0Sd0d@p H0"S 8T0 $408$;T 80$ 8T0 $4V>8$0T 8 -LMTp@ 0`00,@8T0 $4T0P8 $4P,0 0,0T0$84 00 0,   00300 0 00000$8T0 4# 8T0 $4T0@8$ 4@ 000 006 @006  0000008$T0 4@ 0-@L8T0$ 48T0P $4$0 S8T0 80 @5 3S ? Q` p-LM` P@ xx垎(0H0 d08 ` L0P TP 0X0 $8T4 00 \0pphx\"D"!" 0-(0PL@ 7 0ES "8"!" H0"S 00 H0"Sqp H0"S 8T0 $408$;T 80$ 0 -LMTp@ 0`00,@8T0 $4T0P8 $4P,0 0,0T0$84 00 0,   00300 0 000008T0 $48@T0$ 4@@@DT$$t#t#t#0$t#t#t#t#t#t#t#<$t#t#t#H$t#t#t#T$000000000006006 -LM@8$T 08 0?.C53 SB" R 2 BR p-LM` @?>C22SP !S 噍(0H0 t08 p L0P TP 0X0T0$8 40 \ppht3S|"""D"%&̦" 0-(0PL@ 7 0ES @&`& && H0"S 00 H0"Sgp H0"S 8T0 $408$;T 80$ z0 -LMTp@ 0`00,@8T0 $4T0P8 $4P,0 0,0T0$84 00 0,   00300 000 000008$T0 4  00000000000006 -LM @ L53| |S?  0 1yP   @H 00Q0S ? 0 0\\ 0c!Z p-LM L53$`  S R@P ? L5 3S& 噌(0H0 08 L0P TP X (0S ph里0X0\T0$8 40 \pphk?> S P L50 3S?> S, (cZ""4*l("T"t"D" p-LM(0@P0"  H0"S 0ES****0$p{` pGpp+딧" -LM@k8$T 1<8 -LMP`@ L%?> p #C2(0H0 08 L0P T@ 00X0>T0 $840  \ \0 `0  h0hڋ$8T04`ħ""\,l" p-LM(0P@ 9 0ES ,-,d- H0"S p47p H0"S`p H0"S 8T0 $408$;T 80$ p 0-0LP@wP 0 0q 0Q 0P00 -LTMh 0d X`hh ` h0l 0p0 Xt 2t Z X1 R10  p 1P P Pt Z Yx 0  p 1P P P x0Y@< h X 0pX0 0P0 l0h `0 \ `LA$M<9pᰀP 0Q0P Z Lq|0 2  0 ,  $}P  <P@  -p 0 (0 lBP@ ,K0K 0P@ @@SP ҄!0,0+0!= 0 @  @ 1@ A0 @  @ 0  1 @  0 151wP@6&P1T! $@080 m ]P@1 ? 04K PP X|q 04$ @P64@ (P T((X0 $1!_0000 T 0  1?L P 1@ E;Pt @ _o8KB0 $0 ?0T1w00  T1 =0#0Z00S080 `0Z T480@ 1;1 0 8 0  04  4 $3 $!3    P'0 $|30 $Q?!0 $PP0 T0 $= $0@ $@DO?0 T0 $p2!X`_1071a 0 @  101  0LRDT ?=0 $P@@0 T [0TP0 T x0TH!0 T0 $ !0 $0 $08  $g0 $!0 Xh܂@"XXׂ#V X,#@.,!">?BCEAH#l#ty!V!##!\8#\Q( "(R0SS S SSHQHQPQPQPQPQPQPQPQPQPQPQPQPQPQPQ p-LMl2AP@ @ 5 D` \4TPp0$  -PL p`:1V4141l2@ 1@W @ @X@@VHHl"Z@@0@ 0 $X000V000 Tl" 0 T -LMPpP`M  0pPB ` 0T@ 0T 0T  0p}|0 $l p 0T@ 0T 0]\P@ 1 ,` 0T@ 0T 0TZ 1V! W00YX @嗁  0*@ 0@"!P?P17ü10 $`0 $ 0 $ ###0#!# -0L` $@l2 0pb XR$0@c $@D (4C@= 71+%l2 0X0 $ q/0 T 0TX\XPXDX8X,X #0#h##### # -!Lp0 T@x!0 T1   h8!0 TQ/0 T10 $``0 T@-0 TO?@H$80 TP$L0 T0 T@( 0 T1BCEA-A > 4 %lž01!05S<T2-A > 4 %lž01!05S<T2 -LM@P1 71A>,T"%0(1! -LM@P0 0 -LM@P0 0 -LM@P0 0-A > < lž0!10% S<!T2181 -LM@P0 0 -LM@P0 0-A>80 lž !10S101$ Ɍ@ 01! -LM@lB 0 SA>Q 01! !)<T2!P010l"0 1 011b1`-l" 0S,BA>T"  01!v-l" 0S+B@A>T"  01! -LM@P1 71 - L!d# -LMl"@0S SB  A > # -LMl"@0SB  S 0~A > 1 01 SC # -LMl"@00CS L` `T`\`B > 1 01~A C D # Y -LM0 `8 0@P  2  S S  ,Z  SO $K 0K P (0K 0$ 0P $~0( 004 0802:09P6 0,K P,$p@0, (P@ j~T te~pc~d_~ 40S , *0 P|##$v#ty!V!",# -LM0`4pP 0T 0X0B/0"@00 0 900000000 H@ 42:q0:)@@墀0!10 P00Sb 10 0 0 0 ,0 0& 90 02 E0 0? R0 0K ^0 0X k0 0d A? P 9 `03 A-Q$ 㣀 HT 9  00S ZB  I0TI `0T P0TP0 0 0# (0 02 <0 0F U0 0    -L P  0 0 D0) 0! L4[S 08#8T X0 (K4[\ S% T (KX X  Ƞ,Ƞ 0\ @T X X gU L# -4p0`PL 㶪( H L 00R  () A05R )9   !P909?@H$H0 X9A?AS  Z Z909) )  )MH$H 0@X p-LM4`0P@&0S pQ 7\ \0 lD0 Q08 K b Y b 0- PL@$%P  0(0 PP  -LM4p0 àa)0 0P0!0!0PS|a= 00 (0C"(0y (0"(r00@ P0(U"h 0b (0"([ (0"(T00@ P0(U"h@@ 0B 0E("(0: (0"(3 @08RP#h@@A@C@@ -LM@rh -4`0pL@H 00I X 050Z 0000O 000P 0d 0 0@ 06 0K 0h 0L 0IP 0 0P8U#H 0-L@P (w0 T y| u 0T 0T :X=0hB`sb -0 L$0@8 @S(@0 0@R8 P00S00 p-LM@P `$U*00 U00 Tp 0-0@LP T (0 0- @LP$00 0 T0 $  (0bs -0L $ p-LM@` P( 0P  (0#4 04 X ( p p-LMP` x $@ n@p -L@P`p[\ 0@@l -LM@ ` G $ pP U \ 0P T $P  &0 T    0T $ P -LMP`#pP@ 6 D6 A0 X0SdpCT@06 G 0- PL@( 0$  p-LMHP` $H0 X ph p-X0LMH$HP0` X ( < 0p -(LH"H  P`p  80<40 h 0-8@L#8P X ( 0 p-(LM"(H`0P $HX0 Xp p-LM8P#8` X (@ (H$HHp p-(LM"(@P0 `X8#8 %XX0 Xp -(L"(@ȠP0 ,x`XT 0X@T -(L"(@P`0 pXT0 X@T -(L"(@P`0 pXT (@T -(L"(P`@0 pXUڰ0 X10 XPU@ -`(VLp"HP 08 #X(U h"H - L@` pP 0X 0X \0 X (X%X W0 @ @@|U -0`4pLP@ (0"(@T0R 020U H aP008 @0< D  F   0X (P $P -LMPH$HXph 0` 0 ` 0?%X@d@D@`0 58#82 r04 m -LM(0K@KP 2[S   -L@p`P0 T  $P0P S (-L@p"hP0 X  ( V0P S  p-LM@P` @  (@H$Hp -`8 L#x@P08#8S0   @     -8LM`p#P @  0@8T#@@0-0  P`CR@    0@8T# -8LMp`#X@ 0P@ T -8Lp M, #@`P0  Ƞ ,hp0 SPpU@,0@@ 000 0-0P40 0P 400PC U, ` 0S V,@pP  /0 SPpU@400PU,0@  0 S40PpU@0  Ƞ ,h$0 SPp U@ -L M0@4P $ `( x 00 ,0 *, 9B0) 0 0  (` 0T 0T :X0 X ( x (08] #v`0] 0 0 0] 0 X 0 Tx ,08  P P ߐ -L4M4`00Z T0 e  X )Zp Z 0g ;1#X D0K40[ ("(0 H &@0[2 [0L0 30P0 $ HpW@ P* P +!"H (U0"( 0H pW:H00Z p $0P_ RU:L 00gQ00A0D0S 40[@@0 S<,00 [8[0Q,0  DKT 70[S% HS `0TH  0T :X 0X0 T20[080K7@K @ ^r ; 080K@ [)tL  0 RK jP0@00K |000  $!0 70K8 K`\### -L$M4p0`@ w08M #X< ( 4 40"(0@0 /@@ ("((B/8 010 A  U< @ ! U  U Uh  U7 U 40" ("()0@P 80S@ 0<K 0 0K 0(T00U80EP P000K 00[S @忐 ("( 0@ 0 /0[S.0[S0  00 < 80y8 <00倐 P5@04(@ 0"(("(B?  h1  (0"(4@H$H 00 0 K u00K 08 P0 0f 00C 20@  8 < 04S 80< 8<0zSx 8080 00n   p-LM`P@T 6 0 SP Rp 0-LP@@T0 -HLM($H"(P`p, ("(3K"0[![ (0"((K"0[ (0"(![<@K"0[! [H$H0  0 80 -(LM"(P`p0 X (0K A[(H@ (K0[ [0  (K0[ [0  ( (K0[ [ 0  (K0[ [0  0- @PL:X 0X0 0- @LP(0 08#8 X0 0- @LP(086#8 X00 @- L0 ( 00P0S0P 0 ( P 0 8-#x@L@`P1 V 0FS 0F`` (!0 X (0!0 Xp  V `F(  0F0!0 X  -L@P`j 0 8#h] p0]  <X` ( < X0V8#h0] h 4B0>3 -0L (P0 P00 p-(8BLMS@P"(R B`` (008#80 X pp p-LMP`  $@ @p p-LM@P` @0 T p -LM400pK@P .`  04 @0 [PR @0  0K@@4  ("( 0#.[Q R.0[S/0[S@ 0 -@K/0[S,[8 P0",0K8 0-[0\:1  0\ -K8 80Sp< J^: 80S @ -[bBϠ 0-[0, [ 0p<0   00 @p0 BϠ 0 0 -[ 0  yp<0  b忀0p 0 0 0 <0 ῀Qu -[]pW  ,[ p< 0 p0  < 0 <0  4@0@,[   -0L M '0K& K( K%K$K@0`4p<`P P U(0K@2(0K$@K  -P@ 0L`p@ 0h? 0-L@P 0 @R2"0 -X0P0 R00224 LS0S"$P    -LM0@P`$004PP (pR  PU 2UU 0E8#B? $0| 2 x  P 0 RPi  P :^^ C^%^ ^^ Z^U^[0 00  , 9S  (^^! 0 000 00a 0  pP  P*0   W9S  (^^ 0  ;;S0 a0 P  P0   0#000 0   l0^ 0 00:L 00C 20 0`00Im m  #0# -L M40p0 P`X 0 E@ 0 00S ,0 ZʐŅ(0JÁ@Y,0X  80 00    -L,M (`4 8 04< V@ Q 00 00C8#XH 0 0. K8 8- K ;1Q#xH 8 L L0EU8(0K8Q #XD +K,K+ K, K  @@;1("(#x 00K/@KHH 1D("(0 oH 0L8#8QH0 8 4@ <  .0[Q0E"(+PK,PKD .0K+K,KP -LMp0P@`04 0 % ;1#h 0@$ 0 0$0 @@ 0  0!0t 4 0    2@ 00C 20 0p@00  p-(LM"(@P0 `X 04 X 04 X0 X0 X0 X0 X1 X1 X 04 X1 X1 X 04 X 04 X2 Xp$ @0C1a!cP0$IQ0 00 0S`Q0S*0BQ -P[Q(L"(`p%X@ ~@@$@P@@T -p@T`LP: 0P@ T: p-LM6 `PU@ p6 0f6 G0dQT@p 0-6 L@P56 000hF p-LM6 `P#@p6 056 0d T@ -LM0pS` ;QX%(@dV` p-LM6 `P@p6 06 0 d T@ -0`4pL⛠囀@Pe0S ᛠ 0S t -L4MH 0P04L0 vP 0DKS@:;1("h  #xH\  0 0 @R*PalA0ST0 00@    ("(0  L0P>T -L,MH 0@04L0 &P 0DpKS`*P(;1#X0 ,A0S 0 `R*00d  H@\  , 0  7L0 -0L\M91 0`4p ᛀP, 0P0 1 ,0S ,aM P@  0@ | K0OS|K4@|K  0]Ka^KX@ zKxK`K0 @0 0 |KP00  000㛀| KGP`B?  a A0 g\# -LM00p40`@c!@P2`f0,0 B@ 0 PA0@U0 X (,0P0,0 ,0P0,0 뜠因, -LMH$H40 00} -0LM<`@Pp000, S04@P00S 0 00000 0$0S 0 R 0 J 0 S ,  0 00 0S , o&P 0 0 0 -LM@0S< 00S  0P l#|# -LM`@ 02Pp 0UV B0UU00000U/ U B? 40 A0o LP U DP >PB/000 4PB/000  )P U | !PB/000X P000 4P, 000####x""## \@-@ 0R\ 0 00@h`h @-@00C& R 00#!l000 X0C& P 0 "!0, 0 R@ڀ@hhh02`0 Mb 0- @LP0 00"2%d0C"2# P0P0C& R 00#!p000 \0C& T 0 "!00 0 R00h錀`h@hhh0 2 00BaH$gfff -R夢@ 0L00p_뀂@0@0C\` 0  "!H0 00 42C& , 0 "!0"0 RuVq  ! 000 00!C \! 0  "!0 00 l1C& d 0 "!0@!0 R?@$0_1@@@ @ $Y Y0,  @0@ 00 2": 8@"2<p"\8<t"2\rP`g303@h`hlghh0`jg -LM1bPV 2<20S S S S 2S 2@ U 0 0peNW @;3p 0 eNW @2Dc  |31S8"̌X$ʌ" 0i 83i 㵂 0848<"\0pW@ 㣂 0848<"\0pW@0pRB ㌂ 8  0<"\0pW0<"p0W,B t 8  0<"\0pW80<p",00#q8<"0\8@" 0<\2q72 0280<p",00#q8!80"<<\ .8" 0<\2q72 028<"0\8@0<"\2@ 8@ 0<" 0\28@0<" 0\8"08<"0\ \ -LM"@82 :';P:" 0 S12"< 3S 2<22  P0 2"2SRh -LM2@ h `  0Dg282 0( 18g2802##4b -Lp 1R@U 1!0S] ,"`V5 V$ V V  WT122S72x0S<80<","p"0S 80<",0 P` M P"0S A2P >P"r ,0,2"  p-LM2@0P U U U U00UQ U02ph2S S 2gUa 2S(1 R R2S pph x0S080<", pph@Q 30S3$ " 0$"2"1"R ("00R x0S0"/02"(2 02: @0":2 02p1b2S񟗎TPP,,1"02~3  bvg0 2"c2SQ:”;\:0 0 10   SÄ"Ä2B2 0}. 02"2"R)2S$P0 g:"c phP) P3:PX b -LM2@ 2S h8<2t"\3 L 80<"<\ 8 0<"\2" 1 )@-Q pO=^o"0? Bp00? ? Rp00  2:02\\ p ?> hh0 #? b \ 0@ 4<<0A> 耖 A0  -LM@u0227Q2+22<<€"2c -LM@27;2U02 -LM@K2<2A-? =΀2#嶀 TP€P`8 $ "OTp BScᰄrUe% =2: 02 ဖ2 Ɍ0 2 €ꀖ p-QLMP@ Qo 2Sk Q 80<",8`<"0\ ? Rph02Q3 U2 02U"      K?2ph2S K?Q20022 020K/2": @0":pU2S  K?P"2002 " p2*<0+8*2<p"\40R22SP002ph -QL `Pp  @ }H@8Q@P T P R6!R'W RW !R00\@ 0 (S00q0N@0 8Rpp\0A@0 8Rp,05 @0 8Rpd 4e p-LM`P@ 0PP@TU L0P00P0S P:p p P:UPEp 0  0  0  0;0 02202 -LM2@`Sj0<2 4292x!9" 2" P 2Si 0 0Ec:"A0 :0"2 p2 4"2 '30P  <  d 02" ~ P2S stP242 # 0-2@SR2R;U UL2 1“ R7 R00R0S6 q72 020E Shhh2< 52 82<p"\02` 5<2 25<7< 27<5R8<"\ꀖ p-LM\!\08@ P`0P<"\8<"0\80<p",80<p"7\80<p",80<p"5\|80<",@002 5"0`0  0a7 0,0@ B 0p@B@ -LM!0 P8@0P<"\8<"0\80<p",80<p"7\80<p",80<p"5\V|80<",00S0 00S0020 " 0p`t0E@ `ˆ0a7 `"0 Q 2^2"# 2^ 2^6  t2^ ^ 05001 T2 L2 R8 5 822 ^$2  131B  2 1R1  g 1!Q* !00S !00S !00S!2001 h1"5t1,"h1 "414,H1D1-08!^# ,1^ 1^ 1^2< 1^ ^2< 520 4#l02  P0Tx \0 #,0 0L#T\e ]^a V  Uo! W|JR0d Dd " -] P`Lt N 3SE S #L1R @ L8132  $$mL1! 1 !@1!0t TDL0B e 02ST00 A00T 000000 03x0- 4 C00H  U02 1  X#e `#|e l#x##TDd Xd S 0-] P@ L?N #0BS00S S \&p0R 02  T )L2:20< !L003R2<2#|# $##e 0-M @PL N 3SXp|( K0#R|0 300h K`0L03D K@0 4K#0R 0##e he #0d ld #Te -` L  M 30CSw3rSs 1!@8P@@<"1\8<"0\dXv80<"\0_3 0@@@@0@lEv2@DTD0 S 202;00:0;02SR0<02S0 R0002S0SR0<02S0 R0002S0 R000 @ H@@s0 S 0 h[#e '# -L Me P0 U@ *Q 0R PU@: U  Kʟ0 00 040`\&`$& 0S S 3d*S8 2 0  D: 00,0 ZO*0S` ִ000C0 ? 40 R;  ɟ0 ?RP 0 S P1SQ# 1 r00 Q p9S1 d90   q09)0000030000p,Z4`: h/BB!1317!b00 P  0h\0C0`(0h\0C008@<<" `\0U*XH %u 8  0<"\0PU: 8P  U*G u 8  0"<\ PU:0S0S^ 00Pt PUO 0 S 202 0$ 0 40 0$ 0 40"R0 r0<02S0 r0002S0Sr0<02S0 r0002S0 r000 @ H@@G0 SE 8<"\ş0 ?RP 0 S P1SQ* 0!0r0@  0400 $ 0 `40 048 0 0480 0ASx(5 r00 5r0  2:02004r4 r0 000 P 0h \0C`00h\0C00 0eNU` @U:,$P0 0eNU @8:0S0S+ 00Pt PU 0 S 202 0$ 0 40 0$ 0 40 0$!2S 0 S 8<"\ s 084"<8\ PU@: s 0848<"\0PU@:|ŸP0S 0 S P1S\L !00r 04800 $(  q090000 '0  000 0x0S<2:02Z, *dA儑0 S?P 0 S P1S1S@ @ !r 0400 $ 0 40pQ,`Z:0CS$DX r@ᶐ 0 r0 0p0 r0r@ᶐb c  \'?= = -L Mx5 Cp5 T , 5 TT5T5e3 ~ jC454ş , 0 4 P28 0S 3S2$<2#2 f   yDPP= P 0 PR4U4 .\64S* o  H2:2XtP0S o@ QDP@ P1S2:23 ,0S ,9  0SSPUUH g (DP3#3#@Px3x#`pp3p#04K  4K3K2@K1PK0`K/pK.K-0K DPo  3H 3P @ @P @@P? @ @2P2 @ @P 0 SJ2AT 2 ; S  R@ZT 2  # 3RT2 R2#; 2#  bI3 R  G 0 a002  2#;#2[e  G PP P 3S$13h1 R2<23S(=P 0 RPUU1 R1 R 2<28<|"0\|`P@80<|",P0T@ 0PU0e 3 gld Te e \e #f kjihgfedbdon'0d -LMpPL`@2 S@0%P UW "R 0jF iFd0F202iq2"92 0SF" pLFdb -LM@2P;2 1"R T0!P  Q202|20428db 2S00"002 db -LM2PF0 $"`2R <1… 0ڜ2M @002\B rW` pa2@:  M@ @  rW` p100X0 ʆ? 1 ? X ژ2@:<: bBP2@020W0  0`0p A!1`01" ? 0 ? 2A!"101 )B0S2@002@!!0 W!`ph"0]$ p-L M3"0PSl8<X"0\ PpV 2*<7;2X2+*<1 KDO8P00<h"\ KO8P0 0<d"\8@<X"1\0 00$#Q 0 S33 30C 3]υ3 S 00* 0P:υ3 S 00 * 0 #;;0 0P:0Q 0 S0343 830C83)V2  " %2 2?02p80<",80<"\3Vh"@hH k 0-:LPI @D @0:  4 2"2@ 2"2"! 2+<*28<t"2\8@2<p"\2!0S 00h2"0,2"2@ @2200"2@0:0h -hL$M P@ D D0 S` @ H  83Su V 60 S 0S0   `V`V 0S0  0X 0 S0343 830C83Z@ 03JS0 0S0343 830C83Z@"!888C A @ @\0%0\00 R303|3@0|30PE t3x3004E4Et3x3T 2 @ `X00X0 V``H0X0S1X2D 7* <`K  00>0 @-NP<!  0 0S 00 0@43S8300T483SJژ272F4@ 000J@0@0C\` 0!!3 0#C6000 "!|#00 RV}  L3! 00000<0!C \! 0!!2 0"C6000 "!"00 Rc$00 0t  1 @ 0p00KJD"$@0@0C\ 0!! 2  0!C6000 "!!00 R'$ R 1 + 00 1, ( <`8`1@ H0S0 0 B 0@ @8K<`jj}jb= 0 @gS262 0` 08K CP T +2<JH  +0X 0S034C@830C83@@# #0#@h@h`hlghh0`jgmg8# -oP PL&0S"0#+  J 2@!12122!#  0S00000" :;: PP 2 Zڪ/0000 002"8@0,2"<l"<\8<t"2\8@<p"2\CpT 0S3 30CP 3G[ 8  0 00\30\3 X30X3 `30`300Sd30d3h30h3 l30l3x01 S H3 0H3 L30L3T30T30P30P3p 3  z+@ -L0M@pPPK (@  @ 0XX@VRT`  0 S @T`DR (0S (3;R T h2 ) 2P!" )R,&R g$f P#b 6#8!V!l#85!## p-LM@`80<l",2P 008<l"0\ 2"0 R 3 0S  Y7”  2 0 9 S# )92"202 8<p"2\”10 S 2 huK2622 )62"80x"<,8p##8 h1p#0S 2” 382<p"2\38032<p"0\80<l",  8<<l"\2320%0;062 2"; 2"2 pHph 0 ( 1 NQ(@ b # 0-0LMP@0  PK CT0 -LM K00! -cLM@ 000G@0@0C\P 0  "!0 00 2C&  0 "!0x"0 RU 01 000080!C \! 0  "!0 00 1C&  0 "!0!0 R]pp $00R0pp1 p>@ 0h003G$@0@0C\ 0  "!0 00 0C&  0 "!0 0 R!$ R 1 0+10 ,p(p`h@h2i 1i i i hh0!i i 5i 6i( 0-PL:@ 2!0S X1S PAT PX1S,0<10P -NX1S#<# -LM:@ X1S PAT P0 S  h N\# 0-LMP 2* B2Q*262O 1 A 0! 0 0 MP0  0h~2"702" Y02 0/0 A 2 @M2#b # -1MLh`41!01 @004  ,8 0” sP ?P  U= P 0. PM3d L`0<222>]i,m7"h"  l#b #0#!#`G-1M`P 00@p0ppbp |r匢 p匠phr p2b0  P`@  刢2\"`RdlbpBt€xrXЍ -L @M 0 8 0454 0$0H #8#8SQ00Q0S QQ -L8X"0<0\ hAg -L8MPpU` L 0   0   0@@ 8%#8S $P@ P@ PM P X@3@#TX@XTL0(" L 00K ( K0,0K0D([S4,[2902"XT2$02T202TT202TT C T 2  262  <hp @?@ 4K8K 0P@ @@ P0A(d2d-d5d -LM8 P8h0@ lh0@lD h0lH , h0lT @ @$41 0@00 4 @98o48 < p,@!8,27, 2<O^< p4Qhl 0@ h@l 0D hl,0H h@l00T 8ox4!| 0T0`L "2 QQ 2Q 2Q 2Q 2Q |2Q t2Q l2Q L"=A 0CQSg82Qd 02Qa (2Q^ 2Q[ 1RC 800 ( &  1 ,!`, 4< 04 < R <ap @9g<  0R0` L` @9 R 000 0R0玁0 0 0'0  R0000 0S0:0 0 S:'0 00'Α0 0 00 n$!$J$K$$$$$$8d -  808 0 0 0 5d2d-d(dE-08 P` @TP0 p0P:P 00^0:0SS00Q  00QQ0 0Q(d2d-d5d 0@-P@ 000 000 005d2d-d(d -LM4 `)>P@4;t0 S0 1!00d 0 405 1Q^ _1QZ 0601h`0 080< l@ 8 8 80pWP ] g0Pᨀ 80pO^WPhl80@ 8  0h%:@4lŕ\ ,0K4 @0K@Xw\8 8 lŕ4\ 00,0Q0@%#TCAttx[@&#p<it -L MP`0h0l00 0H 40 h0lP 0h@0c,Ÿ2l@ , < p,@ pWOYhl0H h@l 0P  x!| 0T0g! 00 4 2 00, 8  R00ą 0g a 12  07\00L000Ũ0 ` 12 # 0# 04h0 PQ 0 0Rg0 0e?00g0h h h t\&# -LM)0`40 P  0 h0@ h0P 2%XU 2U 2Uu *?060 0t0 S0  60+SL2 d000 008"040` <58480pWP4 P㨀80pO^WPh0@ l g0280 h%>40  Gl5S `A,0K0K 4 @l5S P l5S l5S  40G80hl 0@ 0S>00U0?S>0{>0w0Sp0U d0Ui\>0hP0U H0U_t0@%#TCb@&#p<&#&#&#I1G1&#w11 -LM`)!P3 X兀l> g>t0S 00 A>000d 00400 6 <80`05pP O\p  (0K80O^WP(@,K@d@%#V!TCJp< -LMP@h0H lh0lP 0\"0c2#ppo2  ,2  2Q2 R020ĕ!0SQ00ė`, `VYhl0H h@l0P  x!| 0T0f# 00 ? = 00 6 b"f, Q0|  Q  Q  00| 06\00L000Ř0 ` 12 # 0#d0 ,0 s|00Q fjn>dEdPdXdSdKd -LMhpQ0 @2g1lP `*0 S(0#4 0 P @ p!p1W0`4p@0P!QWL5Ť4Fڤ4S$(> W 7 04 0 4S@,0K0K @S4S 0iP W @ PP  < 4P  0$4< h$#t$#I$#g@&# -h0`LlP h0T l 8 pW P@4S PONU@UU wP8 8 p -`L)P`p@<0 <00 t@8:80T +80@T4&# -LM*0pS(0`#4@ 0P @ <7t0 S0 !00 !Qc [1Q0 1d00<01 `04 8580PU@ 4SONP@80Uh@lPp <<p <T0 00 T0h@lPp 04p hPl@x 04x 6 D0Q40 00 0 00@%#HFTC|koI -LM8 ]8 0 4 ,4可^4 0Q8o80x 0!| 0T200,0  a002Q 0S0@0 20,0 04  00 8h`0lpS4^VPTP@  !,22 4Q[PXP8 h0@lAs@ 80lPh`Q@ @0sPAp40  0P Q55 @0080l@h0As@  @RA80@*R40ȁ60S4040lAhP`s@0p< 0 @A 44< mh0x l8 @P00@  cdhd]d -0LSP p`h0lhPl`@P @00P hh0lT hPl`@T $L4<T -LMpP:x:t0 S0  `1 00X16 d00<0H1hPl@ 4 5`08 00 h@lP 00 hPl` @ $H@8@8 80PU@ 4SONP@80U&#V!TCs -L$M8 4 802a410* <0 (0R8#4 @ 0p!@0  h1<\0 4j<PE 8 20D0 D0hP @lp `@A 44  Z8@ 0 @0<S0$0@:,0K40K<@ @?<4S4<8 @0m$,:h$#t$#m %# %#%#$%#p<&#&# -LM8  < 0 l0h@0 H8@ !  , 80,4 *40叟0S40 8@@A@@ ,00 @0 R8op8<0 x0!| 0T40,0 , j 0080 S"` BX@ 0 SP4 84 @,A08@T@D0 @,0 0010"00"`P @ R0!@2@ 04 00 0@  88@ @  00P0 @007 8 4@0!A,0`@08X@Dp0@ ,0 @TXPh&PA04@ @ &l04 @0 4 0.0 '80@4 0`A, @08\@Dp0@ ,0 @TXPh&PA04@ @ &l04 @m m m m -LM`qPD8 n0t S:ӈ0Մ000R0400 A>000d 0 506 0 `0080< * (0R#48"80pWP \  (0K80pO^WPH@,K@ĕ\ 0 `@%#TCyp< p-LM@`P0 , \S  hRl  0ph x!| 0T <``< -L M`P)pPS Q0 Q0 8@0r 8P@c t0 S10 !000㘁d @40 0`<58 @h(PC L1L! @70 470$ K(0K 0 0 0 <4SKqP 4S 0J,hl 0x7 (K$0KuT7L7t@@7t@('#@%#TCD}h$#%# %#H'#T'#p<`'#p'#'#4&# -LMp P `,@0'`VOh0lL 01ppwpP  Q10m Y x!| 0 T 0w 0Wp 8000 P0S RQ0mkdpd0@-p0"R 0\P0X@00"R  ^0S0( 0R%9fİd$0(#00"(R0 Q(0S009 -LLMl0hpH  80l0  )PP 0 h0@ h<  0`K80 P@  00S00 6  06x6 zt0 S0  L4P00D$D4d 00 040< 85PԂԂ43hPl``0P @$H@P @88P 8 80X` P80OnX`Xl ? X: 0  4S Cd0KhK  @4S  0P Xl l0 0l l0 h@lPH l 88H 4S `l0$0162hPl``0H @H $D@<@4H 1h`lP`0P @P @00P hPl`P @$HP @ZhPl`T @T $L4@<T 0 Q0  0 h0@ h0<  8 `KP000 060L5U0 60Ŕ Ŕ@6@f#@%#TC p<@&#U((# -L Mp` ,P, h0lT A 100p0@000 0Z_Yo0 x!| 0 T % 0S000 PR0C 000 ,00,0 hl0 ,00!,0000@h0@Q@ l@A0  H0!80,000,0 0 R0 0Ņh h i -LMpPy `,@0YO` h!l@ 0Zo x!| 0 T0 -0S000 PR0C 000S0 0\ DDDxx1 0 40 00hH l 02 0S00ą0LS D`0   D4<0  , 0 h h 4(#h h h -LMp3P44 0t0 S20 "h@lP00d T 00T hPl`@ @@ $D@@<4@ x!h040` <85 l D῀8h0l@ l`h@PP@ @PP00@ 80`VP \ 080`O^VPpĕ\  (0K L@,K@,ĕ \ 0|@%#  -LMD0 4 , ,0C, 叏 R, 40S00^hPl`@ @$D0@ @L<4@  m x0!| $ x0!|0 T x!| 0T00 7010!08 @,hP@Al`D@@  822 , @hP@AlpE@` @A844 ~0 RC0S0 ,0,4  0.4 |dddd p-LMx0`|!$ x0!|P $x 0PP|!0Tp -LMh0pl@ 8  Y P `@4ZS PON U@`  x0|$ H8m0S$ 822P(#d(# -LM`)PH2 t0 S0 (!(1d $!000840<56` 08R:0004>80pWP \ 080pO^WPĕ\  (0K T@,K@ĕ \ 0 `@%#TCp< -LM0 h0lD 4 ,`0Xo,Q o00x,!| 0T00h0@80 A@ lh0D@ l 00)  &  0, 0 , P0@00840hP!@ A1@ lhD@l 000   00P, 0 , i |i i -LM4 p< P14t0 S0  <0S000 < 0R000<0S006000#;00d #h`lP040` <85P @P $L@@4<P hPl`P @P @@00P h`lP@ @@ $L@4<@ hPl`L @L $D<@4L h0l 8 8 h)l08  h0l 80  <0SM80`VYP FP㨀80`O^VPJ 0S h%4.1 04 l5S < 1RA0K@4,0K @Fl5S4 0\Pl5S '80h 4l 80 hPl`H @H $L4@<H @%#TC@&#p<l -LMT 8 h0l0 ,2"0 40 , ,P,可P, 8T h00l4 R ob80 x4!| 0T@,`01 0.00 0000 d 00 0 H 00@,0 10! P0 4,  04 ,80AhPlZ@pt1 `@A 44 8H hPl`@H $L@4<H @ \000 QS0L00 0S0@@000 8H h0l0 PO 20 S2Ʌ0SɇGjud{dn -h0`lt L8 XP @4pS PONU@5 j0S  8 /d(# -LMpP *08 S(0#4 0偠 R R R R R / n/t0 S0 #3d #000` <04508  SR6 R R t/04 8080PU"@PS ` h0l4P 0 12#  P}80PONU@ Rm R' R% R# R! 0BS8RQhPl`X @$L@TX !@ @4<X hPl`P @P $D@<4P h`lPT @T $D@<4T hPl`X @X $H8@8X 80@S4 ,0K  , K00Kll5S 0 0 ]h&h0K h%.`8 0BSR:80S0 6040ꅠ80AS@%#V!TCx(#@&#  -L MPX h`l@ 8 00CSi$Ȣ0DSW1堑, 00 p,@0pWOXo< x!| 0T h0 !l@ 0  00 0bZ30 0S00ą  0h !l@ 00,  Q 0S0@0 0 T DD0D@@0@84.0000̯dddddddd$d(#@dTd`d -80ZLP `@px0 |$ 0S 80`ONVp@ h0S0 -x|0 Td(# -LM0`$) 9PP 9P 9P 9P 8P 8P 8P h0lP 4  vPZ (8QQ x8Q p8Q h8Q `8Q X8Q P8Q4  4 (8 QQ 8Q 8Q 7Q 7Q 7Q 7Q 40 - ;000 7R 7RR 7R 0tǟ S00:00t0S 00d'A>000d P@4P5@ RR wR R 6R R 6RR 6R 6R R R R R 6R R 6RR 6R6@ L&L6QQ @6Q 86Q| 06Qy (6Qv 6Qs 6Q(&o 0`  <08 5RR` 5R] 8%5QQi 5Qf 5Qc 5Q` 5Q] x5QZ p5QW 5%|5t5  8p〆  W%8 hPA` l80hd@0l 80pW 4RR 4R̄  x80| \x0| $x0| Tx0| $x|0 T80pW P P&80pO^WP0#3QQ 3Q 3Q 3Q x3Q p3Q h3Q hl40P 0#3QQ! 3Q 3Q 2Q 2Q 2Q 2Q 2QQ 2Q0 4 '$A, 0  4S 0"QQy D2Qv <2Qs 42Qp ,2Qm $2Qj 2Qg 2Qd 2Qa 0K0B  ,0K@?4SO !1QQ( 1Q% 1Q" 1Q 1Q 1Q x1Q BP 0d!QQ* T1Q0& 4  '4  0e 0QQ 0Q 0Q 0Q 0Q 0Q 0Q >2//:  0?'@0K:jꠀ0 L0P 6Pr060o000:00&hMhbiMibuuRurv3@%#3M8M0MTCdddd@&#L `P -LM`0 t3RR^ h3R[ p,@PpWOYox!| 0 T +  2 "   0P2 2  <\W  h !l` 0 P2P"008 $2$"008x0| $h0lP @ ;:   20S`1  1 R20SU!0S00Ƈ  20S T1  H1 R20S020ƅ(!0S00Ƈ  20S0 - 0 R) 0Bx|0 T0 G  000S |0  00S 9x !| \00 0B0208M0Mddddddjn -(x@qL` 0| Tx| $0@ , 0P^hx| 0T   T  0S00 -LMx0|` ,8pWP @4!S PONU@;2 d\  0p 8%*(# -8 ZLp `4S OnX` 4S 0 0QQ' 0Q$ 0Q! 0Q 0Q 0Q 0Q x0!| $8 dP8  p)0xA | 0Tx0@| $  hMhbiMibuuRurv3d(# -p02a`LMP5 @ i x0|$x0 1|0 T5%$x044| \ -`pfL  P 0mx0|$x@0 0<| Tx| 0\ -LM`)PQ)L)t0 S0 1!00d 0 405 0!>C0CS̶ԶԶԶ 060H1 < `008!pS00W80P $\ (0K80pO^WP  0 0@d  :9d x@,K@#ĕ\  0 S4S 0S00@%#V!TC0x -L,M, "0 /h0l@ 4 h0lD h0lH 08 h0lT @ @`00 00x"0!D0 4D0` 8 n,0 < 4 8 ,@4YOhl40@ h@l 0D 0!Q hl80H hl0T <Q,o@0x< |0T,DpD10 0(H0 1L0 0H T0 40!2P 8T 40 8 $ " PL0 bH1< 0h< h0, l00  020000   H0<0< 0  < y000vm m -80ZLP `@px0 |$ 0S 80`ONVp@ b0S0 'x|0 Td(# -L MP}PL *0( S"4pp'u't0 S0 |1|!00d 0 405 00CS0600!0`  <08 `@ P80`ONV@0 R h0lH h0l8H  $0K x$ K(0K}4S 0 0 `(K'00@%#V!TC<p< -L MP0 R h0l@ , t3,h@ lD , !00 p`,@ 6pWO`0 R$ 0 R hl,0@ h@l 0D h@!l,0@ hl 0T x0!| 0T00) ' 0 R  22 2 1!,0 0, 0  111 2 00% # 00 0S h1h!002,!, 0  0'0 ~$1$!0,04", 000 0S 0 002,!, h0lH h0(8lH Op0p 0,04", h0lT !0, .[i Ti ri bi ei hi mi -80ZL@ p `x0 |$1 P80pW`⟀ $0ax|0 T`0S  S Z"&d(# -LMl0h`P ) 4 P & t0 S0 1!00d 0 4 50eS0 oS0060p1 `0< 8 w80pWP  g02P80 娀 80pO^WPhl40P 48 0h%% #lŕ\ ,0K @0K@lŕ\  0/\  0 484 `@%#TCT@&#| -LMPh0P lhlX h0pl\ h` l0j!2#0,0  p@,  @Tό,0Shl0X h@l 0` ox!| 0T00  0 000c1`,  0$, V00Ft `000`00c1s00  00Q ``dd -LM8XpP `@4 S PONU@`x|$08_0S 8$d(# -LMhl0`@ h0lP @oP8$lt0 S10 !00040 1d  6 `0<580Lh@0lP 80pWP \p $0K80O^WPh0l@ hlP ,@(K@`@%#TCp< -LMP`h0@ lph0P lh0WT X l0 07 80 0, 40 ,A)^όhl 0@ h@P l 0hWT X 00l,0Sox!| 0T00"  0S40 00 0 55$$‘0 ,@ 0N,@ X000H000S8 00  04@0  Q0$0#(@0"(R (0#(#<S R P -L$M `#  ,ĠXX 0#0p0<,` HKH 8 4 D @@ V@P < ?//7t -LM`, 僯0 , 00 r 00, P   P@0 S P@@  P;H  P <A(0S/, 00 ?Y,00  0 ,000 00?Y0 (0Sd0  $0 (< 0,, #$0 (7t -LM`4p(0S"P0@T00U0 (JJQ@DC 0`(0S. t20,000 X20(0SX\00\0 b[X040PX01 $0 ( $0 ( $0  (\0 0\0p83.) $@0  10,000 00(0Su 0 $0 ((0ST0  $0 (,0  $0  (A t*#V!0*#D*#X*#p*#*#*#*# 0-4\0L0\0P (008#8 X7K1 ( @T 0000T 0 0 \1 (008#8 X1 (0@08#8 X0'*#  p-0P4@LM40S1 0S. `0 K6R&  d00d0h00h0 h00h0h0`x 1h0`Q,qP 0R   0Sp000pV001$1 ( @TTL 000pT 10 0 \p*#(04\4 ;4 -$!$Q p0a0@00L0 ؉0E @p00C& R 00#!000 0C&  0 "!0h 0 Rh3y:000`h@h*#$hh0 -LM4p4P\ 0X1 ( Hv10SA lkc10SGP210S 10S% d0!0d00S 1 (008#8 X1 (0 08#8 <0 X0SH    VLxph\00\0c 0X$ ""+#V!+#,+#8+#D+# -L d M@ 0P 0, 00 Nܣ@0@0C\P 0  "!0 00 3C&  0 "!0d#0 RU  ! 0000$0!C \! 0  "!0 00 2C&  0 "!0"0 Rpp00p $00R0p1 p@@ 0P00$@0@0C\ 0  "!0 00 1C&  0 "!1  QZ$ R 1 0+10 ,p(p700? 0 P[0#2>0C$ 0 PH44T4PX6$PD0*n8P,)  h'R;> R Dq*2S 041ST/0  mUX$P $f""~\8,#`,#,#,#,#,#-# 0-P;> LR@ R P R 0S000C040S044;400 0- @P0L00P0P0C& R 00#!p000 \0C& T 0 "!00 0 R0+`h@hhh0 -LMdğ@0Pp0 0 T$@0@0C\,  0  "!\0 00 H4C& @ 0 "!ğ$00 R, R,4S3U3UU*3UE 3U , 3@ 0001 @, L$\ß@00C\ 0  "!(0 00 3C&  0 "!2  Q )+@ j404"0 R F9H W, , 4R4@0,0 (Ÿ@0   1S+  !@!00C\ 0  "!0 00 1C&  0 "!l1x  Q *  6P1U> :D1UZ<1 R0ñ@ 000 0L X2f @0@0C\ 0  "!0 00 0C& | 0 "!LX 00 RZ`0U - 0, {*@h`hhh02i 1i i i 5i i >6i( 0-@L 2P ,0~ 0400S04@04Td00d00>8-# 0-L@0P400,     < 00z0S 0h A0S 0hhP) 0Sh 4@04$@0+$H~% 020"\`,#\-#-#$ 0- @P0L00P0P0C& R 00#!p000 \0C& T 0 "!00 0 R0)`h@hhh0 -0"00P00 L0 ,P@`0p)Q00C\ 0  "!0 00 1C&  0 "!0p!0 R}) =4@3`V@ 0S)A00C\ 0  "!0 00 0C&  0 "!0 0 RE)+ 14O02~W,0q`h@hhh0$ -@L~oP 2 ,5 ;~0S) 0 0 ;> R 00"R0 00dS  S ? R060 060#00S00&0/00;.0S0/+ 0-PL  0 SD0S6T 00/00@B00 06Sx0 h0 T T006S  0 00 00~-# -L\MBN0 S`l d h pt b0 S,Ė?0` K@0 @ 0 P,Ė0` d P@`B> (0SʤĖT\lP h@ Yp #\` ,0@r(`0$00 2 !PUPt p0`0p0 (0p QĖĖ\TB.B00"h0b0`00d t `00,Ė(0S 040 Q 2Q!!0\1 S d ? R^` $0 (0,0 \0K @T*\0KB>h P@h  (4 t r P T K$4 0 00 UPT :4l0,$`474,$04,$0`44 044704"88 - 2L@ 1\`! ,0᳠ X Up 42 0!X \(P"x U^P0 "@\^P \pbI> 0P@ m88" 0- @P0L00P0P0C& R 00#!p000 \0C& T 0 "!00 0 R00h'`h@hhh0 -? RL $ 0=c 0QPt$000 ;B R0!t -LM 2@p2\`h" , 2@\PD"C.,U  2!R  , 2!qQR@  ,T 2!, 2@!,T 2!,P 2+, "@0+\ 2!R  <\ 2!R  <\ 2 <\ 2 <\ "0+\ 2 @,IΆ@080 㳐88844(4 404t 0- 2LP,,0@0 , 0 ,00 \ 0\0 -LM 2@,, "0,\ -LM1 S, `0pZ ATP @ ˯K 0S4`<4V P T`@V*~K 0b1S ,0S ,B 2,, 2@0,\( =  ~ 2,, 2@0,\ 2,, = @  2@0,\(~~ g-# p-$1LMQ `0@0~000 R 4@/I0@`00C& R 00#!000 l0C& d 0 "!0@ 0 Rp!%( `h@h f$hh0 -LM 2@ ,;P pPPoW~ \\X0 0P 00s0S `($ ? `-#-#-#.# p-LM 2@ ,;n PU~/ px00Sp0S0/ -LM@s~ g0@4=4 p-LM/^ 0@   m 00S 0 00 0 ?2 0 0 p0,  T0 /~ P01 0CS02pP $.#\.# -LM/ p  PZ χ⹟O0P @P媄PN1S @P 0  @\STP`χ30O_ P@ P`刄P(< 0,K P@,$ P|0, p (P` P  @ U 0 ,  t.#.# ##l#ty!V!.# 0-`PQL@2<3`SS ,3;> `;>QP ?p/1p pt.#.#/# p-@LM PL10PH!L0D1 @!T0<1$8!041 0!00A0 m00@!1” \0* 0# 0 0&} 0x 0s 00n 0 i  ph` +0 ʚ;"p(+#&0 -LM;> @R2S a0S 1  SU+ U 0S303~_"pK  2[:2K"[ 0SS$P P2[<2K"[~"K  2[S  2[S  {2[  :2K"[ 3 0R3 P dP2[<2K"[~ -LMPp  p 0` P@M 000p p *,P@70 04P@%˜0  0P@` 9  80 00 0 00 4 0   8/#p/#/#/# -LM0@ $  80 00  0-LP@L P( 0 0",0# p-LM2@,4PP4`  B> STTp" -LMp3 !,@RPB.+0\ 2`1\5H! 0\ x!@0l^d! 2\ 2@\8!0C.\ 2@1\! 0\1P0CS2S  "0A.\ 2@\ 3-\1S 2+l0\3 $S4$$$4 "34 \8$"8(888  8 ,8 p-LMP(P 0` @V 0`S0x 00@V(P,4S0,4p0(4,4$,4C" -\1LM`B 0RA D4ƒ (4q& 0@S `0 0`0,T(0S+$,4pC0 (T@ 0q XD ڴ4` ;40X0 B> X B>㳀04$0 (,T" -RL MP08 $0 0 L 3R)dhĚAp 0 P`P,0T$@ "hĚ(0S $0  (BzFc3@ 000"@0@0C\P 0  "!0 00 2C&  0 "!t"0|"0 RU 01@2 000"0040!C \! 0  "!0 00 1C&  0 "!!0!0 RU$000p1h1ppp p@ 0h00md9 \X0#0# -80LM@TP 00X\ -LM 2p,0\ "@3\!1B/\0^b<4 ",@^P. +0\ 2`\@!0E/\pQ "@0\T!2F/\ 2@\,!0.\ "@0\0C!J/\`2"6`4R S  S  S L 0R " 0,\  "3H \ 2 z?\ ((\(((,( p-LMPdP 0` @V0`SP0t 00@VdPh4S0h4p`0d4@h4$h4\ -L MT$XPb 00 0, e Q00S_ hĕd$(0ASp00 $ @0 @ Q0a0A880@ I @#H# 0M l4S0"0R00S PS \20C\X20+x4 0x4Xl@PpDlDp p 2@\ "J/0\1 XTd` 00Y00SXz@\J*> ~ QT0D8#H #7P8 @l4S@ptlt 1Z01 p$ 00j 0l00j0p4pp$l0p40 0000S l4,  ,0X 4 PX l$,l,0p4l4l7x4 0x4lP0p4l4@\2\uX20 $0 (d$hĕ7(\1S 0@ 00 0 0`0`S 00 0 -LM "@<8 \ 2 , "1 \ - 2L 0\ - 2L0 \ -L M@K @ AK 0P0 -LM0 0 @ 0  0-0L 0 P@  0 - L 8 0  - L 8 0 A-` ^0P@p00`0A  S R0 ApQN `000 000p0 -LM2S 2 , 2+,K^ Pl0@ t+0, `  2),J~ p`$+0@ }0, p`*0@ M~0,p`*0@ M~0, p`*0@ N~0,p`d*0@ N~0, p`4*0@ O~0,p`*0@ O~0, p`)0@ Q~0, p`)0@ R~0,p`t)0@ R~0, p`D)0@ S~0,p`)0@ S~0, p`(0@ }0,p`(0@ }0, p`(0@ U~0,p`T(0@ U~0, p`$(0@ V~0,p`'0@ V~0, p`'0@ W~0,p`'0@ W~0, p`d'0@ }0,p`4'0@ }0, p`'0@ Y~0,p`&0@ Y~0, p`&0@ Z~0,p`t&0@ Z~0, p`D&0@ [~0,p`&0@ [~0, p`%0@ }0,p`%0@ }0, p`%0@ ]~0,p`T%0@ ]~0, p`$%0@ _~0, p`$0@ |0,p`$0@ |0, p`$0@ a~0,p`d$0@ a~0, p`4$0@ b~0,p`$0@ b~0, p`#0@ c~0,p`#0@ c~0, p`t#0@ }0,p`D#0@ }0, p`#0@ e~0,p`"0@ e^0, Pfn0@ "0,` \%0l 5p0%t h$x400%00%000\0$40d0 2!,K~p`!0@ }0,p`!0@ |0,p`p!0@ Q~0,p`@!0@ f^0, Pgn0@  0,` @8@@@@@ @(@0@@@H@L@P@T@X@\@`@d@h@l@p@t@x@|@@@@@@@@@@@@@@@@@@@@@@@@@@ @4@<@@@ -L M`@!k 2P\!-, 2px!, 0dT 2P\L!B/, 2p(!, 0=I΄I  3 2P\ C., 2P0\p  , 0B> $x$l |$`$Tx$Li0# 8,80# (,( 1#P1#8881#1#1#1#2#02#T2# 0-MP L@ K  t  `O  L  8[  $Q   J  K Q R R  S S  pW  \YN@ H0hx2#2#2#2#2#3#(3#L3#h3#3#3#3#3#3#4#(4#H4#H h0R \0R 0 000 00R (0R0 0CS00 A AP A 0-LM 0@S0-o t0 S S` "X b LL!^ D Z 8,V , R  !N  J ? F  B 3,> 0 SPK 1[   [p @Q> 0A @>-: 0p01K![p d  <@8# Nsq!y012 9:C{S񟗄dZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZ0S S000000 0 0000 0 0 0 -LM@Q00)d0R \0R Q000 , 0 0 0({ p-LM0@S 0 0\0,0\ 0+\0 `,`)0 ,0P S S 0CS񟗀\\\^\^\\#900C Sk\\\\l^l^l^l^l^t^t^t^t^ 0 , : \0 ,}0S0 S S 0 0\0 ,0S p8 {0,, <4<,\0 , : \0xt 3 \ 3 !0bF1' X N p-LM` P@ p08 0\PU Pb @0PP!R,,0@\T0S>0S S $0S 0@S0!, 848l!\@K  K1[[`0`S "Q* 01K[ K0 , 0 \ 0,\0 ,8 0,\0 ,j(8 -LM0@S 0S S0K  P ![,0R 01K![P -LM0K P PQ  R00R0S00RTf 0S`0( p1\0, <\00 1\ 8.\0`0@\D!0Z/\0@$!\.0\0S  @8\ Z/1\0@\8 .0@\8| Z/ 1[02 \1[:  S00v00r`!h! -0L`@ ,0PS^ 'P PPE0SH`ef|ffq0^/0\ 0 \0 ,Xp0S 0 ,P P0 ,P1U2U0\00\0P\pp0Sg'  -LM0` ,0S}0@ +0 \4P@90 SSg Se Sc Sa 0S"pKqPU "pK P@P2[;2K"[` "KQ񟗞,jgg8j2[ 02K2[ 0R2K2[02K"[P@  P@2[L p0R2K 2[<2K"[,"K"[P@P@ 0S^ 8/08(R/08P@ P@2[<2K"[P@0S800P q@T #j@T 2[08#X U0S-P@ Q P@ 8P@nP@} P@ 2[`0c2[@0`CP@k0,, <4<,\JP@R"pK P@I0 S Se2[:2KP"[PP@90S @08PS0@S008 S(   P@$"[ 0  U< U  'P@1 ;2K"[U:*"K2[; P@2[02K"[P@  P@2[:2K"[ P@2[ :RP2K2[: R2[: 2[:2K000a-0 \): -LM K@rP  K kP1[>1K1[![ 01K1[,@01K1[!K01K1[<1K 1[<1K0Sm0So 00,,0 0,\\P`&0S -LM0@S?`p0,00PU 0S &K P2[P  X dQ Q2[@002[  0 ,?@d0 000 p-LMP-@`K \ \0 1[ -0D8#Hp p順 -LM 0@6 \0 , h  -LM 0@6 \0 , h -LM@8 #80CpP S,U  `K 0 066 0 0  0\0 , P -LM0`@ ,pK 60' \0 ,vP8#hm0 ,0 0 `w0PUXm p-LMQ00\00.S@P`  ph[P p p-QLM@`P.0S0(6 \@2C0 ,@?Tpp 8; 0 2hp p-LM@QT 0.8\P` #H phP p p-(LMQ@"hP*0S0(B6 \@0 ,@ T:pp 9280 p 0-0LSP@0 , 1@ \0 ,( 0 \0 ,0 S S 00,, <4<,\0 ,0L@0 \0 , i0@0 ' -LM0@ S  KP 1[91K![)PG0S r 0-LM K@PP 01[8H0, KP[H 0 BHL Rꠄ܄H T0RPGPP0H 0H 0H 0P A0 A A -LM @0S  0 S0 p-L M 0 00@KP} P p1[`K0 JP1[);5 R0   ;P1[*:6B& 0K K P2[![002SPS0nS0S000 p-LM0`K 0@ PP p1[K 03 0 * P1[0 P![("@0C3R0=30 P1[*:6B& 0 p-0LM0000 00000@SP`K P p P1[ 0S Npp0 S0SS0 0 0-LM0P ,0(@0C SE@@@@00@000000200 R 0@000K@P1[;1K1[ S  S  S @00<00< S  S; S::;0 0000 000000 0000200<@00000   -LM0@00  \0 ,h -LM0@00  \0 ,hq -LM0ȠP ,Ƞ`H0L |4,(0(@S$ 0- S* $PK$00$0 $  $0\0 ,=p$0 0$0  \0$0 -LM0@ Ƞ P<,@ T$ `*$pK8#Hh0 ,0`0@$0 qV: -0L` ,0PS(p@%@T T 0P0 \ 0P0 \0P0 \0@P0 \0 ,30#P 0@P0 \ 0 ,30#0@T0#02SP p-LM0@ ,(0PS(`' S p0P0 \0 ,Pd  0 \0 ,phR 0P0 \0 ,@  P0 \0 ,.  P0 \0 ,P 0-0LP ,(0@S = S @@Q 00\@0\ @0 \0 ,  @0 \0 , @@0\ 0-L@P"H0 08 #XU 0U0 -(pL!X(\@"h:V00 eV0S P(0S S hX*   !K0X:P!0USQ   !X*& 4 <X0:' -LMP`@pK0 08P#H 1[?T08#X0U麺 p-0LMP1K@`K0 m08P#H1[![>T01K[0 0K a c? Ppp麺 -L!X\( e`"Hp:T00T0S P(\ 0  @ N@' (-"@TLP!x(`:P6) ?#0WSQ  0 !*T*0 "! 08#HP T:T: -LM(p Ƞ,Ƞ H.P ` B("(V$+*  !0 @0 ,02B 08#HTT 08#hV:  ("(  B("( p-LM@K0 `Pp\0  [ ȠdP0![00 p p-LMP@`K0 O08P#H! [T 1[#4000CS @08#H T p0 ,00#0p p-LM `@ PR1+@ 0\ 1R!;0D0 0@\Tp -LMp`Wl @ PR1+@ 0\ 1R!;0D0 0@\T@ PR1R,,0@\T@ T* PW0 np@ TP:h0S̛0 2" 0 20 3" 0 -LM@ 2RPaaR,,, 0Rx 0RR,,0\ 0PE!R,, 0SR,,0\ 0S11R,,0 -L0p@`P 48@U1+Q@ 0\ 1R;!0D0 0\ -LM@PP` 0P11V,,0\ 0pA!V,,0 S11V,,0\ 0S11V,,0 p-LM`@ PR1V,,0@\Tp p-LM0@Sp0,,0Kx| P>![0RR 01K`P1^3 @R   |0!22|00@S P|dP|dP|0!22008#Q0!22|0!22p -LM0@0C S````LLLLL vP 8  P0S S  |0,\0,, x000 -LM0@0C S````@@@@@,,,,(Px0,\ -LM0@ ,0S:SS 0S S  0 \ 0,0S -LM0@ ,0S:SS 0S S  0 \ |0,0S -LM0@),0 (',0  ',0 &,0 &,0 &,0 &,0 &,0 d&,0 H&,0 ,&,0 &,0 %,0 %,0 %,0 %,0 %,0 h%,0 L%,0 0%,0 %,0 $,0 $,0 $,0 $,0 $,0 l$,0 P$,0 4$,0 $,0 #,0 #,0 #,0 #,0 #,0 p#,0 T#,0 8#,0 #,0 #,0 ",0 ",0 ",0 ",0 t",0 X",0 <",0  ",0 ",0 S0!,0 !,0 !,0 !,0 h!,0 L!,0 S00!,0 !,0  , @@@@@ @(@0@8@@@H@L@P@T@X@\@`@d@h@l@p@t@x@|@@@@@@@@@@@@@@@@@@@@@@@@@@ @4@<@@@@@@ -QL0T  Q(P \X -0LS p t S\)0\0 *\990 99L \0S \ 090 \XG-`0M@O0L 0P 0  @P@ P(P,PP00 ^`@0@00 `P0@ Rf  0P@ `0\K @\A \4 \! h1\ X1\ P1\ 0Ѝ0P@ @0pW P@0`PU` ` P `@0 P J0S(1S 0@0S0 -LM0@S0 0$000 ,)0 R$ Q 9 S0 S00 000 0 S0 00Q00 0-0D@L LPP0 \0@P L,0 -0D@P`LLP0p  \0@PL 0\ -@L M@@0`Spဠ7 S 4KL P*K040C #08P#X2[0A 8}S HZ!UT I0j8 #H7#H  0AS0 0* KP2[=3SL`lx2002P0Pn0n00

K0C 0C)00P 4S 4 S9T |9Pv 卣P`I 0SC  P  P7,90S 0CS  R4,90㐶P  s4S8P@80<HP 4TSd8P- 84 $R P& 㞣㛣4DS7@$P ㍣㊣4TS7P 4S 4  4S  od7 0S k0CShhppS7/4 Pp``@VH70S> 60S 60S6&4S.ʸ4S 4S'4x6# 0C\0\00|K.K 6 B B Ɵ0O4Sʸ4S 4S5BNK4@D@D+(P`60S7 50S |50S/hşP*0S'450/P0S*,5#0 CR 0R00|4 00CS00ä0|4ӵVoW0 Sh|4 VOh4#0 CR 0R00g|(4孵K.K3 B B0Od40S 30S 30S #4Sʸ4S4 S440@3 0 CR 0R00/|<3P@ 0 CR 0R0 S 0`0|2P@ mp` 30S2 20S 20S*x"4Sʸ4S4 S4P2#0 CR 0R00{2 00CS00ä0{140@ 40@ 0 S1 4$St1 4A{4S2  .ޡۡ4DS0@ ӡ10S$1 "@P004SK4 S0  4S4T 0S0S ,0 S,'o!`l ܓ@_t P`@tD! ss(t`4< -LM00 (@(0 u 렊H -LM$ϟ@, _XK0 4 < 00 >Ο00 >P@00P@0 0 P  EPH H0S > 0RS ,0S PU,00-S d>, \呑QH>L @>0S H0S , .0 80 R@0  D0 H0 S  L 啠P! =0S =0S NP*00@0S@<0S<4= @ 4=@/T֠L0@0 ѠP< U ,( PS ,00|SO ,LP@/, @0S 0 S , [@㬠<㩠= T00,0T  T,t %T/0p0WT<0S 0 S,P <0S 0 S ;0S ,w , ,0S HQ;0S f ; ;R^wD; PP PH0S ` 0S L gP 0S  , ^ ZP@ 4 40S @T&, 7P:00 l:@) ,00|S D ,0 00S,|  *0S:Pd:P ,0 00SD:, O80 00KP0S;0 Z0 SiPۿ墿P0@0 @.0: S )0S009 H9@T 0DS0 0S 000ひQppY90  p@0 S pW`dVQLȟ80OP< 80S 80S4(T0S,T0S X0S%X07# 0C\0\006y|7XK |ǟ0OT0ST0S X0ST7i4077 I%PP`pÙʈ70S7 60S 60S/ƟP*0S'60/P0S*6#0 CR 0R00x`6 00CS00ä0x46!U0 S5 W W,`VV 0S 0 xPPU 0p P@0S@0 eP,80@S,5P@05P 080 UP00P0  U[5#0 CR 0R00x4ű4XK 0O 50S l40S p40S X$T0ST0SX0 SX0$ğ@04  PPL0S 000@20 0 CR 0R00:xU u U 00 CR 0R0 S 0P0"x<3P@ 4ypPP0S CP 彎|Îd30S2 20S 20S*"T0ST0SX0 SX02#0 CR 0R00wP2 00CS00ä0w$2400@ 0 Sp1 000@ ,80 S1@ 1@080@<D0SD 43m@ RH0S R0S10S 8 d1R"p ㏘00 0,K0 ]p{K{|넀 0$, !D0PS`0Pd0D 㠝l00S70 @ 喝<㓝`Lt @@tH:k(`Pt P`l`D!؉ `P4 0@P@@80S 00S08040S4l 0S0S-@?<< -LM0 S 01 `0, 1 a 0 S00SS q 0S' l͟xP wTP H AD00 = =0  >K P 0S S0 L<0S$ L0S la < QT,! 2$<1 < K ğpL0DS  p  FP1S00 0Sd >KP@0S S >K  P >K ) ԨPLTC 8P030 >K 彨Px>XC0r/K1 ~P@S2㈩P+Q ZOK3(`K0S S 220S3 20S/H3(KKoK\0P1 \ S_K <@@P1P 0eP R `2 0S82  <2D嶊 QA Q^ ^ 8 0@X@>)0@0 0  $         $ ( , 04<8@@D  ! 1S0s`0a 0 \^$1  0S >K  P~ X@ 0P00  ,0 S,D`o!0@\t gfff|̊Ԋ@܊0|XЋ}~ 8\`ȇ -0L,MP؀0p0U$0 D @KD K `凩@T嬫00妫?[\H0K @H 僧P<n $0S $ջo!`ȇ -LME4 0S@0S!8@` -L 000頊 -|@0Lp0T\" 0S0LbLr0 0S 0b(r@(2(R  Q ,rBΆDQAφA@E0<1 <10@! @10D!D1t00lH1 H1`0L! L1P0P! P1@0T! T10X! X10\!\10 ' #  0+11b0b+  ++ ጘ0S00 頊4 ` `@@ -LM`@00CS00  ä0 re, 0$0000 -$DL0$M,0 D H 00  @ DP4@ 3#3Q040 3@T 30S 30S@@S0S6P 3又|30S d3l儈\3 0S<<P0受PP7 c0@H ,0 P@ ,00000 4D P`B000ZV,Ɨ@2hD H0P/㹗<"00@ 㼾P 20S @ 㱾P10S xQ0S 0@T4D PK Q0S1P_0S0@T 4TD P Q0S. +0A0S1P@0S 00<K0  <0 KᓩP00S0  F00S0,0S@0  <Ltss̊ L dH`l 'tF 0-h0LM0 0PK!K0  I@T0(0 T0t  -/L`PPU1 1UwU/0p0W 0X@+Iս.0PW0PdZ 9X0l000MPp 0X0U.S100E 00EPEW H:k@t( -LBMAq0 S P 10S1  RAnK `F`F0X!P0 0^P0,, 冩10U B>K 0C0$  0 K(4 0BK @@ 在Pʰ 00S0  OU 0K0 +APP@00S 0S8 o! dtFЍ'܍ -BMLML7H'H70 @'@7@ H , 屻0'P  0 S70 7+ 7PP6@P6vP6fP6솟@6@@PP6 6@6@养P@" 0S  PP  P p PP X ټPPP@<6 4μP5   T&P 0S60U0S 50@T@=PP@ 0S  姼P  㡼P  㛼PPxEop5P5  \5X dP Ue P c40NBS񟗔<DPthp `l  4J#00#0G3<0 0 0 <8343 4 @31 33  P#h3% '2 2\3 2L30 rH300000S 3L 3 v3  l2 0"Hp^2202 2l0 2H H !P Z XP BNK@D@D+$T2@ D媔04SBH4&P 10H P4.P@ ㎔ ㋔H@1 0@$ D4 < 8 4D 0CKdAA A0QS R  1h1 u0S 1 (P@@T Z W@o!(` @@@0`̀`+O̎؎ DT#08@_@ @ |!@`4qDd@Q 8$  |` -Lq 寓 p-LMP0`c 0S @0S PD00@PF'00000S T@0S 4(00$0 $ 00`p  p-PLM 200CS00  ä0 tm10S A$峦AQ xP ᝺P^ @0 SP00U1P`1t0X!0CS00Ӥ0$ PB p?0a0S Q00Np@ P 0S 00S0ڃ0  00S 0S d00 CR 0R00m \0R T8L ph4_H}`} t Pp@-& @`QP 0R0S  0R 0S 0`S`PQ^pppl p-d d0LM\` X0X PPP0@T000p( p@-AaP0$S!S0S S001  00 h!h1!Qp0 S S8  S0S00 S0000 S S S "S \S0S 0 0S "S P00P p4 0S00 S000p  -PLMp(N1@ 1QQ! a巂0p2V*Q 0S 0S I0`2V: iZP@U@p`0` l P \<刂0< 倂PEU HlD`| -,0ML  0eO` -MLM , % 5 vP@ " 0S ظ P:?_ !B^KPEPE0h%3XxT5P0S8d=RNK@D@DQP,KR5( K·.P줟 P P  QD Pd LvP TFvP .P@ vP0S0@S񟗼\P %P 5#ڋP P x LP L3YK0AABP5?P %0S52YK0AA*P5?P{ 0Sw΋r20S} P Pl(pp00 P  RqXr0So Lb11@P@U pP ` 2000 pX 0 P0 1pO PpK 0S1 0 0D!!00!!00 00da11 @`QT $1p+ 0 S0TS 00@T1TGP PP5@P0܎0<0ʎ0 ,0St,o!&t `PDhd``4q((pԐ(X p-LM a00` lp 0@ PS,P ppP"P@@\P0V Sp "P\P0J Gp P P P,P00Ppp8@0S 囊P 0S p`h( -LM 㸯@TP 0000寯Pȑ 0-0 L0C@R PP 0 Q000ȑ P0-L@ 0S Q 0PU*0篯0PU:婯0h馯0 p-LM0PU@` *03P0p0PU:p -L MS( 0$ S 33 P$K(K"$ 0BS (0 22 B0S22R(00S(0 2P 0SpP 0S (0PqP@20S 202 @ @嶉2 @尉2 @媉1 @変1 㝉1P0S1@1P(0 z1d0S0`00PV  wP@pl pP@ 0T.S@DpP0@4!kTp,, P 10S11  V  `0 T R00 V   ߵP0K ` HQt @` Ȓ`<'`(O@ r4@ -LM,pQ" ,  r  /K?KKP2  2S 2S&20S" NK"*^K<,8ҩP  P|202  2\"ѢP2WB 2  D22 2S&P`P`V   0~1~|@KP!O|PKns;P@|0[S@TB KP@2Sj ?P@ 2S\] T2@TXQ ((P [W00S'p0P  h0 0K` 0@P0 P P@P 0T,0 St,Xo!  !d(_z{(}{̓` ``ԓ -`LMpP᬴0@T0~0 ~ 00@dP rP ᑴ@T0P S00@@0 800P00_ -AML83M4ß@0T,0 p0 3 0S 3@ SP @0S 0S 00@T@0SزP@ 0SB:00SP/S  0 S R?}D|iBnK`F`F+ᔇ00S/S/00P+eᦠPPL1X0Q  \ 00 1P0S 00pSh1h!0?2cS XL100$R 1PBNK0@D@Ds000SX0009} |P qP@@ P0@0x0 ,0Sh,&o! ̶Զ(8l`zl\ Qt \ -MLMpp0 S( P`L Tq0SHHA0 @|xBK@@$!qP9 1$K R01000ӑa0CS'(DDDDDDDDDDDDDDDDDDDDDP0t0| 0 \0||(0 S4(頮o!_d( 0-0L0M0@PKS@,  ˲0 㱰0S\@0SM? 00宆P 3 0 t -LMp0 SԀ0@0P`P :P (K}(0`P R rp000000S`P T 0S8@,+| 04q -LTMa0qS!0PPPA[ 0r10000S@ Pr1000PU@p ~P \1\{000 00200`KdKhK\0KX K T@KlK , l0X T0 h0\P0 d0v.BL0 `0A BH0 0D @ 40 wmpP X0S 0h {00P X 0SH@8{ 㗿u0 84q@D 0-LMH@0Ps0 Kȉp 0SPP0hwt@ -LM@P00s@ -LMH H0q,0 F(6&6K60S |&Qp6\Ɵ  d@ ( A@ _P$ Ԅ@T@dTd@K0 %50PCUڔ5 ra@ ᔱş@ş`g0%p `P`Pp%5VF%T5UWPT  n@ k5@` \ B0%@P̞0 04bQ c<" =9 B =<" $8 82 0 S0S*<#NK\<8" 0 T< 4020bS aD"  BD" @2 =9 =D@2 *P@@*/ 00 /%KHP;%.K-3/C0ur @ @`0#r @ @`t#g%K-T3OK0ua2g 2crB0@ #? 2cc#aw0S0S%NK/ &PڄŸ0 S 0S* İ@ @" <2S Ṱ@ ᶰ@d"`N !Pu1P@p%K g00 b0%K 3/M-1Po0uv Ᏸ@ ጰ@`0! ჰ@ ူ@`x!d1OK0uf2g2crEq0@m8!?` 2cc,! GΝOK^Q 0žH~QHP 00CS00  ä0 cH(,0 S,.Ao!` @`ĕ Q̕Dԑhrų,2(8 -x3LMp 0@@,0 KSH3H0b0P a  B=9 = 0 )P@{)/ /0 n.K谂 KP@/ %P @K /QP0吠KS0SLŸ HŸH2@K00 脂Y~/ ~/ `."ŸP@Y00 d!p\P 0SL0SI@K]/ %PBڜ R>1 P@@PR50S1:PIP@ DK ;/0 @K5/ .!, 1@o0ef2f2c BDaP ^0Ϡ#PE0l 2lADd`0 @弜@KL0 S00<@,0 Sh,.A>P?o!``DWPų -LM0`V *00`YV@: H1 PUP@ͫ`VA0S,0 :p0AT0jx 0S :000CS00  ä0# a ܮ P@| 0 @0 C\0\00a T,0p0S,0 `V  -L MD00 K4@kp( P0 1[SP00@ht@  -0L M@K 0 K   p-GML1 M a !P0@4 !p ?P -K BoPx B dh1l0@cTQZANK@D0@D4 lP= $04 04 =K 0C\P3I00CS"t  X      |                t0$h屝`\ wD 8=o!@Q@|!J |!/4444+ -L0+ &И` -LM`PᬁP( @(K,pK 0  (0@SѦغ -L M0@p00 0Sf PP 0S nSW =(P0`0@Q lkP QIQG  0V0P . 0' Y0  0000V 0`0 ,K$o, ?R0S@p @0"Sl 0Y000 LPH00D 0oSP 묙,,D,L,\,x,Q-0N. S$PPdPdddddddddddddddddddddddddddPPP 0B00RQ  Q 0B00R -LM8r0 0 ̀NK$2 @D@DP+ Px0Pu0Sr0 0CSmlHa0 %ScPP]0SM PG K0 @ @48 d0H0@T: >K 0C0C$y%P@T'T$0 05R,LP'00S# 0U 0 05R01Sh0 05R TQ D00H0Q< c 㦹 0S  o! h ( -\4LM@P  00'P#((((((((((((((3 3 3 3 33 #^pc@30@cTQ\dcP\3#  P@+# s0S0(0$#@p# Z3  CfcP 2 0000C<0PjP  Zu T X|tVu0SH. DHu@ 㘧42p, " $PP#PP" ,Kʅp" (,,(1" tp@" zHAٖ 0H0Q   p1p0``!lCT妒pL" Hp@" P P  Pc P׹P v"i☓0H 00E 0 O |!L @l 8@Q@H`hP ```gT șЙr@ <  DP\H:dpPd  -,0LM$@ ttAO` p-LMH P0S 000` ph`H@嘧,H0LH0000 H04 H 0 &080H0<`phX ` -LMH0@H XD0,0H00H 00(0 H04 H0 &080hX ` -PL~H0`@T Vp,vl 0S`0 ^W@H 0V0H 00h1HS@`H 0 = 00H0 00}=0H0  00'<0 0H 00h|00H 00 H04 HD0 &080H D0,0hZ<'ȚԚ`X  0-LM(PH0 ,0@S 0R>PzH00SS S Sq$0#!+P 0h!H0 H0@Pl100 $H0 0S10H0 0;S<00H0@2S0?00 o$H0@ 2S g$ 0/"/0B1 0H0 000H0 0S10H0 000H0 0S10H0 00 0H0  0S1 00h0ܚ0,H ` -LMH0@<0 ,H0HP  P !1P0,aH0Q 0SH0H0Qi H0PCH0 H00H0 0H00 0 W"H0 H0 0@ c H 00h  $, `4 0-H0LPH D0,0H00AT 00֧H0@80H 040H$0 &080H 000h4X ` -LM0p0S"(0H0 &|0PU  `$@0@!P 00!$ht PUhF,\ -LM0pS S S 鬀嬠ꨀ娠꤀夠(0H0 &0PU  `$@0@!P 00! @ m6 PU4!x<&, -LM(`PH"2PppQ, 0R 0R⠨P@$0z! 4H 6;0S &0;0100 S+h0SH0@T 0S oPh@TfP@lh1S00000H0L<0,08,H,1 &P 40PP^p _  =PH000H0@H00S 000SP00H 0S@  0S 0S@h0 0bSpWhI@ }8h鰛xțԚ`<' -L娠PP4!妧1`0 pR P@8O 40 p0 804 0 & P@D Z0 0[1S 100,0S AlP@$) @ ,E$ 0@0$7 P@$`1S 100l0S GP@(P H @ l( 004$Ld 0-LM(@H0 ,0PS/0 S (fP $H00SS S S$8 XH0P0S0hH 00(H 000hQ0Ԝ0, -LMHD @24 0bXP@m0S 20S H <0S0@<0H<0S 6!@0 <0H0<0xH0<PTH@ 80S 6!0 H0 8᫣80080H`Tq 68 0RڣOzH0  6@癣@8@80S 6!080H0 &804 0 S0l080X8#8#$H@0$ ࣸ$H0`$p#Oc !4H88<#8hH\0%0@@ H0804 m`$`<' p-LMH0@PH 0S 0SDH0a 0S6 0 ]H00,6H0H0QFPH0  S00H0 0XbH0 0@000o<H Q0 0H0 H 0S 0S R0 0H 00H 00 0H00S UPS|H0QTnH 00H0P & 0D00 {ph/T`l, ̝ht  -L M00PH$c(0 04 SSpb  6#0WH 0040S<0S 0,Q PH0 , < H@0S 0 0RpH0dH0QP DwH0Q,H 00u80S 6"0 0H0 8P80080H`! 680QڣOH0 8@@@8@H0S d1 80 0S0`0808K /H0SS 1 0R0040 070K080KC<3K0S0``0S3 W08#8#$0$$43[4#DHLa$H 0H0%@H 40880  (0S8(o!`0,$ < , p-L MX`0P#DHLa$H 0,wH$0%0@@cp<` -L{KM$pGBKpGMJP`@*J%@K奤+ ᡤH!@✤H5.7%0KT# @ @P3L 6,  `3 #1SH  60<S  60<0 6!0<0H0! 60<0!0 0QH@`@ 0 ``` ``0H 5KSK?5H 0@0H 0A0H 0B0H0C`H@DH0dH0dH0L`H0P`H0T`H0X`H \ -LMBKMH0P+p!0KKKH @D@Dd"@`H5.7!0KP#  `P3H 6,L3 `# ` R00R0S5 _ 2>  \3 ` #1SH  60<S  60<0 6!0<0H0! 60<0!0 0QH@`0 @``` ``H 5KSK?5H 0@0H 0A0H 0B0H0C`H ,0D0H0dH00CSL` LXH0dH 0P0H T0H X0H \J -LEM= K MBK@P+^Hp!@YC>KH`L3 F.KE>KH3 p=K @0$ P H X3 @D 8 ,t (t $ L D < 4 6=S F>K,3 6=`4 6=\4 6=T X4 @@0 @@@ @@H 5KSK?5H0@pH 0A0H 0B0H0C@H ,0D0H0DH0DH0L@H0P@H0T@H0X@H \١ p-LMP$P$(P!@`40S8`V@Zph p-LMPP @cP%?c`0H0 @T  @TX0H0Q 0/yz0ph=@l\ -RLM`P`B0S00ڳ`008r0S,B,bP >l00A8l +l 0 "l( Rl$ Rl,0S l`@4 Q 0 8l!0"`l`V@Z 0 @ v> 0k wZ 0 v>  0kbZ 0 v>  0`kTkiQ`@l\p|Ȟ ,T| -0LMQ`(0 p P %( 0$0 (000 0 % PP) $K 6  @(K1 ( @R * @,K0 ,0 ! 0, @ t$ 0' p 速@ -0LP`Up0 H0d &H@6SᏚH06S uH0 6p H060S H0ƐHH H>V004 H8H$ 0h2ԟDH -ML M 3 P, #0H< 0BS:@<K$<0@pK@0 @G 00T`K0T0 S$ D\0"H1 S@KHK0hPK0h0 S X@0"H(0SHx"$0SHd"`` Pg H@ &PN 40S0@L 18SG\?h???8@4@H0 &0@冑9 40!1YsNK@D0 @D᫟H08 64  64 1h1YdT1`"HsNK@D @D8ᒟH0 &40!0 04 R8@Y ZK'P  0  0HT7`0V7 P {NK@D @D0h +0X H=,0 S@,7o!( 4DThp -LM( 0Rp80 00 40  ᓠ0 $P 4 Z በ8 0 K 08 ,@K0!=0 , (0  P40PU0 Z>t@!00wP`({  @ !0K0 @}(00 @w4K0 @q$04 @k8K0 @e 08 @_@P4 X804 @RPU@ZT,:(0Zp3 4@ -LMs 0P00$0 P P@$pK  %Pxt`1pd  0 0 $0 U$Q< 0 S0(K I(@ -D1L(M<4PK0( $ "(` s 1V H0 &v0@0 @P @08` <0 @pKH@ D ،PPL  LKRP00P@@TP xL@ HK \ἬVH( 0L[R0( o! p ̠ؠ -L M`q6p0@S 6  b[P610=S 6p1S&P F0AW2PbP@8FFVFV6 1 V:@ 70@3@@61S< @0@$S `S20T\ : @ 0@6@@ 0 r 4h 0-6P0LS@ 6&016P1S060-00S ^0 0-S_0 000S0 0 p-0LM0 S@PTl`d0P@rpT 0s TQN00pT P  -LMAP4 8 04 8`z@UNMNMMMMMMMMMMNNMMNNNNNNNNNNNMNNNNNNNNNNNMMMNMMNNMNNNNNMNNNNNNN$N$N$N$N$N$N$N$N$N$N$N$N$N$N$NN$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$N$NNQ@T` pW 08 0 頡ġl @- .0R) .R@" .SABaB00B\Q T00.T\ABaB 00B^Q S ^Q00B-R S T0  0-LM@P P00B.R S 00B.R S0S0 S0 S KsP 0 -PLMpQi@0T1* Rr000000S  0RQ 0 ]P`F0'S"S $S `S \S`F\000`F0@0T:V004q(@ p-L M`Pp P ,0@PMJ PK0  ` 1Kևp@0<ST 0 pHT T` -LMRBp "=" 0< 1<  ̌001P  001` P \001K/ p!1`p 0l|0 00P10!D1  81  04\P@ ,PKi0s  h/vs`P@H0S bؔH0H0S+ 0Hb.՛0H0 6S LƔPPt ,, 堚0H0 VT0PL 0    $t l@  -LMp@"d[P@ K r 40R ,s@t  -LMP pK`@ @@IP񟗹WXXXXXXXXXXXXXWXXXXXXXXXXXXXXXXXXXXXXXXX\VX8WLWpW|WWWWXXXXXXXXlVVXWWXWWXXXVVVXX XP 0 Pl 0 1(P 0 P 0 1W \V ,,"L<K, b0VMb@ ;P Ԣ (@ -LM@$`KpA?@0CSP ABAQ 0($pUP# :R :P $p l0Ph  $寚 RPD$CT| -LMPp`$K 0PP ڼ0p  PP@ 0$/XP @T T @` V p ,P ;P @Pz,($Gأ $ -LM@ `KpM 0P ,H0PS[ H0 6Sh : {P hFX\ r }R H0 &X <d| p-LM@PmPpp|`@T mP @T\㯒P@@ \ ᮙ Zm00@p  -LM@b㓒0PH0 Hb.h鐙̤ p-LMPPH@`~ H0 64S H0 zH0 phN0 -LM@ `Kp {P WPP !W00 0 00 $0  0s$ KP }S b $P=H0S W$ H0PH0` @T 0 S  kPV$0 H0  @TW$  H0 00H0 PH0P 0 S  0R DP$0H0 H$0H0 0 $0H 0 0$0H0Pd4`  -LMP `K@p  @@:Pla`haxaxaxaxaxaxaxaxaxaxaxaxaxaxaxaxaxaxaxaxaxaxaxaxa(axaxaxaxaxaxaxaxaxaxaxaxaxaxaxaxaxaxaxa`8aHaXaxaxa`xaxaxaxaa000001 0P' &@P!,  ($ 48 K ;P <@ -BML M0&K0`HL ,0 p PP@Pt p PH,lPP  .P@HT j g PP@p PD;T p P\8bAH PHQ  %&0S 0AS B0C2SeffffffdffeffffffTeffff$dfffffffffefffefffffeffffffTeHdBKAA+g p K@ 3@PH@0 S BK@@ Htp0P4 CNK@D@DLP @$@ TBK@@^py K@ 2@P CCNK@D @DH  0V  K@ 2@PCNK@D @DH 0C  K@ \2@PCNK@D @DH 00  K@ 2@PP1p  PPPU ^;TK HH#UP HUP1 (K HUP HUP1( KPCKA At 0S K@F ,P00ARPPU@;P H' <P4 @PLAԏ 0L$10S% L$ 0BK1AA ᥕ 0Lq0 ,0Sp,o!`` Х0HtP4Xl@$ܦ -LM0pS`P P0S P0S(K 0P(aP@ (帖  (%jU00@@ ,P00Z00SP;P 4 -L M⼠0p(0 <@K0S ?`V t@P0@K`0P{ ,P ;P <[ (0S (o!X,t -LO P  -LM@BP00@9 -L0Mq0@HK 0 XPtF H`VA 0PU:iP5 0S 050P0 %S$ DK⮔<@ 0R D0S 0PP  pi  喔@0DP00 0K@K40 協`VD0ST 0< ,HY 0S ]o!toԧ0 c -2LM@pT @pTwP` @TP 1 0R 00 !00@0c|!S0"c1QP@T Q  D1RT0S000000@T^  ᲀp z0#S v0S \ "00 S T0S 0 X 0LKX 0 0A0C3Sgt<DDDDDD,DD,DDDDDD4DDDDDDDDDDDDD<DD\<DDDDD,DDDDDD4 X 0 BT0 X 02 QP0 0R rl50000S  Q QT  x0: p 0\ T 0T0 t0 0 K0K p pp0  "0 0Sx Wڜ4  0T|00 W00S`4 gdTP #T TQڗ Q4 a(T R ZT Xp WL K0B0C6S񟗾TTTTTT@TTTTTTTT̉TTTTTTTTTTTTTTTTT$TTTTT|TTTTTT4TTT PP"00 0PET1* Rr200000SP 0RQ 0">|`PE0'S"S $S `S \SPE\000PE0P@ 0T:Q"00PE00G) 8 #" ?K b *  0!|PP`@%: 08C8& 08#8X!{PP`@08!00!{0!S aPP`$f`cP`UX0\ :\RX 00ƴPERp#T0S\ PE ƴUT0Z0hd,0 ST,o!c< 4qhȬTGHP(@ -!ML M4@KPp  `, 岌0S3NK@D@D.ʍpX lx `h KNN00H D d8S 6S0h8 h8S @>K0C 0C1 BS 1Sφ@T0 ,0S,Yo!D p-LMP`P@  `pPP0-H0@0 80840400,0  @  `   -0 0CS00LӤ07e ^00# P 0 000t0 00p PQQ8 00C 0000`  ` p-LM@l1Pd1` PP10S Q q041 0000S#Q"Q0P0`pQ q0 00000S-Q0P0`pQqx0 00000S X0PP0`p80< P00`,0 00p` 4q   0-PL0@S| p0 h0R`0 X0 T000y40 ,0 T(0 000@      -LM℠0SxpxxPx`0 0 S@^L0 D0 @Y(000@      -LM@p P p-LM@`Pppn UP\PP "P H0D0@T80T0Z@D0   0pd| -pL`P@xP000PP px0000D0SuX0 L0@T<0T4 @D0  04q` -pLPBo@xP -P_P p0 00000S<0 pt0 000D\0Q`T0@TH0T@@D0  , 0h4q`  p-LM @R`pRx90000ӑa0CSTDdؖėt̘$44`|d4ܚP44@cIPp\IPpUIPpNIPpGIPp@IP|pPt8IP p\1IPLpH*IP8p4#IP$p@IP pIPp IPpIPpPHPpHPNp IP 0S|ptHPFp` HP 0S@p @8HPp HPp@HPpHPCpHPMp@HPpHPpHPqp@HPlphHPXpTHP[Dp@<HP p$zHPpsHPERp@kHPpdHP6p]HP/pPUHPp kHP@GHPxpt@HPOp@X8HPHpD1HP4p0*HP p#HP p@HPApHPp@ HPpHPp@GPpGPp|GPKpdGPTpPGP@p<GP,p(GPpGPp@GPQpGPpGPEpGPpGPGpGPxptGPdp`GPPpLGP<p8GPp ~GPPp@vGPpoGPphGP:IpP }GP@YGPpRGPJpKGPSphDGPXpT=GPDp<6GP0pp/GPppdԭOWF6 =?M 79$"8@H*\IlCtx:4!ЮKp%Ԯ' bEA13 l\;3 B,4#`Nx@&TG T\+dl.t2|3>Jt4 ̯/)ܯE -̻P B <5L --LM 0 r0@l 0S X҈P ;L 7@ 0S 00;R(tP Pd(X` --Lt r0\ \;X0XH  H080S $   PP d --Lt I0\ \X0XH  H080S r$ ۖ  זPP d --Lt  0\ \X0XH b H080S I$ 㲖  㮖PP d -L`@P4 pR %R0mS Q0@ uPD"`@`PT@D ń R00P --LM@a 4A010$!$Q$`ju0 !  p  0PS00  c 00S ܇ E A҇ ;t 7X0d  B1P -H0   dP t  P d x@  Mp-L@M`P@ 0K 8 DK40 D0RX QX 0 00T K0QXK000 S po!| Mp-L@M`@P 0K DK D00P0X0 XKQ  0 0 T0K Q00XKX0 000 S Ăpo! M-L,M|@  (K ʅ <Kƅ(<0 \$K8K*P 0 S o! M-LM@  (K 墅(0`S X$ C0S880 fZ 0Sro!Ȱ@-\@ * "48<#P @"@"\:\* 0P @"@"00#  p-SLM@P` (K 0S  Mq0 "KS  @ c0(K 1K6000p -LM<[ @qꛃS|P@ ,哃, W88 0`0U8Q" ?8|P ?0> `qB8 8 0@8?>qGW|88@ T|8@T  8Th -LM`-Q@TpP00S xR@ Rr100000S@0w @ `RW B @R7 B/R0 BhhR0&&SX0 E0220CVT T !X  X X BX U U U 0f0fifii(U U U `!ii$4q@D@ -L0MPTpK@PbT080 P@VT2< Pv>@ 0C<0 Ş/P@XGP@`<?T0@@0 /P@4 P@-T0D0 yP@"T0H0 n:P@hP@T0L0 ^:P@ hVP@ L7;T`Tk`0P0 0` 4` B;P@ #M<@E0L!!!?!C!c,B^ B^DHL@PP 010000012c12c1 C @00012c12c1 C @l(Tl@ p-LM`v@T0 zPUP0`z0p 0-L@0SP i0000 p-LM`@ 0 c)p 0P0 0U0Pu0#S 0S R5;zz0p -LMpP` P@X t`Pd0S 0#S t  V15 1;@Td -MLM%0KA ,0 `hQR Q *Q 'd8 SiKAA ld8 S:qZlPP 9vPPXO l(KA Al K+B 0d(0Rp8:s8pP@ vP@- p({*zz>K0C0C#8 Ȁd8! Sl5;h#cKA A]t(d8!M@S:rtP uP t( DKA ?xd(0@R:qxP uP| x( &KA A |(d8@S:r,|Pp uPp |(PゎKd8H@ HS( ;KA A01(81(Rd8@S|:rxu0P1P (PUڈ< 8 ]y [yYyP(1S>K0C…QyPU+d8PSjz 0 ( hX d8 ZP@^ KA jPVKA A aP\MnpDF<C0 ,0S(,{o!4 -(4L -p@ `P0L0 %P00 00 ,S;S;S 0S0S0 0S 00p -LMtD`ğ0 q00  R 0  R3 P 0EUS((\ ((\(((0<000 q00  R 0  R10q10  00S u1  00S^U-U`F`u 2pP ^U-U```\uP 0  }P`P 0.U001``P  2pP`P  0 ;U0 0 0  `0S Vl0 RP /UP` 0U004qT @ -`OLMp0 q00  R 0  R?0P E0pR                                                         h       DD                 8 |   @ xD 4   ͟ 0nS` lS0 P 0 R0= R =p P  a`0pS`0= = P@=  P<= R8ʘPp̟0 0nS` #lS0 P 0 R0W0L kk< R ڨLը `0pS`0X ˟ 0nS` lS0 P 0 R0;T R;;噫{ `0pS`0; Ro0q:0  00S` PpʟX 0nS` KlS0E P 0 R09: P1P2P+P&\!\\: R \t P 8d:)9@   B u`0pS`0 g c9 R ɟ, 0nS` lS0 P 0 R0 (00cS0 (0S q8 8`0pS`0,8 R0ȟ* 0nS` lS0 P 0 R0 (0S070S700L`0pS`0 XIPTǟ1 0nS` $lS0 P 0 R0d7 R 7`'8 PPanT`0pS`0(W PdƟ7 0nS` *lS0$ P 0 R0t6 R 6p& P T&00SP,L`0pS`05 R 5 R5 RH0q(50  00S9 Pp3 0!Sğ* 0nS` lS0 P 0 R0 0S E nA4`0pS`0p("4 Rß 0nS` lS0 P 0 R0 D`0pS`0s0STß+ 0nS` lS0 P 0 R0 d3 R @Pgtl`0pS`083PtŸ/ 0nS` "lS0 P 0 R02 R 2"P. P+8|`0pS`0r0 PR0& 0nS` lS0 P 0 R0\T P]`0pS`0@Q1P* 0nS` lS0 P 0 R0 1  P`&`0pS`04qhn  d@H3`` |!h|htDT 4q@l\l@p`(0?PR$dPPI\0 RA pW0 RX W, 0nS` lS0 P 0 R0 41 R PBO(`0pS`0|1P( 0nS` lS0 P 0 R0 1$" 2 P@i`0pS`0H2Pp( 0nS` lS0 P 0 R0 2" P 6`0pS`0,3 R4$ 0nS lS00P 0 R0 3 R 3 RqU ``pS0q40  00S[ 4 RD4D$Pp8L 0nS` ?lS09 P 0 R0-4 R' D0S!\  >\0S 5\PH 05 P C 05 @<I@`0pS`0U 0gS S 00C S ,pP 4 6 p W 0 Rd6 R d6   0 S 0 S W0006P  PP &U P6 P7 00CS0W0vqW8f '0S00000Y00#000# 00 0nSK ClS ; X L7pPt. 0nS` !lS0 P 0 R0(0S 08(8 P`0pS`00 00pS0 000ܨ g P 0o9vcq00CS08I00p |  9  W- ` ppS rS0p00p0p9PJYPA9 R9 pW0: Rd h 0nS` lS0 P 0 R0 : R AP E`0pS`0 9; R# 0nS` lS0 P 0 R0 Pt `0pS`0 +pWE;UP=GUgUFP3VU00GUX $ 0nS` lS0 P 0 R0 ,000oPc `0pS`0  qX QX} 0qD=0  00Sn _Pph L= R|QP=- PT 0nS` ElS0? P 0 R03N0S!\  <\0S \>TTTWU 0d RP0P > R > RqXG IE`0pS`05? `|? R$! 0nS` lS0 P 0 R0}|?`0pS`0? ? NPD010CS0 0nS` !lS0 P 0 R000  Q0 P|`0pS`0< *pP0000  @T -`0` LRTLL0<SS,0 0Qڎ0 @ -LMܠPp@* W* 0 0S@@T0Tl_`KPP l0 R   0廙P 0+T 0EE@@<  -DLM0 R0Ÿ" 0 q00  R 0  R1 A0 Sb KP$ 0!S[ 0SUʤaQAڄ 0  Q  0 0 0 0 S 0  sP,q$A0\00`P 0P0CS0P0 0800CS0@00`00P @@0@p4q htH -h6LM PR,P P,KB@@Pp 4,0 Q$b0! P0 S 0 !R %R  Qd 00P0\ST 0 R Rʈ5 ett5 P %Q00!QDu8ş0 R`l00#`P 00CS`0d0 t00U8.00CS0D0]0 0 PHt Q`l000_P 0$0C`#S0c0 5|00S= `@f3 , Q@p,  0 0,0P0Cs,0 @00dHs Q`l000_P 0#0C`"S0b0,0T4 2`V0  Px Vp|000q_P 00"0Cp("S0(r0 }07{00CS0KPE 0SB q0 Qʐ0 0@T*0 0P T:}Pa Q@L000'_P 0!0C@!S0A0 w30X7100CS0z`匐0 QP\00^P 0T0CSP0PP0 K~0l\`@htd -鼁LMⴑ崡`0SU !@PO 0 SdP? pqP000C@T V T (1 BR A0 0 O P`00CS0@000.S0 S9P 0 S R@ 0 P0`00`h@t_ -43L M0 00,  R h,e P@` MPpX آ 0S2c0@` T QڐR2 Q@L000!^P] 0P"0C@H"S0040T-P*p00 p00X0P T@00b080pP0@h@t -LMA`1@ 刑0dTpP`V0dfPU+UPE Da0002P@A X@" 1 BRA 00SpPE PZp0 RPl 00CS0\@0000CS0h@t -LM@0p`0 0!P1 0GPxP u0@ R@P 0f  BA 0 Q@0Y000CS0H@0A0h@@t -PLMPp 0 P%`"P@ X P 0 PXPP@T @  -qd0L  000S< 808!R000 4qt -qD0 0 0L0S$ 01h4qtd00@-S  L@P1S0Q0C0 Q00R00S0 p-LMP-[P@  0`0`p3p P- L 0RA\S P -4L@QP a0 \S0 P@0 U 00؀`0|00C[P 0p0CS0p0 Q0v3`O00CS0@@0~:0ht -LM@@0@ DR0 <@0 @ht -LM@ݙ@0@ DR0 <@0 ϙ@Cht p-0LAM 0Q0 @) 0` DP!\ p; 0 Px@P aPGOK  5H .+0 $wxo!t@l -80L R (@ 0! :5;xt` p-L M@mdP0@D`P K` 9P 2[![SC$0BR0T`ptht@ -d0LM @R 0H!S  Fa0S/$q4Plܰ\ -L P> P4 000 S/ S- @PP pP `0S YP@` @@ oP|0p p0Tp` T@B0S2 R! BpD"!00CS00Ӥ0 PpP PB00CS00Ӥ0s PpyUYUi  TpPpZ (&@ T ڛfp00T0S ϔpT>W6 1 R,0  !0S NCLCPH4峔pK RP  0R1 !ޛP 囔p P#C!C劔p|兔CCt/q/x@ܕ0Sa  (D,$k `L!_P@ -LMMpA^K PE0PE` @ 0 >p 0T0 娕Pxph7CP\0P 0 S @ S@('o!\!lx -QLM@l z0S\THt0S@4 40 0Rh.0!l -QLM@p S0S`X H40S@4 40 0Rhԓ0!l p-LM0AP: #:0$ h?`L3c0(  ,0D?B3c 0l>P@BV;  wP 0S 埓@0<0V$ ԚP 呓@0V0 LP ܎0-S xl@pL0S LD>4'e K h@Mb! -L 86@P髎0 R  M! 0-,@,PL $   cO`  -BMLM;;BK@(L; L , @0gS0*K`K⼐帐 P0@D{0 040(kVP ;    0uS0nS00:  B=K(0C 0C@ SVP  MVP[K@ @Z)0(K 0TBMK(@D @DP B}K0(pG(KpGX 03P@ ?hB]KBK0T(PE(L PEL #%-*01v3P@0C0B-K( B BS1`@ 10DES񟗾,m,m,m,m,m,m,m,m,moooooooooooooooooooonooootnoooooooooooooPm\mmmommoooomon(nodnnononlK@@ )0DqlbnBMK`X(@D @D ;00Sa ,&E7 /'P(NܧK@@ (Mǟ0 0 0 @ l77BK@@+( P#%* K ,t7 (LWKBMKL(@DL @D0.S 0.  0 l b(007   &&000&6PPjrp@060XaX6(K0&SBmK(`F6`FK00Q06   U@!0-S 0$S6 10005 @T*K R 50XSp5% 0X0KQ000 0SڐqD%0s500 huP*a3P0C S?pqqqqXuqqq(q40S b  sw 0S.(PNK@DK@DLL$0B P *@ᒳP@00: SP X @a@00* R 40S R30S3#3P `C0S 30SP a(0S BK@+@'(*K R$ 30S 0BK@S@ +P20SarNK@D"@D0@A P! !%*Ÿ0S#BNK@DK@DAAT2Ppp0SP8: SBPI KW  8: S:Kq0S 10S10S i p1BNK@1@DQ@DL! 0 P P $0S3H!0S/@H10S(P$ 0SdX:K0S БP 0S 0S 00S Z ` CuP``00S M`o!O#$LL`#THX|px |!# #@$@##@Q $ @dl2D`zDv$0 -ML ?>qP 10Sp IK(@D@D) ߱P Uʥ?0 x10S)KlLpK(A AP W010S(xp >P W00S9KLjp00S0(K 0(K0R0(K 00R00SŴpWh00S )K( B00C00(K B0 ",0 SL, No!@#Ph# $#l` -LMK _P @0S  [0R 0[S 0SL -ML4M8ğ p0, )KP0 `N P@40 S30S >P 30S P 30Sr_[=|ß0 PR  0`0P Pp$30S@=3@T KL" M)KPL20SKL| O`P x20Sp IK(@D@D))KPL Uʥ?Z00S 20S 0S D _뵉0SYK(PE PEP Z10S|^1 R1(K0AS KPT1(0,  0$   0S L QP00KLq <P Z00SZ#00S (K0S KP(K(00  h00S )K( B0 0C00(K B0  ,0 SL,Lo!@#P##t @$8`# #D -LM<0`Sp (10S$,0!(PϠ ?BlD3c0K0 , (P $0 v8P0S k0@b_k00 0PEP 0Sl0;0I_PDLQ 8P  $#Mb  0-@LP<P!  PD|500CS00Ӥ0^( Pp@ 0@ 0CS00Ӥ0P( PpyT0`L_ -pLQ  uP@ XP0@S $P`PD1SQh% -Lp@`PU 0 #0f0@T oP0Sr00a04 0 dPPr0000D0`d -L 1,PP00PP4PPPPPPDP g0p000wS  @0P` GH0090忆`0wS  0  P  @X@H@L@P@T@ -PLM@P`(0S 00wS` rS`U l0 0 0\000T0000 V9`9\GT@H@P@L@ -LM 0K# \P p-LMD0@S PH`U KP)6P0 D0 ` 0C00  p 0-LP@@0D0HL0 -RLMP` @10@P]T@TSQT1Tq 00 @0D00@Dt p000 V@O@0P00 V4|p V00 0P00 lpX  ec8 000DP  O0 0H@L@ -L Mp@  T,KPt $+K*K < ^' K)K&K%0K(K  ^  $ K` 0# KT, K< 080  4@ {M0000 T  <K+ 0 pS Ho!L@ -LMD0PSp NRL @T T@H@)>P0D0@ P`.  gp0P 4 00P + 00$ 000 P@D`  `VD0S0S$@  g0 cP@L@ȠQ0@-,Ƞ@P 0RO @!@1UQPa30 0  0  0  0   0   0  0  A Q @Q 0Q <0U'7cb2" cb0qh0  b0 QŒ00 , P0 0!Q0 % -0L0S%  p-QLMP@`p00SV@+00$0!0$D"0$0!0$D"0$0!0$D"0$0!0$D"0$0!0$D"0$0!0$D"0$0!0$D"0$01`FV$D#V 0 0$01`V$D#p% Pp@-@ $0 RS `P @`` D  $ 0 4 dHp p-RLM@` @0S01RPPU pPp(0 PS00P(0,0S00,0| (PpVF20`f$00FPS0,0$0p0,0`ph0 0P00D0 0L00H0 -$@L,0pS` P0 (P, Q 02 0$(0 `cV:,b%J 0$00(0(0,PcUP!f J`V ,f J 0(` (0 0S(0$0(`S*0$0 -PL,M4 8 S $`VP 0SM 0S0SG0S00440@  < 04pD H L0 0S1p0Ș|ܙDȚ؞p| ܢģУܣ0S0  WZ 0JpW0(=à c0#22cPQ0S(0 0SpG  4p008WZ 0JpW(4<(<,4<04p8000 0S  40808 R 0S0pc80WZ 0JpW ⨀0 pGS<DT\0  00$<4 000(pGc0pcW8Z 0JpW;((8#"(R p08 08PU~ @ U P!UP!Uy  <I80@ <0e e e@ < 801 WZe 0Jp W⨂⨂;  QT X\(pGP0`000`0TS*WZ@ 0JpW`: 0 Q6`威pG:`Q L*00 0R` R. 0D L0d hd0L PP 0L 0L` 94 094 000X0  `0S*L0 #D B ,K H+[0SZ0Jp[PW*Z 0JpW:+0[` pc8 VP0W*Z  0JpW:` +0[Rpc8 00P(pG*P0W*Z  0JpW:+0[8pc0P⨁pG0W*Z  0JpW:+0[8pc0 P⨃pG`X 0S|PEu  PE0u ` X `0Sw:0S6 R 0d@DL0dX L_h0PPL Gd0XH00P0\ 0PhPP 0L 0 64  03L 02D0C0,@K G+0[SZ0Jp/,0[S ,000 /[0 [0 20C"[0D3  G/ [+0[0SZ0Jppb82[+ [80,0[pbS80  0@54 00@0 00@Q W*Z 0JpW:018 0C0 8 pa8 00P 02H0C0,@K uG+0[SZ0Jp,0[,000 /[0 [0 20C"[0H3  XG/ [+0[0SZ0Jppb8,0[+ [@pb8&2[ <0,0[ 0@0@Q W*Z 0JpW:01< 0C0 < pa8H$0@< 00lR0034 0f@Qt H <0PaS<8P c ( PeU 08Pb,0e0eU P@80UP!0ee80@ 0<PU0< 80S@ RK 80< B0< @ 030S4 WZ< 0JpW4H@ l0@H 0Q00 < H0c +48(4<,(<4 <@SH  14 000p00 L 0L0 <4@ 00S4p0S0H R 4H>P 0040<@4p04 HpPp`De0@ Hp D 0 0RW0 4 H g408 DpHQS@004 p8p  W 043R40 LPL LB$ -PLM@ $ R ,\ ,0S0 0$,0$0 P-LPp` $@T 0S  o l0P P 00 ,VbE 0$0f E$`0 0@-0@SP*S\\0 ^0c0SP:0 -PLM $X0S40S0S 4 00 cR0004 0 ,0K 4 00 B#4R004 0``0,K `0@ `  `0S  @`p0P000P0 $ P 0S40S  0 -Q00PppLMW@$PU (\ ,0S0  P` ,0S  0(Pp0,d "ED0H d0e ee0 WD0H d 0 ,#E,p$` -L|Mp t x0 0LK X R *t0  0 Z00: | |LK00SP| |Y!Qp @00S@TY100cQ^XQp RW 4[ 0cSS06KlK 0 Xj0K Z*t00S 0 000峠 Z:p\ \   #3̠ 0 ll  90 L3p\00x Q00 S0p `0    00lQ0 +0K0,0KK `0,0KպKځ 0,0K0 "K0VA Pd7 ,K CDU H0B @T0DLK p0p0Cp0| XB 00t 0ᲀ X0^ \  0&`l|0 R0 *00cQ`|0 R:L1p Q00R00S Cx0 a 00 0bC10}@0 W,0K+K"K# \ 0S x  +K07  ,K C H0B @T0DpppWx010 z8 0`x= -L= -L4MP`ǁ ' 0oS000 0gR   L0 0mS000 0fR  p\ X T0 H0 &ap@H0@ 0SAıбܱppH  L 0T0 0SD Lş1 -R5 0PcUa.H QP T0S4WppZPp P @T 0 000CSU|00,K 0@M|0S0 ,0 R0 l @ 4@ `P dPP `eP@ 30C Sꜳ <<H RK 0S 0S @ R4 @4 L00L0@8 L00L0@ L+P X壀`0S @0SD NRP LQ 0S0ST R X\ c-P L0SX\ +8@0<0 fO  x`Q0SC  H`Q0S}T 0!R0{0Sv P4K8 K0KZ,P0 #80@ 080 WPU+ P000CS{,K@ P@{0S ,0 R0D@ @0 ; \ 3L lPp{"000P< @@ )0S :@PpP b\ 5X .P@ *pX pL\ o0S0S0@0e0@2VPDO$$`$$T@QdPxR 0-LM0@SP XHP 0K p 0 R U 00U O 2P -LM0@S $:0SK  wp 0 R  O ]2P -t0LPd0 R X0XP PP00L* O@0( 4P000($`$Ox`A$ 0 p-LM` `P0@0@\  0S 0S 0S p`0 -LM"00Qp,0 w$Ps_`0@0 P`O 4d[$K4!04  PN \P4 T勏K` @0S0 0 (P  !0S0 R0 0  0@ f@ 000'P0S d0 ,0S \,=0S 0QOo!/@..  -h2LM 40pE ;;S0S~QQ0SI R, >,0  0++PR, 0\ (0S*fP  ?;?00clcQ/\  D',0 X00000000S0S0.P@0S0 & 0 X@0@@@080   0 0S~{/<0@-@ 0!?;?0c\<`?* Q< R:8\0P0S000 0SP P Q!0/S0S*U 00SS 0 S /S R0S00/@.  -MLMp0P@AnK 0 `F`F uO 0%U0 U 0S l X<@!0S D 08: S0  o!P/\hp- -L@!x^0hFSP7 !0Q0 0 : SWFH` d|Q0 R TQ 0S 00g0hxY!P hqy OXP 4h@1&p-t.- -LCM0`,$0 (@O@A/ K0 0R00P00 P0eS&0eJ/K0P 0 0p 0S0  0A? K   , >U 0SD0 R0 0  $0 S $;o!@.`-. 0-(P, L@ @P  $0 0 S0 000@.`- -LCM Ml$E~KpGpG 0,           `$ \$ ` 4* R@ R  d$ 0S3 R 0 P, 0S x뤃0SZ3 (K 3P\4 4 XT @T40 @TP C0@: S< 0,f P,0 S ,;3 2@.PP 2 P2R( K"\$ XD @A08"X2 R0S @mBNK@D@D~ P@6 qd4 S00C0 {y !0@00e 000p@y `z 0000S M0%,ws (0SPY 0 PQ 0 QP@ d0SE wB< @0S: ^M7PD o!p-.-@1& @L&T@0l `0ܰd$ -T0L8M<0 0  8 @ 4 0K0 , ( $   H@K -CML M☡0PP,0  1Q  0P1#\Q:,0 S @,9EKI I0 0`$ @( K@X d 8 \ `0@0 BNK@D@D 0"P  @00@$;D+to!/0 -0#LM0$,0 P`P 0  Pp@(0S  0 2 ,0S ,98!P4 42((0,00h0O0 82 008"Č Rh  0P1OP5~:\z:00/0SIOK,c<040#0PS<,W< 00L0TO:0082 S0,  0P1OP57:\3:000PS 0<01 R v@@aP0, P( ,P0h0QO 400Lh08"i 85@0 L0P ;0 0L T: 85@0 L0~o!/&<.P\ 0)-Lg1!1Q@@ px`0(40PS ; 04L0T;:0000eW+ A 00CS00 0S 0`00D`0` 000`0 ``< {;0 4L T:@.&&/`0@0& -@LMT x00C0h@-p0\ ` L00n^@` 4K0CB4  0D0 04 01@DpPÏPoD \ 0 ?00S00X W 0t/1E $$pWR`P1 ,0S ,|7 0 P  `0S@tP1)O  0 Ppz@0 `( B0B!Ot0pt00 S 1l X 08  [D@ 0(@_R:0S:P h0So!/dl 1 -MLM0lC\\#, 4 @(  P@[,4(0 B04(  3<  400T` t00\F" $p`"0t/AV#1%Y X @0 0 X \2R_ QQptttl th0 R 0Tt0K0  8s(s/ .T, -0LM@ 0h F\ 00CS hx 00 00 D`0P -X2L MP0 p <0 R $ŸP0P*  0S PU:0U 䑟@}40 0 ` 0! @!T 3S @0R4h1T\000@O000D4 0 0 X0C 0: 7 X  0000@@`kP(0@00,K00d0, ,000 0 40O 404h0  T0 RH H60 Xy0 0/`0//U `@/@.`- 0- L8M00 H0 <0 80 40 00 ,0 (0 $0 0 0 D PK@ HK@4 5`$0$  00C00l -`0@/ -LM@Por0㠂堒堢,0 `00"!Tpf N0@+S񟗊tttttttttttttttttt @dtltttttttttttttttt!000  0b`w1  r 0 |c`jp1h!` X0m^>0D!S8 .0`000`001 Q@bP ~0 RwT @D 0oT@D fS|0| Np0 ,0R0,0 C(0 |!h/ /|.(.t -.x&@QX DZ X O2 p-L@M P`K0S 0S  p 0-@ LP(60Sh  !6P@L 60S8  6P0S03/\+' -LMؕş QS, @i0S 0S]p P0S l5 ,0S `,[1TL%0@D%S001 0ş0S 0S5 R n0DS 50S ' 0S  0S S 弄0帤`8 pb# $0(@q22fP1i2\4/ 0A!b!L@ mq#0S ğ$00`0Q0S #P 0,0b$@0@@40@62@@80#c!00acQDß0SdS0S|X3 #@P@@@h0Si43 R b0S  P,0Tp0 0@"d0 #: P,0Uh"0rSX00R@qb-@-@-@P! 0S( 0S1 R8mP (uK.P!0S lm( =K8 @ < (P m`1 P00p@T p@T ICthp@T Pp@T :Ca4pZP`$p4mm mm|0p~Pmm .o!.',@--4/@/`.gfff$/1,00 -. 10`0@0H:t/ 4<Pd4LY -,0LM ,0  @!/`%T -L8M聟 `,0V!0 00!V0@@T Q?>1 D@!T  `,0V04 @@0T Q?>1 D@!T 0 T0 0̀0P( X (0KP L H D @ < 8 4 0 , p>뜠0 0P,0`U0@T UP@XKP 0 T `,0V00j/0`.@/`%, -LM0 0,0 0p:40  6 6< 00`<0 @0R)0S&6 RtF p 0d 0cP 46 ,0S <,/0 '  2 [o4 0S R1 < 8 0 B ?t `PP@404 S S` Q V@1(@Q0 T `FV@ 0%0tP0P`@T1X@QzTP $0000 00SW4 Q4  A 4 4" 4  R 0s 0 p00t 00pKd4d$00d4 00$4040$0h Rf   #0S k 0p$0h0fPR <0 00x3t3   |~+P 3 l hP3 R! Hn2 R4 3 R <0 R 0SR;Sh0S)|0<(œ R:0S:\4h0S1<  0@#? S`& @CT`0t0@DT `4"80d a( Ÿ.bP^1 R  p (0h0<0 0<  0 0P-n,1 R 0t#nlP  0p4< <0/410m($0 &2P X 2P0S 0S 0 hP P0  } D 0F [ o!/0.`0l-x.@/@0`-. %@%?, .,L--PD -LM@P)Ppe`VWY!?> DR.000 0. $0`F0V$0@\ P0 S00*P*P ,@ R0 0  0R 0S R0R0S NP  0 R ^jPd X\0 S00Hō<<; 0`.@%0@-.  %PD -,0LM ,0  @/% -1L8M1q1!00( T (0KX P L H D @ < 8 4 0 , ,0@Q 0PU `TP@  @0U ,0X00P @0P@ XK0S Q @-%/, %`0 -LM`VPڴp崀,@PT 0S  0T @T R 0S `FVP 0  0P 00%0 -LM @0 @%% -LM @0 @%% -MLME0,0   BR0\ P    P L HBP  8%PD0 %0S 0%000$EKI4 I .q0ğğ q`$aA4( Kxx$x4xğV`$ 0d *MKJ J0P000Ss`V:ğ($`0V0 * D0P00\'`V:ß0 q`S00*PP V:KP,0 S ,i+0S 0 P00S 0 S s S ,#P# /  00C0 "P  000 00C0  SV;;S Z/\"9(K00MKA@AKK@ $@$.0 \4  X$ iBNK @D@D0%1 R" 0̠  A0S0?0?00 R;P 0 @hLh0̠ T@y @F((. 0 ^ PPP PP 0:0 ) d o!`0p@.`--2 %%L  , @0ܰD-4.\PD @8T -ML8M 8Rp, (`  Q d8 Q\853 575$\M@T 0 .P ȟ0 41 R88 (K(K  (K0AO0KK,"0S7(K (K(K ( K(K0 00RP @x .P^^>KMK %-8dP$ $\0S,  R0.S $0&$00@T&+0S T 0S V 00CS񟗓  T T $0SX 06 ,0S H,)00 (&A 0S U0 S %/ 00P@@%00C0(0S$ $\@NK @D@D0\S^K PE0@08%4+05 R $fP $\00$0S0 R$ 4 R4 R$P 0: S0   P$00@^P$0 0 Pc0SM$\6R 0.S/00x0 41 Rh3d3 (K(K  AO(0KKK<,(0S3(K (K(K ( K(K0$00\P000 Q0hNK0ᴀ$00$02  0`0C0 -@@@T X W-P9 0 Q-P+0SP $00$0P "00C0$"2>KMK +P!"C00!9P1@ R 0S 0,0 P>KMK Pe+$00$01  0`0C0 ,崀^  `\T 0|0 P\0 RM 0SJ @00>0 .o!/`-k @.ܰ`00<(H@0X.-<T $$0c -LM @0 @2& -`!LMX0P!1pCH1W0:<000@`V Q 0 R 0pGW* 000 R PQ 0 R 0 UP]`@YPl000`0  00C0D0 0@0  2-, &`03@1@0 -LM @0 @0 & -L4Mtq lPhh!0$0 @P T0 L0 H0 D0 @0 <0 80 40 00 ,0 (0 $K# a Q @L@ 00CS6 d  d   0QP 0S P0@T000  00$xTK TK p 0STK@ <0 ,0,t l &`0@0, -`LVP)P>1 1ER# @T 0S @T.!0EX00C0`FVP 0  @00Z$T0@-`. -LM @0 @`&@& -MLM0Oϟ ,0 KK(A@ 8KA@K  *K$? toR@X\$UU.K! U5U3N8KAK^, P0@@?|\ ``N A$e @'?AV@0p`'/110SoK $ULqK Q8K1PTPK XP5\@@?NA`@ 0|0l(K0'?K!d $5dKS@B@h@$5A@l@0` | '?8K1Ad@HKAK\ d0T@b@aK0=KKP 08K(0CCHK  P*<K(@0@ SHKAX4 ZK(NN 0K 0  $08 00C bpX L?>1 H!X ,;+ ,0(KPK4K KTKKK K `HK @0 0 ! 0l  K`0S 3S 8K EHK@K0 $K0P ,00C\P(K;!1a HK@Ke$5S8&KpHKAK  $  K,(0S0@0^ TK (0, (K!0000@8K1J K0RP04080<0@0D0H0L0(K!KT0K !)L5(KsK pX19Ϡ 0.0CS  t t t  HKA000KK 0IQ0C  0K@\00> 00c# XpK^K(0SK.!0\00> 00c# K 0X0C 08K0UB8p WG?>1 AR!?> p W ^' ^"KG$0KQ0$0K`0.!008 > b0Q0cKP! 08K Z $5S,Kl p@h0PX`P ^ $%^ࠡ1(K01!p@0SX^ $%^ࠡ101f(0K( KHKAv0(K(K$P@K1ܥ(0KHKA 0 (K(K(K(K 0(KK!P3P B (P5 R9 8KHK E'PşK,0PK_PPL5@s(K 8KP% (P,0 S , $K P K0PP0K(K8K w(PHKA`ğ0(K SK T0@D0KSKTT08K ](P HKAh P3 R KXK8K1 SQKHK\0A00RHK@pK\000?000S @@T8K1HK@XKX(RRKHK`0@00QHKApK`000?000S @C@T8K1HK@XLHQHKAK\0RHK@(K \0K 'P' (K!4' P HK@0(K SK!\0A0SK\0|A8K &RKK0?\04000S4K0K RKK0?\0000S4dK0K YKK ]KK o!`0 -\.0@&`&t ,`$ -$@`//U /.`/`0TKK8K %HK@X0(K SK!T0T@0SKKT08K @%K| PcK@000| #K!0pSK0T0T 0 000| #@P#0 #0` #PE#K!0SKX02000000$%R8#(K!?l>1 @  KK 0d2RK`00 ?> 00c# 8bW d#K0HKA"0#P>1KKT K 0 A ͠HKK,0 P54C0SPXP 0S (KpP0@@?|`N A@?#?$%ARP `A2#?AP=L0P4@ P $4o UTM$5SDT0S Pf0S`P Kt4$@@X\: 0 0 &&0&0& --L 03` p-PLM@P`l0l R  T D0 Rp80a s4 0  a 3&&O --L  --L  -LM@]K h --L 2 p-LtM/Pi@TK P0: S p0`rS% # 0-/L@fiPU+D0 00/00(++ 00& -LUMpPKPZP@lK8S0S-0: S  SU CP U@P P@0 R000K@/P h1: S@ ac$^^&H: P-L P 2 -QLM@ P T 1 -LP 1 -^MLM= =@, @= _K A=A`P҃P^5: S  PP  PDx-0S< l= R0 X 0S4= &D `40S 0-@,=@(-(@@@ @@^0 0Z0S P ,P(0,<00iPIl0Sd<@T 4,0 S h ,(,-K B BP 8 HPd5Tt5x%0%#,0106Pd5@T˟˟+; 4`d5T `m; R0  V$+0S 0h$ p , L+0 t'#Po70Cɯ5@"%$pWZ0S[0<cQM0ZQڨ0Qڼ /0@L@0S \0*0S2 P. 0$J QQ\  000S 0 \)0S P  00H0cQ  000cH0t)0S \\0S P  40L0cQ  400cL00S ` \(0SX P X,5S05S. S ( 0S>0S \(0SbP 0(<Q  <0(5<(0S n\$0SKP{  hH080@_Qn d H0S.0O 0S N\'0SV+PR  gL0@0@_QE p L0-0O@'0S /\(0S. P* 7 W0S0,%R0S0L%r 0S 6 R @P `P3S x 0pVPT085"d@00PgS0$PP Ve 00 pWD&00/>10@\6PPF 6E46P(@ 6P6 P5& 0%@U5 @E000%S P 4|5    d{^ L``P` `$h !(4Lxa(0S? $0 00L 0P5?T5 V>X5pP0@@?|PN A@+?$%AR㰠 `A?A=`L 0D#D3 P 0S U0 00,%0S><0(5 H0S.0O "L00O\P p"000D5SL000<5S,2  2 }000a45 SJ]H0S0O L0-0O021  1 *1  1 |000h1@@4P  0<0|P 00t!0S0][ !0[t0Ps]Y  dk]}Y Hc] <<`o!-.(0(,.h/H@102/T0 ..|((Dl.1/Hp|@d@. -0`0`-@0232-,-p`/4\.|x$8HPdPD -LM PUŸ ?7P1q :P@V:` 0P\%1R x,Qaڴ RєڒS0ARph0 S\8Ad0400@T 1 , 0 B0 0!Ph 0SP 0 R,Y@Ph00`T*0 QPd@T:aA\<.0,/Tx-2.<8` -PLM@ 00 R$hZ]\. -L`pP@u Pa0@S p$2@  0@T{ q10  00S2WnC` `F R R1!![!@4@ P8P00 $ 0``,008 (|0 @@ V0 0`V00 |p0B000@8@@P`0$0@0W`,d0`V0d0( 80 ,Pr4q 'tPd0 -0LM@H H~P0T W? *edA 0R  0R 0R 0R 0R 0R, ,0R0 00R4 40R8 80RH H0RL L0RP P0RT T0R` `0Rd d0Rh h0Rt t0Rx x0R 0R 0R 0R 0R\5\%R -L: S  S  S H0 R4[ S S  S S.T -1L `Re P@@ -Tx1 ROl1 RK`1 RT @1 R 8Z,QXp$Z 00CS0X0@ӤX0) T 00CS00 R0 0  0 yTYT nTNT X-YT00yT  R d PXG`@@Z40@,.h/. /h_t, -LM0 @@@0SP1 P00@@PP0 f`V`Tp p 90@05P00TQ  p0W$0@@WR/ 0/// 0-PL@T 0 d!0S @T@T 0 @TT  T 0000 0 @P@0 // 3 p-p0LMd0@SP` @088 000 0  `Pp/.@3, -LM0@S` PU 0 0U  Pp 0PPnT 0` Up806"d@00PeS0$V0`0 PUp0D$0/. 0-L0P LR @  ($P 0/, . -LM(pP2M 2 R a  ? @_Tk 1 RU Aavc@T T lPXVUp@ U QM\!\0Z00 0 $1 R$ (zZ1 R0o|0 @P0 Y0  +PP  ?@0P@ @0UgD.,/-0./// 0 .@3 3(H| -L$M0 !0P@`_ᖄ@K &" $"40 D @K0, Qd4 ,{4 P[ 0@0K,0QM@4 8@ HX4P8pT54 ,{ R0,# @K@_@K0 n 0`Q 00Vs# {@w0P X88 x 4@0pW +8@a0@nX80 00 . -PLM, 00 ]@_l!@K0/a,@@K,< QG 0 *0PP< ,@`K 0Q.-X0pZ o* *@ 0R  @@K0 `@0PK_tp  ,\X0 Z<,X00 ,P00 -`2LMPpH08 P0R@00bT 800g\ `"?>1 1FR#  800g\0 8 a@T^ 0/.!1CQT^@P0 0 ! 0!S 3S 0^^P @ ?>1 A!  ?Q>`0 0 ?> 00c#^ \0008 W0$00C0g0$0^//10U ``. -L8M0@K00 ,  -RSL4MP @`t pq\d1  BRP  T 00c0Q3@T TX0X  0S  R1 018Ġ' -80L0CS%\ \ ] \ ] ] ] \ 0S0 #Q00 L0 R0S -80L0CS!l] ] ] ] ] ] ] `] 000 10B0  2 R0  00 -80L0CS!$^ @^ ^ \^ ^ ^ ^ ^ 000 10B0  2 R0  00$ -80L0CS!^ ^ 8_ _ 8_ 8_ 8_ ^ 0S1 S20#B1  0S 00v4 -L V@>V @b 00cSoNK@DVP m0SXi P >P=]0S / UKP  = R K| p]0S 4NP KPxv:KKAx Pg?: S ]0SY iKP  P`PK`0P p<  0P *Kx ZK:KPtqp<0  00SKtjK2t`W~Cp pG0S 0 S 0S00 S0S L-0SZKtP4S0>0Hm0SKt00S0 0SKt,0S0, 0SKt(0S0\,0sZKtP40H,0SjKt`4S000[0S0S0ڰk0S 0 QڀK0SE @P+0S010; RʨK0S ; ro + 0sKt[4K00 q *Kt 400t`80P )0 8 )*X 0S0^K#10iPE \  ʟ @<0 *800  Y00 hj00  <* ɟ0 S0RS80X0S AK(AnP X8(`K 8(K0 Kx(0(K K .:*K0KZKjK|0x K hP P0 S 0 G0S *KWx0SC p@y PG ێKHH'0nK`F  A]K0(PESPE,0STZ }0SD P  `Kp P(A4 cjK`V, XUNK@D@D0x&\d0 p $8 0(8 (( 0 ,H  >K0C0C G ?P,G KA )P0SmK|UiKK t | S\ URT0J \`ƟPV0  8Ɵp5, @P`0 4(  J0001 S90`Kt(0 S;30Op1d#X:K0 @ 0K $ |c JF,  F$  W@jKPt Ktp Q *KP|:A}K(pGpG GP`) L  {P `VKJP @p0Sr0@00S P  T ^0`Vj?0Z*MF  QEF  hIl"\2hKXA'mp D<8" 2(  ,PNK@D@De/  K>K| jK0C^!t@P(`K1( K,@0) 9 !1 ɠ$ (PKp , ,^KPEPEd!0ZBNKK@D@DP@!@1NKH!1D*KH u ~POo!0264 60@Q4qL;7x`6RB0H:6Dh$H:D:L:p7l2P 0075 < 44654@744d*|*`7t*`6x** 6||*48)*l*t4 76/7p* |!@6 @P>K0C0C``1L0 K00`Pm41P@J0P!P]h1PtPT1PPJ1Pڰ!000",Q:1PPQ11PtQ(2PչQ,2P8հQH2PTէQ d2Pp՞R2P(R2PըՌLR2PcPo|R2Pw0S2P  P#000Q 4 P@3@#G LD3X\#(>4S帜p3P|b31`S孜3P՜>S夜3Pո53 y P` S呜3P"S刜4P$T|,4P8 <W 0T ` 00- L@PpP`0 `R\ 000=P@< 0-H( 4edA <7::* p-d0LM0`S@P p84 0SHph7gdhx -0-LPdP@?$0  O 0-PL0@S00  8 xl0 R 0TST 0S S 0S   6*O` M -LMPp`p@? P. $PK` vGp $0 P < 0$0 xu$C40S$0 ld eU PD>FP$ O$B0H1P -LtMK@:jPx0  P P P 3 8H -LMБ 1, ! 1 ! 1!p1 !  p `PP6 KZ C/KjU@! WT ,0S H, 7P 0 G|P G!P GꈀKZ2@Kl p 0 ` P@ W  P 0\ DjGHP (bGo!hlkp,|/ -LkMp0`h$0 P4 P@ 0SDAsKP (B1# P!7^K P@ P1*$0 S $  P*0 S/R ` d P*P< H,o!̶Զ0H: -LMp0PK 0 5Bt0t `h ,@0X @#   B` 0S  o!= =<8T -LM @ , Ph P  H?P<(?P ?P K0S> >R.@P Ο0 ,50(5P Ѱ ӷڀ>O @ h~匎00 00 R`աڨ RP՜L> H>$ $R(Տڰ$RՊ.N000 0400 B|40AP u~0Q  R:}Rà8xRs0H0400cL0 H0S.0O L00O PP00ZȌʠ ZP00P0ʨ̟ 0T 4Zڈ ʠ ZT00T0h T00S180P,0`0 8Z0<ʠ Z`00`0LP80SL\<} P%00#1t0 003x0@4|0d0 |Zژʠ Zd00d0x˟;` 4@8@H{@0+0PH<4@8@@00"J 8 000P|0@8@@000 夠Zڀʠ Z000`ʟ 0B00000S010CO 00pǏ tSΌ/1`G P$p`Z`Z0 0 0` |02X3 X3嬠S  ʠX30X3l9 X3S PIlzP0`x@@ⴀ <00)1 @@ @` pTBWpp 60|00  0  X@' @"t 0\p0S S0$5P 0P@ @?|`N A@?$%ARp0`A?A@TH0 Sڸw R|`P0@@?|pN A@00$/>AQ@0P`?PA܆ 00SAQ@0P`"?Pn\ 00i0P0 b x@@0o! ==@@<= 67@=`=\7@6t**44(T**7VUUU`7<\560Px`6t*;<`t64x*@7 4 74=46 6T5*o!0=8 =PP` <HZp(p@ 0|0@ `|P/T $(Q0S 40T P 0`@TllpA0xA0SpP0@@?|PN A@^?$%AR㰀 `AQ?A=`L0d 0S2$0@$ |0:|@ $ Q0°0Ũ Ű RӰ:ڴ2 2  2 0L5 @5LV>00h0P0S0X33 Xc0PE`0|pTV V> T5T50X5 ^#|0` 2Q43#0 #@hC0 X3xs@,@P,00,0@`0xQ0000, B` PZ0 "@p0`S$0bZ/0A P+U 8@P  @0|   @ ,00C,0`@n@`@P 0|$ 0d$010 0S  R 4E0Sh $00 ,@5L20000# jl 0Zp0xʠ Zp00p0ʘ0Uf%P? 5&\50 &@0,&<06v0X0H&\P@/0"bd6D 0 0 0 0 0000@0S ؆0S 6P 70 , Z$' GF0pKSD'd (G ,0Xhw0Sz t7 R P  0Pg0 0 G\ł'7 ,7\5 0Z8 P,0X $00@ d0D ,0Xt( lH8 p0 0 ,40娈0 80 0 + 0Q ,*x0 T@0d jZ Q  00 Z4  H900@`T#d0> RP  _? z^ MPB d9; Y<8)$0|  >?@$|P4|~<}- 0,0p`|P4|p~+}/  0d ?X3s夃0d |P  B $0lc?80|008P@@d >0">&@5L 00h0 X3X#r P5PBL%00r/ P5T%  d0P%PD2 X3X,B I80Jp|0P ~@P0 t0` pPEL5` sT5Z20P000s, \X L5sX500VL5sP5T%2 0 / 00n0 L5sP5T%2 0 0 80ZZp L5sX500V. 00V=?T5 V>X5@TX>H|44(`7@\\| =56@O6$T@0 0Q @p0pp>0x40 S(>@ >>pW   bWP T'?/0 0 >W0 0 ,5<0#(`$5SYڴ 0|-/`010Ch0 h000h0h0$%10l0 @0`|/l01d0 )d 0R<ʸ 0,0\ 0,p8.!Q0σ\00>00c 8p W 00C 0pd(@`0xQW%00PUDh% *l 1 D, '&0000| z66 ƟRT000T000@|0嬠  JP``0 @0p <PeR<@6Pp Ri  H00050 80 Y0 (00(0%540( 0l ( 048@ Pp- | `!40040\%4800` \@4 45.!Q0σ`004>00c 4  P $00$044 80<0 SlP 8@4 R`0 \0$%R L$?>l 1 D, 4$0000| ß3 RT000T000@|0嬠  P`0 0p PePT3Pp R  000 3< 800 S<Y#0i14  4 "2.!Q0σ`00>0 0c x2 <$0 Y0$0L0$%R0<0 plp h@\P@" \ !0$%\ 10 10S1p p0W\ 0$%\ 10 1tt!0 00T1T0$ <08!00 001 0008,0 0 0@ dP0oU X@@@V X@@@ 0|/`01d0@]%s ===U @< -LA^ p t00 000 R6Pp04WP㌠(p`͇L|0P` 0O;h0d4 ND400pt 6`<7-+h< ==A -0`A VLP|`A@00000 0`VpcPBO ` p    = -L M0 d@Π , ` t3 R H7@T 0X3 _R`0@P08 P0 8XP43 03`R`0XA  $5S ?l >1 D,  00C0 00C0"00C0 000000|2 0000| D2<2 RT000T00C0@|0 4 40 P`0 0p PeP1 pRU 0400C0@, 00R> 4@P180 0` @80 0` 80$ 0` $ 800`4  4 08 P ?Q>`0 0?>0 0c0@8 T0 d 04AX@@@ V6 ==U 0=\ -LMpQl0A d  al1 RO 00C 0@0S\0000 10 d0 l 00C000C0P`,0W**0 0 0$@x`0d C0XKB$PE 0x 00 6) x t ==U = -0LM`pQ  X0X07!hh<0@ L 0P4P "  656@= -0LM`\0p l0 P X0XN0PP ,0007 h- $  665`=6 -8L0@S%< d x ( 0S0 #Q00 L0 R0S  ` -8L0@S! , l H l l l  000 10B0  2 R0  00 ,` -8L0@S! 4  4 4 4 000 10B0  2 R0  00 `H` -L M@H K0s4 A[TpP @TP@ht@ -LMP@8p1匑匡`p!pP@6 "P/ 0`00``p0 PbUAW0Sl0U\0W 0 RD>=@>d>`>@Q> > -Lbp0LS82 R,2 pRp 2W R PPw 졟P@i #0B SV p  00S@ P  0S P  T 0S R R 0 R P 8P 0S720SiR0S@ <P #W20S$=@> >`>>>P -LtMP@T pppKPJ 0SL D1 R 20S $B7@T: S( `0S : S  P : S  S 0 R )P 8P 0S$X0 RH0S  $`>>=P>>N -LM聟0Q@(0 Pp`h 0: S (0 S ( 0S z p` K,p 1 S!3 PpD 8@ HP XP 6>0  0  ,P <P0  P *P MK#P  o!l|P> -LM@`P  xVp@0V U@0 @PPU`VUU -1L$M℁PUp$ `Sd1 R 0: S P$0 S $$4K>@+[ Q003 Kp@`Da00CS00Ӥ0 PpP @00CS00Ӥ0 PpYU00yU ,@>o! >D`_ p-LMP`P @~@P0/S+ /<P0.S P0S@p0S .S0S`V d 00 Q P0S0P,6  @@P0/S > -0L AO` -LLM0`@/<0#P000 P 0p0R"p fPp "0Sa@a T@DpTW :Py0SRb 0x"S00QS 3P@?0S. 6[8c8Pd0 0`0 dK0S [iPm0S6 hK ` 0dKPh0 R 0S .gXPKp PH?00S0S\,4\0K 㑺0Qh0 %@0 Sh  hPP@:p{0p0Pxpl0DSipPp,`pI0 PH?> |!x@Q1>m|m8@P@1l 0-LM0@P R/ AR@ 3 0 ,00CS00  ä0 $@ 0d@34@0( ,0D@30 $g$A0h3@2KP`8 -RLM@p 0S   s3Tc W@` 0S] |Q<0 CR P00 R%  B02? X 0, CR 100  \ `0 CR 00  \ R@0> CR 000Ri0 Rd \0R R R0RP` -40L R(0$0$   }5>?X`p 0-LP@8P Ph  00`?X @? - L7 -Lj -LMhq0S \\兵PPL e@!PD 4a@*P!@0P P00FP@ @3 0 0@@]Pp@K;0$!  P 0P 0;C 0 0d@d @ˠ$0K $ @8 ?1z ?`?@? -0LS \|0H0  00S_\-\0S 4q p-LCM``GOK0PL  80 Y 0S po! > -LM$@0 S A00> 0-D0L R 4410P@@7T00>$F C 0-LBMdP0FOK\0 P 0[4 0S g0o!$,4 p-LM`@,0 =PUph@? p-BMLM`0<@KP0 B<0[ES FS AS  R0r S00x;K̅0 S X"pCNK@D@D 0<0[FS 0  o!@t> -$0LM K nTP [@? p-QLMP`@00H@ph0PE S U@00p -LM`P$2ဋᨋh!npXq mP pP P@(@ [!0AT3 T`7 @P0/S Z  1P0S@!`P X:cp`1  @@P0/S Q@  zD |!@QPR -LpM`@pK-@, 00RPPSP0: S/0U0 H X ,0S U 6P ,0S  O1H:P -0L  O` -\@LM80(0( 0WYX YX -LM` /P( S l  Q Qq00  R( \ 0S#S 0P00 `  (0pPpp(Ȉ0S 0H00S (S 0S(0 t0W0 S񟗮4 , P ` (0\(   Q Qq00  R( 0000((0\(   Q Qq00  R( 0;S`( \ oSf  ,aa(0\(   Q Qq00  R( 0\S  D(\(   Q Qq00  R( 0S7 * D%(0\(   Q Qq00  R( (0`S0Z00 0Px(0\( h  Q Qq00  R( 0S 0(0;Sp  ( Kt (0\(   Q Qq00  R(  ( KY 0S (0\( D  Q Qq00  R( , 5k(0\(   Q( Qq00  R( 0S  3 @T00u#(pn*d( 0pee`a(( ( 0\SS. (yP(  L( ( -P(   Q Qq00  R( 0;S /+(|&(0 ( P(   Q Qq00  R( 0;S S ( pIQD>(*(VP( p4  Q Qq00  R( 0,S00\(   Q Qq00  R( t("P( pd  Q Qq00  R( Z lC4q$34LxX (H  0-LM P@U R \UDL UH  0S 0[S5 \S- 0\S \R 0S 00  0S000 00\S  0S 0\S0nS 00 0[SKP@ *&0 H @-@000^S00]S00 R ]R0 0[S \S 0 R ]R00]S 0nS 00.^ =^:^00 ]P P 0]S0PP -LMMpNK @D0@D` 0 GPU 0 K0S0 v U P T0S5 0S 0  o! Yx   -L M@X, 02 ,0 p1 100 ,0 0=P0S4P  \S  RE ZQ@D0S4 0bp00 g R AP^0 00 !*P \00, 0 S0`B 0V, 0S`<\Q&Q\00 S SP- 4  0bp@, 0 XK     -LMr ` 0 ( P0 (PxŸ  Q Qq00  R( 0gS 09S,1SUK A A pP@P@(S S (0(8 0 S  ;SpSH wSP( D  Q Qq00  R( 0NK @D@DS  0R S  0( 0RS0Q0 0PU ( p 'x 0tydu00U0P0h(o!4q @ p  X   -MLMh P( 0\SSN ~KpGpGPP(A jK$`FP@ `FPP5 0Q Qq0  00SP@T 000S0S   0S(0 S H(8,o! 4q   D  -ML MD!D0 ,0 낮KJp`J  P@Q ' Q Qq00  R ^ \R 0 R0hQ` 0f Sʉ kp00w@0 ,0S <, 0S So!4q  0-LM0@9SP$0S$S /S  0P@  00Dt 000 Kq \S@   R-`L@ ( 0pS S ;S p0 0 0 S S ;SR 0gPV@ @ \20pS S 8p0 0 0 S S004q  p-PLM@P& `0a0CS 000@Tp 0S0 C0S40 < Y  - P LR` 2P R 01@pT 0S @Tm0@00` 00 P T  p-LM PR` 2P RT0 AT 0S @Tp0 |P0 0pT -\pL`AT 0S<P U@`V0 `T  - rLMP@`! p?@H /P<                                             0 1`1`^ 000 0AQ0S 0S|0jpPT%ܶP n@ |!d X`Xl `X@QWP`  -錂LpP0xSM @:S=d0SX20 #R. @U<ŸPE$ R R 0  0 00 0 0 0 0Q00 00 00 00nS1  paP X1 0S7 S Ha  P@  00#@ 0Q 0#S0nS0@0 (P0 @0  | 墬d0P@ 0X 00h$%0 0%V X@VVX VHVk@X t  -LMb0S!lRhPdr 0SX2X0{ 00CS0r2  p0 40S 00,K0@ @C,  02!刁000 00CS0 0Ӥ0,pXqHQ$Ԁ0S P R" 0pW ` 0@ ,0 S0 ,N0SN P屧PJK(@DP@D *0|/\ 40 0`Wo!XP`W  t  -LMr0@s `PR |R0VQPq`20  00SG \PD 0, CR 600`0S0$ CR "0000CS00  ä00@M0SҰ B \0R0R P(0\ CR #00剺P 0 C0 b\ 00`0\ Pʙ"`0Rt`vdP wfL$ K㮾P2[S<00Z4P`4q    l&ht@ -PLM؀`pP@) T 0 S R@D @00U00  0 QP P #D <0S1WX Y   -LMP, Up & &U0 \Ud 0SDb p9  0r1 P`0@0S*,0   000PU@0S*00K@ 0@ @K @ 00s0s\U @0S*P000K@ 0@ 0&S\SPq(00  00S00@X4q -LM@P P`p W00 R 0 0  N P0-L@P 0wS! sS @T0 p P 0 0[0 d[{Sp P00B 0C{]00 0-PLP @T000 0-LPPP@0 0R0 @@0F 0-SL@p  P`P@4 U@@V@|F hP @\0000Q00E -L,MS @D #Kgp LP ?PPP<#0SA , F$H L Q 0Sw  (Pf 2 ; 00 , w00 080 4 D> D> D> D> D> D> D> D> D> D> D> D> E D> E h`dG 00< 0H D gcpDg ?0@P9S;? ? ? ? ? ? ? ? ? ? ? ? ? |? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? @ ? @ @ ? ? @ Y0`+`-YWX040 \< X @ [PWP0\,0  ,KO`P <0S000  <0KE`P 0 1S +R-R0S004\ 070S-0!R g i9S4i0S4 00P7 84 Pk04\  u&) 2P 0$0 00 @ ğ$1 @{P1S0,0市PYAg4 PQ* #0Z Mv`@T U 0@TLZ-Y0,  0A ß  # @ @z{Ÿ0Z "v`@T Tp  0 RW  20S@TLZU 0 T 60 @T/ @0S 2 A 60  yA-Y uAW0 jA0< S b`A\AYA  =7 1+ $  AA0  ;A 8A 4A 0A +A &A "A A A A prw@k)8 &@Hp H35TP(,048@HLPTX -LPUM 0D%0p ` @, 0 4 8 0%fap?@R 0-+9PG hF hF hF hF hF hF hF hF hF hF hF hF hF hF hF hF hF hF hF hF hF G hF hF hF hF hF hF hF hF hF hF hF hF hF hF G hF hF hF hF hF hF hF hF hF hF hF G hF G hF G hF hF hF G 4,0  0  4 `3080 0 q 0S +R-R0Sp|3, RV X 0S Pa@0`<o@T,tP@T 800<0 < 00S @T@TT =6PP` 2d  [P`s0(U00S 8 RI ,"t0(U00X  S@ U00S 0 R0)XP00 [0 000+Y008 8 00U0 10S@ 1 0!20 0X ,sP@! 0 40S Qqh+Y Q 0 A= 0 !a?= hZh?40S`Mh+Y Q 0 A= 0 `P?P=g8,6h  `@p5 -pDaL MP44! `p dP ?P aPtP`` 0PX(PKssP@ 0 00 s0r sP@p 0L 000S Y0` p-LM0@SP P `K 4PP 0 RPPSpp> -PL@`p _p nP ?P lP`pP` zPPPP 0P ;EPp 4E0PpS  -L@ ^pPPP 0S&>` I_?P 0P C0 SU0S C 64, -tLPMB^p`L  0@ P @g0 @ P50< -LM@pTP 0-S c@#^p lP ?PsPTsPpP=`W00S!0(R00S Vg=Xd R $@K\P $0ASA2 A$ R20S`>1S2 R hBxR` R PdBd`VZX>>0D,0  P5?BQc U`, (` ,pKPB0 R,0 PpPV`U ,@0!@w_\Wpp@R 0%S# $K[P $p`rP`ATAɥ = =BP  0p00  00S& @rPp6 P l P`3 `1HL\4hn5H3854l25gfffppO Ў4qPG 0-@0PTL 0Q]@@0頎 -XRLMP"@]?P 0A`V PU / 0S D0S <1 LPl 0S0@  $0 S  1SqQ0S 10Sls< @P@]?0P0P00S` 0+0 0K@KKV0?0 0K00K?V00Nz0@ ;0 Q~Az K{0P@@ RV  0} { @, 0~}0[<(4  < D X  -PL@p` 2]p lP ?PmPp`t 0P0 PP =z0P0 0PPSt 0fP p-0LM` P@\?P 0AT K 1\0 S0 1 !0l p$;p; 4 ! -LM0@P,0 #\p ?P SPP,0 S ,/3 AT #0 P 00LS!00LS0B \L d; p \ p]  Qf` XIP@PR  Q8 խP3 0X0C SZ 8Z 8Z 8Z 8Z 8Z 8Z 8Z 8Z 8Z 8Z 8Z 8Z 8Z 8Z [ 8Z 8Z 8Z 8Z 8Z 8Z 8Z [ 8Z 8Z Z 8Z 8Z [ 8Z [ [ PI PQPGSP0-V +V ,Q@ 叭P \ \ =V1h0l|P 0a0CS(\ L\ L\ L\ L\ L\ 4\ L\ L\ L\ L\ L\ L\ L\ @\ L\ L\ L\ L\ L\ T\ Ispmk@hjphU @@KPp 0 0=00 bW200P B\,0000D<5;3o!|&!Ў ! !$!0!P00`h0 R 00C8S` RV 0  74` ! p-@AL M8!P#Y?P`E 0AT00  KqVP: Q40 R 08SS#  R 08SQ 0S 000 0 at70bPhR L07pQ 0`007p4 !!| p-LM 0S@`-p KTP'0S !0P@PB S0S0eC10C0@0S0$0 R0pp  -LM`p Xp fP ?PvPpp 0AT W AuP0 [ ˩Qy@T /7(P!\! -LM K{ H7<@7$77!!! -L8M@,KPY0`Sp@ $!$1``0SM0K0M`Kr"`<KM@[B* ,K 0@ L H @ L}0T `Ht0T ~`tb]ggh0h@ Hq`00( <,0c8 (0  c !!"!" " -LMp  -@LPpij`T@X00V00S傝0S |P 0SD@P`d@@V%%l& -L2LM@"<2<4"42@,@ 2"2pb p2",K@@00@,P1 `!1eNp1!aP@ ?^ 1!T10n 0cCP@00p% P7`1 R p|@!0@ 4@,01 06S 1 !pp 0`1` P P P0@P L <0cL'`D ZZ@ZZZ`Z@ 5[[[`\]`]\]Z@[Z [[ \`[[ 0-PLM P@0 K Br0K  PKH00Cs00 `[ -LD0S 00 P P ]@\ -|p|0L@ R``P* ` Q M0 0 0  `Z Z@Z -`嬠L@PpP0 @ 3 0 pS030#00W 00P0Uu0U@ZZ[ZZ -L -T0T LM0 Q<@ P` >3 @ZZ`[ -D0D L0\0 P  `Z@Z`[ P-L`N \ RT LR0S0f0QE$@F0t0f0Pp F@Dtp 䀟 ` 00H0 0 c@BTT@@DtP @Dtu@ @Dt00X0 0PPu0U\@Z`ZZ[ [[ -L -L -LZ 00@Z -LNy - 1 LP@8 `00Cs0䠟p- P P r0 0  R0_S $S@@PP P  q00 0  R_S $S@@00Cs0SJ@ZZ`[4q -1L @\7 `00Cs0ࠟp- \  r0 0  R0_S $S@P\ q00 0 R_S $S@00Cs0@Z`Z`[4q p-0LM@P: 00P:p0@ph`P0`P* 0B0R0T:pp00U0TZ@[@Z -LM@@t @Dt 0-@PPL 0PS0 P0 p(0  0 P004q -hP@L`Y P Lp0T*0V  0S 0T*0V ZZ - PLM@ pH 0 0  R ^jT@?heh4q -D0D 0L0Q0 P`0TL@ZZ`[ -D0D 0L0S0 P0<4@Z`Z`[ -p0 @L `P00Cs0 U0 T  @R 00Cs0(0әP@`Z@Z`[Z 0-0PL@00Cs0 tϠ Qd0AQ 00S 0S0@0Cs00@Z`[Z`Z - L 0   `Z -0L?逋 -0L6@ - 0L0@*`[[ - 0L0`[[ -D0L R80000 ,00@[`[@ -0P LU:0` pUhg0P0@  `1 l0 \ \0 0RhKh"ꀋ@Z`Z[ ZZ[@Z-000 0 0 bL1C 00[@[[000 0Q 0 R Y`ZZ[ -LCM`0JK $0 @ PTJP/,1 P0' )S S1 S (0KU*0T0`pP@ g0^S@ (@T$0 S `$U 00eU@  o! \Z($( -pQL@@0 @dT` :%PP 0@DT*d0 XD0@@0@^S@D [@Z 0- L^RP@ P00d0 ǀP0 -p0xP @L@b\`00=D0 <0 40,0 !`ZZ@ZZ[Z\ -0L9`Z -0L0Z -L -p0LMqP 0  0Ra a1 0@0b!0C01^0 RሑF PU"x 0@S0P0cPcT<0 0CR& 0R 0R>P*Pt @DtP@0T 00t0T 0R P

R0@D?R0 00 p\0 T 00 0S< ^00,P@0 ?00 004qYY P0-L@P T #|0 0h S`0 ! XT0h#H0<#40 #\( \@\H3d(4P4 -LM™pQ, S `,@01Q 0D 0@:T#Pi a ,dP00S SYT 0S@ WG@01 R;0@:T;T 01  h"00 RLq 00@ ,0T1 ?>1 @  ?>1 @ p 0P `OP >@, <,Pd00@TTPUXWT% u" \H3l(@\H\Y( p-LM@,1@LQ 00H\ \ -LM@Q  Q Q Q Q$ h0 @Z\ p-LMP` R @0@0R@PcPb_@ps\@Z -L0Qg0 e\@Z - LM0 0 p` P0@@cP0 PPt 00p 0 L0L H0@ @0@p`E T TZ ZZ`Z@Z0 -Ls -Lk -Lc -L[ -LS -LK -LC p-0L$M` 0K K$K a0a(@K @OPP 0@ 0K @T$0$0P 0S@@T*Ppg`Z@ZZ4 4 -d1L M\\ 0(K n0n4@K0K,K @ P@P> X04 ^00,0KpCrP00T0S`T XU U 04 vP00  0R/S \P(0X800( r PF`Z@ZZ44 -\0\X0X T0L0 L08\000 5 h[Z@[Z@ZZ[04 -T L0LS00P0 S  0S04] p- P PP0PLM`0 0@R 0 R R00CRphp0DS 0 0 0 00C000 [[Z p-LM@,`PP 0S 0U pZ 0-L@Pp0p0  0!0S 00@C_ 0 00000t0 @P4q[`[ -LMPp0` ` K"`H@T 0 0@0@ FT ړ`Z`Z Z@ZZ p-1LM `Vr 1 RPC0S S S "S 'SP0S0C00 R R R "R 'RP0S S S "S 'S00S0C0`@0S S S "S 'SP00@@piP@U0Օ 0  R R "R 'RPEU  R R "R 'R0u0 S S "S 'S \P@[`[ULC -,2,B L^P r00Cs0e b^  q00 0  R_S $S0^ LUT  r0 0  R Qp!B00X0^2  r0 0  R0_S $S#UU r0 0  R Q 00000 r0 0  R Q 00Cs0_000 r0 0  R Q D@Z`Z`[4q@fd -LMtQlh0h @ PT *Tp0Q`vTP*0U@00[ZZ`Z@[ -tt`0@0Lp0@@PP* P4up0mM ( -LM0@S`p P$ ( +*(0  (0 P (PK x0S( 0Q *00 $0 `(0 $ @`DA A@ @ $ ( ` $ (  p-L Ml`0P0@`0 $K 0 $0 9$ K 0B #1P Pp 4 p-L M`0@0P= 0$K0 $ $ K 0B C1<@ S@  @ Zp 4 -PL`M@ p` `   0/0S 0pS0{S @p0  00 , 00(0 80 4 P@ L 嬀 堀 尀 `K 800c R8K9PX񟗦4 X $ ` V񟗚|   4 $ 8 D $  8 H `Z 0-06Z00V0S/ 004, `@g0`: @0T%* @(0V0 0  @0  00 , 004 080 PV Z 0,0<@` DA A0@0@0@0T * 00   P< @`DA eA0@0@+140 0c0 0C Vo Q 0R00S 0S+0] 剐R000 m!0F]Si \ 4 D \  000 00 0Q 000  0 00 `0S0 > S <   00  00 @ {V 0@ 00 X(  08K KP P 0 UPx0`0 ' `   $00(   0 S 8  b R8K8P00 0S )00MHKeP 3  ?000   $00(   0 S 8  b R8K7P00 0S )007 0 | dK@K  000 rZ0@S 8  b R8Kڳ70P00S0 0  000 э KHK  0KPm XX  PJ ([ 3[0cp00@ 0 R00#0C S- 00 ?00A @0  (p|Cppp|4ddV q0p  0A 0  00#0CSO T 00)  000 40PY  H R000 $0 40P᤹#@ Z0 Y{Y000 0 40@U ᄹ ?  # 0 ` 0|`0 )` H0`VH0 00C0  H0`VH0  R 3[SD0 RD0 H 1`VQ 3[S ` Rj 3[S00 dQA ` `D  0SC$ D 0`0V V    0Sv vF D %@3[S 0DB `A bB`z 40 U B s\Pp pEd?VU@P0I@4 TP(먋 Ў(5((( -L M`QPp 0#S pP@@:T 0$ş00 p@ 0pS WPQp0@@T*TNP%UG H#UD 4  0S2@T4@@0ğ0 @" 0 R +U X4 R @4R 0 0 @T+U  @-U=U ?U 3R @T000@ 0=U[㺋P 0@S*S0]S P=U W(X@0(0  P%U _#U 2 0,0 0 4 |^VP 00X40 0`CA 2020@S@@w,0\*000 4  0@0 0@S000eŸ  m10,0 0 4 4,0\* @4 W0 @` DA SA@,@ 4 0 =U0 TpW m0S@p@@T 0pS_`[P 0@S*S0]S( @T*T0 @ T00Q00S W$ 00 4040_VpW`0pPp@]TVD0 0SpX Ў 4( -d1LM`p*DQ``@JP`@ 0S $KK $z=@ P P   }200@0 R0PU 0S 00S 00`=P@P,0 CR ),)0) -L@Pi@%Tp? #T U@` Z6P`T`T TU@ F6P@T0e  m3P@:p`p /6P`DT*P@: "6P@DT*  p-LM 0CP`CA)P @0T *00ᙶ TpX0 @`DA A0@@0@`Adph8  -0LMpH`C 30000`p@ -LM0X pP `ᐣ # Q P&4z1p ,,塕es@0 $ 0 0 '&4c1,厕Qs4@ XP0L  H 40S 4L1$ *+Td+<+ 0-0LSP@ @1SQHJ0S9HIts lh)PHHI R ,:P00P00S100鴛X+PD04 0-LMP@ 0{40\+ -LMpPP`@ ҩ0V`SP U@P0?Bc P@,, (0K(p $` @ ,gfff< -LM@ 0=4P -LMp`PP@ 0UPS` 0,須H p-L M8a0@0 PR Q0 S p0S 2 0AR  SR $K0S 0 0PU000PKP*00 R^:QP RP 00|PP R o!d+x -LM0\ R@A 0 T   4MЍ0 p+ -00L$M@0K 00 , $00 -L$M@H D @ , 8@ 0@ $0[P@ 0 R050$ T),0S$DK<0(S DKlDK<0(SH 0  I$H, HI'0<0 4 Y .$DK  4 -LM@0Q3! (" 4" @" L" X"  &0BS ! ! " " 0 0Q $x0 hH`0K 0 K0K < 4 , $  +@++++, -QL MP L@!0DTS.T, #T T&0DS`_Q 0`S O 0`F 0`$S$ : "!T 0`0 "T T 00c 0 0S00 A0 @`pDWT$01 RT,`  `0D S40 TT T 00DTST W!% % ( % ' $' 4' D' % % T' d' t' % % % & $& <& T& & % ' $' 4' D' T' d' t' ' ( 0 4  R,  0  ,H`@0DSpa"01 R Z, FHT  0R 0R 0 0R 0R 0R 0R 0Rõ 0S 00 00g 0 S 0 S 00C 0 0S 00 00O R 0 S R   0y 0cu 0q 0"m 0i 0pSpW 0 0 0W 0`0C 00%S %W 00 0 W`\  D 0S 0S0 0( ,  8,@D,P, -LMPTp@ t00  RPTP(0 00+  @0 [T 0S 040&00PA ` #`EDLPh!6 P 3 _T 00#T0S @_T0 000#T0SA PE `#`t0<000 `GP  '0 0`V T  0`V )00 ,0 MbP,0VP4qЎ #@ -`@LPpAU P P@00E 00  aGW P F -0LS  0 0!   0! d@ -LM4@ e?0000   -0LS@ P0 R pG0S0e@050E 050` # -8LM# `Rᬀ `ᰀ pᴀ 帀 开 s ܧ''p| 00ACS. . . . . . . . . . (- (- (- (- (- . (- (- (- (- (- (- (- (- (- (- (- (- (- (- (- (- (- (- (- (- (- (- (- (- (- (- (- (- (- (- (- (- (- (- (- (- (- d. (- / (- (- (- (- / (- / (- (- (- (/ . P kPp\|6@  w" `n P0PPP  RP  (   000 {0WaB YX@00 P 0S R P0S R  Pp  0A0S0 `=cxPP 4!00cP@@X 00P0 P S R  Y PP R Y Z 0 S P Y? pR p W00W030"#P``S( 弃0 gA!B+/@ wP\ d0xx /@ d/ RpGp W00W030"S +2F/NP`U pR p W00W030"Scn+pY C DRX@P@  02*PP= K IP`0 2 $00 嘾0@ d -Pڨ@ 0dSʤ00c0l SKR!@ '+00`'i$m x+dmL $. RpGp W00W030"Ssm Y Y  0S  S0 0 R00ꨋ`,,@ ,3,X,,tHp_^@p,H3-,-(-D-h-- -`L VP |p wP@  0S@00T 0P0DP@@^H3 -QLM@< @0 W nD <k\1  000 , Ľ00p0@80 4 7_`g0PP 0*8K @\0S 800c Sx @D0 @pס< ӡ@Z -80`P cR8KY @P ạ4, `r0 - p-LMPK`@J"P' P0 000c0 P*U HppPU "pVP ph0TP?SH0 b@@0@ |P 0^@-- -H0H 0 SL4:QSC @- -,0,  LQu@- p-h0LM`@ XPRT`: 0DRC 000C0 p逋@^4`0@^0`^@-T0T @0aC P  /4 00 $ $0@@`^@^ -LMЀpPQ@Pl`>EQT00? @AT, :0TZ,  &^P 0 AT:0T00cC]P ꀋ@ P-Lx@0lpPh 0af0lCQT a8 r1@0JP`@` p-0LM @R! 0S`0PSpphpX0XPPiH08 <0 B PPOuPp^^^^ ^`@ -LM8@04S $0 0 @ ꀋ``@0 -LP@ `tP000 RTpP@01Q*`P010CQ*00 010CQ:`^@` -1L M R!001(@9A밁P W-Paĉ 0`QPG : 0p@ 0S 匯00SQ(pA60 P SPr0 h Bc| 0㴌pP oyꨋ^^-^` ^ ^`Aq  R@ @ @ A A A 0S Aq 0S     -GML M(q(1IKL 0 $ 4 @FPP! P 耟BnK`F0 1+P@ 0P$4P ‹$0 S d$X0IKA}P$᪋Po!`^--^@-@@ P0S @ P0S P ^ @ P0l0c0 -RPpLM@` PER TC C C C D D 0S  U@PE0S0 0Q : 0FS   ` g0 l0 h0 d0 `p@ p-d0LM\@00cC1@QP 0`Qa0(Spq@` -LMl`4 M0 ㅋDP@P+ n0 8 p`囟p`  0䠟S8   400C0X000 `@F̠F00K FD00K/K.K-@K,`K4偟 4 0:@00^ ^^ -LM@堊00^ - L ƭP4 --LMT0T @0S4&o  * (` --,@L^ ) (&須 --LM0 @0 S&0 |0 R   h0  0L0L 4R$ ) ()`@` --L@<<r) ,)$ (O&TT- P0-L@ 0P PP |0x-S M)T T@Q  R 0<S08>) 000P3rP `. --,0L \])&_ --00L R   J).p -LpM|KzPt0: S  -H@LM $0 $0@D $ 0 p_ 0-LPP@0G0 S U4. p- PLM` P@p馎P@Vc&0 S 4. P0-@L@P UT  0hF0~%ꠈ -LM@xP0T. -LM@&h# p-LMPq 1@ 0 00S  R pP0S T00ppho0`@8P 0%0P00S %10P00S00P00S T 4 P0000ppT04qt....0     @ -LM,@0SP 师00@ -LM4@ P0SR 餈00@ -LM$@0SP 锈00@$0 0PQ 00@. P0-Lp@ h@0S 0SPq000,PPi00Pc00@ -0LM`0V`P@@spP,@d  0Pp'ᒉP *#$0  00.. -1QL@P` @Θ0Ǡ) 4Vpp 0S0 0 " 0 S 0S `P@†0 0 04@TZ 0S40 Rh\:hi`7k @`5( -\1LM@`THQHqH 8Q8q8 0R @TV 0R 0S0 0i;@Q0|{ 0S S0 0S 0S0R`Py 0SPp vs@_489 -LMR Q$ 0"Sxrxb@ hrhb@ G4@TZ 0S i/: 0# @TZ3490QS 1 R R @qa@ 4@TZ0S aA0S ㍺PP `1 00P P8i90be 0 Xe 00uz0P0S  3@ R0R G5et n00+eP d00ꨋ``(589`4l///7// -L Mp4 0  xl, Kb` @DP 4$0``0$006PㄈP@\ 0#SUP3 RWTPPU @ 0S @Q 0@0 ҹt3 RT  40S '30030 4_U3? ,K     0 000  0S  %(`V %`V $ti"t" K,K Җ 0S  4b4R@ 2@TZ0S@ @1!@@@ @ @8I20!<!yT 0S 2 2_xuP@  P܅V@1f ,1 K1   00A>00 $   0h 000T00(``c |,K Lh`_ _>``@00(5,0_40X5x5g89P0_T|0 -LM@K @&8 R 000`_ 0-LMPK  x0p\ 0d 0 P% }0 @0`_000 -L M$`K@ ݕpTpP, (KP 0PS  @ ÕT0d0 㺕 ᴕ( R h0!`X0\ 80 0S \ 0S\0@_ -L M$pK` P凕(KGP@$  R 0S ᵀP q c hUUU㞀  W(0! ? -L M, KpDB0K PP 0S W(@ T `0ŸS0``S" @T X0 0#W 0SB0S  z0S pB `PW00H0 U00 0S W 2 R0">0,K  PW`A00 R  0S AQP ,K _b X Vb 0,1 h60  ,K㡔>b0 ` 0  P604 J6} K,K ~lj,K wT00 !H04l25p``89_0`0101T1\1 0-0@ LR# P0\$ 0S 0S0Q RT p0phTd  0X00\ 0S@ 0S@@_D//// -L M,K`PD pV`pUF 0KP@3 X XT ,40#00 V  @  00CS0<0U@T@T 0 t@T  ԓ ̓000!(@@_pt1 -LM pK` ᱓@T P 0S 0@  00CS0<0@T@T 0 H@T0 ㊓U[@_|1 -LM@K 8w00 \000m 0__ -LMQ@P 0= S< 06 @`쀟,0 0Qp@Q Q 0  T  0R@QT t 0R0   0S 8J@,iE$__`_@_111/0( 000S  0S$, 0S000 ` -LMP0000 0 SQr`偔0 SV Q  Q  001 00 R h2 R{ 0Sx QLbl HBP[ 0SP P Q @ R  i4 0S0;0 0, S 0S! $ 1` 1@  0S Q !_ Q 0S V JP P 412  H-0S0  %4 0  44s_0 1`}P0`;0l`^-P@h 0`00@00j-0@00X_ Q]Kꨋ``89`51 -L(M6\^ L1 0SG ^4`KYHpK P@6DPKN^ (\ 0S \^^ , <0$0b$( 80 0b H00H 0S0 0S S000 00 @_ ` p-LM P (0S QT 0PS, 0S 0 S0000 00CS A0Sa 0 R 0RS  @ a 0S0 * 0SD 0S$ 00S D1 R 0S 0S RA  C0 0S 0 0S p 0S 0 U  ,00 000ppphP00CS000$ph[@ @`|1__11 -L`\MD0V ,0 x 0 #@003# Q Yt +0 0Y 0-0p0 (PU5 0@So q q $r lK@ hV (0Ul t Va VR tŸTp"p Q0l KPx U 0S UxQ1 ,0S ,ai0 SVt  V  PU 0S0 S t\h10Jx 0P@LDT?l0[S (!T100l Kx` 2 - p0'V 0SlK~ lK@ ${0l0Kx @VT0 SS 02f 0lK2a R,P x Xo!@_2(202P4ܑ82H2X25`2t24|222225hn -8#0L` %^0?Sat t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t 0t t t Pt Pt Pt Pt Pt Pt Pt Pt Pt Pt t t t t t u 2P Z0010S P $1 @T 0S @Tړp1@PT ( OPX@TX Z 001@T (PU pOP XPU@TZ 00Q00#p @T ,0S 0S @T@T 0S S @TZ0Ў@_ -p LP00 X R 0S R 0SRd㿭`@_` -L,,0@ S00 魭 ``0SS 0SSS  J00(Q  0Q0 0  ` 0ST 00C0H0H < P000P00@_2`_``__- RR  RRR00Q00Q <R 0S  R 0S @_ p-LM(@`TP 0S@TpePP -LiM䟟 /0@ @ 1 ! j?K( KH1 ! A 1ϟ 1@01 ? p@gK`!00`! ! `` P\P Tϟ 0S   X X #X  0 0 0.0S 1   a  P\P Ο0S00 X" V V0L.010c RnKp V { H{ T X | D 8 T č [X @X*X~ ?X+X{ !Xy 'Xe P"X? \X \X$X    P\P ͟0S00 r(X {XJ $]000@* 00X  ! b RnK4p P\P ̟ 0S  K00   00X  o  10c RnK p00X  @00 Z00$0000nK#p P\P ˟0S00 :X %X#X1 Z 0`00  K?1 Z 0  K2   P\P $˟0S00  P\P ʟ0S00 (X 1 Z 0 00 0`  K1 Z  0 1`0c 0{  K`X1 Z 009 ` R R 0S BR RB BR  K P\P Xɟ0S00 g$X "X 10c RnK2pX  \0000\X `X00! Z@ `@s  K\X P\P hȟ0S00 +X[ 0048 1$ȟ Z  0  K\ P\P ǟ0S0P0 P(U 00 n1 Z 0  K:!`X 00Z4PcqKoP 0@S ! b RnKګ p  00 R60$10 00 8 )X (X$000 0S0C P\P 4Ɵ0S0P0 P)U0010c RnKi pg/KZ V`>X<XAVPW U V00W00SR 嵪)X G&X#  X!J(X5 R P\P ş0S0P0 SP(U㸄  P\P ğ0S0P0 >PU |X&UF ;XL |XD @4&XK;X |X0!`>t0FSGC@T *XX S drX0A0EA0US4 ! 1 AE$1`-1( xl $P@! 0 0S 0S 80S 0$ @ 0"80  AE $P@  2R }Rd" 00T*X 0S,0 "0& 2⩩U0`00C >X000 P\P 0S0P0 PX< <X>U&P 000 0庩l1E` P\P \0S0P0 hP-U0 0 30&U >X00  |U00S @0<X00>X'X1 JZ  ` 00C0l  K"X1 JZ `00]  K Ўh  `a2}Xz1 JZ `0  K`0S | T 4 T \ (X( "X 'X @Tp1 JZ `@  KA  00000)X \X  00C000"X \X0 0C'X0X000C`X  " \X4 P\P 0S00 $X# "X X\0O0S\X `X1 JZ `  K(X000 )X00CS0 P\P 0S0P0 qP)U >a@P aa000( `p 1 JZ ` )  K\X 'X "X 0 01 Z   x#`000g  Kv"X \X P\P 0S00 $X "X X  \00\X `X 00` :)X |X (Xi 00  1 Z 00`(  K7 0 00T}X |X (XM 00  $000 P\P  0S  X X<%00C0L p-LM0P0`0@V:`p0T:  -LM @0, !B0001 < 40 0 圧408 0<0 @ 80,` pcP\P 1 R0P0 }PUR W U p0U <00c R<KC @P`S UU( 1P\P 0P 0R0 QP U<K U$ <  b R @P<00c R @P8 0 08 @@0 `M0 00C00,a `2 --hLM 00CS08 00CS0$@@ pL4 p-LM@<`0DSl0P B    8 $`4 ( , 0 p<004`00,(4 p-LM,`,T- X 1 R$ R 00S  RXij  0S 00S 0S 00 (1  rX0001( daP  0R@ S ,0@(0c aR(o(@@D0S    $0S R;T 00S :"<0q 0 Sraꨋ Ўa` -d1L MP@` P <)*41,)*, ,B 0,0P R ,0 !R% ,0,0 ,0 R@0  ,0 0 EcP0p  ,J0H0,00,0 , 0!S V0 $ Aꀊ3`3  -@LMhꠈ -LM䡟䁟p@`P\P 1 R0P0 PV( h | #U` 00``` 00c R@P000  V[U(K8P/ P(0PS  b Rv0@00S(x0ҤP\P L0 R0P0 P0 `[Ў` 3 -1LM  0((0 $ m(0p000 , P`P\P 0 R0@0 Q@000c R0K!P[T@` ]T`FTV T00,$ `TV00 ` p- LM0`S0C0Px0U  Q@@T0 AQ 0p$ P@ 080`4 p-0LM R 0 0P 00pphP0S`  0 0R@0 \T 0 0R0 P 00p@(0  0P 00pa` 0-8 P0@0L 㶣 @=00  -LM0@=C0 0 أ]  -LtM\ 0S00cS0P@$ T P0 0@TK Px0: SH K 0S 0X S `0S X ,'P 0@@`aa a3@a0a 0-LpMP0@S|0lS`0 TK  P|0: S\0 0 00a_@a` -LMp@:``PP :\`PP%\P@ 0T\S T 00U0L0 R T?[@ꆈ Dچ a` P0-L@ P@(T  T0` p-LtM@PH¢08`KNP0: S`0 0 0p` 0-L@D' P(,0P0h+-3H3 -LM0S  (0QOK0sG/00 Kk'g@0&&}   @ 0@S P@h1PSdg@0S P@Z1PS,,g,7 0{P& "(6000χ&@ @чP  ˇP  ŇP00 6 P PP @0\ @)0S*q<Ɵ<@P0PP  @)d&`t'0@/SP; P 50S+5T  '"@K&(UF& '0S to%5QUe004&0@ 0S 0PP P4P` `PP0S P@T t4@@4p0 Z sPK-P2: St 0`@S@ `' 0DSg#0 e0L03  #P0``P 0SK 0S8@T 0/%&s R$hP PUY00 0S3  n"L00<%&HP  0  0@T; 0vk 0S rPw @#@  0 00 k1p00 s P P0X !0W11pSP00G 1SPFҔ@tnTP&#YP  &W0S 0S0S !0SmK>P<K9P!$2R! 2R@\ᘠP EzPRW0`)O 5`` @ ?Y 0@q! 4<4{ 4<3h\,4= 3444L*445k45` -L$M< @ D0  00, 8 PH w @ R1@000  000  040 1E^P@- ,0SZ00S l00 4 0 0DSD \ D \ P | | \ 1D R(0 R  @0S 0 @000 <00P, ,0H 8 ,@,*,0@ L00S 00 40,0 z  `L5 -,0LM@@@h  -LM, 0 ,0 #  0S 04 80  00S2 < @ <0S2  2]P@( 0@S񟗗ꈯ | | | <0S@ P2 P 02 R ,0 R40S, 00,0", a1 Rg,08 R0S, ,  0 000 0<0SQ,oP@. 0S40S* 0S' 800C80 8 R!\:, 00T 0S ,0  +1T 0S <0S 0S0040S P0S>P ,0  00Sw0@ d0 b,Hz@ 0 _ ,ꨋ 4X5`5t5 P0-L@ 0S PP0 R @P 0SꜲ \T 000%0S TT ꨋ5 9 -P`LpG㠞P@pPሞ P00 Q @  p-LM ?U< [U) ]U" |U )UX IyWpGY00X00S |uSP X pX Y X R0!S@ R0]S@H) -RPL MP@p` R *0U5#SP Q T:U0S h?Sd *S 0TQ T PE0 P0PS:@ S P, 0TPES) ,0 S Z@0   00\ , 0Z,0XP , 0PQ @PQSSڿ0CS P, { 0TPES2   U0@00   00O\ , 0Z,0XV=\  D0r U 1P j, 0'Pa wP, 3 PEU/  k0@   P ,0X , 0P9Zp@-@^P`D R6 R0 ^ R 00 Q00S @^0]STp0-S0S \ Rp0 \0]S[Qp0  R   R( !^` P-L@Pp`*0S @T: `)\ 0W0|\00S V  QP``FvH)1 -LM, ,0 i?B10Q , ` P@BpU<:T P @DU 00 00 P  00 U 00 6HpG@ , 0hC1 iBS, ,`   P 060  PQ 0 0     -LM@`Q 1 PU$ 0Q-P0 Q -P 000#0+P0SPU00 -P  0  0 0:U?U0p ,U00;UppWh#Uf QPa :P- ;P+ ,P! #P 1\ !000p0P 0|!000001 p  10 R 00$!R0 0;Pp :P 0 00 P' 0?100P000:S00P 0T HD0L0-SZ^W0 00 ЎD 545 0-LP0 S@5 0  0S0h0S 0\@ 'Se U 0S C  0  00SU0<0hiePbP0ЎPq7+p -LMh4 4  , 00 @64q8 yPPP@yTX` U`V`P40cyp0S0W<0 ^ ~,@\8   00@T pbWP8o1, 4 0, T < 0  5t7|74 -QLM@ hPp `PP*PU e*0S h0S0@e PzUp:0h0 R-`LPp H|@T@E z00 -L`p $PPZ-0#S )0#S%0@P@ -LM @lP 00 ~lP00 p-@LMTP` ἺTP pU {P0  _P00z0[;`  -`<LVM`0 0 /Q40 8 , P80 0D .Qq 00pW8p  8 R 0 S:S0 0S:S0S0g0 080YS 0/S , R 0S38 0RY 0c0 0 @ cRP @ z 0 SP/R/00040 v{ @0 bRP z8 R00 4`{0 cR@P ,y,  P0 S/R/000.S0S/S  8 40@-S`G /SppW @/P/R7 ^/ .^ QP R/R0 00S/S /^^  .^0/SSQ000 QP@ Q AQ0/SQ.00 /R P-Lp@` zP0 Ulp wyT X0T L0hlPF0P@@ `4  -LM@z|0     00 K 0  P 0P/0000 `  -MLM0ܑ0c0SpP, @ PT? 0/Sb S: /MP`dU VO V> 0/ c 0 0c RPBNK ` P@Dx@D` aP0`(K P/R P PP X@,0 S ,u:0S 0.S0.S U0u/S U0.Sz`0/S o!7 -LM@p|0`g00 0,0< (p0P uP@20 P00S 0`` S`` oe WjpeW@,q  -PLM`lp@60 T$ V`0 0,0$ (` p ` Pꘀ[x0\00@0P jP PP PPPP 7 -pPLM`l@(" T P (0Sv0W< 00$  ` \[ iP P PPpPPP77 -L^M\pP`@)T0㠀 0WB , 0 E 00p(Ppp PPP $0BRU@P_kplX@ 7 0- 0PSL@]P dPP0 , 0,q 0- 0PSL@ BP d 0P 0 P0 0-0L@P  0S0 0  00 0,>e 0- 0PSL@ P0 , 0,% 0- L @ 0  0 0S[ :Q0a0 /.d0 P0   0h b$0 0m 8 -@L P 0 Sw p   0:0@ #  = S , 妒@0  d0d@0 0 90   0p``V  tPp``V@ 90 000S@ ;0 0W$ 0  5v000@د$00@8 -LM @   0S9 / &:0  vP 0S0 0S0:00;0垯0 00$ 0:p  銯$00 08 -L @\`PpK C :  W  0 0 :0  0$cQ]0 ;0$ V ?SR0 e00  0Bu ? S Rp /$00*0 -LMP `p* V# @T T@ u0 `d d0V0 pX f0;-p @T D8X8 -P Lp7 WpG2 @T p) @T!  4cP @0a@T@` ^upW00 V dP  X@l8 -LM @T 0S  0C 0 P 0S 8 0-L@P8 50u  0 Q)  Q000  0QS 0*A0 0 00: A0 PA 00 00p  0S Q8 p-LM @`A v" + 0`KS" PK  ㎄P P0S   ;00 $0p  $0 0\  R 0 B `0p   88 P0-L@P u 0h0 -LMP `pZ XS@T 0PI T@ ]t0 0 d0 `dpV&]p" VQ@ mr@`T`d  Pp@`TV  2t 0 0f0 鏭0S 0 ;0冭 00$ 0X 88 --LM 2 -p-PQ LP@4MH`KH 0 0 ! @p[9 --L4M@@K0B  v -L`M0VPD ,0 < @  @T %T  R 0 B @0D  D @T0D |8 ,0S l,p@T 0DLSd ` l L @TYT A0DS 0@%0DSSkT T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T  T T T T T T T T T T T , T T T 0 <0<00 <0 d0D,pK< S/ Q a@ @ 1!10A00R0guT @P-0+0 0(K0gC Y @Ѫ30#0 P0S X i @ = ShC @ @0@X+YD D I0S C  0  0YpIXDD 0S C0 @0 HXʨ}D00hD0 h0S C0 @0 Xj-P+P/ P- 0P 0@0S# 0C0 00 DIYpD 0xS0S 0C0 00 D p ID 960S 0C0 00 DpID $0gX0000gQ 00SN 00!10 ! g@ \pGX0x00<0倠 8pK0<0 8 K:<0p (1Wp< ,s08@K8pK,}<00@0 <0@0<0 t@Xqhnlꀠi@fd0 b 0@D@@ @0  @10@00C @0 0@`FQ@ @E Co!(9895L9Ў 0-0@ LP0 SlPl0  R0S RR 010000 `b bb -L!PP@`p 0S 0|R0P 0 T  0e@aP00|P`bb -LPP`p 0S0@0 p0T d0T 0P <T2P@X`bb -LMp, PP0@07 T`( U FT&T &T 0PX W  0pV000 ;T`,0S U(0P ?@`bb p-LM@0S( 0 ER p`0P0 Q@@Q$T00 0h 00`S000 L0RP4 5*p000EP`bbhHX9 -LML0@S 80  Q 0P`bb -LM$`Kp@H P 0b -(LlP ꨋ03$P 0S  08P 0S -LMPR0@SD2Q00@A@2p Q`z T1s Tp Te T_ TY 0DSLTEQ;1  0BS51R1=p`0T0 W P@0T*0p0@1@` DA BA000 000P0 pP P0`p V P 0-?P`)Q``(Q``P H0`?PL0Q``,0 R`bb xhn p-LM@0`S0@ %  R 00P0Q* 00p@t0 @dDA ɅA000 000P00w 0 `bb4  -0Q0L0 +(0 0 0`bb0S  0S R   -PpL[@T`01@T 1?A1cX0P`+ @ TmzQU 0   @ Tk0A0 S R 02SP00C0gfff -pLP` 0@01@PT  0R U0Q@5T%>P0 -LM0Sp@0< 8C80C01P`U  0R' V0aP6U0Sсd0cj@„000 P@ 00 h00C0P=P 00 0000CS 0 0P0 000CS0= p-LM0P|0`P@ 0T S0 0 R@0P@fDA 01p  ` -LM 0S!R 0S Q ڰ 0  萀T@tPa4p @ P@`|XT@tPa4p < 0, o5ib bX5x56850 ) 5p p-LM⡡D`0@TP PpPP 00@ Pa -LM0!0PA `1P X -'P qiP`V @Z <'P'P<P WiPpX YiP<$KP $PP0Ў5D= p-0LMR@5`\0 @ P0  0S800 0S`p50 R(4 0S 0 0 R CZ5T 0S R 0S 0  R Q CZ5 p- LM@`T P0@0@ x0 P0S V 0 0SPU @Zp0 07a5H= - p WL` 0S XX P< 0@3 XX@0  p 00<&0  @ 0 `` p-p0LMd `0`@` P0` 0S 0SPU @Zp5 0-8@L P0#0 @ PUZ0b5 0-@ LPP.D0U< 0 0R0 00Q00S` 0h7 <0 R 00Q00 0000如`  0-\@P0L  0 S 0P 0 60S 6 -LM@p PPP0 "  ` 0 R$V` p0ppS 0p(K (p $0 0 O`( K0O(0 S  00 0ꨋ b 0- @ PLt 0 0 S % % % & 0  000 000000  d= -LMp`XP 8C80C S?& 8( P( l( x( x( ( ( ) ) ) * l* l* * h+ p+ + + + + + 0SU @0S %o0S0SB @0S $a0S PU0 @ T&@PT 0P0S 0S@Z m0S % 0$0 '@T 0#"#0#0#t0##P 0 p#\#T# @0S4#1(# @1S R 0S0"""@0S"d"0S0""0 0\"PU @"@0S \)|"0S0 !PU!i! P10!!0!0!yd!0S\>>>99$>,>H>4><>D>P>X>d>l>t>|>>>>> -LM`P@TTpO TM TT  T >  P 00DS 8- - - - - - T \ 0  0  0i 0S|  @t t ` X X T L L 30#0P >=> >>>>>> `0-0L@P^$(@0h#S^$? -LP`p@ T/ / / P/ / / 0 0 h0 |0 0 0 W@ `T"T $T \$(P 0S)P$((P 0S)"p"p${P @T }@T}P(|) -- L 0 -- LP4M@@K B 0 0 -P LR`p %R o R ;0B:Sx2 L1 L1 L1 L1 L1 L1 L1 L1 L1 L1 L1 L1 L1 L1 L1 L1 L1 L1 x2 L1 L1 L1 3 3 03 L1 L1 L1 L1 L1 L1 L1 L1 L1 L1 L1 L1 L1 L1 h2 t3 L1 L1 L1 L1 L1 L1 L1 L1 L1 L1 L1 L1 L1 L1 H3 L1 t3 p0  ;R   Z @T @DTʜ @DT  pa@p  p@P 0Sx ?dRX`X@-00dpPg 0S` -PLM`G d~ p 0 S P 00P @0S`K~@PP200P @0S`7~@PP00 P0 00000SP p-LM`P@e} ph0b p-LM@`P0 S06 86 86 6 6 5 5 @6 T6 l6 t6 t6 0S Tdp@P0SVU@ PEP0TVU S> 0-L0MDPK@ B 0  P7 7 7 7 d7 6 6 7 8 8 ,8 X7 |0$(P 0S)$((P 0S)${P P P}P(| -Lp@PUjH}0@S P?}`00 R 0S0S1SP01  p-PLM`P5 P0P 0@S =}P7}P 0@S -}0S&} P ph}}p p-LM`@PT P 0S 0S|@Tp|||[N ] -LMDapPM00$Q$ p ^P@* RPPP XWieM%+ XM00+x @@+T MPpMP@ i89\>$?H?p? -LM@0S&M0089 p-LM`P?|0 0P)|0@0S000 L000 D@H@ 0 L 0Pp  -pL `L0P0A@TJ0S 0 @TZ 0 (H{h0|i  yB  p-LMd`dd u0PSpA^ ,P1 S0 0@c` -LM@pP` 0[S 0S@␐ 00  k@ͣP{ g ^,Kp /,0 S*0{ ? -L MB0( K$KP` 00Po$P`r00000  0   !0 0B0\0;00  510 R 1! L0R'$A 4A DA A 4A 4A 4A 4A 4A 4A 4A 4A PA 4A 4A 4A 4A 4A 4A 4A 4A 4A 4A 4A 4A 4A 4A 4A 4A 4A hA 1 !P 0?00 00<0l 0@ PpL0PS $0pS 000P0<0(p$0S(}# Ў c`( -LM<0, K@(Kp`I00  Q ! 000 TP 0@L@T " P  0 00  0000(0S 000P0<0,"P\ Ў c -LMp B a8    0`3 0 @ 0O#ODP0`U0 P\00f\P@ U 0 UBa1#  f0E  f00f 0S-00f +`Z4@8@cgfff -LMK@p ^! p-LM@,50 R00SP`@A : 0Q(*4z0 V0   0 00 0pj0 00`p_ 0V0 D{ 0 lP  %T p`@@4 0-@0pPL  0 000h*80/   0 c  -0L @pUF    R@   0@! PQ/ a-QP% #Q, 0 % q0  0  R0Aq0 0  RWAq0 0  R7AQ00?$QU@d@T00S$T@^044qЎ 0-0LM@KpPh  0 R  R0P  00 Ay0 -L M`@^0P  0S082xp   ` P P q00  R@PdU0n@P 0!0!!0eP@ 0S pL10  00S Q8!0000ӑ0Q 0S p00  00S Q 0000ӑ00S q00  R@ 0P  0L @00S  \ 4qЎ@@4@fdt- -LM0p ]` ]0P00Cx@ w\@=  0 0c0 m\Z ohx -LMPp, 00 AP` 0[S =S `@3 R  ]P  ]PL ]P   %$0U [0  , RV0 4V (3x,  O , 0 40 @ 4) @80 < p  0T0V0S   v ,0   k 0 pp00 008 0 R00S@0    0T0V0S  <0S0  Y%@T4 Rk V 0   m0S0 ?S 0S p  W RP 4  00 00400W w wp <QG0g  `@P  @QL@00  Q 0f먋?4<**@ 4Ў - L`p%60W00S PU 0@P5wU 00WD0<0 0h> "w w ! -PLM@ 0T0   R0 0Q [R P@Ў-0S00 0\00 Q\0[S 0S0 [S ]SQЎ -LM@P0 0S00 -LM@P  0S 0=S   -1L M kv< ,0 0 4 Y a`VJPU 0 0 S" `VZLY4,0Q *00010 0 `40 [v0@` DA RvA@,@ 0 4 L@pT  P000L@T0 4,0Q* 004 0X0@` DA &vA@,@ 0 4 0<0  0 RMCc -LM@s $P 0 @c -LM@_ P h,@c -LM@@P:V V XW XW XW W @W XW XW XW XW XW XW XW \W 0<00<0/0 b0 <00 <00S BW0T <00< <040 0<0`cc`c p-LtMPy@P X `X X X X X X Y @Y \Y lY |Y Y Y Y Y pZ BPt00HpXup@ 42 p0<0.@ "@`@0<0p0<0~pp0<00<0oB!0<0떸뺸pp<u0 ! P 0Ӫ0p |p0  0 S0`Pg0@/SJPKiP0: S`wpLu000<0D0 b< @0<0k@`5`cc? 5 c -LM@@P-H[ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ @P0200h|ttld0 h)hP<@P t00h@`55 -LM` pY0W:00pPU 0SPU 0SU 0S  8t@  B-0 A?U0@0 pP0@ 0 P]P [P P]P Ra -LM[@ -0Sd 0  h  -LMpPa0`KW1S~ @1S@ -LM Q#pՉ`a0S  @T 0 S 뤉@t 1 R Q 0T2 0T/ 0T! :P 㯉 㭉멉t @ XQ W 0  0 0  R X0 QA@=넉 T㬉~~l -XXL0@ S4` c c c Pd p` p` p` xd d 8h h0Sr P0^@0RP\ XpR 0ǟS7 S 00'S7 0GSWW0 `P@a ` Pa ` L7 R cQsQ CQ P  6009P@a a Pa Xa 6 R6  00P0S P h6  B P00 P``V10@&S(00@``0  5p@p P 0 Sx@ @0 @TX  5/T ` `  P` p\%0 0  R% 01000C0E $0@00t;10@S0 D0 0$0@0T0 $00v 0rpx$0 0  R\$(QH4D4   PY #000 w$0  #0 00 B3 w  P00 PppWP  0P``V l@T `3 D0S @ 0 0b 0 00 R@0P 0PQ 2'QK  2C 2 R? 0 0S5 0M  0 0-0 @0 TT 0 0S 0^  0" 0@$ 0 0 0  0R 0 @ꐡ꤁1`V P q0@0  R`F`1HV P q0@0  R`F PPEU젟 䠟q@6 0PE0`U 0 ` 0h 0` 0_0@T0 RL@Rp0 l( 0e*00h~}d}}c ulc0H:c4q dL@uc} p-|0LM@`@Pb\\0P P0D D0< <0@ph~ u ~u`~@~~}tP0 0 .PP L p-xLM P00PPPU@C H4 R < P ,ğ0S0C00@0 00C 00  c T 3 ppß0 Q #0S0C000C0  0P0 0 ӷ0C 0 p0P 0P 4#0SP(3PT-k k k k k k k k k k k k k k k k k k k k k k k k l k k l pp2 A p2 RHR0 0CR0$b 82Q@  0 @00 R 1 0 S0 00  c3T 00 0 0St1 `P`1   \\!0a00cSsS CS41@ ph`0 RA 0@  l S0 0d c 00dR0c00P@$h@0S\0PpH0P0  cS0  A P}l ucltul}} -LMPP`0  @P0 0"? R 0LyS{r q p p q p p p p z p z p p p p p p p lq p p 4q p p p p p p p @q p p p p p p lq z p z p xq p p p p p p p p p p p p p r p $r Dr hs p s s p p $t p xt p p p p { p t p ,u Xu p u p p u Pv p p q p p w p Lz p Xv Xv p p z p w z z p p { p { p |{ { p | 0| p | Xv p p p p X} -0S= R 0R0B00P= R  0(=! M  P 000Y ,000,0 P 0?PPPlNS|P%< =P@,00X .<q H P,0S0004L0O 0PPS 0 ̋P 'P 0S  0R LT@Q0 0cc n  pR00@Q@@@pp` R,n @;*:@@4;  :@G:+:*@@ |*@8J0 s0 @0S0C0)UP X:D*00ePcj@E`P00*,:ɟ9@4: @P9)i9@ 6PPEU@T 9 0S0C0U L9090)0 )0lY (@0 H8(8(XP HP0 0H0S|8l(`8UPe0e 00e0Hh0 RV 0   ?Pc\' $0^P@0@%SP@c\Uy\ 0Pc\qt7`'\7<7g0WSwSt0 q470  00S0GN q00  RcRP 0 @ P㓰PGUFN @P h r0 0  R= P; Q @P5@%5 0R00 Q q00  R PP -P  0S0C0!PPU0 Q q00  R ^^$ PUD! R r0 0  R PQ q0 0  R PP PUP @,4t$4$ 0#S0 00Ue3 P^CcP  00 zCceP  eX#d3嬣L#D3 0TcS000@ PPEU dH3 Rf 2"2Q 0A] ?2 RR 2"2@@ 0Q"0Gꔢ P9 U 2 R,2 " 0b0P0U2" 2Pp@Q0 0P 0000#A 0S l1\!P1 0QP`!0Tl0 R U(A`pP0 |0  0  R 0P0Q 00 00CQ00P000q00  R 0P0Qd L~}@uT9`~~} ~@~X9`HN`}Hu@4q4@P@@fdl}}l @ 000 O  0P 0 0 0h0PO Pt 0P0 P00S@] -LP0Lp`tS񟗀0 d ā ԁ  0 0 d Ȅ R3 Q PP3 P@0P 0U0P`P 0U V P 0U0 P@ pHXWVPPUZP P FP00fP``aP@@P2,R@$0 PPWT R2 Q CR!0 0SgWP 1 PR!0 0SdlP 0CUx0 q00  RPlR !0 0SeRࠟؠ0 RZ 0PSTZR㬠0  RK QE 0PUP@hh0 sRD 0 0S3-0 PPPUPE%lP9}4q p-PLM@@lPl` R  XP0@D S<0 0S0C000pp` u}ll-n$0 Q 0M`}Hul[P(P)P{P]P}P 0-4@4P0L M0 0 0l, ,000 0 Ml p-\`LM@iPi M0 0 p` 0-@P LM 0 00h 0- P@Li0hi` -LtQM0l!d1d `1`@$K@` ```@ ``( 0 Q C$0 P0b!0 !0lq00 c`R 00CR@ 0@0C 0>i0 8i {N wN 0 0bd 0C0\0T0T P0`ll<9l 5 ~~``@ p-QLM@PpR `0 Q 0Q 0  L 000ppD`  0S0 cL 00 0l p-LM@`@P 0S d L 0 e0b 0plp@-P @Q` L| T  0P 0 QL|VT @pppPZlE-@A`0 P.`Fv+ Qp0 0  00  0P0 q00  R 0 PP0`Fvq00  R0 0 q00  R0 PlЎ4q@- AP0P+PEu( p@P$0 r0 0  RP 00 ` PJ 00 PPEuPJ0 0 |0 0 Q l4qЎG-$P0 P1PEu. p`BP 0 r0 0  R 0LP0@ 0  P0 0@PPEu P0 0 q00  R l4qЎA-@P0 P)PEu`p# r0 0  R0 P0T q00  R 0 PPPEul4q0@-@0P%@Dt" PP J0 r0 0  RTP 0 r00 Q@ P@Dt0l4qE-Ԁ@ 00CP-@Dt* p`P 0 r0 0  R 0APXP P 0 q00  R @P@Dtl4q Q-LP@,0 Q()0P`V Ttp@jL 0P0C 0 J ,0Pg@~ ~l@ -PLM @`; 00CQU5 0U@@A^S`00 PpXᾩ뵩`P@$L 0P0C 0 qJ 00TU (P@~l -l0LM` `0@ KT 2404 00 Y| W|`~~ 0-PT0P0L@@P8P 00` r00c00%` 0-pPL0 0S0R@@0 P0 0B0@ Tl@ -LM̠0@ `T,@ Ppᨐ0 g?R,`,@ 0p0@ PT0 h?R0` 0 0 `?R`l@ -0LM P@0 s0 -L M0, p^P"0p @7 0^40U0 ^00S00,0 0 P 0W PPĄ^00 pW@0 0Ĵp02 0^U Ÿ000C,0 0W 0!^0  ^!00,0 0W000   0pW 00PPEu`p @ 0 PER` \0 S S M{000u@p 0 00S  R+@S<@P0S 0 1,{@000,0S o"0Q @>@h0 Ru M00 pW-00Ĵp k  0pWur@l~~ p-LM`@PT# 0dR 0@P0@pz0S0C0 zt 0S00z0S00<0 P bPz0S00~~ -PLMpA0S_ PWa$K@0 (K,K @I~PPB H1($01 $0T00 (0@cT  R 0000 0 0@@,0I,0 0S @TYP p300(Q 0ppc@dl@~}~}`~ 4 -PL$M@`P㼒 r0S㨒 T0S PV0 ,K0K4K8@K @}Ps Ve `FVV80S940qI`@M,03,0!0GP00SP 1T0 S/R  P4$~|1|!x1l1l!@@4@P)~1UpU 4@~0P PU48 z4}540P``p}x0 @ x00qQk D0@@ P[  00`dcl 4@~}~`~} -L$MK0 K @KK @}P@ z}6 0 RPPᨋ -T0LM @R 8 TT^h7y6y@@$By@ꨋ@0P00  `  -Lyhy -LM,@0(S8c0000~` -LMp@Pb`!!ep s1 @bTQl@0S.S p10  00SS ! \0 B2?@1cS@`F0S.S.Q WV$` p $Kw&P J0P00P p0  00S 00Aq'BQ`U@0Q qd00 @ 00S 0S D @Q4qgfff -0L t,UO`@ -L! -GML M<2 88@Pp`, $"ep fPp` iPp` {1 @bTQo31IKaAA⿦Pp4: S TcT]BKHH+' P: L=7G0Y/S/00@Tt p/yP`` 0SP :0/S$ V:0/S `FV:0/S`G0 ST0@T4 P  EP40`FV:0/S o!@QA -LjM M,kKH0 H`p,0 CP;2Q 6P2 R2 RWP,0 S ,B,0S  ΃6: S" KA AkCP L6: S !P (ᶃ6: S N /MK@D @DP @TuK@PKrP3Th6P KA A˥P]NK@D @DLB DO= P@=1( K ! Q@10 `(P00CS00Ӥ0 Pp @00CS00Ӥ0 PpyZYZe_:76PQL 8o!P4A0SP| H >@T TP @@OPw1u1@ނYl1D0S>P5(~00LCP!( 08K@8 0 40 ,0 {-PN1P @@巂<P$<宂@婂}0-S @塂L0S @噂}H00 0 R@勂@凂0;0<`H0P0>Pzv}0H D0 i@l@`PAAAAAA -LM0 4 ~P7 ,K 㓁p/ ,0+C4 ~P ,K ぁp ,0 C4 2|t-h@ll 00\"6<0(@4,4 00BBHBPBXB<xBP|B 0-,@,PL $ {RO`BB -LM@=P 09R 0-@L=PU 0S&R000 -LM0@S h > >p@-0PS00p-\@@T \ P`r00 P 0 R0ATap4q -LM0@SK P = 00 0-0@SL =PP  0420(0Q먟 0-0PSL@0S00 RP0P 0S 0- L0@T  0P0Q 0S =S Qh0 `0 00S<Q  !Q >Q  PP e B -L3B 0-XPL0S S 0@ S0 00  -LOM\0X,0 0P S ,0 S ,,?OKKK`VT RP W?K+uPW?K \!QH1SD1 L1@\0P S Tb818S <6/ }3o! BDP -Lp`@T TT#6P0S! P T0  0S T @@T TT @@3 BC -Lp`PU U @0S P U0 0 00b0bPU U 3 C -L MP`p@T T T TT T$KPKP@ (KFP; 0D S Զ 8 L d $ (0Rpp`$ (0Rpp$ (0Rpp$ (0pRp$ (0Rpp$ (0RppGE0D S Է 8 T ^*PppýW*PppP*K*pPpE*PppӤ>*p  p-LM^`P0S p.T@0S 0S uP0S  p-LM``@0S pP0S {@0S t  -LM@`iX0@@D0@ R0S$n~Ou{D hn -@L8Mp` M\l2` N\X2@ L"_p5&LKTpK`H P K0T L` /@P@P00P0 :PP1 P A0H P0 T @@@P |%O<K @P800 pS080 80W@:0T@Z >\)<\00S#\! D`K 0  \C0[SD[0 CR 0R P 00xl}0 pW@X D00CS00  ä0  |!,C4CLCtCP`P -L ; NC` 0-0LP@ AP@D APc0DSꄽ 0 0pA00n PPP0S 00P0$K0 R0 0!S0S0 R0 0!S 00S 0S 00P00S  0!S0S L00S 0S( 00P00X8`PE@# P-L 0S 0 00P p-LMh@P `00$P 00C0p 00PU `p` p-LMd@P `00s#P 00C0p 00gP `U`p` "P-4L h 00RP` P0-L( %P: 0AP$ 0S!Q 000S Q Q 00hK0h,Q0S00S0eP00S 0S 0 Q00hH@ 00_ P00&P0@``EtE p- BLM 0P0 00`1Vp 00CS#      , @ \ Ppph phph3pPppPp@Tp@Tp@Tp@Tp@Tp@Tp`@`E 0- QLpM@PZ KٞP 00DS9  $ @ H P X ` x h x x x x O/P0 |0:S0     H0S0L0S0 |0  't0'p0K;P  P0-LP\@ Q P 0S,0 ' 00@000C@ 0-LM@aw00K PYw0S XT q00 0 R0 0S0 .E4q! -LM@K&0SK@ PX 0R@@ -LM@K0SK@ PX 0R@@ -LM@K0SK@ P 0R| 0R@@ p-0LAM @P`  \p sP` /0 @bTQ!P >PpKGOK_PP Vw.PPKo!@QEE -0L KO`E -LM0p (0 \:P@/UoKK/vPKU  S?K\ u0SKK,L1 H1 D1 @1 <1 81 41 01 +>,K4L0%* L)(0 S (9o!F F -LaMb>K0C 0Cp( @4Pv$6: Sg  S5>PW(0 S (9wKBnK`F`F|!|1+>0S>@aD9PP$[NK@D@D  P<)2W>C R0 RW W')zu0S =@9PPW d}zBnK`F`F+ L0)0KW o!(F@FD:edA<LFpFP -LM@vX o0s G\D\A\T0(at -SL Mp@Pu00!1/P`!  K9Vx xu0S@ 0P* P* 49W@cu?00 \@a` X0P* P* 9W@Iu?00t Dh&D:F -LM@ K K 0K @@;P -LM8 < @ P`pm 4KP@h 4 0R SB 5P`Z 4 ;40@#hP0PS ,KL [PP 0 <P@ U10  FPP 00S0 KJ]P 0 R ;;S 0PP 8PP $PP 0< @0T PPV 5Gt 5D:$G,G@G, -ML MŸ0$ , < P`q*A <P@' JP0 0P1 ,0S |,7rt0S0\ X!{ht0S <4!0qB~KpGpG F:0@CN|PP/ 0@S # N<0S G<0S+ 00L \ 0$ 0:.t?00hP 08{@0t?0$0o!DGHGXGGlGkܰGG -L,MQP, p0K0 `ß Q Qq00  Rp0+S-S-S +S 0+S-S QN QLq\30  00S.^A0.S7 Z0PC Z48 "O1@K 00K @0KH@L P P K 00K`V 10(O @/s "00Z s 000S 8OSl,4`( &"0K`PP, P0 Q!000ӑP PUfs"00 P pl1  0PX1@@K1`M% <0 ,,< kp4@0 KX0 8 W]0K J80K5 B"4@Z$$ `JPU *0 K0 FP00KU:@ K00K ,@ {0@T0 {'0 0R00 s 0j4qL=dT= -L$MR4 00 K80 ,0K?O`#p$`VpWO$8 Ÿ 4BU!5PK 00Sr "00O$ጁ  BU!5PK~\0Sy\<2 0 Sh 0 Sc:\ ! 1 0)O @ oP P`O$  !5 YB9 00, 00 8,P00Q # 0,p l!800 ,4P!' 0dq8 !00,4 !'0c\4 Z,Q @00 K@0  h x0\ 8  8 0K T 0 Kt)r 0ST=L=GGG0= -LMЀ0P` p (0 5P@qK 40UKS   ?% (0S h(58H SK4H,KK0H,K  K/XHKP c?Kmo!4HDH -LM@ K K 0K @@7PRAQ:0S A Q:0S -L(ßSM 0080 0 4 p< W@ 0,K000APP. ,\X 0P@ *0S @ 0T: 0\S 0 S RL, 8 \R 0 S@C80Rr 0Y0\``VS @ R00Z00SB Y@  P; 0 @S P1 0S , S  0S $ SQ  R R08 R0  R0 R 80R R P@  0S00 !9< 4  R<00<  +2P@ <0, 7<,0< ` 1 2P,,0@ C, (P,deY00\00@0 , ^H -ML M"0嘒p,0 ^rJKHPHP` V 0/S T`7Ph BNK@D@D+4 @0S :S SU00 0S S:SE 0S0V0 0S /S  lPJK@P@ T ]l0W0P00S@PW40 P t(1 ,0S ,4k1+ :O|P` 0SPR 0UPE"*0S6P 0SBNK@D@DBNK@Dt@D0l % P:BNK@D@D|BNK@D@D,v(6`eo!HH&HrI I -$0LM KoP逖 -0L: kP逖 p-l0L M0@ KP K0KK@KnP`+ n 0 000p逖 -@PLp|cP p3 R %R XV 4 * R00cPE: UcU pP/갖0I@z!t!"gfffQ p-PLM@`PC ph10  00S H100PC r0 0  R1.\P' *\\ 0SU 0B8 S('08C?P3PPڌ@PEUp pT00  0<0S000PC r0 0  R4q0{!j>w! -LMp`#0P@ r M\P \0 P@> -"P@2L MR0@K0 p` UsLz\Ō\pG   a 0a>Ìp4G6pGƃ??p`F R bЮ?Ф@A P 00Q00S Q b`.^L2a?@ C_`0 Px 0 P0x0Ńƌz(p , 0 KV10U0 v0 P@o0 ᖵ0 z0 O? -L Mp`@P@!<K4K0H0S񟗦p  $ D | 4 \  X  4 $ X D  H  `   $  8  p D , p  $ D | 4 \  X  4 $ X D  H  `   $  8  p D , 8D3#cX Q0@ 0 KD0  DK5P0S m!000PKp qCm!00CP3L#cX Q0@ 0 KD0  DKP0S l!00 NCl!002cX" 00D0 ?0PKQ@  DKP0S l!00h )Cl!00ŸH2D"cX 0QD0 @ 0 KH0S DKPl"00l"0020K00!1cX! 0QD0 @ >0PKA0S DKPp}l"00lyl"00ht10 KdQ814!cX 0QD0 @ 0 K(0S DK|PLYl"00HUl"00D00K000 0cX @ 0Q@D0 00K DK\P,9l"00(5l"00$GP`PIXI`ItI|IIIIIIIIIOIIIIJJ J Jx]>4J8J@@0D cX 0QD0 @ <O0 KX@0S DKPx0 R k!00 YBk!000G00KP0 cX 0QD0 @ O0 KA0S DKP01 R k!00l +Bk!00x100KQ1!cX 0QD0 @ kO0 KA0S DKP1 R k!00 Ak!000200KDR\2`"cX 0QD0 @ O0 KB0S DKPb2 R kk!00Z Abk!00Q2轶00KR2#cX 0QD0 @ O0 K8C0S DKdP4X3 R =k!00, A4k!00#3菶00KS3#cX 0QD0 @ 0 K`C0S DK6P@3 R k!00 sAk!002a00KR2"cX 0QD0 @ 0 K0S DKPj"00j"00d20K00T"2cX" 0QD0 @ ?0PKB0S DKP1 R j!00 !Aj!0010 KQt1p!cX 0QD0 @ 0 KdA0S DKPD1 R j!00 @j"00v000KP0 cX 0QD0 @ 0 K@0S DKPY0 R bj!00QL @Yj!00HD0贵00K JJJ?G?h!00{S?0PK,0 cX 0QD0 @ 0KP0S DKPa0 R jh!00Yp >ah!00P 0@K GJJJK4KII$@h0l cX Q4O0@ 0 KD0  DK?P0S h!00 }>h!00@0 cX QO0@ 0 KD0  DKP0S g!00H Z>g!00g!00cXq/O P@ DP A0K0S DKP0S g!00\ >g!00ttcXD @ /O 0芥Pڠ20K 0R DKPyg"00ug"00qݲP@3cXC@ O0 D @@ }030 K R DKPUbg"00Q^g"00MxC3#cX Q O0@ 0 KD0  DKjP:0S Dg"003@ = =7g"00&D4$cX Q0@ 0 KD0  DKCP0S g"00 @ =  }=g"004C3"cX Q0@ 0 KD0  DKP0S f"00@ Z= V=f"00Bl2h"cX Q 0@ 0 KD0  DKP0S f"00@ 3= /=f"00A1!cX Qi0@ 0 KD0  DKP0S f"00@ =L =f"00`AD1@!cX QB0@ 0 KD0  DKPw0S f"00p@ < <tf"00c0 0cX 0QD0 @ @00K0@0S DK|PLYf"00HUf"00DD00 K@LPLTLJJXL\L4J8J`LhLpLx]>JJG?$P80< cX 0QD0 @ DO0 K`0S DKBP0 R f!00  <f!0000K000 0cX qQ00KD0 @  O 0@K DKPe!00p-`P@0!@`Pp -P@E:::LCLM/\p, J\!h1S   00 \ 8AS, 0110 p0 00 A10 46@ d,0 "&`'@0@p 00 `P@0,!O3\ \0 L03  1S@LRp@- b@0`P \02l`1^1b\@0pRp@- b@0`P \02loQ^Qb\@0pQP:  -P@Lᷦh ׫\ ԫp`᭦T<  0 ᝫp`陫@A 0-L LP@\4 방0᫩0A 0-H LP@0S0hMBIp0 -LP@,M⌥0KQ0 @ ,@ WSO@S`8 RPRI*R4%0 0 0 s 8 0b038 b&xg)@s)(8!8HT*@@*TI2@0@bP)P\)8@8#8XU*P@*U@2 ȀP 0&#@-O@d4xB 02d @-M0Ѝ@4=> 0" 5M -L MQ@0K00#  0 b0T0P00S00#0 -LM K K!#P -LM K K!"P -L 0KM#$ -L@0\M0 0 L0  <0 ,00S00 K$ KP$`|!@{! -LM`Rp @t%  P`F @pT`P0AS Q)0 0  00    p-LM @0`SPR0 S    0100p 0S Q0 S  0S0 .R@- P@0@ .\Q00Q0S@@ 0S0 .R𠁢Q00á? Ph+ p+ x+ + + + + + + + + + + X+ plhd`\XTPLHD@<8(N4NLNlNNNNN O$ODOpOOO 0- LM@P K0  0#p0!*Q@-@ Qq20  00S+.10#0 \00S#10#0 \00S.20#0 \00S  \  0LS00S q82  00S \\ 00@M \ J4. . . . . . . `. p. . . . . . . . . . . . . . . . . . . . . . . . p/ \00n  0000D0\  S00000\00a \00b \00t \00v \00f \00r  Q   0 \ #3 00000 00@\00M00| L  00 R-00 ^0\0?0@0\00s 4q p-LM@QP`0 f0p0  $Q -LMP4 Q @pB8 p Pn*Qq10  00S*'10#0 Q00S"10#0 Q00S'20#0 Q00S 9 Q  0AS00Sq1  00S( \Q PQ T:`4P00 V Q 0K0  jQ@80c@ T4:@D`0K0  j` VPE  &#@`4q -@TL P`p T0g0 0 0 @DT -ML M\$0X,0  LPPa 8P@fBnK`F`F tP 0#S   P@>  9$P  @ 2$P33 0PP( BNK@D @D 44S ?R0Sp  nPP  44S ?R0SpO42 ,0S ,mBnK`F`F GtrP 0#S} p <` 7L 2P ( )PP' BNK@D @D S44S ?R0Sp  PP  =44S ?R0Sp BNK@D@D +P PP #0A0S((  PP0SU{y#0S  ! r#0S   k#0Sx  d#0SX  ]#P@008  @o!@@Yi`OO3PO5\+0' -40L R4P P00@` 0-LP$P P$@ P00` 0-LPP P$@ P00` -LtM@0SK 0ށP H K 0S x0L: S< ZO00Z0P0@Ot  -LM@0S00@ -h0L,M80 \0 00 T0@4 , (0 $@ 8 "00 8K 0  +OO d ꀛP0@-@P  0S ^ 0S^0 @0S SS00@00P0a* -QLM@,0 pR P4 i 000 h 0p` V Vᘦ%j:$,0P  0\0 p` V000S00 YB080 4 0\08 0\0I` Vp Vᘦ%.:"0\0p` V?`Wpᘦ%$ 4,0P 0\04 0\0Y4 @,0PP`@,0PP`Y0 0** -0-0L\MP6K05K{0SlK\0 l0   X d 厁p@ l0 \P 0\0S00Y 000\0 B 0-LPY0 0p@ @ ZPtT0{Y0S yh* -4LMQ<@ 8#8Q8:0Q 4 %*0 0K Ġ̌.Č#̌ !QB*v?* -LMP! -LMt!H" ,  2  `Z P" 8PP 0S) P P 0S $481!@)!,X0@X0 @0ᕯKS/K ڜ1S9 # 4(K`Q  0 QMK0SMK"P3 0 Vv"3`(K0SS SQ  O. I.OK @DA. ~P-?(K R!  ~0S +.?(K R2S "R K  KW)0 4  MK0kPMK⯯ P+ 1MK⥯ P{W 02 qW0S mW Lh* 01w^WLD - hRW0#S NW  R@\K 0T@,"|@@"2@@P 0S"2Po!$Qz1`(Q0Q8QЃhPQ`QQQQQDPP -L,Mp`@ KD0K< 8 @ 4 0 , ( $ 5PDP@  0`4PP @TDIDEh -LMp@P `p08K8 (P , 4` p7K0 8K (0S (2o!R -MLM Z,   4 `a V $ 0P@Q X1X1 - #Pp' B^KPEPE0$! @k}j`e}V INK@D@DP 4: S  R 0 0 ,0S ,RPt $R 0R\ 4 L 8.`o!@(Rt 4RLR`{!hRtRRRR -LMh@pP` 04K4 $@ ( 0P `3K, 4pK $0S $o!R -LEM@pKK, 4! K081 P@  #R 00T-* R+ R) R' r0 0  R r0 0  R0 Qh#0000ӑ000\*0 S S S0\*0 S S 3000 \ *0 S S\*0 S S  \* 0 S S S R r0 0  R> \*00 S S SP\P 0S ``pPz0+Sd -S D 4zP0+S0 -S PPUb ?? UP[|,0 S t,0S @S P K?K)`0S @S K?K)0SP @S  4.P`8~ 81S  K?K) 4v8 0SP @S 8~ 81S  K?K) 4^8 o!4qdR -LM@JKP!p< ( PPP`P@ (0 S (QP/K?KD @ HB KH L @B P0P00@(K ]P(0 R 0SMR- $GR R #@Qʑ T#ppx#KRdpKXpAkR gRmR,pFXD X0XHXhXWn*k*h* -LM<`p@P0$ P@ PpLDX -LM@` q00  R@P pK P00\0SP:Q UqD0  00S0SPU@ 4q -L0Sة -ML M0CKJp`@P J! ,p P`@ Pf ` PE~KpG`pGf P\ \ 0 S RL\  \*BNK@D@D u\4 B.K\4 B B8 P- K@@PKLENK LP `4@D@qPKATA P@ TT|0 ,0S ,"]KPEPE P P@M00o!Xt XXXX -RMLM!0,0 rhPS~KpG`pGe  P[ @ 0 S RL@  \*BNK@D@D @5 B.K@5 B B0 PP-RK@ @GPSKLSKLN4 0PR.K B8 B0P@ 88qx0 ,0S x,R^KPEPE P P@UM00o!t XXXY p-LM`PP  Q Qp r0@0 @TQ <LP IpL00p4q5*b***** -LP@U0#S #U @0S0 P0@0| P P  lP0=SO0@SU @S4q4t[\[[ I[0@- R @P"R. ^" ^ #R P R R R 0 R00L0 P R R R R R R \Q0"S -=LpP00 -LM8@04S0 'P\t  -LM,@0 S/00  *A@-@0gS@ -S S +S0 XS00S 0oS$ uS= #  030100 030100 80 I@ -L$MPPu 0(K0@K0! f,< , ^@* < 0 P`< H0 \ p50 0@ 00S-  4K40P R>0S OJ"00: V:`X P@ `<0$=60` 0  8 a0AS"{ { { { { { { { { { { { { { { { { { { {  80>080 8 C. 8 800p+WP -W=W80@ =W  P@  j0`@C<D0X8 `0S ,S 0 0R 钀;I9 8'͌8 4q@-gQ@ =Q +Q -Q \ XQ0R0- 0+oQ uQ\00@ ! 0 00 0 +^00 -^00 =^000 0@-P 0+S -SXS S5 0+S -SXS @ 0-S" +S XS00 T-00@P^+00P\ X00P0  @0  @0!h * --LM p-P0LM@`P8 4T  /p |O` p-LM@`P7P@ 0S0S p{! 0-@P@0LS00&$ 0000Ut \{! -LM(@0S0 b00{! -LM䁟0So (K PP^ (0 S R@0@(  S*A (0`` P#R #PdqP`\PfP@ `0 S S0 S S WP0P0,K c,0S ?R0Sp 0U0` 0@S  R00 RPPUx@ T 0S 0L0L0V@4 P@ P,,P Y@ȯ\t \z *;w * -LM,4C8̓ <.K #h, ?KKK@D3 0# p @ {! -p`LFPP P @P P 0S0S {! 0-@P@0LS00$ 0000!꠴t \{! -LM(@0S0 .00꠴{! -LM0St (K qQ@`Tg ( 0 S RL0L(  S *W (0#` @Rq PU`@ 0S0T`Å+PP `0 S S0 S S P@00TP@ 0U ` 0S  R00 R@@TP U 0S |00x0V:\PP 00Pa P@Ņ,,SP頴Yh\t @-Mp` @0\@X\x\@ Q $Qq0 0  R#0C'  Q .Q0V42:ЍQ q00  00S 0gC R17 1RTq00 D R q0 0   Ra0LA0L4q** -PLM`p C000@,K0K 0 , ( @@ p0 WV0000}PP0  0 @@ p  #C0@C0@* 0-! L0TT !P@CT @@ T 0C0 0ȹ -PLMU㤀0` @pT 3=0S0h0 @ǥ\h 00VD @: , 0 "0 WC0ꀹȹ -LM@(s n @T0 @l    B00! RA R0000000000000000Z * -LPP \QP!00 DQ0SG d0S7 ,0d LKP@K@KPPP L剹LzP0T@KPT XBTBPBPP d@T XK X 0SpR`@@K` `0]H0 \Po! `il]t]@]]<* P-T P,/C!bL0 Rn$ ? A1c10L000gfff p-LM@PT` h0 d13 p< ( w ^^,^*$* -LMğ !  \ ,    !p4@R@  pP4@K K 0  K K,K  K K K K KW0 \0 x X0 T0 P0 H0 D0 @0 <0 80 40 00 L 0 0 |0 t0 p0 l0 h0 d0 `0 \  !@0PCⅠK  {dP`.0[  R) R' T*00K[p20  00S  Q"0000ӑ0K[ Qt"0000ӑ0K[PPV=L0@R XKK, UPGK }K yK uK qK mK iK eK aK ]Wt0S `!>T0S3 0CS/=v@1 ,0S ,@ KI  f _]KP=KXKL00L0 60[S0X K60K#@<00Hpp< 0o!` 4qd@f_d\ 00` -L0Mp0P 0 `@ LKL@KD00D0 Q Q <00 0 S 8 , GQo!Mt,t,t, -LM^8K- 7<K@ K0 <0 T=p` P" ^PZDK@ B@ `@K=MJvD@K / @K'0 8K_@q!Y%*: Sb0 d Sc0 ] Sp0?0 0r0-00w0-00!=@SL CS-0> d! r0-0 0w0-0R00 &R-0! (!r0-0 0w0-0R0 R-0 00 0 R 0Rt0T0x00 R 0Rs0S0x00 S ! Ss0S0x0 Sd0 Sl0  S-0 Ss0  Sw0d*K**%* M-L(MPP@0P HK;0D0 ; Up` T LKP:L0P p`R 0S  0SH K1 0y;D0K!X p`PW UTv W VwY;0"ST;0"S(` -LM, ,D0 ` v00  R-V`<  +V< `YY0V Y0V <Q +. 0@K  0O@K 0 K@@K 0KP@@K 8<00 KSP T@0PiPepv$B 00Q0`Fv  00Q[ v 00Q7 FW F` VM\< R& 40S 8@T80 W V00S N:"00`D@ 1B"@$$pSƏ4X004 X 80W8@<0W V00S pD@ 0B"@$$pƏ4 X000Q \,0 J00 K\0XSxS`I4qof* b*R0S 0S0S0  R00L*'I* -MLM00ANK@D@D+_P o!k` -LMM|pANK @D0@D`P+ 0 HP 0@ $ 0S  o!` -LMM|pANK @D0@D`P+ 0 P 0@ ( 0S  ]o!`0PP0 Br 0 B\0 r 0-0@SL 0PU ,0 S00P0  0-@0L@PT fP @T00 p-LM0`PU TP00p p-LM4R0b0BP`(` 0St 00P 0S\ 000 0  0 1P0 0S8 00P 0S  00 P 0S  0 0$0D!$0<1p0`o  h0 ` f0`b  [0`Y`0`S  L0`J`0`D  =0`;`0`5  .0`,`~D@ -L M0`S$ p  :S0 $0 0pS PK%t8l8\8P@ (K (0S p00R0S 8P@  }(0S p00R  R W1 $ 0 0 8|8l8d Q T1 R 0S0<00  00  0 R 0 R0 0 0S 0t8p8P@  .(0S p00R0SP XY8P@  (0S p00R0SP$|iD -4L  0PP (`@T T 0T,S 0S ~P   0PU  0PP  0PPP`b p-LMP0 S0 `@0 P P0S0X S0L@0Sp00  @ -L MpȀ@0`SP(@ &\0  "P 10$ KtP(K✱NP  (*D0  $v|@hbp$ aL@-0S@ @ 0 0 0   -LM`Q ^( @`p$ 4 0PB ( K10 P; (P6V00T00S(0V0T00SW P P0 $%@4$ 02P $ 03$K @hbp$ --LM -L@`p*`0 XXP]T  8R8 $0k  LO` H3 -LM4t0p Rd0`V @@TJQ 0PES@TZ`!Vpn! --L 0-<0@ PL,, T oR 0hO` 0-0L@P 0SP0 CR 0P0 00R P-k* 0 0 -PL4MPL p` 0 SR@P X 0 S I@P L0@KP\!H0KQ, < 8 4 0 p4@HP D `` @0)Sn6 0  -/ z+0U# >E0CS <0pCaH0S  g H K ^ 0H0 L0U 0R*0 0\)4q{} 0-@PL0\*ql0  0!0S T000@CT00^00S 0 t4q -LP0SP`p @*d P & 0S*8 P \P`\&*0^S00p\*0]S -S \0* ]R S*-R P0]S-Rx \*0]S %0SS 0 0@SJ0  t02  00SH@TZ 0S?W"  0SJ 0 @@000l 0\0Z 0  00 0 B 0SP x hxhKP  000  00 -00-0 -  Pz00 -00-0 -  h00 ]00]0 ] 4000$i,i4q -@PP050#-SL [S0 :Sa =S1  pR*0-S `WW  0 00 \  V\*0]S -P0`0 `0S0%*00-S]S P*0S*0=S ,0]S00"P*0S0"*00-S]S 'P *0S*0:S 0]SP*0S05l:o h -LM @$Ap\ *P q00  R@ `ePi UP0S PP PP  000   PP0S 30PS4qL -LM@=>0 00  0- LR@%*0S*0[S 0 0.Q00PQ*0S*0.S Y00]S00O R* -PL@  R)* P*0PS 0]Sp`ePV * ẦP0 R 0S,Mpx0   0 R PX 00p , 00  RP 4qd@f p-LM0K KP` 0 ]0@K0K KgP`p -0L `@8pP Pul00  00S P h Y0S 4000404q p-LM0K KP` 0 ^00K K]0 @0K K%P`p -LMP`@p0SGT1 T00W0 W00SiTTTTT(TTTTTTd|` f 00   f  f3"  A*  i f0   f  f"  A    @`pG f 0  f  @D @D`q0 S h - P `L0 0@V 1R V5@0S P0 +0S 0S @`P  R Ϡ>1(!"p>00c # Ϡ h @ VP@ 0^?>1  ^00@9P@ 0@0 p@-0`@  ^R *0 00  n^ :0E\  00C 0p -L M, p0 0 S@"* 00T0R00S P*`P0 00 R0#S P: P @ T:`@ T*,,0p-0 R*0 R:@-0@P*0  \: -LM@`p0 00R0?PU@  P g i 0S  Pia- 00/>\ 0S0\ 0@- 00>Q\@ 0R0\00 -0LS8p`0S PU`P 40PU040@0 S @TP -`RL@PpR 0!000 p-LM0@S`P 0\ 0  !p/ p-LM`\P p@  A 0S0 0H0SHP Z  e! B 0A0S 1>3 01 0-0@SLP0 0S @ 00h 0-0P0@L 0S 0 0 00 p-LM @R0># R0 (R" R @0Q@`R@PpP< @Q>3 SAQ00@pQPNR RRN>3># R R "RR R(00(0p0S0 0>3S S S\(00(0 P L -LM 0R  @T p0R000PP P<PheE -LuMp0 (, 1 P`` PPR 0@x1 0$P}K@{K 0 oK. ́ ȑ q uK "P? 1 pdP@ oK ?0 ,0S ,0 10S{y H0 @l 0(o!}!lPti`i -LbM⸠0JK(0 p @)@KfpaZ_K`cP TjKjK11 P 0S(0 S (o!i -$0L!00  -LMp|# 0 0  R4 УP @j T#1PU%0\ \|t3  00SXH3 /\00\0SP.\ \|3  00SH0 0/\P- \ W u0i U ډ>i1!X H U )(00 0S PSPSPPP0i!UPQQ20  00S W䡟`P c@j T! 1\P \|1  0 R\ Uڶ][i0XSxSNQKq(10  0D0SB X0P` 0\7 \5|00  0D0S, |  0 0  R \ 00ӑ@  @dT0P0U0 XHm 00P02 p( UHE4q`nlnndLnn -LM0  +n` -L M@ 0@ת$o`RW*ZT* -QLM  0K  0   0-LP@kp Pp U T 0\ pP UbgH: -L3S S 0P>3S ? S S 0@U S SS S 0P` 0 P Fp, @E  0@ PP, P , 0@S8 S !S 0P` 0 P Fp@E  0@P 0 S S 0>" 0c O 0 > 0c" 0P` 0 P Fp 1>30@C0  @rP @p1>3@!>#"R@D 1>3PLSJ1>3P!># RA -LM@,@ p RP`A>3Sl S S PU00^ PE0A>3S WSL ,S)>  0 0r 0 @S 0dV   P   1S P1S 0sS ,1V >3,@0ca 0@P@D ,@  ,00C ,0 ,01 , `S< S > 0  0cO0K ,@0 @cP000 KS>30@C 0, NP0!@># R 1>3@!>#"R@D 0a @ K> B000 K@K ,0$P|000,0 P>30  V  V`  0R# [S S V`SV VN*0 SK0G0 0V V0V5:;0 SX S&S- S V$ V(*  R rlA 00  R_Q 0VV r, 00  R_Q00  V V*0V S VV r@ 00  R_P V5:00 PA >3PA>3 S>3 2 V  0|4q -LM0Q, `Q0 AϠ lp 0 4 00XP40`l ^0p U40 @  U V  Vs T e42W  U' u "0 0Q_U  V v 00QF_VD  U u!0 0Q%_U# A?G0CS >2,0X  R 00  @P4  0  @0W  V v 00Q_V pp0  @@DTʎ0 00\@\ d0Wpp~ 0w0r ,@pn 0g4q -LM, 0 0Q0 `Q0AϠ l040 0PX`lp U@  U V  Vr T d02W  U' uŸ 00Q_U  V v!0 0QE_VC  U u 00Q$_U" A?G0CS4 ><,00  X^4 00  @P40  @E0W  V v 0 0Q_V pp0  @(@DTʏ0 00\@\ d0Wpp 0x0s ,@po 0h4qG-Q0`A $ P !>3Sy < S7 S S S Q@3"Zp0   S S0ZS S S0>#0S S S S "S>0!># R0p !>3 S >3 !>3 S&S S\0X0>0400 S2 aB0L~ -LLMh h@ h d l0 ``K$  l0 PpW:<Q U@* 0dR @T<5:T d @ @@PpP$ 0 0( 0 0, 00 000  4  00PP h0SH0SS 0 P0P00 h@T Q D0^ "0D0^H0S0 t L R0Sh R0S]  0]P@ E U0 EPU 0= GP@ hQ 0lc/0cOh R^*l0P@pD0^ h^p@P:PP$urpTPP_f$d (L  0!0DPdH0S]$F@0\ VP dPEp -L M@0TP 1>3S S 0P>3S ? S S 0@U S SS S 0P` 0  P Fp, @E  0@ PP, P , 0@S8 S !S 0P` 0 P Fp@E  0@P 0 S S 0>" 0c O 0 > 0c" 0P` 0 P Fp 1>30@C0  @P @p1>3@!>#"R@D 1>3PLSJ1>3P!># RA -LM@,@ p RP`A>3Sl S S PU00^ PE0A>3S WSL ,S)>  0 0r 0 @S 0dV   3P   1S P1S 0sS ,1V >3,@0ca 0@P@D ,@  ,00C ,0 ,01 , `S< S > 0  0cO0K ,@0 @cP000 KS>30@C 0, NP0!@># R 1>3@!>#"R@D 0a @ K> B000 K@K ,0$P|000,0 P>30  V  V`  0R# [S S V`SV VN*0 SK0G0 0V V0V5:;0 SX S&S- S V$ V(*  R rlA 00  R_Q 0VV r, 00  R_Q00  V V*0V S VV r@ 00  R_P V5:00 PA >3PA>3 S>3 2 V  0|4q -LMp, 00 Q,(P4 0 8 0 Y0000AϠ0 P0P 4V < 0Y04 `<0P 0 V<0 @  V X  X T sp2Z  V' v\ 00Q_V  X x$"0 0QT_XR  V v 00Q3_V1 A?J0CS$0, Y00R0S0 80 40 80P1P<  0P00 P P0Z  X x 0 0Q_X 긠00 P@DTP0y 00\@\ d0Zo 0h0c ,@_ 0X4q -LMp, 00 Q4(P4 0 8 0 Y00 000AϠ PP< 0`Y V @  V X  X T 00 P@DTP82Z  V' v$"0 0Q_V  X x 00QU_XS  V v!0 0Q4_V2 A?J0CS$  0<S 4< P ,Y 0 8 0 40 80PDP< 00 P8P0Z  X x 00Q_X |0wX0X `0Z@n0h0c,@`0Y4qG-QM@p(,P >3 S C S> #S S S P@Ѝ3"Y0   S S0 YS S S0>#00 000S S S +S "S 0>00 1>3 S 0   0S0 `>3 S >3` >3 S 0&S Sy`0\00 >00`0 S00h0S0`@Cca@-M ^@ P`pX\ Ѝ(@ \@Ѝ@F@Ѝ@eE11* -L5L|MHK0 @K0P$uEe/@ @L@ L@T *0 S0L@ L@0|S :S@00$@$@@L KPL@ PX00 T l PX00X0L: @PX080P K@X0pP0<T K@(0T0X K@00X0\ K@,0\0@L K40PLd K@}p00, d0h K@80sp408 h0tl K@<0ip6[>Xp K@4ap7[0<t K@4Yp7[0 x K@4Qp7[0| K@4Ip|00 K@P0Ap00 K@T09p0: K@01p0,K: 0ܠ 0Kؠt 4KԠP  00`HH L o!` ppp0T@ -LM@p$ e$`K ,PK 0 p P , 0S0$ 0C0 00 R  \ 0 S @0:SS|S0:S|S S  0-L@P0h -LM<@0S00( (0^00 -ML8 M00ß0c S0, S8  sP "0S0@04 KAA∉P@R 08 0 C0P  |20  00S p0 S\R000:S #S <Ÿ ^0 S\R00~KpGpGP0 S 0:S  \S 0S0g d;cR0( *408ZP KAA3P@ 080CP 0@Ѡ81@\ 1 ,0S $,eBNK@D@D0 08 0KA80 A@/0S@2Pn 0@ @00P `<PK081P>o!`4q p,pt  -Lp= P@ dP`$ d0:SS ^S \S $ @^ 0:SS00f^@A`P`VPfdP `d P00:P\00BS1P0C@ 0 0/S7SB0@@2S?ꨡܡġܡܡܡܡܡܡܡ̡ܡܡܡԡܡܡܡܡܡܡܡܡܡܡܡܡܡܡܡġܡܡܡܡܡܡܡ̡ܡܡܡԡܡ00:00 0 0 00T 00S:S00ov -Lp= P@/ d+PP! 0d:SS 0`e\d@ 0:SS00e\@APhPPU=_Pd P  0-LP# P 0R @ 00B SaBQABW0B\70BS>. 0 XRxR @@00 :S0-LP 0:S0@0嘛@0- 0 Sn@S`|! -LM K"峟vtO*$* -LM0`=S`pP,K5P@; U P|5:00P0@S=S 0S=Sg P,@tP 1 ,0RA 0=S 0S0 0=S=0000P餐P@0S 0PS 0S PX0@ 0 0 ,P 003P@  pz@@q! p-L@`M@PKP 0! 0S0 p@q! -LM(a0Sp=QQ 00 !1Q耟@P"0 !11j?0P  d01!0P0S00 @ KP CP@`  0-L M@H0P (0 $ 00K K(0@  0  ,P "P 0dP`* B*A`*#*@-@0S  S 0Sd@ -LTMh@K`0Sp06d\@h0` \1Ϡ!O1Nl!EFdA@0SpK0d@\h0` T1O!Ϡ1NFd!ElA @P0l0p !?A6c!1魋ht*(n*Q0 g 0g$h_*$%Y* -LM< 08 rSwS@T V00  , ,0SZ 4K\PT]pPH P < 0rS <0P@4r,0@, P,00,  4>@00@T 0Y@T< 0rS 0P4P 80Mȟ4@0@4<T 4301,,߾Y Y -LM☀@`T 0S `@TT #$pK pP0S V0000u$ -0-LMP0 S@   R1 00 cQ  R!,0 0S 0o!@q!p -0-LMP0 S@   R1 00 cQ  R! ׵ 0S 0o!q -0-LMP0 S@   R1 00 cQ  R! 0S 0o!q -0L 唵@q! -BMLMh#0P,0 0L4  0S 00,3 ,0S ,}/^PL$H$ K2P@@00 cBK J JH OMK@DPpP 0Sr`0CK0A S A P2D4 H2@ K0C0C0  A  00C=S񟗗ꌰ0 S  1S!00 c0Hw p´C0L4 dAPnL$R = 06:0S3/o!q?,kq$q@q! Y@-@^  0 S SS00N0 --L #P` 0-LM@Pᄘ0S 0'0S "0S  \ 0 @@P -LM@`P P pWW0S `U @YT :0S 塼000@0PTP:@T TW OPP  P 0塬q` -PLUp`@: PP@ U:` `       --L p-LM@PG\0X T`富T < #000 LὌ ph靌O` H3 -LpP4B,BP 0S20ZdWBbPq  PzU0S(Z @PP jU @Z @P PP@UT mY m|  MZ /;P@ P& 0/S! `g0 S ^00 R @pP /P 0S/SPU U @P PU @ZZ $0 *Pz vr00 S; BnK`F`F+KP 0/S' p1$K R v@s@@ T*W+Pᠬb@|+Z?00Sp ҩPL@@ 80R@l+㲔o!kH:@sD -PLM Q    0@/ @CܹPA` .0@0K +P@ p00   @ KXP@  Q00RPPU<0S :   Pm 0`0p0 .000PP_ KPZ/000Sy BPUi 0.S]   sKP Z 000S0 S0 @c0Q00TQ5  嵹0P a 0@0@ @b 0 s@ Q /00b  00b0 sO00 0sQVgXB_n"00 0S 040. Sa0S]Z 00PP 0 S/00a0 a Cs4B00?0 P  H: p-LMP `V p 0@ H  S`H 0-P@LⓓPe0 -#LM0,0 H Ļpp KP@<2: S 00" 3 ,0S ,a Pp! ㍸P 5;#;SP ~P@ P 00pᤸuKỳP@K 㯿PP 1  0L2 PP2 ` UP L" P L" 娸L2Pe@P `j  0rP@P``POP2 0Pb@V*0f0  R R0S Y@V:Y0sP 0L"0c 0 0 7 !0@ST"  PT2S ͒P TR 0@S 1SP #  hHppP:P"Rg  do!Ps+ -L4Mp, &$W, Q< , R0, & BX 0BX0 嗃#(R@40 T P?4 P0`Y 00  Y 0AQ0 X`P&TP @0P UR PUJ P"0Y<0 00  Y 0L\0 `g@g' 0L\0 Y 00  Y 0L\0 P@g< ' 0L\0 < RV 0 b0hP,0P㗃#40 Y0`; 0@P0 4@d0fgP!P Y0` 0L\0 ^ T4 , d/  0  0L\0  0@P0 ʿ,0T`P0 0V*@T%Pg PY 00  Y 0AQ0 @' 0AQ0 P`0V: 0Y<0 00 0 0  0 P Y0 0L\0 0' 0L\0 ' 0AQ0 4 4P4 P4 40P01@80  8P@ Ph PZ 800cD0 @ 8PP? P10@4 ` aH 84 HPa P4 P4 k4H H 4P4 PH4 40H P D D0P0 PD D0P0 P   P P  `0VL *@T%Pg PY 00  Y 0AQ0 @' 0AQ0 L`0V: p-LM@㖵^<0  00S 0S0q>  0 0S 0 0C`0ꎓP %T 0S 0S0 0C` 8t= ,0S h ,?pP 8\ @pxT5D8888888888888888888888888888888888888888L88888XXXXXXXXXX8888888888lp8p8888$88088888888`88H8888888dppppx88848$8,88`j| 100Cw+@@# 0<3 0S_@0q:  0 0S 0`0CS0 ʾP LTpZ @ T *000奒P d X1 `0 j 0 0 43 0P4C8@4C `8 Z KK @0S 0 0CZ @ S0 RT `hP T4#0KKQ 4# @ 0Z0C0   0S 0 R@X 0083083 >P XZ@&43@4C @0q48  00S 0Z0C0   0SP 80d`08 0[0q7  0 0S0Z0C @0 SP d7JZ!3Kg @+0DMSa<<<<<<H<<<<<<H<#R0<3  @00CS0000CZ 8@XXTxT/  3K0l`<#3K@C 43 4  43 43 8C@8C 43@ 4C  43 043  43 4 H3>KXX?P 【<x$00<3 <`$00S<3 ʦ<3 S  3K0X <#  4JZ!3KL @+0D:SF@00CS0000BZ   2@xeTET)8 3NK0d>3K% MK 43 @04 8# 8#  43 MK 43@544 @x3.KXx3>KX ᅐP 【  <  S<sP P!@0@# KKN@p@@@@@@C @< ylP 43 43 `4343  @4C 4 `|@"@C @UX@ t40  0PD B$ @0o!4qs̶ [ @-^R  \R n-\ @\00]\0S  R\ A]\ -LMP pR0 0V@ Ჶ000ʏP`dp@V ᢶ 0 f0 0  fȴ -LM`0@0P 4p净PP @ ၶ4@0P 㖰PP _;040Pp0@  pWZP p0-LP@= @1 RK 0 90000PS  40R 0B0PB0000P 00 0R0 \0\S  0B@00< 8040BP00 L0 0ᛣP0000@}! 0-P@LT a DA0DSR0D@TP0 \(P.T.Q0Tt -EMLM@H$ 0,, j'H4 YL h Pl4 Y t7 ,0S p,孲!4 $Tǟ8(<,"(S\$ D ` 0 l hPpDP 6 0YY`  \4`$ P T  S\4`$0Cd$ \4 V:l6 D 0 l gPpXD(PR `V)*gi` VX !*_i`V H*Xi`V x*X4S TJ `\4CS\ d$R00V0#02S`4S T PY? L ""`$00R00S Y! 0S L0  CKA A$H{D4p cWHD4 0D$ YYX^ X$ YR X Q a@ ap Xap0% H$^: Y\ YY d^`` DsPD3 WX^/ `P" D4 0b3 RD :dd nl3TP:hQh ecT4  T4 i`D40D4 D40D40D4 <K 㚴<0S80S40s?2 D4%:8YDlsP%D4|H$D 0 l fPpDcPdd ``QD4!0 2P^D45p#04P 5wy D彵pCNK@D@D 0fPp:Pd40d4 ᤵD4` cpWw D0l D4 D1PP*CNK@D0@D 0fPpPd$ d$ D4P0P uD4`p0D4 nD4p cWdd ŲՈD$H0D4 D$p0D4 0H$ VYo!`!}! Xt<`!@`dt$t 0-0L@,|d0P   0S 0 0QA0s0`!}! - L M0P,90` X X0s. 0fP  q30   00S 0@T td3  00S.Q q0 ,3  0D0S}:\D ,pKn g,0[S6 `S@ 0fS+ "bS @TV0S mP Ƞ 0NP 0R` ᐭySX`  ,0[0@T t1  0 D0S:R .R 0P.S a *xP, ڇt!tt1T @0 @`@D1  :㻇Pz0P.Sl  xP܀,᱇ < 00 @@0 0@v+t0K rOPP'h0 !/00c0F@p X`!}! 4q4L`@`! -BMLM38 0,, "< 08t XZ80S XZ8$0S R80s R S  0S S 8$ p 8$ X X0 SB>K0C0CX@4 .K Xt BnK<`F `Fn f2(K Rb 0pS@ 0fSU LbS @TW0SH2 ,0S @,KP Ƞ@ 0LPP&@$ 0/Pp Q j 8qf!0X0P 1 <$0  0 0 LySX8 p8  p$ 㻆@dP f0 ,  嫠P@`PUZ f妆u400 0 @0@ P@厠b!/00Q00SS (@?p 8 -ko!`!}!t``!4Lttp\ 0-8P@0LS((r0@0s@t t` 0-,PLP 0@T 0)@@` -L M0,똂4 0S ,K grP@ ,0 S R@0@,  S*H  N,0`` @#R #P` *tPP q` WvPU, 0S ,0Q1 p 00 S S0 S S 1hP0`sPP 00U 0S  R00 R@@TP U 0S @@4 0 0@+0K 0 0VP4sPP @ uPv4 0 0,0  f H0 DD%rP _`!}!@Y `@`!tt  -LLM0@<,;0 hP `!}! -pL`"P@ 0SoP PP oP 0Sh0 -pL `PP@  0S0P  -鬁L0M 0嘡0 0` px1Z>*p-sP@P7 P ]0 S S0 S S sP`@ 0 SP P`+U`T 0S  R00 RPPU@ T 0S PX000 R X0W@4rP@ PP $0W`4 `@ Y5 -L(Mp젟0 S( P'oP 0@`8PK P@噞P00%XΞ    t@@0p!lL0\S@0 !$ 0^A(! ! u@G-@M`@<T8 40 ğ0,`0#0c0, `0cC 7?04 #/(00 ( ~- 0 ~ " #~5 ~ !~7   ~9 / 00, ,: "#:0:"&!*  1 !00H,x P `@p` Ph%%),%\P0!ē @ 1 )Wh _)| 0* 0 ` 0+p0 `08000 @`@1p0lPz0p[0ˌ0 00400@Ѝ@C c 3  -LM`0(K\p@P.  b($ 8 ( #"., K00K, `0@,<4 Ġ̌(<"4!Č <.̌ (0 $ ;t -LM0`$S@ 3 R (PK0000e@SP0m _Rl zP `P;@ ZP@P5@9P-P.@0zS `S;0C ZS@S50C9S-S.0C0p 0@SX, K00KUPP2,hŸ * =? 0 7?0  ?0 , [,  9?0 &?  3?0 ? 000  6?0 #? ?00P 0zS `S;0C ZS@S50C9S-S.0C0 Rp 0zS `S;0C ZS@S50C9S-S.0C0 Rq0S  0P0S  0@0#0 eR0S P0SH@ (ᴫ@c"01S [@-!P.*@0 S0ԧ S ԧ RQ 00C210P*0SԧQ <0 C120P *0 S ԧ R 030P:x p-@L$MaP2 ` 0( ȘX%X@ phly -LMp0@P 0 0`K 08#HT UP08  0 S  崦ŧo!!ty -BMLMr0D`K@P ,0 嶩02S0$S aS@ d,0 S T,卦@0$S);0 KZ @ P TKIAK`Y0(H K:K4H  K@TK 0i TN:B]KAKx1 (PE(J(K @PE6J @T@ @?T@BKCK!"41"",!1AK1@TPY$ @20@0  @*K0 TK ጪ vK @TK  T:oo!y \y@!ly(0@-"Q*|@P0#!0\ "0'*0#" \ ! *0##? 0 \0:00000xE-0``&&&C&̠O 1t@X 00#0P 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 0 0#0 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1@x 0 0#0 0#`&&&C&̠O 1@x 0$0#0 0#P%%%C%̠O 1@x 0(0#0 0#`&&&C&̠O 1@x 0,0#0 0#P%%%C%̠O 1@x 000#0 0#`&&&C&̠O 1@x 040#0 0#P%%%C%̠O 1@x 080#0 0#`&&&C&̠O 1@x 0<0#0 0#P%%%C%̠O 1t@ ̐0@@0#D 00#P%`&P`E-D0``&&&C&̠O 1t@X 0@0#0P 0#P%%%C%̠O 1@x 0<0#0 0#`&&&C&̠O 1@x 080#0 0#P%%%C%̠O 1@x 040#0 0#`&&&C&̠O 1@x 000#0 0#P%%%C%̠O 1@x 0,0#0 0#`&&&C&̠O 1@x 0(0#0 0#P%%%C%̠O 1@x 0$0#0 0#`&&&C&̠O 1@x 0 0#0 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1@x 0 0#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1t@ ̐0@0# 00#P%`&P` kyH0@-@P!0\#0 0(S"Ƞ0 -L0M($@KP"h0dp 0 8#x "W 0@2K,0 00 p,K0K  H,0 0("x00W0p@d  608 0#H,0T108#xW -L M((KⴠPp@"hh   0 8# "Y 02K00 40  z000# 00 s40 0#0K4 K40 00 0("04 Y @  X000# 00 Q40 0#0K4 K40 08 4#H00T108#Y p-LMH`P*$H ph? (-"xPUL`@: 08#XU@: (-"xPUL`@: 08#XU@: -pL MW`,*0K0 8 Ƞ<̌ Č40 ,K ,0 0 a,00 ,@[0P[p#Ġ"#" #8"(W0@ P`: -pL MW`,*0K0 8 Ƞ<̌ Č40 ,K ,0 0 d,00 ,@[0P[p#Ġ"#" #8"(W0@ P`: -pL MW`5*0K0 0#0P0 8 Ƞ<̌ Č40 ,K ,0 0 ,00 ,@[0P[p##Ġ"" #8"(W0@ P`: -`CL0V Mp@CPC,K0K6,K0K08 <40,0   Ƞ0̌Č  0 )0[0"[ ,0#40, [ -0[0"[ 00#400 [ 0 0#0Q`FVPE@D08 <40,0   Ƞ0̌Č  0 )0[0"[ ,0#40, [ -0[0"[ 00#400 [ 0 0#0QR-D?0 \ !Zd\ -LM@t@ğ0 8`, 劥 aP 00 0S$S 00R5:0PK c m g K Z  P 'D\@ @'(`@ ?0(LX\ @c@@ '<@<@ (H<@ [H@ @D@ - K(DH [P@ @L@ . K8DP [X@ \/ KX [@@30K`0T@ 0 KP@ L40K, 1K2PK 84K ,0(S(h ,l\o!@ 0-PL@U !", 1#80!"$ 11PX 0h釣0 -LDM@@ hKX p0(h0 0'00 * 霠 d0  (  ly 0)pgz p`00* 00H '臠\  )  $0( jX 0 0'00 * 霠 T0  (  x 0)pgz pP00* 00จ '臠LP  )  0( jH0 0'00p * 霠 D0  (  Lx 0)pgz p@`00*00)COH臠 0'<00) 00 ( j8  '  ܗ0* 霠 40 0(00w )pgz p0  *  0'臠,00)00pd  j0*00(00LP 靠 0)00*00(w< p{ p 0'0 0)00hh0(0 0'00টT  j0*00(00༖X 靠 0)00*00vD p{ p 0'0 0)00th0(0 0'00T\ j0*00(000H  靠 0)00*00 vp{ p 0'0 0)00셟4h0(0 0'00ȥ`  j0*00(00कT 靠 0)00*00uH p{ p 0'0 0)00\h0(0 0' 00< j0*0#00 < i 0)0#00ud pz p 0' 0#00Xh0( 0#00 ꤠ0*0#00औ4  i 0)0#00thpz p 0' 0#00dh0( 0#00H ꤠ0*0#00,\  i 0)0#00 tPpz p 0' 0#00샟D h0( 0#00̣` ꤠ0*0#00ଓ i 0)0# 00spz p 0' 0#00t h0( 0#00T ꤠh0  (  0 0 i *s pg{ p00)00舠T0  '  ̢0 ꥠ( ଒\ i 00* 00r pg{ p  )  l 舠d 'H0 ꥠH00( 00$ i   *  r pg{ pP ) 0舠400' 00༡ ꥠX0  (   i <* tq 0pg{ p`00)00P 舠D  '  (  0ꥠ    xjVp $ν|*ƇGF0FؘiD\"kqCy!Ib%@@QZ^&Ƕ]/SD!7Ç ZEogL*B9q"am 8D꾤K`Kp~('09|eVD")*C#9Y[e }]O~o,CN~S5:*ӆ*#** -LM0p@ LP ภ00 00B S0`Ba0B\W`BA0B0S7`B R Q\S P Q'@A$A(APA4A4A@(@D  0IXS4F<`<`XF<`<`<`<`<`<`lF|G<`GG<`I$I$I$I$I$I$I$I$I$I<`<`<`<`<`<`<`<`<`<`TI[<`[<`<`<`<`X<`<`X<`<`<`<`<` Y<`<`Z<`<`<`<`<`<`<`<`<`<`4[`I[[[]`I<`<`]<` ^ X4__<`_<`,Y<`<``.(K0S 0(K0((  00A SP؅ 10 A0 R0PC$^ 2PSP1$2 $20P 02 02$"S 0c$" 02 k(( g Pb\ PR \$ $2 002 Pb K T/K!>K _ + >(K *Y 00I SP100PC0 I R$Y 0U@@4 2PR SK T/K!>K 6 00A SP؅ 10 A0 R0PC$^ 2PSP1$2 $2PP  0U@@$"  PB\ PR \$ $2P PB K T/K!>K  (20(2 P100PC0 I R$Y0R (( ( s $2` $" VfT(DB ( D 00\0S,K% Q: &:Q 8 ሞ`>(K DVRH H ("H20H2 (@"0HPaUU&0 !1 0RPEK1 ! pUʀ6(!1 0R1 ! p>(K R b?K 0C0 10Q1  pʀTo DPfUUgE00@!1 0RPEK1 ! pRU0!1 0R1 ! p?(" n`!1 0R1 ! p\(" 0"H2PcUUş00!1 0RPEK1 ! p=U!!1 0R1 ! +,02H"R1, S0~K1 K_P P ?KP 50 2 ,0@,0 S ,@KAP =P~K K6P~KeYT K- zPQ3@!1 0R1 ! p>"2R( @4!1 0R1 ! p$2PCUoUC00@!1 0RPEK1 ! pU0!1 0PP~K BKP~KKP{~K"R2RS20!1 0R1 ! p>2P`UU6A00@!1 0RPEK1 ! p!U0!1 0R1 ! p(2 l1 0 1Q01  KP0~KP~K )AKP"~K20!1 0R1 ! p!ʰ0 0 10Q1  p K 0C0K@!1 0KRP~KKKP~Ko!D],9khT]E5 0@!1 0R1 ! pL@4" !1 0R1 ! p92PcUU1ڔ@00@!1 0RPEK1 ! pU0!1 0R1 ! p 201"0Q`KP~KP~K \AKP~KKP~K2Sgڤ1. (K yK0 !1 0R1 ! pN Kz/O EP 20C01"00CQ1  p e?K0@!1 R0 KPC~K2PCUUڤB00@!1 0RPEK1 ! p U0!1 0R1 ! }P~K $CKtP~K(00! 1R0KaP~K\P~K C0H P`UU'C00@!1 0RPEK1 ! pU0!1 0R1 ! plK0P~Ke+P~K lDK"P~KU(R yK00$0(0K0 !1 0R1 ! @KP~K(P~K %L >&B`Pj( K0j`C1!`P0j(" 00S00 0jV0 0j0 ^q`PV P00 U- >(K Pu`(2 2PSP 1$2 $2 PoP $ }("@ 2PSP 1P $2 $2Po 2SP"1$2 $2$ P20P2 Po$ ]((( ("  $2`0$2  >(K L( 2PSP1$2 $2 P P` $" (2@ 2PSP 1P $2 $2P`$ 2SP"1$2 $2$ P20P2 P`$ (( (  $2` $" (2 2PSP 1$2 $2 P`P $ ("@ 2PSP 1P $2 $2P` 2SP"1$2 $2$ P20P2 P`$ L ("  $2`0$2 (000S(" (" u( 2PSP1$2 $2 P P` $" (2@ 2PSP 1P $2 $2P`$ 2SP"1$2 $2$ P20P2 P`$ 2P"SPbK1 $2 $2`0P" $2  >(K t@ GYgYT@(y 2SP"1 -K$2 $2$P20P2 $ -KP K9. 눣P- >(K `k -KP\(2bKL -K<KK (2 DGYgY|\ggYEeeY"fY \ ( ``2(K R- >(K 4\0l``\`T `( 0`L eK  h2@ S``(2 2 KSP1P$2 $2P $ (@l\(" ("  (20(  2PSP"1$2 $2,2P /$20$2 j( 2PSP,1$2 $2 P $2 Y(@ 2 KSPP1$2 $2$ P20P2 $ E 2,SP1$2 $2$ P20P2 $ 5 2tSP(1x$2 $2 L P`P" 0P" $2 ( ,( $G89 2PSP1$2 $2$"80Z TP $"  bP `jV` `Y bK >(K`1S01 KiP L `K`P~K0S  $"f 00 -LG4Mp4K, < PL @0 @8 4pK3pK2pK1pK0pK/pK.pK-pKQ %Q Q %QQ @ 0AXSxaggaggggggcagacgadddddddddggggggggggd0fg0fgggg|eggegggggeggeggggggggggXed0f0f0ffdggfgfe8g\ggdggegge 00B S`ԅ100C0 A R$Q <0Z80 Z p8K<KO<0D P80  W pD@t8K<K=*Q 00A Sk00A Sf 00B S`ԅ100C0 A R$Q<0H P80  W pH8K<K100C0 A R$Q97  <0Z 80 Z p8K<K <0Z 8K<K@ <0Z80 8K<K<0Z 8K<K  <0Z 8K<K <0Z 8K<K@ <0Z 8K<K<0Z 8K<K <0Z 8K<K<0Z 8K<K@  <0Z 8K<K <0Z |8K<Kv@ <0Z q8K<Kk<0Z h8K<Kb<0Z _8K<KY <0Z T8K<KNQqW6P8L 0Q80Slhlhlhlhlhlhlhlhlhlh h hlh h hlhlhPP^ 40K^ @@Z080 d,0 S T,kP@$0 –Lo! -LM`PQp0 @ 0 飖 @ @  bkp錖 I -LM @`PfT40 p ETeTpG/  P090 ,K0K0RqgTGTp400  fT@ ? P0@ 0 R*00SC 00 0:0 g 00S 0@8 W P0h0-0`P -LNMp0Q 0 P-0 +0a0ŵ0ť \00 K0 ` l@,/C!bL0 Rn000n^*0^0: 0eR  匑o!gfff̊ 0-L@!0RP0L1 0 000驎 0@!P 10@! -`Lp@P8#8S"!"81 ("((^ XU 0V1`P` !@ Rp -Lp B/ bR@P`0ڃ0Rʙ V0P0 P @@ 0 BPU@UPe 0 BPU98 88S00000P0   0"108#8S2 "$"""!    -LM@;00@ -LMp`PW, `pP 00 R"0 0!@0 < 0@ , R40 @*004 T:aPX8` 4P @9*0h&hV 4@ p(8#8"(2, !#, T x:p0#h 4@ pP %82! 8"(#8P2! T, x:80X:0 @0R<  0>S000CS00 0>S 00, 0, -LMPp&EQ @T` P 0`S @c0`\0p0J@`0 1p!qh] -LM0b 0PUp@ڂ Ul R0  R00@ d 040 Q2 :RP 0E0e0Q0: P!0 <01R\3# -L@PP`9 @P``!p0@P `a(8#8"(0b! aL8U0CȠ: T * 8#8 "(L8 T0CȠ:0>S0>pGS p00`@-@0!"** B\0l Cʠ\7SL l0\20 -0pQ`5L@B 0` P0U 5 \ lU2><``6> U ` 6> 2.0 -L MP@4Q6%z00 600 T`,@ ' ,KP0 ,0 `100 ,02 0 000S  @0 W 0C>C5 `0C0 C>@0C!0B@`@0K00 0 @ -L MP$K`@0(Kp{ 0$KP N0bŒ\0 :C -L\M8 4 04ޏxCPLP PP T T0  q0 0  RT  T 0-S +ST T 0 S/ 0Sw T0`/RX0 p9R 10W0C10W0`CT@p /RT@ 9RRHp  @EReR@@ 8L04T  T @04  +RT0  -R 00B S4T #0R 10BST0B0 /RT0 9R T@10 0C/RT@ 9RT@!0aPS^@ ` @ W @@ @lH@@ \W  H D . ZD0 SD@00 HLB VP@ 0 Wl aD@@0dPU 0 !PV MU-n"00p0lP dwhupslqto8QT  P0 S4qN؊x]||@??ER$ U@ L`@P 0 U`ʄ5I1 0 a&j0jV0Vἐ5XH 0`l l l0h  ! ⡐ , K00K^d @@p T@,`l0L! 0P`PCP`P`^CN@6@lpP`U࠱ࠡ^ࠡ^pn`nPnQpdp @dd@ VdGd Zh h Uh;h Wp5p hdt 0< 0pcP tpM/O P@P).O JP@<p`Pp`pP/O p`*3 Z] Z/O fP3.O & <p`\p` x0  0 a&jjZ dhhfpdtb< 0 P@<PX46S / <P/ &P - -P`K5I /0  0 1#:x":S5h2\ R `@t<\ O0p`qX46S X N0ndYl"0y\0zi/ P . P@3F[O0<0S, 4`!6S \ <@T 0 QJ/ P@PH  0 ->x1#::646SX1#::C (< R%X#46Stpt 4P5?55?5???|؊AMPe ,  #P@ ERUlU@ p`@P 0 U`ʨ 1 K 0 `K O P`` K@K0 0 .O P@P5P@P Pg@0QtA 0 @ n@ 0 @A 0 @qt@  L }/O qP@[/O kBL  40T0 T 0RT T@ T@ TW T 20R) 10BS0BT PX QP U EW !p₠1W`^W 1p⃠W1Ѓ`PT0 T0 00B STP 0RT 0B Q@L@ T0 0ST S}0T@P T@ q -L M, 0 0S0 H1@, `;Pp4@ , P 8#8!,(!82,8! (#80a"( (bA( T ,BX0S`F V 0S`F VH0S ,00,P0P4@p  8#8!(,Ȃ8! (#80a"( (bA( T ,BX1 `R`F V 0S`F VH0S ,  -LlM4 \80 p`@W00qdz01#:H":S !. P  002Q0 0000K, K3':ც᪪Zp M K J%00ƂJ0 KZ/ l V . g W/ < P@ =R/ ] 0 0 \ P PP QX 0 PP00CP0 X 0j@SP0S@dB C`@ U< U<@ E` ES`@ d0 ` 4 ^ࠃ^4 N4 40P\ PS%ЊЊT|\?aCoc?`(?yPD?h !!؊00. -Lm P -L0(0! 0-P@L0 @00-P@0 0 -L ` -L ` -L8 PR b-  \ 1<20 0 \ ?\"00 0QS@-@0c  \1<0   \ ?\0 @0 @\ PT0 0 -RLM@8"x8S,0 `VhȠ,Ƞ*H&$!PQ # 3(!( '#P020cY ! C2R `0 !8,0S&hh2` 0 Q 2RhF0P13P1 <2 8-(0(   !!P ;;( ;S0 0P0 -LM`PP0@ KpD0 K04 4K00M00Ѝ -LM@Pp`EUW 00-_u@T0-`P\9p T0 R @  S$0 -LM`PpP%J6 K`P`,K0 0K00CM-00!OO$P`0"&pЍ -LM`Pp, H0P`pY ,0 p-LM`P@@@`@p -1LM0S``V$ P@pSS PpR SN $8?S @ U=|:JUT!0000à@T  RP;?$ $  u00Q0SpJe\0 \03  0<$0 00P@ $0P0?45WCpSpp!!! p-LM`P@l@P@` ph -LMPP@`pW P `034 `RE0E0BUPU0H @0`043P 0 00` -LMLß@TXp, 00 ` T W 0^0T2("S*2V ,P0;,P02S|5P3 T T00W00ST00W\ /O0`PP?`P`P`0O/ z?`PP`V%^!000P 0\P2 000 ,P 00 0O/O0`*0`@0@ P` 0`H!v00Q0 S  P 1U:  |0#03  ,K0f0K "Y` ^X,P0W T ,P0^,P0T0^0TJ!!! -RL@M@p $0 0 $ ` `AM P@U0e $ e0(0 21%$ `e( $0 K(K$K$P0 P O4  b p-PL Mp_@@` P0Q S0 U UJA>`o0OoPJ0P` P 0 `p0`S  0 S43"?S04# 0 0 p-;PLMDUEoJP V 0T0U00S pp~UPD 000p5 D" 0a4000V`p! -;L,M\< 8 * \PoO 0^8K< K`P80C8 <=PoOoPJ  0P` P`PD @ `Po4KO0^`P,0P`$1`P -;L`p45gSM 3^@$P 0 )V! W2 0 KN0^0 ^0n03  1>0$0 2 A$0 AB H0Q0UW V2$0 n$Q0 Q03  01$0 0P0S;V V ?"0!P -;LˠP` 45fMà3^@p $0 $U V1$0 N$^0 ^0n03  1>$0 0$0 cAN0Q0\U UP` S:\: 0S00 lp'V U Kn<Q0 Q 03  010$0 1$0 0P0S ";!Ϡ\  Ϡ\  y -;@T;LM/UT`ᠯ", (@ 4P 0 H X9 T^(K, K\0X4P 0K4 KS0,4sL'h$H X!1"4 R0#038"8(!,6.(0\ ! 2\ 0C QCR ,p ;U` H0#o^0U0X00S -;PD;LM0/EU"4 0P ,@ (0 h Sb ST P ?45(K, K0PU4P0K4 K0P,0454( S b4 ࠑ}~ ,0 4 v?0S`,Ƞ,Ƞ(XB[ 4!Q0#038!8 5"40P 20bP  CR`P`  0P0!02S `FT ^S ;T -;0LMS@ ;0S P  00 45S PP i45S;0 S-L# ;0S ?S S 00 P *S S 45S 945S;0 S-L# ;0S ?S S0 0000P *S S 45S  45S -!:**@LAB14LM\?@(0R\0l0&03  T`PT P TQx 000T`0R@L0R000 000 l>"0  ! -p`':@ナ7DL⨊ MXO<0KP  @KX@0H1@0 A@ 0?48@K5 0 ( -LP@K4MH)JJp,jP@ 冪 #T # 3(l0 $(h0.%pH(N.l # R2^P2t 3#S#3t@p#8$0 (, PP@2`3`#\ # 3(t0,( Ƞ##!@ Q020S ! 24`h@^ ! 2ldxY00RKAH D L0 *L`H0DK HKLK0D @T0 0` 0O/ l0T Y 00` 0O` -LP@KlM`K PP<,JXJ@ ,Jᄪ@|40 X%X "| t #[,Hs[2,.\0#03^#38,8 Ƞ&.x 8 "# V2R02 3#h00c bVQ0C2Y0C2S`h0 fh  00|00|0 H0 DK|D 0HKLKDL`dD H0n`Pxt@030# 3# h \|L| h|H ph0l@ 3 #030#0SPLh P DP t ` 0/O VP@Z ` 0O/A?O`PP` -p(  LMP`P' &:::S@ W @0 O00X64460 PP 80460@ -p(  LMP`P3 &:::S@$ ?S@ S@0 O00W VUS S X64460 0460@ -p(  LMP`P3 &:::S@$ ?S@ S @0 O00W VUS S X64460 0460@Q0 0aQ03000100P0R b0@- @P 1<\0 0 ?\4 00-b1R"  @-Sc@#0 401  00S20@-  3#@3@# 0  0bQ@2c0 0@-Pc0 @R#3 e d \@2 n0Q@20p@-X h%X ! $ T#3 Ƞ$ȌH.@!Q2pG-(!X  "(!& ' V#3W#3 Ƞ&Ȍh$a*'x%p,Z@2\P2 3 #P$ PG-ȠM!h,Ƞ !#8() X#3 Ƞ"( X(ȌPA*% ᑌ,Z@#@3H*H F' ᙡ&,QP2 Vp2` P@3@#\#3P, Ƞ%".p RP2 3#^#3@ .,$<0\@2@PTP28 40@0 PЍQPP  :Q00SP  :Q0#02SQP@-0 !-0S! 0  00 000 0$0(0)0*0+ 0,0!-"0.0#00/D80S40 00 00 ]!]]^ -LMKd0KM0( 1S Ѝ0SM0D #2::S Ѝ046S0S P  0S Q  Q0 R0 P0000S0P00R 0S0  R R 0S0  R  --LM 0 _0___ -- L 0 -MLM@P, `T< p 4Q$ #$0K$K0 S2t4 ,0S l,+w馳X 0@$@W KHH 0 $i4PP3 `W \ Q\ #0S0 0 #hP PJ `0S ZJZ:00 00J žKIIR PK %R| T @D R@T<@  0P PJ >K 0CPcT RL K0 A fP@)t W~ { 0 x vP`K> @N>K 0C1Kc@82AlA H D< L @L YFf 07S wK A 0)P@07S  0\KclAx18 A 4< 0 < gYmQ T00%Q00S  `@Dvr `W!X< /hPD@`PgX GD 0@d 0 hP PJ `:1 K@@i2 0| P PJ `1 K@@bN#@ o!_(OP8d0<DP -LM0@s e0000 -LtMp0|@ $0 " 0jP`KS  $0S $uzth KPK叀KM |epPePꦈp j|o!x -PLM@R  ?  000 -LM@Re 0 0 0P0 -LMp@`a1P0T@$K P,0 P00g Z@ -LLMX`\, Pp 0%S U 000S,0 S ,KupzW@X(`l $08T\$\`Fmşp 0RPg0S1| 0 Sş10x5v `d 0lTp 0< ,5Ϡl0BP @ N 0C` R   00b0 B`lv (P 0S \4 0S$1`$p0 p 0PR 0vN @ l Rg#4/2b11T3b11TZl| ` !.0/C!b?@1c!bb1cA0c0cs00\?\@D0S 22a11T3a11T[ό[ό 0a Ba4P P 0VSB gS?\2T`p 0D030 S50S @, P៕  1Ϡ(0 Sň!ըŤ dK8@KdKQ3!0 etlP`P 0h hK hP\ph 0\$p00 v 0?2c11@ 0S$@T @dHPϠ\0Bl4? 2cc1D1o!ēcQ̓*ؓ|$IlenmdTGp_@p$ -LMTp,@KP` 0  e  0S so! Q *0S0 Q*0S0`0 -L"ɠ2l3c13@"c1MP 1K0  U C -QL\`M 0LK KϠhKT0 `0 X Kh ,h0  p-@LMoP` 0P@0@T0PJX u@TXPZp! -0LM R% @00SJ R 0SXZP @ P000H      00 4 D  }!a -LM#L@0cP0S @0cP0SPږa)c|t -La 0 t}! -L0M0 @00 R/`<HT`lx(4@HTdd0 (0 $ (K, K00Ktp, 陮0 0K_Pd 0 K0 (0 $ (K, K00K]tp ,0S  0 0 0 0 0 0 0 0 0$0 (0 0 0(0 0 0 0 0 0 0 0 0 0 0 00! 0(0 $ 0= (0 $ z M-L@M@ 0p`nP{ 0 p`dnPPk 0`0`KX0M0S   0D R 4 40  1@ 0 (@\`$@TpPwr`8@ X0pX L H T` Pp ,CXKBP* <0 0PS` 00A0 @d@  PC 0d KjM@@ 00奭00UnXn0 D0D^ ,0$@(^ 00匭00La~f@}!` M0-LM00 0 PS0`" -LM,ş `,  (q 0  0  5 $0 K0 0 0 8K 匠K┐K80P800X0K00 P  0P   P 00 0 X 0ISP0S0S 3`0K KP L T 32a/@#b! 1`P pj `@? B7c011N0 d 0!T 0 L0L " !!/u`!!0!@! !EنP!!!0 !0@!P 0-0PL,8b4@0, ,bB@0S0`!}!}!h}!H -0PL4,b0`Sp- S  0@W0 0 R@ 0T0\ 0S 0S0S0S .bPp 0@W0 0 R@ 0TP 0P`!}! -AMLM,48 <#h0V,0 4  P`F&B~KpGpG 00PSPz@w ZH00$H T00S4P 0S`F00 ,0S $,G]xPo! -AMLM,$p(. , "h  V, 4  P 0 ,0S ,]P`F%BKHH 040PSP@H $H( 0"(lP0P`F So! -LMH L p ,0, a H` Z 0!d2 L2  S <\t" h l | p 0Px xD R" P  P |2x.X0S @㒟KoK%KK  0@P񟗢?A?C@B)TQ t"R$ 0Tȟp2 0 S@0 S 4XD"0S 0@S D2 QoP00D"LPOK?K@D~H2L42  70 K0C  0C P`  Rh 0"DT 0D< 0D$ 0D  0D0 D00 C00 C00R  po!`!}!dd ,8DP`dp̜  V -ML MȀB^Kp PE@0 $ P`0 K R0. CR 00$0 S <$U0R5 #o!0, -LMP ` @`d pW0TZP0 0S.S Q `0-0k -LAMlpANK @Dd@DP0 P` # 0 S  Uo!( -ML,M?`0p,, :Z0P@8p? UKH|ϟH  0P` n# `08# `08#H `K { `!` 8KKR0`    :K A#`!R    6#  0#0JeSi^bnnb_bbbnabf4ei0c4eiefi@intil@mnhmmnnnmn$nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn o oT( T& *K `00CS00  ä0:K0K c R  0l"`D< ,0S H ,T  MK(@D@D ! K\ KQ`P@ Ƞ,Ƞ 0`{" `s"0  CR T00  P` 0  CR >00  P` 0 Ay ` F"r @f`0 <"h @\`0 2"^ @R`0 ("T @H 0``"]0Ri 0Rc KQMMK(@D@D  ,*K0` @l 0!@ V*P X 0 * !0  CR 00H@P V:0) CR 00 0R 0 R fA0  CR 00  P`0R 0  CR t00KV*"0 CR _00@T 00V0#02SP"0" CR 00V*0  CR 00V:0R 0R `U+P 0\ CR 000 CR 00V0#03PEU00S0R P 0R 0R"| 0Rv 0  CR 00  cP`i 0 V0R]  0@K @T 00V0#02SP0" *P 0\ CR 000 CR 00V0#03PEU00S0R P 0R 0 i@:K0@T 00V0#02SPX0" CR L00V*@T  Z0 lF@# 0\A@H 0;@TVP**P 0\ CR 000 CR 00V0#03PEU00Su0R P 0R 0R HO*P 0\ CR 000 CR 00V0#03PEU00S0R P 0R} R ("(`" m:K   K `T;  ` $  X @JT 0 ' K  P ` S`  K`  ("(l`  K K(HH `D1 OPU@? 0% 0 CR 00PU 0U?TCB ` 0J?0 R \??o!`!}!`!4<ltԝ $,Hlt|L6XMĞ̞0  CR A00 (`"(t] Y:KK0 (HHN f0 PU@? 0 0 CR 00PU0 R \{>0RsH ("(p`\ K.0N K`JWK  >(`P$`@ XH%X$H Ƞ,Ƞ0 `4`@ H0$H8 `#8h@t 0`@ 0`@0 ` 0  CR 00:K0`0RK\< ` p-LM0@S`PU00pP @0SU00p -LM@\ 0Q 0S04 0fBT$00T00 騟! -LM0@S 0Q 0S00 ,EBT 00T00騟!  ̗ @P-L@ P P P 0( BP P P P  P P| Ppl P  PTPHD@<ܢ!`$HT<, -PLMw Q0ᢂ0"h@0(r"g0q@!#BT0`A@ 1V!(0A(PGPEPT V 00 U=*@1@T e8!0A(P1P/PW@ @ 00 U&*0W e0 A 0iPPPX@ U*0X e0 lA 0iPPH`P.0000 @ 004( Z'ꉈ!D$0<H !T - L 20?Lc?NcMP0B !@ 8 8@2!!L  (Agfff`cQ!4 p-LM`PA  q00  R0P0C.\ 11@ 0 P:@TYP P Pp qX0  0 R @ 10qC$00  00S00CP4q`cG-`U@p |0 0 1 Rğ 00@C r0 0  R|x4  0 R`ğG r0 0 1 R4ğ 00`C r0 0  R|3  0 RS$ r0 0  R00pC.^ ß r0 0  Rlß r0 0  RE0N2S񟗑yzzzzzzzzyzzzzzzzzzzzzzzzzzzzzzzyzzzzzzzzyzzzzzzzzz2d12c1"c11AE0N2SNz|z|z|z|z|z|z|z|z z|z|z|z|z z|z|z|zz|z|z|z|z|z|z|z|z|z|z|z|z|zz|z|z|z|z|z|z|z|z z|z|z|z|z z|z|z|zz0\0 q00  R, r0 0  R00@2d12c1"c110c0h|0  0 R< 0111|KCd00  00S+ 10qC(00  00S 00C4q -LM@, 0@ 4@ R(`K06 0Kp4KP0 40S0<0 0@0  R R Q8 ,lC0-S, 0+S,  p00   R000C, 0.S 111BŸ@ p00  RQ2, 5:Ÿ p00  R, Q2, 5: 00< @80,,0 ,% %80 %0$ P0$$@Q*, p00  R\2, 5: p00  R Q2, 5:Q*4< , p00  R\2, 5: p00  R Q2, 5:Q*@ , @p0  0 RX 0, @10tCD00  00S000C, BQ8P P!4q -LlM0, S0 P  T L `@08Pp< 4 (@,$l2@Q @T\b\b`d`^S0@0 @2n.A`N2a@ 1 Ÿ N< 02a 2cN8 ./02bX0 2cNU1PeED %A`2i4 W࠳1D E0âaP 2j Ep1P%/rb ?Bc1"d1LqFH \@ AEM$PPF$P`T`?$P 4P8P<@\ DHX00, @$(p,0`4P=p0X RIX0V LI@00UGI,,$ =igMbQc@ -LM@@PQ 0 .SR0*S P0 S.RQA -LM0K##0 v> 00 0@   x= ! -QL MP`@3ȁ0,0K ,[+K!1* K00K+ [*[0p[ 3""" 1??W/ K.0K-KPEW/ [?RT.[?QQ-[?PN ZJ0 0@ @U@@U4 0S *0K+0K,0K*,K00 R:,[+[ 100K* [0[0"#!!?\/K. K/ [?R.[?P0 SXU 0 0@0 =0@0@=00@ T*00>K렣 -@PL`P p20  00S6 P=P UUXXĆP p0 0  R P=PP Pp00 Q PV 0S=P q"P U񟗽LpV X*0g10PV  \*0 gB2"0 PV  \*0 gB1#0 PV X*0 g00P4qG-@ 0SPPRp 0 SZ0h0? 4@ 3 #T #R p0`W RZh0 0 ^ ^*.000S*0 RpJ\`0.\0 \\ T* RZS*` -SL M, p`   Z 0 S 0S@TP) Z 0E  0 pP020S 0CX03`505 `.T$ \T V*@@T0bST 0@>S TV*00, bZ00`F@T@Q*@$?#<-"-0 0c`0, bP *0S  P*0SPlR Pp4 0 0  RP 00ӑ4qd -RL M00 , *,p `PU 0 S0? 4` PU0S 00X: iPUJ0.S \S@TpPUZPU0S .U 0@- .R .R .^ABa0B" Q00.Q^APBa@BABa0B UT00B SQ 00\S0@B-R T0\S0B ^0*S 0.S S0S !0B]S.R000Q\R R.R0S !0C]S0S0 0   < 00 , 0 ( Ġ P 0000ӑd 0-0 L@ P  R`7P $0bPP00C0P0P 00 U00S 9P 0 9P 0 0! !K0 S0 R@-` 0R00 m̀   0P1PP0Pmͅ@p@  011 P!!le`e -#ML M$0PP,0 `  ;P 0:S /S . P PU 0:S0/S tW L@L@@ T*BNK@D@D+ +"+.PP  <PGHp@ #\K(PE PE`#b7Pkhe 0a$0](0Y 2R,p\ \^2^P2P ZZ0Y0 YQ001001 0 e b 0R|Q @)Xp@X 0 0 QcX X`@pL0SP7T0T7 @SN XX 0X0 `1QuM@p0Xp@ X ZX 0SX7 X X  Y\ 0S\70X l0 ,0S t,6G XPU/P8P0o!H:rL ܰ0S0 C,S R-S+SP@-@  00L S 100C^00L S^ 0-LMPK@ 0P 02c2c20 :R 0 ;0P 0 2c! 0:S<0 P0 00 0-0P-SL@P +SP  U0 0c00 -LM0@JS: MS 00C S00 0P 0/S00    00  0qP 0.S 0fP 0.S 0 0 00 m E-P@p "22a11\3a11\p0Sl S  W02c2cZ@]E ;RPS J^P WXa  102c2c^S,! 1?0c0AZ1`L ` !Ϡl  B 111F/N!b  !@!A! B 0C`aR0B S B^ W 00T` 010S^ 02c2cS002c2cSQ*gfff$I -RLDMP\ `  =Jd4\@ R !`0@d T0 DmP00 `R&T00c  L7PTdY 00 0 0 SmM @ \d Y0@ `x`@ m` @bY0S,S ;S XKP@ 0V0R00SC ;Q,QM Q@Q` 0011P'RL7`c \\%0011P'R\\tr01u.00\'RT0 0f  P'L7R`c\T0X d0c bL7`'0 Td7 Phu@<KkP@ 0,SPKbP@ ^|d0TX]~0ph al0 0`p LP7`Tdh 0 < KhX0@ hP KT0@000@000 0`"`!!Z1Z0 !h0 "b"b3h0 x0ZTT0>CX0 A\@aQd %0S" TKP@0<Q -@LM$N0S h꘦ -@ 0LS0 008Ph@R!! -@LMIhIR! 0-LvGP@8 P0SdP. HPP!\ 0m ,TǃPǃLǃ 00hhP 0:S H gP 0 ,00hL@R!@Q!! -@LMHhHR! -LM`\p  0P"P7 S u RA0S@AL 0 K] Pl T70m= 01(0 @ R0P R0  A!le p-8@LM`PoH] iHpR! -LM(@, 0]HP hR!@! p-LM`\@PJHP P0S 8DH0, 3U$0$0(0p00R!`R!`2!`eM! -LM@  -LM(@, 0HP hR!`! -@LM R!G-p^@EJ1삟@Pu 0`T^PE@Z2 l Bha02c2cSDPzJ2UZE]EU`p2O Ed2d2cREP2Ϡ%H">?lA1c "l1c0c!E S@rB000 D21!/2aB1ca?@4cVP/2b13b1T1T1 !VVPEE0d!"a1@!ba 100h`c@v.D\(0 B0 0`0V0  1`aV 0$ 0Z]U`F~p^p\0up^Nb 0 0R]0 0R@pA T0\QHE.Qų$IQ -Lh -L,M@<K0 Q  -@p0T`LPC0c0hC 0R 0R 0R 0R 0R 0c -LtM0 00TK0SPPKL@K< PfHK P`@KDK PY@PTH^@PD4^$4\@@“$/2b1Q`3b1T1T`3!bH sP/H3^@PD@PD#O22d1ap3d1U1UpW 000# 0A0d^ \D H0 0D0 DPH <PT;Q @0"v> 0ST Ř p00 @　K K  TKCP T@DT00CP0ń0  4C4Є0 4\;`0 S8 "Y 0@S1P1P}R pRJ0 S @TpG4UZ0`S1PQPJP7 SK `VPE4UZLǕ0 00n0  TKP` 40R00 ?\0#S K    00TK:PT;0 T0  qPl@PD0\@@“/2b1H`3b1T1T@0!^H PPKTK< P GlnQ!`2! -LMp@P`\ 0  -MLM 04( S0 0ł>K0C0Cp0 D8 ,(RJ 00S1 P1!88 8( 80QBKL !80Q8(0@ SJBKL@8( 1SA0@(K@1 @( QZ@0S<8 <8.K B8(  0 P1H P'R <(@8 R<( @8XH8( 0>K0C!88!aPǖ\04(D8@X PLLGdUPP P`,8SL'L 0 `bS00 0긡`2!! 0-4PL@D  Z@D0R!0 0 L\ 0 0F\@0  R J1u  0Q R@Z! -LM@K$0c -L M@K$0@K 0 `RA 0 `RS  0 `RS A -LM0xS p00 ` S X0@Pp@vΌ < 0@@ @P1P0Od -LM(@ 0SDP hS! S! -P`LV@Dp0S  SP@D RCA 0\R#R! B00@ S7@00 -PLp\` V * +\00.\P \ V:/\ \|0 0 P \ 00ӑ|0 0 DP @\ \` 00ӑ|0 0 DP B0`p 4q@fR@-@@ P^0#2 S007000 0 S00700 \.00´\ 00@S!P 0000ӑ@f 0-LM0P [[@[0[ P@00@V!t -PLM@  Th7D{/00h -L M⠠p@P8`K0 (P Pp0P030#P0S   (0S $(>{00o! -LdM0p ,  |0 x0 t0 p0 l0 h0 d0 `0 @`P|K 0D0c!1@#T!pP@1SuP``@Tu w Vpw Xp.K\0K S\`K@*wB T@0T=T4 V0#03@T00Sw 0S 0 S*\ K0b@S@\K L1 ,0S 8,>z00 R*:00` R:0305`1:T  R*:00`T Pf1 /PP`WX Xh h0R f P WB`uw w VpPoo! 0@-@dP0 Q 0T b0P 0 0S R0@- @P0 @ T\ ^00Q b0 p-LMH`@PTK U`(r P00pP0ꨄ! 0-0@@0 PRL @00P 0 ꨄ! 0-LM@ PK 0K  P @@?p0 Q-L`P6`Q  R)pR@1@!  .\ 00d0F@`V0 00 @g0d0 5@0 0MP  X 0-L@PP@s:T0o: -LM⬀`pAAjPP P @Q P 0S W P0S {A4ꀄ!f! 0-LM@P*<08kAP 0 Π 0hV!`V! 0-@P@0LS00$ 0000Nf!t ! -LM(@0S0 [00f!! -LM$0S (K PPn (0 S R@0@(  S*A ?(0`` P#R #IqP`@P^PP `0 S S0 S S \OP@ 00,K Z,0S ?RPPUP*8#8#$(,"( @  `,P@ PT 0S  R00 RPPUx@ T 0S 0L0P0V@4 P@ P00uPyf!f!j!Yj!hk!t  0-H0@SLP:0Dx9P0HPD0 - LRPE ,P@ 0@`c` *f@ `PP j#D >P ,P@ 0@pc`P D  >0@0g0`D000`P  00 p-0LMK`QPP0 @T0|  ;P 0 ıX0X $0, P0P (0 P@ 00p+rTrrs -LM@ D0`00w00 -L|M@K\, ( R $ Z Z w 00`PpQ `40 S 7L4P! ;0+P0K 0 p 0P @0Po80000 0 0q PKt9P0: S 0P ;L 0Z KW0  o P0`0PUoP` <0PUoP[ 80P< paoPU`p60# V0 U   0 SR0e cP00  @0P 8000 0 0qL00cPo  0 p 00pP @0P70p0pX 00 SPd Ra:0 g0 0qX0paPU`p 0 p`P vAK8P<`0K0K k6)%Z* ! P0` 0PUoP <0PUoK  0p  0S 0aPo 0  p`P v v 0}!r0-@_0 0-\ @0S  S0S\ -L M, ,P0 `@ t00  R-T@ +T@VV0Tg V0T ``Yqq:;Yp XfphX t0 0Q0@Dt0 0Q2 t0 0Q7 DW D@T%^Y \ 00T00S  d v"00@\00T00SL, u00S ^,00E 0XSxS@`P4q p-LM`K$P PP@ 0S 0S @TxU pu00@P 0Pp -LDM@@KD`KH @  0P < 0 8 4 , w;P PpL T DD6PP P0 d;PD@0U*0S 0 @T:L 0 0S 1gAL  6Pp  !=D\p 0pU 0` \`T0 @*0S 0 @T:96\ `FV0#0%H0% %:H00\*60 S2 S00T0  `T  0T0  \`; `00p ` T ` ;T0S00pp0pP` p D ; D `DpT R 0ST0S 0 P 00   X  `62` V`06` V  D `0S0V V p QX <Xp W; pVp p 0SV X 5H@@50 S S#00T0  T0 S000T TL000pDL0 T R 0S7T0S   X p`6 ` V`6 ` V0S V PX0 0S V X 745 P-L \hB8t/00h -LMP@`T,`K,pK P 010jP VX`@TX ,K :0V0.T00S` X ꬬ -"L$M0KTP(K@0CP@ 0C4 d 3 P@o 3( K!$(,"( R`*R^ 2Kp2 0 IF>K0C"P pt0,^0S 0t t h wdh$`0 K@P@ @6$"(0K!48<#8 S*S 0H T H0L P J I@6  L6h@hA  Hp\ 00p4Slap PBNK@D@DhL!L1\%3p@) m pPo0#SEKEKALK 0 LAIP4 \ X T 8X4P$0P #hP#"p$RhPV0o!Эh!hT`L\h -LM` @0 0\ `0V -pp`@LTP  P `@T` 0V0000h`0ꠄ! -LM$@0 S 00k! -LMPp`P@\ 0,K,jX!0$p\@T`B,0S |||``|,|,||||||||( 0$00,(0 $$| z$p@T` (pP0P (0L 0 d$(0 $d4HH3T`| -Lh\`P0x -L  hBH3` -LM`ZPpP 0 S S 0d #$ 0 0 @0$ $@,@}!(Q -Lh`P0 --LM _ -LM@$ ~6$0K K 0    -@LM 8k! 0-LBP|@ 0S L| 0SPeT 0S \00LS `000A60 -LDM@ d .P d.P`} 0Sh 0S0J0@ @@`KhS2LpP dP00 H XP L T@ fXKP0SV.X. 5!P0P0H0STTA 0@81H  >DP !P0@ 00m00p0d  N X%4 40..  `0X@\ 00m00 00(@, 00m00pi@}!`< -LTM` `\ h0 0Qd 0p KLP0|0 pK0 0Rx0  x 00$0L< 4 00hL   0-LP@P0  P 0S SP 0h0 0-L@PP 0S S 00h0S 0h 0-LM@P0S0P  \02 0i 0-0 0 0LS@P 00S 0S 0S  0S 0hPX4`hpx000 0 0 0 0 0 0P0 P 0 0 00 0-0LS@P S 00  0S S 000  0 S 000 000 P0-  @ ii@-0@SC @<4(<"4!<0  -0S C   <4(<"4!<0   0-LM@0 SKCP0 0<4(<"4!<0  -LM0@SK C < 4  2 0 >0N\*mP 0N\ L\ 10C0?P  Y KZ 0pp 0 CS  10C3<P   00#0\ -, L M`, 0 10 S0C@@1T,  PP ሐq@0g10C0S10S yPP 01v?0 1  I ,0 R ,^P@ @,P 3 0 0p a 0H!8#8 S! 0C8 R#8 1S!0B0h88C#8 0C R80#8!0B1 p   -L(p \`W 0!@0I  cp6 0 0P a: 88C!# 0 Q! 0A8R# 1 Q!0B0h88C# 0AR80#! B!(0 0S  0S1S0C1ǁ p 0 ^\P  -LM@ ` pP X Uq10C00CU^:UQ@10C00CU Y0p RK 000 0K0fPQ P 00 K0 2KP 000  200 2[0  ' P 0 10C00C0 K2KP00  00 K2K0p P0000E0 K2K0p P000K 00p RK P p 0-0 S@LP0 S00HP0 00<P 0 00 -LM@PpQ`-V& KPP  0S  rτ0 ` 2p 00  X0 0 }00 -LLM 2C Q 0  40 < @ 1[=0[8 p 2 [3[4[5[8P[;[<[l0 6[p07@[9`[:p[0 P@` p l1 2K? [>0[@[)[*[ 0  1K+[, [0C7P #XZ P \*T@KXK 0K/[80[#Ƞ T 0 0 00T [ 0X0  00  X0[0,  0\0 Y [ Z0[0[ [ \0[0 ` ]0[0^ [ _0[0` [  0d0 a [ b0[0c [ d0[0 h e0[0f [ g0[0h [ \:\*D@KHK 12K-[0.[8#Ƞ D 0 0 00D [ 0H0  00  H0[0  0L0 I [ J0[0K [ L0[0 P M0[0N [ O0[0P [ \: -LTM 2E Q !t 0B 7R#h R9 0 \0 Y0[h x0 e0[` l0 f0[d Z [[[\[][^[bp[c[d[p0 _@[x0`P[a`[0 @P` p l  p0 0t h["K1g [3K-[.[/[00[ 0P*DPKH@K 0! 0D0 00 0 D[8 #H 00  00H [ ,  0L0 I [ J0[0K [ L0[0 P M0[0N [ O0[0P [  0T0 Q [ R0[0S [ T0[0 X U0[0V [ W0[0X [ 1P2K+ [ ,0[0:!t hPe*4PK8@K1 4   0 04 [ 080  00  80[0  0<0 9 [ :0[0; [ <0[0 @ =0[0> [ ?0[0@ [ 1P2K)0[0* [ :p@-0 M0  0@P`0 @P`0 0 0   000 0 0 00 0 000 0 0Ѝp -LMP`Q@>0DS5J8KJ8K8KJJ8KJ(0#(pK0 .P@  (0 g=rυ @I 2@ (00 ( '(pK m3V0 0 00 p-LM0C`PS1KXLKXLXL|LKXL|L0S 0SV0 0p 0K @ dP 10C  10@00  @ CP 10C 0  10@10C00C -LM@0P0`  $0KO P+ V+ V p0 00@@pW0G 8#x@ T P10C00C0`p!08#x BW@ _T  Pp -L M0  @, P`` @TS 2  0@ p0 Q%8 8P  -0 RQ 0R   Pp 10C00 0B0 ,P   R  0 0 0S   10CR 0 pP U PPp@ p-LM0@S`P( ` ( (0Q0(0p00 0 -,0L Mp1@, 0  $Pb 10C7#H P00 8,#h+0 DP8(C X#8#H 0Z0J8#h `00!`101 @t 2 Z0S10CZ 0 00张0S , 00P , 008P 0 0 0 0 -LMP@` p0S$ K$0  02KP  % K 0 $ -LMP@` p0S$ K$0  10C00C2KP   K 0 $ -LMR`Pp @  ]Y 2   0 0Q PMP/ 00 $0 0 Z: 0*Y 2   0Q PnP 000  0   00 000 P0   |P00 p-L M@\P 70S4 0p 00   0 0 `K p `KQ r?sτ HP1 0  p0 0  0 0 `K 0@-@T010!0Cs 0C\sd b0@-P@U1!L| 0LR|T!200 -L M@` p$KPQ(K M(0S *P'P(00 1`C$ FPU (@X@1 - (0`0dS(0 0$0  -L M10C`p0 40 ,K k@T" 4P,0UP! 0岁ᰁZ 00  0 0040`Vp { 0-LM@P K@ K P 0 1@C00 0 S P00d0 00 E-00 2 0 2 5 0-1 SPL@ 0hCP 10 "0 "10 -LpMPK`p*P@ 0: S|P@  0Q 00 ZT0K 0 t*dT Q0 0($4 $ p-LM4@s`P( P$ U4404 0004 0 00   0S0@0 0 R0p% 0q`D -LA0 001R0000 00 R 0 00 0 0 S    -LMp6P`2 0 001R00000 S    0S0``` R 0 00 0 0 S  p0 0 R0```0 00P` $P0P$P p P EQ0 0 000 0 0   0S0```p0 0 R0``4`S $ A0 00000 -LM@P  R 0 0 00 R0000P 0-@LTP 0@T''P0Np p-LM$ 4PR:@T 0` @TuP@ $ v0 0 404pp00010Q000 00R 0 00 0 0 S 0 0ppp -LM 4`Sp$0P0P4 P4S0 00$ $ 00 R 0S R0  -LDM@PKP@ 4T QP 0P KSR0S0PK0 [P@[TK$P@KK ,PT@,83K#[$8KK[[R3KL K0KKK4pK@KX d0 d@@DTd@ 0S 0d@S@d`@ p0`SL` `` \JX0@\@ZXp3QPX h h P Uh R `0d@Dh \ l l偀 0 RPh H } `i\ 8R \0`FP(*SdP\l 00 L cPe%88cP\X%X@ʷ0Pe%8P d`F\P l@00 L P\P%X@ʷ000l`X\l ` R" h0S d@\ c0 Sh0`@.L0#\ ʌ0#[[[2[P T PK $[[[4[P T P KP@8#0H8#0H8#0H\ h   P T P0Kmp@-^`@ Pb 0 2%$^ 040p p-LM@ P$K, ,0K $0 (` ` P `p -LM`V (  0SP@ p`@ V`pV@  V 1+#,PP 0p0`S0`` 0 @00, eV`pV@ B<B S=  P UP! 0 0e P0 0p0eS0`e0PVPV: ,PP 0 P0f  000SP P*0P` 0PU:MP 0 0c  0P0 V,` `pV@ ,0S? 0Y 1! P Q00P00S$ Q ,PPkY 0p0eS0`e^P], P 0 0e 0  000P E  ?P0g0,0 M 0 03 0-0L @R3 P+  0P @0P  0P$00 0 00 QB< S  0  0 0c0 00000鯞}! p-L M0K K@C 00p!`4PUhC 0 SP P000pJP` 0 0 pt p-LtM@PP`KWP0@  P  Q 0 L P  p( 40R p; 0p0+ 0 pr -LM ap@PP;T 0 0S.@0S$0 p@ 0S 0000 0E#10 @0!0 p0 'P 00 P !n -L Mp@=PPT 0S @S 0ST  P pox`0Sd0 p@  0E #1 0 Y @!n 0-LTPM@KT 0K  0  @@gp m! -LM@isPP/0:0 p-LMP `@0 : 0ph" -LM@pP  0:0q0:0y -LMp`  \0 P@ P@ 0-L0MpP0 @0 0SDK@ 0S ,00@@o! t,@ P-L 0 hK 00h*|t p-LM`0p@T 0Pd@00U0  ,PP`@Up0@00pp -dpLMW` P@PUJ0SX@PUZpW`aR @0S R Mp-LM0`0 @`ip -LM0K *P - LMK0P -LM 0@P@ -LM 0@P@ -QRLtMp` 0@S 0S@b@DT*2K00 0P0XR00S $ -L`p@PP    dFP -0LM@ ,0( P00 0-@LP2P +P \ 031 1! \!00 F0@'F0@p@-0P0 @ 0`0  00  00  00 0 0 0 0 00  00  00  00  00  00  00  00  00  #0 0" ! !0"0 # '0$0& % %0&0$ ' +0(0* ) )0*0( + /0,0. - -0.0, / 30002 1 10200 3 70406 5 50604 7 ;080: 9 90:08 ; ?0<0> = =0>0< ? C0@0B A A0B0@ C 1 G0DFEEFDG ` 0V0pG-M0 咀 0P0呀 @P`pL吠叀 @P`p0P0 0 L0 0 0 兀H儀0D僀@@傀P`p0 <偀8 0 @P`pH0$0D @00<8000tw|04vx 0u0 ~}|{@zPy`xp,t( 0 @!P"`#p40$00%,0&0((0'p00 ,04h jl0r s0pon@mPl`kpdq$i hgf) *(0+,-@.P/`0p$0< 10 @2030405080\ \`0be0a`@Xd c_P^`]p[ ZYX9:;@607 8p0T@?0 @0A0B0C0D0^T0 0TD E0FG崌⾉0 0 ZЍ -RL M`Pp 0 @T 0S @RT ͅ0! A0@ &P@ V00 JP V, 0 10 731 B,0  1@01S -L M1, 0 SQ@`, PP  P  1S0C100, S00 0 P 01-0Q0 P0 0  \0 0S0SF 0 0<3Q B 7  12 0 10S @ ` p0 Y \ಐ\ 0 Q1p0  @0 p@p/P 00 `$P@  0 AQ=Q10 -LMPpPmP@ R0 X 0W@ P  0VAT  L0P @-0@0 @0!00 Q'  0R!Pth\ 2 2 2 2 2 2 2 2Q 0S !0S: 0-P@TUL P :P@   0B 0 0 0-0L M P4 x00 p@, 0(0 $@ 0 0 P 4K0 0 S$$0  B vOo!.@o!@n! 0-0L M @RP0 R|0 4 l00 , 0(0 $P 0 0 @ 4K0 0 0q,`n!Oo! -@Lw ^PF0T$p`0@S p  0St0t 0$&bRB`0` @* P  XB 0 0@m!m!n!`o!m! - ML` Vp0 q$ pD@0 !%10@0n!m! -#LTM0,0 B3 p RpW W Wp3PUP 0SM X`<0C>S񟗰 ĞĞĞ,ĞĞĞĞ4@PĞXĞĞĞ`ĞĞĞhĞĞĞĞĞpĞxĞĞĞĞĞĞĞĞĞĞĞĞĞĞĞĞĞĞĞĞĞĞĞܞ000P 0SpWB0S2  1 P@0 1p& 1  @1^+ 00t1& <1ApP@1P ,0S \,P0041,A:0 1011 10`0`000000@`@d `BPP2l`K? rPPp){ o!`q!qo! o!m!m!m!n!o!8Dn!@m!n!`n!n!n!d p-!LM>t0> `0\@P 0S?*\0S@c$1 R U  * U$F% 0 %b0P 1* 0P:0 R V 0S`pH&@PP PR0 `00 P0d 0 n!@m!n!m!m! o!o!0@S P-L @ <0!RF 0q PRQ @`@` 0 R0!0  B8# 010 g!0`BQc R0) P`VP@@`@PPm!@m! o! 0-0L @R& 0P$ t* TP|0 RU l0 RU0 @<P"@ 00m!@n!qo! -1L@PT`r1 RO 1 b Qf1 QE!1PC P? 020Cp5:#:32"!01H*0@!0!HVSV00T0S 1 R fyPp TV T 1 !W.:#:S0JS `0 VR:DV0JS 8N@n!m!m!m!m! n! o!8PlPh0 R` \0 RP0 b QD @0 Q40 !RJLm!@n!m!lm!m! -LMT@0PS HH0  B0Q0 R? 007`m!@o!` p-LM`0PS@$00 S00 0CR@0` T00PQ00Sp2p`@o!o!n!L p-LMl`0hPS@0X0T S0 phm0 0CR0pph`@o!o! -pL0@S`+P0 0S0T 0 0CR@0l T00Q00S@kQ`@o!o!n!L -L` PpO :36021V 0RP!*FPPe VY0`0@0@0001300p P?@\ " @0d!ST 21 @!T 0U 0'6cQ 10 QX@ڤ21 Ln!@X @*02&60 ` pm!m! -RLMP@ R oY:#:S#0 `1dßS \3 RL3 R@#0S $301 3 RcP P0 0Q=0 0@0pW R 0Rb 0R Y o;0S0 00 0DŸ0@2  FbT` !0 `V0D0 0@S *P p 0@S*pW R @0  0@00 0S R Q0 @00@00p00P0pW  0Z0 P0 0p@pyc e }Z E < 0`$0 1S +88m! o!n!@m!n!o! n!q`o!m!m!P p-LM0<@0C*"*2dR!0`36\|1 RV \Q \0&H  04 R% 0R p R 0S 0 0 a01 R PUphIG  R \ 0S * R 0S  0S: @prph o!m!m!  - LM0S!P0,0 % 0( 00 ,K0pK` @ 0``p@ PUU00 0`0`o! p-0LTMP`XK <@KhK0 0h0 K0XK< Kㅈ@0 dK`0 \0 d0 = o! 0-LMPK 00%0 @( 0ST 0S @S 0ST 0S="  =00 !o!10*2 `|! -LM⨐Kp H!@0% 0 尠KⴀK`PK  0 ``p@P Tl 0 0C000 P`@000 Z00`@@TZ q!-000   00@0S 4 0  R 0 0 p!p! -0LM , R p0 0C000 P` @=, 0Z00 00`p!p! -x0LM R `0 R P@D00L0H00D@p! q!p!@-M Ѝ@-MЍ! !P: ZŒŒ#! !P: `B!,aB 0>ZJJJJJJJJJJJJJJJJJJ }J xJ sJ nJ iJ dJ _J ZJ UJ PJKJFJAJ=Q:Q:Q:Q:Q:Q:Q}:Qx:Qs:Qn:Qi:Qd:Q_:QZ:QU:QP:QK:QF: QA: Q<: Q7: Q2: Q-: Q(: Q#: Q: Q: Q:Q:Q :Q:QA ? QA ? QA > QA > QA = QA = QA < QA < QA ; QA ; QA : QA : QA 9 QA 9 QA 8 QA 8 QA 7 QA 7 QA 6 QA 6 QA 5 QA 5 QA 4 QA 4 QA 3 QA 3 QA 2 QA 2 QA 1 QA 1 QA 0 QA 0 \aBC`B0QA 0  -LM@h; -LM@\Pp` h:^[QT0SD R 0S=0W07 00CS꘼pȼммммммммؼ0 0900 1 0 0 ;00 0 0 R 0;S< W 0 9 009 0, @-DP@-@p `0S0S=S 0S=S PdP U 0S  0R^ 0S ^0=S P00cC10@q! -LMK@-Q:@- R (2 R R -PPPP RrPP B PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R@- RP1P P1P RrP1P  B P1P B@  R010 1  B R0q0`0q0`0q0`\0q0`0q0`0q0` R 0\6 R B0@-81, Ġ%̌T$\D#L0P  R0@ Ġ01#̌  R R B0@-81, Ƞ%ȌX$XH#H0P  R0@ Ƞ01#Ȍ  R R B0@-81, ̠%Č\$TL#D0P  R0@ ̠01#Č  R-R0 0c BSR48 R p-@P`x BRpR0 BRRR -LM`@ 0pP`0S  0Sb RCA 0\R! B Mp-LM0`0 @`p2**x*J** -LM, ,`\0 4 P u00  R-UP8  +U8 P4 RR0Uv 4@T0U 4 4@0K/0 @K 8@@K< pu 00Q0PEu P!0 0Q4 u,A 00Q7 EW EP4U%\ X  W W0 < U00S V7p"00PD@ <B"D@p$$ŏ X008Q\pw0 R \,00F0XSxS0P40 `4q$P1 *  rs*u* 0*s -LMPpP PU` 0 <P @H0K-D 8 0` ,@ H` @` <` 4` P`, U@ 0 2< 2 R"  ? "W0 2&= 2W, 600  0|pa 0 2: 2 S 6006V@W 6@K P K 0S3 2< 2L1L!0H1 0@!@1 08!81 0 P 0S00 0  bU 0 2  p xP 2 @0  !qT60S 2: 2 z-0b,84\t  -LM@ 0S  2 "&60 0 00 p-LM@PQ"%p 2`  @ SP`pp7P`^ P 2 2` 00 -L$MP@`Qz Tt "; S  p+  0%0D K$<0 @ 2@K 2 LpK 0P p$ 0q q 0P 2: 2r L @ T 0P /0LpK0 ,0  0P8K L04 80  @ T 0P  O00~ -LMP`pQ@5T0@TN50 02T 2  P`@D P@  0p 2` 00  00 -L M1"pS *PDP4 "! X0 , 0K!*`P!00CS0!0@Ӥ0&t `V@@V 0Pt X"55: X* 2< 2? j@ -L M?Z@8*Qa!00CS0!0pӤ08w W V 1PP`l UP Pp`F1w c00 ,  0 K 0OPw  Z: Z* 2< 2R p -LM1"PS *P:P"!' b1( ,0 V,KB r*T#*•\ \ 00T0#02S \ 0P`V:B? 2< 2: -LMR?UpB b*T*,@ 0S @T*0S,l, K0( PP U@:B 2< 2 -LM@pPQ` 2    R 1S *PP` 21 %"? l !,K, 2(0 V_8(0$PP "U 2 B 0U 2<00 40 4K-0U 2 E 0]P  2 V: 2$P  0 4p 0DP0U)P4 "?0 4K(p "^3000PU"P` 0PU0PU "UWi0( ,0 ,Kz &00M -L$M<"w/, p\`t"V00X0SjV g P0 VP@Y V 2XG:00` a0R1:0A7#(Uᅀ!!: f!0!0  0E2 "0 "2 1 ,0S ,_酀 e * 0 `P P202 zp` 08#X 8 K p 40K@0 80 < 40  @K0 zo!h p-LMP`@Q-T T 20 0p(0 2S  $AP$00C$0 P 2:0 20Q 2Q A P00 p-LM `@Q0 @  PP 40p -pLM0!P@0 p< 00` a0e7#88!8C#8 S! 0C8R#8 1 S!0B000`07#888C#8 0CR80#8! B!20C2 -LM@QPk0ESD0PU7 P U 2 & P U E P` (0$P0(0 0@ 2p 00  Pp10 0P 2  Rp(0$0P(0 $0PS g00 -LMSP @`p 1S PJP4 01  K1 0 W7 00!P0# 2  00  0!Q PP001 0! ?r?sτ P10 . -LM,`pἑP oP< 0410C7#0 8#P@ 0QP1@!Z101 :Z  0 0 0C00 0 00e00ZP 1@ C S@! T P Z0000   B   0P -p@L00l8#hP 08#x `0 0c8#h08#x 0b0C`p`0 -LM@P 0S p7U0R G0`8U#h 0  b Rʂ0 S00@0@@0@Rڰ 0000G000A8  B8 000o -L4M@ 0< 开@ PD p <0Px D0@ 00  0 ZH P L *P0<S`R0000 l , @0g\0KH8 K8' 0080 0 c4 CP08#8P0 0ZpPP0n0 a B 00ഀD   000#8ᲀL  L 08# a L0 00`0ᲀPD  0<@ D   000 -LLMT X PpP 0L8#hL \\P ` h [00C8S 0@TL s \d `E0S@@KHKd0@ @ b 00H0 0L c@d@ P P3 0S 0 00S L Pp   00008#h\0 0S\`0S L'\0S 0 00S\  TLPT \ \  hT 000 0a0C0 h 0b0C 0X L0lPX L` X0@QPh  L X` eX 8K TP X0LPP4PT 8pW\ 0 RL0X P X -LM@p0Qs P`0 R=V0e S0 0RS 00P U*V0 00Q *^ 0P@  0Y008 8(P40Po P0 00S"P@ 0S 0 00S 0$P  Q p-LM40@SP`$ 000`!H 0 Pp0000000 0 B@ 0p00S40040 -L M`pxQ  0 0C0ppSa <0R@W  P@0PLp  P P>Y 0S00C0pp  ,1R Y 0C\0K 1 00  0 !0  00[\002K)0[* [0 0\ʌ0 0"K+ [,[ \-O0 0|@0@0<  JPPBJ@ l@00@ -L MPx`p@ `  1R TI 0CP0K100  0!0  00[P0Z" <0W@  P@0PRp  P 7-O0 0@0@0< J PpBJ@ @00@0Tʀ0 0"K) [*[ Pڸ5P  -LM` 0H20APP p0 101  d 020 0  崜8Q0 00P -L M  !4 0pD $0@SQ!P40 BU00 ,P 18aV U 0, 1 CU@  T pb @ TPU00ZD0 $0@0@@c TD ZF !4 0@  A@ D@ 010CY ?=2!I !U08#X&ʊU0 aP`40@ D0 T0D0Z 1@@ AU@ D 1 I,001 @,d@?=2D  $0!E!P@T$ U D0T P U D0TU1@ \0@bT5У 0$10C@/-"@dP`S -0p8#(=1@0@A0C$0^^ 18a!$ BVLP ?=2!E.!h}` -LAMp0P 0 N-ANK0AnK @D `FS@D `F) \0 0 $AK A0A $4 =0s1 1   0 pS $ (o!̶. -L MⰀ0ሐ` 0cV8#Ƞ, F0@p P0 00 0c8#Ƞ 0 밀,000 0Pc PEP00@ -LM1@QPap 0 Rp8! ,5P8q8%pR0-P@ 0bR03 B0 -LM@p4 00 , 08 40L0 Ƞ< S,ȠL 0X0C8#Ƞ3 X0 08\<#X5 0<0e8#h < GX0` 0n0C 00,`0 0X00 00C8#Ƞ Pp@00 0E8X#X4  R 0("X0e8#h 80`0l0C0 , ` ^8040 ePp80 4 4P㌠!\/ X0 08#X\< " 0<0e8#h< `Ie00e0 `0@040\ 00C8#ȠQ00X @ -LMP @p`0B8S`RE 00Q 00U@3PT3 V  0S 0Q S0ò000 B0 00C0C0 0 00T00  UU800C800 R -LMP`  a("H T p 0 ʲ0S T0 P  `Q0 >Ppd`P 0 0b8#H Tʲ0S  0- LP@0S 0\P 0Q 0S 0S 0S00 -LM@ PQpk 0 RW 00 P) @Y 00d0 0S 0S 0P  0(1 P$1 0$1  $1 0(! @0 d Ƞ Q`ἠ,P  0 3p 0 S }1 0")0 00 0S0P 张@`0 0S0P 0S @ -LMP`  Q@ n, $ 0 0S0`P  0Pp 0, S 0 ( (0 0  pP!zP Y 0(10S$1 0 ! 0S 0'P  0P$1 0$1 0-LMP @p 1 00 -L M`@ A nQP, p'P"-P 0 P 0, S 0  Z(0 0 B0 0S0P  0Pp -LMP<0 80K0 Kp `P@Q0, 0 <KRq8#80CY 0@00PP08#X ("X 0 P L 00< 0@00Q<Y0A  P00<PP< 0LP -LDMP, \X0 ' 2 XQ :Q '004 ,0S l,.w?0 R ` Pw? RX^ 1ST@K P\ X\ Q`崐 T0S 2   0sp@z  00 0p l0Rc:0L7#(Y@!S: g0!1 @ @`0 @(0 0S. 1S 0S10C00CY{?   $X Q 20 2{\ 0 D!010SY{?㳐  0R1 S0"1!@ i b` 0P H BT0S{  97T@K 0UP\ VN CP`ḑY@@K  p 4K0  L0 P  0KLw? `RPK` @@K p <0K D H0 8K `0D0HK`0 (00S&0  00o! -LMPp@  P`E {000   ` Q:1S 0S @T P@A G@P0000S0@0 0CR P0 0  0  -L 000CS?X 82[!0 h!!2[ 0H@00TQ/ 0S  ~ z 2 0 40 p  k g0 c4 _0 40  Q0 M4 I2[!0 h!!P2[\L01 @ @ L 0 00L0P  L0 p2[ S000!! B  @@  2[!0 h!!2[0A0@v2[S000!! B  @@10C00  2[!0 h!!2[!0 B  0@T*K0 K40K"0@7[#(Q:0 1T  a .A 0 0TL $ 00X0 0S2[S1L 0C0 0 !<K0 80 < 0D @0 DK 00SX0%1P P0 %P  2 0 40 p0 40  @ 000@t*K0 K40K@pX/ -LMP,K00 &P`N ,0 1v?0 1 0 0\ 01 0CRB  Pp8 !000 v?0 1 0\ 1  P@ 00 0 !@|T@P00`  01P00` -LM@,Kp`V0K% PU0  , @0vϠ@ @ @@@`P -LMv` Lp1P0C@ 00!  B!1@1!0C 00 01  } -vL LP@@ ` R+ R:! p 0  0 n!!1 @ @ 0   0 !0 0 0L 'p!0 0 n!1!@ 00 -L$MP, ,@vAL! Ƞ< ^D 00 8 ,Ƞᰠ`4 @ pS*Z@  000CS000000000000 0 0 @0H0 Z@400S*<0AW Z 10d1 1 Ƞ  ,x@@ 0088@#8S@0 :HDP^ D <08W#h:1, 001  ,0 0R` Z00с,0g0< `W6*0Z8#h 000CSy$00000H0000000\0  @001 0d10@1 Ƞ ,x<08W#h:0<1Z0110100 0 0@ 1@0  R0"0! !R0%,%0%05,@5 g 050% !0F8#h|0!0 0 0@ H ?0!@080!@H@ 00@0 -LM @P0  0 0 00-10C7#\ 0* 08 #8S:  -Lጃ%s: %s not compiled in instbinUsage: %s ..., where is one of: mount_cd9660dfmountmount_ext2fssyncnewfs_msdossttylndisklabelpaxtarcpiofsck_ext2fscatifconfigrtsolping6kbdlessmoremount_nfsfdiskgrepfgrepegrepumountmount_msdosmknodwicontrolmount_ffsdhclientreboothaltcpgzipgunzipgzcatchmodchgrpchownfsck_ffsfscknewfsrmmtejectmkdirksh-shsleepmvexprdmesgtest[hostnamehJ'Ј ' '@@'<t '$' ȹ̉@@('T( $\(d( %l( &p(x((( !( "( #((((    [.<(+!&]$*);^-/|,%_>?`:#@'="abcdefghijklmnopqr~stuvwxyz{ABCDEFGHI}JKLMNOPQR\STUVWXYZ01234567897-./% <=2&?'@O{[lP}M]\Nk`Kaz^L~no|JZ_myjС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx7-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|_myOС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx    .<(+|&!$*);~-/,%_>?`:#@'="abcdefghijklmnopqr^stuvwxyz[]{ABCDEFGHI}JKLMNOPQR\STUVWXYZ01234567897-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|ཚmyO_ !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwxjJ7-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|_myOС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwxcbsconvfilesibsobsofskipno value specified for %srecord operations require cbsbuffer sizes cannot be zeroseek offsets cannot be larger than %qdcbs cannot be zerocbs meaningless if not doing record operationsbs supersedes ibs and obs%s: illegal argument combination or already setunknown operand %sasciiblockebcdicibmlcasenoerrornotruncoldasciioldebcdicoldibmosyncswabucaseunblockunknown conversion %s%s: illegal conversion combination%s: illegal numeric value%s: short input recordstdoutinput bufferoutput bufferfiles is not supported for non-tape devices%s: short write on tape device%s: short write on character device%s: end of device%u+%u records in %u+%u records out blocks%u odd length swab %s %u truncated %s %qd bytes transferred in %ld.%03ld secs (%0.0f bytes/sec) summaryskip reached end of inputD+P+'\+`+h+t+|++++ +userquotagroupquotarwautoaccesstimeatimeexecsuidrdonlyunionupdateegjo:Rcd9660%s: Filesystem not supported by kernelrealpath %s%s on %susage: mount_cd9660 [-egjR] [-o options] special node %s: illegal value '%s'needsdoes not need-o %s: option %s a value-o %s: option not supportedhiklnPt:retrieving information on mounted file systems%s mounted as a %s file system%s is not a local file system-i is incompatible with -Ponly one -t option may be specified.empty type list %lld %6s%-*.*s %*u %8u %8d %5.0f%% %7u %7u %5.0f%% %s 1K-blocks%-*.*s %s Used Avail CapacityFilesystem Mounted on iused ifree %%iused Size%-*.*s %s Used Avail Capacity1024-blocks 512-blocks%-*.*s %s Used Available Capacity Mounted on %-*.*s %*d %10ld %11d %5.0f%% %s df: %qd: %s usage: %s [-hiklnP] [-t type] [file | file_system ...] ffsext2fskerberos uid mappingNFS exportedanon uid mappingexported read-onlynoatimenoaccesstimenodevnoexecnosuidwith quotasread-onlyroot file systemsynchronoussoftdepasynchronousasyncexported to the worldAadfo:rwt:uvforcerqnoauto/var/run/mountd.pidsignal mountdgetmntinfo:@nfsunknown special file or file system %s.root_devicecan't find fstab entry for %s.%s has unknown file system type./usr/sbinexec: mount_%smountfsstatfs %s%s/mount_%sexec %s for %sno mount helper program found for %sforkalready mounted%s on %s type %.*s: %s %s on %s type %.*s (%sunknown flag%s %#xv2v3udptcpsoftintrnoconn%s%s=%dwsizersizerdirsizetimeoretransmaxgrouplistreadaheadprmounthardmfsadosfs%s%s=%u, %s=%u%s%s=0%omsdosshortnowin95gemdirexecnorripgensextattprocfslinuxversion %d%s%s=%lu %s, ctime=%s%s,%s-o[-Aadfruvw] [-t ffs | external_type][-dfruvw] special | nodeusage: mount %s %s mount %s mount %s [-dfruvw] [-o options] [-t ffs | external_type]special nodeufs%s: fstab type %s != disklabel type %s%s: fstab uses outdated type 'ufs' -- fix pleaseD+P+'\+`+h+t+|++++ +mount table fullspecified device does not match mounted device%s on %s: %sfilesystem not supported by kernelusage: mount_ext2fs [-o options] special node $FreeBSD: src/sbin/newfs_msdos/newfs_msdos.c,v 1.9 1999/08/28 00:13:52 peter Exp $%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) %s: can't read sector %u%s: can't write sector %uNO NAMEFAT%uBSD 4.4%u clusters too few clusters for FAT%u, need %uwarning: sectors/FAT limits file system to %u clusterstoo few reserved sectorsno room for backup sectorbackup sector would overwrite info sectorno room for info sector/boot/%s%s: inappropriate file type or format160180320360720120014402880%s: bad FAT typevolume ID%s: bad volume label%s: bad OEM stringbytes/sectorsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorswarning: %s is not a character devicebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %u-%c is not a legal FAT%s optionblock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: FAT type limits file system to %u sectors/dev/%s is mounted on %s%s: unknown standard format%s: can't figure out partition info%s: partition is unavailablegetdiskinfo%s: unknown disk typeioctl (GDINFO)%s: can't read disk label; disk type must be specifiedbps=%u spc=%u res=%u nft=%u mid=%#x spt=%u hds=%u hid=%u bspf=%u rdcl=%u infs=%#x bkbs= bsec=%u spf=%u sec=%u rde=%u%s: no default %s%s: illegal %s%s: bad %s"*+,./:;<=>?[\]|usage: newfs_msdos [ -options ] special [disktype] where the options are: -N don't create file system: just print out parameters -B get bootstrap from file -F FAT type (12, 16, or 32) -I volume ID -L volume label -O OEM string -S bytes/sector -a sectors/FAT -b block size -c sectors/cluster -e root directory entries -f standard format -h drive heads -i file system info sector -k backup boot sector -m media descriptor -n number of FATs -o hidden sectors -r reserved sectors -s file system size (sectors) -u sectors/track EE E$&ETJ1JFF F FF $F,F 4F J(Iundefoption requires an argument -- %sillegal gfmt1 option -- %sillegal gfmt1 optiongfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:ispeed=%d:ospeed=%d %s=%x:%lx%ldoflagospeedlflagiflagispeedcflagcbreakcolscolumnscookeddecekeverythingextprocnewoldostartostoprawrowssanespeedttyillegal option -- -%s%d %d TIOCSETDTIOCSTARTTIOCSTOPcs5cs6cs7cs8cstopb-cstopbcread-creadparenb-parenbparodd-paroddparity-parityevenp-evenpoddp-oddppass8-pass8hupcl-hupcl-hupclocal-clocalcrtscts-crtsctsmdmbuf-mdmbufignbrk-ignbrkbrkint-brkintignpar-ignparparmrk-parmrkinpck-inpckistrip-istripinlcr-inlcrigncr-igncricrnl-icrnliuclc-iuclcixon-ixon-flowixoff-ixofftandem-tandemixany-ixanydecctlq-decctlqimaxbel-imaxbel-echoechoe-echoecrterase-crterasecrtbs-crtbsechok-echokechoke-echokecrtkill-crtkillaltwerase-altweraseiexten-iextenechonl-echonlechoctl-echoctlctlecho-ctlechoechoprt-echoprtprterase-prteraseisig-isigicanon-icanonnoflsh-noflshtostop-tostopflusho-flushopendin-pendin-crtnewcrt-newcrtnokerninfo-nokerninfokerninfo-kerninfoxcase-xcaseopost-opostlitout-litoutocrnl-ocrnlolcuc-olcuconlcr-onlcronlret-onlretonocr-onocrtabs-tabsoxtabs-oxtabsonoeot-onoeottablet disc; ispeed %d baud; ospeed %d baud;lflags-extprociflagsoflagscflags%-8scchars%s = %s; %d rows; %d columns;speed %d baud;#%d disc; slip disc; ppp disc; strip disc; -aefgaef:gTIOCGETDTIOCSWINSZtcsetattrgfmt1illegal option -- %sTIOCGWINSZnot a terminalusage: %s [-a|-e|-g] [-f file] [operands] @(#) Copyright (c) 1987, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: ln.c,v 1.10 2003/06/02 23:32:08 millert Exp $Ffhnslinkit%s: is a directoryusage: %s [-fhns] file1 file2 ln [-fs] file ... directory @(#) Copyright (c) 1987, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: disklabel.c,v 1.90 2004/08/08 19:04:25 deraadt Exp $ Ym,Pm,P Z@8mmP,OPmDPdPmhPmmmadosunknownSMDMSCPold DECSCSIESDIST506HP-IBHP-FLtype 9floppyccdvndATAPIRAIDunusedswapVersion6Version7SystemV4.1BSDEighth-Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSHFSADFSNTFSBEf:NRWb:cdenp:rs:tvwbckmgioctl DIOCWLABELunknown disk type: %sDANGER! The disklabel was not found at the correct location!To repair this situation, use `disklabel %s > file' tosave it, then use `disklabel -R %s file' to replace it.A new disklabel is not being installed now.writelseekwriting label to block %lld (0x%qx) ioctl DIOCSDINFOioctl DIOCWDINFO%s: No disk label on disk; use "disklabel -r" to install initial label%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of disk%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)no disklabel found. scanning.no disk labeldisk label corruptedfound at 0x%lxreading label from block %lld, offset %lld ioctl DIOCGPDINFOioctl DIOCGDINFOioctl DIOCRLDINFOBootstrap doesn't leave room for disk label\ :Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:nc#%u:sc#%u:su#%u:%srm#%hu:%sil#%hu:d%d#%up%c#%u:o%c#%u:t%c=%s:t%c=unknown%d:b%c#%u:f%c#%u:%sts#%u:%shs#%u:%scs#%hu:%ssk#%hu:%.*s| %c: %*.1f%c %*.1f%c %8.8s%8d%22.22s # %s # (Cyl. %4u- %u %5u %5u %5hu %5u %5u %5.5s %c: %*u %*u # %s: type: %s type: %d disk: %.*s label: %.*s bytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %hu interleave: %hu trackskew: %hu cylinderskew: %hu headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %d %hu partitions: offset# %*.*s %*.*s fstype [fsize bsize cpg] badsect ecc removable # Notes: # Up to 16 partitions are valid, named from 'a' to 'p'. Partition 'a' is # your root filesystem, 'b' is your swap, and 'c' should cover your whole # disk. Any other partition is free for any use. 'size' and 'offset' are # in 512-byte blocks. fstype should be '4.2BSD', 'swap', or 'none' or some # other values. fsize/bsize/cpg should typically be '2048 16384 16' for a # 4.2BSD filesystem (or '512 4096 16' except on alpha, sun4, ...) re-edit the label? [y]: editNo changes.-cEDITOR/usr/bin/vifailed to start editor/bin/sh # line %d: syntax errorIDEline %d: warning, unknown disk type: %sremovableeccbadsectline %d: bad flag: %sdrivedataline %d: bad drivedata %s%d partitionssectors/cylindertracks/cylindercylinderstotal sectorsrpmtrackskewcylinderskewheadswitchtrack-to-track seekline %d: bad partition name: %sline %d: warning, unknown filesystem type: %sline %d: too few fieldsline %d: bad partition offset: %sgetasciilabelline %d: bad partition size: %sline %d: unknown field: %sline %d: bad %s: %sline %d: bad # of partitionssector size %dtracks/cylinder %dwarning, unused partition %c: size %d offset %dpartition %c: block size < fragment sizepartition %c: partition extends past end of unitpartition %c: offset past end of unitwarning, partition %c: size 0, but offset %dwarning, number of partitions (%d) > MAXPARTITIONS (%d)warning, super block size %% sector-size != 0super block size %dwarning, boot block size %% sector-size != 0boot block size %dwarning, revolutions/minute %dcylinders/unit %dsectors/track %dcmplabel usage: disklabel [-c | -d | -r | -t] [-v] [-p unit] disk (read) disklabel -w [-c | -d | -r] [-nv] disk disktype [packid] (write) disklabel -e [-c | -d | -r] [-nv] disk (edit) disklabel -E [-c | -d | -r] [-nv] [-f tempfile] disk (simple editor) disklabel -R [-nrv] disk protofile (restore) disklabel -N | -W [-nv] disk (protect) disklabel -B [-nv]%s disk [disktype] (boot) disklabel -Bw [-nv]%s disk disktype [packid] (write) disklabel -BR [-nv]%s disk protofile [disktype] (restore) `disk' may be of the form: sd0 or /dev/rsd0%c. `disktype' is an entry from %s, see disktab(5) for more info. /etc/disktab`packid' is an identification string for the device. `protofile' is the output from the read cmd form; -R is powerful. You need to specify a type for this disk.No 'c' partition found, adding one that spans the disk. Initial label editor (enter '?' for help at any prompt) unable to get default partition tablePAGER/usr/bin/lessunable to execute %sEnteringExiting%s expert mode This option is not valid when run without the -f flag. Write the modified label to disk?Write new label?unable to write labelNo label changes.In no change mode, not writing label.Recalculated free space.cannot open %sFilenameName of the file to save label into.Nothing to undo!Last change undone.Unknown option: %c ('?' for help) can't run when there is partition overlap.Partition must be between 'a' and '%c' (excluding 'c'). editor_add Please re-enter an offset and size for partition %c. Partition '%c' exists. Delete it first. The letter of the new partition, a - p.partitionPartition '%c' already exists. Partition must be between 'a' and '%c'. No space left, you need to shrink a partition Partition '%c' is not in use. You cannot name a filesystem of type %s. partition to nameThe letter of the partition to name, a - p.Command aborted Please re-enter an offset and sizeWarning, need %u sectors but there are only %u free. Setting size to %u. partition to modifyThe letter of the partition to modify, a - p.You may not delete the 'c' partition. The 'c' partition must exist and should span the entire disk. By default it is of type 'unused' and so does not take up any space. partition to deleteThe letter of the partition to delete, a - p, or '*'.device: %s free sectors: %u %hu partitions: Partition %c is currently %u sectors in size (%u free). new sizeSize of the partition. You may also say +/- amount for a relative change.Invalid entry Only %u sectors free, you asked for %u 'c' partition may not be larger than the disk partition to change sizeThe letter of the partition to change size, a - p.%s: [%s] %s: [%u] Rounding to nearest cylinder: %u getuinthas_overlap Error, partitions %c and %c overlap: size offset fstype [fsize bsize cpg]Disable which one? (^D to abort) [%c %c] Changing device parameters for %s: What kind of disk is this? Usually SCSI, ESDI, ST506, or floppy (use ESDI for IDE)."%s" is not a valid disk type. Valid types are: "%s"label name15 char string that describes this label, usually the disk name.The Numer of sectors per track.The number of tracks per cylinder.The number of sectors per cylinder (Usually sectors/track * tracks/cylinder).number of cylindersThe total number of cylinders on the disk.The total number of sectors on the disk.Not enough free space to shrink by %u sectors (only %u sectors left) The rotational speed of the disk in revolutions per minute.The physical sector interleave, set when formatting. Almost always 1.edit_parmsYou may want to increase the size of the 'c' partition.failed to sort partition tablesdrzFLOPPYxdhdCCDVNDsvndPossible values are:"IDE", Disk typeWhat kind of disk is this? Usually SCSI, IDE, ESDI, CCD, ST506, or floppy.Starting sectorThe start of the OpenBSD portion of the disk.Size ('*' for entire disk)The size of the OpenBSD portion of the disk ('*' for the entire disk).The 'p' command prints the current disk label. By default, it prints the size and offset in sectors (a sector is usually 512 bytes). The 'p' command takes an optional units argument. Possible values are 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, and 'g' for gigabytes. The 'D' command will set the disk label to the default values as reported by the disk itself. This similates the case where there is no disk label. The 'M' command pipes the entire OpenBSD manual page for disk label through the pager specified by the PAGER environment variable or 'less' if PAGER is not set. It is especially useful during install when the normal system manual is not available. The 'X' command toggles disklabel in to/out of 'expert mode'. By default, some settings are reserved for experts only (such as the block and fragment size on ffs partitions). The 'a' command adds new partitions to the disk. It takes as an optional argument the partition letter to add. If you do not specify a partition letter, you will be prompted for it; the next available letter will be the default answer The 'b' command is used to change the boundaries of the OpenBSD portion of the disk. This is only useful on disks with an fdisk partition. By default, on a disk with an fdisk partition, the boundaries are set to be the first and last sectors of the OpenBSD fdisk partition. You should only change these if your fdisk partition table is incorrect or you have a disk larger than 8gig, since 8gig is the maximum size an fdisk partition can be. You may enter '*' at the 'Size' prompt to indicate the entire size of the disk (minus the starting sector). Use this option with care; if you extend the boundaries such that they overlap with another operating system you will corrupt the other operating system's data. The 'c' command is used to change the size of an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. You may add a '+' or '-' prefix to the new size to increase or decrease the existing value instead of entering an absolute value. You may also use a suffix to indicate the units the values is in terms of. Possible suffixes are 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, 'g' for gigabytes or no suffix for sectors (usually 512 bytes). You may also enter '*' to change the size to be the total number of free sectors remaining. The 'd' command is used to delete an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. You may not delete the ``c'' partition as 'c' must always exist and by default is marked as 'unused' (so it does not take up any space). The 'e' command is used to edit the disk drive parameters. These include the number of sectors/track, tracks/cylinder, sectors/cylinder, number of cylinders on the disk , total sectors on the disk, rpm, interleave, disk type, and a descriptive label string. You should not change these unless you know what you are doing The 'g' command is used select which disk geometry to use, the disk, BIOS, or user geometry. It takes as an optional argument ``d'', ``b'', or ``u''. If you do not specify the type as an argument, you will be prompted for it. The 'm' command is used to modify an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. This option allows the user to change the filesystem type, starting offset, partition size, block fragment size, block size, and cylinders per group for the specified partition (not all parameters are configurable for non-BSD partitions). The 'n' command is used to set the mount point for a partition (ie: name it). It takes as an optional argument the partition letter to name. If you do not specify a partition letter, you will be prompted for one. This option is only valid if disklabel was invoked with the -F flag. The 'q' command quits the label editor. If any changes have been made you will be asked whether or not to save the changes to the on-disk label. The 'r' command is used to recalculate the free space available. This option should really not be necessary under normal circumstances but can be useful if disklabel gets confused. The 's' command is used to save a copy of the label to a file in ascii format (suitable for loading via disklabel's [-R] option). It takes as an optional argument the filename to save the label to. If you do not specify a filename, you will be prompted for one. The 'u' command will undo (or redo) the last change. Entering 'u' once will undo your last change. Entering it again will restore the change. The 'w' command will write the current label to disk. This option will commit any changes to the on-disk label. The 'x' command exits the label editor without saving any changes to the on-disk label. Available commands: ? [cmnd] - this message or command specific help. a [part] - add new partition. b - set OpenBSD disk boundaries. c [part] - change partition size. D - set label to default. d [part] - delete partition. e - edit drive parameters. g [b|d|u] - use [b]ios, [d]isk or [u]ser geometry. M - show entire OpenBSD man page for disklabel. m [part] - modify existing partition. n [part] - set the mount point for a partition. p [unit] - print label. q - quit and save changes. r - recalculate free space. s [path] - save label to file. u - undo last change. w - write label to disk. X - toggle expert mode. x - exit without saving changes. z - zero out partition table.Numeric parameters may use suffixes to indicate units: 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, 'g' for gigabytes or no suffix for sectors (usually 512 bytes). '%' for percent of total disk size, '&' for percent of free space. Non-sector units will be rounded to the nearest cylinder. Entering '?' at most prompts will give you (simple) context sensitive help.The 'z' command zeroes out the existing partition table, leaving only the 'c' partition. The drive parameters are not changed. mpsave%s%c %s %s rw 1 %d Starting sector for this partition.The OpenBSD portion of the disk starts at sector %u, you tried to add a partition at %u. You can use the 'b' command to change the size of the OpenBSD portion. The OpenBSD portion of the disk ends at sector %u, you tried to add a partition at %u. You can use the 'b' command to change the size of the OpenBSD portion. Size of the partition.Sorry, there are only %u sectors left The OpenBSD portion of the disk ends at sector %u, you tried to add a partition ending at sector %u. You can use the 'b' command to change the size of the OpenBSD portion. Size may not be larger than %u sectors Size of fs block fragments. Usually 2048 or 512.Zero fragment size implies zero block sizeSize of filesystem blocks. Usually 16384 or 4096.Error: block size must be a multiple of the fragment size. Error: block size must be at least as big as fragment size. Error: block size must be at least as big as page size (%d). cpgNumber of filesystem cylinders per group. Usually 16 or 8.FS type (decimal)Filesystem type as a decimal number; usually 7 (4.2BSD) or 1 (swap).FS typeFilesystem type (usually 4.2BSD or swap)Unrecognized filesystem type '%s', treating as 'unknown' noneWhere to mount this filesystem (ie: / /var /usr)Mount points must start with '/' Can't stat deviceBIOS geometry not defined. You must enter either 'd', 'b', or 'u'. Note: user geometry is the same as disk geometry. Enter 'd' to use the geometry based on what the disk itself thinks it is, 'b' to use what the BIOS says,or 'u' to use the geometry that was found on in the label.[d]isk, [b]ios, or [u]ser geometry$OpenBSD: ar_io.c,v 1.36 2004/06/20 16:22:08 niklas Exp $$OpenBSD: ar_subs.c,v 1.28 2004/04/16 22:50:23 deraadt Exp $$OpenBSD: buf_subs.c,v 1.20 2004/04/16 22:50:23 deraadt Exp $$OpenBSD: cache.c,v 1.17 2004/03/16 03:28:34 tedu Exp $$OpenBSD: cpio.c,v 1.17 2004/04/16 22:50:23 deraadt Exp $$OpenBSD: file_subs.c,v 1.27 2004/04/16 22:50:23 deraadt Exp $$OpenBSD: ftree.c,v 1.25 2004/04/16 22:50:23 deraadt Exp $$OpenBSD: gen_subs.c,v 1.17 2003/06/13 17:51:14 millert Exp $$OpenBSD: getoldopt.c,v 1.8 2003/07/02 21:19:33 deraadt Exp $$OpenBSD: options.c,v 1.61 2004/04/16 22:50:23 deraadt Exp $$OpenBSD: pat_rep.c,v 1.28 2004/06/11 03:10:43 millert Exp $@(#) Copyright (c) 1992, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: pax.c,v 1.27 2004/04/16 22:50:23 deraadt Exp $$OpenBSD: sel_subs.c,v 1.18 2004/04/16 22:50:23 deraadt Exp $$OpenBSD: tables.c,v 1.21 2003/08/16 17:31:55 deraadt Exp $$OpenBSD: tar.c,v 1.33 2004/04/16 22:50:23 deraadt Exp $$OpenBSD: tty_subs.c,v 1.12 2003/06/02 23:32:09 millert Exp $Cannot write an archive on top of a directory %sFailed stat on %sFailed chdir to %sFailed open to read on %sFailed open to write on %sFailed open to read/write on %s%qu blocks %s: %s vol %d, %lu files, %qu bytes read, %qu bytes written. %s: unknown format, %qu bytes skipped. done. %s: Waiting for tape drive close to complete...ar_drainUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specEnd of archive volume %d reachedFailed read on archive volume %dWARNING: partial archive write. Archive IS FLAWEDWARNING: partial archive write. Archive MAY BE FLAWEDFailed write to archive volume: %dUnable to append, trailer re-write failed. Quitting.Write failed, archive is write protected.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Cannot allow updates to an archive with flaws.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to seek archive backwardsReverse position on previous volume.Unable to obtain current archive byte offsetUnable to backspace tape %d blocks.Tape drive unable to backspace requested amountget_physUnable to backspace tape over %d pad blocksUnable to backspace over tape filemark.Unable to locate tape filemark.Cannot determine archive tape blocksize.Unable to backspace over last tape block.ar_next ATTENTION! %s archive volume change required. %s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot open %s, try again Cannot save archive name.Quitting %s! %s ready for archive tape volume: %d Load the NEXT TAPE on the tape driveReady for archive volume: %d Unable to restore signal maskUnable to set signal maskcould not pipecould not forkcould not exec-dcCan't fchdir to starting directoryCannot chdir to %sextractUnable to open %s to readCannot mix current archive format %s with %sappend%s: Reading archive to position at the end...directory name is too long %scopyDestination is not a directory %sDestination pathname too long %sCannot access destination directory %sArchive I/O error. Trying to recover.Archive I/O error, cannot continuePremature end of file on archive readInvalid header, starting valid header search.Unable to append, archive header flawCannot identify format. Searching...Sorry, unable to determine archive format.Write block size of %d too large, maximium is: %dWrite block size of %d larger than POSIX max %d, archive may not be portableWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximium is: %dWrite block size %d is not a %d byte multipleUnable to rewrite archive trailer, cannot append.Cannot append to an archive that may have flaws.Archive read error limit (%d) reachedUnable to append when there are archive read errors.File changed size during read %sFile %s was modified during copy to archiveRead fault on %sActual crc does not match expected crc %sUnable to obtain block size for file %sFile %s changed size during copy to %sFile %s was modified during copy to %sFailed stat of %sFailed write during copy of %s to %sUser specified archive volume byte limit reached.Unable to allocate memory for user id cache tableUnable to allocate memory for group id cache tableUnable to allocate memory for user name cache tableUnable to allocate memory for group name cache tableTRAILER!!!cpio_endwrCpio file name in header is corruptedCpio file name length %d is out of rangeCpio link name is corruptCpio link name read errorCpio link name length is invalid: %qu070707File is too large for cpio format %sCpio header field is too small to store file %scpio_wrUnable to write cpio link name for %sUnable to write cpio header for %s070701070702File is too large for sv4cpio format %sSv4cpio header field is too small for file %svcpio_wrCould not write sv4cpio link name for %sCould not write sv4cpio header for %sFile is too large for bcpio format %sbcpio_wrBcpio header field is too small for file %sCould not write bcpio link name for %sCould not write bcpio header for %sUnable to create %sUnable to close file descriptor on %sA hard link to the directory %s is not allowedUnable to link to %s from %sUnable to copy %s, file would overwrite itselfCould not link to %s from %sUnable to remove %sUnable to link file %s to itselfCould not create: %snode_creatCould not access %s (stat)cannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCould not unlink %sUnable to remove directory %sAccess/modification time set failed on: %sUnable to obtain file stats %sUnable to set file uid/gid of %sCould not set permissions on %sFailed write to file %sOut of memoryFile seek on %sWARNING! Major Internal Error! GNU hack Failing!Failed seek on file %sFile changed size %sset_crcFile %s was modified during readFile rewind failed on: %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:Can't chdir to %sFile system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %sIgnoring too-long pathname: %sIgnoring unterminated pathname at EOFls_list%b %e %H:%M%b %e %Y%s%2u %-*.*s %-*.*s %4lu,%4lu == => %9qu %s%s %s ls_tty%s: unknown option %c %s: %c argument missing bcpiosv4cpiosv4crcustarab:cdf:iklno:p:rs:tuvwx:zB:DE:G:HLPT:U:XYZ0Write limit is not a %d byte multipleInvalid write limit %sError count value must be positiveInvalid block size %sInvalid -p string: %cUnknown -x format: %spax: Known -x formats are:Destination directory was not suppliedb:cef:hmopqruts:vwxzBC:HI:LOPXZ014578/dev/rst0/dev/rst1/dev/rst4/dev/rst5/dev/rst7/dev/rst8Unable to allocate space for option listTAPEProblem with file '%s'Unable to open file '%s' for read-C-Iwrite_opt=nodirabcdfiklmoprstuvzABC:E:F:H:I:LO:SZ6Unknown -H format: %scpio: Known -H formats are:Problem while reading stdin%s: Invalid combination of options: -%cThese format options are not supported %s = %s Invalid option nameInvalid options format [-G group] ... usage: pax [-cdnvzO] [-E limit] [-f archive] [-T [from_date][,to_date]] ... [-s replstr] ... [-U user] ...[pattern ...] pax -r [-cdiknuvzDOYZ] [-E limit] [-f archive] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [pattern ...] pax -w [-dituvzHLOPX] [-b blocksize] [ [-a] [-f archive] ] [-x format] [-B bytes] [-s replstr] ... [-T [from_date][,to_date][/[c][m]]] ... [-o options] ... [-U user] ... pax -r -w [-diklntuvDHLOPXYZ] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [file ...] directory usage: tar [-]{crtux}[-befhmopqsvwzHLOPXZ014578] [blocksize] [archive] [replstr] [-C directory] [-I file] [file ...] usage: cpio -o [-aABcLvVzZ] [-C bytes] [-H format] [-O archive] [-F archive] < name-list [> archive] cpio -i [-bBcdfmnrsStuvVzZ6] [-C bytes] [-E file] [-H format] [-I archive] [-F archive] [pattern...] [< archive] cpio -p [-adlLmuvV] destination-directory < name-list Empty replacement stringrep_addInvalid replacement string %sInvalid replacement string option %s%s while compiling regular expression %sUnable to allocate memory for replacement stringEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern list inconsistentPattern select out of memoryRemoving leading / from absolute path names in the archive ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Processing continues, name changed to: %s tty_renameProcessing continues, name unchanged. Skipping file. File name %s/%s, too longrep_name%s >> %s >> %s Replacement name too long %s >> %sReplacement name error %sTMPDIR/tmp/Cannot allocate memory for temp file name.Can't open current working directory.can not gzip while appendingCpu time limit reached, cleaning up.Signal caught, cleaning up.LC_TIMEUnable to set up signal handlerUser selection table out of memoryUnable to find uid for user: %sUnable to allocate memory for user selection tableGroup selection table out of memoryCannot determine gid for group name: %sUnable to allocate memory fo group selection tableEmpty time range stringUpper %s and lower %s time overlapIllegal upper time range %sTime range format is: [[[[[cc]yy]mm]dd]HH]MM[.SS][/[c][m]]Illegal lower time range %sBad option %c with time range %sUnable to allocate memory for time rangeImproperly specified time range: %sCannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %schk_ftimeFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryFailed ftime table readFailed ftime table seekCannot allocate memory for interactive rename tableNo interactive rename table, links may failInteractive rename table out of memoryCannot update rename tableCannot allocate memory for device mapping tableDevice map table out of memoryUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryUnable to create temporary file for directory times: %sUnable to store mode and times for directory: %sUnable to store mode and times for created directory: %sUnable to set mode and times for created directoriesproc_dirwrite_optnodir%s=%s is only supported when writing.Unknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format optiontar_wrFile name too long for tar %sTar header field is too small for %sFile is too large for tar %sTar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for ustar %sUstar header field is too small for %sustar_wrFile is too long for ustar %sLink name too long for ustar %sUstar cannot archive a socket %s/dev/ttyFatal error, cannot open %s%s: @(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: ping.c,v 1.67 2004/05/03 20:55:46 millert Exp $DI:LRS:c:dfi:l:np:qrs:T:t:vw:number of packets to transmit is %s: %sbad interface address: %stos value is %s: %s%s: only root may use interval < 1sbad timing interval: %spreload value is %s: %spacket size is %s: %sttl value is %s: %smaxwait value is %s: %s-f and -i options are incompatiblebind-R option and -D or -T, or -t to unicast destinations are incompatiblesetsockopt IP_MULTICAST_IFgetsockoptCannot set the receive buffer sizePING %s: %d data bytes ping: recvfromPING %s (%s): %d data bytes Could only allocate a receive buffer of %i bytes (default %i)setsockoptsetsockopt IP_MULTICAST_TTLsetsockopt IP_MULTICAST_LOOPping: record routerecord route not valid to multicast destinationsunknown host: %sping: wrote %s %d chars, ret=%d pingerping: sendtopacket too short (%d bytes) from %s unknown option %x LSRR: 0.0.0.0 (truncated route) %s RR: (same route) NOP%d bytes from %s: icmp_seq=%u ttl=%d wrong data byte #%d should be 0x%x but was 0x%x%x (DUP!) time=%d.%03d ms%d bytes from %s: %ld packets transmitted, %ld packets received, %.1f%% packet lossround-trip min/avg/max/std-dev = %d.%03d/%d.%03d/%d.%03d/%d.%03d ms -- somebody's duplicating packets!%ld duplicates, --- %s ping statistics --- Echo ReplyDestination Net UnreachableDest Unreachable, Unknown Code: %d Destination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF setfrag needed and DF set (MTU %d) Source Route FailedNetwork UnknownHost UnknownSource IsolatedDest. Net Administratively ProhibitedDest. Host Administratively ProhibitedDestination Net Unreachable for TOSDesination Host Unreachable for TOSRoute administratively prohibitedHost Precedence ViolationPrecedence CutoffSource QuenchRedirect Network(New addr: %s) Redirect, Unknown Code: %dRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostUnknown ICMP type: %d Echo RequestRouter Discovery Advertisement(%d entries, lifetime %d seconds) Router Discovery SolicitationTime exceeded, Unknown Code: %d Frag reassembly time exceededTime to live exceededParameter problem, required option absent: pointer = 0x%02x Parameter problem: pointer = 0x%02x TimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask Reply (Mask 0x%08x) Vr HL TOS Len ID Flg off TTL Pro cks Src Dst Data %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x%02x%s (%s)TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xpatterns must be specified as hex digitsusage: ping [-DdfLnqRrv] [-c count] [-I ifaddr] [-i wait] [-l preload] [-p pattern] [-s packetsize] [-T tos] [-t ttl] [-w maxwait] host $OpenBSD: fsutil.c,v 1.13 2003/09/25 04:15:29 deraadt Exp $lost+foundwrong type to dirscan %d DIRECTORY CORRUPTEDNAME=%s fileerror%s=%s DIRLINK COUNT %s COUNT %d SHOULD BE %d (ADJUSTED)ADJUSTLINK COUNT INCREASINGUNREFmkentryUNREF %s (RECONNECTED)SORRY. CANNOT CREATE lost+found DIRECTORYlost+found IS NOT A DIRECTORYREALLOCATElinkupSORRY. CANNOT CREATE lost+found DIRECTORY SORRY. NO lost+found DIRECTORY DIR I=%u CONNECTED. PARENT WAS I=%u SORRY. NO SPACE IN lost+found DIRECTORYNO lost+found DIRECTORYCREATE (CREATED)RECONNECTmakeentryNO SPACE LEFT IN %s (EXPANDED)EXPANDckinodeDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDSiblockPARTIALLY TRUNCATED INODE I=%ublk %d < cgdmin %d; blk + cnt %d > cgsbase %d blk %d >= cgdmin %d; blk + cnt %d > cgdmax %d bad inode number %d to ginode bad inode number %d to nextinode Cannot allocate space for inode buffer cannot increase directory list cannot find inode %d CLEAR (CLEARED) I=%u OWNER=MODE=%o SIZE=%u MTIME=%12.12s %4.4s %d %s I=%uBAD STATE %d TO BLKERR b:dfm:npyAlternate super block location: %d ** lost+found creation mode %o bad mode to -m: %o -%c flag requires a %s checkfilesysCAN'T CHECK FILE SYSTEM.** Phase 1 - Check Blocks and Sizes** Phase 1b - Rescan For More DUPS%d files, %d used, %d free ***** REBOOT NOW ***** ***** PLEASE RERUN FSCK ***** ***** FILE SYSTEM WAS MODIFIED *****The following zero link count inodes remain: %u,The following duplicate blocks remain: %d,%d blocks missing %d files missing ** Phase 5 - Check Cyl groups** Phase 4 - Check Reference Counts** Phase 3 - Check Connectivity** Phase 2 - Check PathnamesINTERNAL ERROR: dups with -p** Root file system** Last Mounted on %s starting Usage: %s [-dfnpy] [-b block] [-c level] [-m mode] filesystem ... INCORRECT BLOCK COUNT I=%u (%d should be %d) (CORRECTED)LINK COUNT TABLE OVERFLOWCONTINUEUNKNOWN FILE TYPE I=%ubad indirect addr: %d bad direct addr: %d bad size %lu ndb %d:HOLD BAD BLOCKbad size %lu:INODE I=%u HAS DTIME=%12.12s %4.4sPARTIALLY ALLOCATED INODE I=%uDUP TABLE OVERFLOW.EXCESSIVE DUP BLKS I=%u (SKIPPING)EXCESSIVE BAD BLKS I=%uBAD STATE %d FOR ROOT INODE DUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYCANNOT ALLOCATE ROOT INODE ROOT INODE UNALLOCATEDALLOCATEpass2MISSING '..'FIXBAD INODE NUMBER FOR '..'DIRECTORY %s: LENGTH %lu NOT MULTIPLE OF %dDIRECTORY TOO SHORTMISSING '.'I OUT OF RANGEREMOVEpass2checkUNALLOCATEDBAD TYPE VALUEIS AN EXTRANEOUS HARD LINK TO DIRECTORY%s %s %s (IGNORED)DUP/BADZERO LENGTH DIRECTORYEXTRA '.' ENTRYEXTRA '..' ENTRYCANNOT FIX, INSUFFICIENT SPACE TO ADD '..' CANNOT FIX, SECOND ENTRY IN DIRECTORY CONTAINS %s BAD TYPE VALUE FOR '..'CANNOT FIX, INSUFFICIENT SPACE TO ADD '.' CANNOT FIX, FIRST ENTRY IN DIRECTORY CONTAINS %s BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'BAD STATE %d FOR INODE I=%d ZERO LENGTHBAD/DUPsummary info for cg %d is %d, %d, %d,should be %d, %d, %d SUMMARY INFORMATIONS WRONG FOR CG #%dBLK(S) MISSING IN BIT MAPS #%dINODE(S) MISSING IN BIT MAPS #%dsummary info bad in superblock: %d, %d should be %d, %d SUPERBLK SUMMARY INFORMATION BADpass5ino_bitmap:ibmap:blk_bitmap:bbmap:BAD STATE %d FOR INODE I=%ld %u: %2x %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. /r%s is not a character device Can't stat %s Can't stat rootmalloc failedrealloc failedstrdup failed%s is not a character device (NO WRITE)cannot allocate space for superblock setupLOOK FOR ALTERNATE SUPERBLOCKSLOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ext2fs(8).SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO FSCK_FFS TO SPECIFY THE%s %s %s %s %s %s USING ALTERNATE SUPERBLOCK AT %d WRONG FPG=%d (BPG=%d) IN SUPERBLOCKBAD SUMMARY INFORMATIONcannot alloc %u bytes for blockmap cannot alloc %u bytes for statemap cannot alloc %u bytes for lncntp cannot alloc %u bytes for inphead cannot alloc %u bytes for typemap IMPOSSIBLE RESERVED BLOCK COUNT=%d IN SUPERBLOCKSET TO DEFAULT** File system is already clean %sile system is clean; not checking ** Fstate = %d NO WRITE ACCESS** %sCan't open %s: %s Can't stat %s: %s MAGIC NUMBER WRONGBAD LOG_BSIZEINCOMPATIBLE FEATURE BITS IN SUPER BLOCKcompat 0x%08x, incompat 0x%08x, compat_ro 0x%08x VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEsuperblock mismatchesoffset %ld, original %ld, alternate %ld BAD SUPER BLOCK: %s %s: NOT LABELED AS A EXT2 FILE SYSTEM (%s) %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION ioctl (GCINFO): %s %s: can't read disk label PARTIALLY WRITING %sZERO'ED BLOCK %d TO DISK bad file type 0%o %s? yes %s? [yn] %s? no INTERNAL ERROR: GOT TO reply()cannot allocate buffer pool deadlocked buffer pool CANNOT %s: BLK %dProgram terminated MARKING FILE SYSTEM CLEAN cache missed %ld of %ld (%d%%) MARK FILE SYSTEM CLEANUPDATE STANDARD SUPERBLOCKSPanic: lost %d buffers READTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %ld (%ld), %ld,SEEKWRITETHE FOLLOWING SECTORS COULD NOT BE WRITTEN:returning to single-user after filesystem checkSALVAGE (SALVAGED)UNKNOWN INODESC FIX MODE %d benstuvusage: %s [-benstuv] [-] [file ...] %6d @(#) Copyright (c) 1983, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: ifconfig.c,v 1.112 2004/08/08 19:04:25 deraadt Exp $,b,baa,b,b,b,b$8a8a8a8gh@`etfl|m|m oo$pp4h`@`HhT0c\0ch0ct0c\clcdd444474`@p$d  4^ 4^_$[,,b4,b< ,bD,bL@,bT,b\pwdwphx|xxy``]ahi i@@ `  (@i ix` ,i i@  'i i@@  ܔ\i i@@    @@``+## ##$ $($0$4%<%D%L%P&X&d'l'x(())**++,,,---.. // 0(040<0H1P1\CdCpDxDEEFFccddee (08@HL|T`hx|  @@ @@ @(@4`<`HLT\dpx T``hp@hp|`T`\7 instance %dmediaopt trailers-trailersarp-arpdebug-debug-aliasdeletegroup-groupnetmaskmetricmtunwidnwkey-nwkeypowersave-powersavepowersavesleepbroadcastipdstprefixlenanycast-anycasttentative-tentativepltimevltimeeui64802.2802.2tr802.3snapEtherIIvlanvlandev-vlandevpass-syncif-syncpeermaxupdgiftunneltunneldeletetunneldestroylink0-link0link1-link1link2-link2mediamediaopt-mediaoptinstanceinsttimeslotdescriptiondescrinetinet6atalkipx-a-ASIOCAIFADDRSIOCDIFADDRencapsulation routing'%s' requires 2 arguments'%s' requires argument-ma-am-mA-Am-minterface name '%s' too longextra address not acceptedSIOCGIFMETRICSIOCGIFFLAGSgetifaddrsstrdup%s: no such interface SIOCIFCREATESIOCIFDESTROYSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namessource and destination address families do not matchinvalid sockaddrSIOCSLIFPHYADDRsettunnelerror in parsing address string: %sSIOCDIFPHYADDRSIOCSIFDESCRNote: trailers are no longer sent, but always receivedsetifflagsSIOCSIFFLAGSinvalid %s %s: %s%s not allowed for the AFinterface index is already filledcould not determine link local addressSIOCSIFMETRICmetric %s: %sSIOCSIFMTUmtu %s: %ssetifgroup: group name too longsetifgroup SIOCAIFGROUPunsetifgroup: group name too longunsetifgroupSIOCDIFGROUPhexadecimal digits too longstrings too longbad hexadecimal digits0x"%.*s"setifnwidSIOCS80211NWIDpersistsetifnwkeySIOCS80211NWKEYpersist:SIOCG80211POWERSIOCS80211POWERsetifpowersavesetifpowersavesleeppowersavesleep %s: %s nwid: nwkey: %d:ieee80211_status powersave: on (%dms sleep) init_current_mediaSGIOCGIFMEDIA%s: no link type?SIOCSIFMEDIAonly one `media' command may be issuedmay not issue `media' after `mediaopt' commandsonly one `mediaopt' command may be issuedmay not issue `mediaopt' after `instance'only one `-mediaopt' command may be issuedmay not issue both `media' and `-mediaopt'only one `instance' command may be issuedmust specify `media' before `instance'media instance %s: %sSIOCSIFTIMESLOTEthernetetherTokenRingtokenFDDIIEEE802.11TDMautoselectmanual10baseT10baseT/UTP10UTP10base210base2/BNC10BNC10base510base5/AUI10AUI100baseTX100TX100baseFX100FX100baseT4100T4100baseVG100VG100baseT2100T21000baseSX1000SX10baseSTPSTP10STP10baseFLFL10FL1000baseLX1000LX1000baseCX1000CX1000baseT1000T1000baseTX1000TXHomePNA1HPNA1DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDIFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72t1t1-amie1-g.704e1-amie1-ami-g.704t3t3-m13e3e3-g.751e3-g.832full-duplexfdxhalf-duplexhdxflag0flag1flag2loopbackhw-loopbackloopEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapibssibss-mastermonitorhdlc-crc16pppframerelay-ansiframerelay-ciscoframerelay-ituunknown %s media subtype: %sunknown %s media option: %smedia physical address inet%s %s --> %s phys_statusno carrieractiveno ringinsertedno networkUPBROADCASTDEBUGLOOPBACKPOINTOPOINTNOTRAILERSRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST media: supported media: status: SIOCGIFMEDIA%s: no media types? description: %s address: %s mtu %lu metric %lu inet %s netmask 0x%x in_statusbroadcast %sSIOCGIFBRDADDR--> %s SIOCGIFDSTADDRSIOCGIFNETMASK inet6 %s prefixlen %din6_alias pltime vltime inftySIOCGIFALIFETIME_IN6 scopeid 0x%x deprecated detached duplicated tentative anycastSIOCGIFAFLAG_IN6SIOCGIFNETMASK_IN6 -> %sSIOCGIFDSTADDR_IN6 AppleTalk %d.%d range %d-%d phase %d broadcast %d.%dat_status--> %d.%dSIOCGIFADDR ns %s SNAP ipx %s frame %s %s: bad valueprefix %s: %s%s=%o%s=%x%u.%u%s: illegal addressAppleTalk does not use netmasks%u-%u%s: illegal net range: %u-%u%s: illegal phase atalk %d.%d range %d-%d phase %d AppleTalk address is not in rangeAttempt to set XNS netmask will be ineffectualAttempt to set IPX netmask will be ineffectualusage: ifconfig interface [address_family] [address [dest_address]] [[-]alias] [[-]arp] [broadcast addr] [[-]debug] [delete] [up] [down] [ipdst addr] [tunnel src_address dest_address] [deletetunnel] [description value] [[-]group group-name] [[-]link0] [[-]link1] [[-]link2] [media type] [[-]mediaopt opts] [instance minst] [mtu value] [metric nhops] [netmask mask] [prefixlen n] [nwid id] [nwkey key] [nwkey persist[:key]] [-nwkey] [[-]powersave] [powersavesleep duration] [[-]anycast] [eui64] [pltime n] [vltime n] [[-]tentative] [vlan vlan_tag vlandev parent_iface] [-vlandev] [vhid n] [advbase n] [advskew n] [maxupd n] [pass passphrase] [state init | backup | master] [syncif iface] [-syncif] [syncpeer peer_address] [-syncpeer] [phase n] [range netrange] [timeslot timeslot_range] [802.2] [802.2tr] [802.3] [snap] [EtherII] ifconfig -A | -Am | -a | -am [address_family] ifconfig -C ifconfig -m interface [address_family] ifconfig interface create ifconfig interface destroy vlan: %d parent interface: %s vlan_statusSIOCGETVLANsetvlantagSIOCSETVLANvlan tag %s: %ssetvlandevmust specify both vlan tag and deviceunsetvlandevBACKUPMASTERgetifgroups groups: SIOCGIFGROUP carp: %s vhid %d advbase %d advskew %d carp_statusSIOCGVHsetcarp_passwdSIOCSVHsetcarp_vhidvhid %s: %ssetcarp_advskewadvskew %s: %ssetcarp_advbaseadvbase %s: %ssetcarp_stateSIOCGETPFSYNCsetpfsync_syncifSIOCSETPFSYNCunsetpfsync_syncifsetpfsync_syncpeeronly IPv4 addresses supported for the syncpeerunsetpfsync_syncpeersetpfsync_maxupdmaxupd %s: %s pfsync: syncif: %s pfsync_statussyncpeer: %s maxupd: %d 1ACFLRSTWacdfghiklmnopqrstuxCOLUMNS%s: %s: %s: directory causes a cyclefts_readdisplay%qu%*s%*qd printlong%3d, %3d %-*s %*qd %*u total %lu %s %*u %-*s %-*s total %llu -> printlink ls: %s: %s %*s usage: %s [-1ACFLRSTWacdfhiklmnopqrstux] [file ...] mainifconfigmake_packetrtsol_check_timerrtsol_timer_updatesockopensendpacketrtsol_inputinterface_upinterface_statuslladdropt_fill)get_llflagprobe_initdefrouter_probesendprobeadDFfailed to open a socketfailed to initilizatoin interfacesselect: %sfailed to setup for probing routersfailed to initialize %skernel is configured as a router, not a hostkernel is configured not to accept RAsadDfFm1memory allocation failedinterface %s was already configuredfailed to get link layer information for %slink-layer address option has null length on %s. Treat as not included.memory allocation failed for %sNew timer is %ld:%08ldthere is no timer%s status is changed from %d to %dNo answer after sending %d RSstimer expiration on %s, state = %dset timer for %s to %d:%dstop timer for %sillegal interface state(%d) on %susage: rtsol [-dDF] interfaces... usage: rtsol [-dDF] -a usage: rtsold [-adDfFm1] interfaces... usage: rtsold [-dDfFm1] -a <%s> %swarnmsgprobing %sreallocmultiple interfaces foundff02::2inet_pton failed for %ssetsockopt(ICMP6_FILTER): %sIPV6_HOPLIMIT: %sIPV6_PKTINFO: %ssocket: %smalloc for send msghdr failedmalloc for receive msghdr failedsend RS on %s, whose state is %dsendmsg on %s: %ssendpacketfailed to get receiving interfacertsol_inputinvalid icmp type(%d) from %s on %sinvalid RA with hop limit(%d) from %s on %sinvalid RA with non link-local source from %s on %sreceived RA from %s on %s, state is %dreceived RA from %s on an unexpeced IF(%s)invalid icmp code(%d) from %s on %spacket size(%d) is too shortfailed to get receiving hop limitrecvmsg: %schecking if %s is ready...interface_up%s is duplicated%s is tentative%s is readyget_llflag() failed, anyway I'll tryioctl(SIOCSIFFLAGS): %sioctl(SIOCGIFFLAGS): %sinterface_statusioctl(SIOCGIFMEDIA) on %s: %sioctl(SIOCGIFFLAGS) on %s: %sunsupported link type(%d)get_llflagioctl(SIOCGIFAFLAG_IN6): %sgetifaddrs: %ssocket(SOCK_DGRAM): %sshutdown: %slo0defrouter_probedefault router list contains a non-link-local address(%s)ioctl(SIOCGDRLST_IN6): %sprobe a router %s on %ssendprobeTTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftinvalid namelen:%d/%luno nameunknown qtyperefused???unknown, type 0x%xrefused, type 0x%x%d bytes from %s, icmp_seq=%u hlim=%d(DUP!) time=%g ms dst=%sfailed to get receiving packet informationa:b:c:dfHg:h:I:i:l:mnNp:qRS:s:tvwW-R is not supported in this configurationinvalid source address: %sinvalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit -- %sillegal hoplimit %stoo small interval, raised to 0.01illegal timing interval %sillegal preload value -- %sMust be superuser to preloaddatalen value too large, maximum is %dillegal datalen value -- %sgetaddrinfo failedsetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_HOPOPTS)setsockopt(IPV6_DSTOPTS)-f and -i incompatible optionsUnable to allocate packetsetsockopt(IPV6_USE_MIN_MTU)setsockopt(ICMP6_FILTER)%s: invalid interface namesetsockopt(SO_SNDBUF)PING6(%lu=40+8+%lu bytes) %s --> new path MTU (%d) is notified recvmsgpollsetsockopt(IPV6_HOPLIMIT)setsockopt(IPV6_PKTINFO)setsockopt(SO_RCVBUF)you need -b to increase socket buffer sizeUDP socketUDP setsockopt(IPV6_PKTOPTIONS)UDP connectgetsocknamecan't initialize rthdrbad addr family of an intermediate addrcan't add an intermediate nodecan't set the last flagcan't allocate enough memorysetsockopt(IPV6_RTHDR)IPV6_MULTICAST_HOPSgateway resolves to multiple addressestoo many intermediate hopsgetaddrinfo for the gateway %s: %sping6: wrote %s %d chars, ret=%d sendmsg\%03odnsdecodeinvalid peernamepr_packunknown code 0x%x, type 0x%xNodeInfo NOOP HbH Options: Routing: Dst Options: -%uNodeInfo Supported Qtypes, compressed bitmap, raw bitmap %s(TTL=%u)pr_nodeaddr(TTL=infty) no address truncated --- %s ping6 statistics --- round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms %.1lf%% packet loss+%ld duplicates, IPv6 addressDNS labelIPv4 addressSuccessRefusedNo Route to Destinationpr_icmphDestination Unreachable, Bad Code: %d Destination Administratively UnreachableDestination Unreachable Beyond ScopePacket too big mtu = %d Time exceeded, Bad Code: %d Parameter problem: Bad code(%d) pointer = 0x%02x Erroneous Header Unrecognized Option Unknown Nextheader Listener QueryListener ReportListener DoneRouter SolicitationRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sBad ICMP type: %dNode Information QueryNOOP, invalid, oldfqdn, subject=%s(%s), no subject, subject=%s(invalid)Supported qtypesDNS namenodeaddrIPv4 nodeaddrNode Information Reply, %sVr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->pr_iphHBH RTHDR FRAG ESPICMP6: type = %d, code = %d Unknown Header(%d) DSTOPT IP6ff02::2:0000:0000nigroupusage: ping6 [-dfHmnNqtvwW] [-a [aAclsg]] [-b sockbufsiz] [-c count] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-h hoplimit] [-g gateway] [hops...] host usage: %s -l or %s [-q] name lq_pckbd_keydesctab_ukbd_keydesctab_akbd_keydesctab_zskbd_keydesctab_sunkbd_keydesctab_sunkbd5_keydesctab_hilkbd_keydesctab_gsckbd_keydesctabpc-xt/pc-atusbadblk201sunsun5hilgscdkfrukjpsvnohuberuuasgsflabrplsinodeaddeclklk401swapctrlcapsdvorakmetaesciopenermachdep/dev/wskbd%dWSKBDIO_GTYPEList not available; sorry.kbd_listunknown encoding %sunknown variant %s%s: unsupported encoding %s on %s WSKBDIO_SETENCODING: %skeyboard mapping set to %s kbd_set?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for dataLESSSECURELESS-E-G-LMOREWARNING: terminal is not fully functionalCannot allocate memoryticdcmsomdmbvbbc|^srget_termraw_modeLESS_TERMCAP_ltget_envLINESlicokrklkukdkPkNkh@7kDTERMhcxndadbNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketseek errorread errorch_ungetchar overrunseek error to 0ESC^%c*s<%X>Non-match First-file EOF-ignore Keep-pos Regex-off (P)+ [Press space to continue, 'q' to quit.]less %sungetcc overflowPattern not found help(N-th) No %snext fileNo %sprevious fileNo such filemark: goto mark: Command not availableBrackets: [Press 'h' for instructions.]Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableeditchar"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)LESSMETAESCAPE\LESSMETACHARS; *? '"()<>|&^`#\%c%s%c%s%s%sHOMEbin_file%s %s %sLESSOPENLESSCLOSE...skipping... Cannot find help fileCannot seek to end of fileCannot seek to beginning of fileCannot seek to line number %nDetermining length of fileDon't know length of fileCannot seek to that file positionLESSANSIENDCHARSplinenum~ Calculating line numbers (press RETURN)Invalid mark letterMark not setMark not in current fileLine number is required after -lless Copyright (C) 2002 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less Tab stops and then every %d spacesopt_x-" must be followed by 1 or 2 charsquotes %sUse "h" for helpThere is no %s option ("less --help" for help)There is no %s optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric option-%sValue is required after %sNumber is required after %sfakeSearch includes displayed screenSearch skips displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by clearing each lineRepaint by painting from top of screenAssume intelligent terminalAssume dumb terminalDon't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesAllow help commandDon't allow help commandCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: Position target at screen line %dDon't display a status columnDisplay a status columnDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numbersprompt: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directlyDisplay control characters directly, processing ANSI sequencesDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linesDisplay underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: Horizontal shift %d positionsUse keypad modeDon't use keypad modeBe less helpful in promptsBe helpful in promptspostoalinenumtoainttoaiprint_intiprint_linenumap_posap_linenumap_intNo previous regular expressionInvalid patternPlease re-enter search patternNothing to searchLine numbers turned offD+P+'\+`+h+t+|++++ 0+6 61$6 ,6@86@611  L6@T6X6d6p6|6bgdumbtimernfsv3rdirplusmntudpresvportnfsv2acacregminacregmaxacdirminacdirmax23a:bcdD:g:I:iL:lo:PpqR:r:sTt:w:x:U-2 and -3 are mutually exclusiveillegal -D value -- %sillegal -I value -- %sillegal -L value -- %sillegal -R value -- %sillegal -a value -- %sconflicting version optionsillegal -r value -- %sillegal -t value -- %sillegal -w value -- %sillegal -x value -- %sNFS Portmapcan't access %s: %snqnfs 2bad MNT RPCCannot MNT PRCcan't resolve address for host %sno : or @ spechostname too long [-R retrycnt] [-r readsize] [-t timeout] [-w writesize] [-x retrans] rhost:path nodeusage: mount_nfs %s %s %s %s [-23PTUbcdilqs] [-a maxreadahead] [-D deadthresh] [-I readdirsize] [-g maxgroups] [-L leaseterm] [-o options]0@DHDPDW\D@hD0@DHDPDW\D@hD0@DHDPDW\D@hD0@DHDPDW\D@hD0@DHDPDW\D@hDunused DOS FAT-12 XENIX / XENIX /usr DOS FAT-16 Extended DOSDOS > 32MB HPFS/QNX/AUXAIX fs AIX/Coherent OS/2 Bootmgr Win95 FAT-32 Win95 FAT32LDOS FAT-16 Extended LBAOPUS OS/2 hidden Compaq Diag.OS/2 hidden OS/2 hidden OS/2 hidden AST swap Willowtech Thinkpad Rec Willowsoft $NEC DOS 8Theos 9Plan 9 @VENIX 286 ALin/Minux DRBLinuxSwap DRCLinux DR MQNX 4.2 Pri NQNX 4.2 Sec OQNX 4.2 Ter PDM QDM RCP/M or SysVSDM TOntrack UEZ-Drive VGolden Bow \Priam aSpeedStor cISC, HURD, *dNetWare 2.xxeNetWare 3.xxfNetWare 386 gNovell hNovell iNovell pDiskSecure uPCIX Minix (old) Minix (new) Linux swap Linux files*OS/2 hidden Linux ext. NT FAT VS NTFS VS Amoeba FS Amoeba BBT Mylex BSDI NotebookSaveFreeBSD OpenBSD NEXTSTEP MacOS X NetBSD MacOS X bootBSDI filesy*BSDI swap CTOS DRDOSs FAT12DRDOSs < 32MDRDOSs >=32MHPFS DisbledCPM/C.DOS/C*Dell Maint SpeedStor SpeedStor SpeedStor BeOS/i386 SpeedStor DOS 3.3+ SecSpeedStor Xenix BBT 0@DHDPDW\D@hDusage: %s [-ieu] [-f mbrboot] [-c cyl -h head -s sect] disk -i: initialize disk with virgin MBR -u: update MBR code, preserve partition table -e: edit MBRs on disk interactively -f: specify non-standard MBR template -chs: specify disk geometry `disk' may be of the forms: sd0 or /dev/rsd0c. /usr/mdec/mbrieuf:c:h:s:Cylinder argument out of range [1..262144].Head argument out of range [1..256].Sector argument out of range [1..63].using builtin MBRCan't get disk geometry, please use [-chs] to specify.Please specify a full geometry with [-chs].BytesSectorsKilobytesMegabytesGigabytesCommand help listShow entire OpenBSD man page for fdiskreinitRe-initialize loaded MBR (to defaults)setpidSet the identifier of a given table entryEdit current drive statsEdit given table entryflagFlag given table entry as bootableUpdate machine code in loaded MBRSelect extended partition table entry MBRPrint loaded MBR partition tableWrite loaded MBR to diskexitExit edit of current MBR, without saving changesQuit edit of current MBR, saving current changesabortAbort program without saving current changes ----------------------------------------------------- ------ ATTENTION - UPDATING MASTER BOOT RECORD ------ ----------------------------------------------------- Do you wish to write new MBR? Do you wish to write new MBR and partition table?USER_initMBR is unchangedEnter 'help' for informationfdisk:%c%d> Aborting changes to current MBR.USER_modifyWriting current MBR to disk.Invalid command '%s'. Try 'help'. Offset: %d USER_print_diskask_cmd%s [%X - %X]: [%X] %s [%d - %d]: [%d] (? for help) ask_num'%d' is out of range. '%s' is not a valid number. %s [n] %s is not a character device or a regular fileDIOCGDINFODISK_getlabelmetricsDisk: %s geometry: %d/%d/%d [%.0f %s] geometry: Signature: 0x%X MBR_pcopyChoose from the following Partition id values:%02X %s %02X %s %02X %s %02X %s Warning CHS values out of bounds only saving LBA values Starting Ending LBA Info:%c%1d: %.2X %4u %3u %2u - %4u %3u %2u [%12u:%12.0f%s] %s #: id C H S - C H S [ start: size ]------------------------------------------------------------------------Start of partition #%d after end!In memory copy is initialized to:Use 'write' to update disk.XreinitChange disk geometry?BIOS CylindersBIOS HeadsBIOS SectorsInvalid argument: %s Invalid partition number.Partition id ('0' to disable) Partition %d is disabled. Do you wish to edit in CHS mode?BIOS Starting cylinderBIOS Starting headBIOS Starting sectorBIOS Ending cylinderBIOS Ending headBIOS Ending sectorLoop to offset 0! Not selected.Selected extended partition %d New MBR at offset %d. Partition %d is not an extended partition. Writing MBR at offset %d. Xwrite %s %s Machine code updated.Partition %d marked active. (standard input)(fd %d)invalid file type^%s[[:<:]]%.*s[[:>:]]%susage: %s [-AB num] [-CEFGHILPRSUVabchilnoqsvwx] [--context[=num]] [--binary-files=value] [--line-buffered] [-e pattern] [-f file] [pattern] [file ...] 0123456789A:B:CEFGHILPSRUVabce:f:hilnoqrsuvwxybinary-filesmmapline-bufferedafter-contextbefore-contextextended-regexpfixed-stringsbasic-regexpbinarybyte-offsetregexpno-filenameignore-casefiles-without-matchfiles-with-matchesline-numberquietsilentrecursiveno-messagesrevert-matchword-regexpline-regexpunix-byte-offsetscontext out of rangegrep version %u.%u without-matchUnknown binary-files optionBinary file %s matches [[:<:]][[:>:]]%lldaFfh:t:v%s: not a directory or special deviceumountfsBad MNT RPC%s: unmount from %s %s: not currently mountedusage: %s %s umount [-fv] [-t fstypelist] special | nodeumount -a[fv] [-h host] [-t fstypelist]D+P+'\+`+h+t+|++++ +Gsl9xu:g:m:o:not an MSDOS filesystemstat %sunknown group id: %sunknown user id: %sinvalid file mode: %susage: mount_msdos [-o options] [-u user] [-g group] [-m mask] bdev dir mkfifom:invalid file mode.non-numeric major number.non-numeric minor number.major or minor number too largenode must be type 'b' or 'c'.usage: %s [-m mode] fifoname ... usage: %s [-m mode] name [b | c] major minor usage: %s [-m mode] name p @(#) Copyright (c) 1997, 1998, 1999 Bill Paul. All rights reserved.@(#) $OpenBSD: wicontrol.c,v 1.54 2004/08/25 17:16:44 mickey Exp $ W4WHWhWWWWWWW X ,X DX DX DXDXXXXXXXXXtXtXtXtXXXXX!X"X#X$X&XESSIBSSPOLLABLEPOLLREQPRIVACYSHORT_PREAMBLEPBCC8CHNL_AGILITY%d station%s: %02x:%02x:%02x:%02x:%02x:%02x asid=%04x, flagsAUTHASSOCPERM, capsLucent WaveLAN/IEEESony WaveLAN/IEEELucent Embedded WaveLAN/IEEEPRISM2 HFA3841(EVB2)PRISM2 HWB3763 rev.BPRISM2 HWB3163 rev.APRISM2 HWB3163 rev.BPRISM2 HFA3842(EVB3)PRISM1 HWB1153PRISM2 HWB3163 SST-flashPRISM2 HWB3163(EVB2) SST-flashPRISM2 HFA3842(EVAL)PRISM2.5 ISL3873PRISM2.5 ISL3874A(Mini-PCI)PRISM2.5 ISL3874A(PCI-bridge)PRISM3 ISL37300PPRISM3 ISL37300P(PCI)PRISM3 (USB)SIOCGWAVELAN (0x%x)wi_getvalwi_setvalSIOCSWAVELAN[ %s ]must specify stringstring too longmust specify addressbadly formatted addressno WEP option available on this cardencryption key must be no more than 13 characters longonly 4 encryption keys availableencryption key must be no more than 26 hex digits long[ 0xUnknown Lucent chipUnknown PRISM chip[ %s, Firmware %d.%02d variant %d ][ %s, Firmware %d.%d.%d ][ On ][ Off ][ Firmware WEP ][ Software WEP ][ Unknown ]AP Informationap[%d]: netname (SSID): [ %s ] BSSID: [ %02x:%02x:%02x:%02x:%02x:%02x ] Channel: [ %d ] Beacon Interval: [ %d ] Quality/Signal/Noise [signal]: [ %d / %d / %d ] DataRate [Mbps]: [ %2.1f ] AvailableRates [Mbps]: [ %d.%d Capinfo: [ PRIV IBSS ESS [dBm]: [ %d / %d / %d ] NIC serial number: Station name: SSID for IBSS creation: Current netname (SSID): Desired netname (SSID): Current BSSID: Channel list: IBSS channel: Current channel: Comms quality/signal/noise: Promiscuous mode: Process 802.11b Frame: Port type (1=BSS, 3=ad-hoc, 6=Host AP): MAC address: TX rate (selection): TX rate (actual speed): Maximum data length: RTS/CTS handshake threshold: Create IBSS: Antenna diversity (0=auto,1=pri,2=aux): Microwave oven robustness: Roaming mode(1=firm,3=disable): Access point density: Power Management: Max sleep time: Enhanced Security mode: Intersil Prism2-based card: Card info: Encryption: Encryption algorithm: Authentication type (1=OpenSys, 2=Shared Key): TX encryption key: Encryption keys: Transmitted unicast frames: %u Transmitted multicast frames: %u Transmitted fragments: %u Transmitted unicast octets: %u Transmitted multicast octets: %u Single transmit retries: %u Multiple transmit retries: %u Transmit retry limit exceeded: %u Transmit discards: %u Transmit discards due to wrong SA: %u Received unicast frames: %u Received multicast frames: %u Received fragments: %u Received unicast octets: %u Received multicast octets: %u Receive FCS errors: %u Receive discards due to no buffer: %u Can't decrypt WEP frame: %u Received message fragments: %u Received message bad fragments: %u , rates1M2M5.5M11M, sig=%d/%dwi_dumpstationsSIOCHOSTAP_GETALLusage: %s [interface] [-olL] [-t tx rate] [-n network name] [-s station name] [-e 0|1] [-k key [-v 1|2|3|4]] [-T 1|2|3|4] [-x 0|1] [-F 0|1] [-c 0|1] [-q SSID] [-p port type] [-a access point density] [-m MAC address] [-d max data length] [-r RTS threshold] [-f frequency] [-M 0|1] [-P 0|1] [-S max sleep duration] [-A 1|2|3] [-D 0|1|2] [-R 1|3] [-E 0|1|2|3] wi0a:c:d:e:f:hi:k:lm:n:op:q:r:s:t:v:x:A:D:E:F:LM:S:P:R:T:get_if_flagsset_if_flagsbssad-hocunknown port type %s@(#) Copyright (c) 1983, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: route.c,v 1.73 2004/09/07 10:14:43 markus Exp $$OpenBSD: show.c,v 1.33 2004/07/05 02:19:03 pvalchev Exp $UGHRBD M@dmCXLS1@2 3cs0123456789abcdefassuming route to if old usage of trailing 0entry in usenot in tablerouting table overflow: gateway %s (%s): source %sold usage of trailing digit, assuming route via gatewaynetmask missingroute: botched keyword: %s usage: route [ -nqSv ] cmd [[ - ] args ] keywords: get, add, change, delete, show, flush, monitor. route: nqdtvS/dev/null%-20.20s doneroute: write to routing socket: %s got only %d for rlen Examining routing table from sysctl(address family %s) actual retrieval of routing tableroute-sysctl-estimatemust be root to alter routing tableinet6_makenetandmask128internal error%s: resolved to multiple values %s: bad value %s: bad address%s: not a network%d: bad address familyprefixlen is not supported with af %d actual retrieval of interface tablegot message of size %d on %sroute: read from routing socket: %s writing to routing socketso_labelso_srcmaskso_srcso_ifaso_ifpso_genmaskso_maskso_gateso_dstRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics or flagsRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_RESOLVE: Route created by cloningRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_IFINFO: iface status changeRTM_IFANNOUNCE: iface arrival/departurerouting message version %d not understood %s: len %d, if# %d, link: %s, flags:pid: %ld, seq %d, errno %d, flags:metric %d, flags:if# %d, name %s, what: departurearrival route to: %s destination: %s mask: %s source: %s interface: %.*s flags: label: %s recvpipe sendpipe ssthresh rtt,msec rttvar hopcount mtu expire%8d%c %8d%c sockaddrs: gateway: %s RTM_GET: %s (errno %d) message length mismatch, in packet %d, returned %d locks: inits: sockaddrs: %s: link %s; sodump%s: inet %s; %s: ipx %s; %s: inet6 %s; label too longRouting tablessysctl of routing tableout of spaceGatewayFlagsRefsUseMtuInterfaceSource%-*.*s %-*.*s %-*.*s %-6.6s %6.6s %8.8s %6.6s %s %-*.*s %-*.*s %-6.6s %6.6s %8.8s %6.6s %s PortProtoSA(Address/Proto/Type/Direction)%-18s %-5s %-18s %-5s %-5s %-22s %-*.*s Address%-6.6s %6d %8ld %6ld %6s %.16sp_rtentryInternet Protocol Family %d: XNSX.25AppleTalkIPXInternet6Encapp_flagsroutename(%d) %s%u.%u.%u/%d%u.%u.%u.%u/%d%u.%u/%d%u/%d%s/%dnetname6illegal prefixlen af %d: %s*.**.0x%XHany%XH.%s%s.%XH%02X%02X%02X%02X%02X%02XHlink#%dblackholecloningdstexpiregatewaygenmaskhopcountifaifplinkllinfolockrestmpathnostaticosiproto1proto2recvpiperejectrttrttvarsasendpipeshowsrcsrcmaskssthreshstaticx25xresolve KMGTPimagetenexusage: %s [ | Using %s mode to transfer files. %s: unknown mode. TYPE %s %sTYPE %sinternal error: unknown type %d.We only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. local-fileremote-fileusage: %s local-file [ remote-file ] APPESTORSTOUlocal-filesusage: %s local-files Continue withmput%s: not foundr+wusage: %s remote-file [ local-file ] local: %sRETRgetitremote-filesusage: %s remote-files mgetand logged inConnected %sto %s. Not connected. Connected for proxy commands to %s. No proxy connection. (none)Gate ftp: %s, server %s, port %s. Passive mode: %s. Mode: %s; Type: %s; Form: %s; Structure: %s. Verbose: %s; Bell: %s; Prompting: %s; Globbing: %s. Store unique: %s; Receive unique: %s. Preserve modification times: %s. Case: %s; CR stripping: %s. Ntrans: (in) %s (out) %s Ntrans: off. Nmap: (in) %s (out) %s Nmap: off. Hash mark printing: %s; Mark count: %d; Progress bar: %s. Use of PORT/LPRT cmds: %s. (disabled for this connection)Use of EPSV/EPRT cmds for IPv4: %s%s. Macros: usage: %s [ on | off ] %s %s. Bell modeEPSV/EPRT on IPv4Packet tracingusage: %s [ on | off | bytecount ] %s: bad bytecount value. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeusage: %s [ on | off | gateserver [ port ] ] Disabling gate-ftp mode - no gate-ftp server defined. GlobbingPreserve modification timesusage: %s [ on | off | debuglevel ] %s: bad debugging value. Debugging %s (debug=%d). remote-directoryusage: %s remote-directory CWD %sCWD command not recognized, trying XCWD. XCWD %susage: %s local-directory Local directory now %s getcwd: %slcdDELE %susage: %s remote-file mdeletefrom-nameto-nameRNFR %susage: %s from-name to-name RNTO %susage: %s remote-directory local-file nlistLISTNLSToutput to local-file:usage: %s remote-files local-file Try again latershellusernameusage: %s username [password] [account] USER %sPassword: PASS %sAccount: ACCT %sLogin failed. PWDPWD command not recognized, trying XPWD. XPWDLocal directory %s getcwdlpwddirectory-nameMKD %susage: %s directory-name MKD command not recognized, trying XMKD. XMKD %sRMD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendusage: %s line-to-send arguments to SITE commandSITEquote1SITE CHMOD %s %susage: %s mode file-name SITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITusage: %s [password] Account:usage: %s command ?Ambiguous command. ?Invalid command. ?Invalid proxy command. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutusage: %s [mapin mapout] nmap: unbalanced brackets. Passive modeStore uniqueReceive uniqueCDUPCDUP command not recognized, trying XCUP. XCUPrestart: offset not specified. restart: invalid offset. Restarting at %lld. Execute get, put or append to initiate transfer SYSTLimit of 16 macros have already been defined. macro nameusage: %s macro_name Enter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4K buffer exceeded. usage: %s filename %s %lld %s %sSTAT %sSTATLocal file "%s" is newer than remote file "%s". |%sCan't allocate memory for $PAGERaccountbellbyecasecdupclosedisconnectepsv4formgateglobhashidlemacdefmdirmlsmodtimemsendnewernmapntranspagepassivepreserveprogresspromptpwdquoterecvregetresetrestartrhelprmdirrstatusruniquesendportsitestructsuniquetraceumaskverbose'%s' macro not found. domacroRetrieving %s/%s auto_fetchExtra `@' characters in usernames and passwords should be encoded as %%40Can't allocate memory to parse URLhttp://ftp://url_get: Invalid URL '%s'Invalid URL (no `/' after host): %sInvalid URL (no file after host): %sInvalid URL (no file after directory): %sCan't allocate memory for proxy URL.Malformed proxy URL: %sCan't open file %sReading from filehost %s, port %s, path %s, save as %s. (unknown)Trying %s... r+Requesting %s (via %s) GET %s HTTP/1.0 %s User-Agent: OpenBSD ftpRequesting %s Can't allocate memory.GET /%s HTTP/1.0 Host: [%s]:%s %s GET /%s HTTP/1.0 Host: [%s] %s GET /%s HTTP/1.0 Host: %s:%s %s GET /%s HTTP/1.0 Host: %s %s Writing HTTP requestreceived '%s' 301302200Error retrieving file: %sContent-Length: Location: Redirected to %s Can't open %sCan't allocate memory for transfer bufferReading from socketRead short file. Successfully retrieved file. Auto-login using ftp URLs isn't supported when using $ftp_proxyReceiving HTTP replyWriting %sImproper response from %surl_get http fetch aborted. file fetch aborted. ftp_proxyhttp_proxyCan't allocate memory for auto-fetch.Invalid URL: %suser %s:%s host %s port %s dir %s file %s Can't connect or login to host `%s'*?[]{}Can't allocate memory for URL decoding:/ftpgatehttp%s: bad port number `%s'connect to address %ssetsockopt TOS (ignored)fdopen failed.Connected to %s. hookup---> PASS PASS XXXXACCT ACCT XXXXNo control connection for command.%c%c%c421 Service not available, remote server has closed connection. getreply send aborted waiting for remote to finish abort. sentlocal: %s remote: %s %s: not a plain file. REST %ldnetoutsendrequest receive aborted waiting for remote to finish abort. receivednetin%s: short writeWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %suse of scoped address can be troublesomesetsockopt (ignored)EPSVwrong server: return code must be 229 disabling epsv4 for this connection PASVLPSVPassive mode refused. wrong server: return code must be 227 %u,%u,%u,%u,%u,%uwrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode AF mismatch. Shouldn't happen! %c%c%c%d%cparse error! setsockopt (reuse address)setsockopt IP_PORTRANGE (ignored)setsockopt IPV6_PORTRANGE (ignored)listenEPRT |%d|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dinitconnacceptdataconnproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s runique: can't find unique file name. Lost control connection for abort.%cABOR abort_remoteNeither $FTPSERVER nor $GATE_SERVER is defined; disabling gate-ftpdumbemacssu-r requires numeric argument46Aadegimno:pP:r:tvVRetrying... FTPSERVERPORTFTPMODEunknown FTPMODE: %s. Using defaultsgate-ftpFTPSERVERftp> sorry, input line too long. Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous help command %s ?Invalid help command %s %-*s %s usage: %s [-46AadegimnptVv] [-P port] [-r seconds] [host [port]] %s [-o output] ftp://[user:password@]host[:port]/file[/] %s [-o output] http://host[:port]/file %s [-o output] host:[/path/]file[/] anonymous4K macro buffer exceeded. Unknown .netrc keyword %sError: .netrc file is readable by others.Remove account or make file unreadable by others.Missing macdef name argument. Macro definition missing null line terminator. Remove password or make file unreadable by others.ruserpasspasswordmachine%s/.netrc: %s%s/.netrcstringlist|%.*s%*s| %5lld %c%c %2d:%02d:%02d --:-- ETA - stalled -%02d:%02d ETAprogressmeterAlready connected to %s, use close first. usage: %s host-name [port] gateserver not defined (shouldn't happen)PASSERVE %sConnected via pass-through server %s non-printstreamRemote system type is %s. 215 UNIX Type: L8215 TOPS20Remember to set tenex mode when transferring binary files from this machine. %s@Name (%s): Name (%s:%s): Password:Login failed.$initftp_loginsorry, arguments too long. (%s) unable to create temporary file: %sftpXXXXXXXXXXunable to create temporary file %scan't find list of remote files, oops.can't find list of remote files, oops. remglob%s %s? n, y, p, a, are the only acceptable commands! Interactive mode: off. Prompting off for duration of %s. confirmSIZE %sMDTM %s191Y2K warning! Fixed incorrect time-val received from server. %*s %04d%02d%02d%02d%02d%02dCan't convert %s to a time. %3d%% *************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************%lld byte%s %s in %.2f seconds (%.2f %sB/s) ETA: %02d:%02d:%02d ptransferD+P+'\+`+h+t+|++++ /@+0/reloadfilesystem must be mounted read-only; you may need to run fsckusage: mount_ffs [-o options] special node mediumreason/etc/dhclient.confalias_routehandlerc:dl:qucallocInterface name too long%s.%s/var/db/dhclient.leasesasprintf%s: no link giving up got link cannot open %s: %m_dhcpno such user: _dhcp, falling back to "nobody"nobodyno such user: nobodycan't open and lock %s: %mPREINITAF_ROUTE/var/empty/chrootchdir("/")can't drop privileges: %musage: %s [-dqu] [-c conffile] [-l leasefile] interface ARPCHECKcheck_DHCPACK from %spacket_to_lease failed.BOUNDRENEWREBINDREBOOTold_new_bound to %s -- renewal in %d seconds.BOOTREPLY from %s rejected.DHCPOFFERDHCPNACKDHCPACK%s from %s rejected.BOOTREPLY%s from %s%s isn't satisfactory.%s already seen.ARPSENDdhcpoffer: no memory to record lease.dhcpoffer: no memory for server name.Bogus server name %sdhcpoffer: no memory for filename.dhcpoffer: no memory for option %dInvalid lease option - ignoring offerDHCPNAK from %sDHCPNAK with no active lease. Trying medium "%s" %dMEDIUMDHCPDISCOVER on %s to %s port %d interval %dNo DHCPOFFERS received.Trying recorded lease %sTIMEOUTbound: renewal in %d seconds.bound: immediate renewal.No working leases in persistent database - sleeping. EXPIREDHCPREQUEST on %s to %s port %dsend_requestDHCPDECLINE on %s to %s port %dcan't create %s: %mlease { bootp; interface "%s"; fixed-address %s; filename "%s"; server-name "%s"; medium "%s"; option %s %s; renew %d %d/%d/%d %02d:%02d:%02d; rebind %d %d/%d/%d %02d:%02d:%02d; expire %d %d/%d/%d %02d:%02d:%02d; } buf_open: %mbuf_add: %mbuf_close: %mscript_init: no memory for environmentPATH=/usr/bin:/usr/sbin:/bin:/sbinip_addressnetwork_numberbroadcast_addressserver_nameprepend optionappend optionno space to %s %sexpirypriv_script_write_paramsunexpected msg type %ureceived corrupted messageREASON=NBIfork: %mwait: %mexecve (%s, ...): %mpriv_script_goscript_set_env: no memory for variablescript_set_env: no memory for variable assignmentillegal character (%c) in value '%s'%s%s=%sdaemonInvalid IP address in option: %sBogus Host Name option %d: %s (%s)unknown dhcp option value 0x%xoption_as_string: bad code %d dhcp option too largecannot fork%s [priv]poll errorno memory for client state.no memory for client config.Corrupt lease file - possible data loss!not allowed here.hardware address parameter %snested interface declaration.expecting a statement.semicolon expected.expecting string or hexadecimal datastring constant too long.expecting hexadecimal constant.hexadecimal constant too long.expected option name.expecting semicolon.%s: unexpected option name.%s: too many options.expecting interface name (in quotes).expecting left brace.unterminated interface declaration.Insufficient memory to record interface %sno memory for state on %s no memory for config for %s no memory for lease. unterminated lease declaration.expecting lease declaration.expecting identifier after option keyword.no memory for vendor information.expecting identifier after '.'no vendor named %s.no option named %sno option named %s for vendor %sexpecting number.expecting identifier.truefalseexpecting boolean.Bad format %c in parse_option_param.expecting string.option data buffer %soption data buffer overflowout of memory allocating option data.parse_option_declExpecting media options.no memory for string list entry.no memory for reject list!parse_reject_statementexpecting IP address.getifaddrs failedno space to remember ifpdiscover_interfacesCan't allocate poll structures.No live interfaces to poll on - exiting.poll: %mreceive_packet failed on %s: %sInterface %s no longer appears valid.got_oneioctl(SIOCGIFFLAGS) on %s: %mioctl(SIOCGIFMEDIA) on %s: %mCan't allocate timeout structure!can't allocate protocol struct for %sCan't create socketinterface_link_statusCan't add %s to hash table./dev/bpf%dCan't find free bpf: %mCan't attach interface %s to bpf device %s: %mif_register_bpfCan't get BPF version: %mKernel BPF version out of range - recompile dhcpd!Can't set immediate mode on bpf device: %mCan't get bpf buffer length: %mCan't allocate %lu bytes for bpf input buffer.Can't install packet filter program: %mCan't install write filter program: %mCannot lock bpfsend_packet: %msend_packetcSclarger than bufferoption %s (%d) %s.Many bogus options seen in offers. Taking this offer in spite of bogus options - hope for the best!rejecting bogus offer.Can't allocate storage for option %s.Can't expand storage for option %s.cons_optionspretty_print_option: bad code %d %s: Excess information in format string: %s%s: garbage in format string: %s%s: expecting at least %d bytes; got %d%s: %d extra bytes%s: %d extra bytes at end of arrayUnexpected format code %cpretty_print_optionDiscarding packet with invalid hlen.do_packetno memory for cons.eof in string constantstring constant larger than internal buffernumeric token larger than internal bufferlways-reply-rfc1048llowbandoneduthoritativeackoff-cutoffootingoot-unknown-clientslassiaddrlient-identifierlient-hostnameomainenyefaultynamic-bootp-lease-cutoff-lease-lengththernetxpireixed-addressddiet-lease-hostnamesardwarenitial-intervalnterfaceax-lease-timeediameserveretmaskext-serverne-lease-per-clientrependequestequireetryenewebindeboottartsubnethared-networkerver-nameerver-identifierelect-timeoutcriptupersedeimestampoken-ring-host-decl-names-lease-addr-for-default-routenknown-clientsendor-classexiting. %s line %d: %s%s^^ subnet_numberbroadcast_addraddr_eqpiaddr%d bad IP checksums seen in %d packetsip length %d disagrees with bytes received %d.%d udp packets in %d too long - droppedaccepting packet with data after udp payload.%d bad udp checksums in %d packetssubnet-masktime-offsetIAtime-serversien116-name-serversdomain-name-serverslog-serverscookie-serverslpr-serversimpress-serversresource-location-servershost-nameboot-sizemerit-dumpdomain-nameswap-serverroot-pathextensions-pathip-forwardingnon-local-source-routingpolicy-filterIIAmax-dgram-reassemblydefault-ip-ttlpath-mtu-aging-timeoutpath-mtu-plateau-tableSAinterface-mtuall-subnets-localbroadcast-addressperform-mask-discoverymask-supplierrouter-discoveryrouter-solicitation-addressstatic-routestrailer-encapsulationarp-cache-timeoutieee802-3-encapsulationdefault-tcp-ttltcp-keepalive-intervaltcp-keepalive-garbagenis-domainnis-serversntp-serversvendor-encapsulated-optionsnetbios-name-serversnetbios-dd-servernetbios-node-typenetbios-scopefont-serversx-display-managerdhcp-requested-addressdhcp-lease-timedhcp-option-overloaddhcp-message-typedhcp-server-identifierdhcp-parameter-request-listBAdhcp-messagedhcp-max-message-sizedhcp-renewal-timedhcp-rebinding-timedhcp-class-identifierdhcp-client-identifieroption-62option-63nisplus-domainnisplus-serverstftp-server-namebootfile-namemobile-ip-home-agentsmtp-serverpop-servernntp-serverwww-serverfinger-serverirc-serverstreettalk-serverstreettalk-directory-assistance-serveruser-classoption-78option-79option-80option-81option-82option-83option-84nds-serversnds-tree-namends-contextoption-88option-89option-90option-91option-92option-93option-94option-95option-96option-97option-98option-99option-100option-101option-102option-103option-104option-105option-106option-107option-108option-109option-110option-111option-112option-113option-114option-115option-116option-117option-118option-119option-120option-121option-122option-123option-124option-125option-126option-127option-128option-129option-130option-131option-132option-133option-134option-135option-136option-137option-138option-139option-140option-141option-142option-143option-144option-145option-146option-147option-148option-149option-150option-151option-152option-153option-154option-155option-156option-157option-158option-159option-160option-161option-162option-163option-164option-165option-166option-167option-168option-169option-170option-171option-172option-173option-174option-175option-176option-177option-178option-179option-180option-181option-182option-183option-184option-185option-186option-187option-188option-189option-190option-191option-192option-193option-194option-195option-196option-197option-198option-199option-200option-201option-202option-203option-204option-205option-206option-207option-208option-209option-210option-211option-212option-213option-214option-215option-216option-217option-218option-219option-220option-221option-222option-223option-224option-225option-226option-227option-228option-229option-230option-231option-232option-233option-234option-235option-236option-237option-238option-239option-240option-241option-242option-243option-244option-245option-246option-247option-248option-249option-250option-251option-252option-253option-254option-endpaddhcpCan't allocate dhcp option hash table.value %s%o exceeds max (%d) for precision.value %s%x exceeds max (%d) for precision.value %s%u exceeds max (%d) for precision.Unexpected integer size: %dfilename must be a stringno memory for string %s.expecting a network hardware typehardware address too longExpecting numeric lease timecan't allocate space for numeric aggregateunexpected end of fileexpecting numeric value.too few numbers.no temp space for number.can't allocate space for numeric aggregate.Bogus number: %s: digit %d not in base %dBogus number: %s.numeric day of week expected.numeric year expected.expected slash separating year from month.numeric month expected.expected slash separating month from day.numeric day of month expected.numeric hour expected.expected colon separating hour from minute.numeric minute expected.short write: wanted %lu got %ld bytesconnection closedbuf_read: %mshort read: wanted %lu got %ld bytescorrupted message receivedreceived unknown message, code %ddispatch_imsg/etc/rcWARNING: some process(es) wouldn't die(can't restart init): SIGTERM processes/dev/consolesetsidrevokeSIGTSTP inithalted (with powerdown) by %shalted by %srebooted by %sdlnpq~usage: %s [-dn%sq] cannot read temp filecannot seek temp fileline too longcannot write temp fileinvalid address/tmp/ed.XXXXXXXXXXw+cannot open temp filecannot close temp fileEnter key: get_keywordbad hex digit in keybad binary digit in keydes_setkeydes_ciphercbc_decodedecryption failed (block corrupted)decryption failed (incomplete block)cannot read fileinvalid pattern delimiter& no previous commandunexpected end-of-filecannot close input filecannot open input file%lu newline inserted newline appended cannot read input filecannot close output filecannot open output filecannot write filecannot read stdin \abfnrtv\\ warning: file modifiedinvalid filename@(#) Copyright (c) 1993 Andrew Moore, Talke Studio. All rights reserved. usage: %s [-] [-sx] [-p string] [name] p:sx ? interrupt? script, line %d: %s number out of rangeinvalid redirectioninvalid destinationno previous substitutiondestination expectedcannot nest global commandsno current filenameunexpected command suffixinvalid command suffixunexpected addressno matchfilename too longshell access restrictedinvalid mark charactered.hup/ed.hupno previous patterntrailing backslash (\)unbalanced brackets ([])infinite substitution loopnothing to undoHLPRfiprthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s%s: name too long (not copied)cannot overwrite directory %s with non-directory %s%s is a directory (not copied).%s and %s are identical (not copied).overwrite %s? readlink: %sunlink: %scopy_linksymlink: %smkfifo: %smknod: %schown: %schflags: %sutimes: %slchown: %susage: %s [-R [-H | -L | -P]] [-fip] src target %s [-R [-H | -L | -P]] [-fip] src1 ... srcN directory <DḢp `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @      inflate 1.2.1 Copyright 1995-2003 Mark Adler  #+3;CScsLB !1Aa  0@`@@8HD D%s not a regular file%s%s already has %s suffix -- unchanged/dev/stdout%s: unknown suffix: ignored%s%s: name too long%s: input: %soutput: %sdeflate.gzzcatzipunknown program nameGZIPGZIP is too longoption -a is ignored on this systemillegal bit count -- %s-o argument is too long123456789ab:cdfghlLnNOo:qrS:tvV/dev/stdin-o option may only be used with a single input filemay not mix -o, -c, or -t options%s is a directory: ignored: unchanged%s: won't write compressed data to terminalfile would grow; left unmodified docompress%s: won't read compressed data from terminal%s: unrecognized file formatcrc errordodecompressZgzztgztaz.-_method crc date time compressed uncompressed ratio uncompressed_name%-7.7s %08x %s %10lld %10lld %4.1f%% %s %10lld %10lld %4.1f%% (totals) OK %4.1f%% -- replaced with %s %lld bytes in, %lld bytes out usage: %s [-cdfghOqrtvV] [-b bits] [-S suffix] [-[1-9]] [file ...] 1.2.1put_headerfile errorstream errordata errorinsufficient memorybuffer errorincompatible versionneed dictionarystream endHLPRXfghorstuwxinvalid flags: %sinvalid flag: %sthe -R and -h options may not be specified together.%s: invalid user name%s: invalid group nameusage: %s [-R [-H | -L | -P]] %s file ... [owner][:group]usage: %s [-R [-H | -L | -P]] [-f] [-h] %s file ... $OpenBSD: dir.c,v 1.17 2004/07/05 02:31:54 pvalchev Exp $$OpenBSD: inode.c,v 1.26 2003/10/11 01:43:45 tedu Exp $@(#) Copyright (c) 1980, 1986, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: main.c,v 1.25 2003/06/02 20:06:15 millert Exp $$OpenBSD: pass1.c,v 1.15 2003/10/11 01:43:45 tedu Exp $$OpenBSD: pass1b.c,v 1.9 2003/08/25 23:28:15 tedu Exp $$OpenBSD: pass2.c,v 1.19 2003/10/11 01:43:45 tedu Exp $$OpenBSD: pass3.c,v 1.8 2003/06/02 20:06:15 millert Exp $$OpenBSD: pass4.c,v 1.10 2003/10/11 01:43:45 tedu Exp $$OpenBSD: pass5.c,v 1.17 2003/10/11 01:43:45 tedu Exp $$OpenBSD: fsutil.c,v 1.13 2003/09/25 04:15:29 deraadt Exp $$OpenBSD: setup.c,v 1.21 2003/09/25 04:19:39 deraadt Exp $$OpenBSD: utilities.c,v 1.20 2003/08/25 23:28:15 tedu Exp $?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@dirscanexpanddir blk + cnt %d > sblock.fs_fpg %d cannot allocate memory for inode cache cannot increase directory listSIZE=%llu CG %d: BAD MAGIC NUMBER dfpnNyYb:c:l:m:conversion levelusage: %s -p [-f] [-m mode] %s [-f] [-b block#] [-c level] [-y] [-n] [-m mode] [filesystem] ... %d files, %d used, %d free (%d frags, %d blocks, %d.%d%% fragmentation) phase 1, inode %d/%dcheckinodebad size %llu:convert symlink %d(%s) of size %llu bad size %llu ndb %d:cannot read symlink phase 1b, inode %d/%dphase 2, directory %d/%dphase 2, parent directory %d/%d%s %s: LENGTH %ld NOT MULTIPLE of %d%s %s: LENGTH %ld NOT MULTIPLE OF %d (REMOVED)BAD WHITEOUT ENTRYphase 3, directory %d/%ldphase 4, inode %d/%dphase 5, cg %d/%dCREATCANNOT %s CLUSTER MAPS SUMMARY INFORMATION BADBLK(S) MISSING IN BIT MAPSALLOCATED FRAG %ld MARKED FREE ALLOCATED INODE %ld MARKED FREE FREE BLK COUNT(S) WRONG IN SUPERBLKCREATE CLUSTER MAPS%sING CLUSTER MAPS DELETING CLUSTERING MAPS DELETE CLUSTERING MAPSUNKNOWN ROTATIONAL TABLE FORMAT %d INFORMATION; SEE fsck_ffs(8).IMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED)IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=%x IN SUPERBLOCKINCORRECT FMASK=%x IN SUPERBLOCKINCORRECT MAXFILESIZE=%llu IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%lx IN SUPERBLOCKINCORRECT QFMASK=%lx IN SUPERBLOCKcannot alloc %u bytes for cylinder group summary area cannot alloc %lu bytes for lncntp cannot alloc %lu bytes for inphead CONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATIMPOSSIBLE MINFREE=%d IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKclean = %d CPG OUT OF RANGENCYL LESS THAN NCG*CPGSIZE PREPOSTEROUSLY LARGEoffset %d, original %ld, alternate %ld NCG OUT OF RANGE%s: NOT LABELED AS A BSD FILE SYSTEM (%s) UPDATE STANDARD SUPERBLOCKreturning to single-user after filesystem check catchquitcatchinfoffs_isblockffs_clrblockffs_setblockffs_isfreeblock   init: %s init: already running initial setsid() failed: %mrootsetlogin() failed: %munrecognized flag '-%c'ignoring excess argumentsfatal signal: %scannot get kernel security level: %scannot change kernel security level from %d to %d: %scan't open %s: %mcan't get %s for controlling terminal: %m/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bincan't exec %s for single user: %mcan't fork single-user shell, trying againwait for single-user shell failed: %m; restartinginit: shell stopped, restarting single user shell terminated, restartingsingle user shell terminated.single_userautobootcan't exec %s for %s: %mcan't fork for %s on %s: %mwait for %s on %s failed: %m; going to single user modeinit: %s on %s stopped, restarting %s on %s terminated abnormally, going to single user modesession database close: %ssession database open: %sinsert %d: %sdelete %d: %scan't parse getty for port %scan't allocate windowcan't parse window for port %scan't fork for window system on port %s: %msetsid failed (window) %mcan't exec window system '%s' for port %s: %mcan't fork for getty on port %s: %mgetty repeating too quickly on port %s, sleepingcan't exec getty '%s' for port %s: %mport %s changed utmp index from %d to %dcan't exec %s for %s %s: %msome processes would not die; ps axl advisedNOS:T:a:b:c:d:e:f:g:h:i:k:l:m:n:o:p:qr:s:t:u:x:z:P:T:a:b:c:d:e:f:i:m:o:s:%s: can't figure out file system partitiondisagrees with disk label%s (%d) %s (%lu) Warning: calculated sectors per cylindermfs:%dNumber of cylinders restricts cylinders per group to %d. Warning: changing optimization to space because minfree is less than %d%% %s: no default sector size%s: no default #sectors/track%s: no default #tracks%s: maximum file system size on the `%c' partition is %d%s: `%c' partition overlaps boot program%s: `%c' partition is unavailable%s: %s: not a character-special device %s: getmntinfo: %s%sr%snewfs_%s%s/newfs_%s%s not found%s: bad sector size%s: bad maximum contiguous blocks %s: bad block size%s: bad cylinders/group%s: bad rotational delay %s: bad blocks per file in a cylinder group %s: bad fragment size%s: bad average file size%s: bad average files per dir%s: bad bytes per inode %s: bad track skew%s: bad interleave%s: bad free space %% %s: bad rotational layout count %s: unknown optimization preference: use `space' or `time'.%s: bad spare sectors per track%s: bad revolutions/minute %s: bad file system size%s: bad sectors/track%s: bad spare sectors per cylinder%s: bad total tracksinsane maxpartitions value %d%s: mount: %sabnormal terminationioctl (WDINFO)%s: can't rewrite disk label-N do not create file system, just print out parameters-O create a 4.3BSD format filesystem-P src populate mfs filesystem-S sector size-T disktype-a maximum contiguous blocks-b block size-c cylinders/group-d rotational delay between contiguous blocks-e maximum blocks per file in a cylinder group-f frag size-g average file size-h average files per directory-i number of bytes per inode-k sector 0 skew, per track-l hardware sector interleave-m minimum free space %%-n number of distinguished rotational positions-o optimization preference (`space' or `time')-p spare sectors per track-r revolutions/minute-s file system size (sectors)-t file system type-u sectors/track-x spare sectors per cylinder-z tracks/cylinderusage: %s [ -fsoptions ] special-device mount-point usage: %s [ -fsoptions ] special-device where fsoptions are: %s: exitedchdircannot stat %s%s: not a dir or a block device-rw-pe/bin/paxcopy %s to %s failedunmount %srmdir %smount %s %s/mnttmp mountpoint %s busygettmpmnttmp mountpoint %s too longmntXXXXXXXXXXmkdtemp %stmp mount point too long%s: initializing cg %ld/%d siginfopreposterous size %dpreposterous ntrak %dpreposterous nsect %dillegal expected average file size %dillegal expected number of files per directory %dblock size must be a power of 2, not %dfragment size must be a power of 2, not %dfragment size %d is too small, minimum is %dblock size %d is too small, minimum is %dblock size %d is too large, maximum is %dno block size to support this diskminimum bytes per inode isWith a block size of %d %s %ld With %d sectors per cylinder, minimum cylinders per group is %ld CylinderWarning: cylinder%s groups must have a multiple of %ld cylinders panic (fs_cpg * fs_spc) %% NSPF != 0cylinder groups must have at least %ld cylinders!mapcramped && !inodecrampedBlock size and bytes per inode restrictBlock size restrictsBytes per inode restrict cylinders per group to %d. file systems must have at least one cylinder (not %d)and ntrak File system performance may be impaired. rotational layout tables with nsect%s %s %d %s %d.%sWarning: insufficient space in super block for Warning: inode blocks/cyl group (%ld) >= data blocks (%ld) in last cylinder group. This implies %ld sector(s) cannot be allocated. mkfsfsinit failedsuper-block backups (for fsck -b #) at:%s: %d sectors in %d %s of %d tracks, %d sectors %.1fMB in %d cyl groups (%d c/g, %.2fMB/g, %d i/g) cg summaryWarning: %d sector(s) in last cylinder unallocated filesystem must have at least %d sectorsinode blocks/cyl group (%ld) >= data blocks (%d) number of cylinders per cylinder group (%d) %s. must be increased%s to be changed from %d to %d This requires the block size %s to be changed from %d to %d and the fragment sizeWith %d bytes per inode, Minimum bytes per inode is %ld block size (%d) cannot be smaller than fragment size (%d)fragment size %d is too small, minimum with block size %d is %dpanic: cylinder group too bigcg 0: bad magic numberinternal error: can't find block in cyl 0first cylinder group ran out of spacecg 0: bad magic number (0x%06x != 0x%06x)fsinit: inode value %d out of rangerdfs: read error on block %dwtfs: write error on block %disblock bad fs_frag %d clrblock bad fs_frag %d setblock bad fs_frag %d dfiPRrWrm_overwrite%s (inode %u): not overwritten due to multiple links%s: malloccheckoverride %s%s%s/%s for %s? remove %s? "." and ".." may not be removedusage: %s [-dfiPRrW] file ... bsfbsrdensityeomfsffsrofflinerewindrewofflretensionweoff:%s: illegal count%s: unknown commandioctl MTIOCGETWriteProtectMounted76543210%s tape drive, residual=%d erblocksize: %d (%d, %d, %d, %d) density: %d (%d, %d, %d, %d) %d: unknown tape drive type usage: %s [-f] device usage: %s [-f device] command [ count ] Lost connection to remote host.shell/tcp: unknown service/etc/rmtwho are you?invalid user name: %sO%s %d rmtopenC S I%d %d ioctlrmtioctlProtocol to remote tape server botched (code "%s").rmtreplyProtocol to remote tape server botched.(rmtgets got "%s").m:pusage: %s [-p] [-m mode] dirname ... $OpenBSD: compile.c,v 1.20 2004/07/10 11:41:26 otto Exp $0123456789/\$invalid command code %cextra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandunexpected }branchempty labelread commandw commandfilename expectedunterminated substitute patternsubstitute pattern can not be delimited by newline or backslashextra text at the end of a transform commandcommand %c expects up to %d address(es), found %dcommand expectedunexpected EOF (pending }'s)\ can not be used as a string delimiternewline can not be used as a string delimitercompile_reRE error: %sunterminated substitute in regular expression123456789\%c not defined in the REunescaped newline inside substitute patternnumber in substitute flags out of rangemore than one number or 'g' in substitute flagsbad flag in substitute command: '%c'compile_flagsno wfile specifiedunterminated transform source stringcompile_trtransform strings are not the same lengthunterminated transform target stringtransform pattern can not be delimited by newline or backslashcompile_textexpected context addressunterminated regular expressionwhitespace after %sundefined label '%s'duplicate label '%s'unused label '%s'$OpenBSD: main.c,v 1.9 2003/06/10 22:20:50 deraadt Exp $ae:f:nusage: sed script [-an] [file ...] sed [-an] [-e script] ... [-f script_file] ... [file ...] stdout: %s ..."$OpenBSD: misc.c,v 1.6 2004/07/20 03:50:26 deraadt Exp $sed: %lu: %s: $OpenBSD: process.c,v 1.12 2003/11/07 02:58:23 tedu Exp $\%d not defined in the REflush_appends\ \abfnrtv%03ofirst RE may not be emptyx  F . = J3 = , T M P ,M 3 X2 = = K 9 N N `W <(@l"4] p"X X,o t"`g |"$o "`g "xd "pn "-eq-ne-gt-ge-lt -le!-ef"-nt#-ot$2#t#f#c$d$s$$l8$mH$n,p tF| % 4% H%D X%H d% |% % % %Ա % %t Ld dԭ %x , %l & & &D (&$ 4& D&D \\ P&t \&< h& t& &У & &T & &4 & & & 'ī ' ' $' @' \'$ l' ' '0 '  ' <( ' '$ ' ' ' (H (hb fd'(! ! %"#)< >g  0y7#-1 1= ?2*?* /.&.&_606162636465666768695U5u4L4l3C3c[O%A"BCDDT+++--==!== *= /= %= += -= <<= >>= &= ^= |= <<>><=>=<>&& || */%+-&^|? , ~!():40/ } ${PS3=#? } ${PS4=+ }KSH_VERSION0383*?&03T+\03L4<303L4D3P3X3$333334,4<4P4`4p4|4$444(;8\$\44<4. 4403T+?4* 6a6$6c8,6<6eD6L6X6ikؓld6Xpmp6C/n|6f66|1b6u666pX*r \s6h؁v466666xlet9999 9 h9  9 99gLx(9{9}999:::& ||&&!()dinqt]]<>4 %???̶- ? Y ? 3??????@(#)PD KSH v5.2.14 99/07/13.2 AAA  Q AA A QBunable to allocate memoryLPrestricted shell - can't cdOLDPWDCDPATH%s: bad directoryno OLDPWDdon't know current directorytoo many argumentsno home directory (HOME not set)can't get current directory - %sRnprsu,-p: %s-u: %s: %spvVpv is a reserved word special is a%s shell builtin is a function undefined (autoload from %s) tracedn exported%s is *GOK*exported is an %salias for alias %s= is a tracked %salias for not foundL#R#UZ#fi#lprtuxfunction %s %T %s() %T %s: not identifierexportreadonly%s[%d]typeset -U -u -l -Z -R%d -L%d -t -r -x -i only -t, -u and -x options may be used with -funalias-tadprtUxalias: -r flag can only be used with -t and without arguments alias %s alias not found adtno argumentslpnzjob control not enabled%%%*d %*s %s%*d %*d %sls:bad signal `%s'Usage: kill [ -s signame | -signum | -signame ] {pid|job}... kill -l [exit_status] %s: arguments must be jobs or process IDsmissing name argument%s: is not an identifierarguments changed since last callOPTARGc_getopts: no argvmissing options argumentlm+alias+cd+command*=export+fc+getopts+jobs+killlet*=readonly=typeset+unaliaswhence+bg+fgnothing to shift%s: bad numberc_umask=+-rwxugoXsbad maskaugo%#3.3o ugorwxprsu,%s is read onlytrap -- bad signal %s%s: can only %s %d level(s)%s: cannot %sfvShell: %8ss user %8ss system Kids: %8ss user user %8s %8ss user sys %8s real %8s %8ss real :ptime: -%s requires an argumenttime: -%s unknown option*=.*=:*=break=builtin*=continue*=eval*=exec*=exit+false*=return*=set*=shift=times*=trap+=wait+read+trueulimit+umask*=unset-tmissing ]internal error: unknown opunexpected operator/operandmissing closing parenmissing argumentmissing expression operatormissing second argumentexpression expectedtime(cpu-seconds)file(blocks)coredump(blocks)data(kbytes)stack(kbytes)lockedmem(kbytes)memory(kbytes)nofiles(descriptors)ulimit: %cunlimited%-20s unlimited bad limit: %sexceeds allowable limitinvalid limit: %sx_modefileglob: substitute errorFPATH;|&()`*+?@!IFS\$(){}*&;#|<>"'`beginning-of-historycomplete-commandcomplete-filecompletedelete-char-backwarddelete-word-backwarddelete-char-forwarddelete-word-forwardkill-lineredrawend-of-historyeot-or-deletegoto-historymacro-stringauto-insertkill-to-eolkill-regionlist-commandlist-fileprefix-1prefix-2yank-popbackward-charbeginning-of-linebackward-wordend-of-lineforward-charforward-wordnewlinedown-historynewline-and-nextno-opup-historyprev-hist-wordsearch-character-forwardsearch-character-backwardsearch-historyset-mark-commandstuffstuff-resettranspose-charsexchange-point-and-markcomplete-listexpand-filecapitalize-worddowncase-wordupcase-wordset-argcommentx_search_hist I-search: nothing to yank yank something first%s = '%s' %s: no such functioncannot bind, not a ttyPOSIXsubstituteparameter null or not setexpand(NULL)%S%s: bad substitution%s: parameter not set%s: cannot open $() input%Rfunny $() command: %s*+?@! coprocess already existsPS4%s: can't find function definition file%s: can't find function definition file - %s%s: function not defined by %sCFUNC %d%s: can't open function definition file %s - %s%s: cannot execute - %s%s: restrictedcommand -p: restrictedbuiltin: %s: not a builtinEXECSHELL%s: %s: %sshcomexec: %scould not finish (dup) redirection %s: %sdupcannot %s %s: %s%s%s herein: yylexerror writing %s: %scan't %s temporary file %s: %shere document missing-rPS3%*d) %sdbteste_isadbteste_error: %s (offset %d)%s: unexpected `%s'end of expression%s: bad number `%s'%s: expression recurses on parameter `%s'%s: %s requires lvalue%s: %s applied to read only variablemissing )missing :zero divisorhistory functions not availablee:glnrs0,1,2,3,4,5,6,7,8,9,-%c%scan't use -e, -l, -n, -r with -s (-e -)can't use -l, -n with -e%.*s ${FCEDIT:-/bin/ed} $_error reading temp file %s - %scannot open temp file %serror writing temporary file - %scannot create temp file %s - %s-16substitution failed%s: not in history%s: invalid rangeno history (yet)HISTFILE%s.%dhist_shrinkinternal error: %s[%d]: shl_stdout not validtoo many files open in shellcan't create pipe - try againillegal file descriptor namefd not open for readingfd not open for writingbad file descriptorno coprocess/tmp%s/shXXXXXXXXstoppedrunning and You have %s%s%s jobs no such jobambiguousargument must be %job or process idwarning: won't have full job controlj_init: tcsetpgrp() failed: %sj_init: setpgid() failed: %sj_init: tcgetpgrp() failed: %sj_init: getpgrp() failed: %s[%d]jw:last procchildexchild: execute() returnedexchild: XPIPEI and no last_job - pid %dcannot fork - try againwaitlast: no last jobjw:waitlastwaitlast: not startedjw:waitfor| jw:resumecannot continue job %s: %sfg: 2nd tcsetpgrp(%d, %d) failed: %s1st tcsetpgrp(%d, %d) failed: %s[%d] job not job-controlledjobsnotifyzombiej_async: bad nzombie (%d)j_async: job not startedj_waitj: tcsetpgrp(%d, %d) failed: %scheckjobcheck_job: job started (flags 0x%x) Running (core dumped)%-20s %s%s%sj_print%s%5d %-20s %s%s %s%s%s%s %5d [%d] %c DoneDone (%d)remove_job: job not found (%s)no closing quote here document `%s' unclosed PS2PS1missing ] MAILyou have mail in $_typeset-xPPIDOPTIND=1evaltypeset -i RANDOM MAILCHECK="${MAILCHECK-600}" SECONDS="${SECONDS-0}" TMOUT="${TMOUT-0}"hash=alias -ttype=whence -vstop=kill -STOPsuspend=kill -STOP $$autoload=typeset -fufunctions=typeset -fhistory=fc -linteger=typeset -inohup=nohup local=typesetr=fc -e -login=exec login-tUccdatemailmakeprviwhopdkshENV$ /etc/suid_profile/etc/profile$HOME/.profileCannot determine current working directory-c requires an argumentinclude: %dUse `exit' to leave ksh shell: %dalloc: %s%s%s-`%c' requires argument%s%s-%c: unknown option |&;<>()*@#!$-? =-+?#% "#$&'()*;<>?[\`|0123456789ABCDEFallexportbraceexpandbgniceemacs-usemetaerrexitgmacsignoreeofinteractivemarkdirsnoclobbernoglobnohupnolognounsetphysicalposixprivilegedtrackallvirawvi-show8vi-tabcompletevi-esccompletextrace%-*s %sCurrent option settings -o %sgetoptionsparse_args: `%c'%s: bad optionA:o;sgmatch'\'%-*s%*sdo_phys_pathshf_fdopen: missing read/writeshf_reopen: bad shf/buf/bsizeshf_reopen: missing read/writeshf_sopen: flags 0x%xshf_flush: no fdshf_emptybuf: no fdshf_fillbuf: no fdshf_read: bsize %dshf_read: flags %xshf_getse: flags %xshf_getchar: flags %xshf_ungetc: flags %xshf_putchar: no fdshf_putchar: flags %xshf_write: nbytes %dshf_write: flags %xshf_snprintf: buf %lx, bsize %dshf_vfprintf0123456789abcdef(null %s)too many <<'s for%s: bad identifier too many redirections %s: invalid function name thenelseeliffiesacwhileuntildo{}[[&&||;;((|&unexpectedunmatchedsyntax error: `%s' %s ?%dsyntax error: unexpected EOF EXITSignal 0HUPHangupINTInterruptQuitILLIllegal instructionTRAPTrace trapABRTAbortEMTEMT trapFPEFloating point exceptionKILLKilledBUSBus errorSEGVMemory faultSYSBad system callPIPEBroken pipeALRMAlarm clockTerminatedURGUrgent I/O conditionStopped (signal)TSTPStoppedCONTContinuedCHLDChild exitedTTINStopped (tty input)TTOUStopped (tty output)IOI/O possibleXCPUCPU time limit exceededXFSZFile size limit exceededVTALRMVirtual timer expiredPROFProfiling timer expiredWINCHWindow size changeInformation requestUSR1User defined signal 1USR2User defined signal 2Error handlerSIGtimed out waiting for inputsetexecsig: unset signal %d(%s)%S #no-args# #no-vars# ( %T) %T| %T%;%T%s %T ]] %Sdo%N%T%;done in %;for %s select %s case %S in%N(%S%c%;%T%N;;%Nesac %s %T%;doif %Telif %Telse%;%T%;fi then%N%T{%;%T%;} %T& function %s %T%s() %Ttime %T%T|& < >| <> <<- << >> <&>&wdscan: unknown char 0x%x (carrying on)j_ttyinit: can't set close-on-exec flag: %sj_ttyinit: dup of tty fd failed: %sNo controlling tty (open /dev/tty: %s)Can't find tty file descriptorOPTINDPOSIXLY_CORRECTHISTSIZEVISUALMAILCHECKMAILPATHRANDOMSECONDSTMOUTLINENO%s: subscript out of range0123456789abcdefghijklmnopqrstuvwxyz0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZsetstr: %s=%s: assigning to self%s: is read only%0*s%.*s%*s%.*sy$%s %dfc -e ${VISUAL:-${EDITOR:-vi}} --grabhist: bad history arrayM-usage: %s seconds %s: destination pathname too longdo_moverename %s to %scan't remove %scannot resolve %s: %scannot rename a mount point%s: remove%s: set times%s: set flags%s: set mode%s: set owner/group%s: set owner/group; not setting setuid/setgid%s: waitpid%s: terminated with %d (non-zero) status/bin/cp/bin/rm%s: did not terminate normally-rf-PRpusage: %s [-fi] source target %s [-fi] source ... directory |&=<>+-*/%:()syntax erroreval5division by zeronon-numeric argument_msgbufpM:N:sysctl: KERN_MSGBUFSIZEcouldn't allocate space for buffer datasysctl: KERN_MSGBUFusage: dmesg [-M core] [-N system] T+D83DDYDD EEE E # EEE El"p" E T$E(Eİ,E0E4E8E?@[\]^_`{|}~lowerabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ punct!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ upperABCDEFGHIJKLMNOPQRSTUVWXYZxdigit0123456789ABCDEFabcdefalnumABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789NULSOHSTXETXEOTENQBELalertBSbackspaceHTLFVTvertical-tabFFform-feedCRcarriage-returnSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBIS4IS3GSIS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfivesixseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDEL[:<:]][:>:]]$OpenBSD: auth_unix.c,v 1.16 2003/09/20 00:39:39 deraadt Exp $authunix_createauthunix_create: out of memory authunix_create_defaultauth_none.c - Fatal marshalling problemh:x::::^^:: ;;^@;X;l;x;;^^;;;<0<^_<<,_<<=h:x::::^^:: ;;^@;X;l;x;;^^;;;<0<^_<<,_<<=option requires an argument -- %coption requires an argument -- %sambiguous option -- %.*soption doesn't take an argument -- %.*sunknown option -- %cunknown option -- %s$OpenBSD: getopt_long.c,v 1.17 2004/06/03 18:46:52 millert Exp $$OpenBSD: inet_net_pton.c,v 1.3 2003/04/25 19:40:25 henning Exp $0123456789abcdef0123456789/usr/src/lib/libc/net/inet_net_pton.cn >= 0 && n <= 9n >= 0 && n <= 15$OpenBSD: assert.c,v 1.7 2003/06/11 21:03:10 deraadt Exp $assertion "%s" failed: file "%s", line %d assertion "%s" failed: file "%s", line %d, function "%s" ipx_addrab0b1simulatedncdtscilhssbpxbxfxoxtxdx$OpenBSD: getcap.c,v 1.22 2004/05/18 02:05:52 jfb Exp $getenttc%s.dbcgetnext|:$OpenBSD: strcspn.c,v 1.4 2003/06/11 21:08:16 deraadt Exp $$OpenBSD: setenv.c,v 1.6 2003/06/02 20:18:38 millert Exp $$OpenBSD: strspn.c,v 1.4 2003/06/11 21:08:29 deraadt Exp $execlexecleexeclpexecvpexecvp: : path too long $OpenBSD: strsep.c,v 1.5 2003/06/11 21:08:16 deraadt Exp $$OpenBSD: authunix_prot.c,v 1.4 2001/09/15 13:51:00 deraadt Exp $$OpenBSD: xdr_array.c,v 1.6 2002/08/01 01:05:24 deraadt Exp $xdr_array: out of memory $OpenBSD: rpc_commondata.c,v 1.4 2003/12/31 03:27:23 millert Exp $LC_ALLLC_COLLATELC_CTYPELC_MONETARYLC_NUMERICLC_MESSAGES/usr/share/localePATH_LOCALE%s/%s/%s/%s/%s/%s%s/%s/%sloadlocaleLANG$OpenBSD: realpath.c,v 1.10 2003/08/01 21:04:59 millert Exp $realpath__opendir2$OpenBSD: qsort.c,v 1.8 2003/06/02 20:18:38 millert Exp $$OpenBSD: rindex.c,v 1.5 2003/06/11 21:08:16 deraadt Exp $__svfscanf$OpenBSD: gethostnamadr.c,v 1.60 2004/07/29 03:09:40 itojun Exp $gethostby*.getanswer: asked for "%s", got "%s"-_/getanswergethostby*.getanswer: asked for "%s %s %s", got type "%s"gethostbyaddr%x.%x.ip6.arpa/etc/hosts%u.%u.%u.%uhosts.byaddr_yp_gethtbyaddrhosts.byname$OpenBSD: bcmp.c,v 1.5 2003/06/02 20:18:38 millert Exp $:2*" <4,$ >6.&@80( 91)! ;3+# =5-% ?7/'91)! :2*" ;3+# <4,$?7/'>6.&=5-%      )4%/7(3-!0,1'8"5.*2$                                                                                                                                  @ @ @ @ @ ./ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz01234567896789:;<=>?  !"#$%&'()*+,-./012345%2.2u$bcrypt_gensaltOrpheanBeholderScryDoubtbcrypt 1Ѭߘr/Ḗ~&jE|,G$l iciNWqX~=t XrX͋qJT{YZ90`*#`(yA8۸y:`l>w'K1/x`\`U%U攫UbHW@cj9U*4\̴ATr|*oc]ũ+1t>\3֯\$lS2zw(H;Kkē!(f a!`|H2]]]u#&܈e>#Ŭom9BD . Ji^Bh!la gӫҠQjh/T(3Ql n;zP;*~ev9>YfCoEå}^;uos D@jVbNw?6r=B$7H ۛIrS{y%P;LylO`@ž\^c$johSl>9oR;Qm,0DE ^J3(fK.WtE9_ ӹyU 2`yr,@%g̣饎"2u<kaP/R=2`#H{1S>W\o.ViB~(2gsUO'[iXʻ]=!lJ[-ySeEIҐK3~ˤAb Lw6~д+MەqՓkю%ǯ/[{AI~-%^q h"W6d$ cUYCxSZ٢[} Źv&ϕbhAJsN-GJ{RQ)S?Wƛv`+t恵oWk *!ec.4dV]-SGjnpzKD). u#&İn}ߧI`fqilRdVឱ¥6)L u@Y>:䚘T?eB[k?ҡ08-M]% L&pc^?kh >\D}W7: P tAu8/;21>8TNmO Bo ,y|$ryVw.?rU$qk.P̈́GXzt}K:zfC cdG27;C$CMQe*P:qUN1w_V5kǣ;< $Y,n<pEㆱo ^*>Zw=Ne)։>%fRxL.jxS<- N=+6&9`y#RnfE{7(2åZl!Xeh;/ۭ}*/n[(!pa)uGa0a4c\s9pL ު˼,b`\ndi#PZe2Zh@*<1! T_~}=b7w-_h)5ǡޖXxWcr"ÃF T0.SHُ(1mX4a(s<|J]d]B> EꫪOlOBBǵj;Oe!AyMjGKPb=bF&[$ti GV[ Htb#*BXU >ap?#r3A~_;"lY7|`t˧@n2w΄PU5ai Z .zD4Egɞs͈Uy_g@Cge48>q(= m!>J=+hZ=@&L4)i Av.khq$j 3ԷCaP.9FE$tO!@MpE/f m1'A9UG%ښ ʫ%xP()Sچ, mbhiHפh'?Oz|Ϊ_7әxB*k@5 ٫9N;VmK1f&tn:2C[Ah xN جV@E'H::SU kKмgUXc)3VJ*%1?~^|1)p/'\,(H"m?H܆AyG@n]Q_2Տd5A4x{%`*`lc´2Of#k>3b $;" r(-Exb}doITH}'>AcG t.no:7`L knU{7,gm;e' )̒9 i{f} ϑ^و/$[Qy{;v.97yY̗&-1.Bh;+jLu.x7BjQ满PcKkؽ%=YBD n *Ngd_ڈ鿾dW{x`M``FѰ8Ew63kBqA_^;Z4ٷ,Q+:Ֆ}}>(-}|%rZLZq)GW;()f(.y_xU`uD^mm%adâW<'*:m?!cf&(3uU4V<wQ( gQ̫_QM08bX7 z{>d!Q2Ow~㶨F=)iSHd$m-if! FEdlX [@X̻k~jEY:D 5>ʹrdfGof,ҏ"W##v215VbuZ6ns҈bIPLVq z2E{Sb%ҽ5iq"|˶+v>S@`8G% 8vFšw``u N˅؍芰z~L\HjiԐ\-% ?2aN[wߏWr:j?$.Dsp"8 1).lN!(Ew8fTl 4)P|ɵՄ? Gy$1$%s%.*s$md5crypt$OpenBSD: md5.c,v 1.7 2004/05/28 15:10:27 millert Exp $MD5Pad$OpenBSD: vfprintf.c,v 1.20 2003/06/02 20:18:37 millert Exp $__sbprintfbug in vfprintf: bad baseInfNaN__find_argumentsexponent?$@Y@@@@j@.AcAחAeA _BvH7BmB@0BļB4&k C7yAC؅W4vCNgmC=`XC@xDPKDMD7yACnF?O8M20HwZError %d[%ld]%h %e %T syslog: unknown facility/priority: %xconnectlog_r/dev/logȒВؒ $(,048@HP\hp|$OpenBSD: strftime.c,v 1.13 2003/06/04 21:47:58 deraadt Exp $JanFebMarAprMayJunJulAugSepOctNovDecJanuaryFebruaryMarchAprilJuneJulyAugustSeptemberOctoberNovemberDecemberSunMonTueWedThuFriSatSundayMondayTuesdayWednesdayThursdayFridaySaturday%H:%M:%S%m/%d/%y%a %b %e %T %YAMPM%a %b %e %H:%M:%S %Z %Y_fmt%Y-%m-%d%H:%M%04d%2d%03d%I:%M:%S %p%e-%b-%Y_conv$OpenBSD: getdtablesize.c,v 1.3 2003/06/11 21:03:10 deraadt Exp $$OpenBSD: clnt_udp.c,v 1.20 2003/12/31 03:27:23 millert Exp $clntudp_create: out of memory clntudp_call/&/etc/resolv.conf;#lookupsearchnameserversortlistres_initRES_OPTIONSenvLOCALDOMAINndots:insecure1insecure2edns0$OpenBSD: atoi.c,v 1.3 2003/06/02 20:18:37 millert Exp $111111gethostby*.getanswer: asked for "%s", got "%s"explore_numeric# _gethtentipnodes.bynameres_querydomainNres_query%.*s.%.*sres_querydomainHOSTALIASES__hostalias __res_nameinquery__res_queriesmatch__res_sendОԞܞ4$k <DTXlpx|    ԟ؟ $(8 <@T\ptt[؟D=ĠРԠ ,0PT x!"ܡ4<dT\e|f#Ԣ%d day%s%d hour%s%d min%s%d sec%s0 secssystatdaytimenetstatqotdchargenftp-datatelnetsmtprlpwhoisaptsapfsbootpsbootpctftprjefingersupdupnewaccthostnamesiso-tsapx400x400-sndcsnet-nspop-2sunrpcauthsftpuucp-pathnntperpcntpstatsrvprofileNeWSsnmpsnmp-trapprint-srvicmpigmpggpuclegpigpnvp-IIpupchaos;; res options:;; ->>HEADER<<- opcode: %s, status: %s, id: %u; flags:; Ques: %u, Ans: %u, Auth: %u, Addit: %u;; QUESTIONS: ;; , type = %s, class = %s ;; ANSWERS: ;; AUTHORITY RECORDS: ;; ADDITIONAL RECORDS: __fp_nquery ;; ...malformed ;; ...truncated ad UNUSED-BIT-ON ra rd tc aa qr__p_cdnname__p_fqname %lu;; packet size error (found %ld, dlen was %d) __p_rr %s ; proto %u, port %u ( %lu ; serial %lu ; refresh (%s) %lu ; retry (%s) %lu ; expire (%s) %lu ) ; minimum (%s) %s %s ( "\ ""?" ;; *** Warning *** OS-type missing ; LABELS WRONG (%d should be %d) ( %s %u ) ; BAD BASE640x%04x %u ( %u %u %u %u %u %u "%.*s" ?%d? %uINCHAOSHSHESIODANYname serverMDmail destination (deprecated)MFmail forwarder (deprecated)CNAMEcanonical nameSOAstart of authorityMBmailboxMGmail group memberMRmail renameNULLnullWKSwell-known service (deprecated)PTRdomain name pointerHINFOhost informationMINFOmailbox informationMXmail exchangerTXTRPresponsible personAFSDBDCE or AFS serverX25X25 addressISDNISDN addressrouterNSAPnsap addressNSAP_PTRsignaturePXmapping informationGPOSgeographical position (withdrawn)AAAALOClocationNXTnext valid name (unimplemented)EIDendpoint identifier (unimplemented)NIMLOCNIMROD locator (unimplemented)SRVserver selectionATMAATM address (unimplemented)IXFRincremental zone transferAXFRMAILBmailbox-related data (deprecated)MAILAmail agent (deprecated)UINFOuser information (nonstandard)UIDuser ID (nonstandard)GIDgroup ID (nonstandard)NAPTRURN Naming Authority"any"?0x%lx?usevcigntcprimry(unimpl)aaonly(unimpl)defnamdnsrchstyopnrecurs%ld.%.2ld%d %.2d %.2d.%.3d %c %d %.2d %.2d.%.3d %c %d.%.2dm %sm %sm %sm; error: unknown LOC RR versionABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/=  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~QUERYIQUERYCQUERYMCQUERYUNOTIFYUPDATEAUPDATEDUPDATEDAUPDATEMUPDATEMAZONEINITZONEREFNOERRORFORMERRSERVFAILNXDOMAINNOTIMPREFUSEDNOCHANGEGMTmn/usr/share/zoneinfotzload/etc/localtimeposixrules,M4.1.0,M10.5.0TZSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec%.3s %.3s%3d %02d:%02d:%02d %d $OpenBSD: strstr.c,v 1.4 2003/06/11 21:08:16 deraadt Exp $  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~%u.%u.%u.%uinet_ntop4inet_ntop6  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~$OpenBSD: strcasecmp.c,v 1.5 2003/06/11 21:08:16 deraadt Exp $$OpenBSD: _yp_check.c,v 1.5 2003/06/02 03:48:42 deraadt Exp $$OpenBSD: yp_get_default_domain.c,v 1.5 2003/06/02 03:48:42 deraadt Exp $/etc/services,/$OpenBSD: fgetln.c,v 1.4 2003/06/02 20:18:37 millert Exp $$OpenBSD: strpbrk.c,v 1.4 2003/06/11 21:08:16 deraadt Exp $$OpenBSD: strtol.c,v 1.5 2003/06/02 20:18:38 millert Exp $01234567890123456789abcdef0123456789ABCDEFinet_pton6$OpenBSD: strtoul.c,v 1.5 2003/06/02 20:18:38 millert Exp $$OpenBSD: ypmatch_cache.c,v 1.11 2003/06/25 21:51:56 marc Exp $yp_match: clnt_callyp_next: clnt_call$OpenBSD: yp_bind.c,v 1.14 2003/06/02 03:48:42 deraadt Exp $/var/run/ypbind.lock_yp_dobindclntudp_createfcntl: F_SETFDYP server for domain %s not responding, still trying clnttcp_create%s/%s.%d/var/yp/bindingЯ(Lh0Llı0Ld$OpenBSD: clnt_perror.c,v 1.15 2002/09/10 05:39:07 deraadt Exp $; errno = %s ; s1 = %u, s2 = %u ; why = (unknown authentication error - %d) ; low version = %u, high version = %u RPC: SuccessRPC: Can't encode argumentsRPC: Can't decode resultRPC: Unable to sendRPC: Unable to receiveRPC: Timed outRPC: Incompatible versions of RPCRPC: Authentication errorRPC: Program unavailableRPC: Program/version mismatchRPC: Procedure unavailableRPC: Server can't decode argumentsRPC: Remote system errorRPC: Unknown hostRPC: Port mapper failureRPC: Program not registeredRPC: Failed (unspecified error)RPC: Unknown protocolRPC: (unknown error code)%s: %s - %s Authentication OKInvalid client credentialServer rejected credentialInvalid client verifierServer rejected verifierClient credential too weakInvalid server verifierFailed (unspecified error)$OpenBSD: strerror.c,v 1.6 2004/05/03 05:07:34 espie Exp $$OpenBSD: strlcat.c,v 1.11 2003/06/17 21:56:24 millert Exp $$OpenBSD: clnt_tcp.c,v 1.19 2003/12/31 03:27:23 millert Exp $clnttcp_create: out of memory $OpenBSD: auth_none.c,v 1.7 2001/09/15 13:51:00 deraadt Exp $$OpenBSD: rpc_prot.c,v 1.7 2001/09/15 13:51:01 deraadt Exp $$OpenBSD: xdr_mem.c,v 1.9 2002/12/11 22:55:39 millert Exp $bindresvport_sa$OpenBSD: pmap_getport.c,v 1.7 2001/09/15 13:51:01 deraadt Exp $$OpenBSD: pmap_prot.c,v 1.4 2002/02/13 22:36:52 deraadt Exp $$OpenBSD: xdr_rec.c,v 1.9 2002/02/16 21:27:24 millert Exp $xdrrec_create: out of memory perror$OpenBSD: strerror_r.c,v 1.2 2004/05/03 05:07:34 espie Exp $Unknown error: _catopen/usr/share/nls/%L/%N.cat:/usr/share/nls/%N/%LNLSPATH$OpenBSD: index.c,v 1.4 2003/06/02 20:18:38 millert Exp $lķܷ 4H\"xȸܸ 4ThйX;0Tpк4Phл<`|̼(<`tн 4H\t,$OpenBSD: errlist.c,v 1.7 2003/06/02 20:18:34 millert Exp $Undefined error: 0Operation not permittedNo such file or directoryNo such processInterrupted system callInput/output errorDevice not configuredArgument list too longExec format errorBad file descriptorNo child processesResource deadlock avoidedPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkOperation not supported by deviceNot a directoryIs a directoryInvalid argumentToo many open files in systemToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksNumerical argument out of domainResult too largeResource temporarily unavailableOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not availableProtocol not supportedSocket type not supportedOperation not supportedProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceOperation timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downNo route to hostDirectory not emptyToo many processesToo many usersDisk quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticatorIPsec processing failureAttribute not found$OpenBSD: strlcpy.c,v 1.8 2003/06/17 21:56:24 millert Exp $$OpenBSD: xdr_ypbind_resp.c,v 1.5 2003/06/02 03:48:42 deraadt Exp $$OpenBSD: xdr_ypbind_binding.c,v 1.5 2003/06/02 03:48:42 deraadt Exp $$OpenBSD: xdr_ypbind_resptype.c,v 1.5 2003/06/02 03:48:42 deraadt Exp $$OpenBSD: strdup.c,v 1.5 2003/06/11 21:08:16 deraadt Exp $$OpenBSD: xdr_ypreq_key.c,v 1.5 2003/06/02 03:48:42 deraadt Exp $$OpenBSD: xdr_domainname.c,v 1.5 2003/06/02 03:48:42 deraadt Exp $$OpenBSD: xdr_mapname.c,v 1.5 2003/06/02 03:48:42 deraadt Exp $$OpenBSD: xdr_ypresp_key_val.c,v 1.5 2003/06/02 03:48:42 deraadt Exp $$OpenBSD: xdr_keydat.c,v 1.6 2003/06/02 03:48:42 deraadt Exp $$OpenBSD: xdr_ypresp_val.c,v 1.5 2003/06/02 03:48:42 deraadt Exp $$OpenBSD: xdr_valdat.c,v 1.6 2003/06/02 03:48:42 deraadt Exp $$OpenBSD: xdr_ypstat.c,v 1.6 2003/06/02 03:48:42 deraadt Exp $$OpenBSD: xdr.c,v 1.6 2001/09/15 13:51:01 deraadt Exp $xdr_bytes: out of memory xdr_string: out of memory $OpenBSD: ypprot_err.c,v 1.6 2003/06/02 03:48:42 deraadt Exp $$OpenBSD: db.c,v 1.8 2003/06/25 21:15:04 deraadt Exp $$OpenBSD: bt_open.c,v 1.11 2003/06/02 20:18:33 millert Exp $%s/bt.XXXXXX$OpenBSD: bt_close.c,v 1.7 2003/06/02 20:18:33 millert Exp $$OpenBSD: bt_delete.c,v 1.8 2003/06/02 20:18:33 millert Exp $$OpenBSD: bt_get.c,v 1.6 2003/06/02 20:18:33 millert Exp $$OpenBSD: bt_conv.c,v 1.7 2003/06/02 20:18:33 millert Exp $$OpenBSD: bt_seq.c,v 1.8 2003/06/02 20:18:33 millert Exp $$OpenBSD: bt_search.c,v 1.7 2003/06/02 20:18:33 millert Exp $$OpenBSD: bt_utils.c,v 1.6 2003/06/02 20:18:33 millert Exp $$OpenBSD: bt_overflow.c,v 1.7 2003/06/02 20:18:33 millert Exp $$OpenBSD: bt_page.c,v 1.7 2003/06/02 20:18:33 millert Exp $$OpenBSD: mpool.c,v 1.12 2003/06/02 20:18:34 millert Exp $mpool_new: page allocation overflow. $OpenBSD: atexit.c,v 1.7 2002/09/14 22:03:14 dhartmei Exp $isatty$OpenBSD: memchr.c,v 1.6 2003/06/11 21:08:16 deraadt Exp $ ((((( AAAAAABBBBBB ((((( $OpenBSD: hash.c,v 1.17 2004/06/21 23:13:22 marc Exp $%$sniglet^&$OpenBSD: hash_buf.c,v 1.12 2003/06/02 20:18:33 millert Exp $$OpenBSD: hash_func.c,v 1.8 2003/06/02 20:18:33 millert Exp $$OpenBSD: hash_log2.c,v 1.7 2003/06/25 21:15:05 deraadt Exp $$OpenBSD: calloc.c,v 1.8 2003/06/02 20:18:37 millert Exp $ warning: malloc_initmmap(2) failed, check limits unknown char in MALLOC_OPTIONS MALLOC_OPTIONS/etc/malloc.confallocation failed malloc() has never been called junk pointer, too high to make sense modified (chunk-) pointer chunk is already free pointer to wrong page modified (page-) pointer junk pointer, too low to make sense recursive call in malloc(): in free(): in realloc():page is already free freelist is destroyed stack overflow in function %s$OpenBSD: abort.c,v 1.13 2004/01/20 19:35:17 millert Exp $$OpenBSD: getenv.c,v 1.6 2003/06/02 20:18:37 millert Exp $$OpenBSD: strlen.c,v 1.6 2003/06/11 21:08:16 deraadt Exp $$OpenBSD: strtoull.c,v 1.2 2003/06/02 20:18:38 millert Exp $$OpenBSD: rec_open.c,v 1.9 2003/06/02 20:18:34 millert Exp $$OpenBSD: rec_close.c,v 1.9 2003/06/02 20:18:34 millert Exp $$OpenBSD: rec_get.c,v 1.8 2003/06/02 20:18:34 millert Exp $$OpenBSD: rec_put.c,v 1.7 2003/06/02 20:18:34 millert Exp $__rec_iput$OpenBSD: rec_delete.c,v 1.7 2003/06/02 20:18:34 millert Exp $$OpenBSD: rec_seq.c,v 1.6 2003/06/02 20:18:34 millert Exp $$OpenBSD: rec_utils.c,v 1.5 2003/06/02 20:18:34 millert Exp $$OpenBSD: rec_search.c,v 1.7 2003/06/02 20:18:34 millert Exp $$OpenBSD: hash_page.c,v 1.14 2003/06/02 20:18:34 millert Exp $HASH: Out of overflow pages. Increase page size %s/_hash.XXXXXXopen_temp$OpenBSD: hash_bigkey.c,v 1.13 2003/08/06 21:08:05 millert Exp $$OpenBSD: bt_put.c,v 1.9 2003/06/02 20:18:33 millert Exp $__bt_put$OpenBSD: bt_split.c,v 1.11 2003/06/02 20:18:33 millert Exp $DddDHh(((T(HFO$\D$D,48B8F@FHD;TTM\hwdhwlhwtܠ|ԫг\jh(L (;hXiii||`D_  z    $ . ,D- D- 0D- 4 < @Ю H( P X \P `|$OpenBSD: args.c,v 1.14 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: conv.c,v 1.10 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: conv_tab.c,v 1.4 2003/06/02 23:32:07 millert Exp $@(#) Copyright (c) 1991, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: dd.c,v 1.14 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: misc.c,v 1.13 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: position.c,v 1.7 2003/06/11 23:42:12 deraadt Exp $@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount_cd9660.c,v 1.16 2003/07/03 22:41:40 tedu Exp $$OpenBSD: getmntopts.c,v 1.9 2004/07/05 18:33:38 otto Exp $@(#) Copyright (c) 1980, 1990, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: df.c,v 1.37 2003/07/29 00:24:15 deraadt Exp $@(#) Copyright (c) 1980, 1990, 1993, 1994 The Regents of the University of California. All rights reserved. @(#) Copyright (c) 1980, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount.c,v 1.35 2004/03/16 21:27:47 otto Exp $@///D/D(/D8/DL/D\D`/`/h/Dx/x///// /D/'@/D/// +DDD00@(#) Copyright (c) 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount_ext2fs.c,v 1.12 2003/07/03 22:41:40 tedu Exp $$OpenBSD: getmntopts.c,v 1.9 2004/07/05 18:33:38 otto Exp $@(#) Copyright (c) 1987, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: sync.c,v 1.5 2003/06/02 23:32:09 millert Exp $87@@<7@h @7pD7p H7p L7` T7@ \7 $1м|^t0 Non-system disk Press any key to reboot NB:F:I:L:O:S:a:b:c:e:f:h:i:k:m:n:o:qr:s:t:u:$OpenBSD: cchar.c,v 1.10 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: gfmt.c,v 1.6 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: key.c,v 1.12 2003/06/11 23:42:12 deraadt Exp $طGGGG`GGXGtGxGp(GItG`GG0 Gh GG4G`\GG$OpenBSD: modes.c,v 1.8 2003/07/02 21:19:33 deraadt Exp $$OpenBSD: print.c,v 1.11 2003/06/11 23:42:12 deraadt Exp $@(#) Copyright (c) 1989, 1991, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: stty.c,v 1.11 2003/06/11 23:42:12 deraadt Exp $PPP$P,P4P' prompt will exit the editor. At prompts that request a size, `*' may be entered to indicate the rest of the available space. The editor commands are as follows: ?? [_c_o_m_m_a_n_d] Display help message with all available commands. A _c_o_m_m_a_n_d may be specified to get more detailed help. There is also (simple) context-sensitive help available at most prompts. aa [_p_a_r_t] Add new partition. This option adds a new BSD partition. If no partition letter is specified (a-p), the user will be prompted for one. bb Set OpenBSD disk boundaries. This option tells ddiisskkllaabbeell which parts of the disk it is allowed to modify. This option is probably only useful for ports with fdisk(8) partition ta- bles where the ending sector in the MBR is incorrect. The us- er may enter `*' at the ``Size'' prompt to indicate the entire size of the disk (minus the starting sector). This is useful for disks larger than 8 gigabytes where the fdisk partition table is incapable of storing the real size. cc [_p_a_r_t] Change the size of an existing partition. If no partition is specified, the user will be prompted for one. The new size may be in terms of the aforementioned units and may also be prefixed with `+' or `-' to change the size by a relative amount. DD Sets the disk label to the default values as reported by the kernel. This simulates the case where there is no disk label. dd [_p_a_r_t] Delete an existing partition (or `*' to delete all parti- tions). If no partition is specified, the user will be prompted for one. The `c' partition cannot be deleted. ee Edit drive parameters. This option is used to set the follow- ing parameters: disk type, a descriptive label string, sec- tors/track, tracks/cylinder, sectors/cylinder, number of cylinders, total sectors, rpm, and interleave. gg [_b|_d|_u] Set disk geometry based on what the _B_I_O_S, _d_i_s_k, or _u_s_e_r thinks (the _u_s_e_r geometry is simply what the label said before ddiisskkllaabbeell made any changes). MM Display this manual page. mm [_p_a_r_t] Modify parameters for an existing partition. If no partition is specified, the user will be prompted for one. This option allows the user to change the filesystem type, starting off- set, partition size, and mount point for the specified parti- tion. If expert mode is enabled (see XX below), then block fragment size, block size, and cylinders per group can also be modified. Note that not all parameters are configurable for non-BSD partitions. nn [_p_a_r_t] Name the mount point for an existing partition. If no parti- tion is specified, the user will be prompted for one. This option is only valid if ddiisskkllaabbeell was invoked with the --ff flag. pp [_u_n_i_t] Print the current disk label. If a _u_n_i_t is given, the size and offsets are displayed in terms of the specified unit. qq Quit the editor. If any changes have been made, the user will be asked whether or not to save the changes to the on-disk la- bel. rr Recalculate free space. This option should really not be nec- essary under normal circumstances. ss [_p_a_t_h] Save the label to a file in ASCII format (suitable for loading via the --RR option). If no path is specified, the user will be prompted for one. uu Undo (or redo) last change. Entering _u once will undo the last change. Entering it again will restore the change. ww Write the label to disk. This option will commit any changes to the on-disk label. XX Toggle ``expert mode''. By default, some settings are re- served for experts only (such as the block and fragment size on ffs partitions). xx Exit the editor without saving any changes to the label. zz Zeroes out the existing partition table, leaving only the `c' partition. The drive parameters are not changed. In the restore form of the command (fifth form), the prototype file used to create the label should be in the same format as that produced when reading or editing a label. Comments are delimited by _# and newline. As with --ww, any existing bootstrap code will be clobbered if --rr is specified and will be unaffected otherwise. The sixth form of the command (protect) is used to control write access to the label area of a disk so that the label cannot be inadvertently overwritten. The --NN and --WW options are only available on architectures that support this feature, such as vax, hp300 and some sparc models. The final three forms of ddiisskkllaabbeell are used to install bootstrap code on machines where the bootstrap is part of the label. The bootstrap code is comprised of one or two boot programs, depending on the machine. When installing bootstrap code with the --BB flag, if the names are not ex- plicitly given, standard boot programs will be used. The boot programs are located in _/_u_s_r_/_m_d_e_c. The names of the programs are taken from the ``b0'' and ``b1'' parameters of the disktab(5) entry for the disk if _d_i_s_k_t_y_p_e was given and its disktab entry exists and includes those param- eters. Otherwise, boot program names are derived from the name of the disk. These names are of the form _b_a_s_e_n_a_m_eboot for the primary (or only) bootstrap, and boot_b_a_s_e_n_a_m_e for the secondary bootstrap; for example, _/_u_s_r_/_m_d_e_c_/_s_d_b_o_o_t and _/_u_s_r_/_m_d_e_c_/_b_o_o_t_s_d if the disk device is _s_d_0. The first of the three boot-installation forms is used to install boot- strap code without changing the existing label. It is essentially a read command with respect to the disk label itself and all options are related to the specification of the boot program as described previously. The final two forms are analogous to the basic write and restore versions ex- cept that they will install bootstrap code in addition to a new label. Note that when a disk has no real BSD disklabel, the kernel creates a de- fault label so that the disk can be used. This default label will in- clude other partitions found on the disk if they are supported on your architecture. For example, on systems that support fdisk(8) partitions the default label will also include DOS and Linux partitions. However, these entries are not dynamic, they are fixed at the time ddiisskkllaabbeell is run. That means that subsequent changes that affect non-OpenBSD parti- tions will not be present in the default label, though they may be updat- ed by hand. To see the default label, run ddiisskkllaabbeell with the --dd flag. ddiisskkllaabbeell can then be run with the --ee flag and any entries pasted as de- sired from the default label into the real one. FFIILLEESS /etc/disklabels Directory for backup labels. /etc/disktab Disk description file. /usr/mdec/_x_xboot Primary bootstrap. /usr/mdec/boot_x_x Secondary bootstrap. EEXXAAMMPPLLEESS Display the in-core label for sd0 as obtained via _/_d_e_v_/_r_s_d_0_c: # disklabel sd0 Create a label for sd0 based on information for ``sd2212'' found in _/_e_t_c_/_d_i_s_k_t_a_b. Any existing bootstrap code will be clobbered. (Normally you do not want to use the --rr flag though.) # disklabel -w -r /dev/rsd0c sd2212 foo Read the on-disk label for sd0, edit it and reinstall in-core as well as on-disk. (Normally you do not want to use the --rr flag though.) Existing bootstrap code is unaffected. # disklabel -e -r sd0 Restore the on-disk and in-core label for sd0 from information in _m_y_l_a_b_e_l. Existing bootstrap code is unaffected. # disklabel -R sd0 mylabel Install a new bootstrap on sd0. The boot code comes from _/_u_s_r_/_m_d_e_c_/_s_d_b_o_o_t and possibly _/_u_s_r_/_m_d_e_c_/_b_o_o_t_s_d. On-disk and in-core la- bels are unchanged, but on some systems other information may be de- stroyed. Use with care. # disklabel -B sd0 Install a new label and bootstrap. The label is derived from disktab in- formation for ``sd2212'' and installed both in-core and on-disk. The bootstrap code comes from the file _/_u_s_r_/_m_d_e_c_/_n_e_w_b_o_o_t. # disklabel -w -B /dev/rsd0c -b newboot sd2212 DDIIAAGGNNOOSSTTIICCSS The kernel device drivers will not allow the size of a disk partition to be decreased or the offset of a partition to be changed while it is open. Some device drivers create a label containing only a single large parti- tion if a disk is unlabeled; thus, the label must be written to the `a' partition of the disk while it is open. This sometimes requires the de- sired label to be set in two steps, the first one creating at least one other partition, and the second setting the label on the new partition while shrinking the `a' partition. On some machines the bootstrap code may not fit entirely in the area al- located for it by some filesystems. As a result, it may not be possible to have filesystems on some partitions of a ``bootable'' disk. When in- stalling bootstrap code, ddiisskkllaabbeell checks for these cases. If the in- stalled boot code would overlap a partition of type FS_UNUSED it is marked as type FS_BOOT. The newfs(8) utility will disallow creation of filesystems on FS_BOOT partitions. Conversely, if a partition has a type other than FS_UNUSED or FS_BOOT, ddiisskkllaabbeell will not install bootstrap code that overlaps it. SSEEEE AALLSSOO disklabel(5), disktab(5), scan_ffs(8) CCAAVVEEAATTSS On i386 machines, installboot(8) is normally used to install boot code. The --BB option to ddiisskkllaabbeell can still be used to install old style boot code, but this usage is deprecated. On some machines, such as the sparc, partition tables may not exhibit the full functionality that is described above. ddiisskkllaabbeell only supports up to a maximum of 15 partitions, `a' through `p', excluding `c'. The `c' partition is reserved for the entire physi- cal disk. By convention, the `a' partition of the boot disk is the root partition, and the `b' partition of the boot disk is the swap partition, but all other letters can be used in any order for any other partitions as desired. BBUUGGSS When a disk name is given without a full pathname, the constructed device name uses the `a' partition on the tahoe, the `c' partition on all oth- ers. In --EE mode, ddiisskkllaabbeell is far too quick to shuffle partitions around; it should keep a free block list and only move partitions around with the user's permission. Also, in --EE mode, partitions outside the OpenBSD portion of the disk should be changeable. OpenBSD 3.6 October 27, 1997 6  abcdfiklnoprstuvwxBDEGHLPTUXYZ0 $T|EL $T|EnL $T|En$T|E(ԃIPITl(0T|E`8.? ɚ; ...@(#) Copyright (c) 1980, 1986, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: main.c,v 1.13 2004/04/07 14:09:35 aaron Exp $PPP$P,P4P> P30123456789=:f/?/*?*n+n,N-N.m'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !+ Hh VqQ:q:QZZ    l h b  w  i x X      0  $  k  j  is a directory is not a regular file (use -f to see it)+aнg +0+bн@dP+p+Bн@e++cнe+,0,dнAfX,t,eнd,,,fнf,,Fн@d-<-gнe`---hн d--HAe .4.iнcP.p..jнc..Jн!d./lH0Lн`e/Uu|agPtPS[X!Using drive X, partition YMBR on floppy or old BIOS Read error No O/S No active partition OxU)dutDvDD@mDD`rDEnEYn0EHEvPE+utETsEXtE0RtEF\u F F@u@FtFHu|FFDISK(8) OpenBSD System Manager's Manual FDISK(8) NNAAMMEE ffddiisskk - DOS partition maintenance program SSYYNNOOPPSSIISS ffddiisskk [--iieeuu] [--ff _m_b_r_n_a_m_e] [--cc _c_y_l_i_n_d_e_r_s] [--hh _h_e_a_d_s] [--ss _s_e_c_t_o_r_s] _d_e_v_i_c_e DDEESSCCRRIIPPTTIIOONN In order for the BIOS to boot the kernel, certain conventions must be ad- hered to. Sector 0 of a bootable hard disk must contain boot code, an MBR partition table, and a magic number (0xAA55). These MBR partitions (also known as BIOS partitions) can be used to break the disk up into several pieces. The BIOS loads sector 0 of the boot disk into memory, verifies the magic number, and begins executing the code at the first byte. The normal DOS MBR boot code searches the MBR partition table for an ``active'' parti- tion (indicated by a `*' in the first column), and if one is found, the boot block from that partition is loaded and executed in place of the original (MBR) boot block. The options are as follows: --ii Initialize the MBR sector. --ee Edit existing MBR sectors. --ff _m_b_r_n_a_m_e Specifies an alternate MBR template file. --uu Update MBR code, preserving existing partition table. --cc _c_y_l_i_n_d_e_r_s, --hh _h_e_a_d_s, --ss _s_e_c_t_o_r_s Specifies an alternate BIOS geometry for ffddiisskk to use. The DOS ffddiisskk program can be used to divide space on the disk into parti- tions and set one active. This ffddiisskk program serves a similar purpose to the DOS program. When called with no special flags, it prints the MBR partition table of the specified device, i.e., # fdisk fd0 Disk: fd0 geometry: 80/2/18 [2880 sectors] Offset: 0 Signature: 0xAA55 Starting Ending #: id cyl hd sec - cyl hd sec [ start - size] ---------------------------------------------------------------------- *0: A6 0 0 1 - 79 1 18 [ 0 - 2880] OpenBSD 1: 00 0 0 0 - 0 0 0 [ 0 - 0] unused 2: A7 0 0 2 - 79 1 18 [ 1 - 2879] NEXTSTEP 3: 00 0 0 0 - 0 0 0 [ 0 - 0] unused The geometry displayed is the BIOS geometry unless another geometry has been selected using the --cc, --hh, and --ss options. This disk is divided into two partitions that happen to fill the disk. The first partition overlaps the third partition. (Used for debugging purposes.) _# Number of partition table entry. A ``*'' denotes the bootable partition. _i_d System identifier. OpenBSD reserves the magic number 166 decimal (A6 in hex). If no 166 partition is found, it will use an older FreeBSD partition (with a magic number of 165 or A5 in hex). _c_y_l_/_h_d_/_s_e_c These fields provide the starting and ending address of the partition in BIOS geometry. _s_t_a_r_t_/_s_i_z_e These fields provide the starting sector and size in sectors of the partition in linear block addresses. _N_O_T_E: The sectors field is ``1 based'', and the start field is ``0 based''. The CHS values will need to be in the BIOS's geometry for the system to be able to boot and use the drive correctly. The --ii flag is used to indicate that the partition data is to be initial- ized. In this mode, ffddiisskk will completely overwrite the primary MBR and partition table, either using the default MBR template, or the one speci- fied by the --ff flag. In the default template, partition number 3 will be configured as an OpenBSD partition spanning from cylinder 0, head 1, sec- tor 1, and extending to the end of the disk. This mode is designed to initialize an MBR the very first time, or when it has been corrupted be- yond repair. The --uu flag is used to update the MBR code on a given drive. The MBR code extends from offset 0x000 to the start of the partition table at offset 0x1BE. It is similar to the --ii flag, except the existing parti- tion table is preserved. This is useful for writing new MBR code onto an existing drive, and is equivalent to the DOS command ``FDISK /MBR''. Note that this option will overwrite the NT disk signature, if present. The --ee flag is used to modify a partition table using an interactive edit mode of the ffddiisskk program. This mode is designed to allow you to change any partition on the drive you choose, including extended partitions. It is a very powerful mode, but is safe as long as you do not execute the _w_r_i_t_e command, or answer in the negative (the default) when ffddiisskk asks you about writing out changes. CCOOMMMMAANNDD MMOODDEE When you first enter this mode, you are presented with a prompt, that looks like so: _f_d_i_s_k_: _0_>. This prompt has two important pieces of infor- mation for you. It will tell you if the in-memory copy of the boot block has been modified or not. If it has been modified, the prompt will change to look like: _f_d_i_s_k_:_*_0_>. The second piece of information pertains to the number given in the prompt. This number specifies the disk offset of the currently selected boot block you are editing. This number could be something other than zero when you are editing extended partitions. The list of commands and their explanations are given below. _h_e_l_p Display a list of commands that ffddiisskk understands in the interac- tive edit mode. _m_a_n_u_a_l Display this manual page. _r_e_i_n_i_t Initialize the currently selected, in-memory copy of the boot block. _d_i_s_k Display the current drive geometry that ffddiisskk has probed. You are given a chance to edit it if you wish. _e_d_i_t Edit a given table entry in the memory copy of the current boot block. You may edit either in BIOS geometry mode, or in sector offsets and sizes. _s_e_t_p_i_d Change the partition identifier of the given partition table en- try. This command is particularly useful for reassigning an ex- isting partition to OpenBSD. _f_l_a_g Make the given partition table entry bootable. Only one entry can be marked bootable. If you wish to boot from an extended partition, you will need to mark the partition table entry for the extended partition as bootable. _u_p_d_a_t_e Update the machine code and 0xAA55 signature in the memory copy of the currently selected boot block. Note that this option will overwrite the NT disk signature, if present. _s_e_l_e_c_t Select and load into memory the boot block pointed to by the ex- tended partition table entry in the current boot block. _p_r_i_n_t Print the currently selected in-memory copy of the boot block and its MBR table to the terminal. _w_r_i_t_e Write the in-memory copy of the boot block to disk. You will be asked to confirm this operation. _e_x_i_t Exit the current level of ffddiisskk, either returning to the previ- ously selected in-memory copy of a boot block, or exiting the program if there is none. _q_u_i_t Exit the current level of ffddiisskk, either returning to the previ- ously selected in-memory copy of a boot block, or exiting the program if there is none. Unlike _e_x_i_t it does write the modified block out. _a_b_o_r_t Quit program without saving current changes. NNOOTTEESS The automatic calculation of starting cylinder etc. uses a set of figures that represent what the BIOS thinks is the geometry of the drive. These figures are by default taken from the in-core disklabel, or values that _/_b_o_o_t has passed to the kernel, but ffddiisskk gives you an opportunity to change them if there is a need to. This allows the user to create a bootblock that can work with drives that use geometry translation under a potentially different BIOS. If you hand craft your disk layout, please make sure that the OpenBSD partition starts on a cylinder boundary. (This restriction may be changed in the future.) Editing an existing partition is risky, and may cause you to lose all the data in that partition. You should run this program interactively once or twice to see how it works. This is completely safe as long as you answer the ``write'' ques- tions in the negative. FFIILLEESS /usr/mdec/mbr default MBR template SSEEEE AALLSSOO boot_i386(8), disklabel(8) BBUUGGSS There are subtleties ffddiisskk detects that are not explained in this manual page. As well, chances are that some of the subtleties it should detect are being steamrolled. Caveat Emptor. OpenBSD 3.6 January 3, 2002 3 O0O)@OHOXOAhOBC)DxOEOFOGOUV aObcOe<'fOhOiOLOlPnPqPq Pr,Ps8PvHPwTPx`Pu@(#) Copyright (c) 1980, 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: umount.c,v 1.16 2003/07/29 18:38:36 deraadt Exp $$OpenBSD: mount_msdos.c,v 1.18 2003/07/03 22:41:40 tedu Exp $$OpenBSD: getmntopts.c,v 1.9 2004/07/05 18:33:38 otto Exp $@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mknod.c,v 1.13 2003/06/02 20:06:15 millert Exp $ ,\D\X\At\\B\\\\C\]714]P]|]]D]]]]^%<^-\^^ ^ ^C^81^ _ _$_*@_t__k\acde fmn0pq0rs0txA*DECM%P R-S TF71\\\\D@jTjpjjjjk,kLklkkkkl0l pksentrttvarrttssthreshsendpiperecvpipeexpirehopcountmtuUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CLONING XRESOLVE LLINFO STATIC BLACKHOLEPROTO3PROTO2PROTO1CLONEDSOURCEUPBROADCASTDEBUGLOOPBACKPTPNOTRAILERSRUNNINGNOARP PPROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD SRC SRCMASK LABEL`tq<qqq8c{ K$\ B08_y@8@X,Dt.$K,Dx0.?<d@LA\dBpdCDEFGHȶIضJKL dM,.N8.OD.PP.Q\.Rh.St.TU.V.W.X.Y.Z̷.[ط.\.].^._.`.a .b,.c8.dD.eP.f\.gh.ht.i.j.k.l.m.n.oȸ.pԸ.q.r.s.t.u.v.w(.x4.y@.zL.{X.|d.}p.~|......Ĺ.й.ܹ.... ..$.0.<.H.T.`.l.x.......̺.غ...... .,.8.D.P.\.h.t.......Ȼ.Ի.......(.4.@.L.X.d.p.|......ļ.м.ܼ.... ..$.0.<.H.T.`.l.x.......̽.ؽ...... .,.8.D.P.\.h.t.......Ⱦ.Ծ.......(.4.@.L.X.d.p.|249:;<=   !"#$%&'()*+,-./017>?@ABCDEFGHIJKLNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~;Zx0N@(#) Copyright (c) 1980, 1986, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: reboot.c,v 1.26 2004/07/09 18:49:57 deraadt Exp $$OpenBSD: buf.c,v 1.16 2003/10/18 19:15:43 jmc Exp $$OpenBSD: cbc.c,v 1.13 2004/05/08 07:05:19 deraadt Exp $@ $OpenBSD: glbl.c,v 1.10 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: io.c,v 1.11 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: main.c,v 1.28 2003/06/11 23:42:12 deraadt Exp $LH$OpenBSD: re.c,v 1.10 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: sub.c,v 1.10 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: undo.c,v 1.8 2003/06/11 23:42:12 deraadt Exp $@(#) Copyright (c) 1988, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: cp.c,v 1.28 2003/10/30 16:01:43 millert Exp $!D$OpenBSD: utils.c,v 1.25 2003/11/24 04:22:44 mickey Exp $TX\`d@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: chmod.c,v 1.18 2004/07/01 18:25:47 otto Exp $ ... ...PPP$P,P4Ph?(h@8h[Lh\Xh\hh]h^h^h_h_h`h{h{h|h}i}i~ i$OpenBSD: regfree.c,v 1.4 2003/06/02 20:18:36 millert Exp $4i(+,+`+,-$OpenBSD: _sys_siglist.c,v 1.2 1996/08/19 08:21:27 tholo Exp $$OpenBSD: siglist.c,v 1.3 2003/06/02 20:18:35 millert Exp $$OpenBSD: siglist.c,v 1.3 2003/06/02 20:18:35 millert Exp $m?Dn$OpenBSD: utime.c,v 1.4 2004/05/18 02:05:52 jfb Exp $$OpenBSD: daemon.c,v 1.5 2003/07/15 17:32:41 deraadt Exp $$OpenBSD: ipx_addr.c,v 1.6 2003/06/02 20:18:35 millert Exp $$OpenBSD: sscanf.c,v 1.6 2003/06/02 20:18:37 millert Exp $$OpenBSD: fts.c,v 1.34 2003/06/11 21:03:10 deraadt Exp $$OpenBSD: regexec.c,v 1.8 2003/06/02 20:18:36 millert Exp $$OpenBSD: engine.c,v 1.10 2004/08/13 14:52:49 millert Exp $$OpenBSD: disklabel.c,v 1.9 2003/06/11 21:03:10 deraadt Exp $PPP$P,P4P>Spam Daemon/var/empty/sbin/nologin3>_rstatd*rpc.rstatd/var/empty/sbin/nologin3_isakmpd*DDisakmpd privsep/var/empty/sbin/nologin1_isakmpdsmmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin1smmspfa#A< k f #  O J _ntp*SSNTP Daemon/var/empty/sbin/nologin2 _bgpd*KKBGP Daemon/var/empty/sbin/nologin2_spamd*>>Spam Daemon/var/empty/sbin/nologin2_portmap*portmap/var/empty/sbin/nologin2_tftpd*OOTFTP Daemon/var/empty/sbin/nologin3Oproxy*GGProxy Services/nonexistent/sbin/nologin3G_ntp*SSNTP Daemon/var/empty/sbin/nologin1_ntp_afs*QQafs Daemon/var/empty/sbin/nologin1_afs_rbootd*PPrbootd Daemon/var/empty/sbin/nologin1_rbootd_tftpd*OOTFTP Daemon/var/empty/sbin/nologin1_tftpd_kdc*;;Kerberos Server/var/empty/sbin/nologin1_kdc_x11*##X Server/var/empty/sbin/nologin1_x11_rstatd*rpc.rstatd/var/empty/sbin/nologin1_rstatdbin*Binaries Commands and Source,,,//sbin/nologin1binoi"NI  i d   nobody*Unprivileged user/nonexistent/sbin/nologin2!_tcpdump*LLtcpdump privsep/var/empty/sbin/nologin2uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2_identd*identd/var/empty/sbin/nologin2 rootdaemonCharlie &/root/bin/csh2_rbootd*PPrbootd Daemon/var/empty/sbin/nologin3P_rusersd* rpc.rusersd/var/empty/sbin/nologin3 rootdaemonCharlie &/root/bin/csh3proxy*GGProxy Services/nonexistent/sbin/nologin1proxy_portmap*portmap/var/empty/sbin/nologin1_portmapsshd*sshd privsep/var/empty/sbin/nologin1sshd[T _Z ? : k 5 k _dhcp*MMDHCP programs/var/empty/sbin/nologin2www*CCHTTP Server/var/www/sbin/nologin2_rstatd*rpc.rstatd/var/empty/sbin/nologin2 daemon*The devil himself/root/sbin/nologin2_afs*QQafs Daemon/var/empty/sbin/nologin3Q_syslogd*IISyslog Daemon/var/empty/sbin/nologin3I_fingerd*!!fingerd/var/empty/sbin/nologin3!smmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin3daemon*The devil himself/root/sbin/nologin3nobody*Unprivileged user/nonexistent/sbin/nologin1nobody_pflogd*JJpflogd privsep/var/empty/sbin/nologin1_pflogd_kadmin*<<Kerberos Admin Server/var/empty/sbin/nologin1_kadmin vm,%KB k f  u p / * Q Q _mopd*NNMOP Daemon/var/empty/sbin/nologin2_isakmpd*DDisakmpd privsep/var/empty/sbin/nologin2_rusersd* rpc.rusersd/var/empty/sbin/nologin2 operator*System &/operator/sbin/nologin2_ppp*RRPPP utilities/var/empty/sbin/nologin3R_pflogd*JJpflogd privsep/var/empty/sbin/nologin3Juucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Bpopa3d*POP3 Server/var/empty/sbin/nologin3operator*System &/operator/sbin/nologin3_tcpdump*LLtcpdump privsep/var/empty/sbin/nologin1_tcpdump_bgpd*KKBGP Daemon/var/empty/sbin/nologin1_bgpd_syslogd*IISyslog Daemon/var/empty/sbin/nologin1_syslogd_spamd*>>Spam Daemon/var/empty/sbin/nologin1_spamdoperator*System &/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonrootdaemonCharlie &/root/bin/csh1root\Vpk-( Z U    z + & _tftpd*OOTFTP Daemon/var/empty/sbin/nologin2named*FFBIND Name Service Daemon/var/named/sbin/nologin2_fingerd*!!fingerd/var/empty/sbin/nologin2 bin*Binaries Commands and Source,,,//sbin/nologin2_ntp*SSNTP Daemon/var/empty/sbin/nologin3S_bgpd*KKBGP Daemon/var/empty/sbin/nologin3Kwww*CCHTTP Server/var/www/sbin/nologin3C_kdc*;;Kerberos Server/var/empty/sbin/nologin3;_x11*##X Server/var/empty/sbin/nologin3#sshd*sshd privsep/var/empty/sbin/nologin3bin*Binaries Commands and Source,,,//sbin/nologin3named*FFBIND Name Service Daemon/var/named/sbin/nologin1namedwww*CCHTTP Server/var/www/sbin/nologin1wwwuucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucplg&!72 G B _rbootd*PPrbootd Daemon/var/empty/sbin/nologin2proxy*GGProxy Services/nonexistent/sbin/nologin2_x11*##X Server/var/empty/sbin/nologin2 smmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin2_tcpdump*LLtcpdump privsep/var/empty/sbin/nologin3L_isakmpd*DDisakmpd privsep/var/empty/sbin/nologin3D_kadmin*<<Kerberos Admin Server/var/empty/sbin/nologin3<_portmap*portmap/var/empty/sbin/nologin3_dhcp*MMDHCP programs/var/empty/sbin/nologin1_dhcp_fingerd*!!fingerd/var/empty/sbin/nologin1_fingerd . install.md set_term() { [[ -n $TERM ]] && return ask "Terminal type?" ${MDTERM:-vt220} TERM=$resp export TERM md_set_term } welcome() { local _q cat << __EOT Welcome to the $OBSD $MODE program. This program will help you $MODE OpenBSD in a simple and rational way. At any prompt except password prompts you can run a shell command by typing '!foo', or escape to a shell by typing '!'. Default answers are shown in []'s and are selected by pressing RETURN. At any time you can exit this program by pressing Control-C and then RETURN, but quitting during an $MODE can leave your system in an inconsistent state. __EOT set_term cat << __EOT IS YOUR DATA BACKED UP? As with anything that modifies disk contents, this program can cause SIGNIFICANT data loss. __EOT case $MODE in upgrade) cat << __EOT NOTE: once your system has been upgraded, you must manually merge any changes to files in the 'etc' set into the files already on your system. __EOT _q="Proceed with upgrade?" ;; install) cat << __EOT It is often helpful to have the installation notes handy. For complex disk configurations, relevant disk hardware manuals and a calculator are useful. __EOT if [ -f /etc/fstab ]; then cat << __EOT You seem to be trying to restart an interrupted installation! You can skip the disk preparation steps and continue, or you can reboot and start over. __EOT _q="Skip disk initialization?" else _q="Proceed with install?" fi ;; esac ask_yn "$_q" if [[ $resp == n ]]; then cat << __EOT Enter 'halt' at the prompt to gracefully exit OpenBSD. You can then power cycle the machine and boot your original OS. __EOT exit fi echo "Cool! Let's get to it..." } get_dkdevs() { bsort `sed -ne "${MDDISKDEVS:-/^[sw]d[0-9][0-9]* /s/ .*//p}" /var/run/dmesg.boot` } get_cddevs() { bsort `sed -ne "${MDCDDEVS:-/^cd[0-9][0-9]* /s/ .*//p}" /var/run/dmesg.boot` } get_ifdevs() { ifconfig -a \ | egrep -v '^[[:space:]]|(bridge|enc|gif|gre|lo|pflog|pfsync|ppp|sl|tun|vlan)[[:digit:]]+:' \ | sed -ne 's/^\(.*\):.*/\1/p' } get_serialdev() { local _devs _d _bd _td [[ -n $MDSERIAL ]] || exit set -- $MDSERIAL _d=$1 _bd=$2 _td=$3 _devs=$(sed -ne "/^${_d}\([0-9]\) .*/s//\1/p" /var/run/dmesg.boot) _devs=$(bsort $_devs) set -- $_devs echo "${_bd}${1} ${_td}${1}" } askpass() { set -o noglob stty -echo read resp?"$1 " stty echo set +o noglob echo } ask() { local _question=$1 _default=$2 set -o noglob while : ; do echo -n "$_question " [[ -z $_default ]] || echo -n "[$_default] " read resp case $resp in !) echo "Type 'exit' to return to install." sh ;; !*) eval ${resp#?} ;; *) : ${resp:=$_default} break ;; esac done set +o noglob } ask_until() { resp= while [[ -z $resp ]] ; do ask "$1" "$2" done } ask_yn() { local _q=$1 _a=${2:-no} _resp typeset -l _resp while : ; do ask "$_q" "$_a" _resp=$resp case $_resp in y|yes) resp=y ; return ;; n|no) resp=n ; return ;; esac done } ask_which() { local _name=$1 _query=$2 _devs=$3 _defdev=$4 _err=$5 set -- $_devs if [[ $# -lt 1 ]]; then echo "${_err:=No ${_name}s found}." resp=done return fi : ${_defdev:=$1} _devs="$*" while : ; do ask "Available ${_name}s are: ${_devs}.\nWhich one ${_query}? (or 'done')" "$_defdev" [[ $resp == done ]] && break if isin "$resp" $_devs; then makedev $resp && break else echo "'$resp' is not a valid choice." fi done } isin() { local _a=$1 _b shift for _b; do [ "$_a" = "$_b" ] && return 0 done return 1 } addel() { local _a=$1 shift echo -n "$*" isin "$_a" $* || echo -n " $_a" } rmel() { local _a=$1 _b shift for _b; do [ "$_a" != "$_b" ] && echo -n "$_b " done } bsort() { local _l _a=$1 _b [[ $# -gt 0 ]] || return shift for _b; do if [[ $_a != $_b ]] ; then if [[ $_a > $_b ]] ; then _l="$_a $_l"; _a=$_b else _l="$_b $_l" fi fi done echo "$_a " bsort $_l } save_comments() { local _file=$1 if [[ -f /mnt/etc/$_file ]]; then grep "^#" /mnt/etc/$_file > /tmp/$_file.new [[ -f /tmp/$_file ]] && cat /tmp/$_file >> /tmp/$_file.new mv /tmp/$_file.new /tmp/$_file fi } edit_tmp_file() { local _file=$1 ask_yn "Edit $_file with $EDITOR?" [[ $resp == y ]] && $EDITOR /tmp/$_file } manual_net_cfg() { ask_yn "Do you want to do any manual network configuration?" [[ $resp == y ]] && { echo "Type 'exit' to return to $MODE." ; sh ; } } ftp_list_files() { ftp ${_ftp_active} -V -n "$1" << __EOT user "$2" "$3" cd "$4" ls quit __EOT } makedev() { local _dev=$1 _node=/dev/r${1}c if isin $_dev $IFDEVS || [[ -c $_node || -z ${_dev##+([0-9])} ]] ; then return 0 fi if [[ ! -r /dev/MAKEDEV ]] ; then echo "No /dev/MAKEDEV. Can't create device nodes for ${_dev}." return 1 fi (cd /dev; sh MAKEDEV $_dev) [[ -c $_node ]] || return 1 DEVSMADE=`addel $_dev $DEVSMADE` } addhostent() { sed "/ $2\$/d" /tmp/hosts > /tmp/hosts.new mv /tmp/hosts.new /tmp/hosts echo "$1 $2" >> /tmp/hosts } select_sets() { local _avail=$1 _selected=$2 _next _f _action while : ; do _action= cat << __EOT The following sets are available. Enter a filename, 'all' to select all the sets, or 'done'. You may de-select a set by prepending a '-' to its name. __EOT _next= for _f in $_avail; do if isin $_f $_selected; then echo " [X] $_f" else echo " [ ] $_f" : ${_next:=$_f} fi done : ${_next:=done} ask "\nFile name? (or 'done')" "$_next" case $resp in done) break ;; -*) _action=rmel ;; esac : ${_action:=addel} resp=${resp#+|-} case $resp in "") continue ;; all) resp=* ;; esac for _f in $_avail; do eval "case $_f in @($resp)) _selected=\`$_action $_f \$_selected\` ;; esac" done done resp=$_selected } configure_ifs() { local _IFDEVS=$IFDEVS _ifs _name _media _hn while : ; do ask_which "interface" "do you wish to initialize" "$_IFDEVS" \ "" "No more interfaces to initialize" [[ $resp == done ]] && break _ifs=$resp _hn=/tmp/hostname.$_ifs ask "Symbolic (host) name for $_ifs?" "$(hostname -s)" _name=$resp _media=$(ifconfig -m $_ifs | grep "media ") if [[ -n $_media ]]; then cat << __EOT The media options for $_ifs are currently $(ifconfig -m $_ifs | sed -n '/supported/D;/media:/p') __EOT ask_yn "Do you want to change the media options?" case $resp in y) cat << __EOT Supported media options for $_ifs are: $_media __EOT ask "Media options for $_ifs?" _media=$resp ifconfig $_ifs $_media || return 1 ;; n) _media= ;; esac fi rm -f $_hn v4_config "$_ifs" "$_media" "$_name" "$_hn" [[ -f $_hn ]] && _IFDEVS=$(rmel "$_ifs" $_IFDEVS) done } v4_info() { ifconfig $1 inet | sed -n ' 1s/.* /etc/dhclient.conf if [[ -n $_hostname ]]; then echo "send host-name \"$_hostname\";" >> /etc/dhclient.conf echo "Issuing hostname-associated DHCP request for $_ifs." else echo "Issuing free-roaming DHCP request for $_ifs." fi cat >> /etc/dhclient.conf << __EOT request subnet-mask, broadcast-address, routers, domain-name, domain-name-servers, host-name; __EOT cat >> /etc/resolv.conf.tail << __EOT lookup file bind __EOT dhclient $_ifs set -- $(v4_info $_ifs) if [[ $1 == UP && $2 == "0.0.0.0" ]]; then ifconfig $_ifs delete down rm /etc/dhclient.conf /etc/resolv.conf.tail return 1 fi mv /etc/dhclient.conf /tmp/dhclient.conf mv /etc/resolv.conf.tail /tmp/resolv.conf.tail return 0 } v4_config() { local _ifs=$1 _media=$2 _name=$3 _hn=$4 _prompt set -- $(v4_info $_ifs) if [[ -n $2 ]]; then ifconfig $_ifs inet $2 delete [[ $2 != "0.0.0.0" ]] && { _addr=$2; _mask=$3; } fi [[ -x /sbin/dhclient ]] && _prompt=" or 'dhcp'" _prompt="IPv4 address for $_ifs? (or 'none'$_prompt)" ask_until "$_prompt" "$_addr" case $resp in none) ;; dhcp) if [[ ! -x /sbin/dhclient ]]; then echo "DHCP not possible - no /sbin/dhclient." elif dhcp_request $_ifs "$_name" || dhcp_request $_ifs ; then addhostent "127.0.0.1" "$_name" echo "dhcp NONE NONE NONE $_media" > $_hn fi ;; *) _addr=$resp ask_until "Netmask?" "${_mask:=255.255.255.0}" if ifconfig $_ifs inet $_addr netmask $resp up ; then addhostent "$_addr" "$_name" echo "inet $_addr $resp NONE $_media" > $_hn fi ;; esac } v4_defroute() { local _dr _prompt=" or 'none'" [[ -x /sbin/dhclient ]] && _prompt=", 'dhcp'$_prompt" _prompt="Default IPv4 route? (IPv4 address$_prompt)" _dr=$(route -n show -inet | sed -ne '/^default */{s///; s/ .*//; p;}') [[ -f /tmp/dhclient.conf ]] && _dr=dhcp while : ; do ask_until "$_prompt" "$_dr" case $resp in none|dhcp) break ;; esac route delete -inet default > /dev/null 2>&1 route -n add -inet -host default "$resp" && { echo "$resp" >/tmp/mygate ; break ; } route -n add -inet -host default $_dr >/dev/null 2>&1 done } isalphanumeric() { local _n=$1 while [[ ${#_n} -ne 0 ]]; do case $_n in [A-Za-z0-9]*) ;; *) return 1;; esac _n=${_n#?} done return 0 } enable_network() { local _netfile for _netfile in hosts dhclient.conf resolv.conf resolv.conf.tail protocols services; do if [ -f /mnt/etc/${_netfile} ]; then cp /mnt/etc/${_netfile} /etc/${_netfile} fi done ifconfig lo0 inet 127.0.0.1 for hn in /mnt/etc/hostname.*; do if=${hn#/mnt/etc/hostname.} if ! isalphanumeric "$if"; then continue fi ifconfig $if > /dev/null 2>&1 if [ $? -ne 0 ]; then continue fi while :; do if [ "$cmd2" ]; then set -- $cmd2 af=$1 name=$2 mask=$3 bcaddr=$4 ext1=$5 cmd2= i=1; while [ i -lt 6 -a -n "$1" ]; do shift; let i=i+1; done ext2="$@" else read af name mask bcaddr ext1 ext2 || break fi case $af in "#"*|"!"*|"bridge"|""|"rtsol") continue ;; "dhcp") [ "$name" = "NONE" ] && name= [ "$mask" = "NONE" ] && mask= [ "$bcaddr" = "NONE" ] && bcaddr= ifconfig $if $name $mask $bcaddr $ext1 $ext2 down cmd="dhclient $if" ;; "up") cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 up" ;; *) read dt dtaddr if [ "$name" = "alias" ]; then alias=$name name=$mask mask=$bcaddr bcaddr=$ext1 ext1=$ext2 ext2= else alias= fi cmd="ifconfig $if $af $alias $name " case $dt in dest) cmd="$cmd $dtaddr" ;; [a-z!]*) cmd2="$dt $dtaddr" ;; esac if [ ! -n "$name" ]; then echo "/mnt/etc/hostname.$if: invalid network configuration file" return fi case $af in inet) [ "$mask" ] && cmd="$cmd netmask $mask" if [ "$bcaddr" -a "$bcaddr" != "NONE" ]; then cmd="$cmd broadcast $bcaddr" fi [ "$alias" ] && rtcmd="; route -qn add -host $name 127.0.0.1" ;; inet6) continue ;; *) cmd="$cmd $mask $bcaddr" esac cmd="$cmd $ext1 $ext2$rtcmd" rtcmd= ;; esac eval "$cmd" done /dev/null 2>&1 route -qn add -host default $(< /mnt/etc/mygate) fi route -qn add -host `hostname` 127.0.0.1 >/dev/null route -qn add -net 127 127.0.0.1 -reject >/dev/null echo "Network interface configuration:" ifconfig -am route -n show if [ -f /etc/resolv.conf ]; then echo "\nResolver enabled." else echo "\nResolver not enabled." fi } install_files() { local _src=$1 _files=$2 _f _sets _get_sets for _f in $THESETS; do isin $_f $_files || continue; _sets=$(addel $_f $_sets) isin $_f $DEFAULTSETS && _get_sets=$(addel $_f $_get_sets) done if [[ -z $_sets ]]; then cat << __EOT No $OBSD sets were found at $(echo $_src | sed -e 's/\(^ftp:\/\/[^/]*\)\(:[^/]*\)\(@.*\)/\1\3/') Set names are: $THESETS __EOT return fi select_sets "$_sets" "$_get_sets" [[ -n $resp ]] || return _get_sets=$resp ask_yn "Ready to $MODE sets?" yes [[ $resp = n ]] && return for _f in $THESETS ; do isin $_f $_get_sets || continue echo "Getting $_f ..." case $_f in *.tgz) ftp $_ftp_active -o - -V -m "$_src/$_f" | tar zxphf - -C /mnt ;; *) ftp $_ftp_active -o "/mnt/$_f" -V -m "$_src/$_f" ;; esac if [ $? -ne 0 ]; then echo "'$_f' did not install correctly." else DEFAULTSETS=$(rmel $_f $DEFAULTSETS) fi done } encode_for_url() { echo "$1" | sed -e " s/%/%25/g s/ /%20/g s/!/%21/g s/\"/%22/g s/#/%23/g s/\\\$/%24/g s/&/%26/g s/'/%27/g s/(/%28/g s/)/%29/g s/\*/%2a/g s/+/%2b/g s/,/%2c/g s/-/%2d/g s/\./%2e/g s/\//%2f/g s/:/%3a/g s/;/%3b/g s//%3e/g s/?/%3f/g s/@/%40/g s/\[/%5b/g s/\\\\/%5c/g s/]/%5d/g s/\^/%5e/g s/_/%5f/g s/\`/%60/g s/{/%7b/g s/|/%7c/g s/}/%7d/g s/~/%7e/g " } ftp_error() { if [[ -n $(echo "$2" | grep "$1") ]]; then echo $1 return 0 fi return 1 } install_url() { local _url_type=$1 _file_list _url_base _oifs _prompt _passwd ask "HTTP/FTP proxy URL? (e.g. 'http://proxy:8080', or 'none')" \ "${ftp_proxy:-none}" unset ftp_proxy http_proxy [[ $resp == none ]] || export ftp_proxy=$resp http_proxy=$resp rm -f $SERVERLIST ask_yn "Display the list of known $_url_type servers?" "${_get_server_list:-yes}" _get_server_list=$resp if [[ $_get_server_list == y ]]; then echo -n "Getting the list from 129.128.5.191 (ftp.openbsd.org)..." ftp $_ftp_active -V -a -o - \ ftp://129.128.5.191/$FTPDIR/ftplist 2>/tmp/ftplisterr \ | sed -ne "/^${_url_type}:\/\//s///p" >$SERVERLIST if [[ -s $SERVERLIST ]]; then echo "done." _prompt="Server? (IP address, hostname, list#, 'done' or '?')" cat -n $SERVERLIST | less -XE else echo "FAILED." cat /tmp/ftplisterr fi fi : ${_prompt:="Server? (IP address, hostname or 'done')"} while : ; do eval resp=\$_${_url_type}_server_ip ask_until "$_prompt" "$resp" case $resp in done) return ;; "?") [[ -s $SERVERLIST ]] || continue cat -n $SERVERLIST | less -XE ;; +([0-9])) [[ -s $SERVERLIST ]] || continue set -- $(sed -ne "${resp}p" $SERVERLIST) [[ $# -lt 1 ]] && { echo "There is no line $resp." ; continue ; } echo "Using $*" eval _${_url_type}_server_ip=${1%%/*} eval _${_url_type}_server_dir=${1#*/}/$SETDIR ;; *) eval _${_url_type}_server_ip=$resp break ;; esac done if [[ $_url_type == ftp && -z $ftp_proxy ]]; then case $_ftp_active in -A) resp=no ;; *) resp=yes ;; esac unset _ftp_active ask_yn "Does the server support passive mode ftp?" $resp [[ $resp == n ]] && _ftp_active=-A fi eval resp=\$_${_url_type}_server_dir ask_until "Server directory?" "${resp:-pub/OpenBSD/$SETDIR}" eval _${_url_type}_server_dir=$resp if [[ $_url_type == ftp ]]; then _oifs=$IFS IFS= ask_until "Login?" "${_ftp_server_login:=anonymous}" _ftp_server_login=$resp _passwd=root@`hostname` if [[ $_ftp_server_login != anonymous ]]; then resp= while [[ -z $resp ]] ; do askpass "Password? (will not echo)" done _passwd=$resp fi IFS=$_oifs fi _url_base=$_url_type:// if [[ $_url_type == ftp && $_ftp_server_login != anonymous ]]; then _url_base=$_url_base$(encode_for_url "$_ftp_server_login"):$(encode_for_url "$_passwd")@ fi eval _url_base=$_url_base\$_${_url_type}_server_ip/\$_${_url_type}_server_dir if [[ $_url_type == ftp && -z $ftp_proxy ]] ; then _file_list=$(ftp_list_files "$_ftp_server_ip" "$_ftp_server_login" "$_passwd" "$_ftp_server_dir") ftp_error "Login failed." "$_file_list" && return ftp_error "No such file or directory." "$_file_list" && return else _file_list=$(ftp -o - -V "$_url_base/index.txt" | sed 's/ //') fi install_files "$_url_base" "$_file_list" } install_mounted_fs() { local _mp=$1 _dir=$2 while : ; do ask_until "Pathname to the sets? (or 'done')" "$_dir" case $resp in done) return ;; *) [[ -d $_mp/$resp ]] && { _dir=$_mp/$resp ; break ; } [[ -d /$resp ]] && { _dir=/$resp ; break ; } echo "The directory '$resp' does not exist." ;; esac done install_files "file://$_dir" "`ls -l $_dir`" } install_cdrom() { local _drive _part _fstype _directory _n ask_which "CD-ROM" "contains the ${MODE} media" "$CDDEVS" [[ $resp == done ]] && return _drive=$resp _n=0 until disklabel $_drive >/tmp/label.$_drive 2>&1; do if egrep -q '(Input/output error)|(sector size 0)' /tmp/label.$_drive; then _n=$(( $_n + 1 )) if [ _n -le 5 ]; then echo "I/O error accessing $_drive; retrying" sleep 10 else echo "Cannot access $_drive." return fi else break fi done echo if grep -q '^ *c: .*ISO9660' /tmp/label.$_drive; then _fstype=cd9660 _part=c else resp= while [ -z "$resp" ] ; do ask "CD-ROM partition to mount? (normally 'c')" c case $resp in [a-p]) _part=$resp ;; *) echo "Invalid response: $resp" resp= ;; esac done cat << __EOT Two CD-ROM filesystem types are currently supported by this program: cd9660 ISO-9660 ffs Berkeley Fast Filesystem __EOT resp= while [ -z "$resp" ] ; do ask "Which filesystem type?" cd9660 case $resp in cd9660|ffs) _fstype=$resp ;; *) echo "Invalid response: '$resp'" resp= ;; esac done fi rm -f /tmp/label.$_drive if ! mount -t ${_fstype} -o ro /dev/${_drive}${_part} /mnt2 ; then echo "Cannot mount CD-ROM drive." return fi install_mounted_fs /mnt2 "$SETDIR" umount -f /mnt2 > /dev/null 2>&1 } mount_a_disk() { local _drive _def_partition _partition_range _partition local _fstype _fsopts ask_which "disk" "contains the ${MODE} sets" "$DKDEVS" [[ $resp == done ]] && return 1 _drive=$resp cat << __EOT The following partitions have been found on $_drive: __EOT disklabel $_drive 2>/dev/null | grep '^ .:' echo _likely_partition_range=`disklabel $_drive 2>/dev/null | \ sed -n -e '/swap/s/.*//' -e '/unused/s/.*//' \ -e '/^ .:/{s/^ \(.\).*/\1/;H;}' \ -e '${g;s/\n//g;s/^/[/;s/$/]/p;}'` _partition_range=`disklabel $_drive 2>/dev/null | \ sed -n -e '/^ .:/{s/^ \(.\).*/\1/;H;}' \ -e '${g;s/\n//g;s/^/[/;s/$/]/p;}'` _def_partition=`echo $_likely_partition_range | \ sed -n 's/^\[\(.\).*\]/\1/p'` if [ -z "$_def_partition" ]; then _def_partition=`echo $_partition_range | \ sed -n 's/^\[\(.\).*\]/\1/p'` if [ -z "$_def_partition" ]; then echo "There are no usable partitions on that disk" return 1 fi fi resp= while [ -z "$resp" ]; do ask "Partition?" "$_def_partition" case $resp in $_partition_range) _partition=$resp ;; *) echo "Invalid response: $resp" resp= ;; esac done cat << __EOT The following filesystem types are supported: default (deduced from the disklabel) ffs $MDFSTYPE __EOT resp= while [ -z "$resp" ]; do ask "Which filesystem type?" default case $resp in default) ;; ffs) _fstype="-t ffs" _fsopts=async ;; $MDFSTYPE) _fstype="-t $resp" _fsopts=$MDFSOPTS ;; *) echo "Invalid response: $resp" resp= ;; esac done if ! mount $_fstype -o ro,$_fsopts /dev/${_drive}${_partition} /mnt2; then echo "Cannot mount disk." return 1 fi return 0 } install_disk() { if mount_a_disk; then install_mounted_fs /mnt2 umount -f /mnt2 > /dev/null 2>&1 fi } install_nfs() { if [ ! -f /sbin/mount_nfs ]; then echo "/sbin/mount_nfs not found. Cannot mount NFS filesystems." return fi ask_until "Server IP address or hostname?" "$_nfs_server_ip" _nfs_server_ip=$resp ask_until "Filesystem on server to mount?" "$_nfs_server_path" _nfs_server_path=$resp _nfs_tcp= ask_yn "Use TCP transport? (only works with capable NFS server)" [[ $resp == y ]] && _nfs_tcp=-T if ! mount_nfs $_nfs_tcp -o ro ${_nfs_server_ip}:${_nfs_server_path} /mnt2 ; then echo "Cannot mount NFS server." return fi install_mounted_fs /mnt2 umount -f /mnt2 > /dev/null 2>&1 } install_tape() { local _xcmd cat << __EOT The installation program needs to know which tape device to use. Make sure you use a "no rewind on close" device. __EOT ask_until "Name of tape device?" "${TAPE##*/}" TAPE=/dev/${resp##*/} if [ ! -c $TAPE ]; then echo "$TAPE does not exist or is not a character special file." return fi export TAPE echo -n "Rewinding ${TAPE} (mt rewind)..." if ! mt rewind ; then echo "FAILED." return fi echo "done." resp= while [ -z "$resp" ]; do ask "File number?" case $resp in [1-9]*) _nskip=$(( $resp - 1 )) ;; *) echo "Invalid file number ${resp}." resp= ;; esac done if [ $_nskip -ne 0 ]; then echo -n "Skipping to source file (mt fsf ${_nskip})..." if ! mt fsf $_nskip ; then echo "FAILED. Could not skip $_nskip files." return fi echo "done." fi cat << __EOT There are 2 different ways the file can be stored on tape: 1) an image of a gzipped tar file 2) a standard tar image __EOT resp= while [ -z "$resp" ]; do ask "Which way is it?" 1 case $resp in 1) _xcmd="tar zxvphf -" ;; 2) _xcmd="tar xvphf -" ;; *) echo "Invalid response: $resp." resp= ;; esac ( cd /mnt; dd if=$TAPE | $_xcmd ) done echo "Extraction complete." } set_timezone() { local _zoneroot=/mnt/usr/share/zoneinfo/ _zonepath [[ ! -d $_zoneroot ]] && return if [[ -L /mnt/etc/localtime ]]; then TZ=$(ls -l /mnt/etc/localtime 2>/dev/null) TZ=${TZ#*${_zoneroot#/mnt}} fi : ${TZ:=GMT} while : ; do _zonepath=$_zoneroot ask "What timezone are you in? ('?' for list)" "$TZ" if [[ $resp == ? ]]; then ls -F ${_zonepath} continue; fi _zonepath=${_zonepath}${resp} while [[ -d $_zonepath ]]; do ask "What sub-timezone of '${_zonepath#$_zoneroot}' are you in? ('?' for list)" case $resp in "") ;; ?) ls -F $_zonepath ;; *) _zonepath=$_zonepath/$resp ;; esac done if [[ -f $_zonepath ]]; then TZ=${_zonepath#$_zoneroot} echo -n "Setting local timezone to '$TZ'..." ln -sf /usr/share/zoneinfo/$TZ /mnt/etc/localtime echo "done." return fi echo -n "'${_zonepath#$_zoneroot}'" echo " is not a valid timezone on this system." done } sane_install() { local _insane if [[ ! -s /mnt/bsd ]]; then _insane=y DEFAULTSETS=$(addel bsd $DEFAULTSETS) cat << __EOT +*** 'bsd' must be (re)installed: no kernel found. __EOT fi if [[ ! -d /mnt/sbin || ! -d /mnt/dev ]]; then _insane=y DEFAULTSETS=$(addel base${VERSION}.tgz $DEFAULTSETS) cat << __EOT +*** 'base${VERSION}.tgz' must be (re)installed: /sbin or /dev is missing. __EOT fi if [[ ! -s /mnt/etc/rc ]]; then _insane=y DEFAULTSETS=$(addel etc${VERSION}.tgz $DEFAULTSETS) cat << __EOT +*** 'etc${VERSION}.tgz' must be (re)installed: /etc/rc is missing. __EOT fi [[ -n $_insane ]] && return 1 return 0 } install_sets() { local _d cat << __EOT You will now specify the location and names of the ${MODE} sets you want to load. You will be able to repeat this step until all of your sets have been successfully loaded. If you are not sure what sets to ${MODE}, refer to the installation notes for details on the contents of each. __EOT while : ; do _d= cat << __EOT Sets can be located on a (m)ounted filesystem; a (c)drom, (d)isk or (t)ape device; or a (f)tp, (n)fs or (h)ttp server. __EOT [[ -z $DEFAULTSETS ]] && _d=done ask "Where are the $MODE sets? (or 'done')" "$_d" case $resp in done) sane_install && return ;; c*|C*) install_cdrom ;; d*|D*) install_disk ;; f*|F*) install_url ftp ;; h*|H*) install_url http ;; m*|M*) install_mounted_fs /mnt ;; n*|N*) install_nfs ;; t*|T*) install_tape ;; *) ;; esac done } munge_fstab() { local _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do [[ $_dev == \#* || \ $_fstype == nfs || \ ! -f /sbin/mount_$_fstype || \ $_opt == *noauto* || \ $_opt == *xx* ]] && continue _opt=$(echo $_opt | sed -e 's/softdep//') [[ $_fstype == ffs ]] || _opt=$(echo $_opt | sed -e 's/rw/ro/') echo $_dev /mnt${_mp%/} $_fstype $_opt done < /tmp/fstab > /etc/fstab if [ ! -s /etc/fstab ]; then echo "Unable to create valid /etc/fstab." exit fi } mount_fs() { local _async=$1 _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do [ "$_mp" = "/mnt" ] || mkdir -p $_mp if ! mount -v -t $_fstype $_async -o $_opt $_dev $_mp ; then cat << __EOT FATAL ERROR: Cannot mount filesystems. Double-check your configuration and restart the ${MODE}. __EOT exit fi done < /etc/fstab } check_fs() { local _dev _mp _fstype _rest _fail echo "Checking non-root filesystems..." while read _dev _mp _fstype _rest; do [ "$_dev" != /dev/"$ROOTDEV" ] || continue [ -f "/sbin/fsck_$_fstype" ] || continue _rest=${_dev#/dev/} makedev ${_rest%[a-p]} || continue echo -n "fsck -p ${_dev}..." if ! fsck -fp ${_dev} > /dev/null 2>&1; then echo "FAILED. You must fsck $_dev manually." _fail=y else echo "OK." fi done < /etc/fstab echo "...done." [ "$_fail" ] && exit } get_fqdn() { local _dn _dn=$(hostname) _dn=${_dn#$(hostname -s)} _dn=${_dn#.} echo "${_dn:=my.domain}" } donetconfig() { local _dn _ns configure_ifs if [ -f /tmp/resolv.conf.shadow ]; then mv /tmp/resolv.conf.shadow /tmp/resolv.conf _ns=$(sed -ne '/^nameserver /s///p' /tmp/resolv.conf) _dn=$(sed -n \ -e '/^domain[[:space:]][[:space:]]*/{s///;s/\([^[:space:]]*\).*$/\1/;h;}' \ -e '/^search[[:space:]][[:space:]]*/{s///;s/\([^[:space:]]*\).*$/\1/;h;}' \ -e '${g;p;}' /tmp/resolv.conf) fi ask "DNS domain name? (e.g. 'bar.com')" "${_dn:=$(get_fqdn)}" hostname "$(hostname -s).$resp" ask "DNS nameserver? (IP address or 'none')" "${_ns:=none}" if [[ $resp != none ]]; then echo "lookup file bind" > /tmp/resolv.conf for _ns in $resp; do echo "nameserver $_ns" >> /tmp/resolv.conf done ask_yn "Use the nameserver now?" yes [[ $resp == y ]] && cp /tmp/resolv.conf /tmp/resolv.conf.shadow fi [[ -n $(ifconfig -a | sed -ne '/[ ]inet .* broadcast /p') ]] && v4_defroute edit_tmp_file hosts manual_net_cfg } populateusrlocal() { if [ -f /mnt/etc/mtree/BSD.local.dist ]; then /mnt/usr/sbin/chroot /mnt /usr/sbin/mtree -Uedqn -p /usr/local -f /etc/mtree/BSD.local.dist >/dev/null fi } questions() { local _bd _td ask_yn "Start sshd(8) by default?" yes if [[ $resp == n ]]; then echo "sshd_flags=NO # disabled during install" \ > /mnt/etc/rc.conf.local fi if [[ -n $MDXAPERTURE ]]; then ask_yn "Do you expect to run the X Window System?" yes if [[ $resp == y ]]; then sed -e "/^#\(machdep\.allowaperture=${MDXAPERTURE}\)/s//\1 /" \ /mnt/etc/sysctl.conf > /tmp/sysctl.conf fi fi [[ -z $SERIALDEV ]] && return set -- $SERIALDEV _bd=$1 _td=$2 ask_yn "Change the default console to $_bd?" [[ $resp == n ]] && return ask_which "speed" "should $_bd use" "9600 19200 38400 57600 115200" [[ $resp == done ]] && return echo "set tty $_bd\nstty $_bd $resp" >>/mnt/etc/boot.conf sed -e "/^${_td}/s/std.9600/std.${resp}/" \ -e "/^${_td}/s/unknown/vt220 /" \ -e "/${_td}/s/off/on secure/" /mnt/etc/ttys >/tmp/ttys } finish_up() { local _dev _mp _fstype _rest if [[ -x /mnt/sbin/swapctl ]]; then /mnt/sbin/swapctl -a /dev/$SWAPDEV >/dev/null 2>&1 while read _dev _mp _fstype _rest; do [[ $_fstype == swap ]] && \ /mnt/sbin/swapctl -a $_dev >/dev/null 2>&1 done /var/run/dmesg.boot DKDEVS=$(get_dkdevs) CDDEVS=$(get_cddevs) IFDEVS=$(get_ifdevs) SERIALDEV=$(get_serialdev) DEVSMADE= THESETS="bsd bsd.rd bsd.mp $MDSETS" DEFAULTSETS="bsd bsd.rd" for _set in base etc misc comp man game xbase xetc xshare xfont xserv site ; do [[ $MODE == upgrade && ( $_set == etc || $_set == xetc ) ]] && continue THESETS="$THESETS ${_set}${VERSION}.tgz" isin $_set xbase xetc xshare xfont xserv site && continue DEFAULTSETS="$DEFAULTSETS ${_set}${VERSION}.tgz" done if [ -z "$EDITOR" ] ; then EDITOR=ed [ -x /usr/b0123456789abcdefxd)B_xdY 0d xl t xd,T 1 M xE p. W xdv||{ xd:||{ h*X>xd<0xd+(xd,xd)t |  xdt | xdg| xdv| |v "`vdxd @`@2X Xd$`>HD>d8D< Ԥ ̪  h 8x؝(tܨD C0EK,LLę`tl0~~~~~@$4 dp4l`# %|''(6t(11|($`@ tPD|HT|,CDDE@GxIH @@$d\`  T hlacG\bd ?"0dd"dv!|A@KBP |0yz{@ !0HpPT\d@l 4\dlt<P Td$X0HpPT\d@l 4\dlt<P Td$X0 Ԥ"8  " "  T"$$Ħ" (("4+<+"0t--@;"=>PxxPYi8`8$Zu`|Zxa$Zx!$Z8`$ZxqZxrZxs([xtZxuZxvd[x[x\x[x\xL\x[x[x\x[\\!\\\\\\\b\ b^ \b\\\xx0]xx0]xx0]xx0]P^P^Q^Q^S^ d^ d^d^xPYxUY`8$Zx`$ZxpZx[\\x0]P^d^x^x^t|FF h`|`H'']"8 4H4 WD2?2?   XD31  SB1 B 1 11111NeN3NQ"NQ!NQNQ&3NQ&!NQ&1NQ1NM1NI1Nm1NE1NE^ & b .,f,b,b܂bܚbܑb܎b܍bmb܁ e T C B ꂀ"T"B"TB BBBB    eB"  55 #0H#@'#PP# '#0'#00'#3'#5'#@"E'#F'#H"PtG#Q'#R'#U'#X'#0'#3'#5'#@ #A(#E(#F(#H (#P(#Q(#R(#U(#b  (#c $(#04(# )#H\ 0D1.7.25|0_#BBB    [129 ( lTdl05#ȌHt4$(p07#Ld+"7#7#U#"7#dpy#<d::B$B aaaI|wbab`b(ge_bihUSB audiouaudioz#~~#dȵddddd0d8d d`dhdPddd  ddȶddddd d(ddPdXd@dddpddddddзdddd@dHd0dpdxd`ddddиdظddеdd d@dpddжdd0d`ddd d  d#Pd'd)d+d0>"L#\###(D  % 3u Du u <u 8u 2u 0&'u 1&u 0&u  ##DX##X# #*#P#D ### # #,#{{#lP$ܨ#T<#tL@ة#8D## D##Pd l GhGGT!0~PpPp<Ht######Ȱ#а#ذ######### #(#0#8#<#@#D#H#L#P#T#X#\#`#d#h#l##$Td\d2d|TX\D++#aa@(([//\))](-{/-|)-}!!c/l-y-soxoco<<>>??  ` ~ ^ "' AAA AA'CEEEEIIIINOOOOOUUUUYaaaa aa'ceeeeiiiinooooouuuuyy"A"E"I"O"U"a"e"i"o"u"yA^A`A*A~ACE^E`EI^I`I~NO^O`O~OU^U`UYa^a`a*a~ace^e`ei^i`i~no^o`o~ou^u`uyX#X`t8PBoldface.iso1 dwfllllllll||| 0 `F8ll8vv0 000000 0 0f<0p000x6 0>p00p>p|`08l 8llF`0| 0|``f`?8`DDE9  2 2 a>wc`aaa?`  0  0f`vvf`    ` 00`000000006??a@ 0  @````@``@? !? ?1```@```0 00`gop``````p@??`@@000  000 ``````p?```<     `xx``88`9  ?0```g ollg`0? ? @@`@`````a``````````` `````` 0 @a``````````````````@a0@0@000?00000 0 0@0@000?000000x` ````a`` `0````````````````````````80acflxx|ngca`px00000000000 0 p`pppY`Y`Y`M`N`N`D`D`p` p x X L F G C A@@@`0 ````````````` @0@00`0`0`07000000x `````````````0@8@#a````|ngca`p0`` ` p<@`@``F p` ` ` ` ` ` ` ` ` ` p@?`@000 f f f v w@3@7@;;p` 0@8   @`p` 0@ ?   ?``00 || ||1`0009 ```gop````````p`xO1 ````p@0`````1 ````````p9`p0``````0`   1```1?`? `@ @ ?0p00790000000y 08````acf|x|ngcnf`f`f`f`f`f`f`p'y0000000y ````````p@8q``````````@p````  ````````p`8````s48000000x00@8 0?  @y00000009`p` 0@0@ pf f f 7@;@;@p@8  ` 0@0@  xp`A8 p`8    8 >`6gC0000~|V`s@ o`?0000?o`@ ``00`0?a00`0`00/@)@(@(@)@/@0``0`0`?` 6ll6 `??0/@)@/@*@*@+@0 33 ???<f0`~<ff< y00000009>`0000x?```?````````` 8<0`0`0`?l6 `` 6l08@@@@08 8D8D8@@@@ 000@9  ? @@` ? @@` ? @@`  ? @@` ? @@` ? @@`   # ##CCC` `````` 0 @  0@0@00?000 0 0@0@00?000 0 0@0@00?000 0 0@0@00?000 0  100`0`0``0`0`0`0`0@1 p` p X L F C A@@`0  ``````` @0@ ``````` @0@ ``````` @0@  ``````` @0@ ``````` @0@ 0`  0` `!!c`c`f`f`l`l`8@8@8o p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` 0@ ``````````8```acc````````ac 000900090009 0009000900096@&``?fff v@;1 ````p@0  0``````0`0``````0`0``````0`0``````0` Dl88lF ````p@8 'y0000000y  ````````p@8 ````````p@8 ````````p@8  ````````p@8 ````````p@8``#c`f`f`l`|@8?`` y00000009`y00000009`y00000009`y00000009`` 0@0@  xp````aaaaa`` 0@0@  xpdd  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ͳɿپ̴ްdd2d)daDdddXdhdxddddd  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~`doddddd  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~     Lda?Ldddd&d!dD#P8(#K%  `   X,nK22Kn,X` %K0$NetBSD: blockio.S,v 1.4 2001/06/02 11:15:56 bjh21 Exp $.symtab.strtab.shstrtab.text.start.data.sbss.bss.arm.atpcs.ident#!e($$A.ee4ee0 9eDe9لeK܆e  \0gBw$ee  [$6"`8-TH<hI4#T`Xd}k$h8q$N$H >t18T ,lx/d;tHp,P Xcx4pp|N4 D!Lc$eDl ȌU#X$.8s$D|Q$4]|depn4,}X<PP$-$Tl`$H\e 8k L p-L D8sEU]de`Xud3$|k < |$xhԨd8dL4$h\(px9d?LU 4ct0?@wgPYh@.X\D ldd!< $`Q$$5x@OLYU]$pH}4X|p c,px e09eG<Lx+`D;4Z$BH4@R[@jλ <@V$k<h$W l4Z<IP$ )05P<=`$N\[ \dXc$t8 ~ T0h@ig\ag${gh~ }g }g(.$ B<t d5DB"HP(Y@$iTHmHy4  T$\> 0X_$  d d% d7 0< K 4%^ |w4p (<\~ \W @ g  R  x  Dd 9$ H?" 1 X HM u$([ D$k hx , p  xh 6  l xu$ h g lQ  (d+ 0; p(P \` Q k ܾx U$ (  <0 h  8jh  q$x og Ԉd   g P , h@< L "T `7g_ &hh <w tK$ # h H D f X  \ P N( g Y\ T ^/ xeE XU  t^ lpp V} d0 L:  h x$l  T  #t \ 4 0} x4 0bTG hW Db@xPj98y`fDLH\d> (_@f DxXq $r$"p<d C\P@_ gHTtxexh$`$4 8P D  g d$(VH/T<@Lp MC$]io84Tԣ @ J4 x +6dd  ($ @ ' 7 FhR fi zT$$LXj H@sgO$XGdh l lsxM8g+9X9 G W| cT@x[l@_g4,LPc|Bhf$@H (({t(d7(((TX$(l(($),),')h=)ئ\I)x3T)eh)tx)dU()$`)@)DT)e))@)tl))*xc8 *l*$(*@ T6*ԙ $E*hgM*^Z*Ĝfr*P*<*i *V$$*P0*( p*8 *\* P*! *t+L8pR+X`a+q+h }+(+`0+m$+f+pB +C$+T+(+ԘL,(S,4',<1,"B,T$Y,Pdd,s,`hx|,h, `,x,p,h,@,,e,:L,9e -yg- $-59-bJ-@h\-|fg-d s-<-h-}g-L- $-` $-MP-k -\- a`-{d..h#&.H1.`bD?.H.pR.D T^.X$t.lX. L.h..(e.8.= . D.W$.@vD/e// )/p0/\G/` eO/`igY/$v,b/T6\p/Tp /\P/ /tc$/H//0X4//xH 0Ȏ 0p20h$500d E0VR00l0ܬx0 00Q$0p00000\f1d 1f$1Ht010}d91xA1\H1(R1c]18q1) x1h1i`1f1De$181T\1(1| 1T 1\ 42x2,2-2A 52oA2/XM2 [2 h2L2X 2 h\2n29$2lt2h2t2,2hM(3ܩd3tB`$3p13sh?3 8L3TW3, h35v30 ~3D-H3f33|3|<3lD3I3|3N$4̞  4td4h#4H64D@4 LF4 O4e4d r4 4# 4#x4T :\~h:L p:Q@:0:;wg ;cg(;h8;\3E;TJM; <X;hj;4|;;d;lc$;! d; T;t;L$;0;̮d;!A;W <1p<D$<8P()<;<XK<LbY<i<@x<]< g<4<L<Vh<<DK$<| <I]$<<4yd=8f=d>,=%=̄-=hd4=dM=5$\=TDn=HX=@f=X/ =9=@O=Td= X= =U  >_> '>f<>dN>D[>Xdh>~s>PW>~d>f$>> >>U$$>x>+ T>[h>@>d?$ x?(h4!?\+? H;?Lg$C?lHQ?\?n ,l?ex?L?3$<?d?P?f?<?@?H[P?\?D??`e @#@\6|&@U1@f:@-J@ \@@hg@@ p@0Mx@@t @Ԙ@@йf@4s@x@}d@o@޻ A< A(j hAi8(A0AH ;A`LAd [A6qAHlyAD AATDATAT AX8AAA\Ld BF Bx&Bdk8BdMBĿaB|HqB`{B`B! BpBDBPBx=B,B@fBlB hCxl CC,5 4$Cȁ <1C|XX9CqCC|q PXCdeCnC@C pyC@hgCChd Cj$hC  C0C$OC,CTCȦCC<Dp"Dt6DhCDOD.$ZDeDEtrD@l|D`jgDDDM0DTDTK$Df@DdDHDDxE(/EqEh?*E$9E f?EhQE @]Eg$ sEd]$E`_gE hEEE@fEV`EXEhEbgE ED FxFМ L F`vh3F`ML Mi`M Mh$MЛlM 8MBPMԇd N NH9$NL2Nм DN$8WNlNdL xNNN`lNzhNfNlApNDNNO g OO@e#O@n8O EO[xXOfOhsOT{OD\OL-$OP OqOO< OXOL4S`>SHFS8 QSP_S$nSC$xS#}SXS8U$SSDdSvS4SlgSS< ,Tpd$T PT`f+T[M[ [[]\e[Xo[ y[ \ [@ $[|[ [d[A [$d [\X[P\ L \x$2\tJ\Ha\Tp\l{\tD\d\K \`Fh\ \Xe,\xW\\t0$\]G&]|g1]h=]H|O]T b]hk]Dx]b]h:X]]0]y$]il]4P]@ ^t^pg!^$8-^L@^,T^Yd\^<^Xq^^<}d^ ^@ ^X^<^*$^v^8^ h^d3 _wX_th"_$,_X>_ 0O_,]$Y_X.$^_0gk_t$___4F0_ P_@cg_0X_$t_ _z _hA`_d`h `4P0`p8 x:`eH` 8W`8{<r` z`#`*`l`` D`|T`+`@h`p`xD`xaxE  aab*af5aHa,dQa aaxsaP a,VapFhataDda4M4ac$a8adaTvdbI(b@d,b8l;b8dHb WbPh$mb( wb{db$blbbHbL@bybDhb bHdb$|be$ c tci$/c BcPYSc\c0icBhsc~gcwc hchc@c@dcDc \cDcLck< ddd,!d(|d)dHV7dvJdSdf_d(dxd*8dgd(gXdl[ d`gd$BdcHd@fd =ed <dX edPe+$@#e-e]t;e eBeo UePT|dedpe@he e CeheePydev ee}eЭ$ex fD$ff!fd\6fBf$If WfXcfp]vfdfhff<^4f f6f0Hf fԓg@>eg*8&g$} 2ghpgXgt hXhh 'h0d-hx48hBDhU Qh`$dhnhD}hpg$ h|`hfhx`h )hp4i( i`fih}did9$ipixdi p Di|jl jZjL&j$2j_Fj?Rj <_jT9kjX( vj_j*jtj `j[xj $j gjX jcgjk kigk @&k h0kL=k` Skp_kT2$ pk@<0k kk gknJn̙ Xn agdn,ylyn\nd n Xn@p$nlnp4nx[n]$nz@n`nz,oDdo D"o@~h&o3oh>o_$Jo(D]o@modx}oLeoXdo oydoD-(o o}o$!pfptp\5"p0pH:pX`$EpX.$^ptepĆppg{pp|p p08p$pluإLMu(h PXufuP7$(}uFhu u uau$1u gu4u0Q<udu(uhvH vydv,)v;v4OvTXvPjv6zvg4v v<v\M$v vdbvvlU$$vowcwPw<+w<7w|d>wܩOwXX\wfjwȬzw-$wܨhw\wp wD (w?ewlew4wL wHlwxؾ8x|;x`eMxpr^xl dvx8x4xnxx̍x$x@hx(#xxy g  yhy@g&y1y@hCy<" NymgVyT7_yP@fyP$$wy= ygypygyV$yRy`5 y@yXy``zvz`cg#z4.z=z pCzXn `Sz@gczxzThzdzdQz(hz/$0z 0z,z<@z` L{Q$${%$){@V(4{ >{@PI{ S{(f{,t{P|{d{0{g{{\x{Y {h{{8 {{~ |T1|7|x$)| 9|, K|Q|di|,$p|pD{| @|8 |l|$0| |`g|h|hy$|+|_ } }l$(} h -}h@7}@}L}# 0V}k}D |}x}$ }}0}0t}@9$}}-$}~T~E!~8l'~m0~-0@~`3N~\~0o~0}~"X~P~D~l> ~~d~~M\~ g~d:@ 0yd_ #t% </`9$PF\Q^Tm? tzd,9Dh0l(d ܹh xpZ 'XHL&.m <\Z$CfQ=ht (0D>tl`$d̀\ՀH `9$(L3$T Lhl( 0A>PQ,[^dj}hc$hǁD$΁ =DlZ$00X(;،E dC8*,h>\LB0\  eXrp $h`Q$$x;e̍0 3<L L$@M,=d( 45`g> H|vRhbXkwTy`4)p tdllŎhӎQ& 0I $|U':dB0K]jew$~{@",bʏd ӏ84V|pd4$&894)HXV>g`J<j:lup$} 0T> l*2$DvȐHА`Lې` PD$ 8$ '0*P$$9X ChHH 4$S TZ\ e@h n vhdt@fDTBTőD d X'0&Ȅ t1>PgcH n zh8l@.$ْ,T (2$ mg$1T/l=(8L0Ha|n${{ td1 P$uH\ɓ ؓ @04lNX,x"X|3$:_Ec<KTn|bdp< ̸igC$˔PDڔ<; he|`xhz0)<@8D|iSh0e{b$ ѕTޕD}PTth TO$w $6$F XMVYp<i!v8dh0(|9 , X Ė\Ֆp|dD `&d/@d7Tr4EDQ0\b nTx ~L @t$$PHȗlҗݗ d 04'g.l:SLHZE$oP>T| t  n LAG8˘d$Pט X2@d$ dF DpPD%\h<Ge[ <ao4(\h,$dlD™ <͙   h< p ?\xd4"ĩd-D<TP] tnh.heP  $.ȹf˚[]$`hg 5T$$T d8> `LW0 bHDvh+\ULP( $ě3$͛X ԛg6(yg [C$#/d`9`FpLXbpglL`Hd8 < H$pɜ8L՜Tߜ=eS 0|d$T X 8h"M$2lD thM\_$Z`c mC|d x$&(ÝΝ۝M$0 $0h`$е"x8$:l <F LOxk0a{8%4`h8tF4d(hըP>b T;e$0( > J Y jP <4 d L#  x©dxҩHs2$Qx t(ܓD5tEhtOY\hoxLydt d0tʪq@ժldުd, pBh@$N\4Իd>hKdUh^h4 u T$$|l<d ȫX ګkl@ T4*lt>JLi$Y`1g`WhnV$$h$NS$$,L@s$ƬLK$̬\ڬ3@zBh,!H `;̉KxxUkcqd~l`fP!Pc$ĭڭ5gyd( x#0HdAh0NH ZD;,jl ~( p<R$$T\ȮlԮ4y0.T t  \$T7 CHMA4ZhDjStTt? Whmg(|˯1կ xh , ̞<X*|:L @]vh|0xq j\zd ,e(ð \аDfװ \` ,q  xl < +048 t CV _h$lHe}&p P,±S$$ѱp D8@th|d( h4g=P8E@%hW_4$oT}d$T$ X# ,²,ɲpTز@"h|i$1@=fG]k8|1gfجY $+xȳhֳd"xM$N(L+P(@&=FhR Dip<xhDd\fLTǴ, ԴHe>,4g |$d&@ 3dG@Q4h`ps P}I`vT$ydM  D <̵ eϵHDصld$x . dD) i|4* X9P/K@6| $DP X\Pish~b$N$,h@<̶nԶ g\u 8+`g3?$FD Tԣ0esoLC$H{gdF$ 4(ʷg^i0j[sHWh4L(hL laXйt4),( $$<28 9WhB$KWHX Hc(h 0v ( 9R$$ͺ\ߺ`}gN(uh x@h' h6eD?W J DV0bqxy|ADD$s@d ˻xHܻ =  fJf0CtDWtd en@0\@hULa,{r@ 7 &|X+8LEPP8tY$96  l"pg/h9T`GFDSf{Hdd,LXg0X E$l`QH hg D$-@t tK$0T,$]d$Tk@r$t`Xp6gx`TD+0$ `UH'd6I|U4f4,s\Gh\u  8L  "l%\h0 t0!@3L9HHVR$$e0Ddv 0DF$h8@VpFD ug <L \dDd!g/x A{d<L,[nXb,Dj(M$4u.$l2 C@Xh,ChO|  fh$Ĉ /89|8DO]$[|cdnk , eL^ |D$( 4d |*3IPF$OH\hddlg4x0@_ @8|ԫ8C$duL<H(O,0V <0KD\bx!iesĥ| B 0$p $T\ X\ <H$V eP;&t3PJ[ rgh8 xh_ \ D`I4`h d .p# <3,jD Vh dXt< l|PFXrxa0|g@h0h$ yp 3$wg)(;|tEthLuhVhj$ b>@ko\}0fxl 0 T0E  tagzgd\mD X0@g:lDl$X ``vdph_$4p[$@T}d4o$x8, Ix%lV`{g _g(d('=7* C PSf tp$@U0@Wh @f<O$P@lf`C` @|g)P/3$6|<uhQ7 d`hi8nrh[}0DL` $f@ Lؽd$HhPD1X?=S dHr83 LAйf@ftHȝ d! hgl ,$p +@_h9GBgJT؂^8de$mf,u NL t]P dexd*8tBLk $Vplxthx <S$$0 D Hdd<.9`Hj ^ hnu|xDI$ B$=e|4\ d   "uh/Y@T S `Ujt؇,$E$$DbTb $L d |``)@5`.xIz Rl[e,tstxX@@dDI 0D:et\f 0A\N,RC^lC$hsLl yHdTA0ET, x ~pO,('8k6CtP*gZHxr,"Lh (LZ$TTlJ N hg,@{P(@  *(h0H ;AxM]xlpd$ o(L{X( p  L;eY @ xd6#h7(?eKddZt(l@xd|̮pk M$qx1+z83@?EMgHS=alw lTnd~xh   0m L DhT04P LOP#3 H:*$(Q; eP`p;24 llQ FhjgHW4\xRh#@/ 06XHZydktsp<lp+܏  ]$lLX@l ($C`"0`%TX2\ P</QX^4h xxPx(PpTx$P D2g] h`;e'M6 NgSDb0m:d$NFh0` 08`g  e@.4L81 Eo8Tshdcl8ydzPPPk<p gH8 D(lL d1h8(O Z hp^d @ag@x0 `v |dY  `Xu)9X N0Sp_| tU$$ܼTxD 4 , 0I,$hfPO \'8Gk \ gXluWdd`hD h(He.$"h*>O$K@ tW`e F$s\| j$$h$XT40l`e`|g04 0Xd$ D.69`$K9eX cop;hxؖ8X0< g<<(-4dtd`& 4p&,/Pd9fH@TtolhTādpZ0M(4(D8' 4-G0dOdel |l4H` D> D$08<Dk P4L|(ܢ7 Tt;eaNphH؟@rgh  geH<Plv@HS*D7%GxH ^ i XvLW|TR# `xH<T .=$/ $@Ld|sȗ<d@f p3X fT| f8drĔ `&8u;TR4Z\:c\qu|{  T@(\p x\Q$(D5$ D8 \ &lx5{g<dC0Ud Xt|dHH9b|hxdX\p 5T/"X=I@<T,\pC fq{yh XX| 4Q$$,4X h%p  \ $ = 5h$P`vq,d|k le\t wt hDB0p}g"D .@Gh9`_$ BHQ XfHXp;e{ L|\ldX(PLC<wgp{gpt(  +d(9 TF<Vd]fܫ<uz[h @L̅\ 0( hL8d0.  zh' 8P< hM Y dj <4pu x$ H $ e  d H   n$ p  x     , xx( X  @e$# d$1 pC 3$M Td *t ]\ ~ Ȣ $ D ( `X L  4 ȯ 3  $ \7 9$= fN  W j  gu    \ / yg Q$$ Q$ p    %   x z<, `7 8 lJ T,$P [4Z b 3w   u  $f m D> P @ d D  ,  @]h \3$) C5  \E P xX` |y HE$$ @U$$ @     t0 ,$ h `H<h:m$8PS$ f Hn_gq`Yhh,\8>̯HTHf$@, `fY *Xd$F,ZTAl؋ z &h@r8hth0f3xT;e4Xd<P$$$! 2! Bt 0K <W Lbn]${ @h4(Ldd He@:g$-< `9@B$ LZ\Vdct rU}fz,M8k h ZP$>ehxhGt/A4TA@[fi_t{0TLn +@ |;,J]@f ydt0C84\D(> |`Cܜe -$Ti B*ZX;dlI\;TVXeDp0o8`h$ D8 lgD!`lp9<ص8l  ċ*D`58wCpQ|a0mn\(`$M glhX &|/P$$? PKp0^D l).DsRT(O|_ (`Xd xgx|8 @g4$`0;pJXh$dr4p$,& P$2gpdm\ (Bt l # Y5 L\B d<O (,Z e dq  w 8$  ` d @ug p     4 (q !,!T.*!4+5!0C! Z!ri!Tv!P D!e\!4K! !Q\!X!f!D$!0]$"^ "pg("d."0:"0d H"(T"f"(Pt""P""d","" " 4"pT"L "l"d #g#`P+#`E 5#|R#[#q#_${##$ `#h3$# ##@ P#l#|]$@#E$$YT $ $ !$(s$2$?e>$`dO$h$|~Pu$Hs$($4$$$h$D$ ,$l $ $8h$d%  %(S$3%PHD%` O%_% g$@p%y%`D%\%= <%H%t%p%|d%DH%}%&@ML&vhP%&A&@ I&PtV&|gg& n&v&0&& f&(D&d$&;e& `&K&&@}g&`:g&F&t '@<','c$6'$D'M'xc$Y'd'| l' Dx'H' L'H' '\T$' '@G8' 'O$'(le(lH$(41(dTB(L(T(a(} \s(i\(z(P (x(T(b$(0R(y@())0!) 1)Hyd@)hi$R)N$])i)4~dp))D`<)l-4)tg)|k)\T))$4)l@) ) xg*` x*@ * g*l(*hB*p.$[*0Pi*;{*\K$*`**lK*rg*@g*l&*T*v*ܑ0+d$+E$#+\ P/+ <D+ xM+}dZ+n+t+H+f+-$ +hq +*+p+P0/`Wh/ /+/'/X@/X\/g/ 0h$0U$60 ?0(P0`0ܷ k0ԡv0x080H0 D0_$0,0d0̃d00  1`%1D,A1 K1(H[1hLl1eu1nP1 1`1e1101@h1:1Y 1 d1h 2xh2 L2 \%2P128C2,M2 gd2$g2 r2,m02d 022$2.$2b$2g$2 L2g2R 3!X3zt#3V$93F3dN3hP[3g3`gs3 }3 338$3 3lA,3Ld3, 3HZ3h3s834Hl#4,4e34>4R4dd]4y$j4C$z4ē 44 4 H4h4EP4`h4xC4L585\]5T\)5p`45?5<H5@xgS5  D`5 ygp5Ch({55H57t t7"77|77 7+g`7  88S%8l28ng98@ZhLB8I8#LU8x f8@{8d8C8@T88 8g8~g88d9h  9 zg9 9 <+9`h:9 Hh H9_9(d9|k x9d9X9P 9W98\h9İ X9&9{9g9P:tg :2X:<8":rg):3: ?:xR:dY:8 f:D$ k:p<t:8d:: $::L(:d$: @:@ g :f:h;`f;n ;&8);Ě 7;DD;0N(U;u0k;@r;hKL;@pg;{ ;$;f;D@;@c$;d;e;d;t(P;<<4$< '< .<PT8<dA<uY<j<hTz<4]<v$ <T<<X@<< h<4D<<<d4 =t=`g&=8d.=h 8?= O=HcT[=W <j=rgt=}=~g=D=m == =jD=` =e = @=  0 >`>@*>$:>R|J>]h$W>0h> t>o>>hL>S>@ >D>>̻>, >xt??Th%?Jh7?J?U?Pd_?@q?8Y@?d$?t?0?|'|?D?  ?dX?` d??b$?e @@d$2@( <@xE$E@@ygO@xi]@=@e@,Cn@ \{@=@@ @`@Ћ@Ln\@<h@@h@t2$x AA/ATs|;A0 PJAQAZA0$fAuAd}A,@Ah$AxA A` A 3$A|,A<4A`A@ AzB%Bh#Bؒ*Btn4B@l@BHSBVZBhbBr$pB4~B BdBDBI\BjBBB`BpiBTCUCM($Ce7CF?C`h LCdTCeC <vC <C`hC C0CC,$CL9xCJ@C(C{d DD!Dh.Df8DGD$ QDԺXDi$gD&0D:gDj TDLD#4D HD$D4}dD\D!D <ExdE(lEvh0EXFEOEUhZE@g`E|O@lE|`|E4wE|_ 0E|E$EdE+(Ea0E܂0EHE|D 8EtN4Epx FhWFFdt `&F,$AFx RFd<bFE {FthF0XF F(@ F2$FNF`F PFp  Fth G8dG|.GDc$AGhTG^ldG\n kGDeyGGZG (GL Gh4pGgGXdGCGtGtHlTH ,!HV$$3HЧDH,P$$VHLqHzH8HHH0RH!HHМxHؒ HܥHI`ygI~(I2g1IAIhSIl X[Il lIx lvI<HIVhI`hI|gIPI IZIfIIy J zhJ( (J5JBJhUJ8 @cJ|mJ4JĬJ JoJ M5MHlM@;MdMDN < NN (N D7NLJNTN |]N`aghN.$ sNGLNh NXNnNܺ@NzNbLN<2 NgNR$O vgdOXd$O|[ +O\6O; COYY|YPZxd%Z$HZ uhTZ^ZPgDlZ4kZ Z}gZHZ@Z`Zo$Z\S8Z Z"D[P0[</[? E[hN[<8Z[0@g[$p[[X[ h[,Q$[[@[l[.$[.[L\ȡ\Z|%\t@:\F\@gJ\̰X\\\o\ {\ \\\ \T\( \\ h\.\@\[h\\] ]l]LX#]п\1]t<]H]4gT]"([]D0k]] ]]L9@]]A]d0]$]DgPb`bjb8b>xb4db Db-Lb1 |b^bHbbWbhcTcc7 *ctD:c\DchgVc bc}mcؤzcСc tc4cIhcTc@ Pc,ct c,$ch c|sd`*d/dJd@ZdPXqd`

0  0 P x Õ<0K,pK0D0* ,P@ 0 Õ? 0 <  D04P@  ÕD?0 0  P@  Õ#D0 P@ tlh `?j202L^T <Y8}#d #d"5#5#5#6#D6#!dl#ty!V! -3 L!$ -LMC 0 T -L -LMÐ@0@ \03 -L M3`T  S,@p3S $3sS3 P00PT@@00 TU 80Ug@0@@DT$#RK ÖU00@ \ Ö(0S U  $0  ( Ö $$3W@j Wp@0T$C ,00d0(#000B0p=0P@0 }000@'H!ZÖU00@ \@3T , @ TZ(3pxZ3T , x[ 0X 0T,ÖU00@ \sÖU00@ \8 3$ ep6#6#6#7#7#H7# -L M`CÖSP00p @ \(s,0 S$3P 00 Ö 0  P@  Ö0D \,pCʠ,ʠ0P*lPbc 0H pl(\UpZEzUpX 0H0P,pZEUpZEzUp0S l7# -LM$3PSc sÐ4 C (0 S W$0( C(0S  $0(Õ,0X \CW00@ \ÕW00@ \03 -LM 3ÐS@00@ \03 -3L@ ,$0(#00"(R 0Q0Q3C -LBMtp0@^Kh` 0 ̠$( 0X(0 4,d 0S   gV!7#7# 0-LM$@KP 1(($ $ 0  t0ܤ"dd Q- L7# -LMRPP@0p @IP` 0  W  7#h$#t$#-J -LcM☁0P@$0 ^0@@R00}/#\Bl1lTTpT H0H0 $0S ,$'pa@0S0!0000iK1 S04 0P#<T0S 008 R 0  0S0 00C0p00T 80H0DQ 4L0H0 gTd8#8#(8#V!0d=48#T8# p-LMD 0 @x@喑Qh`hPhh h0^ pP兑P 84,(!`f@h@@ft8#|8#8#8#8# p-0@LM P0000S000 00`DP00C& R 00#!t000 `0C& X 0 "!04 0 Rpph`h@h@hhh0@- 000 R R 000  0  @00C& R 00#!t000 `0C& X 0 "!04 0 R@@h`h@hhh0 0-LM0? P H0SP@002c1 , 嶷H0S @D@嫹$8# -\1\LM 0H0DDq0P@ 0T0! ? Q00!00 00P00CQ` 0 "!000 0C&  0 "!l0|  Q  80 0P00 @T@T`h@h@hhh9#0 Q- L 9# 88#$R\\ 0R01SH0SQ 00Hfhdh - 8LcM‑8#P, @F0 SBHaH1p P kK $0S! 0#PPP @p00C\ 0  "!0 00 0C&  0 "!0 0 RU ,0 S T,  Pk g@h`hLd9#hh0 9# 88#P0 Hfh -L Ƞ Ƞ,4MP@p <2 QHPy(2Q 2Q 0ό1Q 0B~S001<P   0 d0T N  VS00< R V P0KH0 @0KP T TD 0 ,p L` 8` 4 00S 00<1 P0T0 V 00S X ɔTH KAT H K<PT H0Q @0QQ(0$0phdUU@Ut}f~fh 88# P-L=@0P A p 0 R p)`P00C\ 0  "!0 00 0C& x 0 "!0T 0 Rg\ ,@h`hDfhh0`h@-0@ 00Q000 0 S0  0S00@00C\ 0  "!t0 00 `0C& X 0 "!04 0 R@@h`hdhhh00 R=  0Df -1Ls 88 #4 S@pP`0Pp 2 ,0S t,b [a0[eT }P @ 0 pW@ mT eK0SpP0@0  @ A@0 0S Y p0 0l(0 @RPpPee 3P4p 0W@ 0L Pp@T@TJ$@TZ  _0l0K 0lKT Kf0KkKepKjpKipKhpKgpKPQ0[ XKPX0[ pc@TI gHw#`w# -LMP`4 epڂ P@0 0P 0,p`$   (   00PUe  00@0ꔃ -LM@\00  0e0C0h遃 <0S R -MLM8   ` P@ Č`$ D `D`d4 Pd"d2XKL@ PP H < 8` 0` ,` 4` X TP \ ٱP@ e dPX0@` 00h P!SP!1\XK`P 8P 4` T 嶱P@  eAPX0@P0 h }P@FL0P` PEKT IEK40I1PU0e 0 ,` PX pWP  \0\XKPUW0XeXph0\h 8 @P@ _P@ X0X 0p11\$d4`$34w# -LM, @00 4P4 \e ʁPP \ ,0 $00 -0(2, `\ 0 P0? @./12 0S `V 0S@ `0$ 0@P@Pp8` 0p@T` W [0 R4 0S,0S) 00 107P@4@  >  X4d 1 F? d1 R001 H1 X0SP PR $@I {00XP!U00R00S@U2I? PePU T0S ! 0PUY"00S 00 4 PUT T 0U 0 13 p-LMPP!4P L0@`Te㾀LP XPeph鴀e㲀e㯀@T4 -@`XLPp 0PS /0 1<h PHQ <X0P+X0!RtDx#8x#Px#p@-|` @P  0 Č$ L0#Q `P8Sp0 S0S S -LM@ 0 S0 S  -EMLMX4BNK`@D@D;0` p,  & " PP 0S  ß,0 S ,天KL L3d (K_3(K)@(KC>ß@(0K PEKtßE>K0CI PPK 0KIV0LUPN <#(0KPZ00P00SU@ TKLL?>1 1DQ@ T" Z20"QŸ  0f ~P TdlB 0S0 0S 0S$ E.K B BPP `OP 00S  f{0T0d840` prPPp  U 20  ` 0S}d00 \T @ 0 T4090- PP @S T 0.01 0CĠKd$UNK V0LPC gV!@"xy#y#p!0#!! "lx#t?x#x#x#y#pC,y#Ly# -L MT p90S 0S0`V B P P 0`VT 0  D@ZTP T0S  50S@  7 K P  d P 0  0 00  `PP T0S       @ d 0SS00D m4 h0 y#y#y#$z#Hz#lz# -LM00QTp! Q W `V28PU XQ 0@S`VuX0@!R- -00LTp`W 44e 0S P0@0S@ PU 0f~0 0T0dR R0x4) -@0L MQK0K_m0@K0K0K KK0K@K@K@K -L M`0 Sp-  0S_@ P( K'K$0K#0K* (K0  e\#0 #4,D&K%0K!@K"KxPP 0U:^0 S  p-LMP`P@ pQ T@P@P0S -LM 0@S 8P 0S 0S0 @ -LMMBNK@D@D;pP , Q0 Pl oP C 0`80, P(0P;`Vh\d# 0S* \`#@0B$0$02p00XSQ}0x# l3 0l30  R| ,0S ,圦 P hC\  d#0 S( 10hC\Z( 01, $ g"z#{#4{#dL{#\{#{# Q0--0L@P  Q 00|3S=@ 0-@P<0L|P@0 d0W@ 0-= LR@lSgh3USa 0SdIIIIJLJxJJ X*%10#0 0 0000 %20#00  10#0  0%0  0 0 0 0 00  \0  @ݵ00 00{#{#{#{#{#{#{#{#@- R@ 000 R R0S0S p-L M`x@`<f {PPa x3SUtS 0 S  0< L\0  L\0 00cS 0L0 0\0 P0 MxStÖBePxSp"ct!гtf{ph{# %00-P@L 20h{ - @LM0  f |# 0-LMP@K^ 00CSMXNlNNNNN00K K K  K 00K厳0@KtW ㍮ P v$|# -LdMx x0 Q ,0 t | l@Kx 0| x  R x0t#0 $x P0@ 0D0K1%K U K00 hx 0pK | |p[` VP\ 0 ?>1!B bQ\^P` VZ U5` VP 4\ p0 ?>1!B bQ 0h BP0P` V0| t#x0l CKhKtVKx 0 R0 00 ,0 S ,* gD|#L|#X|#l|# -LdM0@0Cl p , t  Xx 0|0 0|t | 0R0 B0X 0$0P00 @l@ 3t 4R 5Kt 0@J| 4 6KV K+0  Zڼ,0 S ,ңt 0BQV0KfPK` tX0 040F0Et \`P0D0K T#`SSST`TRhTTTU1AhPKl00 0 U0Khpx lr!CK0@9lhPKAhPKl0 U0K0 lAhPK0l U0K0@ LApx 0lU0K0@ I!CK0@ A0px lU0K8@ 0CK@0hPK00 0px lU0K%@0CKx 00px lU0Kp@0px lU0K T@$ 0CKj g|#0#!z#z#|w!D|#z#z#z#z#z#z#z#z# -L@Mp0 00  0`P 0S t 08KX@$ 7K̠@ KI@KJ@KK0S 0S\K> g|#0#!|# -LDMȠP00, 0`tCK W  ,0S d,CDK@D0 0̠UKVKKpEKXhK g|#|#0#! -L@Mp0 0`0P@ `0 0x 7K 0S T 凢0C8K8D$ ̠IKJKKDK#\K g|# }#0#! 0-L@P4P 00h -PhLpf w`Vh hC T! dc@hCdװdfxhCh$}# -L$M` P @$Rp0S  0 R 0$S0S0 R 0S 0 D$uD 0S00S0D0 0SD00 0H0 0  H Y00R00SH0Sf YX 0%S0S00S0 0\\$ \ <0BS0Z[[[[\l30 \l30 \  0> K@0KD0 @K40 0,0 ?K8 0 BHp3Q00p3l3@0l3l30l3dl30l30H8 80Q000 0 qY@}#l}#}#}#}#0!"}# -LM 0`KDP&p 0P \0S0\3 S 0  0P \ \p3 壿}# -MLM@0B.Kd B B0, `P , 0S P4 0$S0S 0 tQ00  4 SBK$0I`#\3+ ᗪ pPUL@* 0S0$S M ` VQ` VAT 0AS^^ _ _4_H_\_p_0` V(       ~#<~#d~# -=`LVPT@x3TH =T0 @DT00(t#2dA %⇰$0 0 $ `V 00 8(y0<0 @ 0(0 ,`lD@p gX`0 0@@$0d ZT0@ 0`$040@ 0`$0E""~#~#~#= Rp3S  ! 0<0   -LM@ 0<01 -<L0 0-D0BS7 %000 R P@0$@&0S0S p0 Plh00S lpP@@K,=P 00 4@ |0XK<P0 |0P08P0 |0@P06P0 4 03 0s0 48<0JP@$4PT0 BP@0P@ @ LPD 0PXC @@0@0T0T0<0<000屉2S0 0C\ 0  "!0 00 2C&  0 "!0"0 R T,0 S l,Ǐ7`@;PP\D 00pB0 0C\ 0  "!0 00 1C&  0 "!0!0 R\ P@h \1P@ p0 pX2 @XPjfPt @0 0C\ 0  "!0 00 0C&  0 "!0l 0 Rt0 Q kixd g@h`h#+hh0#K$ 0-0? LQt@p0 0000h p02p0  h00S00CS0lpxdK$ 0-t0L?A0tS 000h<020P0CS00zxdK$ 0-t0L?A0tS 000h<02 0P0CS00WxdK$0? 1txd 0-LMP?Q@@ 0@0CS004xd -L M`pPt@hTŸŒPP 0PPh 0Sr1 , 1 W |0P0 G1WA 31W, P,0A0, 00C\ 0  "!x0 00 d1C& \ 0 "!08!0 R1W 1W0W 0Wm00S % mnP0P|0lp  0 PPtK$@h`h]t@yt xt hh0zt {t \tjt@ p-LMPP@` UPP0V& 0V 0V  zBt0V  zphHpz00z040Vz00z0z  z z00ltktmtz0  7y S@   ,D  -LMh @0Tpl -LMh @0Tpl -LMh @0Tpl p-LMhPx \y0t`yxplpy@ y0@$ h 02pK$ -LM l0@?0 0S/$0S( (S&|009900S 00h00S plPh D020SxdK$ -LM!l0?0Q@ Rea1p  pa5{0S2.H0SZ⵿H0S' HPP$ p00p0`0P$0 h0S? $0Klp\ 00$AXT\0  @{Xx@p00C\ 0  "!0 00 0C&  0 "!0` 0 R\$ 0Hp01xd@h`hHhh0 p-L MR@tPO 0SLRH0Ka p1d@0 0` 0 p 0p00p0. h0!"Q@00C\ 0  "!T0 00 @1C& 8 0 "!0!0 RppH< 0@00p  p 00C\ 0  "!p0 00 \0C& T 0 "!00 0 R T@h`hK$hh0 -LM@H<D0@(  @P -L Mt`@2h RR2p 0S5 pBp"P000 DP0P0C\ 0  "!0 00 1C&  0 "!0!0 RR <$PK(K0 h0\OXQX1( 0R0 B0( /0a00C\ 0  "!0 00 0C&  0 "!0 0 R\P 噩$0$0 p (0 R0C(0 ( D僩lp 0 K$@h`hhh0## -LM@P<0ST0S@0SX0S0X00@0#T0T0<0<0 -QLM@B0s=## -L~ 00s S0 00$P -MLM쀟BNK@D;`P $ p  @ 0@h0S 0  $0S h$削@0S 4 0  gV!@"#H(#4# -L M0pP`@04 @RLT0S  P@$!KP@ D,!0[`T(K P@%"K(P@"0[P!0[`V(W @01#R1  20DDP(00" [T -L$Mß0 "R, 0qW 3 R4 4 RZ0 40 1,120 D 00SP PR 0S 00 0S00 0 0Q, 6 0 11!!21DP `L 00S%ػ0Q3  0- f 5_< p P<0Ÿ @ @ P 0  R0 4040<f_ 0 P 1L00 R  0 BiAAf ^@<@HD@0 P5@PP0180 P` T P 8 0X1 R⼕0ZP \0? X@ښXJ11T@X@DZ<f_,0OQ8錺dH  -41L M 2`, 4` 1100 X8,  0 2 @DP PXȐ 040%00  R R <P fF_0<0AX@:@ppW@Z,0ꌺd -IMLME`\C_, p ^ 0  R* R xE,0 S h,坈\\5  H@ PW P$ W00Q00S@ ^ lAQ@1@! _tPpH0D 0SH0<0%@H0%H\  @QD0 0C\ 0  "!`0 00 L4C& D 0 "!0 $0 R걽D00lT@!@ 0T#  @3p RpWH@ P 0H@ 0 0dC0 0C\ 0!!034 0#C6000 "!0"0 R#NeRI"000 R@ 0T"  @L2p RpWQ0S 8B0 0C\ 0  "!0 00 1C&  0 "!0!0 R& ReW00Q00S\ JnK`F`FQ@1@!T@# r ssPpH REQA 00 00%P  0 S@1K#T! BnKJK`FI`FID L0  @0S AsPp4S:0 S@1K#T Sp Sp0s  pPp  Pn R'Q 112Cϓ 0S 0S 0 000 0h0R112Cϓ 0L0HrUqUhU pUtAdU@iU@fU eUkUmU jUoUlUnU ~f p-L Ƞ M Ƞ,@   Qh`@ 0 Z0@0CS0pꌺdD -1LM.2A1 \Pp 4U011„CM HAH!`000 00SE 6S) Q`00C\ 0  "!0 00 0C&  0 "!0 0 RA @ H0SOeSA  0S錺dH@h`hhh0@-1  < 40S040  Q0 0 0S00@00C\ 0  "!p0 00 \0C& T 0 "!00 0 R@贷@h`hhh0<0 R <0H@ Q a< %D0% b 0a 0 5 0%  0-1L ,21  R@ 4 0112C !rI r 0 ̓00S= 8S180  1< 0P00  @00C\ 0  "!0 00 0C&  0 "!0t 0 R08SP0H0 ̓00SꌺdHd@h`hhh0dd0D0 0$0(0,0004080<0@0 -LP`Hp WP@(  200tPP# 0-PpLP d@WTp@0hW -L` p$R |Q)0\ t44 0R*\ ,1,\P  \ @U S:U `ᦟ ^?8  (0\ 0 \ @t4S 1t@t$8 #8@0\x4 0 \ $@8 #8@\ 0 \ (@8 #8@,@0@4@H8@<@@@D@0NS:\<D 4S xt1|PP T@ \0|40\0x$Rc $ (0R t4S1t t(0 RxS0 0h UX dP"` tTxT$ L 0 L P0H@ h <t L0 0CP L0 h , ^ (0<Dl80d@@@@@X@@` \@ hUh PdPdP`@h `@V@@0D @0D HLP0Čt4 0CS0!1t  |4h 0|4Ɏ`0X 0 `0d 鬀##Ѐ### -LhMp Pxp@`KP p0S<0SZ,,0 40 'zj? -LlMp t M`KPuP@ @0S<p0St0 SY80K RKG@@-p^@`TQ *?>1 e!\:0> 0C0 n>S -LhM ` PPpK $P@ < R RXp0 SD0Sl -LM 0@S  P 0S0S   -MLM4 P0p 004P( BNK@D@D` ;H嵝0` 孝 kP 0 S ᛝ0\0 (0S p(*00S< L2Rz KA!-K A Bf0@ &PP @DHL R  0S T @ h Q0--0L@P  Q 00|1S>@+ p-LM1 S@P\`|P50p~`Жk 0 x#h -0 RL`p@ @*PX@ P 0p000 @WP:!چE? R 1S 1S 1S m$>FOv\ umu>FOv u00Ba$Q -LTM0PS `, LpX @ W*0@ 0S|K S <00p0 T:!PP @T*0P\@T:@T*0\@T:L0WO 1SPx S@TKTS|KTKb0 0S U@TC#P0 00|kP0P0C\ 0  "!0 00 2C&  0 "!0"0 R YOWuX@,0 S P,hwᄁIu 0u,2$2Ba uŬ0  0<<0S Q1 P @ |K0|  @jT R`1S  K` T!R\13 0K <\ 0[D!2 0K HQ 0[P!2 0K K0e p-!ALMP0`00!b|jP0P0C& R 00#!000 0C&  0 "!0l 0 RYOTt HtD0<0Baphtӫ`h@hhh0T$gfff0 Q-L t0Q 00T0Q L0Q0YS001tb`1 W@W@ WW -0PLPp@0S' p+0\1j?@L`j a壄 00@W0@m004þ\[00ff# p-LM00P@K4墼U` 0 000000奾p 00C& R 00#!000 p0C& h 0 "!0D 0 R 00C0@hhf`hh0 0 h -L|M`K0 K pK@X PP< @0S<6[S4 t0S 8\X 80Kp[Ƞ 80S4^00 1S80KḀ@40Oφh P640RφL P.40Uφ0 P&$#<#P#l### -L M@K KD 0^P -t2L0M<00P00 @4 0p0廽4K08 K000<`K0008@!4`Pt < 0S :0L!48`P` < 0S 0!48X`PC <00SXp7 p0K`0 (48@`P pWG 1Q! 00pWd`0 (48`0pW `ڤ DK0D @@ jy0Z000#00d 48`oP @˒00##14#20#!#p!#X 48ԃ# Q0--0L@P  Q 000S@z -0PLKz0 -LMp`@]L, Y00cX00 S00`XPd@EP0E S e0PU @,0 0 00X 0ĀS@ P00000, uqP0P0C\ 0  "!l0 00 X0C& P 0 "!0, 0 R o3@h`hhh00S0S000000Q00 W@ - 0LS  P 0S0S00CS -ML M "0p,0 她BNK@D@DP ; lLّ0 4ё ᎹP 0 `4U*0Sf 0`V:`V %P 4QBK(0K@AA@(K 0T<0D0(<0s 0 0D0D0SX! P啑40 800 G1 ,0S ,s ! 00>P 0 S 00S< 0(K @T00SD    |\ 0R0S 0S0S 0H gV!#`#######{#Q-0 Q0 -`@0PL0XHPSXAX!P000  BR 8,qP00C\ 0  "!0 00 0C&  0 "!0 0 R0PU ,0S PU@ 0@@+ 0&0 㑵ާ꠸Ꞹ@h`hhh0xdpd 0-LM0088@PLĠK^0 K0K@KKKKPKPKPKgP[0 p-L M8`8@ PK00LĠ 0K#0KK 0K@K@K@K@KKP p0!0 0KBL 0SP -LM 88 `#4V *0X 40S 0S Q 0 @0  P0@b" ?#? UC1@i#P0S0/"?CQ@00CS0 l@04< P0CP1 R> D0s; 4DH0ڵP60W00LS0LP0P SP PP@DH@A딐HQPNLT`pH@@P 00 pUPH0 0 pNLK00@ 00@0-zd$#Իdt -LM080@# 0 <@   ( j!(j!H0 ҳP P= q  B>0S? 4µP 0 S00S=  X0S 0PUf 00S> 00S<   ؍PJ > < : 8 6S'000S PS00 gV!#@"$#(#+"4#8# P#h## # #";#Ѕ#ԅ#܅# -L`p@P@PRPU@ZDAD!P000  BR qP00C\ 0  "!0 00 0C&  0 "!0 0 RAT PQE0X1 *0  tI @p@h`hhh0 -Q L1-  Q S 0S ]u -L`p@PPPU@Z@P`@PPU@ZH@`Yp p-LMP @ 0`@TP@ Ƞ,Ƞ OLP@@p p-LM@HP8P #8 T0 000C+Pࠁࠓp -LMP@U`1p @0<0L00MQ0PNPOPRPSP L0 -L ML0Xp 0 8@8P`DD!LMNORPPQ@S` -LM0p,  40 0`0  N=WP$ FFFL08 >0U0d0S B0e f0C 0g 90K Xh 0C4i0 j k000mno@l`9pK9 [qp , srm|̀00`040080@00D00d @#0Sod p-L M0PS@- 0BS|+,,-+-/D//T 0R0P RA R*R# T00CS000@  0PPpphCG0\# ֋ | 0 yT T 0Q0ph {D 0@@@ 0@ T R 0\`@ `@48" <S^  hi0jk 48 P`7 H00H0  R@1J#T ,K,@ < >@舲0S ,SP,0S:0 S:#S@٬H00CSH0 ᳳS S<Ƭ d# -@1LM (("AL0`SA0嚬Pp: gPP3 H00H0  R*#R$ ᛬H00CSH0u $RX >hD$K PP0 S:#S$0 P P<p d # -L/@@3#2"0RR#@2C.K B-P@#0: pa8?HbL!L3 p%.pz0`TT2S X2S \2S  ,0S ,:aܒBNK0 <4 2@D @D  ;i  o20pL0x"x2$0p"p2 0 P0PjT2nP"40L28  @<0 0"02pn 0i$ R "0n"nM^i #^1  <$A 00C\ 0  "!|0 00 h1C& ` 0 "!0LPP? 3LPP? τ%Ld @1oPP ̠` ` P僡倠p~ 4zpw s fpgĤ### 0-? LR^? ( R $@T ;0@T0 0-@LNP000,  0 -@?PLP`p2 t2 \ ~d2\j*\2\Z T2\* pHB0 0C\ 0  "!0 00 2C&  0 "!0!0 R靐$# = S =@S @ 8C8pp2g$p2  * jp2  @ 404H0 R0ᕞ 0d4P p40e0\ |0\p0PL~|`0\y. 0hps@h`h2i 1i i i hh05i i 6i( -LMd0@0Pd0ya!p0O000 K峠 0S(@p00C& R 00#!|000 h0C& ` 0 "!0< 0 Rޏb!@h`hhh0 -LMP0p@ T _#3X`PVdP=hP$`PPP`PP xP/4=4x/b댂)bUP hĞP0h2 yxߨ sx?P d实P0d2Ϩ xcxɨ d]x)P `嘞P`R꺨 ,Nx괨 Hx$#D#d###ĥ# 0-LM?@0TA KPK0K 0?00K00K0K0K@K@KK@KܡPPP[ -L M?@TA K0K ?00K00K00KK@K@KK@K弡P0 [0[4 p-L M?@\AdBT0 K  p@0 0K00KPK`KK@KKK噡P00 0-LMQP@ ?0@00KAĠ0EKK@KPK0KKK0K|P0 0-LM?0@P K0K 00KK@K@K@K@K@Kd0PS0w0# -LM0p4`,? <4 ??\ !?@?\ QU@ P4<4$ ?@8b;;1,"  3i0S %b;;!,0U@P40]$ -L M?@ \K @00K 00KKKKKKKPD&wģ# -LM 0S4 0 0嬡P 00hd -LAM0BNKP@D@D;p` ( ⋨v v 4PR!2 `!.2`/2..2C.K2rr B0P tv (0S \(aX4@ 兞0PT4傞Pz 0 Sn00S" b0@TBNK@D @DQ!`000a v f10@L0!1$0!10 P 0pa~Ua UD1D  `0`0C\ 0  "!0 00 0C&  0 "!0 0 R  ~X00S"00S"  ` PP?  oPP ̠  L P偙~p| rpu  ## -@?PLP`pHH2 <2 \ ~,2\l*$2\\ 2\* pB0 0C\ 0  "!0 00 1C&  0 "!0!0 RȈ$% = S =@S @ 8C8pl2$l2  `` `l2 `S @ 4040 R0ᾖ 0\4Ppp0]P0\D0PLՂڀ@h`h2i 1i i i hh0i  -L MP0/@ qTo d00d0Gq 0$K000 $ A0S'@00C& R 00#!x000 d0C& \ 0 "!08 0 R @hb!`hhh0 -LMP0p@` TnP PS$P:(P!`PPP`PP xP4=4&xmb 댂gbꓘP (P0(2# p p}P $P0$2  xp dpgP  ֖P R ,p p$#D#d###ĥ# 0-LMP"D@0K 0KK@KPKKKKK#0 0-LM8QP#@0?00K@!Ġ0%K K@KPKK0KK0K0 p-LMP,K)P@; 0[ [4S? `9p0A @P@+0-N @P@0@ @P@ .rps Xppl @h 4,op0#  n X###Ц# -LM04P <4Ϡ000  mW/A0T00p` @ 0ȠȠ W p" aP `0_T@4O<4 0 8  #88 4  -LM @֢P}/P o h頡ģ# -LM 0S4 0 0 P 00v -LAM☣BNKP@D@D;p` ( `Wo TSo ᓢP@4&Q!(3 `~/`PB.K B BᑗP@,0PT2S 2S "o (0S (P 0P@TP2 f&P0V $2$R` O @ _Y n _10@L0!1$0!10 P 0pAZMXY1  `0`0C\ 0  "!l0 00 X1C& P 0 "!0,!0 R f괅,iP 0 S00S" 0@Tf00S"00S"  ln] gV!@"#####$# `h@hpx! гmhh0L## -1qLM` @ 00PP[0S)xA`00C\ 0  "!D0 00 01C& ( 0 "!0!0 R24@'X]MP00`00C\ 0  "!x0 00 d0C& \ 0 "!0bf%002`h@hmhh0Q-0 Q?0 -RLMP P$ ; 0 0 Pb2@ 000Jdܢ@0@0C\P 0  "!0 00 2C&  0 "!0d"0 RU 01(2 0000 0!C \! 0  "!0 00 1C&  0 "!0!0 RS$000p1X1ppp p@ 0X00c$@0@0C\ 0  "!0 00 0C&  0 "!0  Q$ R 1 0+10 ,p(pPT ̠A0  @坔p"0lpR,0K 2, R \ 0 4,0 助,0 S\00\0X00X0, 1 P0 00x7P\00\0 4P*T@0 0C\ 0  "!0 00 l0C& d 0 "!0@ 0 R 4Dt8#@h`hhh0 -P?LP`p0@5DD!0W00$+$9 WW( A00C\ 0  "!0 00 0C&  0 "!0 0 Rmd00d0< `kW ؓ`00`0 e p0S E@h`hhh0X# p-AMLAO0P `0 P  0/"-C4? 0@ \X  Pd20d2p kp x# -LM@? R4+Q P 4;4Q 0S000C04P4 ;$4C -L M0`4P@ 阁1p @0 @/ 004  00 @ >7PA 7P; *2S- 4@@04$+$p00C\ 0  "!0 00 0C&  0 "!0d 0 R iP (@p0(j@h`h#hh0# p-LM@!> ?冐PP"> }oPP ̠ L Pp jp t## -@?PLP`pDD2 82 \ }(2\k* 2\[ 2\* p B0 0C\ 0  "!0 00 1C&  0 "!0!0 R^$$ = S =@S @ 8C8p(2$(2  ?  (2 ?  @ 4040 R0U 0fU4Pp p0VP0\D0PLՃځ@h`h2i 1i i i hh0i  -L MP0/@ qTo d00d0i 0$K000 們$ 0S'@00C& R 00#!x000 d0C& \ 0 "!08 0 R %@hb!`hhh0 -0pPLMT@PS P:$P!T`PPLP@`PP 8P4=4Đ8 @b꾐LTb1P $堏P0$2 Ui껙 OiP  劏P0 2꫙ x?i꥙ d9iP tPRꖙ ,*iꐙ $i$#D#d###ĥ# 0SH08 #\ 08S0 S ᜼d -ML M BNKP@D@D;` , ‚h h )P #Q2B.K`< B B`.P l0@匐0PTf2S 2S 2S $ h ,0S ,LJR2p 0@ ;!L01 !0> 4 P0T1!`0JT IH`G3F1`p0p0C\ 0  "!T0 00 @1C& 8 0 "!0!0 R k0"P 0 S00S" 0@T00S "00S"   X:h} gV!@"####@h`hddVhh0# -!aLMP0威000pS0@)AP00C\ 0  "!X0 00 D1C& < 0 "!0!0 R~4@2wAG@00P00C\ 0  "!0 00 x0C& p 0 "!0L 0 R o~`h@hVhh0Q-0 Q 00U -RLMP P$ ; 0 0 Pb2@ 000^ܢ@0@0C\P 0  "!0 00 2C&  0 "!0d"0 RU 01(2 0000 0!C \! 0  "!0 00 1C&  0 "!0!0 RS$000p1X1ppp p@ 0X00]$@0@0C\ 0  "!0 00 0C&  0 "!0  Q$ R 1 0+10 ,p(pU8#@h`hhh0 -h1PL`Pp0@5HH!0W00$+$9 WW(A00C\ 0  "!0 00 0C&  0 "!0 0 Rm|d00d0 deW垍`00`0 + p0S 9U@h`hhh0X# p-AMLAOP `0֡ P XX  ɌƋPL20L2p鿕 Sep# -LM@0 R4+Q P 4;4Q 0S000C04P4 ;$4=U -\1L @R0P4@ 4q4!`000k7P? A7P9 2S- 4@@04$+$`00C\ 0  "!0 00 0C&  0 "!0h 0 R h{P ,@`0,dU@h`h#hh0# -LM@? !>mPP? 3dpPP? τ$ @p嚊#nPP ˠ ` P 4{d ܔ Ĥ### p-0LM@PQ00 4@ R R00R``V pd20d20SUphQꬔX"0 ?ddbU# -1@LQpU\Q\1` P1 \ < 3<1\* p0A`00C\ 0  "!0 00 0C&  0 "!0 0 R{4040\  RL  @ p@ )U@h`hi i hh0i 0-P@P0L HR 0d00d0c 0S 0heUb! -0pPLMT@PSP:P!<`PP4P(`PP  P4=4݊ $(b׊4000S0p  0 0p p) xAP00C\ 0  "!D0 00 01C& ( 0 "!0!0 Ryႜ0崀00P00C\7p 0  "!t0 00 `0C& X 0 "!04 0 Ry`h@hhh0 -"B0L00pȢ2P0   0S bP00C\ 0  "!h0 00 T2C& L 0 "!0("0 Rq0 Q00-0 @0 C \  0  "!0 00 1C&  0 "!0`!0 R|00|0By000Spp0 @0 C \ p 0  "!0 00 0C&  0 "!0  QX0l0X0 lyy000 00 yZh@h`hhhh0g p-L M @Pp靉P圉P00U\0 4S ` 0S VpK K00S p 00S0S` 0 $R0S `  -CML MⰓBNKP@D@D;` , |a0P 8G0p P~a0DH 40S$ :P  D0H # ß@ 00<@  `a,PU(0!RPU@P i 0X4 T4 0PUpiX4s t[ T4s dV 0囋0 D0 H0OPG0L00 d h0 PS%0` g̩# 0-@ L@ PP D@ A_ 00C00A00S 0-L@<PP 010< 7M< 0000 -RLMp R |0^`l@0FGT@0$K $0K#K!KPK"`K pK@K@K嗆R  0^`l -L MH0`SP\8Q Q_ @0K0G@0 J 00K/K-K.pK,K+K*@K)@KhPC0 @J   LL< S@ 7S@0L@D@0 p 00K-K+K/pK.@K,K*K)KEP 0-K.K 0  0.0K- K.K-K@0@0  00K/K,K+K*@K)@K&P S@  S@( RD ʖR ʖR KR qKRqq R K RlqK R`q~\q|XqzT1R H1R  R4pn R pjph1R  Rq`0Rp[pYpWpU( K R% ʖR KRpJKR RpDpB R ʖ R K Rp9p7 R D0R p0p.p,p*' q8A-@NS@00RA00 -LMRL0L`pi@0FGT@0$K $0K#K!KPK"`K pK@K@Ku -LM 0S4  0 0CP 00T -CMLMD3BNK`@D@DP; , "[ [0@00`D T4 X4 P@ y[0`02 ,0S ,=0+PT 4 ἃP@ Ƌ T40p80 To@0si 4<0SX  @8 0pT2X4s+ T4s& 0X0W04\4 1,L$ 0x0f  (  Hf # <0+S`d L ! T0S4XT0 {P07}PD 02}P\ 0) 0X TU!0@ 4<0{P@  00錽dD#p# -$0 (("L錽d 0-@DLP-\P&80P<PTPHP `Px00x00f 0`0f 0H0f}T{TPa}<{ykM|K|@h`hhh0xdpd(0 (("1 REጽd< p0S0p0 Q0 0 0S00X0 (("!\10S0< 80p0 0pጽdd 0S 0?S 0R  -ML MPBNKP@D@D;p , ⥅T  T NP`B.K B BY|P`4BBK(0KAA0P4`;|(K 0V@P080@0r80sk @0sh P0se 8 4<0yP` 0X4@D0 yP`&4PT0 yP`{PX zP\ zPH zP` zPd  S ,0S d,/5X10P1P00708!t7gp0:0p 5xySuS46{P 0 S 00SP t0(K @Tx00S8   00S@  X gV!@"###ث## #D#l###ܬ# f2## -LM@<0P0KDPFTPAQ!`000  BR 8p`00C\ 0  "!0 00 0C&  0 "!0x 0 R pPP0 w:izzz@h`hhh0 -LM@<PDPTPXP`Pz0`0z0X0x0T0x0D0x0<0Q-0 Q0<0S8<0 -LMlp$`KP  @=0$0K\h0  0 #K 0KX@B\0XT }Π @yXx0S 0,0 0- lh X0@ 0X0P0L00lBP0P0C& R 00#!p000 \0C& T 0 "!00 0 R00hAi@h`hhh0 p-L M`l@P0K y $0U0b(0 U 0,0:p0 ,P d >BU0,0S_p p-L MP@ 0K l`yT T 0,0pd4 B0S0T00 0-LM@HDh4}ΠL0  lP/yH,xP0,00 p-0LMSP l` S0 0,0phh<@ `d0<}Π @y`xPp p-LMR@lP 'R 0,0ph$ R,  0 < `h`$0  0P`d0  x`wP,`pd ATR0 -LM 0P `pW$0S@"h@lP \AXT\0@d@ }Π @xXwP 0,00h0X  X 00QH#, -L M`0 p:P@ V 0Q \P囀  0S0 00 00,0000  PP" 0S0 0pYP 0 0 @ 0@h -L M0@S K 0KS .0堀 Q-LpP 0S00@T 0a @P@ 0T p-@PLMa `@P@DUL< D0vP< 40 Q$phmPlPjP# ###t" - QL MpPr<0Sl8P@e 00K4 K400 ,0K( KP` (04@KP  @P@B 001< 000p R+ A0 0C\ 0  "!0 00 0C&  0 "!0 0 R/g04`0 0lpp@4(00 @h`hhh0 0- PRL R1<@T  0.;0  );0p0Sl0 0 0-0LS@P0Pxx ,0 S P <0 T  \0 0hh 02xd`#pdK$ - QLMpPf0<@T_ 1R 0S 0 HaH!000p R? 0 <0 0C \ 0  "!0 00 0C&  0 "!0 0 R 00@f400  `*O x*.fp@h@h`hhh0,# 00sS0S  0-LM@P 0 A0S ``0 R 0P0 R@@,0S  R0 840hdxd`#pd Q- LND# -LM0  Q- LND# -LMP@ x1P`c ThPB  0``` `jP<P1P H1PN&P (N<0l`p0`N00q4080@V(T!t0@12c10 0!/B!0  -00 Q 00 0z f 0P0@T0CLT#@h\#`h|#V!(d$@fID$4K# -LMd@P``p"00  0 0  0@h0#!hd h - (L|(P"!$RR01SN RM RI1<`VE @T' p!20#p1 0lP$  0 Q0p0h 0PW 0S 01< 01< 00 0$t`0 X 0K<0 {pĽd(27K$+ -("LM \ w$ 1<`@T 0SCh 12i0S3 0S0S 0!0 0P|1 l1-9$0K#L! 00 0 $1 R 0 $ @0P  P0P0C\ 0  "!0 00 |0C& t 0 "!0P 0 R@dĽdK$hhhWh@h`hhh0 -0LMT0 ^@ 7 <0@0S h02@ĽdK$ -0LMT0 ^@ 7 <0@0S h02 @ĽdK$ -000  QL 7 1< JĽd# -L M @.W` .D`pP0S+ 1<@T h0`Œ 0P 0`clP  0`P  0`p 0`oĽdK$ -LM0@400 -@#LMTp` 3T  01PP3T G3T; 3T 40 00S000H3T @3TQ 00 0S 4 -B2`:2`:00 0 0002T- 2T od2T \2To00 R 080 400 PP 0S$0PP00S P 1 1QP"P T1 \1QP"t+Q~0 R% 0 0ASQ 00 0&0S4 00}t*0S PQQ0S000o00S00W@WLWKW@DW@RW @EW$QW VWPW \ h 0 \2pp0,R 0 \p KP@@,`0h "0 T@DK$ -1aL M@ P p0QppQ) Q@00C\ 0  "!\0 00 H1C& @ 0 "!0!0 RF_2S 0W0 K0" 0,PrP@00C\ 0  "!t0 00 `0C& X 0 "!04 0 R _`h@hhh0W -2L@`p-  Q.1 -p0LS Q R hP0 R$ p-LM0@S`PP`pP 0 S00 0S Q00   Q 1<0 S 00  p0 Sl  -qLMP`K QG<@TC $$"p000p T 0"0 00`<0`T 0`0 0Ap00C\ 0  "!0 00 1C& x 0 "!0T!0 R\ !p000p R @ 0@p P00R00S`@p00C\ 0  "!x0 00 d0C& \ 0 "!08 0 R9\@h`ht#hh0Qp 00j$ -LM,@0S  P `h -X0LM KR @ 8P K0 <   h`h@h 0-Lt (0PR0X0@P@ 00$ R 800S04Ľdhh0 dh0  dhG -DLM\ 0<40@`h Q-0L  pS0  A b00\p40 -LM0@ 00 R 0tS0S00# -00L 0aS@4  P0t00 R00+R00p0P00C& R 00#!000 p0C& h 0 "!0D 0 R h/[00n# @h`hhh0b 0-LM@P$KT 0 P  0@SQ0@SP  0 0@S  0>0 XW 0Ra R R P-L P ?#?00cSLLLLhhhP Q hQ h - PLM@pPL TD T@XaP+ 00<@\ 0 ?02  <2200< R00< R00< R00< R00< ,PT02o@ 0(@"P00R00S0P 0200 R`P0 r`f|#h -LM0Pp 0専p@1`1@D0S0ץ0CS`` p0  00CP0ҥ0CP0p 0l""0pP ,0 o9 (0 p ,00,0o`f -LMܠHp0$H 400pP1`s1 0p < P)$p 6 :w0 p1`T1P 0`f 0-h0 !Xp0 L0  8#UP@008#HT`f -!LM0, p 0嶂@11 8C00C8#0 p04`0p0@!1P1  0 P8  X#, R Z 0J X`f - LM0p 0崢0 J , 0 8p C04p@0`0P0  0J8 P #,0XY0I `f -8!LM`p0 P@010`00C8#8 4,0 0p 00P  00 p04`0p0@0P q0 H0 !0 R8, Z#X0H`fD -TL M`p0  @JXE0 0`8#84,0 U0p900P   00 40 0Jp 4p 0`@70P0 \ 0I!48#00 R, X040S0C040 4`fD -LMܐHp0$H X0`400p/ 0p 8%X h`#80A40/p/  1@T@`fD -H!LM0 -L"R ! B0,0 `0T00 S0R !0 TS2 a0 BRDPH@0S 0 l eR`1`!aL^HD H@DP34fQ @XQ- "PQ(0T@PS>0 eR`1`! b\ Ġ$4 T@>$f44$.cQ0S$ 3T 0Q3 0/S5 88ę8̙88888888888888ԙ8ܙ888880@VP `VXK 0\@K@IPX0\ @004 8PJ?##i?h?l?p$? -LM@P`p 0@0 00P+ 0@`@ 0@@`@ 0@ 00@p@`00 0 0-PLU@ U$L ( ^0 /R 19R00C P^L0 0 C000^L00C-p#AQ$Ԝ!R,00 ,R ,0,00,0 p-LM,@AP0CQK`О !R@ ,R@,@p!R@ ,R@!R @ ,R @ !R@@ ,R@@T@` @` 0V!R@ ,R@ p-LMP@p !0@Tp`@t 0!0@T@`@x 0!0@Tph|!|! -LPp@| !0@TDD@`01| 0 !0@ T!|! 4S!3=8S>08S, >8 ST3T#1 $t2Q h2Q `2Q L2L2H2@2Q 82Q,2,2$2$2222Q 2Q 2Q111Q 1Q1111Q 1Q ʼ1Q 1Q1Q 1Q1Q ʈ1Q 1Qx18 h1Q `1QX1T1<1< @1}<1{81y41w01u,1s1k n1!10 101;C Ⱦd@7p#t#x#|#############hdȱ#б#ر#ܱ#####fd53 0-PP0@0 L * 0h  -LM0PS#0000QS 0BS0%pa 00C|a2\ 0  "!0 00 2C&  0 "!0\"0 R&0 0#B Wp 0`00S@g00P0T0SpWWp  `p-D@p0T!2@mP`0Q HA00C\ 0 !1 0!C600  00#!0 0 R C@00C\ 0 !x0 0d C600X  00#!0< 0 R#C(@h`hhh0# -0@PLpA 0R p) `P00C& R 00#!|000 h0C& ` 0 "!0< 0 RC@`h@hhh0 00000 Q- L_,# 00sS0S  -0L Mh0`p d 0Qx\x ;, Rp100D d z 00 ` 04 0 800< T0 P?00 lP0@0|0S ,x @0  i0`+Ph |+$$00 000w8+,)# fd,dV!8df#|#0#P# p-H@LM 0`PW$ $$P`0 p f,ܾпf -$0@LM@@@0@ ff -,1,q` L 0@S hP PU0000PUh0 0 ,! @`00C\ 0  "!x0 00 d0C& \ 0 "!08 0 RhaB`h@h$Mbhh0 -LM 0 Pp1 0Syd0@@S1  0SL a!p000  BR 0H00 R00?0SS0SJp0h!2c1dP:HAp00C\ 0  "!0 00 1C&  0 "!0 0 R0P ,0 S P0 Ax*0$ 0000; f@h`h$d#hh0xd|pdl# -LM0@Sp. Q' 0 PPhP D1P 81 ,!i 00!Q`V00h0`VhP T0S P0`@`P ?#<0 Pc 0U   puP>0S0S 0$ i00 i($Mb# -@TLp`Ph@}T p-LMh0PS`p<@V0@@T 840<@ Q- L0S h0S840 0- ((L" P 0AT 0S 0S TPU@T HP0000d@- @.@d -LM@@004T -t0LM Ƞ Ƞ,A0@S 0000 0CS0  d@-$ @.MЍ@d 0-LMP@@ 0@0CS00 -LM\  p0\ 0p  0 0S0\0(0\T$1  P ~f}fvt -@L MTP`p9 d%T dX%TT P5T00 840p 5pPT0S  D$`0000 0:0 0 R'T`00C\ 0  "!0 00 x4C& p 0 "!0L$0 R ?00c 84l p 3T 3T 00 3T  00  l|d3T ^l3TW *`3Tv 0S 1@  Pp o  0 _2TKPpT @ 2 |2"#  \2 T2q"# 000003z |2T& 1To l   0     0 0 1T0\0 ! L,Pp0D p  0   t  0x0 00084 p0)+ @< S 00 K  $@ uPp0@0< Sf< 0S aWW @W W@W@h`hhh0WW@ W @,dW@dW W W $MbWW W- 0 Ƞ Ƞ,@ dD0P  0(1S h0SPd 0-L0LM@T@0P  hP 0f8d p-LM@d0QhPPSU h`VUhPfP h`pU 0 (s'pph`Vp騲##hP -PL Mp @0P0^ 0@ST@0\  / @d8dP ,0R0!R r d -0LMP) 00S P" @P`p0 KS0C$ K0 0l $ 5000 0* R0 >; S  fff ff -@0L R 000 0S 0S 0ff f -4L,\ \ f f -L MPhP@`; S, $ R R R 0 @@ @ @ @R <0T 84  0<@ PP PP_ P  @0`0RQ 4 0; X 0 0 @@ @ @ @R <0T 84  0<@; S) 0 @0E U  8:S00SP 2UP 30E8S0E8#X8UP 008#XQ0Q12,R0T0 R002Pp 0 ; 0 jl2R d2Rc0Sz 0 ; 0 Z RSp,"O <60000S 0 00000S 0 00000S 0 0 0 000S 00#00S 00#00S 0 0@0@000S 0 00000S 0 0<<00S 0<#U 00S 0;# 0 (U 0S 0 R R0T0T00S 09#,pK | @@ @ @< 0@U 0 <0T84   0- 0P @@ @  @ @RL <0T 84  0<@0R  Q 00# 0Q 0 000 -p!LM04 S\q1Tq080 0K  8P`@`V@DPEAJ3[ S"[00b0cS  0KX8@ @08@ 040`၀?000 R # 3 R?H0`?À 4@ 0R # 3`fPd 4S @08#<@8oS: S>; S P 0 R0,R! -LM@Q  0@h<000000000000000000000 -<00000@ L `+ p\&0S \\ 0PP*; Sh!,\1R 0P: R: S:#:A >; S= ^; x   Sp , d0R P0 R:U  hO P0S   ܲ# p-LM0`PP@ SP 0\  00  00  0 \p -L,M@  `^Q 0S `^ \ ^PK aQLXPpPKa @0T*<@8oS: S >; S|p2Q} @ T:XZ WePKa @p0T[* ; S1QO: Sʠ,ʠ >; S<@8oS: S <= S= 1P: 1P7 |1P4 TP*00@ ;   S 1Q P0 R:U 1 g0 @0Tp:XZ  10 p@: S:#: >; S Pw: SZ%Zr >; SPPm0S #,#0Q 0`c Q- L!`# -L M0 000480 <0@t  ;r! ho!d#V! -LM 0 PpO<@0SL a!p000  BR 0D00 R0050SS0SJX0P!2c1P:0Ap00C\ 0  "!0 00 0C&  0 "!0 0 R0P ,0 S P0 F8` 0$ +00;@h`h$p#hh0xdpdx# -LMp8@P,0 0 "!!ĐP0< 4 4 0@0 h0`@0h0@l0,0l0 D p00d0p0@04 S40 P< 0"80 ` t0S P?#<080cS 00嶸U4 Xh  `@`T 0S W( 0 R0 R @TY`X  P``l 0p`0 RhZ騲##WhP(0$8 Q!0  Q:!0@-P(P  $08@Dt @\ 0 0 A\(@Dt0 -0` 0p@0T0L0P  @T@p00C\ 0  "!t0 00 `0C& X 0 "!04 0 RhP1`h@hfhh0-LQ@0 0R, 0 S fdf,0 P 0SPf -LM0@`PUp@ T0 0$ R, PUA`00C\ 0  "!l0 00 X1C& P 0 "!0,!0 R0W 0 RZ 0( RX !P@`00C\ 0  "!x0 00 d0C& \ 0 "!08 0 R0@h`hfhh0 -LŸp0@P`XP@r U ,0U 0S?0,PV 00V 0S300`00("X0XAp00C\ 0  "!$0 00 1C&  0 "!0 0 R=0@p00C\ 0  "!|0 00 h0C& ` 0 "!0< 0 R0P@h`hhh0 -0@0`LpP10  `0P0C& R 00#!|000 h0C& ` 0 "!0< 0 RU/`h@hhh0 -0@0P L Pp 0(S"x) `P00C& R 00#!|000 h0C& ` 0 "!0< 0 R/|`h@hhh0#@-0S4 S/0!0@ ^@(00^$ 0lQ T00^ 0@bS 0 S00T0P00SS0e -LM P`p@T K0  KKppp\! K0 !K@ K0 KK@@@4 0S 0P 0Qh 0-LM0P S 0s# @ K0K0b0@@P@ P00[4S 0fP0$# p-L$M@P`V0  004  0 P00@@{||| (K0(` $ P <p000 0)0K0) K```:4`V!h!! p-QLMP# 4@T00 l0 K 00b`0@PQP@ 00!P@4` pNpp0^ K 00b 0/P@00 84@H#h#Q0@-P0@0 " Q 0* 0 S0R R R00 0  0  0\ 0 0 0QEQ QQ 00 -`L@pPh00000000 -LM@00KK0[0 80 K0 -L M@@KP 0K <nn0 K}P<  0-0LMQP@% 0Q00 0Q 080Q 0Q 0 0S00@000KK0[0 80@ K0@@Y WW@ W@WW -LM<@T 0hh 0S 0hh p-d`MLP@ 0; K 00b0@@@@ Rph!! p-LM@`P| 0 P p  $ 0 0-LMP@U 0K KK0PP@0[(S 00[S ꐴ# -LM0@00 4 prP%`K 0%K$KPx04ZJJJJJJJJJJJJJJJJJJ }J xJ sJ nJ iJ dJ _J ZJ UJ PJKJFJAJ=Q:Q:Q:Q:Q:Q:Q}:Qx:Qs:Qn:Qi:Qd:Q_:QZ:QU:QP:QK:QF: QA: Q<: Q7: Q2: Q-: Q(: Q#: Q: Q: Q:Q:Q :Q:QA ? QA ? QA > QA > QA = QA = QA < QA < QA ; QA ; QA : QA : QA 9 QA 9 QA 8 QA 8 QA 7 QA 7 QA 6 QA 6 QA 5 QA 5 QA 4 QA 4 QA 3 QA 3 QA 2 QA 2 QA 1 QA 1 QA 0 QA 0 \aBC`B0QA 0  0-LBP|@ 0S L| 0SPeT 0S \00LS `00000S  0SbQ1QR B?R/0Q< 0bR30Q0-P@P@0Q0-P@P%@ 0Q1Q3:P: R0P0QcP  R0-P@P@0! !Q@-: R (2 R R -PPPP RrPP B PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R- RP1P P1P RrP1P  B P1P B  R010 1  B R0q0`0q0`0q0`\0q0`0q0`0q0` R 0\6 R B0-81, Ġ%̌T$\D#L0P  R0 Ġ01#̌  R R B0-81, Ƞ%ȌX$XH#H0P  R0 Ƞ01#Ȍ  R R B0-81, ̠%Č\$TL#D0P  R0 ̠01#Č  R@-@08#8S  0   !` `! R 0B?R # 0bR030e``0 B`3`1`1c11c!0"b2c3c0acP@e_ NR@-@ R 00 R \T000Sa@\0S S0S0S  S 0S R  0R P0Qc\R0@-P@0 A@P `R00\00Sa@ 0zR @R00Q00S ZR 0 PP ^0b0Q 0-@LP00000!8< !P0P0C& R 00#!t000 `0C& X 0 "!04 0 R0$@h`hhh0 0-@LP000008<1P0P0C& R 00#!t000 `0C& X 0 "!04 0 R0v$@h`hhh0 p-L M$@1P 0 1 `K0P 0 0S  p^P1 01 !00 P -L M@` T00D^\P$:T8 p,KW" 1!,0 $ ( 1.$ 1$00$0 1$00$0 ,0$00$0 (00 (0 PP P00# 0v R0 j 0-LMP@0 (0 (K0 $0   0$K 0 彻@P 0  -LYM   0p0`S0  0S00g\Kc  a?K PP0/SP 0S< 10 S@C/R 0t/S0@ L0 H l D pK0pp RP/0P0\0p 10@glP?P  P0PV`h\cpK@@LP H@ l pp D PP0KP @ 0 帀 匠 PP0` GK 0pPP0 K 0gPP!l1R!h1RP.`, a?K v@-@\  0S0  0ST 0q0015 -L@dMPL, Tp` l,T` # T 4T 3 ,0S ,e0903Th0S00+3T 3T3@ R x p3T00  00  00  ,g9p@P0000  T9p|P P402Tg2T9*2T- :20SPKT2T H2T D4 0 8#88t0 2T08080 S  K XK PU14P !4 PU10P !0  0E0KC K]0 t  !@1T( (1T 1T,  0 0  00  00+  0 0 0 0 00 R00 00  00  00 < gtt@ct@bt t 4#t@btt@|t@f@#t@e t tt~t}tt,tt et,tut -LM @@   @: @  @@@   S @ @ t06@< S# F D   @KHCHX H@BH0 A0 Q@$n F CfX#@-t  @++@@,, **   +M+M",0  LL@S   !S 00 S 00 S0 0  S @ @      S    S     0@-t   @0@@P KK 0 PJ S `00 ST0 @0 @SPP0@ 0P  @     00000000101011<0S8000 00( 00(0H 0 @040L 8 P0<0 -LM` PD0FK0 !  P ppKP@ 0 c@再TЀK00S@@ @ 0 -LM` P0FK0 !  P @pKP@ 0 3@VTЀK0X0S@@ @ 0 -LM`p!딀KP@  0 ,00,0,0( 0CPԠK,,0U 0&0S DP Q @ Pe -LM0O K K  -LM0O K K 鳦 p-LM(O`$K,K4 K, P D400p -LM0 0K 0 ĝN -LM0pSl K6P l0  $00 80SlPP`t0K t H0 8 p D` 0P 4P , Gl0HK0@0K  hK@TH#|0K h0 T` x@ 嬿l0|  hK0K`PPحl0 ` K0\X0 cV * P0\0P R:  B2 P 0 b2B&! 02 S`1b1 R0``0`04bP00C\ 0  "!0 00 1C&  0 "!0!0 RU ԭP6 80R4 P0 80R<0 T @0   @00@0l $l0 0> K08 l0b0 ,00C,0l(0,;l0PU DK @K@KH0l Pʿ}R Z:U@h`g`hg+ghh0$e:0 0-L M0 @P0000 0(0 :(0  (04 0(0 (0(000(0  (0, 0(0  (04K0(0 0O$ Ky(0! p-LMP0@0 meP0,`KS   0S Dpz0S +0[2KP gh# p-LMP0@0 9k,`KP  0 S DpQ0S +0[2K g# p-LMP0@0 j,`KP  0 S Dp)0S +0[2K g# -L,M@DK< K04 0 DP @` $p <@ 8@ ,@ h 09 09h -LdM0`DK P@8 0B S*RPKp@ QQ Q@#Q80B4s43 @  Q0P0 @00C\ 0  "!0 00 2C&  0 "!0"0 Rr8 pK0!9<,0 P@ 0D K  V) V - @<K@0K< 8 4@ @` P@00Q@K  V <K@0K@ < @ ` @NP<K@0K< 4 0P ,` 8@ @: VY  V <K@0K< " VA e Vtt \\PhP@P h0L 0` f0($0`@f0 0`Q0@0  @@ T@ @0 |P\T\ D\s <K@0K@ @ <K@0K< @ <K@0K@{@K PhG hh!!4d -LM@P 0 `:g p-LMP` PK0 p .@`@B &L'$(#80x25PHM 80x25PHM80x25bfPHM 80x40P(HM 80x40P(HM 80x40bfP(HM 80x50P2HM 80x50P2HM80x50bfP2HM $ $Xdl "*' %2K} }}}%}2> > >>> > > >>%+2>K}  4x5x7r x@t xxxx4x5xxxxx6x 7xT8 t4j 5l@`@`7j @`6j@`4z`884t5r@`X@`PP``XXP``@4zhh5~~4|X4zhh5~~X4|r\jr]jr^jr_j\rj]rj^rj_rj|`@`H@`@@@`HHxx5r6r           xxxx(C|z%2K} }}}%}2> > >>> > > >>%+2>K}  F  8H "H 8$6 & $(":#I0!;8>$& ;&$H 8!8$8G  8H "H 8$/ & 7(":#J0!<8>$& ;&7H 8"878U7X  8V@ ̀#V8 L$H88U80baaH 00$aa~ !," 0z 80z 8-L$7:@8zl HL$$ u && "&8&4 8[!Ye YE$6 b " " !l"l!"\!L!U8g'7:& Y"Y81 H &8BU~  C8V@ Ѐ#V8O$H880aaH 00$aa~ /" 0808O$~:@8o  O$$ && "&8&8!e  E$6 " "!o"o!"_!O!8'~:& "81 H &8vo% 0q@0wWl@s`p AooK0roH@< 8 8P9P:P@< oPr` 80LroLQl@߀Rl@_Wl@Wl@0oM0-Ql@&̀Rl@&MWl@&moL00r@oL qProI0 Wl@0% `l@N o@o@o@ oL0& r@& oL0r@ oL0qOr@ 4oLr4`5`6`0qa0 `PoIypa  [ o] 0en`]HWHPYNAZ NC] [s_ .60a %+2> 88888 9 7 6 97 5 9 423 9 2 9 1 0 9 9 \/|\/O|/-| "&*.26:>ACEGIKMOQSUWY[]_abcdefghijklmnoppqDqrDrsDstDtuDuvDvwDwxDxxy$ydyyz$zdzz{${d{{|$|d||||}}4}T}t}}}}~~4~T~t~~~~~~~~ ,<L\l|||||||||||||||||||||||||||||||||<<<<<<<<\܆\܅\܄\܃lL, ̂lL, ́tdTD4$ԀĀxph`XPH@80(   !"#$%&'()*+,-./02468:<>AEIMS[gjkhinolmbc`afgdeu@ut@tw@wv@vq@qp@ps@sr@r*."&:>26 UWQS]_Y[EGACMOIK~~~~~~~~~(~8~~~h~x~H~X(8hxHXzzz z`{{{ {`xxx x`yyy y`}P}p}}0}}}}|P|p||0||||@@@@@@@@XHxh8(؁ȁ聘XHxh8(؀Ȁ耘` ` ` ` Ђ0pPЃ0pP****++++(((())))....////,,,,----""""#### !!!!&&&&''''$$$$%%%%::;;8899>>??<<==2233001166774455   jnbfzrJZ镗 n;AvXaM ְdx \ff0ggghh hnhAnCopyright (c) 1982, 1986, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. Copyright (c) 1995-2004 OpenBSD. All rights reserved. http://www.OpenBSD.org 4! S"L!?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?Ѫ?????????????????????????????յݯ????  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~U\` m n n n Lp q Xq L$ |q d n;0&AvQkkXaMq//^SShѹ,` @ȱy[[jjFˍپgK99rJJLLXXJυkл*媪OCCMMU33fEEPPD<KKܽa ppB>>|ĵqffHHaa_55jWWйiX':'8볘+3"iip٩3-"< I·UUx((PzߥY  ڿe1BBhhAA)w--Z˰{TTֻm:,ccƥ||ww{{ kkֽooޱőT00`PggΩ++V}׵bMvvʏEɉ@}}YYGG AԳg_Eꜜ#Srr[u=&&Lj66lZ??~ÃO44h\Q4qqثs11bS*? ǕR##FeÝ^0(7 / $6=&''Niuu ,,Xt4.6-nnܲZZ[RR;;vMַa}))R{>//^qSSѹh, @`y[[jjԾˍFg99rKJJLLXXυJлk*OCCMM33fUEEPP<!KKݽa܋ pp>>|Bqff̪HHaa£55j_WWiІX:''8+"3iiһ٩p3-<" ·IUU((PxߥzY e1BBhhиAAÙ)--Zw{TTm,:cƥc||ww{{ kֽkoޱoőT0`P0gΩg+V}+׵b׫MvvʏEʂɉ@}}YYGG AԳgԢ_Eꯜ#Srr[u·=&Lj&6lZ6?~A?̃O4h\4Q4qqثs1bS1*? ǕR#Fe#Ý^0(7 / $6=&'Ni'Ͳuu  ,Xt,4.6-nܲnZZ[RR;vM;ַaֳ}γ)R{)>/^q/SSѹh, @` yȱ[[jԾjˍF˾gپ9rK9JJLLXXυJлk*OCCMM3fU3EEPP!KKaܽ pp>|B>qĵf̪fHHa£a5j_5WWiйX:''8+"3iһi٩pَ3-<" ·IUU(Px(ߥzߌY  eڿ1BBhиhAA)-Zw-{˰TTmֻ,:ƥcc||ww{{ ֽkkޱooT`P00ΩggV}++bM櫫vvE@}}YYGG A쭭g_E꯯#Srr[u·=Lj&&lZ66~A??Oh\44Q4qqsbS11*? RFe##^0(7 / $6=&Ni''Ͳuu Xt,,4.6-ܲnnZZ[RRvM;;a}γR{))>^q//SSh,@` yȱ[[ԾjjFgپrK99JJLLXXJϻk*O媪CCMMfU33EEPPxD<<%K㨨QQ]@@?!pH88c߼wuBc!! 0mҁL &5/__5DD.9WU~~zG==Ȭdd]]2+ss``OODf""T~**; FF)kӸ(<y޼^^ v;dV22tN:: II Hl$$\\]½nCשּׁĦbb917yy2CnY77ڷmmd՜NNI੩شllVV%ʯeezzG鮮oպxxJo%%\r..8$WsǴQ#|tt>!KKaܽ pp|B>>qĵ̪ffHH£aaj_55WWiйX:''8+"3һiip3-<" IΪUUPx((zY  eڿ1BBиhhAA)Zw--{˰TTmֻ,:cccc||||wwww{{{{kkkkoooo0000gggg++++׫vvvvʂ}}}}YYYYGGGG𭭭Ԣrrrr&&&&6666????4444qqqq1111####''''uuuu ,,,,nnnnZZZZRRRR;;;;ֳ))))////SSSS [[[[jjjj˾9999JJJJLLLLXXXX着CCCCMMMM3333EEEEPPPP<<<>>>ffffHHHHaaaa5555WWWWiiiiَUUUU((((ߌ BBBBhhhhAAAA----TTTTPQSeA~ä^':k;EXKU0 mvv̈%LO*ŀD5&bIZg%E]u/LFk_zmYR-!tX)iIDɎjuxyk>Xq'Of ɴ:}Jc1`3QESbwdk+XhHpElޔ{R#sKrW*Uf(µ/{ņ7(0#j\+ϊyiNeվb4ъĝS.4U2u9 `@q^Qn!>=ݖ>FMT]qoP`$C@wgB谈8[yG |B| H+2pNrZlV8ծ='9-6d !\hT[:.6$g WҖO aiKwZ *C"< Nj򹨶-ȩWLuݙ`&r\;fD4~[v)C#hc1cB@" Ƅ}$J=2m)K/0R wl+pH"dGČ?,}V3"NI8ʌ6 Ԙρ(z&ڤ?:, xP_jbF~Tؐ^9.Â]|i-o%;ȧ}nc{; x&Yn쨚Oen~ϼ!ٛ6oJ |)11#?*0f57NtʂАا3JAP/MvMCTMўjL,QeF^]5st.A ZgRے3VGmaךz 7Y<'5ah,4$8_@r %⼋I<(A q9޳ ؐVda{p2t\lHBWЧQPeA~S^':k;EXK0 Umvv̈L%O*D5&bZI%gE]u/LFk_眒zmYRڃ-!tXiI)ɎDujyx>Xkq'Oᾶ f:}Jc13Q`SbEwdk+hHpXElޔ{Rs#KrWUf*(µ/{ņ7ӥ(0#j\ϊ+yiNe;b4ĊS.4U2u 9`@q^nQ!>ݖ=>ݮMFT]qoP`$֗C@̞gwB谽[8y |GB| +2HprZlN8Vծ=9-6' d\h!T[.6$:g WґO aKwZi *"4$8,@_r% I<( A9q ؜Vd{a2p\lHtWBQPA~Seä':^;kEXK0 Uvm̈v%LO*5&DbIZ%gE]/uLFk_mzRY-tX!I)iɎDujxyXk>'qᾶO f}:cJ1Q`3SbEdwk+HpXhEޔl{Rs#KrWUf*(/ņ{7ӥ(0#j\ϊ+yiNeվ4bĊ.4SU2u 9`@q^nQ!>ݖ=>ݮMFTq]oP`$֗@Cgw谽B8[y|G B| +2HpZlNrV8=-6'9 d\h![T6$:. gWҖOa wZiK *"$8,4_@r %<(I A9q ޳؜Vd{a2plHt\BWQP~SeAä:^';kEXK U0mvv%LO*&D5bIZ%gE]u/LFk_zmYR-X!tI)iDujxyk>X'qOf }:cJ1`3QbESwdk+pXhHElR{#srKWf*U(/µ{ӥ70(#j\+ϧyNieվb4Ċ4S.U2ኤu 9@`^qQn>!=ݮ>MF摵Tq]o`P$֗齉C@gwٰB8[yȡG ||B 2H+plNrZV8=ծ6'9- dh!\T[$:.6 g WҖOa ZiKw *h8,4$_@r %(I>>>KKKKyyyy xxxxZZZZݨ33331111YYYY''''____````QQQQJJJJ ----zzzzɜ;;;;MMMM****뻻<<<m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxqg jgrn<:ORQhك["(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDl؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHGɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~[ 1Ѭߘr/Ḗ~&jE|,G$l iciNWqX~=t XrX͋qJT{YZ90`*#`(yA8۸y:`l>w'K1/x`\`U%U攫UbHW@cj9U*4\̴ATr|*oc]ũ+1t>\3֯\$lS2zw(H;Kkē!(f a!`|H2]]]u#&܈e>#Ŭom9BD . Ji^Bh!la gӫҠQjh/T(3Ql n;zP;*~ev9>YfCoEå}^;uos D@jVbNw?6r=B$7H ۛIrS{y%P;LylO`@ž\^c$johSl>9oR;Qm,0DE ^J3(fK.WtE9_ ӹyU 2`yr,@%g̣饎"2u<kaP/R=2`#H{1S>W\o.ViB~(2gsUO'[iXʻ]=!lJ[-ySeEIҐK3~ˤAb Lw6~д+MەqՓkю%ǯ/[{AI~-%^q h"W6d$ cUYCxSZ٢[} Źv&ϕbhAJsN-GJ{RQ)S?Wƛv`+t恵oWk *!ec.4dV]-SGjnpzKD). u#&İn}ߧI`fqilRdVឱ¥6)L u@Y>:䚘T?eB[k?ҡ08-M]% L&pc^?kh >\D}W7: P tAu8/;21>8TNmO Bo ,y|$ryVw.?rU$qk.P̈́GXzt}K:zfC cdG27;C$CMQe*P:qUN1w_V5kǣ;< $Y,n<pEㆱo ^*>Zw=Ne)։>%fRxL.jxS<- N=+6&9`y#RnfE{7(2åZl!Xeh;/ۭ}*/n[(!pa)uGa0a4c\s9pL ު˼,b`\ndi#PZe2Zh@*<1! T_~}=b7w-_h)5ǡޖXxWcr"ÃF T0.SHُ(1mX4a(s<|J]d]B> EꫪOlOBBǵj;Oe!AyMjGKPb=bF&[$ti GV[ Htb#*BXU >ap?#r3A~_;"lY7|`t˧@n2w΄PU5ai Z .zD4Egɞs͈Uy_g@Cge48>q(= m!>J=+hZ=@&L4)i Av.khq$j 3ԷCaP.9FE$tO!@MpE/f m1'A9UG%ښ ʫ%xP()Sچ, mbhiHפh'?Oz|Ϊ_7әxB*k@5 ٫9N;VmK1f&tn:2C[Ah xN جV@E'H::SU kKмgUXc)3VJ*%1?~^|1)p/'\,(H"m?H܆AyG@n]Q_2Տd5A4x{%`*`lc´2Of#k>3b $;" r(-Exb}doITH}'>AcG t.no:7`L knU{7,gm;e' )̒9 i{f} ϑ^و/$[Qy{;v.97yY̗&-1.Bh;+jLu.x7BjQ满PcKkؽ%=YBD n *Ngd_ڈ鿾dW{x`M``FѰ8Ew63kBqA_^;Z4ٷ,Q+:Ֆ}}>(-}|%rZLZq)GW;()f(.y_xU`uD^mm%adâW<'*:m?!cf&(3uU4V<wQ( gQ̫_QM08bX7 z{>d!Q2Ow~㶨F=)iSHd$m-if! FEdlX [@X̻k~jEY:D 5>ʹrdfGof,ҏ"W##v215VbuZ6ns҈bIPLVq z2E{Sb%ҽ5iq"|˶+v>S@`8G% 8vFšw``u N˅؍芰z~L\HjiԐ\-% ?2aN[wߏWr:j?$.Dsp"8 1).lN!(Ew8fTl 4)P|ɵՄ? Gy@0 /kz%?/?!M@`Iɟ'Կ@uИcnafŽ"o;h(Yy#P_w@CV/|-ҢɡHl4ma/T"2*kT:V"AӢ@f/9/Mҹ-?JDvR7,YQoz Zh{.T"5Y/mKdPIf-徐"3;䎴]4K@E?1.eUʱծ-mԢP @"8On ׿r[O/LVSTIiFXEŅc]ՊSW9j7=T*_}x:vbj Bz)^'rgP8ƌDŽZ*'JkѢ*V`C u\B&Ʉq-ls5&5 M{n0f&%HVV^c ϲc|E pPr(pH# yM;-AB G&LjMG\^ |Y#јr8S#/nqFnEV 9q +A|iCHy}B{BIZݿe\ [ ~iC?9zaz UQry吝5rNcZպ60ę _}֡{/6Y DYD̃Aѱ* ;{ B[A%zzӤ0XޘN?wiy{$[Ĭ%5P_aT1bcKU !h]Yfsc=4·~!+g\ab906;Wd/`:5F- 'zy㠌l0^7%oo;j tE'4:NiOM>dY58EfCr3c%N? (Υ'R¦սTUdpfM w&ۄgC!`X0TroSUGڿ]bVhkʃ;n-Ӧ\= wL3{9+^S_aodC x^c"&gI{ڷ"%-U^7rRyL H[k0 cq/޹ S E!5(T<)c)A|-nRPf4,0P1`sY&D\dwR3A+ٺ|o!PaH?ek«dv&4{^% ;MM1$~I,;jx`]sVz\/1Co0TyXR^/2zj0>՚1B°I #ڸ(0q_`ɣaM/Ǚ."płNؼ40y;'ƸaiH?;(ZC/v7ܱӧßn>ƼB7Q(heRwj-K'5.n\ )^XOX{iT̨g&H`K`8# ~8lI `s5GƱVL>#8d^BFzk Od^AE#\;]>rC|m~ll9`qpsv#E@]%=`GK6DήPQH<p}}d^(O= &g.yr?U+HԼ?^!@WNFRWs3NɷdŸW1O g_?@k{C=K۵cUȗn-J(JqoCCl< _P/~׿PZG.Q>pX.0_|r *,]I鎸P'WIoyR}}Yr@EEt]>uOiVA#. '`vteyvvwHNma}/ 4H<0(Ow Vܒ M"7)}V'|@|硴f^aÝ <є`AFv\;x,WGl"}NC~8<=Q8d{h'فI]j~vh]9K9 ;#Im<Eub'z\aBΒ~Brrp }ȡ[(Ob<51)BSjO[}m(Ki\j#MŌ?,-ҖXRg[HJI \EkӉ7`:SRqDIK @sg4|~q6UO/Т`?mPьGnU?墼38Wg} =3{r3O̫]ňv{{uWBdBc+ri/n+_mazgaq%9̸L!gуb>ܷν8\ =Dmn`I:T`H'W+8$ ږ%Eh;}E `P/(b4 ٠m+1+dZ0RXBA\1>26F3S75 {s{OJWdCQz(~c5_ yCdcdJ$_(͸O@C " 0 O7-{$MgQLq_-_d !S^>'_aB%rqK=;&o~~TLmDl߫I&Ǡ36~?Pa w8Pr.PwWFgOT3ɏ1 i5M\=fȦ[]oڑo/"F}F9mOCCN!и  ?X(>nH&p׋wt|% - y#;(8itb߷@!{7Ȋ@ YVvO@/{U MVi35'#WȯVeka^u˅nwU2?-ɿ[%;з$;mc fÀ(82 Tɪס2Zb,gTzuw11&o6F HjyZVLj~CRv/ t,t* M|k .TA5B=!&|,aRe1i%& !\1cr ^Iy p1 d>>̶Ոî 0rlqn/kءDVÈ9/ű1(x⤣2}o~X$Ū{s0a!-!)۳*)e\,0?Б\,ԩT _w:^VxV޾\!uQųåҶw#)Ei/z毲p[v F98/gsD)k)/Ifingӛ/~p%Q^$Slj>!DYܷ)eyCy9A+MWN )zkS< ~U3rŅ?~  ~tn,fy3jXDD1Zs"*ˁc8:$zi HIĀ@8HުL H_%A@N$A UeQr% 9jyMc@hV 틕Z Vqק)N-fcqw*7 5Wa"ɠBր[t!h!hl iwW~@PճMװx QV$AV ʔUWnྵa$ XK'aU{whkldMDfd~i/IO70j5,s@IvM;B(HDLns) _ɋ}oaOw.+rץ<}+FYYEEهTNoHm| ǥcs_DVj͈prͳ]ny` E`1©\1BN"r\,rN@%/N2g@#x\n܃"ukMxnXO DH?{vw#Vu*F_( +8=6 JRft;QZylu eX&hJpFS(l\v0k)h76*g$ k%ֿh,DUueI40" WIbuU~bڨv^FESGml,gHL|3ەCh\SU2` ߝWc9^28aI37~^b<#NygCHKJf-ۄoH Ja)Yfc(` 0qt&@3/C~A^ l( ؒ0~of˜os*`ژ46K-%#= %IH6Jo8C@TzWOpA:Z„TU|5YŗZ:G:%Sj~=eI&TwQ[P]vlDȨ!帊iX`[ŗY)L;]J5ULkD$5鰽bעT/I18T(q)9H[/u@g+3-fVo*ɛ`( ')dMP˲,\26K_A !PNhذy\CPIMAC8wn\e0Rԋ@+>`xT7}02m-yyS"wuXȃoxkcZ\3]ùzv٣Byqj3ƚ`'PC=+mvN%ύHf6AN( aϩI=߹_d: }+p?PO+Zbbyj.H@,Z@"ғ-ES4n)olIIBr~V>olbfLTq*+9)XLVRf.S9v.i硦>iFt+LVvuOx39]O#2]2=&K/~~<O^?vf)o=E4ӷ+4grN=U"g`k8=ü0}8QcÐӝXyTGָaYwSW-XVcNx.F~eyUڑ0@5㶼P?!@=LXI6QpӱڍyKoqK 0ݻ맕d5w$,ϩ/ tцB*v:-7ޚ, )p@ :$7ѴyN] h1 HZ޻Bf1畏?r 3uQB}\cmd!@ WS1zݨ]3CoFq"8ԚέiGb[UgfN G[oLĎnrWxzdD]Ջ` l_9 ]c2֋~ pIPӻߘ)* mS~H~X.t;/RG'~[!<8zvOB9`55'{ɸ6g {pqT3^-ZId, =4pBwbO&Ҹ$d%FN`7>͕xE_{ ۫v"{.1ן%$r_m L=mPO%os#(ĴyI%4aĘnzn|l6AT޾'VAJJ{` ,8I%vK$%Gv XY f 0NndQ& #Phꃢ H!x-ML.RN8D( `hz=Skc|j9{Б/Uڅ?AZX_f ؐ53eiEVmv° GJBnI[#Q")yq~ ruo7ӎbwO$26󦻬^lW%㽨:Y*F                              A@@@A@@A@@@@A@@@A@@@@@@AAA@@@@@@@@@@@@@A@@A@@A@@@A@A@@A@@A@@A@@@@A@A@@A@AA@AA@@AA@@@AAA@A@A@A@A@                              @@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@                                  ##%%&&))**,,//1122447788;;==>>@@CCEEFFIIJJLLOOQQRRTTWWXX[[]]^^aabbddgghhkkmmnnppssuuvvyyzz||        0 0 0  0 0  0 0  0           0  0 0 0 0  0  0  0          $$  $ $ $$  $ $             $$  $ $ $$  $ $                  0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0                            ((  ((  ((  ((  ((  ((  ((  ((          """"   " " " " ((((((((    """" ( ( ( ("("("("(hX?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@e+ee ./$13 4$66e\> e@ee\e\> vmmapbsyBUSYWANTEDTABLEDCLEANCLEANCHKRELEASEDFAKERDONLY ZERO PAGER1FREEINACTIVEACTIVELAUNDRYANONAOBJ8DP[ ""\!""`!""l!""p!"" $!$! t!"$!x!"|!" !"!"!"!"!"!"!"!"!"!"p !"!"p 0!"!"p `!"!"p p!"!"P !"!"P !"!"P @!"!"P P!"!" !"!"""!"!"""""""!"]"!"]" ""]"""]"""]"$""]"  l\"6"l\"6",""0""@4""0""<""@"" D""H"" D""L""/P""x8!oT""X""0/p!"x8!p \""" "d"" l""d"" @p""d"" `t""d"" T!d"" x""d"" |""d"" ""d"" """" 0"""" @"""" `"""" ""d"" """" ""d"" """""""""""" """"0""""@""""P""""`""""p"""""""""""""""""""""""""""""""""""" #""0#"""@#"""P#"""` #"""p#"""#"""#"""#""" #"""$#"""(#""",#""" 4#"8#" <#"8#"@#"D#"L#"P#" X#"&"0\#"&"@`#"&"Pd#"&"h#"l#"t#"l#"x#"l#"#"l#"#"#"#"#"#"#"#"#"#"#"#"#"#"#" #"#"#"#" #"#"eqnecsccmiplvsvchilsgeltgtlenvdaiadbibedeafdfalsllsrasrrorpmzsdep0.01.02.03.04.05.00.510.0px['"'"'"'"'"'"("("("(" ("(("0("8("@("H("'"P("X("`("h("'"("("("(" ("(("0("8("@("H("'"p("x("'"'"'"("("("("("0("8("@("H("("'"'"'"("("("("("(" ("(("0("8("@("H("(")"'")"0)"D)"\)"p)"("(" ("(("0("8("@("H("(")"(")")"'"("("("(" ("(("0("8("@("H("("("'"'"'"'"("("("(" ("(("0("8("@("H("(")"("("(")"("("("(" ("(("0("8("@("H(")"'"'"'"'"'"("("("(" ("(("0("8("@("H("VA$+"PVA8+"VAD+"VA)"VA)" VA)"pA)"qA)"qA)"qA)"qA)"qA)"rA)"tA*"tA*"A4*"A<*" AD*"AL*"`A T*"`A `*"`A `*"PTl*"A x*" A *"D *",D *"li *" i *" i *", $i *"l0$i *"l ,i *"l0,i *"l!i *" !i *")i *" )i *"-i *" -i *"Ai *"Ai *"Ai +"+"$+" +",+"4+"D+"@+"P+"L+"\+"X+"h+"d+"x+"t+"+"+"+"+"+"+"+"+"+"+"+"+",","$,"<,"T,"d,"t,",",",",","."."."/"/"8/"P/"p/"/"/"/"/"/"0"00"P0"@````` ```H"H"H"H"H"$I"m">m">n">,n">Ln"?xn"?n"?n"?n"?n"?o"?0o"?Xo"?to"? o"? o"? o"? o"? o"?p"?$p"?#"D""P""X"\"`"h"p" x"0"@"""\""l"̪""ī"̫" ԫ"ܫ"""""v!"" " ""0"8""L"$ X"H h" p" x"P ! !" "X " h!  " H " l "  " P " " p! Ь" ج"2h"6h"rh "%i "3i0"ri@"T"\"d"p"3x"5"E"Y"PY"QY"RYȭ"UPܭ"`"U`"V`"Fv,"pw8"P"`"t""" "P"QԮ"U"V"X"Z("<"P"d"t""""""Я"""" " ""$","4" <"==D"==L"==T"==\"==h"==p"==|"== "== |""""P"Eİ"H"԰""Q "BX"" "("4" @"L"T" `"0l"@x"P""""3@`"3@ "%5"Eб"I"Q"a""!"#"1("34"5@"CL"AX"!d"Gp" 3|"R"R")R"7R"GRȲ"CRܲ"QT"q" " " "("x8"x!D"`8T"xP`"xUl"Yx"Y"x`"xa"xp"xq"xrȳ"xsԳ"xt"x"x"x"x"x"x("i8"xD"P"`"p"""""P"Qд"_""" ""$"4"@"L"dX"e`"dl"|"""""е"""""" "0"@"T"\"d"#t"%"'"2"5".B"0B̶"B"dܶ"B$d"""" ";";";$"",""D""X""h"" x"" "" ""@ ""0ȷ""pط""p"" p"" p""p""p ""t""t ""t(""t8""t@"" tH"" tP"" t`""tp""tx""t""t""t""@t""At""Ct""Etȸ""FtԸ""Ht""It""Pt""Qt""Tt""Ut(""`t4""dtD""htP""it\""jth""ktt""mt"`""`"T!"kй"kع"kܹ"k"k"k"k"k\"k "k!"k"$"k$"k%0"k&8"k'D"k(P"k)P"k-\"k.h"k/h"k0t"k1"k2"k3"k4"k5ĺ"k6ĺ"k;Ժ"k>"k?"\"푠"홠"""[ "Cul"XA0"BB8"6CH"7CX"TCd"XCp"TE|"BG"DG"IG"LG"MG"NGĻ"OGл"PGܻ"QG"RG"SG"TG"UG"VG "WG,"XG8"YGD"ZGP"fI\"nIh"BLx"DL"EL"FL"GL"IL"ML"NL̼"PLؼ"QL"RL"SL"WL"YL "ZL8"fLP"FMh"LM"DN"PN"dNĽ"DPܽ"FP"RP"DQ"EQ"FQ"GQ("LQ4"MQD"NQT"OQd"WQt"YQ"ZQ"lQ"ER"FR"GR̾"KRؾ"LR"HS"KS"LS"MS"NS "FT,"LT<"RTL"TV\"UVh"VVt"AY"aY"p"ʨ"PG"C̿" ܿ""""#"#"@#$"@#,"@@4"P!<"D L"DX"Dh"Dt""""V"D"E "F"G"H"M"S"]"^"""" "" $" 0"8"DD"XL"XT"X\" Xd"!Xl""Xt"#X|"P"Q"n"o"x"y"t"K@"K@"K0"tcsg"}"?",$",,",4",<",D",L",T",\",0 d"8l"x"""""""""""""$"0"`<"`X"``"`"@"B"C"F"G"H"I"P"p"s""1"1"5" ("""0" 0"20<"30D"40<"@0"p@T"@h"@x"@"@"@"@"@" p\"""""")"+$"2,"3D"4T"5h"@"C"i"l"m"""0,"`"x "0("P4"h;# D"X"3d"6d"""C$t"/""Ɯ""""""@"p"p"p"88"D"X"d"x"""""<"x"x"x"x"x"x"x","4" <"D"T"\"d"t" |" """""""!"""#"$"%$"&4"FD"e\"(h"(t"("("(t"( t"("("(t"("(t"(t"(t"(t"(!t"`" """"@"L"D"Dp"D"D"D"X("J0"u<"H"\"p"#"H"""5" 6".B"0B̶">B"$"tq"tP "tX,"]4"]hP"]i\"]xp"]|"]"]"]"]"]("]8("](" " "4"8D"'P"'\"l"6x"""FP"p"<"<"<"< "<("<) "<0$"<1,"<H4"<L"<\"<|"<"<"""""""""" "3"3"3# "" " 0"<"@"T"`" ""h".x"6">"W"p"""OI""P"`""$"0"I<"9D"L" T")h"*"0"2""""""""` $"b 4"d D"T"h"|"" " " """"4"L"d"d"|""""""""&4"'L"(d")|"0"1"2"3"4"5"6"7"8"9":";"<"=">"C"H"P"Q"Y"u"vd"w"xd"y"zL"{"|"" ",""," "! "0"1 "2,"a<" P""X"#d"&l"'|"(")"-"."0"4"5"7"<"K "P$"`,"`<"aT"bd"`t"!"#"$"0"1"$"$"$"$"$"$"$" $$"!$0""$<"#$H"%$X"&$h"($x"@$"B$"C$"D$"E$"F$"H$"I$"J$"K$"L$"N$,"Y$8"]$8"$D"$P"$`"$P"$t"$"$P"$"$"$"$"$"$"$"$"$"$"$"$ "$,"$"$<"$L"$\"$l"$\"$"$"$\"$"$\"$\"$"%"%"0%"@%"A%"C%"D%"E%4"F%L"G%d"H%|"1%"2%"5"5"5"5"3%"4%"5%"6%"`%"a%$"b%<"p%L"q%d"r%x"s%"v%"x%"y%"{%"%"%"%"%"%"% "%,"%8"%"%H"2X"u5d"v5x"w5"x5"5"5"5"5"@3"A3"0"5$"50"5@"5P"5h"5"5"5"5"5"R"R"p "p" p$"0p0"q8"qH"q\"qh"qt" q"!q""q"#q"$q"%q"q"q"q"q"q"q"q "q"q,"q8"qD"qP"qd"qd"qp"xx"Ą"ń"ʄ"˄""" "!"" "A0"@"RP"Td"x"~"`s8""a"a"D/""0".0"v"v"v"v""""" " " "!"("(" " " "4"@"@"P"}`"}fh""72"7d"""@"A"B"C"D"E"F"G"H"I"J"K"L"M"N"P"Q"R"S"T"U"V"W"X"Y"Z"\""X\"X"X"X" "X"1"2"%("0"H"d"""" " " """=(" C4"P<"+L"+`"+|"+"+"+ "+!"+%"+ "+ "+"++,"+y!8"+'%L"+\"+t"+"+"+"`"ap""W"W"WV"WH"A"@"A"$","i8"iH"iX"i h"iPx"iV""""Y"0"1" " " " \"  " "$" <" H" T" `" p" " " " " м"35\"3F"3t"3}"3"3"3X"3<"""("<"P"d"%x""""A" b" c"5"E"`Qw""" " "0" <"JPD"P""""""" "!"0"1"2"4"5"6"P"Q"R" " " " " " " "! "0 "1 "2 "@ "A "B "P "Q "R "` "a "b " "`"h"p"x""" " " " """" "!"0"" "!"""#"$"%"`""txN0"@"lL"l0X"] #l"]9#x"]=I"]HS"" " "(")","-"`"d"e"f"g"h("j8"kL"l\"m\"nl"""""""""""""$"4"<"H"X"d"Pp"Q"R"S"p"q"r"t"u"v"x "y"z0"{D"|T"d"|"""""""""" "4"@"P"\"l"x"""""""""""""P"Q "S "X4"YD"[T"d"t"""$"N""""!"EW"EX"Eh"Eh"E!"E"E"E" "Ea("0"<"H" T"!`"@l"x"""" """"" "B"Myx"f"f "f,"f4"f D"fT"f\"fl"f|"f"f"f"f"f"f"f"f"f"f"f "f!"f%"f'("f04"f<"fH"fT"f`"fh"t""v"w"P""ZS"Z3M"Z8M"Z8 "Z0 "Z0M"ZhM"Zhb"ZiM"Zib"Zu"ZuR "Zur,"Z38"Z3D"Zq3P"Zu3\"Zv3h"Zw3t"Zs3"Zr3"Zf"Z&f"Z)f"Z f"Z!f"w "w""w"w@"w"w"w"w!"w""w#$","4"<")D")L"9"iT"e\"fl"u|"v"w"x"!"Q"R"z "3S1V"3S "3S"3S "3S,"3S8"3S=<"3SH"3SP"3S\"3Sˆh"3SÈt"3SЈ"3Sш"3S҈"3Sӈ"3S"3S"3S"3S"3S"3S"3S"3S"3S "3S"3S $"3S!0"3S"<"3SH"3ST"3S`"3Sp"3S|"3S"3S."3S"3S"3S"3S"A"HC"H C"HD" "J"J "J "JF("d4"<"9L"9X"9d"9l"9 |"9"9"9"9d"9"9"9"9"90"9@"9P"9"9 "90"93"95"9@"9E "9F("9H0"9P8"9Q@"9RH"9UP"9XX"90`"93h"95p"9@x"9A"9E"9F"9H"9P"9Q"9R"9U"9 "9a "9b "9c "9U"9U"9U"9qU"9U"9U"9U$"9U0"9U8"9UD"9bL"9bT"9c\"9cd"9%cl"9&ct"90c"9p"9p"9p"9p"9p"9p"9p""""o"o$"o ,"o4"o<"o D"o L")P")`")BI") a"M "M9"M"""""""\"+"P "TT0"UT<"H"T"h"|"""! " hq" hr"4"""b"""""e"=!"=!(")H" iT"\";'d";4t";5"L"L="L="L"L "L"L"L"L ,"L!@"L#T"L$h"L&|"L'"L)"L*"L+"L"L"L"L"L "L0"L@"LP"L`"Lp"L"L"L"L "L!"L@"LA"LB"LD"LF"LG$"LH4"LID"LJT"LKx"LL"LP"LQ"LR"LS"LT"LU"LV$"LW4"LXD"L`T"Y`"p"/ "/ "//"y"y"y"y "y"y"y"y"y$"y8"y@"# H"# T"#`"# p"#"# "#"# "# "# "#P"#`"#"#"#"# ,"#@8"#%D"#`P"#\"#h"#Pt"#P"#"#"""""""# 2# 2(# 2<# 2P# 2d# Gt#`|#`#`#`#`#`#`:g#`#`j#`#`#` #`#`#`"`$#`,#4#<#6D"D#X#` p#`Ʉ#####a#q#v#### #0#@#P#\#h#x##& ###q##80#@0#C0 #D0#P0,#S0@#W0T#X0d#Y0t#e0#h0#t0#0#1#1#1#"1##1#G1#H1#I1 #w1#1$#10#'2<#a"1H#5T#`#l#|#######h#####$#4#D#L#T#\#d# l# t# |# # ########### ##$#0#<#H# T#!`#"l##x#$#%#6#7#8#9#:#;#<#=#>#?#f#g #h,#i8#jD#kP#m\#nh#ot###########`#a### #,#8#H# `# h#p#x############1#1#2 #B # #JX"P$ #P@, #P@ < #PeP #P` #PZZl #Pfx #J #] #] #] "s #s #s #s #s #s #s #s #s #s # #8 #W`" a #= #p #u #, #4 #D #H #X #` # p # t # # # #4" # #" ## #% #( #) #+ #, #/ #3 #6 #9 #< #B0 #C@ #DH #EL #HT #J\ #Kh #Lt #M #N #P #W #Z #] #` #a #f #i #k #s #t #w #x #} #~4 #@ #T #\ #d #h #t # # # # # # # # # # # # #( #@ #H #T #` #l #t # # # # # # # # # ####$#4# 8# D#L#T#\#p#'t#8#<#B#H#Y#]#f#y ########$#,#@#T#`#h#|#########?#D#[#]0v#`#l(#o8#tH#yP#z\#h#p#|###########J #M#v #0#8#@#H#P#X#d#x# ##=#O#a#######T"##$#;#b4#<#D#X#`#8x#`####7# #;#T#}### ##3#==#@` #3@#OI #J(#FP0#3S8#tc<#H#J #."P#P#X#d#Yl####> #$sH6s#6@6 PH#6`OH#6`bF M#asM΁3swO 33i`J`c,c<3 #hM #h##acj3 Nv3 6-3PNPDF##Ɓ#a Jac6-3#hW`愀#愀sKa O#AObHFV#s)Bg#sw2|<LزjNgc-xfjn3|P`P##< #%aOo##$+fj 3cCM #a15l8?#a31 5 9=~-   x33|`B~`)1`C~"X<\"3%|>`> 3B~#:nl8?B~B؃|3/B؃|ă3&8+26##k#c 3|`  k#c-<4830| ` 3 #b cZ3cd# v3 3B##"#"(#"#"B#JaE#3 bG# 3 bC##D#sM3'##&KOO"va F$Hڀ#4#Ja@#AK`#I0I`w#]b#c3-c#Ja#APb#Ac̆_+gcz|#hH##c|#cJa6#Ac37 #c`c#|ocKARaN#Ac3 b#Acg#cc#|gc3@ bcc|+@c|@cC|g@c|#c3*c +3)Ccކ3 bڀc|{c3, .c,|3=gc D|#acrqpcrppqrqppcrppqrqppc##3H#HCڇ#c nCvwc nCvwc#tC@Dt$&$scuZF&JudNsc{cv3>gcc8+8+2 1 c26:>c26:>c8+@2@6@:@>cZ @]cs #ss#f ##bswhA###BT+####$#8#L#+"l#`##t#x#######"##$%!%&&(''###### #,#8#T#l#####          4x l <\ @@@@@x $   t 8  | d+)hUU72|12896|256128|512160|1024%2K} }}}%}2> > >>> > > >>%+2>K}  }}}} } > > > >  >> ! >> >    &(`& 0&0 0 `"0 0  JtT4$   rq! 2r!qq! 0  S1B1SSA1B1B11qw!! RSQQP@064a2tF"tF0LKpLKqLKqLK$LK!$LKJ$LKK$LK$LK$LK$LK$LK$LK$LK$LK t8Yt8YAt8Yit8Y@hCiFiHiIio1pxq0^q0^I1azUdh)R     3Mԣ8Mԣ0 ԣ0MԣhMԣhbԣiMԣibԣuԣuRԣurԣv3ԣ@@@@ @e8j "j j Lk pk 9|k  k k k xl fl Zk l l 222CC @ @  "2"]G4" w! C0ae01S0 3@ Fv PQUVXZEUPU`V`)0 I$567129:=PQ348;<>Y)Y$]$   &'(uvwxyz{| (((((((((2222222<<<<<<<<<FFFFFFPPPPPPZZZZZZZZZddddddddddddddnnnnnnnnnnnnnnnnnnxxxxxxxxxxrrrrqqqq)P@ & 4JPJ.0Lx #9# #:# # :# # :#!0 #4:#F #H:#\:#l:#\:#:#\:#:#!0\:#4:# :#:# :#:#@:#:#@:#:#@:#;#@:#;#@:#;# @:#;# @:# ;#A:#$;#A:#(;#:#,;#:F4;#H;#:FP4;#\;#g  #t;#;#;#" ;#;#@ ;#;#` ;#;#`;#;#h;#;#h!;#<# <# <#T0<#<<#T0<#H<# \<#D?# #p<##<##<#<#<# <#<# x<#<#<#<#<#=#<#=#a <#<# <#$=# <#4=# <#D=# <#T=# <#d=# <#t=#)=#=#f(=#=#=#=#=#=#=#=#r=#=#p>#>#># >#0>#L>#G1!`>#p>#G '`>#x>#>#h;#>#>#>#># >#>#'>#h;# >#>#W ?#4"W ?#$?#W ?# "W@?#4?#o D #@?#3P?#X?#VP?#d?#vP?#?# ?#?#` #?#8h?#?#?#?# ?# @#  ?#@# ?#" !?#,@# ?#D@# T@#h@# T@#@# T@#@#T@#@#\ #@#\ 3 #@#@#@#ng@#@#"o# A# "o#A#A0o#,A#C0o##|B#B#B#B#B#B#B#B#B#B#B#B#, #C#, #C#3, #C#v, #$C#JP, #8C# PC#`C#xlC#xC#C#C#C#C# C#C# C#C#C#C##C#@#C#X#C#  D#:#$D#,D#8D#>#8D#PD#8D#\D#8D#lD#`e8D#xD#y5iD#D#BD#D#$D#D#AD#D#D#E#D#E#D# E#N0E#@E# LE#TE# LE#TE# 7LE#dE# @LE#tE# @LE#TE# @LE#TE# @LE#;# @LE#TE# ALE#TE# LE#TE# E#E#v E#E#mE#E#mE#lw!nE#E#n E#E#n@E#E#n@E#E#n @E#E#nPE#E#nE#E#e"E#E#0E#E#EF#F#EF#(F#EF#4F#EF#@F#EF#LF#EF#\F#EF#h;#EF#hF#EF#tF#EF#|F#EF#h;#F#F#F#F#F#F#F#F#F#F#F#F#F#F#F#G# F#$G# F#8G# F#XG#F#hG#F#xG#F#G#F#G#F#G#lG# "G#G#G#G#`H# H#qH##k @#U#mU#U#mU#U#mU#U#mU#U#mU#U#m@U#U#mPU#xC#mU#V#mU#V#mU# V#mU#,V#mU##pW#K#pW#tW#pW#W#0pW#W#pW#W#W#W#W#W# W#W#W#W#W#W#W#X#W#X#'W#0X#=W#DX#pXX#dX# gpX#:#^X#X#^ X#X#^ X#X#^X#X#^X#X#^$X#Y#^%X#Y#^+X#0Y#^nX#HY#^zX#p@#XY#dY#XY#pY#XY#|Y#XY#Y#Y#Y#Y#Y#Y#Y#Y#Y#Y#Y#Y#Y#Y#Y#cY#Y#z  Z#Z#@,Z#4Z# @,Z#@Z# @,Z#LZ#@,Z#XZ#dZ#lZ#ddZ#|Z#idZ#Z#BZ#h;#cU #Z#cA #Z#Z#Z#_Z#Z#_Z#Z#_Z#[#_Z#Z#_Z#[#_Z#[#_Z# [#_sZ#K#_Z#0[#_AZ#8[#@[#L[#@[#L[##9 X[#p[#|[#[#|[#[# U #E# U #E#b X #[# P0[#[# P[#[#%\#\#%@\#,\#F8\#h;#F8\#h;#F 8\#p@#F@8\#D\#FA8\#\\#d\#l\#d\#t\#d\#|\#p' \#D_#\#\#\#\#\#\#\#\#\#]#\#\#\#\#\#\#\#\#\#\#\# ]# \#(]#\#<]#U\#T]#h\]#t]#0]#]#0]#]#0]#]#0]#]#0 ]#]#01]#]#0@]#]#0P]#]#0`]#^#0p]#^# ^#8^# ^#@^#} @P^#\^#} P^#d^#} } P^#E#el^#^#el^#h;#el^#^#el^#h;#q^#^#q^#^#q^#E#q^#^#q^#^#q^#_#q^#_#q ^#,_#q^#L_#q^#`_#q^#x_#qq^#_#q^#_#"_#E# _#_#3_#_#`#$`# 4`#@`#` #\`#Zh`#h;#Z h`#h;#Z 0t`#`#85`#`#a`#`#a`#`#a`#`#a`#`#a@`#`#aA`#`#aE`#`#a``#a#aa`#a#a`#(a#a`#0a#a`#(a#a`#@a#aM`#Ha#aM`#Pa#aM`#`a#{pa#a#{pa#a#{pa#a#{#pa#a#{#pa#a#{#pa#a#{%pa#a#~b#$b# 4b##P?#dZ#PK#P#|[# #H#  # lS#W###"n##|A#$Xg#(I#0i#6j#8n#=T#@n#Nn#O|k#Qt #Vo#X(T#Zi#^X#a`#do#jHB#ko#mU#n@#q^#td#xlC#}Q#~HW#T#4`#h##, #,K#;#Dm#o#d\#4"8D#F#hb#4P#j#\:#0o#Po#\o#PI#|o#o# T#o#0I#_#o#d#o#o#o#># ^#Le#M#|e#o#XQ#B#@#D# # # p# ?#Q#0>#"p#%\#'0p#(8p#)=#@l#Cl#En#G`>#L #S,m#VLp#W?#_Z#b(k#el^#f=#jm#lG#mE#nE#s #vhp#{,n#|#Lb#b#c#b#n#=#P#p#p#T#\#dO#>#D#4b#E#p#Dl#p#Y#Xi#T#p#pI#q#q#(q#tQ#4q#8q#_#Hq#|B#\q#tq# g#q#hW#q# q#$q#6m#8?#Dk#^ #cd#k#nq#odf#wq#xq#{pa#|D#` #,Z#B#J#$D#q#d#r#<#r#8r#(R#Pr#Z#<#dr#f#r#lJ#Xg#b#pW#M#1Tj#N0E#Ur#cY#{#}DJ#(d#Q#r#r#r#,i#r#r#s#s##C#G#XY#\#:#Q#\#s#$s#,s#Ls##A#ds#ts#s# i#n#'s#-J#5s#0]#:4;#AD#F8\#T0<#Zh`#ni#pXX#|s#} Q#s#s#s# t# t#(t#$g#T@#G#@[#@t# ?# k# Lt# PC#! I#) \t#< "O pn#Q DS#V xt#W t#Z t`#g  #v t#x t#z  Z# # t# t# t# <# t# u# u# (u# @u# Hu# Xu#  D# k# >#C `u#\ #k  J#y pu# [# k#9 #b  #o D #~ u# >#  J# \<# <# E#v E#= pj#} P^# pX#f$K#\]#`#c #e$B# #>#E(Q#f#u#A4l#?#BZ#4e#'f#g#\l#M#EF#h;# LE#p'\#85`#y5D##9X[#@P#AP#U\#ag#H#PK#u#u#u#v# v#v#v#(v#4v#?@ABCDWXFE7JNOPQKLMGHIRSVY]^_~sp}y{\xwv*8۝6D @  `abcde f g h i jklmnopqrstuvwxyz1!2@ 3#!4$"5%#6^$7&%8*&9('0)( ) *+ , --_.=+/[{0]}1\|2#~3;:4'"5`~6,<7.>8/?9:;<=>?@ABC D E FG HIJK,LMN-OPQRS T/U*V-W+X Y1Z2[3\4]5^6_7`8a9b0c..d\|e 2"#6&$7'%8(&9)'0--=.^~/@`0[{2]}3;+4:*5\_\|9mMqQ@zy2" 3#6&$7/{%8([&9)]'0=}-?\./0+*2#'345 6,;7.:8-_d<>| .'`0+*~5^2"@ 3#!4$#6&$7/{%8([&9)]'0=}-+?.|/02'*3456,;7.:8-_d<>\ .'`|0^~-+?\0345d<>| .'`|0^~.\0345|d<>.\`0^~q,?azw&12~ "3#!'4{"(5[#-6|$7`%_8\&9^'0@-)].=+}/0$2*3m4%56;.7:/8!d<> 2" 3!4$"5%#6&$7/%8(&9)'0=-'?.^/{[0+*}]13@4#5\|6,;7.:8-_d<> 1!2" 3!4$"5%#6^$7&%8*&9('0)--_.=+1#~4'@5``d\|1!|2"@ 3#!4$~#6&$7/%8(&9)'0=-`?./[0+*]1}34{5\6,;7.:8-_d<> q,?azw&1|2@ "3#!'4"(5#6^$7%!8&9{'0}-).-_/[0$*]2`3m4%56;.7:/8=+~d<>\ 1+|2"@ 3*#!4#6&$7/%8(&9)'0=-'?.eEz/[0!]34{5 2$}y6,;7.:8-_d<>\ -'?.^`~0!]/[34{   4  O  Z޻  FҺ ^ J M& n     λ J X   ҿ  [T PD  p %&) ) +00h1( @ v @  @ @  W 1 Q `@  6@  0 2 A` @  @  @ @ @ @ P0@ P@  A @ @ h@ } @ } } } @@ @ 85@   6  L+ L 7L2@ D@   O  {@87o ! AZPZPZPP?\?TA C---0000 0@0P010`0pLfLLLLi`IINlNTTDP_0"`Ju % 5 pJ @ P u u @zyx|zy{ u ണ V  zy{0 $4 t.4 t/4z{  ~<uStІЄЅuuSnDghijklmnopqrstuvuuuKepuxu@ D@uux D@uSt|EpP$P -xSTRdPOuONt(%TBOЂЃ20~uu8}Ӕ@0~JK"ү Lu u u u H~}| P zyx $ 5 5 LMu u u u ~}| Pzyx ~}| PTzyx $ 5 PDҌ ct ct c$4T P W ^ e suBuC "uBuC0"uBuC"uBuC "uBuC"uBuC "uBuC"uBuC "uBuC "uBuC"uBuC"uBuC"uBuC"uBuC"uBuC"uBuC"uBuC"uBuC"uBuC"uBuC@"uBuC""D$4$4t"3 uB|0dPuuGFF P3t+4R  Pt+4  TuӔP` LpuӔP u $4~Q  R    %SЂЃ2XV`@ X+P(؊v`@(;PF`@#0hf`@ h30x^ @ x/~ @?8N @ 8'pHn @ H7pHR @H)p8Ȏr @89pB @!xb @x1hZ` @h-0z`@=0(J` @(%PXj` @X5P1300@' 2  $4 $ $ $ $  $ $@  %  $ $@  %  !"Z  u / $ 1%u R Q ( *%u u%u <RFC Distribution (S) Pte Ltd.T Y@pPhone - The way to chat. DC"e"L~):u{zyedp-"b{zyl |0#D#X#  l#  #0 @#P `( p#< #P Њ### #d  #x  4#0H# @\#J#Xh#^ n ~   # p#|## ## p##ċ#؋# ##n ~ #D T# d# #p# 0#p#O# D#p#gO#hO#iO#jO#kO#lO#mO#nO#oO#pO#qO#rO#sO#tO#uO#vO#C4 8 L  ` 0t @ P <X#Ll#_t##)# 9##Ȍ# ܌#K#  ###,# @# T# / ? O4 _h#x# # # 0#H ## S#Kč#[؍# k#x##$#(#<#P#d#x### #Ȏ#*܎#:#J#Z\ j#z,#p 4#Ct x    0 @ P    8#X h<#x P#d#x####ȏ#܏###(#8,#H@#XT#h, xh#@ |####T ̐####(# 8h D0#TD#dX#tl#####Б##x    $#4 #D #T d t 4#H#\#p##  , ##$#4Ԓ#D#T#d#t$#8#L#\#d#x####ȓ#ܓ##&#6#F,#V@#fT#vh#|#@ T ###h |  ̔# & #6 #F #V #f 0#v D# X# l# # # # # Е# # # #& #6 4#F H#V \#f p#k x#{ #  # # Ȗ# ܖ#      +  ; 0 K D [ X k l { # # # #  0# 8# L#d#  `# d#d#d# h## 3 C S |#c  s #   ,  @  T  h  # # |  ̗# ## 3 #C S #c s #  0# D#  X#  l# # # ## "#- =Ș#Mܘ#]# m x##Ę#O#,#@#O#O#L##O#O#O#O#O#O#O#O#O#O#O#O#O#( < P d x # 3 C S c s   , @ T h |    # 3 C S c s0 D X l   `#t#####ę#3ؙ#C#S#c#s(#<#P#d#x####Ț#ܚ####3#C,#S@#cT#sh#|#####ԛ#### $#8#)L#9`#It#Y#i#y#Ĝ#؜####(#<#P# d#x#)#9#I#Yȝ#iܝ#y###,#@#T#h#h#h# |##)#9#I#Y#i#y#̞######## #0#)0#90#ID#YX#iX#yX#l#########ğ#؟#/؟#?؟#O#_#o###(#(#(#<#P#P#P#d#x#/x#?x#O#_#o###Ƞ#Ƞ#Ƞ#Ԡ#ܠ#   0 @ P ` p 4 H \ p    #    0#@ P `$ p8 L ` t     #,#@#H#)\#0d#2h#B R b p#q|#  #4 #H ## #L# \̡#eč#u؍# #ء#### ##4#H# \#l#### #Т#,#<#p 0#!00QlQTR\RF  @@@ @ @AA@:F:FP  !      @ @ @ @ A n n@n @nn@0f @  Q k k"k"k"k"k @^z F | [h[D`a`tdϼWg($g"  Yg$ϒWW WVp  W@Y@ b WRVWV `YYW Wx,VH 7hW b' pDP g H ' H7 `!7>#W?g0L0 H Qϟhϟ7 pPgpߟWWz nb'4' 6W W w W w w /B w zBz'P4w y'P4w y`0PP0zBzW. \'^ϟLiW3'ز'Ҵg`' 'ߗ rbdd$'r'd$ WbpWd d02 dbWdp r'xb'r@ 0d QWj j'j'Rljl`ϟh b r'rϗ ',wW" '' Ag0 0  @YIJg P |wwLdwww w~dPTp\p\`0    Sxd Ȃ ςd‰0`xω Sy‰0zߗ f h f h d02  b7Wh=$ dgw*f0 w f'w f  'wfD'F`'bhW  h lPgl dbWbpߗ  $ dg zfwW P'RW W wX'Zwp'rw' wd'fw@\'^w76'W WP'RT'V 4wW''.W ߗ nb'n'Rpnph?3WR      X T  D'''tD' | LH'Vr W IC `J |gQ Ibuߧ$"  ,  f$("` 4 >   ( ( ' W* 7* Ҳ < W* '  ''\'AgP gZ' ^ `ZAQϟ  Y' |Y  IZ` HAPYYW&~\AgZ' ^\ `ZAQ W~ @'' ' "AgZ^'\\ `ZPY`X I JX@D' }D@A7PW'vA@D't vA؟D'(g$Wz "g>. > T'R  @ x ''|  ~) } 'jjl'nnp'x'b'd t vr @zQ  v zQWR W 2g&  W#@@W @ @ ߟϟ w w  "g"w g"g"w " W Wz w   f  gw dWșgL  7 AHdwA`qWC!C!C!d$.,>DHP\`flpvtz~ $"*06<NRX\ &l *.4:DNZ^jr08<@HFT^dtx,0JVZ &.4HRd $*2808<DBH    $ ( 2 F J P T Z ` |       $ , 2 < F L P T Z ^ f l r x ~ |  $ @ D H N L R h l p v $ ( 0 6 < @ J P X V \ ` d     " 0 ~ ,>LP^d@ 'W W@ @EEE }WQ  k"BFFeeeZZ Z 0|h P$X\{ W {#nP1(ah d00  hTp" @ ` a       8h"X ___s_____aaaaa@aAaEa`aaaaaa   00`$!1!1@X$     !"#$%&'()*+,-./0000000000:;<=>?@00000000000000000000000000[\]^0`00000000000000000000000000{|}~00000000000000000000000000000000000000000000000000000000000000\mnldlvt100vvhx,y  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^%% $ $ $ $ $%% %%<%%$%4%,%%d"e"`"  " %" #!#%# # # # ""*#d"`"e"+"4"""""<"C"!!a"""")"*"'"(""!!!!#@[\]^_`{|}~@[\]^_`{|}~|^_`#@_^_`#_#^_`^_#@^_`~#@^_`~^_``#_ABCDEFGHIJKLMNOPQRSTUVWXYZ@ `P0pH(hX8xD$dT4t L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}C#cS3s K+k[;{G'gW7wO/o_?<l|$! 1!2@3#4$5%6^7& 8* 9( 0) -_ =+! qwertyuiop[{]} as d!f"g#h$j%k&l';:('")`~*+\|,z-x.c/v0b1n2m3,<4.>5/?67*89 :;<=>?@ABCD E F G7H8I9J-K4L5M6N+O1P2Q3R0S.W X  / ,-.2"36&7/{ 8([ 9)] 0=} ?\ qQ@z+*'() +#',y2mM3,;4.:5-_V<>| '`+*~)^2"@3#4$6&7/{ 8([ 9)] 0=} +? |'()+'*3,;4.:5-_V<>\ '`|^~ +?\'()V<>| '`|^~ \'()|V<> \`^~&12~"3#'4{(5[-6|7` _8\ 9^ 0@ )] =+}az$q'm(%)+*,w2,?3;.4:/5!V<> 2"34$5%6&7/ 8( 9) 0= '? ^{[+*}]'@(#)\|+3,;4.:5-_V<> 1!2"34$5%6^7& 8* 9( 0) -_ =+('@)``+#~V\|2"6&7' 8( 9) 0 -= ^~@`[{';+(:*)+]}ps\_y{}\|1!|2"@3#4$~6&7/ 8( 9) 0= '? [+*]'({)\+}3,;4.:5-_V<> !1@-2_/3#;4$:5,6^.7& =8* [9( ]0) ?+' xX%eE{wW}!'(")`~+qQ|-34fF5\9 &1|2@"3#'4(56^7 !8 9{ 0} ) -_az[$*]q'm(%)+`,w2,?3;.4:/5=+~V<>\ `~)<> W  FE7JG7H8I9K4L5M6O1P2Q3R0S.-N, [{ ]}'",<.>pyfgcrl/?=+o e!u"i#d$h%t&n's(-_,;:-q.j/k0x1b3w4v5z:; <=>?@ABCDW X 6^6,7&7.qQwWeErRtTyYuUiIoOpP[{]}aAsS dD!fF"gG#hH$jJ%kK&lL';:('",zZ-xX.cC/vV0bB1nN2mM3,<4.>5/? 6^6,7&7. -_ =+qQwWeErRtTyYuUiIoOpP[{]}aAsS dD!fF"gG#hH$jJ%kK&lL';:('")`~+\|,zZ-xX.cC/vV0bB1nN2mM3,<4.>5/? 1+|2"@3*#46&7/ 8( 9) 0= '? eEz[!]'({) +$},y3,;4.:5-_V<>\ '? ^`~!]['({2"@3#4$6&7/{ 8([ 9)] 0=} '? <>+*'()\|+3,;4.:5-_V<> 1!2"3#4$6&7/ 8( 9) 0= '?\ qQ@+*~'({[)|+}]3,;4.:5-_V<> 1!2@3#4$5%6 =+[{'()'"+]}5;:S.V\|s/?2'3^#4+$5%6&7/{ 8([ 9)] 0=} *?\ -_qQ@I~'(i)"+,;345.:V<>| ''+,;`eEoOaAsS&lL,zZ-xX.cC1nN 1'~2"3+^4!5%6/7=` 8( 9) qQ\wW|zZiIQP!fF["gG]$jJ'$()0+qp,yY>-xX#.cC&/vV@0bB{1nN}3,?;4.:5-_*V< 1!~2"3#^4$5%6&7/` 8( 9) 0= '? +*qQ\wW|zZ!fF["gG]%kK&lL'()+,yY/vV@0bB{1nN}2mM3,;4.:5-_V<> !O ! !Z !F !: !Jn !M !4 ! J ! v !  !  !C !K!<!@#F!<!<! <!<!H@<! J! [j!!!X|! ,! D! ,!EZ!i!J!=x!W! !0! !!PH  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abc  !"#$%&'()0123456789@ABCDEFGHIPQRSTUVWXY`abcdefghipqrstuvwxy0123456789abcdefghijklmnopqrstuvwxyzOpenBSD3.6RAMDISK#45 @(#)OpenBSD 3.6 (RAMDISK) #45: Fri Sep 17 17:52:25 MDT 2004 OpenBSD 3.6 (RAMDISK) #45: Fri Sep 17 17:52:25 MDT 2004 deraadt@cats:/usr/src/sys/arch/cats/compile/RAMDISK dackirqiomemiosizdrqdrq2channeldrivetargetlunphydevfunctionconfigurationvendorproductreleaseportnoreportidconsolemuxslotwsmuxcryptoloopbpfiltervga_init_screen: no font vga_init_screen: no fontvga_common_setup: couldn't map vga iovga_common_setup: couldn't map 6845 iovga_common_setup: couldn't map memoryvga_common_setup: mem subrange failedvga_free_screen: consolevga_doswitch: disappeared vga: pcvt font support not built in, see vga(4) vgadrive at %s channel %d drive %datapiscsi at %s channel %dwdcspl%s channel %d: reset failed for drive 1 drive 0atapi type: %s c_bcount: %d c_skip: %d missing untimeoutwdc_probe_caps%s(%s:%d:%d): using PIO mode %d, Ultra-DMA mode %d, DMA mode %d using BIOS timings%s: transfer error, downgrading to PIO mode %d %s: transfer error, downgrading to DMA mode %d %s: transfer error, downgrading to Ultra-DMA mode %d wdccmdwdccommandwdccommandext%s:%d: %s %s(%s:%d:%d): %s physio split wd ioctl request... cannot proceed user_strat: No ioctl TagSCB %d - Abort%s Completed. Bus Device ResetSelection Timeout%s: ahc_intr - referenced scb not valid during SELTO scb(%d, %d) parity error detected %s. SEQADDR(0x%x) SCSIRATE(0x%x) non- Unexpected %sDT Data Phase Illegal CRC packet request No terminal CRC packet recevied CRC Value Mismatch %s:%c:%d: %s: Someone reset channel %c %s: Transceiver State Has Changed to %s mode %s: Spurious SCSI interrupt NONEaic7770aic7850aic7855aic7859aic7860aic7870aic7880aic7895aic7895Caic7890/91aic7896/97aic7892aic7899Illegal Host AccessIllegal Sequencer Address referrencedIllegal Opcode in sequencer programSequencer Parity ErrorData-path Parity ErrorScratch or SCB Memory Parity ErrorPCI Error detectedCIOBUS Parity Errorin Data-out phasein Data-in phasein DT Data-out phasein DT Data-in phasein Command phasein Message-out phasein Status phasein Message-in phasewhile idlein unknown phase80.040.033.020.016.013.410.08.06.675.75.04.44.03.6%s: WARNING no command for scb %d (cmdcmplt) QOUTPOS = %d Attempt to queue invalid SCB tag %x:%x %s: brkadrint, %s at seqaddr = 0x%x ahc_intr: seqint, intstat == 0x%x, scsisigi = 0x%x %s:%c:%d: unknown scsi bus phase %x, lastphase = 0x%x. Attempting to continue %s:%c:%d: Warning - unknown message received from target (0x%x). Rejecting ahc_intr: HOST_MSG_LOOP bad phase 0x%x %s:%c:%d: no active SCB for reconnecting target - issuing BUS DEVICE RESET SEQ_FLAGS == 0x%x, SCBPTR == 0x%x, BTT == 0x%x, SINDEX == 0x%x SXFRCTL0 == 0x%x SEQCTL == 0x%x Unable to clear parity error. Resetting bus. %s:%c:%d:%d: Attempt to issue message failed data overrun detected %s. Tag == 0x%x. HaveHaven't%s seen Data Phase. Length = %ld. NumSGs = %d. sg[%d] - Addr 0x%x%x : Length %d Bogus TAG after DMA. SCBPTR %d, tag %d, our tag %d for saftey%s: BTT calculation out of range SAVED_SCSIID == 0x%x, SAVED_LUN == 0x%x, ARG_1 == 0x%x ACCUM = 0x%x SEQ_FLAGS == 0x%x, SCBPTR == 0x%x, BTT == 0x%x, SINDEX == 0x%x , A == 0x%x SCSIID == 0x%x, SCB_SCSIID == 0x%x, SCB_LUN == 0x%x, SCB_TAG == 0x%x, SCB_CONTROL == 0x%x SCSIBUSL == 0x%x, SCSISIGI == 0x%x for safety%s: No free or disconnected SCBs %s:%c:%d: Missed busfree. Lastphase = 0x%x, Curphase = 0x%x %s: Interrupted for status of 0 (?) ahc_intr - referenced scb not valid during seqint 0x%x scb(%d) HOST_MSG_LOOP with invalid SCB %x %s: Missing case in ahc_handle_scsiint. status = %x Unexpected busfree %s SEQADDR == 0x%x %s: %s: Infinite loop in critical section critical section loopscb:%p control:0x%x scsiid:0x%x lun:%d cdb_len:%d Shared Data: %#02x dataptr:%#x datacnt:%#x sgptr:%#x tag:%#x %s: ahc_alloc_tstate - Target already allocated DT%s: target %d synchronous at %sMHz%s, offset = 0x%x %s: target %d using asynchronous transfers %s: target %d using %dbit transfers %s:%c:%d:%d: Bus Device Reset Message Sent Abort%s Message Sent ahc_intr: AWAITING_MSG for an SCB that does not have a waiting message SCSIID = %x, target_mask = %x SCB = %d, SCB Control = %x, MSG_OUT = %x SCB flags = %xNo or incomplete CDB sent to device. %s: Issued Channel %c Bus Reset. %d SCBs aborted Protocol violation %s. Attempting to abort. Completed command without status. Unknown protocol violation. No SCB found during protocol violation Target did not send an IDENTIFY message. LASTPHASE = 0x%x. HOST_MSG_LOOP interrupt with no active messageUnknown REQINIT message typeTarget MSGIN with no active message(%s:%c:%d:%d): Target Initiated PPR (%s:%c:%d:%d): Initiator Initiated PPR (%s:%c:%d:%d): requested %dBit transfers. Rejecting... (%s:%c:%d:%d): refuses WIDE negotiation. Using 8bit transfers orderedhead of queue(%s:%c:%d:%d): refuses %s tagged commands. Performing simple queue tagged I/O only (%s:%c:%d:%d): refuses tagged commands. Performing non-tagged I/O %s:%c:%d: Message reject for %x -- ignored (%s:%c:%d:%d): refuses synchronous negotiation. Using asynchronous transfers %s: %s on %c:%d. %d SCBs aborted Unsupported adapter type (0x%x). Ignoring %s: WARNING - Failed chip reset! Trying to initialize anyway. hardware SCB structuressense buffers%s: ahc_init_scbdata - Unable to allocate initial scbs %s: No SCB space found SG spaceUltra Ultra160 Ultra2 SingleWide%s%s Channel %c, SCSI Id=%d, %d SCBs%d/%d SCBsTwin Channel, A SCSI Id=%d, B SCSI Id=%d, primary %c, shared data%s: Host Adapter Bios disabled. Using default SCSI device parameters %s: unable to allocate ahc_tmode_tstate. Failing attach Infinite interrupt loop, INTSTAT = %xInactive SCB in Wait List scb_index = %d, next = %d Waiting List traversalWaiting List inconsistency. SCB index == %d, yet numscbs == %d.found = %d, qinstart = %d, qinfifionext = %d First/Second Qinfifo fixupInactive SCB in qinfifo qinpos = %d, SCB index = %d Loop 1Disconnected List inconsistency. SCB index == %d, yet numscbs == %d.Disconnected List Loop. cur SCBPTR == %x, prev SCBPTR == %x.Inactive SCB on pending list Bogus resid sgptr value 0x%x %s: Program too large for instruction memory size of %d! ahc_loadseq: Could not malloc%s: BMOV not supportedUnknown opcode encountered in seq program%s[0x%x]ahc_print_register:(|%s%s>>>>>>>>>>>>>>>>>> Dump Card State Begins <<<<<<<<<<<<<<<<< %s: Dumping Card State %s, at SEQADDR 0x%x ACCUM = 0x%x, SINDEX = 0x%x, DINDEX = 0x%x, ARG_2 = 0x%x HCNT = 0x%x SCBPTR = 0x%x SCSISIGIERRORSCSIBUSLLASTPHASESCSISEQSBLKCTLSCSIRATESEQCTLSEQ_FLAGSSSTAT0SSTAT1SSTAT2SSTAT3SIMODE0SIMODE1SXFRCTL0DFCNTRLDFSTATUSSTACK: SCB count = %d Kernel NEXTQSCB = %d Card NEXTQSCB = %d QINFIFO entries: Waiting Queue entries: %d:%d Disconnected Queue entries: QOUTFIFO entries: Sequencer Free SCB List: Sequencer SCB Info: %3d SCB_CONTROLSCB_SCSIIDSCB_LUNSCB_TAGPending list: Kernel Free SCB list: FEATURES = 0x%x, FLAGS = 0x%x, CHIP = 0x%x BUGS =0x%x <<<<<<<<<<<<<<<<< Dump Card State Ends >>>>>>>>>>>>>>>>>> Untagged Q(%d): (SCSIPHASECard was paused %s: failed to allocate DMA mem for %s, error = %d %s: failed to map DMA mem for %s, error = %d %s: failed to create DMA map for %s, error = %d %s: failed to load DMA map for %s, error = %d ahc_createdmamem error (%d) ahcahc_attachno longer in timeout, status = %x cmd fail %s: board is not responding SCB 0x%x - timed out again Other SCB Timeout%sBDR message in message buffer SCB %d: Immediate reset. Flags = 0x%x Queuing a BDR SCB %s: Hung target selection sg[%d] - Addr 0x%x : Length %d %s: Timedout SCB already complete. Interrupts may not be functioning. Timed-out target SCB but bus idle%s: Illegal cable configuration!!. Only two connectors on the adapter may be used at a time! adv%s: unable to allocate control structures, error = %d %s: unable to map control structures, error = %d %s: unable to create control DMA map, error = %d %s: unable to load control DMA map, error = %d %s: unable to initialize ccb, error = %d %s: unable to create DMA map, error = %d advccb%s: unable to load overrun buffer DMA map, error = %d %s: unable to create overrun buffer DMA map, error = %d %s: unable to map overrun buffer, error = %d %s: unable to allocate overrun buffer, error = %d %s -set: tag queuing enabled w/o disconnects unknown warning %d I/O port increment switch enabled %s -get: Chip is not halted Couldn't get MicroCode Start address I/O port address modified EEPROM checksum error IRQ modified adv_init: adv_find_signature failed%s: bad signature%s: unable to initialize board RISC chip%s: unable to create control blocks %s: WARNING: only %d of %d control blocks created %s: unable to load MicroCode%s: unable to initialize MicroCode%s: adv_scsi_cmd, more than %d dma segments %s: adv_scsi_cmd, error %d loading dma map timed out AGAIN. Resetting Bus %s: exiting ccb not allocated! %s: timed out [ecb %p (flags 0x%x, dleft %x, stat %x)], AGAIN sync negotiation disabled espESP100ESP100AESP200NCR53C94NCR53C96ESP406FAS408FAS216AM53C974FAS366/HMEout of memory %s: unknown variant %d, devices not attached : %s, %dMHz, SCSI ID %d %s: unknown revision code, assuming ESP100 %s: resetting SCSI bus ncr53c9x_ecb[NCR_INIT(%d) %d] SELATNS [ncr53c9x_select(t%d,l%d,cmd:%x,tag%x,%x)] [0x%x, %d]->%d [ncr53c9x_scsi_cmd] [ncr53c9x_poll: rescheduling] [ncr53c9x_poll] %d:%d busy [ncr53c9x_sched] ncr53c9x_sched: not IDLE (state=%d)requesting sense sense=0x%02x resid=%lu %s: QFULL -- throttling to %d commands [ncr53c9x_done(error:%x)] [flushfifo] cont [rdfifo %s (%d): %02xncr53c9x_rdfifo: bad flag[wrfifo(%d):ncr53c9x_sched_msgout %x %d %s: reselect from target %d lun %d tag %x:%x with no nexus; sending ABORT %s: reselect with invalid selid %02x; sending DEVICE RESET %s: msgin: no msg byte available %s: phase change, dropping message, prev %d, state %d %s: unexpected MESSAGE IN; sending DEVICE RESET %s: reselect without IDENTIFY; MSG %x; sending DEVICE RESET got %ld extra bytes cmdcomplete unrecognized MESSAGE EXTENDED; sending REJECT %s: wide mode %d async mode max sync rate %d.%02dMB/s SDTR period %d, offset %d extended(%x) save datapointer restore datapointer disconnect %s: tagged queuing rejected: target %d (rejected sent tag)%s: sync transfer rejected: target %d %s: wide transfer rejected: target %d msg reject (msgout=%x) noop unrecognized MESSAGE; sending REJECT ident TAG %x:%x%s: TAG reselect without IDENTIFY; MSG %x; sending DEVICE RESET gotmsg(%x) state %d[ncr53c9x_msgin(curmsglen:%ld)] %s at line %d: no nexus %s at line %d: unexpected MESSAGE OUT phase [ncr53c9x_msgout(priq:%x, prevphase:%x)]%s: waiting for SCSI Bus Reset to happen %s: identify failed, state %d, intr %02x selid=%2x %s: RESELECT: %d bytes in FIFO! [intr %x, stat %x, step %d, prevphase %x] %s: target didn't identify backoff selector ncr53c9x: no nexus%s: MSGIN: unexpected FC bit: [intr %x, stat %x, step %x] %s: MSGIN: weird bits: [intr %x, stat %x, step %x] MESSAGE_IN_PHASE %s: unexpected bus phase; resetting MESSAGE_OUT_PHASE DATA_OUT_PHASE [%ld] COMMAND_PHASE 0x%02x (%d) DATA_IN_PHASE STATUS_PHASE ncr53c9x no nexus%s: step 1 & !NEG %s: !MSGOUT (%s:%d:%d): selection failed; %d left in FIFO [intr %x, stat %x, step %d] (%s:%d:%d): select; %lu left in DMA buffer [intr %x, stat %x, step %d] %s: unexpected status after select: [intr %x, stat %x, step %x] <>%s: target didn't send tag: %d bytes in fifo [%d] %s: STATUS_PHASE: msg %d %s: can't get status, only %d bytes %s: ICCS: : [intr %x, stat %x, step %x] %s: invalid state: %dsync nego not completed! %s: unexpected disconnect; sending REQUEST SENSE %s: SCSI bus parity error %s: !TC on DATA XFER [intr %x, stat %x, step %d] prevphase %x, resid %x %s: !TC on MSG OUT [intr %x, stat %x, step %d] prevphase %x, resid %lx %s: DMA error; resetting %s: illegal command: 0x%x (state %d, phase %x, prevphase %x) %s: SCSI bus reset regs[intr=%02x,stat=%02x,step=%02x,stat2=%02x] [ncr53c9x_intr: state %d] %s: nexus in reset stateDMA activetagged DT %s: target %d now using %s%s%d bit MHz %d REQ/ACK offset xfers 13.3??3.33async siop: can't find my sync parameters%s: unable to allocate script DMA memory, error = %d %s: unable to map script DMA memory, error = %d %s: unable to create script DMA map, error = %d %s: unable to load script DMA map, error = %d %s: rejecting invalid wide negotiation from target %d (%d) %s: rejecting invalid PPR negotiation from target %d %s: ppr negotiation for target %d: offset (%d) or sync (%d) out of range %s: ppr negotiation for target %d: transfer width (%d) incompatible with dt %s: ppr negotiation for target %d: sync (%d) incompatible with adapter %s: ppr negotiation for target %d: no DT option %s: bad offset in siop_sdp (%d) clear fifo failed %s: timeout waiting for DIFFSENSE to stabilise %s: invalid SCSI mode 0x%x %s: switching to differential mode %s: switching to LVD mode %s: switching to single-ended mode siop%s: can't alloc lunsw for target %d %s: unexpected phase mismatch %d %s: selection timeout without command %s: unexpected disconnect without command != NULL%s: siop_intr() - we should not be here! istat = 0x%x, dstat = 0x%x, sist = 0x%x, sstat1 = 0x%x need_reset = %x, irqcode = %x, siop_cmd %s %s: script interrupt (0x%x) with invalid DSA !!! unknown irqcode %x %s: done without command, DSA=0x%lx invalid retval from siop_wdtr_neg()invalid retval from siop_sdtr_neg()%s: extended message too big (%d) unhandled message 0x%x scsi message reject, extended message sent was 0x%x scsi message reject, message sent was 0x%x our reject message was rejected %s: reselect with invalid target %d %s: target %d lun %d tag %d reselect without command %s: target %d reselect with invalid lun %d %s: reselect with invalid target error, DSP=0x%x reselect failed %s: reselect with invalid tag %s: bad offset for disconnect (%d) %s: command with invalid status (IRQ code 0x%x current status %d) ! %s: unhandled scsi interrupt, sist=0x%x sstat1=0x%x DSA=0x%x DSP=0x%x parity error %s:%s: phase mismatch without command scsi gross error %s: DMA IRQ: dma fifo empty, DSP=0x%x DSA=0x%x: last msg_in=0x%x status=0x%x current DSA invalid parity bus fault illegal instructionsingle step dsp 0x%08x dsa 0x08%x INTRF %s: unable to load data DMA map (for SENSE): %d request sense failed %s: untagged command already running for target %d lun %d (status %d) %s: scsi bus reset cmd %p added to reset list from urgent list cmd %p added to reset list from ready list cmd %p (status %d) reset with status %d, xs->error %d cmd %p (tag %d) added to reset list %s: unable to load data DMA map: %d %s: can't alloc siop_lun for target %d lun %d %s: can't malloc memory for target %d siop_start: bad statustimeout on SCSI command 0x%x %s: unable to allocate cbd DMA memory, error = %d %s: unable to load cbd DMA map, error = %d %s: unable to create data DMA map for cbd: error %d %s: unable to create cbd DMA map, error = %d %s: unable to map cbd DMA memory, error = %d %s: can't allocate memory for command descriptors %s: can't allocate memory for command descriptors head siop: resel switch fullsiop_stat_intr %d siop_stat_intr_shortxfer %d siop_stat_intr_xferdisc %d siop_stat_intr_sdp %d siop_stat_intr_done %d siop_stat_intr_lunresel %d siop_stat_intr_qfull %d %s: command never completed! %s: eeprom failed to come ready %s: reset didn't complete %s: bogus xcvr value in EEPROM (%x) %s: choosing new default based on card type %s: WARNING: no media options bits set in the media options register!! %s: this could be a manufacturing defect in your adapter or system %s: attempting to guess media type; you should probably consult your vendor %s: unknown device ID: %x -- defaulting to 10baseT %s: guessing MII %s: guessing 10/100 internal %s: guessing 10BaseT transceiver %s: guessing COMBO (AUI/BNC/TP) %s: guessing 10baseFL %s: guessing 100BaseT4/MII %s: guessing TPC (BNC/TP) %s: guessing 10/100 plus BNC/AUI %s: rx load failed %s: bad receive status -- packet dropped %s: transmission error: %x %s: initialization failed: no memory for rx buffers %s: unknown XCVR type: %d %s: watchdog timeout %s: no carrier - transceiver cable problem? %s: failed to read station address : can't alloc list mem : can't map list mem : can't alloc list map : can't load list map : can't create rx spare map : can't create tx spare map : can't create tx map : can't create rx map xl%s: warning: SCB timed out fxp: %s, address %s %s: no phy found, using manual mode %s: Disabling dynamic standby mode in EEPROM, New ID 0x%x, cksum @ 0x%x: 0x%x -> 0x%x %s: Failed to malloc memory %s: unable to create rx dma map %d, error %d %s: unable to create tx dma map %d, error %d fxp_stop: no buffers!%s: device timeout %s: fxp_mdi_read: timed out %s: fxp_mdi_write: timed out %s: timeout loading microcode %s: phy_read: bad phy register %x %s: phy_write: bad phy register %x %s: failed to force tx and rx to idle state %s: reset never completed! %s: MII without any PHY! %s: no memory for rx list -- packet dropped! %s: no memory for tx listdcne2000_attach%s: setup failed %s: where did the card go? ne2000_detect%s: remote transmit DMA failed to complete ne2000_write_mbuf: negative len%s: %d silo overflow%s, %d ibuf overflow%s : unknown uart %s: console : ns8250, no fifo : ns16450, no fifo : ns16550, no working fifo : ns16550a, 16 byte fifo : st16650, no working fifo : st16650, 32 byte fifo : ti16750, 64 byte fifo comattach: bad fifo type%s: can't establish soft interrupt.comprmcomstartcomcninit: mapping failedkbdauxkbc: cmd word write error kbc: aux echo error 1 kbc: aux echo error 2 (%s slot)pckbc_slot_enable(%d) failed pckbc_cmd: send error pckbc: command timeout pckbc_start: command error pckbc_start: send error pckbc: cmd failed kbccmdpckbc_set_inputhandler: bad slot %dpckbcintr: no dev for slot %d pckbclptlptopen%s: offline %s: out of paper %s: output error lptwrite2lptpshihaerror %d loading SG list dma map buffer needs >%d dma segments error %d loading buffer dma map iha_init_tulip%s: couldn't create SCB SG DMA map, error = %d %s: couldn't create SCB data DMA map, error = %d error %d loading request sense buffer dma map SCSI Parity error detected SCSI OpCode 0x%02x timed out %s: target %d using %d bit %d.%d MHz %d REQ/ACK offset %s: unable to allocate SCBs, error = %d %s: unable to map SCBs, error = %d iha: invalid EEPROM, bad signature or checksum version %d.%d%s %s: unsupported OHCI revision %s: SMM does not respond, resetting %s: reset timeout ohci, legacy support%s: blocking intrs 0x%x %s: unrecoverable error, controller halted %s: resume detect %s: %u scheduling overruns ohci_add_done: addr 0x%08lx not foundohci_rem_ed: ED not foundohci_abort_xfer: not in process contextohci_root_ctrl_startOHCI root hubohci_setintr: 0 interval %s: isoc TD alloc failed ohci_device_isoc_abort: early return rd%drdattach: device name too long RAM diskfictitiousrd_idleAll breakpoints used. Already set. Too many breakpoints. Not set. No breakpoints set Map Count Address %s%p %5d %-12sdb_commandCount missing Bad modifier Ambiguous No such command Malloc debugging not enabled. procscalloutbreaksextentsmallocobjectpoolprocregistersuvmexpwatchescrashhaltrebootpoweroffmachineexaminesearchdeletebreakdwatchwatchstepcontinueuntilnextmatchtracecallshowboothelphangmandmesgddb> Bad function %#n Argument missing Too many arguments ELF[ %s symbol table has bad start address %p ] ELFbad magic[ %s ELF symbol table not valid: %s ] bad e_machine.strtab.symtabsymtab unaligned[ using %lu bytes of %s ELF symbol table ] symtab corrupted= 0x%lx %c\%03o%-*ld%-*lo%-*lr%-*lu%-*lx%-*lz: %*d%*o%*r%*u%*x%*zAddress missing Value missing Syntax error Symbol not found Divide by 0 Negative shift amount ^R String too long Bad escape Bad character Bad character in number End of stack trace. --db_more-- -%*lo-%#*lo-%*lu-%#*lu-%*lx-%#*lxFaulted in traceback, aborting... Starting stack trace... %-12s%#*ln %s+%#lr[after %6d] bsd[ no symbol table formats found ] No slots left for %s symbol tableUnable to find symbol table slot for %s.invalid symbol table name%s %s%s Sifting table %s: db_printsym [%s:%d]+%sBreakpoint at Stopped at RUN AT LEAST 'trace' AND 'ps' AND INCLUDE OUTPUT WHEN REPORTING THIS PANIC! DO NOT EVEN BOTHER REPORTING THIS WITHOUT INCLUDING THAT INFORMATION! After %d instructions (%d loads, %d stores), radixmaxoffmaxwidthtabstopslinesUnknown variable No value All watchpoints used. No map. Too many watchpoints. No watchpoints set Map Address Size %s%p %8lx %lx Unknown size %#8n = %#8n Nothing written. () Score: %lu/%lu db_hangmanmiccdspeakerheadphonesaudioaudio: could not allocate play buffer audio: could not allocate record buffer audioattachrecordmonitorsourcemasterauddetaudiodetach: %s didn't detach au_portofoplaudioprint: unknown type %d%s at %smpuaud_draud_hraud_rdaudio_silence_copyoutaud_wrau_set_gainau_get_gainau_set_portau_get_portaudiosetinfoaudiogetinfo%s: address %s dp8390_initdp8390_start: no header mbuf%s: NIC memory corrupt - invalid packet length %d : failed to clear NIC buffer at offset %x - check configuration %s: device enable failed midimid_rdmid_wrmid_drmid_cl: <%s> midi at %sunconfiguredrndrdextract_entropyarc4_stircd9660_lookupcd9660_inactive: pushing activecd9660_reclaim: pushing activeRRIP without PX field? RRIP with incorrect flags?RRIP with incorrect NM flags? IEEE_P1282RRIP_1991AIEEE_1282SPcd9660_mountroot: can't setup bdevvp'scd9660root_deviceCD001%/@%/C%/Eisoinodefhtovp: directory crosses block boundary %d[off=%d/len=%d] fhtovp: bread error %d fhtovp: crosses block boundary %d fhtovp: lbn exceed volume space %d cd9660_strategy: spectag VT_ISOFS, isofs vnode elf32_load_fileOpenBSDexec_elf32_makecmds#!/dev/fd/%dswappercannot mount rootcannot find root vnodefork initpagedaemonfork pagedaemonreaperfork reapercleanerfork cleanerupdatefork updateaiodonedfork aiodoned/sbin/init/sbin/oinit/sbin/init.bak/dev/consolewarning: /dev/console does not exist warning: /dev/console error %d init: couldn't allocate argument spaceexec %s: error %d init: not found no initinitclocks: unable to register softclock intrfileplfdescpldup2: fdallocclosefkqeueplknoteplkqreaduser mapping failed kernel mapping failed %d init died (signal %d, exit %d)waitppwaitWARNING: thread `%s' (%d) exits with status %d unable to allocate kthread_qlockmgr: make up your mindlockmgr: not holding exclusive locklockmgr: unknown locktype request %dlockmgr: non-zero exclusive countlockmgr: locking against myselflockmgr: upgrade exclusive locklockmgr: processor %lu, not exclusive lock holder %lu unlockinglockmgr: pid %d, not exclusive lock holder %d unlockinglockmgr: draining against myself lock type %s: EXCL (count %d) by processor %lupid %d with %d pending not locked lock type %s: SHARED (count %d)malloc: allocation too largemalloc: out of space in kmem_map%d,rwlockrw_enter: locking against myselfphysbufphysio%-16s %-8s %18p %s %5d %5d %5d %d %#10x %-9.9s %-16s COMMANDSTRUCT PROC *UAREA * PID %-10s %18s %18s %18s VMSPACE/VM_MAP PID %-16s %-8s %18s %s EMULWAIT-CHANNELWAIT-MSGWAITPPIDPGRPUID PID %5s %5s %5s S %10s %-9s %-16s usage: show all procs [/a] [/n] [/w] /a == show process address info /n == show normal process info [default] /w == show process wait/emul info procplzombieplucredplpgrpplsessionplpcredplchgproccnt: lost userchgproccnt: procs < 0idlestopzombiedeadADVLOCKCTTYINMEMNOCLDSTOPPPWAITPROFILSELECTSINTR SUGID SYSTEM TIMEOUT TRACED WAITEDWEXITEXECPWEUPCFSTRACESSTEPSUGIDEXECNOCLDWAITNOZOMBIEINEXECSYSTRACECONTINUEDSWAPINBIGLOCKPROC (%s) pid=%d stat=%s flags=%b pri=%u, usrpri=%u, nice=%d forw=%p, back=%p, list=%p,%p user=%p, vmspace=%p estcpu=%u, cpticks=%d, pctcpu=%u.%u%, swtime=%u user=%llu, sys=%llu, intr=%llu mawn%c%5d %-10.10s %18p %18p %18p plimitplsigaplpauseissignal procfs debuggingpid %d was killed: %s sorry, pid %d was killed: %s coredump%s.corehashinit: bad cntsysctlsysctl_disklocksysctl_doproc%s,denied attempt to set clock forward to %ld denied attempt to set clock back %ld seconds nanosleep%9d %2d/%-4d %8x %s ticks now: %d ticks wheel arg func %s0x%lxsmashed stack in %sproc %d (%s): %s num OUT OF RANGE (%d)%d call: %s%d ret: err = %d, rv = 0x%lx,0x%lxpreempt: cpu_preempt not yet implementedsetrunnable not configured unsupported >>> %s probe returned %d >>> probing for %s* mapply: no match function for '%s' device>>> %s probe won >>> no winning probe root device %s not configured %s (root)config_make_softcconfig_make_softc: allocation for device softc failed%s%dconfig_make_softc: duplicate %sexpandcreatconfig_make_softc: %sing dev arrayconfig_make_softc: device name too long%s detached config_detach: forced detach of %s failed (%d)config_defer: can't defer config of a root deviceconfig_defer: can't allocate defer structurewrit%s%d%c: %s %sing fsbn %d of %d-%d (%s%d bn %d; cn %d tn %d sn %d)disk_attach: can't allocate storage for disklabeldisk_detach: disk_count < 0disk_unbusy: %s: dk_busy < 0 rootdev=0x%x rrootdev=0x%x rawdev=0x%x cannot open disk, 0x%x/0x%x, error %dfilesystem type %d not known.. assuming ffs dk_mountrootcannot read disk label, 0x%x/0x%x, error %droot filesystem has size 0intrextentplextntextent_free: start 0x%lx, end 0x%lx extent_free: region not foundFLWANTEDWANTEDNOCOALESCEFIXEDextent `%s' (0x%lx - 0x%lx), flags=%b 0x%lx - 0x%lx extent_print: NULL extentklogmtx_enter: ipl not implementedphpoolpcgpoolpool_init: too much uptimepool_get: %s: page emptypool_put: %s: page header missing page %p, nmissing %d, time %lu,%lu POOL %s: size %u, align %u, ioff %u, roflags 0x%08x alloc %p minitems %u, minpages %u, maxpages %u, npages %u itemsperpage %u, nitems %u, nout %u, hardlimit %u nget %lu, nfail %lu, nput %lu npagealloc %lu, npagefree %lu, hiwat %u, nidle %lu empty page list: full page list: partial-page list: no current page cache %p: allocfrom %p freeto %p hits %lu misses %lu ngroups %lu nitems %lu group %p: avail %d %p no log curpage %p pool(%p:%s): page inconsistency: page %p; at page head addr %p (p %p) pool(%p:%s): page inconsistency: page %p; item ordinal %d; addr %p (p %p) kernel %sassertion "%s" failed: file "%s", line %d%s: table is full panic: splassert: %s: want %d have %d spl assertion failure in %slogprikprintf%llx%llobug in kprintf: bad base0123456789ABCDEF(null)0123456789abcdefaddchangeddbdisableenableexitqfindlistquittimezoneverbose--- more --- 0x%x0%o*UNKNOWN**FOUND*%3d free slot (for add) Unknown devno (max is %d) %3d at disable %s flags 0x%x ???%3d %s count %d (pseudo device) %s [] ? Unknown argument %3d can't change free slot change (y/n) ?%3d %s changed flags changed out of memory. alreadyError unknown state %3d can't disable free slot %3d %s can't disable pseudo device %3d can't enable free slot %3d %s can't enable pseudo device command args description [count] number of lines before more enter ddbdev add a device8|10|16 base on large numbersdevno|dev change devicesattr val|devno|dev disable devicesattr val|devno|dev enable devicesdevno|dev find devices this message list configuration leave UKC[attr [val]] show attributes (or devices with an attribute)[mins [dst]] set timezone/dst don't know toggle verbose bootingUnknown routine /%c/ Unknown attribute Unknown pseudo routine /%c/ Value missing for attribute %s ? Not same device type No more space for new devices. No device of this type exists. Clone Device (DevNo, 'q' or '?')Insert before Device (DevNo, 'q' or '?')Device not complete number or * is missing Argument expected Dev expected 8|10|16 expected DevNo or Dev expected Attr, DevNo or Dev expected timezone = %d, dst = %d Unknown command disautoconf verbose %sabled Unknown command, try help User Kernel Config UKC> Continuing... sys_ioctlpipelkpiperdpipewrpipeclpipeplsyscallforkwait4compat_43_ocreatunlink#11 (obsolete execv)chdirfchdirchmodchowncompat_25_ogetfsstatcompat_43_olseekgetpidunmountsetuidgetuidgeteuid#26 (unimplemented ptrace)recvmsgsendmsgrecvfromacceptgetpeernamegetsocknamechflagsfchflagskillcompat_43_stat43getppidcompat_43_lstat43dupopipegetegidprofil#45 (unimplemented ktrace)sigactiongetgidsigprocmaskgetloginsetlogin#51 (unimplemented acct)sigpendingosigaltstackexecveumaskchrootcompat_43_fstat43compat_43_ogetkerninfocompat_43_ogetpagesizecompat_25_omsyncvfork#67 (obsolete vread)#68 (obsolete vwrite)sbrksstkcompat_43_ommapvadvisemunmapmprotectmadvise#76 (obsolete vhangup)#77 (obsolete vlimit)mincoregetgroupssetgroupsgetpgrpsetpgidsetitimercompat_43_owaitcompat_25_swapongetitimercompat_43_ogethostnamecompat_43_osethostnamecompat_43_ogetdtablesizedup2#91 (unimplemented getdopt)fcntl#94 (unimplemented setdopt)setprioritysocketconnectcompat_43_oacceptgetprioritycompat_43_osendcompat_43_orecvsigreturnsetsockoptlisten#107 (obsolete vtimes)compat_43_osigveccompat_43_osigblockcompat_43_osigsetmasksigsuspendcompat_43_osigstackcompat_43_orecvmsgcompat_43_osendmsg#115 (obsolete vtrace)gettimeofdaygetrusagegetsockopt#119 (obsolete resuba)readvwritevsettimeofdayfchownfchmodcompat_43_orecvfromsetreuidsetregidcompat_43_otruncatecompat_43_oftruncateflockmkfifosendtoshutdownsocketpairutimes#139 (obsolete 4.2 sigreturn)adjtimecompat_43_ogetpeernamecompat_43_ogethostidcompat_43_osethostidcompat_43_ogetrlimitcompat_43_osetrlimitcompat_43_okillpgsetsidquotactlcompat_43_oquotacompat_43_ogetsockname#151 (unimplemented)#152 (unimplemented)#153 (unimplemented)#154 (unimplemented)nfssvccompat_43_ogetdirentriescompat_25_ostatfs#159 (unimplemented)#160 (unimplemented)compat_09_ogetdomainnamecompat_09_osetdomainnamecompat_09_ounamesysarch#166 (unimplemented)#167 (unimplemented)#168 (unimplemented)#169 (unimplemented 1.0 semsys)#170 (unimplemented 1.0 msgsys)#171 (unimplemented 1.0 shmsys)#172 (unimplemented)preadpwrite#175 (unimplemented ntp_gettime)#176 (unimplemented ntp_adjtime)#177 (unimplemented)#178 (unimplemented)#179 (unimplemented)#180 (unimplemented)setgidsetegidseteuid#184 (unimplemented)#185 (unimplemented)#186 (unimplemented)#187 (unimplemented)compat_35_stat35compat_35_fstat35compat_35_lstat35fpathconfgetrlimitsetrlimitgetdirentriesmmap__syscalllseekftruncate__sysctlmlockmunlockundeletefutimesgetpgidxfspioctl#209 (unimplemented)#210 (unimplemented)#211 (unimplemented)#212 (unimplemented)#213 (unimplemented)#214 (unimplemented)#215 (unimplemented)#216 (unimplemented)#217 (unimplemented)#218 (unimplemented)#219 (unimplemented)#220 (unimplemented semctl)#221 (unimplemented semget)#222 (unimplemented semop)#223 (unimplemented semconfig)#224 (unimplemented msgctl)#225 (unimplemented msgget)#226 (unimplemented msgsnd)#227 (unimplemented msgrcv)#228 (unimplemented shmat)#229 (unimplemented shmctl)#230 (unimplemented shmdt)#231 (unimplemented shmget)clock_gettimeclock_settimeclock_getres#235 (unimplemented timer_create)#236 (unimplemented timer_delete)#237 (unimplemented timer_settime)#238 (unimplemented timer_gettime)#239 (unimplemented timer_getoverrun)#241 (unimplemented)#242 (unimplemented)#243 (unimplemented)#244 (unimplemented)#245 (unimplemented)#246 (unimplemented)#247 (unimplemented)#248 (unimplemented)#249 (unimplemented)minheritrforkissetugidlchowngetsidmsync#257 (unimplemented)#258 (unimplemented)#259 (unimplemented)pipecompat_35_fhstatpreadvpwritevkqueuekeventmlockallmunlockallgetpeereid#274 (unimplemented sys_extattrctl)#275 (unimplemented sys_extattr_set_file)#276 (unimplemented sys_extattr_get_file)#277 (unimplemented sys_extattr_delete_file)#278 (unimplemented sys_extattr_set_fd)#279 (unimplemented sys_extattr_get_fd)#280 (unimplemented sys_extattr_delete_fd)getresuidsetresuidgetresgidsetresgid#285 (obsolete sys_omquery)mqueryclosefromsigaltstack#289 (unimplemented shmget)#290 (unimplemented semop)fstatlstat#295 (unimplemented)#296 (unimplemented)#297 (unimplemented)ttckoutqttwritettyrub: would panic c = %d, val = %d load: %d.%02d not a controlling terminal no foreground process group runningrunnableiowait cmd: %s %d [%s] %ld.%02ldu %ld.%02lds %d%% %ldk empty foreground process group putc: required clalloc b_to_q: required clalloc WARNING: mclpool limit reached; increase kern.maxclustersmbplmclplm_copym0: null mbufm_copym0: m == NULL and not COPYALLm_copym0: off %d, len %dm_copydata: off %d < 0m_copydata: null mbuf in skipm_copydata: null mbufm_copydata: len %d < 0m_apply: len %d < 0m_apply: null mbuf in skipm_apply: null mbufm_apply: off %d < 0m == NULL in m_pulldown()unixsockplsoclose: NOFDREFsoaccept: !NOFDREFsbappendaddrsbappendcontrolsemi-panic: sbcompress sbdropsbcreatecontrol: message too large %d uipc 1uipc 2uipc 4uipc 3piusrrequnp_attachunp_bindunp_connect2unp_disconnectbremfree: lost tailbufplgetblkallocbuf: buffer larger than MAXBSIZE requestedgetnewbufbiowaitbiodone alreadynchplcluster_read: DONE bpcluster_callback: too little memoryClustered Block: %d addr %x bufsize: %ld Child Block: %d addr: %x Clustered write to wrong blocksvop_generic_revokealloperation %s not listed in %s. vfs_op_descsvfs_opv_init: bad operationvfs_opv_init: operation vector without default routine.nameilockfpllf_findoverlap: defaultrelookup: null namerelookup: lookup on dot-dotvnodesvfslock%s_mountroot failed: %d v_lockvnodefree vnodefree vnode isn'tvgetvclean: deadlockvclean: cannot reclaimvclean: not cleanvgonemissing bdevvgonel: not cleanmissing aliasVNONVREGVDIRVBLKVCHRVLNKVSOCKVFIFOVBADtype %s, usecount %u, writecount %u, holdcount %u,vprint flags (%s)|VALIASED| VBIOWAIT|VXWANT|VXLOCK|VSYSTEM|VTEXT|VROOTkinfo: vp changed WARNING: some file systems would not unmount retrying unmount of %s failed with error %d syncing disks... giving up done softdep vwakeup: neg numoutputvinvalbufvinvalbuf: flush failedvinvalbuf: dirty bufsvflushbufvflushbuf: dirtyvflushbuf: not dirtybgetvp: not freebrelvp: NULLsyncersched_sync: fsync failedmounted on: %s syncer vnodesys_mountmount: lost mountunmount: dangling vnodesys_statfssys_fstatfssys_getfsstatsys_getfhsys_fhopensys_fhstatsys_fhstatfsvn_lockvop_islockedvop_lookupvop_createvop_mknodvop_openvop_closevop_accessvop_getattrvop_setattrvop_readvop_writevop_leasevop_ioctlvop_pollvop_kqfiltervop_revokevop_fsyncvop_removevop_linkvop_renamevop_mkdirvop_rmdirvop_symlinkvop_readdirvop_readlinkvop_abortopvop_inactivevop_reclaimvop_lockvop_unlockvop_bmapvop_printvop_pathconfvop_advlockvop_reallocblksvop_whiteoutvop_getextattrvop_setextattrvop_strategyvop_bwritedead_read: lockdead_write: locktag VT_NON, dead vnode dead_badop calledchkvnlockfifowfifortag VT_NON, fifo with %ld readers and %ld writersfifo_badop calledspec_read typespec_write typespec_ioctlspec_fsyncspec_fsync: not dirtyspec_close: not specialtag VT_NON, dev %d, %d spec_badop calleddos2unixtime(): month value out of range (%ld) denodedeget(): pcbmap returned %d detrunc(): can't truncate root directory, clust %ld, offset %ld deextend: file too largemsdosfs_reclaim(): pushing activemsdosfs_inactive(): pushing activeextendfile(): attempt to extend root directory extendfile: pcbmapmsdosfs_lookup. .. doscheckpath(): .. not a directory? RRaArrAamsdosfs_sync: rofs mod dev %d, %d, %s msdosfs_createmsdosfs_write(): bad file typemsdosfs_renamemsdosfs_rename: lost to startdirmsdosfs_rename: lost from startdirmsdosfs_rename: updating .. in root directory?msdosfs_mkdirmsdosfs_readdir.msdosfs_strategy: spectag VT_MSDOSFS, startcluster %ld, dircluster %ld, diroffset %ld (LOCKED)bpf_detachd: descriptor not in listbpf: ifpromisc failedbpfbpfwritebpf_mcopybpfattachtoo many interfacesif_attachhead: mallocif_attach: mallocif_clone_listifioctlifconfif_getgroupifpromisc%s: can't handle af%d lo%dlooutputlooutput: no header mbufifmedia_add: can't malloc entryifmedia_set: no match for 0x%x/0x%x ifmedia_setfile errorstream errordata errorinsufficient memoryunknown compression methodinvalid window sizeinvalid reserved bitincorrect header checkincorrect data checkinvalid block typeinvalid stored block lengthsinvalid bit length repeattoo many length or distance symbolsincomplete dynamic bit lengths treeoversubscribed dynamic bit lengths treeoversubscribed literal/length treeincomplete literal/length treeinvalid literal/length codeinvalid distance code0.95Pstream endrn_addmask: mask impossibly already in tree Mask for route not entered Non-unique normal route, mask not entered rn_delete: inconsistent annotation rn_delete: couldn't find our annotation rn_delete: couldn't find us %s %p at %p rn_delete: Orphaned Maskrn_init: radix functions require max_keylen be set rn_initrn_init 2raw_usrreqrtentplrtfreertfree: %p not freed (neg refs) rtfree 2ifafreertrequest deletertinit: wrong ifa (%p) was (%p) rttmrplrt_timer_queue_destroy: rtq_count reached 0 rt_timer_remove_all: rtq_count reached 0 rt_timer_add: rtq_count reached 0 rt_timer_timer: rtq_count reached 0 route_outputroutearp_rtrequest: bad gateway value arp_rtrequest: malloc failed arprequestarpresolve: can't allocate llinfo arpintrarp: attempt to add entry for %s on %s by %s on %s in_arpinputarp: attempt to overwrite entry for %s on %s by %s on %s arp info overwritten for %s by %s on %s arp: attempt to overwrite permanent entry for %s by %s on %s duplicate IP address %s sent from ethernet address %s arp: ether address is broadcast for IP address %s! arptfreearplookup: unable to enter address for %s revarprequestrevarp[NULL][ ifa_addr= ifa_dsta= ifa_mask= flags=0x%x, refcnt=%d, metric=%d la_rt=%p la_hold=%p, la_asked=0x%lx rtentry=%p flags=0x%x refcnt=%d use=%ld expire=%ld key= mask= gw= ifp=%p (%s) ifa=%p genmask= gwroute=%p llinfo=%p (NULL)Route tree for AF_INET (not initialized) in4_cksum: offset too shortin4_cksumcksum4: out of data in4_cksum: bad mbuf chainin_controlinvalid argument to in_lifaddr_ioctlin_ifinitin_addmultiin_delmultiin_pcbinit: hashinit failedin_pcbinit: hashinit failed for lportinpcbplIPv6 pcb passed into in_pcbconnectinterneticmp_erroricmp lenicmp_reflecticmp_mtudisc_timeouticmp_mtudisc_timeout: bad route to timeouticmp_redirect_timeout: bad route to timeout%d.%d.%d.%dipqeplaeshmac-sha1deflateip_initip_dooptionsattempted source route from %s to %s ip_outputip_setmoptionsrip_attachrip_detachrip_usrreqtcp_inputm_pulldown malfunctiontcp_pulloutofbandsynpltcp_outputtcp_output REXMTtcpcbpltcpqepltcp_inittcp_respondtcp_ctlinputtcp6_mtudisc_callbacktcp_timer_rexmttcp_usrreqtcp_identudp_inputudp6_ctlinputudp_usrreqipip_inputipip_input: should never reach hereetherip_inputMD5FinalRMD160FinalSHA1Finallibdes v 3.21 - 95/11/21 - eaycryptopcryptodesccrypto_waitcryptof_ioctlcrydevcuio_copydata: off %d < 0iov_copydata: empty in skipcuio_copydata: emptycuio_copydata: len %d < 0cuio_copyback: off %d < 0cuio_copyback: empty in skipuio_copyback: emptycuio_copyback: len %d < 0cuio_apply: len %d < 0cui_apply: ind %d >= uio_iovcnt %d for offcui_apply: ind %d >= uio_iovcnt %d for lencuio_apply: off %d < 0swcr_encdecswcr_authcomputeSoftware crypto device cannot initialize!DES3DESBlowfishCAST-128SkipjackRijndael-128/AESARC4HMAC-MD5HMAC-SHA1HMAC-RIPEMD-160HMAC-SHA2-256HMAC-SHA2-384HMAC-SHA2-512Keyed MD5Keyed SHA1MD5SHA1DeflateLZSrpc denied, status=%d rpc denied, error=%d RPC timeout for server 0x%x krpc_call: sosend: %d bind failed nfsbioread: type %x unexpected nfsbioreadnfsvinvalnfs_doio: type %x unexpected Process killed due to text file modification nfs_boot: using network interface '%s' nfs_boot: socreate, error=%dnfs_boot: GIFFLAGS, error=%dnfs_boot: SIFFLAGS, error=%drevarp failed, error=%dnfs_boot: client_addr=%s nfs_boot: set if addr, error=%dnfs_boot: server_addr=%s hostname=%s nfs_boot_initnfs_boot: bootparam whoami, error=%dnfs_boot: no suitable interfacenfs_boot: bootparam get %s: %d nfs_boot: mountd %s, error=%d nfs_boot_getfhnfs_boot: portmap NFS/v2, error=%d nfs_boot: bootparam_whoami: bad reply nfs_boot: bootparam_getfile: bad reply nfs_hashlocknfsnodeplnfs_inactive: pushing activenfs_reclaim: pushing activenfskqlcknfskqpwnfskqdetnfskqpollnfsconnfscon sotypenfs send error %d for server %s nfsd send error %d receive error %d from nfs server %s Egad!! short receive (%d/%d) from nfs server %s %s (%d) from nfs server %s impossible packet lengthnfsreply nilnqnfstrynfs_requestis alive againnot respondingnfsndlcknfs sndunlocknfsrcvlknfs rcvunlockKerb nickname short Kerb nick verifier bad Bad kerb verifier Not fullname kerb verifier nfs server %s: %s build > MLENnfs S too bignqnfstimrcld kerbnfsd initnfsidlnfsionfsauth1nfsauth2nfs_mountroot: root/root on %s nfs_mountroot: getattr for rootswap on device 0x%x nfs_mountrootswap/swapswap on %s nfs_mountroot: getattr for swap WARNING: no swap nfs_mountroot: can't setup swap vpnfsnfs_mount_diskless: vfs_rootmountalloc failednfs_mountroot: mount %s failed: %dnfs_args: retrying connect nfs_mountnfsdismnfs: writerpc iovcnt > 1nfs_remove: no namenfs_remove: bad v_usecountnfs_rename: no namenfs readdirrpc bad uioEEK! readdirrpc resid > 0 nfs readdirplusrpc bad uioEEK! readdirplusrpc resid > 0 .nfsA%05x4.4nfs physio/asyncnfs_fsyncnfsfsyncnfs_fsync: not dirtytag VT_NFS, fileid %ld fsid 0x%lxbwrite: buffer is not busy???file system full %s: write failed, file system is full ffs_realloccg: bad blockno%s: optimization changed from SPACE to TIME dev = 0x%x, optim = %d, fs = %s ffs_realloccg: bad optim%s: optimization changed from TIME to SPACE dev = 0x%x, bsize = %d, bprev = %d, fs = %s ffs_realloccg: bad bprevfree inode %s/%d had %d blocks out of inodes %s: create/symlink failed, no inodes free mode = 0%o, inum = %d, fs = %s ffs_valloc: dup allocpos = %d, i = %d, fs = %s ffs_alloccgblk: can't find blk in cylffs_alloccgblk: cyl groups corruptedffs_clusteralloc: lost blockffs_nodealloccg: block not in mapcg = %d, irotor = %d, fs = %s ffs_nodealloccg: map corrupteddev = 0x%x, bsize = %d, size = %ld, fs = %s ffs_blkfree: bad sizebad block %d, ino %u bad blockdev = 0x%x, block = %d, fs = %s ffs_blkfree: freeing free fragffs_blkfree: freeing free blockdev = 0x%x, ino = %u, fs = %s ffs_freefile: range: dev = 0x%x, ino = %d, fs = %sffs_freefile: freeing free inodebno = %d, fs = %s ffs_alloccg: block not in mapstart = %d, len = %d, fs = %s ffs_alloccg: map corrupteduid %u on %s: %s ffs_balloc: blk too bigCould not unwind indirect block, error %dffs_update: bad link cntffs_truncate: newspaceffs_indirtrunc: bad buffer sizeffs_isblockffs_clrblockffs_setblockffs_isfreeblocksoftdep_flushfiles calledsoftdep_setup_inomapdep calledsoftdep_setup_blkmapdep calledsoftdep_setup_allocdirect calledsoftdep_setup_allocindir_page calledsoftdep_setup_allocindir_meta calledsoftdep_setup_freeblocks calledsoftdep_freefile calledsoftdep_setup_directory_add calledsoftdep_change_directoryentry_offset calledsoftdep_setup_remove calledsoftdep_setup_directory_change calledsoftdep_change_linkcnt calledsoftdep_load_inodeblock calledsoftdep_update_inodeblock calledsoftdep_slowdown calledffs_mountroot: can't setup bdevvp's ffsWARNING: %s was not properly unmounted WARNING: R/W mount of %s denied. Filesystem is not clean - run fsck WARNING: soft updates isn't compiled in ffs_reload: dirty2ffs_reload: dirty1no UFS2 support ffs_statfsupdate: rofs modffsino%s: typeffs_write%s: nonsync dir writeffs_fsyncffs_fsync: not dirtyffs_inactive: pushing activeufs_reclaim: pushing activei_ffs_size too smallmangled entry%s: bad dir ino %d at offset %d: %s bad dirFirst bad Second bad ufs_direnter: newblkufs_direnter: compact2ufs_direnter: compact1checkpath: .. not a directory chown: lost quotaufs_linkufs_whiteout: unknown opufs_whiteoutufs_renameufs_rename: lost to startdirrename: EXDEVufs_rename: same fileufs_rename: lost dir entryufs_rename: lost from startdirufs_mkdirufs_readdir: lost in spaceufs_strategy: spectag VT_UFS, ino %d, on dev %d, %d flags 0x%x, effnlink %d, nlink %d mode 0%o, owner %d, group %d, size %lldufs_makeinodemode = 0%o, nlinks %d, inum = %d, fs = %s ext2fs_valloc: dup allocext2fs_nodealloccg: block not in mapcg = %d, ipref = %d, fs = %s ext2fs_nodealloccg: map corruptedbad block %d, ino %d dev = 0x%x, ino = %d, fs = %s ifree: range: dev = 0x%x, ino = %d, fs = %sifree: freeing free inodeext2fs_mapsearch: block not in mapext2fs_alloccg: map corrupteduid %d on %s: %s ext2fs_inactive: pushing activeext2fs_indirtrunc: bad buffer sizeext2fs_readdiri_size too smallrec_len is smaller than minimalrec_len % 4 != 0reclen is too small for name_lendirectory entry across blocksinode out of boundsbad directory entry: %s offset=%d, inode=%lu, rec_len=%d, name_len=%d ext2fs_dirbadentryext2fs_direnter: newblkext2fs_direnterext2fs_direnter: frag sizecheckpathext2fs_writeext2fs_mountroot: can't setup bdevvp'sext2fs%s: file system not clean; please fsck(8) ext2fs_reload: dirty2ext2fs_reload: dirty1ext2fs_statfsExt2 fs: unsupported inode size Ext2 fs: unsupported optional feature ext2fs_rename: lost to startdirrename: linked directoryext2fs_rename: lost dir entryext2fs_rename: mangled dirext2fs_rename: lost from startdirext2fs_mkdir: blksizeext2fs_reclaim: pushing activeamap_lookup: offset out of rangeamap_lookups: offset out of rangeamap_add: offset out of rangeamap_add: replacing null anonamap_add: slot in useamap_unadd: offset out of rangeamap_unadd: nothing thereamapplamap_wipeout: corrupt amapcownowpagecownowamap_cow_now: non-resident wired page in anon %pamap_splitref: split at zero offsetamap_splitref: map size check failedamap_pp_adjref: overshot targetamap_pp_adjref: negative reference countuvm_anon_add: can not allocate %d anons uvm_anon_adduao_set_swslot: uobj = %p uao_set_swslot: attempt to set a slot on a NOSWAP objectuao_create: kernel object already allocateduao_create: hashinit swhash faileduao_create: malloc swslots faileduao_create: asked to enable swap on kernel objectuaoeltplaobjpluao_flush: strange, got an out of range flush (fixed) uao_flush: weird flagsuao_getuao_getpageudv_attachudv_detachudv_faultfltamapcopyanonget1anonget2flt_noram1flt_pmfail1flt_noram3flt_noram2flt_pmfail2flt_noram4flt_noram5fltagain2uvm_fault_unwire_locked: address not in mapuvm_fault_unwire_locked: unwiring non-wired memoryuvm_fork: uvm_fault_wire failed: %duvm_swapin: uvm_fault_wire failed: %dschedpwaitscheduleruvm_init: page size not setuvm_km_init: could not reserve space for kerneluvm_km_suballoc: unable to allocate space in parent mapuvm_km_suballoc: submap allocation faileduvm_km_suballoc: unable to create submapkm_getwait2km_allockm_alloc1wuvm_km_alloc1: non-released pagevallocwaitkmthreadkmallocvmmaplkuvm_mapent_alloc: out of static map entries, check MAX_KMAPENT (currently %d)# uvm_map() successful calls# uvm_map() back merges# uvm_map() missed forward# map lookup calls# map lookup hint hitsvmspplvmmpeplvmmpekpluvm_map_clean: weird flagsfork: encountered a submap during fork (illegal)fork: non-copy_on_write map entry marked needs_copy (illegal)MAP %p: [0x%lx->0x%lx] #ent=%d, sz=%u, ref=%d, version=%u, flags=0x%x pmap=%p(resident=%d) - %p: 0x%lx->0x%lx: obj=%p/0x%llx, amap=%p/%d submap=%c, cow=%c, nc=%c, prot(max)=%d/%d, inh=%d, wc=%d, adv=%d OBJECT %p: locked=%d, pgops=%p, npages=%d, refs= PAGES : <%p,0x%llx> refs=%d PAGE %p: %b flags=%s, pqflags=%s, vers=%d, wire_count=%d, pa=0x%lx uobject=%p, uanon=%p, offset=0x%llx loan_count=%d [page ownership tracking disabled] >>> ANON DOES NOT POINT HERE <<< (%p) checking pageq list >>> PAGE NOT FOUND ON PAGEQ LIST! <<< uvm_page_printit page found on pageq list anon backpointer is OK checking object list >>> PAGE NOT FOUND ON OBJECT LIST! <<< page found on object list uvm_page_bootstrap: no memory pre-allocateduvm_page_init: lost %ld page(s) in init uvm_page_inituvm_setpagesize: page size not a power of twouvm_pageboot_alloc: out of virtual spaceuvm_pageboot_alloc: out of memoryuvm_pageboot_alloc: pmap_growkernel() faileduvm_page_physget: called _after_ bootstrapuvm_page_physget: out of memory!uvm_page_physload: page size not set!uvm_page_physload: start >= enduvm_page_physload: tried to add RAM after vm_mem_inituvm_page_physload: unable to load physical memory segment %d segments allocated, ignoring 0x%llx -> 0x%llx increase VM_PHYSSEG_MAX uvm_page_physload: bad free list %duvm_page_physrehash: WARNING: could not grow page hash table rehash: physical memory config [segs=%d of %d]: 0x%llx->0x%llx [0x%llx->0x%llx] STRATEGY = BSEARCH number of buckets = %d uvm_pagealloc_strat: bad strat %demergvapager_mappagedaemon: deadlock detected! pgdaemon%s = %d Current UVM status: pagesize=%d (0x%x), pagemask=0x%x, pageshift=%d %d VM pages: %d active, %d inactive, %d wired, %d free min %d%% (%d) anon, %d%% (%d) vnode, %d%% (%d) vtext pages %d anon, %d vnode, %d vtext freemin=%d, free-target=%d, inactive-target=%d, wired-max=%d faults=%d, traps=%d, intrs=%d, ctxswitch=%d softint=%d, syscalls=%d, swapins=%d, swapouts=%d fault counts: noram=%d, noanon=%d, pgwait=%d, pgrele=%d ok relocks(total)=%d(%d), anget(retrys)=%d(%d), amapcopy=%d neighbor anon/obj pg=%d/%d, gets(lock/unlock)=%d/%d cases: anon=%d, anoncow=%d, obj=%d, prcopy=%d, przero=%d daemon and swap counts: woke=%d, revs=%d, scans=%d, obscans=%d, anscans=%d busy=%d, freed=%d, reactivate=%d, deactivate=%d pageouts=%d, pending=%d, nswget=%d nswapdev=%d, nanon=%d, nanonneeded=%d nfreeanon=%d swpages=%d, swpginuse=%d, swpgonly=%d paging=%d kernel pointers: objs(kern/kmem)=%p/%p swapsysuvm_swap_init: can't get vnode for swap deviceswapmapswp vnxswp vnduvm_swap_init: extent_create failedswapdrum_addsys_swapctlswapctl: copystrswapctl: miniroot copy failedswap0x%04xswap_on: miniroot larger than swap?Preserved %d pages of miniroot leaving %d pages of swap swap_on: unable to preserve minirootdisklabel regionswap_off: swapdev not in listswstrategy: vnode type 0x%xsw_reg_strategy: swap to sparse filewarning: resource shortage: %d pages of swap lost swapmount: no device swapmount: no device 2 swap_deviceswapmount: copystrsbrk: grow %ld failed, error = %d uvm_coredump: user process with submap?uvm_deallocate with null mapuvnsyncuvn_attach: blocked at %p flags 0x%x uvn_attachuvn_termuvm_vnp_terminate: io sync wanted bit setuvn_releasepg: kill flag set on referenced object!uvn_flush: obj=%p, offset=0x%llx. error during pageout. uvn_flush: WARNING: changes to page may be lost! uvn_flushuvn_cluster: offset out of rangeuvn_getuvn_getpageuvn_iosyncrd%d: fixed, %d blocks NULL pointer passed to ip_ecn_ingressNULL pointer passed to ip_ecn_egressNULL pointer passed to ip6_ecn_ingressNULL pointer passed to ip6_ecn_egressin6_pcbconnectin6_pcbnotifyin6_ifloop_requestADDDELETEin6_ifloop_request: %s operation failed for %s (errno=%d) in6_controlnd6_prelist_add succeeded but no prefix prefix ioctls are now invalidated. please use ifconfig. in6_update_ifain6_update_ifa: addmulti failed for %s on %s (errno=%d) in6_update_ifa: failed to remove a route to the old destination: %s in6_update_ifa: the prefix length of an existing (%s) address should not be changed in6_update_ifa: valid lifetime is 0 for %s in6_update_ifa: prefixlen should be 128 when dstaddr is specified in6_update_ifa: a destination can be specified for a p2p or a loopback IF only in6_purgeaddr: failed to remove a route to the p2p destination: %s on %s, errno=%d Couldn't unlink in6_ifaddr from in6_ifaddr in6_unlink_ifa: autoconf'ed address %p has no prefix invalid argument to in6_lifaddr_ioctlin6_savemkludge: no kludge spacein6_addmultiin6_delmultiin6_are_prefix_equal: invalid prefix length(%d) in6_prefixlen2mask: invalid prefix length(%d) in6_prefixlen2maskin6_ifawithscope: output interface is not specified get_rand_ifid%s: interface identifier generated by random number %s: ifid: %02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x %s: failed to get interface identifier %s: borrow interface identifier from %s %s: got interface identifier from %s %s: got interface identifier from itself in6_ifattach_linklocalin6_ifattach_linklocal: failed to configure a link-local address on %s (errno=%d) %s: no ifid available in6_ifattach_loopbackin6_ifattach_loopback: failed to configure the loopback address on %s (errno=%d) in6_nigroupin6_ifattach: %s has too small MTU, IPv6 not enabled in6_ifattachin6_ifattach: %s is not multicast capable, IPv6 not enabled in6_ifdetach%s: didn't unlink in6ifaddr from list in6_cksum: mbuf len (%d) < off+len (%d+%d)in6_cksum: out of datainternet6icmp6_mtudisc_callback_registerENOBUFS in icmp6_error %d icmp6_input: unknown type %d(src=%s, dst=%s, ifid=%d) ICMP6 checksum error(%d|%x) %s icmp6_notify_erroricmp6_notify_error: in6_embedscope failed icmp6_mtudisc_updateni6_inputicmp6_rip6_inputicmp6_reflecticmp6_reflect: source can't be determined: dst=%s, error=%d /usr/src/sys/netinet6/icmp6.csanity fail: off=%lx, sizeof(ip6)=%lx in %s:%d (src=%s dst=%s tgt=%s)icmp6_redirect_inputICMP6 redirect sent from %s rejected; must be from linklocal ICMP6 redirect sent from %s rejected; hlim=%d (must be 255) ICMP6 redirect rejected; no route with inet6 gateway found for redirect dst: %s ICMP6 redirect rejected; neither router case nor onlink case: %s icmp6_redirect_input: lladdrlen mismatch for %s (if %d, icmp6 packet %d): %s icmp6_redirect_input: invalid ND option, rejected: %s ICMP6 redirect rejected; redirect dst must be unicast: %s ICMP6 redirect rejected; not equal to gw-for-src=%s (must be same): %s ICMP6 redirect rejected; no route found for redirect dst: %s icmp6_redirect_outputicmp6_mtudisc_timeout: bad route to timeouticmp6_redirect_timeout: bad route to timeoutip6_initip6_input: packet to an unready address %s->%s ip6_savecontrolip6_nexthdrip6_nexthdr: m == NULLOpenBSD-currentcannot forward from %s to %s nxt %d received on %s cannot forward src %s, dst %s, nxt %d, rcvif %s, outif %s ip6_mrouter_doneadd_m6ifregister_mifdel_m6ifadd_m6fc: %s o %s g %s p %x dbx %p multiple kernel entriesdel_m6fcip6_mforward: ip6_mrouter socket queue full ip6_outputassumption failed: hdr not splitip6_setmoptionsip6_setpktoptionsip6_rthdr0nd6_init called more than once(ignored) nd6_setmtu0: new link MTU on %s (%lu) is too small for IPv6 ndopts == NULL in nd6_optionuninitialized ndopts in nd6_optionndopts == NULL in nd6_optionsduplicated ND6 option found (type=%d) too many loop in nd opt nd6_options: unsupported option %d - option ignored uninitialized ndopts in nd6_optionsln->ln_rt == NULLln->ln_rt->rt_ifp == NULLrt_llinfo(%p) is not equal to ln(%p)dst=0 in nd6_timer(ln=%p)nd6_lookupunspecnd6_lookup: failed to lookup %s (if = %s) nd6_freend6_rtrequestnd6_rtrequest: bad gateway value: %s %s: failed to join %s (errno=%d) nd6_rtrequest: malloc failed nd6_ioctla router(%s) advertises a prefix with non-link local address default router list contains a non-linklocal address(%s) ifp == NULL in nd6_cache_lladdrfrom == NULL in nd6_cache_lladdrnd6_output: can't allocate llinfo for %s (ln=%p, rt=%p) nd6_storelladdr: something odd happens nd6_storelladdr: sdl_alen == 0, dst=%s, if=%s scope error in prefix list (%s) nd6_ns_inputnd6_ns_input: src=%s nd6_ns_input: dst=%s nd6_ns_input: tgt=%s nd6_ns_input: invalid hlim (%d) from %s to %s on %s nd6_ns_input: bad DAD packet (wrong ip6 dst) nd6_ns_input: lladdrlen mismatch for %s (if %d, NS packet %d) nd6_ns_input: duplicate IP6 address %s nd6_ns_input: bad DAD packet (link-layer address option) nd6_ns_input: invalid ND option, ignored nd6_ns_input: bad NS target (multicast) nd6_ns_outputnd6_ns_output: source can't be determined: dst=%s, error=%d nd6_na_inputnd6_na_input: invalid hlim (%d) from %s to %s on %s nd6_na_input: duplicate IP6 address %s nd6_na_input: lladdrlen mismatch for %s (if %d, NA packet %d) nd6_na_input: invalid ND option, ignored nd6_na_input: a solicited adv is multicasted nd6_na_input: invalid target address %s nd6_na_outputnd6_na_output: source can't be determined: dst=%s, error=%d %s: starting DAD for %s nd6_dad_start: memory allocation failed for %s(%s) ???nd6_dad_start: called with non-tentative address %s(%s) nd6_dad_start: ifa->ifa_ifp == NULLnd6_dad_timer: called with null parameter %s: DAD complete for %s - no duplicates found %s: could not run DAD, driver problem? nd6_dad_timer: called with non-tentative address %s(%s) nd6_dad_timer: called with duplicated address %s(%s) nd6_dad_timer: DAD structure not found nd6_dad_duplicated: DAD structure not found %s: DAD detected duplicate IPv6 address %s: NS in/out=%d/%d, NA in=%d %s: DAD complete for %s - duplicate found %s: manual intervention required nd6_dad_ns_input: ignoring DAD NS packet for address %s(%s) ifa == NULL in nd6_dad_ns_inputifa == NULL in nd6_dad_na_inputnd6_rs_inputnd6_rs_input: invalid hlim (%d) from %s to %s on %s nd6_rs_input: lladdrlen mismatch for %s (if %d, RS packet %d) nd6_rs_input: invalid ND option, ignored nd6_ra_inputnd6_ra_input: invalid hlim (%d) from %s to %s on %s nd6_ra_input: src %s is not link-local nd6_ra_input: lladdrlen mismatch for %s (if %d, RA packet %d) nd6_ra_input: bogus mtu mtu=%lu sent from %s; exceeds maxmtu %lu, ignoring nd6_ra_input: bogus mtu option mtu=%lu sent from %s, ignoring nd6_ra_input: invalid option len %d for prefix information option, ignored nd6_ra_input: invalid prefix len %d for prefix information option, ignored nd6_ra_input: invalid prefixlen %d for rfc2374 prefix %s, ignored nd6_ra_input: invalid prefix %s, ignored nd6_ra_input: invalid ND option, ignored defrouter_addreqdefrouter_addifreqdefrouter_addifreq: failed to install a route to interface %s (errno = %d) defrouter_addifreq: failed to find an ifaddr to install a route to interface %s defrouter_delifreqdefrouter_delreqdefrouter_select: called unexpectedly (forwarding=%d, accept_rtadv=%d) defrouter_select: there's no default router and no default interface defrouter_select: more than one router is installed nd6_prelist_add: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_remove: failed to make %s/%d offlink on %s, errno=%d prelist_update: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_update: nd6_prelist_add failed for %s/%d on %s errno=%d, returnpr=%p pfxlist_onlink_check: failed to make %s/%d offlink, errno=%d nd6_prefix_onlinknd6_prefix_onlink: failed to add route for a prefix (%s/%d) on %s, gw=%s, mask=%s, flags=%lx errno = %d nd6_prefix_onlink: failed to find any ifaddr to add route for a prefix(%s/%d) on %s nd6_prefix_onlink: %s/%d is already on-link nd6_prefix_offlinknd6_prefix_offlink: failed to recover a prefix %s/%d from %s to %s (errno = %d) nd6_prefix_offlink: failed to delete route: %s/%d on %s (errno = %d) nd6_prefix_offlink: %s/%d is already off-link in6_ifaddin6_ifadd: failed to make ifaddr %s on %s (errno=%d) in6_ifadd: wrong prefixlen for %s (prefix=%d ifid=%d) in6_init_prefix_ltimes: preferred lifetime(%d) is greater than valid lifetime(%d) rip6_inputrip6_outputrip6_attachrip6_usrreqrip6_detachudp6_outputspsrr1r2r3r4r5r6r7r8r9r10r11r12usr_spusr_lrsvc_spsvc_lrpcund_spabt_spirq_spFaulted in DDB; continuing... address %p is invalid address 0x%08lx not a valid page framepanicdb_fetch_reg: botchbranch_taken: botchscp=0x%08x rlv=0x%08x ( rsp=0x%08x rfp=0x%08xBad frame pointer: %p Bad user frame pointer: %p %sr%d=0x%08xtrace: pid %d not found swapped out at %p Panic string: %s frame address = %08x frame address must be specified spsr=%08x r0 =%08x r1 =%08x r2 =%08x r3 =%08x r4 =%08x r5 =%08x r6 =%08x r7 =%08x r8 =%08x r9 =%08x r10=%08x r11=%08x r12=%08x r13=%08x r14=%08x r15=%08x slr=%08x mainbuscpufootbridgemainbus_bs_alloc(): Help!mainbus_bs_free(): Help!%s, #0x%03x-imbimbrangeswiblxblmulSnmsmlaSnmsdumullSdnmssmullumlalsmlalstrtdaWldrtstrbtldrbtstrldrstrbldrbstmYnWlldmXnWlldrsbldrhstrhldrshswpdmoswpbmrsdpmsrpFmpF2bxclzdmbkptSdn2eorsubrsbadcsbcrsctstDn2teqcmpcmnorrmovSd2bicmvnadfPRfghmufsufrsfdvfrdfpowrpwrmffmlfdvfrdpolfpbopmvfPRfhmnfrndsqtloglgnexpsincostanasnacsatnfpuopstfQLvldffltPRgdfixPRdhwfsrfswfcrfccmfPRghcnfcmfecnfemcr2#zmcrmrc2mrccdp2#ycdpldc2L#vldcstc2stcund%s %08x #0x%08xp%d_f%d#%s[r%d]cpsr[%c - unknown]%d, c%d, c%d, c%d, %dr%d, c%d, c%d, %d, rrx, %s r%d, %s #%d{r%d-r%d}^[r%d#0x%02xf%d, c%d, No support for this CPU type (%08x) in kernelcpu.cachecpu.nocachesa110.cachesa110.icachesa110.dcachecpu.writebufcpu.nowritebufsa110.writebufUndefined instruction in kernel Warning IRQ's disabled during boot() real mem = %u (%uK) cpu_startup: system table size inconsistencycpu_startup: cannot allocate UVM space for buffersavail mem = %lu (%uK) using %d buffers containing %u bytes (%uK) of memory cpu_startup: not enough memory for buffer cachecpu_startup: no room for system tables; %d bytes required_bus_dmamap_load_raw: not implemented_bus_dmamap_sync: mix PRE and POSTunknown buffer type %d _bus_dmamap_sync_bus_dmamap_sync: ARM32_BUFTYPE_INVALID_bus_dmamap_sync: ARM32_BUFTYPE_RAW_bus_dmamem_map: size botch%s: SA-110 with bugged STM^ instruction rev 0rev 1rev 2rev 3rev 4rev 5rev 6rev 7rev 8rev 9rev 10rev 11rev 12rev 13rev 14rev 15step Jstep Kstep Sstep Tstep Bstep Cstep Dstep Erev 10step Gstep A-0step B-0step B-1step B-2step B-3step B-4step B-5(IXP1200 step A)(IXP1200 step B)(IXP1200 step C)(IXP1200 step D)(IXP1240/1250 step A)(IXP1240 step B)(IXP1250 step B)step A-1step C-0step D-0step 0ARM600ARM610ARM620ARM700ARM710ARM7500ARM710aARM7500FEARM710TARM720TARM740T (8 KB cache)ARM740T (4 KB cache)ARM810ARM920TARM922TARM940TARM946E-SARM966E-STI ARM925TARM1020EARM1022E-SSA-110SA-1100SA-1110IXP1200i80200i80321 400MHzi80321 600MHzPXA250PXA210IXP425 533MHzIXP425 400MHzIXP425 266MHzunknownCPU_ARM2ARM2asCPU_ARM250CPU_ARM3CPU_ARM6CPU_ARM7CPU_ARM7TDMICPU_ARM8ARM9TDMIARM9E-SARM10ECPU_ARM10SA-1CPU_SA110XScaleCPU_XSCALE_...write-throughwrite-back**unknown 3****unknown 4**write-back-lockingwrite-back-locking-Awrite-back-locking-B**unknown 8****unknown 9****unknown 10****unknown 11****unknown 12****unknown 13****unknown 14****unknown 15** IDC disabled IDC enabled WB disabled WB enabled LABT EABT%s: %dKB/%dB %d-way %s unified cache %s: %s does not fully support this CPU. %s: This kernel does not fully support this CPU. %s: Recompile with "options %s" to correct this. %s: %dKB/%dB %d-way Instruction cache %s: %dKB/%dB %d-way %s Data cache branch prediction enabled DC disabled DC enabled IC disabled IC enabledunknown CPU (ID = 0x%x)%s %s (%s core)Processor failed probe - no CPU ID Vector ExceptionAlignment Fault 1Terminal ExceptionAlignment Fault 3External Linefetch Abort (S)Translation Fault (S)External Linefetch Abort (P)Translation Fault (P)External Non-Linefetch Abort (S)Domain Fault (S)External Non-Linefetch Abort (P)Domain Fault (P)External Translation Abort (L1)Permission Fault (S)External Translation Abort (L2)Permission Fault (P) uvm_fault(%p, %lx, %x, 0) -> %x UVM: pid %d (%s), uid %d killed: out of swap Non-emulated page fault with intr_depth > 0 data_abort_fault: Misaligned Kernel-mode Program Counter kerneluserFatal %s mode data abort: '%s' trapframe: %p FSR=%08x, FAR=r0 =%08x, r1 =%08x, r2 =%08x, r3 =%08x r4 =%08x, r5 =%08x, r6 =%08x, r7 =%08x r8 =%08x, r9 =%08x, r10=%08x, r11=%08x r12=%08x, usp=%08x, ulr=%08xssp=%08x, slr=%08x, pc =%08x Fatal abortInvalid, Fatal %s mode prefetch abort at 0x%08x trapframe: %p, spsr=%08x badaddr: invalid size (%lu)mmrwpmap_enter: no pv entriespmap_enter: failed to allocate L2 bucketprefetch_abort: page is already mapped - pte=%p *pte=%08x prefetch_abort: pc=%08lx proc=%p process=%s prefetch_abort: far=%08x fs=%x xscale_cache_clean_minidata call pmap_init_l1: can't get PA of L1 at %ppmapplpvepll2dtblpll2ptpplpmap_bootstrap: WARNING! wrong cache mode for primary L1 @ 0x%lx pmap_bootstrap: WARNING! wrong cache mode for L2 pte @ %p pmap_bootstrap: No L2 for va 0x%x, pa 0x%lxpmap_bootstrap: out of static L2spmap_bootstrap: No L2 for L2 @ va %p pmap_alloc_specials: no l2b for 0x%lxCannot allocate L1 KVMCannot allocate L1 physical pagespmap_map_entry: no L2 table for VA 0x%08lxpmap_map_entry: can't find L2 table for VA 0x%08lxpmap_map_chunk: no L2 table for VA 0x%08lxpmap_map_chunk: can't find L2 table for VA0x%08lxpmap_map_chunk: no L1 table providedxscale_setup_minidata: xscale_minidata_clean_size, xscale_minidata_clean_addruser pmap (%p): pmap_kernel (%p): domain %d, l1 at %p %08lx: %c |0000 |8000 |10000 |18000 |20000 |28000 |30000 |38000 pa 0x%08lx: krw %d kro %d urw %d uro %d %c va 0x%08lx, flags 0x%x dumpconf: bad dumpdev=0x%x dumping to dev %u,%u offset %ld dump device bad aborted from console i/o error device not ready succeeded area improper area unavailable dump to dev %u,%u not possible pagemove: size=%08lxvmapbufvunmapbufisaattach: can't map `delay port' irq %d drq %d drq2 %d/%d iomem 0x%x port 0x%xisascan>>> probing for %s%d succeeded >>> probing for %s%d failed >>> probing for %s%d >>> probe for %s* clone into %s%d %s: iosize not repaired by driver >>> probing for %s* finished >>> probing for %s* nonepulsededge-triggeredlevel-triggeredisa_intr_typename: invalid type %dcom_isa_attach: mapping failedkbc selftest: %x pckbc_attach: couldn't map%s: unable to establish interrupt for %s slot %s: using irq %d for %s slot MPU-401 MIDI UARTpcppipcppi_attach: couldn't mapbellspkrrestPC speaker: polledlpt_isa_attach: couldn't map I/O portspci bus %d%s: Cannot map registers: DC21285 rev %d serrsdram_paritydata_paritymast_abttarg_abtparityfcom%s: Unrecognised IDfootbridge_intr: ctrl=%08x footbridge_intr: pcistat=%08x footbridge_alloc(): Help!footbridge_free(): Help!footbridge_pci_intr_map: out of range interruptpin %d line %d (%#x) pci_intr_map: no mapping for pin %c isairq %ldirq %ldfootbridge_pci_intr_string: bogus handle 0x%lxNo memoryfootbridge_intr_establish: IRQ %d out of rangestatclockhandler: Statclock overrun clock: hz %d stathz %d profhz %d clock%s: Cannot install timer 1 interrupt handler%s: Cannot install timer 2 interrupt handler/usr/src/sys/arch/arm/arm/softintr.csoftnet_intrhand != NULLsoftintr_establish: unknown soft IPL %d: consoleserial_rx%s: Cannot install rx interrupt handler%s: Cannot allocate rx buffer memoryfcomstartfcomcninit: mapping failedfcomcons_alloc(): Help!fcomcons_free(): Help!wd%s: %d-sector PIO, LBA, %lluMB, %llu sectors wdattach%s: WARNING: unable to establish shutdown hook CHS, %lluMB, %d cyl, %d head, %d sec, %llu sectors LBA48, %lluMB, %llu sectors %s: IDENTIFY failed __wdstart: bad return code from wdc_ata_bio()wddone%s: soft error (corrected) , retrying device faultdevice timeoutST506/MFM/RLLESDI/IDE disk%s: %s wddumpwddump: try againwddump: device timed outwddump: unknown error typewddump: %swddump: drive faultwddump: DMA errorwddump: polled command has been queuedST506wd_get_params: bad return code from ata_get_params%s: flush cache command didn't complete %s: flush cache command: drive fault %s: flush cache command timeout wdc%s:%d:%d: not ready, st=0x%b, err=0x%02x BSYDRDYDWFDSCDRQCORRIDXERR%s:%d:%d: timeout waiting for DRQ, st=0x%b, err=0x%02x %s:%d:%d: bad state %d in _wdc_ata_bio_start _wdc_ata_bio_start: bad state%s:%d:%d: intr with DRQ (st=0x%b) %s:%d:%d: read intr before drq %s:%d:%d: device timeout, c_bcount=%d, c_skip%d %s:%d:%d: bad state %d in wdc_ata_bio_intr wdc_ata_bio_intr: bad statewdc_ata_ctrl_intr: state==RECALrecal%s:%d:%d: %s drive fault error (%x) %s:%d:%d: %s timed out piomodedmamodesetmultino media/write protectedinterface CRC erroraddress mark not foundtrack 0 not foundaborted commandmedia change requestedid not foundmedia changeduncorrectable data errorbad block detected%s %serror not notifiedtodclockresettod: %02d/%02d/%02d%02d %02d:%02d:%02d Clock has gained %d day%c %ld hours %ld minutes %ld secs %sCheck Condition (error %#x) on opcode 0x%x AT BLOCK #: %d (decimal) SENSE KEY: %s off INFO: 0x%x (VALID flag %s) SKSV: %s FRU CODE: 0x%x ASC/ASCQ: %s COMMAND INFO: 0x%x %c Incorrect Length Indicator Set%c EOM Detected%c Filemark Detectedscxsplgetxscannot allocate scsi xs could not get size scsi_scsi_cmdscsi_execute_xs: invalid return codescbusyunknown error category (0x%x) from scsi driver probe%s(%s:%d:%d): No Additional SenseSoft ErrorNot ReadyMedia ErrorHardware ErrorIllegal RequestUnit AttentionWrite ProtectedBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare ErrorReservedNo Additional Sense InformationFilemark DetectedEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnCleaning RequestedErase Operation In ProgressLocate Operation In ProgressRewind Operation In ProgressSet Capacity Operation In ProgressVerify Operation In ProgressNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Not Ready, Rebuild In ProgressLogical Unit Not Ready, Recalculation In ProgressLogical Unit Not Ready, Operation In ProgressLogical Unit Not Ready, Long Write In ProgressLogical Unit Not Ready, Self-Test In ProgressLogical Unit Not Accessible, Asymmetric Access State TransitionLogical Unit Not Accessible, Target Port In Standby StateLogical Unit Not Accessible, Target Port In Unavailable StateLogical Unit Not Ready, Auxiliary Memory Not AccessibleLogical Unit Not Ready, Notify (Enable Spinup) RequiredLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorLogical Unit Communication CRC Error (ULTRA-DMA/32)Unreachable Copy TargetTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureHead Select FaultError Log OverflowWarningWarning - Specified Temperature ExceededWarning - Enclosure DegradedWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedWrite Error - Recommend ReassignmentCompression Check Miscompare ErrorData Expansion Occurred During CompressionBlock Not CompressibleWrite Error - Recovery NeededWrite Error - Recovery FailedWrite Error - Loss Of StreamingWrite Error - Padding Blocks AddedAuxiliary Memory Write ErrorWrite Error - Unexpected Unsolicited DataWrite Error - Not Enough Unsolicited DataError Detected By Third Party Temporary InitiatorThird Party Device FailureCopy Target Device Not ReachableIncorrect Copy Target Device TypeCopy Target Device Data UnderrunCopy Target Device Data OverrunInvalid Information UnitInformation Unit Too ShortInformation Unit Too LongID CRC Or ECC ErrorUnrecovered Read ErrorRead Retries ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block ReadNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite The DataDe-Compression CRC ErrorCannot Decompress Using Declared AlgorithmError Reading UPC/EAN NumberError Reading ISRC NumberRead Error - Loss Of StreamingAuxiliary Memory Read ErrorRead Error - Failed Retransmission RequestAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRecord Not Found - Recommend ReassignmentRecord Not Found - Data Auto-ReallocatedLocate Operation FailureRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorData Sync Error - Data RewrittenData Sync Error - Recommend RewriteData Sync Error - Data Auto-ReallocatedData Sync Error - Recommend ReassignmentRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data Without ECC - Data RewrittenRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With L-ECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteRecovered Data With ECC - Data RewrittenRecovered Data With LinkingDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationRecovered ID with ECCPartial Defect List TransferInvalid Command Operation CodeAccess Denied - Initiator Pending-EnrolledAccess Denied - No Access rightsAccess Denied - Invalid Mgmt ID KeyIllegal Command While In Write Capable StateObsoleteIllegal Command While In Explicit Address ModeIllegal Command While In Implicit Address ModeAccess Denied - Enrollment ConflictAccess Denied - Invalid LU IdentifierAccess Denied - Invalid Proxy TokenAccess DEnied - ACL LUN ConflictLogical Block Address Out of RangeInvalid Element AddressInvalid Address For WriteIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBCDB Decryption ErrorSecurity Audit Value FrozenSecurity Working Key FrozenNonce Not UniqueNonce Timestamp Out Of RangeLogical Unit Not SupportedInvalid Field In Parameter ListParameter Not SupportedParameter Value InvalidThreshold Parameters Not SupportedInvalid Release Of Persistent ReservationData Decryption ErrorToo Many Target DescriptorsUnsupported Target Descriptor Type CodeToo Many Segment DescriptorsUnsupported Segment Descriptor Type CodeUnexpected Inexact SegmentInline Data Length ExceededInvalid Operation For Copy Source Or DestinationCopy Segment Granularity ViolationInvalid Parameter While Port Is EnabledHardware Write ProtectedLogical Unit Software Write ProtectedAssociated Write ProtectPersistent Write ProtectPermanent Write ProtectConditional Write ProtectNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedPower On, Reset, or Bus Device Reset OccurredPower On OccurredSCSI Bus Reset OccurredBus Device Reset Function OccurredDevice Internal ResetTransceiver Mode Changed to Single EndedTransceiver Mode Changed to LVDI_T Nexus Loss OccurredMode Parameters ChangedLog Parameters ChangedReservations PreemptedReservations ReleasedRegistrations PreemptedAsymmetric Access State ChangedImplicit Asymmetric Access State Transition FailedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedCurrent Program Area Is Not EmptyCurrent Program Area Is EmptyIllegal Power Condition RequestPersistent Prevent ConflictPrevious Busy StatusPrevious Task Set Full StatusPrevious Reservation Conflict StatusPartition Or Collection Contains User ObjectsOverwrite Error On Update In PlaceInsufficient Time For OperationCommands Cleared By Another InitiatorIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledCannot Write Medium - Unknown FormatCannot Write Medium - Incompatible FormatCannot Format Medium - Incompatible MediumCleaning FailureCannot Write - Application Code MismatchCurrent Session Not Fixated For AppendCleaning Request RejectedMedium Not FormattedMedium Format CorruptedFormat Command FailedNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorEnclosure FailureEnclosure Services FailureUnsupported Enclosure FunctionEnclosure Services UnavailableEnclosure Services Transfer FailureEnclosure Services Transfer RefusedRibbon, Ink, or Toner FailureRounded ParameterEvent Status NotificationESN - Power Management Class EventESN - Media Class EventESN - Device Busy Class EventSaving Parameters Not SupportedMedium Not PresentMedium Not Present - Tray ClosedMedium Not Present - Tray OpenMedium Not Present - LoadableMedium Not Present - Medium Auxiliary Memory AccessibleSequential Positioning ErrorTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Begining Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyEnd Of Medium ReachedMedium Magazine Not AccessibleMedium Magazine RemovedMedium Magazine InsertedMedium Magazine LockedMedium Magazine UnlockedMechanical Positioning Or Changer ErrorInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetLogical Unit FailureTimeout On Logical UnitLogical Unit Failed Self-TestLogical Unit Unable To Update Self-Test LogTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has Changedcomponent Device AttachedDevice Identifier ChangedRedundancy Group Created Or ModifiedRedundancy Group DeletedSpare Created Or ModifiedSpare DeletedVolume Set Created Or ModifiedVolume Set DeletedVolume Set DeassignedVolume Set ReassignedReported LUNs Data Has ChangedEcho Buffer OverwrittenMedium LoadableMedium Auxiliary Memory AccessibleRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorData Phase CRC Error DetectedSCSI Parity Error Detected During ST Data PhaseInformation Unit iuCRC Error DetectedAsynchronous Information Protection Error DetectedProtocol Service CRC ErrorSome Commands Cleared By iSCSI Protocol EventInitiator Detected Error Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorInvalid Target Port Transfer Tag ReceivedToo Much Write DataACK/NAK TimeoutNAK ReceivedData Offset ErrorInitiator Response TimeoutLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureErase Failure - Incomplete Erase Operation DetectedCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedSCSI To Host System Interface FailureSystem Resource FailureSystem Buffer FullInsufficient Reservation ResourcesInsufficient ResourcesInsufficient Registration ResourcesInsufficient Access Control ResourcesAuxiliary Memory Out Of SpaceUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change InputOperator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedFailure Prediction Threshold ExceededMedia Failure Prediction Threshold ExceededLogical Unit Failure Prediction Threshold ExceededSpare Area Exhaustion Prediction Threshold ExceededHardware Impending Failure General Hard Drive FailureHardware Impending Failure Drive Error Rate Too HighHardware Impending Failure Data Error Rate Too HighHardware Impending Failure Seek Error Rate Too HighHardware Impending Failure Too Many Block ReassignsHardware Impending Failure Access Times Too HighHardware Impending Failure Start Unit Times Too HighHardware Impending Failure Channel ParametricsHardware Impending Failure Controller DetectedHardware Impending Failure Throughput PerformanceHardware Impending Failure Seek Time PerformanceHardware Impending Failure Spin-Up Retry CountHardware Impending Failure Drive Calibration Retry CountController Impending Failure General Hard Drive FailureController Impending Failure Drive Error Rate Too HighController Impending Failure Data Error Rate Too HighController Impending Failure Seek Error Rate Too HighController Impending Failure Too Many Block ReassignsController Impending Failure Access Times Too HighController Impending Failure Start Unit Times Too HighController Impending Failure Channel ParametricsController Impending Failure Controller DetectedController Impending Failure Throughput PerformanceController Impending Failure Seek Time PerformanceController Impending Failure Spin-Up Retry CountController Impending Failure Drive Calibration Retry CountData Channel Impending Failure General Hard Drive FailureData Channel Impending Failure Drive Error Rate Too HighData Channel Impending Failure Data Error Rate Too HighData Channel Impending Failure Seek Error Rate Too HighData Channel Impending Failure Too Many Block ReassignsData Channel Impending Failure Access Times Too HighData Channel Impending Failure Start Unit Times Too HighData Channel Impending Failure Channel ParametricsData Channel Impending Failure Controller DetectedData Channel Impending Failure Throughput PerformanceData Channel Impending Failure Seek Time PerformanceData Channel Impending Failure Spin-Up Retry CountData Channel Impending Failure Drive Calibration Retry CountServo Impending Failure General Hard Drive FailureServo Impending Failure Drive Error Rate Too HighServo Impending Failure Data Error Rate Too HighServo Impending Failure Seek Error Rate Too HighServo Impending Failure Too Many Block ReassignsServo Impending Failure Access Times Too HighServo Impending Failure Start Unit Times Too HighServo Impending Failure Channel ParametricsServo Impending Failure Controller DetectedServo Impending Failure Throughput PerformanceServo Impending Failure Seek Time PerformanceServo Impending Failure Spin-Up Retry CountServo Impending Failure Drive Calibration Retry CountSpindle Impending Failure General Hard Drive FailureSpindle Impending Failure Drive Error Rate Too HighSpindle Impending Failure Data Error Rate Too HighSpindle Impending Failure Seek Error Rate Too HighSpindle Impending Failure Too Many Block ReassignsSpindle Impending Failure Access Times Too HighSpindle Impending Failure Start Unit Times Too HighSpindle Impending Failure Channel ParametricsSpindle Impending Failure Controller DetectedSpindle Impending Failure Throughput PerformanceSpindle Impending Failure Seek Time PerformanceSpindle Impending Failure Spin-Up Retry CountSpindle Impending Failure Drive Calibration Retry CountFirmware Impending Failure General Hard Drive FailureFirmware Impending Failure Drive Error Rate Too HighFirmware Impending Failure Data Error Rate Too HighFirmware Impending Failure Seek Error Rate Too HighFirmware Impending Failure Too Many Block ReassignsFirmware Impending Failure Access Times Too HighFirmware Impending Failure Start Unit Times Too HighFirmware Impending Failure Channel ParametricsFirmware Impending Failure Controller DetectedFirmware Impending Failure Throughput PerformanceFirmware Impending Failure Seek Time PerformanceFirmware Impending Failure Spin-Up Retry CountFirmware Impending Failure Drive Calibration Retry CountFailure Prediction Threshold Exceeded (false)Low Power Condition OnIdle Condition Activated By TimerStandby Condition Activated By TimerIdle Condition Activated By CommandStandby Condition Activated By CommandPower State Change To ActivePower State Change To IdlePower State Change To StandbyPower State Change To SleepPower State Change To Device ControlLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackPacket Does Not Fit In Available SpaceIllegal Mode For This TrackInvalid Packet SizeVoltage FaultAutomatic Document Feeder Cover UpAutomatic Document Feeder Lift UpDocument Jam In Automatic Document FeederDocument Miss Feed Automatic In Document FeederConfiguration FailureConfiguration Of Incapable Logical Units FailedAdd Logical Unit FailedModification Of Logical Unit FailedExchange Of Logical Unit FailedRemove Of Logical Unit FailedAttachment Of Logical Unit FailedCreation Of Logical Unit FailedAssign Failure OccurredMultiply Assigned Logical UnitSet Target Port Groups Command FailedLogical Unit Not ConfiguredData Loss On Logical UnitMultiple Logical Unit FailuresParity/Data MismatchInformational, Refer To LogState Change Has OccurredRedundancy Level Got BetterRedundancy Level Got WorseRebuild Failure OccurredRecalculate Failure OccurredCommand To Logical Unit FailedCopy Protection Key Exchange Failure - Authentication FailureCopy Protection Key Exchange Failure - Key Not PresentCopy Protection Key Exchange Failure - Key Not EstablishedRead Of Scrambled Sector Without AuthenticationMedia Region Code Is Mismatched To Logical Unit RegionDrive Region Must Be Permanent/Region Reset Count ErrorDecompression Exception Long Algorithm IDSession Fixation ErrorSession Fixation Error Writing Lead-InSession Fixation Error Writing Lead-OutSession Fixation Error - Incomplete Track In SessionEmpty Or Partially Written Reserved TrackNo More Track Reservations AllowedCD Control ErrorPower Calibration Area Almost FullPower Calibration Area Is FullPower Calibration Area ErrorProgram Memory Area Update FailureProgram Memory Area Is FullRMA/PMA Is Almost FullDEFERRED CDBParametersError in %s, Offset %d, bit %dProgress Indicator: %dActual Retry Count: %dASC 0x%02x ASCQ 0x%02xDiagnostic Failure on Component 0x%02xDecompression Exception Short Algorithm ID OF 0x%02xTagged Overlapped Commands (0x%02x = TASK TAG)host adapter code inconsistency unknown error category (0x%x) from host adapter code User command with no ioctl User command with no buf scistrcmdlen too big physio split the request.. cannot proceed DEC RZ55 (C) DECEMULEX MD21/S2 ESDIA00IBMRAID 0662SIBM 0663HIBM0664H3171-S2KZ-CDFRSS2FQUANTUM ELS85S SEAGATE ST19171FCST34501FC iomegajaz 1GBIOMEGAZIP 100ZIP 2500661467MICROP4421-07SEAGATEST150176LW0002HPC3725SDCASSONY SDT-5000 3.WangDAT Model 1300 02.4Model 2600 01.7Model 3200 02.2ALPS ELECTRIC CO.,LTD. DC544CSW03DCR-2801TE1.07CREATIVECD3630EAC101FX320Sq01GCD-R580B1.00MATSHITA CR-5741.021.06Memorex CRW-26421.0gNEC CD-ROM DRIVE:2734.21SANYO CRD-256PSANYO CRD-254PSANYO CRD-S54P1.08CD-ROM CDR-S11.70CD-ROM CDR-N161.25UJDCD87301.14scsibusscsibus at %s: %d targets scsibusattach: can't allocate target linksscsibusattach: can't allocate lun linksscsi_probe_busPLEXTORCD-ROM PX-40TS1.01FUJITSUM2513A0800DELTIS MOS321 3.30MICROP 1588-15MBSUN0669vendor-uniqueremovablefixed targ %d lun %d: <%s, %s, %s> SCSI%d %d/%s %s%sscsibusprintdirectsequentialprinterprocessorwormcdromscanneropticalchangercommunicationenclosure servicessimplified directscsibusprint: impossible device type offlinescsibusprint: impossible qualifierNEC CD-ROM DRIVE:260%s: not queuedcdioctlATAPI CD-ROMSCSI CD-ROMdvd_authdvd_read_physicaldvd_read_copyrightdvd_read_disckeydvd_read_bcadvd_read_manufactcd_scsibus_set_pa_immedcd_scsibus_setchancd_scsibus_getvolcd_scsibus_setvolsd%luMB, %lu cyl, %lu head, %lu sec, %lu bytes/sec, %lu sec totalunformatted mediadrive offline%s: not queued, error %d SCSI opticalSCSI disksdgetdisklabel%s: removable disk stopped - not restarting %s: respinning up disk %s: respin of disk failed - %d %s: ..is spinning up...waiting sd_atapibus_get_parms%s: mode sense (%d) returned nonsense; using fictitious geometry %s: could not mode sense (4/5)%s: WARNING: cache synchronization failed TDC 3800 ARCHIVE VIPER 2525 25462SANKYO CP525 ANRITSU DMT780 VIPER 150 21247VIPER 150 21531WANGTEK 5099ES SCSI5150ES SCSI5525ES SCSI REV7EXABYTE EXB-8200 263HHP T4000s TANDBERG TDC 3600 ????TEAC MT-2ST/N50 rogue, %s: %sdensity code 0x%x, drive empty or not ready %d-byteprotected blocks, write-%s variable%s: cannot set selected mode %s: bad request, must be multiple of %d %s: bad request, must be between %d and %d %s: not queued st_mode_sensest_mode_select%s: block wrong size, %d blocks residual %s: bad residual %d out of %d %s: %d-byte record too big atapiscsiwdc_atapi_start: not ready, st = %02x wdc_atapi_intr_command%s:%d:%d: device timeout waiting to send SCSI packet unexpected data phasezero length transfer requested in data phasedata transfer direction disagreementdata phase where none expecteddata transfer direction disagreement during senseunexpectedly in command phasewdc_atapi_intr: warning: device requesting %d bytes, only %d left in buffer wdc_atapi_intr: warning: reading only %d of %d bytes atapiscsi: Shouldn't get here %s:%d:%d: device timeout, c_bcount=%d, c_skip=%d, status=0x%b, ireason=0x%x Device Reset WaitIdentifyPost-IdentifyPIOMODEunknown state%s:%d:%d: soft reset failed use one of: %s[a-p]parsediskboot_file: '%s' rootconf: device name too longboot device: %s. root device (default %s%c)swap device can't figure root, hope your kernel is right rootconfroot on %s%c boot device not knownboot device: lookup '%s' failed. rebooting... The operating system has halted. Please press any key to reboot. OpenBSD/cats booting ... initarm: Configuring system ... physmemory: %d pages at 0x%08lx -> 0x%08lx Incompatible magic number passed in boot args(hd0)wd0bootfile: %s bootargs: %s diagcan't init serial console @%xinvalid geometrydos partition I/O errordisk label I/O errorno disk labeldisk label corruptedisa_alloc(): Help!isa_free(): Help!stray interrupt %d%s ; stopped loggingintr_alloc: bogus typeintr_establish: bogus irq or typeintr_establish: can't share %s with %sintr_disestablish: bogus irqisa_irqdispatch: %x sysbeep_isadsrtc: cannot map I/O space : lithium cell is dead, RTC unreliablemii_attach: phyloc and offloc specifiedmii_activate: phyloc and offloc specifiedmii_activate: DVACT_ACTIVATE%s: config_activate(%d) failedmii_detach: phyloc and offloc specifiedOUI 0x%06x model 0x%04x rev %d at %s phy %dmiiautnsphyDP83840 10/100 media interface: %s, rev. %d qsphyQS6612 10/100 media interfacei82562EM 10/100 media interfacei82555 10/100 media interfaceunknown inphyi82562ET 10/100 media interfaceexphy: 3Com internal media interface : unknown phy %s: ignoring this PHY, non-zero instance Broadcom 3C905B internal PHYBroadcom 3C905C internal PHYexphy_service: can't isolate 3Com PHYukphy: Generic IEEE 802.3u media interface %s: OUI 0x%06x, model 0x%04x, rev. %d %s: no media present dev %d function %dpciprintset_pci_isa_bridge_callbackpci_io_find: bad requestpci_io_find: expected type i/o, found mem pci_io_find: void region pci_mem_find: bad requestpci_mem_find: expected type mem, found i/o pci_mem_find: expected mem type %08x, found %08x pci_mem_find: void region pci_mem_find: reserved mapping register type pci_mem_find: 64-bit memory map which is inaccessible on a 32-bit platform pci_mem_find: bad 64-bit requestmiscellaneousSCSIfloppyIPIethernettoken ringFDDIWorldFipPCMIG Multi ComputingXGAvideotelephonyflashhostMicroChannelNuBusRACEwaySemi-transparent PCIInfiniBandparallelmulti-port serialmodem8259 PIC8237 DMA8254 timerRTCPCI Hot-Plugdigitizergame portgeneric386486PentiumAlphaPowerPCMIPSCo-processorFirewireACCESS.busSSAFiber ChannelIPMISERCOSCANbusIrDAConsumer IRRFstandardTVvoicedatanetwork/computingentertainmentDPIOTime and Frequencyprehistoricmass storagenetworkdisplaymultimediacommunicationssystemdockserial buswirelessI2Osatellite commDASPundefinedOZ6832 CardBusOZ6836/OZ6860 CardBusOZ68[17]2 CardBusOZ6922 CardBusOZ6933 CardBusOZ69[17]2 CardBus3c9853c996V.90 Modem3c9403c3393c3593c4503c590 10Mbps3c595 100Base-TX3c595 100Base-T43c595 10Mbps-MII3c555 100Base-TX3CRSHPW796 802.11b3c556 100Base-TX3c556B 100Base-TX3cSOHO-TX3crwe777a AirConnect3c900 10Base-T3c900 10Mbps-Combo3c900B 10Mbps3c900B 10Mbps-Combo3c900B 10Mbps-TPC3c900B 10Mbps-FL3c905 100Base-TX3c905 100Base-T43c905B 100Base-TX3c905B 100Base-T43c905B 10/100Mbps-Combo3c905B 100Base-FX3c905C 100Base-TX3c9201 100Base-TX3c920B-EMB-WNM3cSOHO 100B-TX3c980 100Base-TX3c980C 100Base-TX3cr9903cr990-TX3cr990-TX-953cr990-TX-973c990b-TX-M3cr990-FX3cr990SVR953cr990SVR973c990BSVRVoodooVoodoo2BansheeVoodoo3Voodoo5300SX500TXDeltaPermedia500MXPermedia 2Oxygen GVX1Permedia 3Escalade IDE RAIDPC4800 WirelessPCI35x WLANPC4500 WirelessMPI-350 WirelessACCM 2188 VL-PCI2051 PCI2051 ISAATP850U/UFATP860ATP860-AATP865-AATP865-RAEC6710AEC6712UWAEC6712UAEC6712SAEC6710DAEC6715UWMPX 5030/5038EN2242EN1217rtl8139RhineIIM1435 VL-PCIM1445 VL-PCIM1449 ISAM1451 PCIM1461 PCIM1489 PCIM1523 PCIM1523 ISAM1531 PCIM1533 ISAM1535 PCIM1543 ISAM1541 PCIM1621 PCIM1647 PCIM3309 MPEG AcceleratorM4803M5219 UDMA IDEM5229 UDMA IDEM5237 USBM5247 AGP/PCI-PCIM5243 AGP/PCI-PCIM5451 AudioM7101 Power MgmtAL981AN983AN985ADM8211 WLANAIC-7810AHA-2940AU/CNAHA-2930CUAIC-7850AIC-7855AIC-5900 ATMAIC-5905 ATMAIC-7860AHA-2940AUAIC-7870AHA-2940AHA-3940AHA-3985AHA-2944AIC-7880AHA-2940UAHA-3940UAHA-398XUAHA-2944UAHA-2940UWProAIC-6915AIC-7895AHA-2940U2 U2AHA-2930U2 U2AAA-131U2 U2AIC-7890/1 U2AIC-7892 U160AHA-29160 U160AHA-19160B U160AHA-3950U2B U2AHA-3950U2D U2AIC-7896/7 U2AHA-3960D U160AIC-7899BAIC-7899DAIC-7899FAIC-7899 U160AAC-2622ASR-2200SASR-2120SAAC-364AAC-3642Dell PERC 2/QCAIC-7901 U320AHA-29320A U320AHA-29320LP U320AIC-7901A U320AHA-29320 U320AHA-29320B U320AIC-7902 U320AIC-7902B U320AHA-39320 U320AHA-39320B U320AHA-39320A U320AHA-39320D U320AHA-39320DB U3201200A1200BABP-930/40UAABP-940UWASP-3940U2WASP-3940U3WWaikato Dag3.2Endace Dag3.5Endace Dag4.22GEEndace Dag4.23AT22AT24AcenicAcenic CopperBCM5700BCM5701AC1000AC1001AC9100AMD64 HyperTransportAMD64 Address MapAMD64 DRAM CfgAMD64 Misc Cfg79c970 PCnet-PCI79c978 PChome-PCI53c974 PCscsi-PCI79C974 PCnet-PCIElanSC520 PCI751 System751 PCI-PCI762 PCI762 PCI-PCI761 PCI761 PCI-PCI755 ISA755 IDE755 Power Mgmt755 USB756 ISA756 IDE756 Power Mgmt756 USB Host766 ISA766 IDE766 USB766 Power Mgmt766 USB OpenHCI768 ISA768 IDE768 Power Mgmt768 AC97768 Modem768 PCI-PCI768 USB8131 PCIX8131 PCIX IOAPIC8151 Sys Control8151 AGP8111 PCI-PCI8111 USBAMD8111 LPC8111 IDE8111 SMBus8111 ACPI8111 AC97MegaRAIDMegaRAID Series 428MegaRAID Series 434Antares GigabitBanditGCOHareHeathrowPaddingtonUni-N EthUni-NUni-N AGPGMACKeylargoPangeaPangea USBPangea AGPPangea PCIUni-N2 AGPUni-N2 HostPangea FireWireUniNorth FirewireGMAC EthernetUni-N ATAUniNorth AGPUniNorth PCIIntrepid ATAIntrepidIntrepid USB1000PV2000PV2000MT2000MIAX88140A/88141Mach32Radeon 8500 BBRadeon IGP 320MMobility M6Mach64 CTMach64 CXMach64 ETRage ProMach64 GDMach64 GIMach64 GLMach64 GMMach64 GNMach64 GOMach64 GPMach64 GQRage XLMach64 GSMach64 GTMach64 GUMach64 GVMach64 GWMach64 GXMach64 GYMach64 GZRadeon 9000Radeon 9000 SecMach64 LBMach64 LDRage128 LEMobility M3Mach64 LGMach64 LIMobility 1Mach64 LNMach64 LPMach64 LQRage P/MMach64 LSRadeon Mobility M7 LWRadeon Mobility M6 LYRadeon Mobility M6 LZRadeon Mobility M9 LfRage 128 Mobility MFRage 128 Mobility MLRadeon 9500/9700Radeon Mobility M10 NPRadeon 9500/9700 SecRage 128 Pro PDRage FuryRage 128 PKAIW RadeonRadeon QERadeon QFRadeon QGRadeon 8500 QLRadeon 9100 QMRadeon 8500 QNRadeon 8500 QORadeon 7500 QWRadeon VE QYRadeon VE QZRadeon 8500 QlRage 128 GLRage MagnumRage 128 RGRage 128 RKRage 128 VRRage 128 SHRage 128 SKRage 128 SLRage 128 SMRage 128Rage 128 Pro TFRage 128 Pro TLRage 128 Pro TRMach64 VTMach64 VUMach64 VVRadeon 9200 2ndRadeon 9200RS200 AGPRS200 PCIS5933 PCI MatchmakerMyrinet LANaiIDE-2015PLVortex 1Vortex 2Vortex AdvantageAVL2301AVG2302ALG2301ALG2302ALS4000LP-PCI 4 SerialFritz ISDNFritz v2.0 ISDNBRI ISDNPRI T1 ISDNVME 617VME 270655015601BCM5702BCM5703BCM5704CBCM5702FEBCM5705BCM5705MBCM5705M_ALTBCM5782BCM5788BCM5702XBCM5703XBCM4704SBCM4401B0BCM5901BCM5901A2BCM44015801580258055820582158225823BT848BT849BT878BT879BT878 AudioBT879 AudioBt8474 HDLCMultiMaster NCMultiMasterFlashPointGPPCINitrox XLCinemaster C 3.0 DVD Decoder643106554565548655506555465555685546900069030CL-GD7548CL-GD5430CL-GD5434-4CL-GD5434-8CL-GD5436CL-GD5446CL-GD5480CL-GD5462CL-GD5464CL-GD5465CL-PD6729CL-PD6832 CardBusCL-PD6833 CardBusCL-GD7542CL-GD7543CL-GD7541CS4610 SoundFusion AudioCS4615CS4280/46xx CrystalClear AudioCS4281 CrystalClear AudioPCI0640PCI0642PCI0643PCI0646PCI0647PCI0648PCI0649PCI0650AUSB0670USB0673PCI0680SiI3112 SATASiI3114 SATASiI3512 SATAEX110TXTriflex PCIQVisionQVision 1280/pSmart Array 5300Smart Array 5iSmart Array 532Smart Array 5312Smart Array 641Smart Array 642Smart Array 6400Smart Array 6400 EMNetelligent ASMCPCI HotplugUSB OpenHostSMART2P RAIDISAPnPNetelligent 10/100 TXNetelligent IDENetelligent 10 TIntegrated NetFlex 3/PDP Netelligent 10/100 TXProLiant Netelligent 10/100 TXEmbedded Netelligent 10/100 TXNetelligent 10 T/2 PCISmart Array 5300 rev.2Smart Array 5i/532 rev.2NetFlex 3/PNetFlex 3/PBRL100-ATX 10/100PMAC 9871356k WinmodemSoftK56 PCIHSF 56k HSFi82C599 VLBCY82C693U ISAC-Bus II-PCISoundBlaster LiveSoundBlaster AudigySoundBlaster Audigy LSPCI Gameport JoystickSoundBlaster Audigy Digital InputEctiva 1938Cyclom-Y below 1MCyclom-YCyclom-4Y below 1MCyclom-4YCyclom-8Y below 1MCyclom-8YCyclom-Z below 1MCyclom-ZIQ80310GXm PCIGXm ISACx5530 SouthCx5530 SMI/ACPICx5530 IDECx5530 XpressAUDIOCx5530 VideoDM9100DM9102DM900921050 PCI-PCI2104021030Zephyr NV-RAMKZPSA21140TGA2DEFPA21041DGLPB (OPPO)ZLXP-L2 (Pixelvision)21142/3Farallon PN9000SX21052 PCI-PCI21150 PCI-PCI21150-BC PCI-PCI21152 PCI-PCI21153 PCI-PCI21154 PCI-PCICompaq SMART RAID 42xxSWXCR RAIDPERC 2/SiPERC 3/DiPERC 3/SiPERC 4/Di i960PERC 4/Di Verde8139Viper/PCI550TX530TX+DGE-550TDGE-530TSmartCache/RaidSmartRAID (I2O)SmartRAID 2005SMemory ControlPCI-SCIDMX3194UIS64PH ISDN155P-MF1 ATM (FPGA)155P-MF1 ATM (ASIC)25SS-3010 ATM (ASIC)SpeedStream 1023QuickStep 1000 ISDNLight Pulse FibreChannelLight Pulse 8000Endace Dag3.6DEndace Dag4.23GECB-1410 CardBusAudioPCI97AudioPCICT5880ES366H Fax/Modem (early)Maestro IISOLO-1 AudioDriveMaestro 2EES1989ES1989 ModemMaestro 3ES1983 ModemMaestro 3 Audio AcceleratorES366H Fax/ModemES2838/2839 SuperLink ModemES2898 ModemRoadRunner HIPPIRoadRunner Gig-EFreedom GBusWL11000PATM PCA-200ATM PCA-200e801 SoundTMC-18C30 (36C70)GL24110PGL24110P02PR103WinTVVisualize EGVisualize FX6Visualize FX4Visualize FX2Tach TL FibreChannelTach XL2 FibreChannelJ2585AJ2585BDiva Serial MultiportVisualize FXeTopTools Communications PortNetRaid-4MNetServer SmartIRQ82557B 10/100 NIC77516500781179517814/7851/785480658165815479567955/7954MCACPU - Alta LiteCPU - Alta MPISA w/PnPCPUAuto LANStreamerGXT-150P82G267582351 PCI-PCIServeRAIDMiami/PCIOlympici82557B 10/100FireGL2PCIX-PCIX77201/77211 ATM (NICStAR)WDT 50x Watchdog TimerINIC-850 (A100UW)INIC-1060 (A100U2W)INIC-940INIC-941INIC-950884921145EES ISA80312 I/O CompanionPCIE-PCIX Bridge Hub APCIE-PCIX Bridge Hub BIOP331 Channel 0IOP331 Channel 182375EB EISA82424ZX Cache/DRAM82378IB ISA82426EX ISA82434LX/NX PCI/Cache/DRAMGDT RAIDi960 RP PCI-PCIi960 RM PCI-PCIi960 RN PCI-PCIPRO/1000 (82542)PRO/1000F (82543GC)PRO/1000T (82543GC)PRO/1000XT (82544EI)PRO/1000XF (82544EI)PRO/1000T (82544GC)PRO/1000XT (82544GC)PRO/1000MT (82540EM)PRO/1000MT (82545EM)PRO/1000MT DP (82546EB)PRO/1000MF (82545EM)PRO/1000MF DP (82546EB)PRO/1000MT (82541EI)PRO/1000MT Mobile (82540EM)PRO/1000MT (82540EP)PRO/1000MT Mobile (82541EP)PRO/1000CT (82547EI)PRO/1000CT Mobile (82547EI)PRO/1000MF QP (82546EB)PRO/1000MT Mobile (82540EP)PRO/1000MT (82545GM)PRO/1000MF (82545GM)PRO/1000MB (82545GM)PRO/10082559PRO/100 VEPRO/100 VM82562EH HomePNAPRO/2100 3BPRO/XGBPRO/100 MPRO/1000MT Mobile (82541EI)PRO/1000MB DP (82546EB)PRO/1000GT82815 Hub82815 AGP82815 Graphics82806AA PCI64 APIC82559ER82092AA IDESAA7116EE Pro 10 PCIEE Pro 100EE Pro 100 Smart8255782437FX82371FB ISA82371FB IDE82371 ISA and IDE82437 PCI/Cache/DRAM82441FX82380AB Mobile ISA82380FB Mobile PCI-PCI82439HX82806AA PCI6482870P2 P64H2 PCI-PCIP64H2 IOxAPICP64H2 Hot Plug80960RP ATU82840 Host82840 AGP82840 PCI82845 Host82845 AGP82801AA LPC82801AA IDE82801AA USB82801AA SMBus82801AA AC9782801AA Modem82801AA Hub-to-PCI82801AB LPC82801AB IDE82801AB USB82801AB SMBus82801AB AC9782801AB Modem82801AB Hub-to-PCI82801BA LPC82801BA USB82801BA SMBus82801BA USB282801BA AC9782801BA Modem82801BAM Hub-to-PCI8256282801BAM IDE82801BA IDE82801BAM LPC82801BA AGP82801E LAN82801CA LPC82801CA/CAM USB82801CA/CAM SMBus82801CA/CAM AC9782801CA/CAM Modem82801CAM IDE82801CA IDE82801CAM LPC82801DB LPC82801DB USB82801DB SMBus82801DB AC9782801DB Modem82801DBM IDE82801DB IDE82801DBM LPC82801EB/ER LPC82801EB SATA82801EB/ER USB82801EB/ER SMBus82801EB/ER AC9782801EB/ER Modem82801EB/ER IDE82801ER SATA82820 MCH82820 AGP82850 HostE7500 MCH HostE7500 DRAME7500 MCH HI_B vppb 1E7500 MCH HI_B vppb 2E7500 MCH HI_C vppb 1E7500 MCH HI_C vppb 2E7500 MCH HI_D vppb 1E7500 MCH HI_D vppb 282860 Host82850/82860 AGP82852/82855 CPU-I/O-182852/82855 AGP82852/82855 CPU-I/O-282852/82855 CPU-I/O-382860 PCI-PCI82845G/GL82845G/GL/GV/GE/PE AGP82845G/GL Video82865G/PE/P CPU-I/0-182865G/PE/P CPU-AGP82865G Video82865G/PE/P CPU-CSA82865G/PE/P CPU-I/0-282875P Host82875P AGP82875P PCI-CSA6300ESB LPC6300ESB IDE6300ESB SATA6300ESB SMBus6300ESB USB5300ESB USB6300ESB WDT6300ESB APIC6300ESB PCIX31244 SATA82830MP CPU-I/O-182830MP CPU-AGP82830MP Integrated Video82830MP CPU-I/O-282852GM Hub-PCI82852GM AGP82852GM Memory82852GM Configuration82855PE Hub82855PE AGPRCU32 I2O RAIDE7710 SMCHE7710 MCH ERRE7710 MCH DMAE7710 MCH PCIE Port A0E7710 MCH PCIE Port A1E7710 MCH PCIE Port B0E7710 MCH PCIE Port B1E7710 MCH PCIE Port C0E7710 MCH PCIE Port C1E7710 WMCHi960 RD PCI-PCIPRO 100 Server82371SB ISA82371SB IDE82371SB USB82437VX82439TX System82371AB PIIX4 ISA82371AB IDE82371AB USB82371AB Power Mgmt8281082810 Graphics82810-DC10082810-DC100 Graphics82810E82810E Graphics82443LX AGP82443BX AGP82443BX82440MX Host82440MX AC9782440MX Modem82440MX ISA82440MX IDE82440MX USB82440MX Power Mgmt82440BX AGP82443GX82740 AGP82450KX/GX82450KX/GX Memory82451NX Mem & IO82454NX PXB82802AB Firmware Hub 4Mbit82802AC Firmware Hub 8MbitI2O RAID PCI-PCIRCU21 I2O RAIDRCUxx I2O RAIDRCU31 I2O RAIDRCU31L I2O RAIDS21152BB PCI-PCIS21154AE/BE PCI-PCIPowerstorm 4D50T5526 FibreChannelPRISM2.5AEONAGX016ITT3204 MPEG DecoderADSP 2141IT8212FIT8330GKTIHSSIDS3SSIDS1Appian LiteDual SerialSerialQuad SerialParallelDual ParallelDual Parallel BS3 805Leadtek WinFast TV 2000LXT1001EG1032EG1064PNICPNIC-IIK56flex DSVD LTMODEMLTMODEMVenus ModemUSB 2-portUSB QuadraBusFW322 1394LS242 DVD DecoderPMAC 98715PMAC 98727MX86250Smart 16/4 PCI RingnodeSmart 16/4 PCI Ringnode Mk2Smart 16/4 PCI Ringnode Mk3Smart 16/4 PCI Ringnode Mk116/4 CardbusPresto PCISmart 100/16/4 PCI-HS RingnodeSmart 100/16/4 PCI Ringnode16/4 CardBus Mk2Collage 25 ATMCollage 155 ATMi740 PCISKv2Belkin F5D5005MGA PX2085 (Atlas)MGA Millenium 2064W (Storm)MGA 1064SG 220MHzMGA Millennium II 2164WMGA Millennium II 2164WA-B AGPMGA G200 PCIMGA G200 AGPMGA G400/G450 AGPMGA ImpressionMGA G100 PCIMGA G100 AGPMGA 1064SGMGA G400 Twin HeadMGA G550 AGPMGA Millennium G200 SDMGA Produktiva G100 SDMGA Mystique G200 SDMGA Millennium G200 SGMGA Marvel G200 SDGUI AccelMPC105 PCIMPC106 PCISM56Raven PCICP-114C104HCP-104ULC168HDMA4 serialDAC960P V2 RAIDDAC960P V3 RAIDDAC960P V4 RAIDDAC960P V5 RAIDAcceleRAIDeXtremeRAIDMTD800 10/100MTD803 10/100MTD891 10/100/1000MV1000NCP130NCP130 Rev A2DP83810 10/100PC87415 IDE87560 Legacy I/ODP83815 10/100DP83820 1/10/100/1000SCx200 ISASCx200 SMISCx200 IDESCx200 AUDIOSCx200 VIDEOSCx200 X-BUSSC1100 ISASC1100 SMI/ACPISC1100 X-BusNS87410PowerVR PCX2I/OUSB 2.0Versa MaestroVersa Va26D MaestroMagicgraph NM2070Magicgraph 128VMagicgraph 128ZVMagicgraph NM2160Magicgraph NM2200Magicgraph NM2360MagicMedia 256AV+MagicMedia 256XL+MagicMedia 256AVMagicMedia 256ZXMA301GA620GA620T2S1P4SCMI8338A AudioCMI8338B AudioCMI8738/C3DX AudioCMI8738B AudioHSP56 AMRNSP2KNetVin 5000Universe VME53c81053c82053c82553c81553c810AP53c86053c1510D53c89653c89553c88553c87553c151053c895A53c1010-3353c1010-6653c103053c875JFC909FC909AFC929FC919Packet Engines G-NICNX82C501 PCINDR4600 PCIBS21 10/100E-mobility WirelessImagine-128Imagine-128 IIImagine-128 T2RImagine-128 T2R4NV1DAC64Riva TNTRiva TNT2Riva TNT2 UltraVantanForce2 ISAnForce2 SMBusnForce2 IDEnForce2 LANnForce2 USBnForce2 USB2nForce2 AC-97 AudionForce2 AudionForce2 PCI-PCInForce2 FireWireAladdin TNT2nForce3 ISAnForce3 PCI HostnForce3 PCI-PCInForce3 SMBusnForce3 IDEnForce3 LANnForce3 USBnForce3 USB2nForce3 AC-97 AudioGeForce256GeForce256 DDRQuadroGeForce2 MXGeForce2 MX 100GeForce2 GoQuadro2 MXRGeForce2 GTSGeForce2 TiGeForce2 UltraQuadro2 ProGeForce4 MX 460GeForce4 MX 440GeForce4 MX 420GeForce4 440 GoGeForce4 420 GoGeForce4 420 Go 32MQuadro4 500XGLGeForce4 440 Go 64MQuadro4 200/400NVSQuadro4 550XGLQuadro4 GoGLGeForce4 MX 440 AGP 8xGeForce4 MX 440SE AGP 8xGeForce 4 MX 420 AGP 8xQuadro4 580 XGLQuadro4 NVSQuadro4 380 XGLGeForce2 Crush11nForce PCI HostnForce 420 DDRnForce 220/420nForce AC-97 AudionForce ISAnForce SMBusnForce AGPnForce PCI-PCInForce IDEnForce USBnForce2 PCInForce2 AGPnForce2GeForce4 MX - nForce GPUGeForce3GeForce3 Ti 200GeForce3 Ti 500Quadro DCCGeForce4 Ti 4600GeForce4 Ti 4400GeForce4 Ti 4200Quadro4 900 XGLQuadro4 750 XGLQuadro4 700 XGLGeForce FX 5600GeForce4 Ti 4200 GoGeForce FX 5200GeForce FX Go 5200OTI107OC2183OC2325OC232682C092G82C557 Host82C558 ISA82C568 IDE82D568 IDE82C621 IDE82C70082C70182C822RM861HAVScom 010LVScom 100LVScom 110LVScom 200LVScom 210LVScom 400LVScom 800LVScom x10HVScom 100HVScom 200HVScom 200HV2VScom 400H/800HVScom 800HVScom 011HExsys EX-41098PMC/GNIC2RZ1000HSP MicroModem 56PCIHB5I/O BridgePCIHB7CNB20HE HostCNB20LE HostCIOB30CMIC_HE HostCMIC_LE HostCNB20-HECMIC_SL HostCIOBX2CIOB-EROSB4 SouthBridgeCSB5 SouthBridgeCSB6 PCIOSB4 IDECSB5 IDECSB6 IDEOSB4/CSB5 USBCSB6 USBCSB5 PCICSB6 LPCPCI/ISAPT80C826PT86C521PT86C523PC87550PT86C523_2PCC-ISESES1849I/O 9050I/O 9080DC5030PDC20246PDC20262PDC20263PDC20265PDC20267PDC20268PDC20268RPDC20269PDC20271PDC20275PDC20276PDC20277PDC20318PDC20319PDC20371PDC20375PDC20376PDC20377PDC20378PDC20379PDC20617PDC20618PDC20619PDC20620PDC20621ISP1020ISP1022ISP1080ISP1240ISP1280ISP12160ISP10160ISP2100ISP2200ISP230085008580RT2460A8029812981695C465 CardBus5C466 CardBus5C475 CardBus5C476 CardBus5C477 CardBus5C478 CardBus5C521 Firewire5C551 Firewire5C552 FirewireRS56/SP-PCI11P1 ModemViRGETrio32Trio32/64Aurora64V+Trio64UV+868ViRGE VX86C92886C864-086C864-186C864-286C864-386C964-086C964-186C964-286C964-386C968-086C968-186C968-286C968-3Trio64V2/DXPlatoTrio3D AGPViRGE DX/GXViRGE GX2Trio3 DX2Savage 3DSavage 3DMSavage 4ViRGE MXViRGE MXPSavage/MX-MVSavage/MXSavage/IX-MVSavage/IXSuperSavageTwisterTwister-KProSavage DDRSonicVibesSafeXcel984x GESK-9821 v2.0SK-9D21TigonSTG 2000XSTG 1764Kyro-IISTG 1764X64GXDVDmagic-PRO86C201 AGP86C202 VGA86C20585C503 System5595 System85C503 ISA5597/5598 VGA6215300/305/630 VGA85C50185C496SiS596530 PCI540 PCI550 PCI85C601 EIDE620 PCI630 PCI633 PCI635 PCI640 PCI645 PCI646 PCI648 PCI650 PCI651 PCI652 PCI655 PCI658 PCI730 PCI733 PCI735 PCI740 PCI741 PCI745 PCI746 PCI748 PCI750 PCI751 PCI752 PCI755 PCI900 10/100BaseTX961 PCI962 PCI963 PCI551155125513 EIDE5571 PCI558155825591 PCI55965597 Host5598620462056300530 VGA650 VGA6326 VGA6330 VGA5597/5598 USB7002 USB7007 FireWire7012 AC977013 Modem7016 10/100BaseTX7018 AudioFDC 37C665FDC 37C92283C170 (EPIC/100)LynxEMLynxEM+Lynx3DMLynxELynxE+Lynx3D910Pirahna 2-portTulip, power, switch extenderFPGA I-Bus Tracer for MBDSZB6120CXD1947A FireWireCXD3222 FireWireMemory Stick SlotVelocity128PCIO Ebus2HMEPCIO Ebus2 (US III)ERI EtherGEMSimba PCI-PCICrypto 5821Crypto 1KPsycho PCImicroSPARC IIep PCIUltraSPARC IIi PCIUltraSPARC IIe PCICassini EtherST201ST202140XX4018ASurecom NE-344S2PSpectrum24 LA41X382C10182C10382C10582C565 ISATamarack TC9021 GigETamarack TC9021 GigE (alt ID)DC-290(M)DC-690CDC-3x5UTerratec TV+Terratec TValueTerratec TValue RadioTLAN3DLabs Permedia3DLabs Permedia 2TSB12LV21 FireWireTSB12LV22 FireWirePCI4450 FireWirePCI4410 FireWireTSB12LV23 FireWireTSB12LV26 FireWireTSB43AA22 FireWireTSB43AB22 FireWireTSB43AB23 FireWireTSB43AB21 FireWirePCI4451 FireWirePCI4510 FireWirePCI4520 FireWirePCI7(4-6)10 FireWireDWL-520+PCI1130 CardBusPCI1031 PCMCIAPCI1131 CardBusPCI1250 CardBusPCI1220 CardBusPCI1221 CardBusPCI1210 CardBusPCI1450 CardBusPCI1225 CardBusPCI1251 CardBusPCI1211 CardBusPCI1251B CardBusPCI2030 PCI-PCIPCI2031 PCI-PCIPCI4450 CardBusPCI4410 CardBusPCI4451 CardBusPCI4510 CardBusPCI4520 CardBusPCI7510 CardBusPCI7610 CardBusPCI7410 CardBusPCI7610 CardBus (Smart Card mode)PCI7[46]10 CardBus (SD/MMC mode)PCI7[46]10 CardBus (Memory stick mode)PCI1410 CardBusPCI1420 CardBusPCI1451 CardBusPCI1421 CardBusPCI1620 CardBusPCI1520 CardBusPCI1510 CardBusPCI1530 CardBusPCI1515 CardBusPCI2040 DSPPCI interface5634PCV SurfRiderR4x00TC35856F ATM (Meteor)R4x00 PCIToPIC95 CardBus-PCIToPIC95B CardBusToPIC97 CardBusToPIC100 CardBusFast Infrared Type OSD ControllerVirtual NorthbridgeMem1Mem24DWAVE DX4DWAVE NXCyberBlade i7CyberBlade i7 AGPCyberBlade i1CyberBlade i1 AGPCyberBlade Ai1CyberBlade Ai1 AGPCyberBlade XP/Ai1TGUI 9320TGUI 9350TGUI 9360TGUI 9388CYBER 9397CYBER 9397DVDTGUI 9420TGUI 9440CYBER 9525TGUI 9660TGUI 9680TGUI 96823DImage 97503DImage 9850Blade 3DCyberBlade XPHPT343/345 IDEHPT36x/37x IDEHPT372A IDEHPT302 IDEHPT371 IDEHPT374 IDEPyramid3D TR25202ET4000w32p rev AET4000w32p rev BET4000w32p rev CET4000w32p rev DET6000/ET6100ET6300UM82C881 486UM82C886 ISAUM8673F EIDEUM8881 HB4 486 PCIUM82C891UM886AUM8886BFUM8710UM8886UM8881F HostUM8886F ISAUM8886AUM8891AUM9017FUM8886NUM8891NUS2013CP5610V961PBC i960 PCIV292PBC AMD290x0 PCIV960PBC i960 PCIV96DPC i960 (Dual) PCIVT8363 HostVT8371 HostVT8501VT82C505VT82C561VT82C571 IDEVT82C576 3VVT82C585 ISAVT82C586 ISAVT82C595 PCIVT82C596A ISAVT82C597 PCIVT82C598 PCIVT8601 PCIVT8605 PCIVT82C686 ISAVT82C691 PCIVT82C693 PCIVT86C926 AmazonVT82C570M PCIVT82C570M ISAVT82C416 IDEVT82C1595 PCIVT83C572 USBVT82C586 Power MgmtRhine/RhineIIVT6306 FireWireVT82C596 Power MgmtVT6105M RhineIIIVT82C686 SMBusVT82C686 AC97VT8233 AC97RhineII-2VT82C686 ModemVT8366 ISAVT8366 PCIVT6202 USB 2.0VT6105 RhineIIIVT8375 PCICLE266VT8623 PCIVT8233 ISAVT8751 PCIVT8237 SATAVT8235 ISAK8HTB HostVT8377 PCIVT8237 ISAVT8231 ISAVT8231 PMGVT8363 AGPVT8371 PCI-PCIVT8501 AGPVT82C601 AGPVT82C597 AGPVT82C598 AGPVT8605 AGPVT8633 AGPVT8366 AGPVT8235 AGPK8HTB AGPVT8377 AGPGDT6000/6020/6050GDT6000B/6010GDT6110/6510GDT6120/6520GDT6530GDT6550GDT6x17GDT6x27GDT6537GDT6557GDT6x15GDT6x25GDT6535GDT6555GDT6x17RPGDT6x27RPGDT6537RPGDT6557RPGDT6x11RPGDT6x21RPGDT6x17RP1GDT6x27RP1GDT6537RP1GDT6557RP1GDT6x11RP1GDT6x21RP1GDT6x18RDGDT6x28RDGDT6x38RDGDT6x58RDGDT6x17RP2GDT6x27RP2GDT6537RP2GDT6557RP2GDT6x11RP2GDT6x21RP2GDT6513RSGDT6523RSGDT6518RSGDT6x28RSGDT6x38RSGDT6x58RSGDT6x33RSGDT6x43RSGDT6x53RSGDT6x63RSGDT7x13RNGDT7x23RNGDT7x18RNGDT7x28RNGDT7x38RNGDT7x58RNGDT7x43RNGDT7x53RNGDT7x63RNGDT4x13RZGDT4x23RZGDT8x13RZGDT8x23RZGDT8x33RZGDT8x43RZGDT8x53RZGDT8x63RZGDT6x19RDGDT6x29RDGDT7x19RNGDT7x29RNGDT8x22RZICP82C592 CPU82C593 ISA82C594 Wildcat82C596/597 Wildcat ISA82C54182C54382C53282C53482C53582C14782C97582C925Virtual SVGAVirtual SVGA IIP9000P9100WD33C193AWD33C196AWD33C197AWD7193WD7197WD33C296AWD34C296WD9610W83769FW89C840F 10/100Linksys EtherPCI IIW83C553F ISAW83C553FW89C940FW6692 ISDNLinksys EtherPCIX3201-3X3201-3 (21143)724734738737740740C724F7447541221PCI-ST32DVDMartin-MariettaHauppauge Computer WorksDynalinkCompaqSymbios LogicATIULSI SystemsVLSIAvance LogicNSTseng LabsWeitekDECCirrus LogicWestern DigitalAMIAMDTridentAcerDellSiemens Nixdorf AGMatroxChips and TechnologiesToshibaNECFuture DomainSISHewlett-PackardPC TechnologyAsustekDPTOptiElsaSGS ThomsonBusLogicTexas InstrumentsSonyOak TechnologyWinbondMotorolaPromiseNumber 9UMCI. T. T.PicopowerMylexAppleYamahaNexGen MicrosystemsQLogicCyrixLeadTek ResearchInterphaseContaq MicrosystemsBit3OlicomSunIntergraphDiamond MultimediaCMD TechnologyQuantum DesignsBrooktreeSilicon GraphicsACC MicroelectronicsSymphony LabsSTB SystemsPLXMadge Networks3ComSMCAcer LabsMitsubishi ElectronicsSurecomNeomagicMentor ARCAdvansysMolexMacronixEvans & SutherlandNvidiaEmulexIntegrated Micro SolutionsTekram (1st ID)NewbridgeApplied Micro CircuitsRealtekNKKInitioCreative LabsHighPointSigma DesignsVIACogent DataSiemensAcctonVortexEfficent NetworksIDTFORE SystemsZiatechCycloneAlliance SemiconductorSchneider & KochMutechXircomServerWorksRicohD-Link SystemsCorrollaryAcardZeinetOmega MicroMarvellLite-OnV3 SemiconductorPinnacle SystemsAT&T/LucentDolphinMesa Ridge (MAGMA)IREZoranPijnenburgCompexCycladesEssential CommunicationsO2 Micro3DFX InteractiveAdvanced Telecommunications ModulesC-CubeAVMASIXIntersilNortel NetworksSilicon MotionEnsoniqTransmetaRockwellDavicomITExpressPlatformLuxSonorTriTech MicroelectronicsAlteonUS RoboticsNVidia/SGS-ThomsonAurealADMtekPacket EnginesForte MediaSIIGDTC TechPCTELLAN Media CorpNetgearMoxaLevel 1Hifn3wareSundanceC-Media ElectronicsLavaSunixOxfordTamarack MicroelectronicsAskeyAvermediaAironetAvlabInvertexBroadcomConexantMyson CenturyTopic/SmartLinkENETerraTec Electronic GmbhSymbolSybaBluesteel NetworksVMwareNational Datacomm CorpEumitcomNetSecGlobal SunSafeNetLinksysNetoctaveAltimaAntares MicrosystemsCaviumLanergyRalinkTekramHint3D LabsAddtronIndustrial Computer SourceNetVinGemtekS3c't MagazinIntelAdaptecAtronicsNetMosTigerJet NetworkEndaceARC LogicINVALID VENDOR ID"%s %s"unknown class 0x%02x, subclass 0x%02xclass %s subclass %sclass %s unknown subclass 0x%02x, rev 0x%02x) rev 0x%02xvendor "%s", unknown product 0x%x%svendor 0x%04x product 0x%04xunknown cy82c693_init: bus_space_map failed (%d)cy82c693_initcy82c693_readcy82c693_write%s: External SRAM, %s access%s, %dbytes/SCB : unable to map registers %s: couldn't map interrupt %s: Using left over BIOS settings : couldn't establish interrupt%s: Enabling 39Bit Addressing %s: unable to allocate bus-specific data fast, parity checking enabledslow%s: PCI error Interrupt at seqaddr = 0x%x %s: Latched PCIERR interrupt with no status bits set %s: Data Parity Error has been reported via PERR# %s: Signaled a Target Abort %s: Received a Target Abort %s: Received a Master Abort %s: Signal System Error Detected %s: Data Parity Error Detected during address or write data phase RAID functionality unsupported adapter at unexpected slot %d unable to map to a channel %s: unable to map device registers %s: couldn't map interrupt %s: couldn't establish interruptadv_pci_attach: adv_init failedAscInitFromEEPAscIsrQDone: completed scsiq with unknown statusAscIsrQDone: Attempting to free more queues than are activeAscIsrQDone: Corrupted SG list encounteredAscExeScsiQueue: Queue with QC_SG_HEAD set but %d segs.AscExeScsiQueue: Queue with too many segs.AscResetDeviceQUANTUM XP343011071NEC YAMAHACDR400CD-ROM DRIVE TDC 36HP %s%d: %s%s pass %d.%d%s address %s 21040 [10Mb/s]21041 [10Mb/s]21140 [10-100Mb/s]21140A [10-100Mb/s]21142 [10-100Mb/s]21143 [10-100Mb/s]82C168 [10-100Mb/s]Full Duplex 10baseTAUIExternal SIAAUI/BNCFull Duplex 100baseTX100baseT4Full Duplex 100baseFXparity errormaster aborttarget abortreserved #3reserved #4reserved #5reserved #6reserved #7transmit process stoppedtransmit jabber timeouttransmit underflowreceive underflowreceive process stoppedreceive watchdog timeoutlink failure%s%d: enabling %s port %s%d: link up %s%d(phy%d): error: reset of PHY never completed! DEC DE500DE450ZNYX ZX3XX SMC 9332DST 9334BDT 9332BDT 8432Cogent EM100TX EM440TX EM100FX ACCTON EN1207 EN1203 EN1207TX Asante %s%d: can't find phy 0 tulip_read_macaddrframe too longalignment errorbad crc%s%d: receive: %s: %s %s%d: abnormal interrupt:tulip_print_abnormal_interrupt (switching to store-and-forward mode) (raising TX threshold to %s)%s%d: system error: %s tulip_txput: compress called twice! tulip_txput: different mbuf dequeued!tulip_if_start: txput failed! tulip_if_start_one: txput failed! %s%d: transmission timeout %s%d: %d system errors: last was %s (invalid EESPROM checksum): not configured; limit of %d reached or exceeded de%d: not configured; 21140 pass 1.1 required (%d.%d found) , couldn't map interrupt , couldn't establish interrupt: %s%s: warning: couldn't establish shutdown hook : can't read ENET ROM (why=%d) (%s%d: %s%s pass %d.%d address unknown: unable to map device registers : not configured; 21040 pass 2.0 required (%d.%d found) : broken match/attach! : couldn't map interrupt , using %dK of on-board RAM, can't map on-board RAMpciide %s: device disabled %s: couldn't map %s cmd regs %s: couldn't map %s ctl regs %s: couldn't map native-PCI interrupt unknown interrupt%s: using %s for native-PCI interrupt %s: unable to subregion %s ctl regs %s: couldn't establish native-PCI interrupt, (unsupported maptype 0x%x), unused (couldn't query registers), unused (registers at unsafe address %#lx), unused (couldn't map registers)%s:%d: unable to allocate table DMA for drive %d, error=%d %s:%d: unable to map table DMA fordrive %d, error=%d %s:%d: unable to create table DMA map for drive %d, error=%d %s:%d: unable to load table DMA map for drive %d, error=%d %s:%d: unable to create xfer DMA map for drive %d, error=%d %s:%d: unable to load xfer DMA map fordrive %d, error=%d %s:%d:%d: bus-master DMA error: missing interrupt, status=0x%x %s:%d:%d: bus-master DMA error: status=0x%x channel 0channel 1%s: %s cannot allocate memory for command queue%s: %s disabled (no drives) %s: no compatibility interrupt for use by %s configuredwiredcompatibilitynative-PCI, %s %s to %s: DMA%s:%d:%d: cannot allocate DMA maps, using PIO transfers %s:%d:%d: using DMA data transfers not responding; disabled or no drives?other hardware responding at addresses%s: %s ignored (%s) , (partial support) (unsupported): no DMA%s: %s ignored (disabled) %s:%d:%d: multi-word DMA disabled due to chip revision : ATA33: ATA66: ATA100: ATA133 %s: bus-master DMA support present%s: %s %s to %s mode %s %s: can't allocate memory for command queue: unexpected PCI function %d , %s %s to native-PCI compatibility : cannot allocate memory for command queue , (unable to map ctl registers)540620630630S633635645645DX651652655658730733735741745746748750751752755962963: 5597/5598unknown SiS IDE type %d %s:%d: error intr %s:%d: bogus intr %s: unexpected PCI function %d %s: no known timing values %s:%d: bogus intr (reg 0x%x) ppb%s: not configured by system firmware pci at %svr%s: Using force reset command. : failed to enable I/O ports : failed to find i/o space : failed map i/o space %s: can't load dma map %s: can't create dma map %s: can't map dma buffers (%d bytes) %s: can't alloc list : could not establish interrupt%s: rx error (%02x): rx buffer error system bus error received runt packet received giant packet FIFO overflow frame alignment error crc error%s: rx shutdown error! %s: tx shutdown timeout %s: restarting %s: receive error (%04x) packet lost overflow no buffers%s: rx packet lost %s: initialization failed: no memory for tx buffers : can't map i/o space %s: chip is in D%d power mode -- setting to D0 %s: Allocation of PCI resources failed %s: Unable to initialize the hardware %s: EEPROM read error while reading mac address %s: Invalid mac address , address: %s %s: Unable to allocate rx_desc memory %s: Unable to allocate tx_desc memory %s: watchdog timeout -- resetting %s: Could not setup transmit structures %s: Could not setup receive structures %s: Unsupported media type em_set_multiFull DuplexHalf Duplex%s: Link is up %d Mbps %s %s: Link is Down %s: Memory Access and/or Bus Master bits were not set! %s: Unknown MAC Type : mmba isn't memory: can't find io space : can't find mem space %s: The EEPROM Checksum Is Not Valid %s: Hardware Initialization Failed%s: EEPROM read error while reading part number %s: em_dma_malloc: bus_dmamap_load failed; error %u %s: em_dma_malloc: bus_dmammem_map failed; size %lu, error %d %s: em_dma_malloc: bus_dmammem_alloc failed; size %lu, error %d %s: em_dma_malloc: bus_dmamap_create failed; error %u %s: Unable to allocate tx_buffer memory %s: em_allocate_receive_structures: bus_dmamap_create failed; error %u %s: Unable to allocate rx_buffer memory %s: Adapter hardware address = %p %s:tx_int_delay = %d, tx_abs_int_delay = %d %s:rx_int_delay = %d, rx_abs_int_delay = %d %s: fifo workaround = %lld, fifo_reset = %lld %s: hw tdh = %d, hw tdt = %d %s: Num Tx descriptors avail = %d %s: Tx Descriptors not avail1 = %ld %s: Tx Descriptors not avail2 = %ld %s: Std mbuf failed = %ld %s: Std mbuf cluster failed = %ld %s: Driver dropped packets = %ld %s: Excessive collisions = %lld %s: Symbol errors = %lld %s: Sequence errors = %lld %s: Defer count = %lld %s: Missed Packets = %lld %s: Receive No Buffers = %lld %s: Receive length errors = %lld %s: Receive errors = %lld %s: Crc errors = %lld %s: Alignment errors = %lld %s: Carrier extension errors = %lld %s: XON Rcvd = %lld %s: XON Xmtd = %lld %s: XOFF Rcvd = %lld %s: XOFF Xmtd = %lld %s: Good Packets Rcvd = %lld %s: Good Packets Xmtd = %lld : can't find I/O space : can't map I/O space : %s,: unknown device: %x:%x dc_pci_attach: can't find I/O base : can't subregion i/o space ne_pci_attach: impossible: can't map mem space %s: init failed, error=%d vendor 0x%04x%s: unable to map registers pcscp%s: can't create dma maps %s: unable to allocate memory for the MDL, error = %d %s: unable to map the MDL memory, error = %d %s: unable to map_create for the MDL, error = %d %s: unable to load for the MDL, error = %d dmaintr: discarded %d bytes (tcl=%d, tcm=%d) dmaintr: tcl=%d, tcm=%d, tch=%d; trans=%d, resid=%d pcscp_dma_intr: empty esp FIFO of %d %s: dma_intr: DMA aborted. %s: error: DMA error detected; Aborting. pcscp dmaintr: DMA wasn't active%s: unable to load dmamap, error = %d pcib%s: %s (rev. 0x%02x) pcibattachisa at %s%s: %s channel interrupting at irq %d pre 1.0usb: USB revision %s, not supported usb_attach%s: root device is not a hub %s: root hub problem, error=%d usbtaskunable to create task thread usb_create_event_thread task%s: unable to create event thread for usb_create_event_threadusbevtusbtskusb at %susbreausbreadusbd_add_dev_eventusbd_add_drv_eventusb_add_eventusb_detachusbdet%s: event thread didn't die usbsynusbd_transfer: not doneusbd_start_next: error=%d usb_detach_wait: %s didn't detach HomeConnectBluetooth3C19250 EthernetHomeConnect 3C460U.S.Robotics 56000HomeConnect 3C460BU.S. Robotics3Com OfficeConnect Analog Modem3Com U.S. Robotics Pro ISDN TA3Com HomeConnectAboCom SystemsXX1XX2URE450 EthernetUFE1000 Fast Ethernet1/10/100 ethernetXX4XX5XX6XX7XX8XX9XX10Accton TechnologyUSB320-EC EthernetSpeedStream EthernetWarplinkAcer PeripheralsAcerscan C310UAcerscan 320UAcerscan 640UAcerscan 620UATA/ATAPIActiontec ElectronicsPrism2.5 WLANPrism2.5 WLAN AACTiSYSACT-IR2000U FIRActiveWireI/O BoardI/O Board, rev. 1Addonics TechnologyAN986 EthernetAN8511 EthernetAN8513 EthernetADS TechnologiesUBS-10BT EthernetAgate TechnologiesQ-DriveAGFA-GevaertSnapScan 1212USnapScan 1236USnapScan TouchSnapScan e40SnapScan e50SnapScan e20SnapScan e25SnapScan e26SnapScan e52Aladdin Knowledge SystemsUSB-HASP 0.06Alcor MicroMacAlly Kbd HubAU9814 HubMicroConnectors/StrongManNEC Kbd HubAltec LansingADA70 SpeakersASC495 SpeakersAmerican Power ConversionBack-UPS Pro 500Anchor ChipsEZUSBEZLINKAOXApple ComputerOptical mouseSpeakersAsahi OpticalPENTAX Optio230AsanteASIX ElectronicsUSB 2.0 10/100 ethernet controllerATEN International10Mbps EthernetDSB-650CUSB Cable 205AtmelUHB124 hubDWL-900AP Wireless access pointDWL-120 WirelessAudio-TechnicaATC-HA4USB USB headphoneUSB Audio SpeakerAvision1200UBelkin ComponentsF5U002 ParallelF5U103 SerialF5U109 SerialUSB to LAN ConverterF5U120-PC HubBillionton SystemsUSB100N 10/100 EthernetUSB100LPUSB100ELUSBE100BCM2033BCM2033 (no fw)Brother IndustriesHL-1050 laser printerBehavior Tech. ComputerKeyboard/MouseCANOSCAN N656UCANOSCAN N670UPowerShot S10PowerShot S20PowerShot S100PowerShot G1PowerShot A20Computer Access TechnologyNetmate EthernetNetmate2 EthernetUSB Chief Bus & Protocol AnalyzerAndromeda hubCASIOQVBE-300 PDACASIO Nameland EZ-USBCCYU TechnologyEasyDisk PortableCherry MikroschalterMy3000 keyboardMy3000 hubChic TechnologyCypressChicony ElectronicsKB-8933 keyboardCH ProductsPro ThrottlePro PedalsFighterstickFlight Sim YokeiPAQ PocketPCA1500W100WLAN MultiPort W200Personal Jukebox PJB100Concord CameraEye Q 3xConnectixQuickCamCoregaEther USB-TFEther USB-TXWirelessLAN USB-11FEther USB-TXSWireless LAN Stick-11Nomad IINomad II MGVoip BlasterCambridge Silicon RadioChuntexEx1300 hubCypress SemiconductorthermometerKeyboard/HubFM RadioUSB2 HubDaisy TechnologyPhotoClipDallas SemiconductorJ-6502 speakersUSB-FOB/iBUTTONDiamondRio 500Digi InternationalAccelePort 2AccelePort 4AccelePort 8Digital StreamPS/2 ActiveD-Link10/100 ethernetWireless DWL12210Mbps ethernetDMIStorage AdapterEasyDiskFlash DiskEIZOhubElecom29UOLD-USB/TXLD-USBL/TXUC-SGT SerialELSAMicrolink USB2EthernetEntrega1S serial2S serial1S25 serial4S serialE45 EthernetCentronics1S9 serialEZ-USB2U4S serialSeiko EpsonUSB PrinterISD Smart Cable for MacISD Smart CablePerfection 636U / 636PhotoPerfection 610Perfection 1200U / 1200PhotoExpression 1600Perfection 1640SUPerfection 1240U / 1240PhotoPerfection 640UPerfection 1650GT-9700FPerfection 2400Perfection 1260Perfection 1660e-TEK LabsExtended SystemsXTNDAccess IrDAFreecomConnector for DVD driveFuture Technology Devices8U232AM Serial converterPS/2 Keyboard/MouseMatrix Orbital MX200 Series LCDMatrix Orbital LK202-24 LCDMatrix Orbital LK204-24 LCDCrystalfontz CFA-631 LCDCrystalfontz CFA-632 LCDCrystalfontz CFA-633 LCDCrystalfontz CFA-634 LCDSEMC DSS-20 SyncStationFuji Photo FilmMass StorageFujitsuAH-F401U Air H deviceGenesys LogicGeneLink Host-Host BridgeGL650 HubGL641USB CompactFlashGoHubsGoCOM232 Serial converterAdvanced Gravis ComputerGamePad ProGREENHOUSECF-writer/MP3 PlayerGH-USB100B EthernetGriffin TechnologyiMate, ADB adapterGuillemotDA LeaderHagiwara Sys-ComFlashGate SmartMediaFlashGate CompactFlashFlashGateHandspringHandspring VisorHandspring TreoHandspring Treo 600WinTV FMHawkingHitachiDVD-CAM DZ-MV100A CamcorderHewlett PackardDeskJet 895CScanjet 4100CPhotosmart S20DeskJet 880CScanJet 4200CCD-Writer PlusMultimedia Keyboard HubScanJet 6200CPhotoSmart S20DeskJet 815CScanJet 3300CCD-Writer Plus 8200eDeskJet 1220CDeskJet 810C/812CScanjet 4300CCD-Writer+ CD-4eOfficeJet G85xiLaserJet 1200Scanjet 5200CDeskJet 830CScanJet 3400cseScanjet 6300CDeskJet 840cScanJet 2200CScanjet 5300CDeskjet 970CseScanjet 5400CDeskJet 930cInkjet P-2000UDeskJet 640cPhotosmart P1100HN210E EthernetPhotoSmart C500OpticalCD-ROMIiyamaImationFlash Go!Inside Out NetworksEdgePort/4 RS232Hubport/7Rapidport/4Edgeport/4 RS232Edgeport/2 RS232Edgeport/4 RS422Edgeport/2 RS422/RS485Hubport/4Hand-built Edgeport/8MultiTech version of RP/4Edgeport/(4)21 ParallelEdgeport/421 Hub+RS232+ParallelEdgeport/21 RS232+Parallel1/2 Edgeport/8Edgeport/2 RS232/DINEdgeport/4 RS232/DIN1/2 Edgeport/16Edgeport CompatibleEdgeport/8 RS422OEM deviceIn-System DesignUSB2 StorageIDE ISD110IDE ISD105Portable USB Harddrive V2USB cableUSB Storage Adapter V2EasyPCWireless 2011B82930 test boardPrism2.x WLANValueCANNeoVI BlueI/O DataUSB-SSMRW SD-cardUSB-SDRW SD-cardUSB ETTUSB ETTXUSB Airport WN-B11RSAQ1 SerialI-O DataUSB2.0-SCSI Bridge USB2-SCIomegaZip 100Zip 250CDRW 9602iRiveriFP-1xxiFP-3xxiFP-5xxJatonJenoptikJD 350Japan Radio CompanyAirH"PHONE AH-J3001V/J3002VJVCMP-XP7250 Builtin WLANKawasaki LSIKawatsu SemiconductorMiniHub 4000PKC-180 IrDAKeisokugikenHKS-0200 USBDAQKensingtonOrbit trackballTurboBallOrbit trackball for MacVideoCAM VGAKeyspanUSA-28 serialUSA-28X serialUSA-19 serialUSA-18 serialUSA-18X serialUSA-19W serialUSA-49W serialUSA-19QI serialUSA-19Q serialUSA-28X/XB serialUSA-28XB serialUSA-28XA serialUSA-18XA serialUSA-19WQ serialUIA-10 remote controlUIA-11 remote controlKingston TechnologyKNU101TX EthernetEastman KodakDigital Science DC220Digital Science DC260Digital Science DC265Digital Science DC290Digital Science DC240Digital Science DC280EasyShare DX4900KonicaKYE SystemsNiche mouseGenius NetScroll mouseFlight 2000 joystickColorPage Vivid-ProKyoceraAH-K3001VLaCieHard DiskCD R/WLexar MediajumpSHOT CompactFlashLexmark InternationalOptra S 2450Camedia MAUSB-2USB10TXUSB10T EthernetUSB100TX EthernetUSB100H1 Ethernet/HPNAUSB10TA EthernetWUSB11 802.11bWUSB11 802.11b v2.5WUSB12 802.11b v1.1LogitechM2452 keyboardM4848 mousePageScanQuickCam WebQuickCam ProQuickCam ExpressQuickCam Pro 3000N43N48 mouseM-BA47 mouseWingMan Gaming MouseBD58 mouseiFeel MouseWingMan GamePad ExtremeWingMan RumblePadWingMan Force joystickWingMan Formula Force GP (GT-Force)iTouch KeyboardUSB-PS/2 TrackballTrackMan WheelCordless mouseCordless keyboardCordless Desktop OpticalLucentUSS-720 evaluation kitMacallyMCTD-Link DU-H3SP BAY HubRS232 InterfaceSitecom RS232ML-4500MelcoLUA-TX EthernetLUA2-TX EthernetLUA-KTX EthernetWLI-USB-S11MCR-SM2 SmartMediaUSB-IDE Bridge: DUB-PxxGWLI-USB-KS11G wlanLUA-U2-KTX EthernetMetricomRicochet GSMicro Star InternationalMicrosoftSideWinder Precision ProIntelliMouseNaturalDigital Sound System 80Sidewinder Precision Racing WheelTrackball ExplorerIntelliEye mouseInternet Keyboard ProMN510 WirelessMicrotechSCSI-DB25SCSI-HD50CameraMateFreecom IDEMicrotekPhantom 336CX - C3ScanMaker X6 - X6UPhantom C6ScanMaker V6USLScanMaker V6ULMidimanMidisport 2x2Minds At WorkDigital WalletMinoltaDimage S304Dimage XDimage 7iDimage A1MitsumiCD-R/RW DriveMouseFDDMobilityMC141555 hub controllerSB4100 Cable ModemMultiTechMT5634ZBA modemMustek Systems1200 CU600 CU1200 UB1200 Plus1200 CU PlusBearPaw 1200FMDC-800DV2000M-SystemsDiskOnKeyNational InstrumentsGPIB-USB-ANational SemiconductorBearPaw 1200BearPaw 2400USB2.0 HubNeodio6-in-1 Flash Device ControllerMulti-format Flash ControllerNetChip TechnologyTurbo-ConnectClik! 40BayNETGEARUSB 2.0 Fast Ethernet802.11bNikonE990E880E885NHJOlympusC-1C-700 Ultra ZoomOmniVisionOV511OV511+OnSpecMDCFE-B CFMemory Stick+CFDatafab-basedPNY/Datafab CF+SMSimple Tech/Datafab CF+SMCF + SM Combo (LC1)Datafab MD1-II PC-Card8In2Ours Technology Inc.Solid state diskPalm ComputingUSB Serial AdaptorPalm m500Palm m505Palm m515Palm i705Palm Tungsten ZPalm m125Palm m130Palm Tungsten TPalm ZirePanasonic (Matsushita)LS-120MultiMediaCardPen Drive6 in 13 in 1Peracom NetworksSerial ConverterAt-Home EthernetPhilipsDSS 350 Digital Speaker SystemDSS XXX Digital Speaker SystemPCA645VCPCA646VCPCVC675K VestaPCVC680K Vesta ProPCVC690K Vesta Pro Scan CameraPCVC730K ToUCam FunPCVC740K ToUCam Pro PCPCVC750K ToUCam Pro ScanDSS 150 Digital Speaker SystemDIVA mp3 playerPhilips SemiconductorsP.I. EngineeringPS2 to MacXkeys Programmable KeyboardPilotechCRW-600 6-in-1PlantronicsPlatronics DSP-400 Headsettest boardPortGearPortsmithExpress EthernetPQITravel Flash DrivePrimax ElectronicsG2-200G2E-300G2-300Colorado 9600Colorado 600uVisioneer 6200Colorado 19200Colorado 1200uG2-600ReadyScan 636iG2E-600ComfortMouse-in-a-BoxSony PCGA-UMS1Prolific TechnologyPL2301 Host-Host interfacePL2302 Host-Host interfacePL2303 SerialParallel printerATAPI-4 Bridge ControllerPL2501 Host-Host interfacePutercomUSB-1284 BRIDGEQtronixScorpion-980NQuickshotUSB StrikePadRainbow Technologiesi-Key 2000RATOC SystemsUSB serial REX-USB60RolandUA-100 Audio I/FUM-4 MIDI I/FSC-8850 MIDI SynthU-8 Audio I/FUM-2 MIDI I/FSC-8820 MIDI SynthPC-300 MIDI KeyboardUM-1 MIDI I/FSK-500 MIDI KeyboardSC-D70 MIDI SynthUM-880 MIDI I/FSD-90 MIDI SynthUM-550 MIDI I/FSD-20 MIDI SynthSD-80 MIDI SynthUA-700 Audio I/FRockfiregamepad 203USBSaitekCyborg 3D Gold JoystickSanDiskImageMate SDDR-05aImageMate SDDR-31ImageMate SDDR-05ImageMate SDDR-12ImageMate SDDR-09ImageMate SDDR-75Sanwa SupplyJY-DV9USB gamepadSanyo ElectricSanyo SCP-4900 PhoneScanLogicSL11R-IDERoot HubSN1 L1 System ControllerSharkPocket AdapterSharpSL5500A300SL5600C700C750Shuttle TechnologyE-USB BridgeeUSCSI BridgeImageMate SDDR09eUSB SmartMedia / CompactFlasheUSB MultiMediaCardSony HifdeUSB ATA/ATAPIeUSB CompactFlashCD-RW DeviceSCM MicroSpeedStreamSpeedStream 1022SigmatelDatum Networks SSF-7X Multi PlayersDigiFilm-ComboMULTICARDREADERSilicon PortalsYAP Phone (no firmware)YAP PhoneSirius TechnologiesNetComm Roadster II 56SitecomCN104SmartBridgesSmartLink EthernetsmartNIC 2 PnPStandard MicrosystemsEZ Connect EthernetSOHOwareSolid YearSony DSC CamerasMemorystick NW-MS7Harddrive V2Memorystick MSAC-US1HandycamSony MSC Memorystick SlotClie v3.5PlayStation2 keyboardPlayStation2 keyboard hubPlayStatoin2 mouseClie v4.0Clie v4.0 Memory Stick slotSony Clie s360Clie v4.1 Memory Stick slotClie v4.1Sony Clie nx60Sony Clie tj25STMicroelectronicsCommunicatorSTSNInternet Access DeviceSun Communications, Inc.Mobile AdaptorSUN CorporationU-Cable type D2U-Cable type P1Slipper UIr-TrinityU-Cable type A3U-Cable type A4Sun MicrosystemsType 6System TalksSGC-X2ULDiamond (Supra)Supra Express 56KSupraMax 2890 56KRio 600Rio 800Nike psa[play 120SusteenEricsson DCU-10/11TangtopUSBPS2Taugagreining HFCameraMate (DPCM_USB)TDKUSB-PDC Adapter UPA9664USB-cdmaOne Adapter UCA1464USB-PHS Adapter UHA6400USB-PHS Adapter UPA6400TEACFD-05PUBTelex CommunicationsMicrophoneUT-USB41 hubTUSB2046 hubNex II DigitalThrustmasterFusion Digital GamepadTodos Data SystemArgos Mini SmartcardTrek TechnologyThumbDriveThumbDrive 8MBTrumpion MicroelectronicsUSB/MP3 decoderXXX 1100TsunamiSM-2000Ultima1200 UB PlusUMAX Data SystemsAstra 1236UAstra 1220UAstra 2000UAstra 2100UAstra 2200UAstra 3400Universal AccessPanache Surf ISDNViewSonicG773 Monitor HubP815 Monitor HubG773 Monitor ControlVLSI VisionCPiA CameraVisioneerOneTouch 7600OneTouch 5300Scanport 3000OneTouch 6100OneTouch 6200OneTouch 8100OneTouch 8600VivitarDSC350WACOMCT-0405-U TabletGraphireIntuos A5XirlinkImaging DeviceIBM PC CameraY-E DataFlashbuster-UUX256 MIDI I/FUX96 MIDI I/FRP-U200YanoU640MO-03Zoom Telephonics2986L Fax ModemZyXEL CommunicationOmni 56K PlusADI SystemsAdvanced Micro DevicesNANAOAlps ElectricAnalog DevicesAMPAmerican MegatrendsMethode Electronics Far EastMaxi SwitchLockheed Martin Energy ResearchToshiba AmericaMicro Macro TechnologiesLite-On TechnologyTatung Co. Of AmericaMyson TechnologyDigiITT CanonAnnabooksAztech SystemsAdvanced Connectek USAALTRAATI TechnologiesAsahi Kasei MicrosystemsBAFO/Quality Computer AccessoriesA-Trend TechnologyAdvanced Input DevicesBrainboxes LimitedAxiohm Transaction SolutionsSymbol TechnologiesFuji ElectricKeithley InstrumentsEIZO NanaoFFCAnko ElectronicAOC InternationalBarco Display SystemsBridge InformationBio-Rad LaboratoriesAct LabsAlarisApexAcer Semiconductor AmericaAiwaACARD TechnologyAskey ComputerAlcatel TelecomAsia Microelectronic DevelopmentBizlink InternationalAashima TechnologyAlcatel MicroelectronicsBoston AcousticsAureal SemiconductorBrimaxAxis CommunicationsABL ElectronicsAlfadata ComputerNational Technical SystemsOnntoBeAPG Cash DrawerB.U.G.Allied Telesyn InternationalAVerMedia TechnologiesAptio ProductsArasan Chip SystemsAllied CableBroadLogicAction Star EnterpriseADESSO/Kbtek AmericaAPT TechnologiesBoca ResearchAndrea ElectronicsBurr-Brown Japan2WireAIPTEK InternationalAuthenTecAlation SystemsAmerican Biometric CompanyBlueWater SystemsAgilent TechnologiesAdirondack Wire & CableBeckhoffAltius SolutionsArris InteractiveACTIVCARDA-FOUR TECHAIMEXAddonics TechnologiesAKAI professional M.I.ARESCOMBay AssociatesAlteraBoca SystemsGeocast Network SystemsKurusugawa Electronics, Inc.Acer Communications & MultimediaNORMAL_COMPLETIONIN_PROGRESSPENDING_REQUESTSNOT_STARTEDINVALNOMEMCANCELLEDBAD_ADDRESSIN_USENO_ADDRSET_ADDR_FAILEDNO_POWERTOO_DEEPIOERRORNOT_CONFIGUREDTIMEOUTSHORT_XFERSTALLEDINTERRUPTEDXXX%x.%02x, class %d/%d, rev , addr %dusbd_devinfousbdly0 lengthout of datausbd_fill_iface_data: bad descriptor(s): %s iface descusbd_set_config_index%s: device addr %d (config %d) exceeds power budget, %d mA > %d mA %s: port %d, set config at addr %d failed %s: No free USB addresses, new device ignored. usbd_print%s, %s configuration %d interface %d port %d%s: at %s (addr %d) disconnected %s: %d port%s with %d removable, %s powered %s: bus powered hub connected to bus powered hub, ignored %s: no interface handle %s: no endpoint descriptor %s: bad interrupt endpoint %s: cannot open interrupt pipe %s: port %d power on failed, %s uhub%s: hub depth (%d) exceeded, hub ignored uhub_attach%s: port %d reset failed %s: device problem, disabling port %d %s: strange, connected port %d has no power %s: illegal enable change, port %d %s: port error, giving up port %d %s: port error, restarting port %d mutefea%d-%s-%sbassmidtrebleagcdelay4 msbassboostloudnessuaudio%s: audio descriptors make no sense, error=%d %s: audio rev %d.%02x %s: %d mixer controls uaudio_attach%s: alt %d missing AS interface(s) %s: failed to get configuration descriptor ulinearmulawalawslinearslinear_leulinear_leslinear_beulinear_beuaudio_mixer_add_ctl: no memory i%duaudio_get_cluster: bad data volumemix%d-%suaudio_add_mixeruaudio_add_selector: NOT IMPLEMENTED uaudio_add_featureuaudio_add_processing_updownpro%d-modepro%d.%d-enableuaudio_add_processingext%d-enableuaudio_add_extensionuaudio_add_alt: no memory %s: ignored setting with type %d format %s: ignored setting with precision %d %s: ignored setting with format %d adaptiveasync%s: ignored %sput endpoint of type %s %s: no usable endpoint found uaudio_identify: skip desc type=0x%02x uaudio_identify: unexpected AC header uaudio_identify: bad AC desc subtype=0x%02x outputsequalizationinputsumidi %s: %s %s: out=%d, in=%d umidi_attach%s: disabled. USB MIDI I/F%s: illegal endpoint(in:%d) %s: illegal endpoint(out:%d) Fixed EndpointYamaha Specific(genuine USB-MIDI) ucom: portno %d, %sucomopucomopen%s: read start failed %s: lost %d chars ucom at %s portno %dugen%s: setting configuration index 0 failed ugen_attach%s: setting configuration %d failed ugen_do_readugenriugenrbugenwiugen_do_writeugenwbhid_start_parsedefault bType=%d Local bTag=%d Main bTag=%d Global bTag=%d BAD LENGTH %d uhidev%s: %s, iclass %d/%d %s: could not read endpoint descriptor %s: unexpected endpoint uhidev_attach%s: no report descriptor %s: no memory %s: %d report ids uhid at %s reportid %duhidev_intr: bad repid %d uhidev_set_report_asyncuhid: input=%d, output=%d, feature=%d uhidreauhid_do_readuhid_do_ioctlukbd %s: attach failed, %s %s: was console keyboard ukbd_decode This port is broken, it does not call cnpollc() before calling cngetc(). This should be fixed, but it will work anyway (for now). too many modifier keysbad modifier sizemultiple key code arrays key codes not on byte boundarytoo many key codeskey code size != 8 and Z dir.: %d button%s%s %s: mouse has no Y report ums %s: mouse has no X report %s: X report 0x%04x not supported %s: Y report 0x%04x not supported ulpt%s: setting alternate interface failed bi%s: using %s-directional mode ulpt_attachuni%s: could not find bulk out endpoint %s: couldn't get ep %d ulptopulptwrumassumass_attachCBIBulk-OnlyRBC%s: using %s over %s %s: bus attach failed %s: command protocol=0x%x not supported %s: isdata not configured %s: unable to get Max Lun: %s UFIISD-ATACBI with CCI%s: BBB bulk-%s stall clear failed, %s %s: Invalid CSW: sig 0x%08x should be 0x%08x %s: Invalid CSW: tag %d should be %d %s: Invalid CSW: status %d > %d %s: Phase Error, residue = %d %s: BBB reset failed, %s %s: BBB bulk-in clear stall failed, %s %s: BBB bulk-out clear stall failed, %s %s: transferred %d bytes instead of %d bytes%s: Unknown state %d%s: CBI bulk-in/out stall clear failed, %s %s: CBI intr-in stall clear failed, %s %s: CBI reset failed, %s %s: CBI bulk-in stall clear failed, %s %s: CBI bulk-out stall clear failed, %s %s: Get Max Lun failed: %s umass_cmd: large datalen, %d %s: Unknown status %d in umass_scsi_cburio%s: setting config no failed %s: getting interface handle failed urio_attach%s: missing endpoint uriorsuriowruvisorGenericuvisor_attach%s: no proper endpoints for port %d (%d,%d) DebuggerHotSyncRemote File System%s: init failed, %s %s: init failed, device type is neither visor nor palm %s: failed to get interface, err=%s %s: failed to set configuration, err=%s tSDDDү$]` pD$% 5u d` E ണ%  {V  % 5  Ld@pn E `h  }{z~y % 5 DÕP p%5X0 $4 t.4z{ StІЅЂЃ2tІЄЅЂtІЄЅЂtІЄЅЂpN`"ү"p#D%uu""p%D%Duu""0uN d`uN$`H`,$`w$`N^uY$D ІЄЅЂЃ2$``$p"""$``$pSxu l ):"P%"%"):" ):"P%"%" F > 2 n f ZNBҀƀԀU)ꀚڀʀ)䓣 䓣"䓣ֈ$##EN``#sX t)%TuNNThNOTHON SNt%ON4%(ONTNOOOpNt%ON4%S%TTTÔ@uT Ҝ0˜œ$ %0™ t8%S$S06 3t8-&u$4tDEhD S SӔ@uS uuTpxt uue uuV uuG TThTHTK BCeKpeJ`uuu_uҩ¬«t@tT~Dtttt  C tSD~STSߐT 5 0HxLMMELp $ 5 5 5 xLMMELp  k HeBpeCpH @A 5 5 00R`&uA@@ @A A@@07¯QTDt TQTү 7TӐD7"T`T` pp =$p $pppp$` @ c$``S$`@$!pxtt cqI` cD ctt c0I` cD cD c  c  cPt c@ c$`$`1$p[3%3OTTT/%t cD c@ c$`$` c cD cp9TTT/%$4TTT/D  cD c@ c$`$` c cD cp TTT/%$4t]DT PODFT`T P2D)T`T PD  PDD"pp v I l B ; 4 - &      BC0"ttDt"BCBFG~GFt""TTDP` Lp @@BFCG%5   X  X0 T0  Pt+I P6t+4~Pt+4~5 /"StЂЃ2StЂЃ2t¯`t(/TuүAAp@StTŒЂЃStЂЃ2St+k K;{[#cC3sS//ooOO??__''''ggggGGGG7777wwwwWWWW))))))))iiiiiiii IIIIIIII99999999yyyyyyyyYYYYYYYY!!!!!!!!!!!!!!!!aaaaaaaaaaaaaaaaAAAAAAAAAAAAAAAA1111111111111111qqqqqqqqqqqqqqqqQQQQQQQQQQQQQQQQ--------------------------------mmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmm MMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMM================================}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%eeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE55555555555555555555555555555555uuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuUUUUUUUUUUUUUUUUUUUUUUUUUUUUY@pPhone V1.0 03 )% u %uTD0D~TD"pN`"uuuGuuu&bb):uxuT"P"""):"P %" %"*"BBEЃЂptp tstth`飣D䓣䓣@)䓣T$ 3TD ȃ@VF  @~`T?0 T`T%`@䓣䓣䓣łŃłŃ瀾uyap%s: downloading firmware %s: download ezdata error: %s uyap_attach%s: firmware download complete, disconnecting. aue%s: EEPROM read timed out %s: MII read timed out %s: reset failed auemiiaue_attach%s: couldn't get endpoint descriptor %d %s: %u usb errors on intr: %s %s: %u usb errors on rx: %s %s: usb error on tx: %s %s: aue_send error=%s %s: tx list init failed %s: rx list init failed %s: open intr pipe failed: %s %s: open tx pipe failed: %s %s: open rx pipe failed: %s %s: close intr pipe failed: %s %s: abort intr pipe failed: %s %s: close tx pipe failed: %s %s: abort tx pipe failed: %s %s: close rx pipe failed: %s %s: abort rx pipe failed: %s cue%s: read MAC address failed cue_attach%s: cue_send error=%s kue%s: cold boot, downloading firmware %s: failed to load trigger segment: %s %s: failed to load fixup segment: %s %s: failed to load code segment: %s %s: warm boot, no firmware download %s: loading firmware failed kue_attach%s: could not read Ethernet descriptor %s: no memory for multicast filter buffer %s: kue_send error=%s uplupl_attach%s: upl_send error=%s no %s: data interface %d, has %sCM over data, has %sbreak %s: no data interface %s: Could not find data bulk in %s: Could not find data bulk out umodem_attach%s: status change notification available %s: could not set data multiplex mode %s: no endpoint descriptor for %d umodem%s: no CM descriptor %s: close notify pipe failed: %s %s: abort notify pipe failed: %s %s: abnormal status: %s %s: Invalid notification length! (%d) uftdiuftdi_attach%s: could not read endpoint descriptor: %s uftdi_openuplcomuplcom_attach%s: reset failed, %s %s: failed to get second interface, err=%s %s: Could not find interrupt in %s: close interrupt pipe failed: %s %s: abort interrupt pipe failed: %s umctumct_attachuscanner%s: bulk-in and/or bulk-out endpoint not found uscanner_attach%s: could not get interface descriptor, err=%d,id=%p %s: cannot open bulk-out pipe (addr %d) %s: cannot open bulk-in pipe (addr %d) uscnrbuscnwbusscanner%s: open in pipe failed, err=%d %s: open intr pipe failed, err=%d %s: open out pipe failed, err=%d %s: alloc cmd xfer failed, err=%d %s: alloc cmd buffer failed, err=%d %s: alloc intr xfer failed, err=%d %s: alloc data xfer failed, err=%d %s: alloc data buffer failed, err=%d usscanner_attachwsdisplay%s: screen %d-%d added (%s, %s emulation%s: screen %d deleted wsdisplay at %sdmux: console (%s, %s emulation), using %swsdisplay_common_attach: no memorywsdisplaytty() on ctl devicewsdisplay_switch3: giving up wsdisplay_switch3: screen %d disappeared wsdisplay_switch3: not switching wsdisplay_switch3: invalid screen %dwsdisplay_switch2: giving up wsdisplay_switch2: screen %d disappeared wsdisplay_switch2: not switching wsdisplay_switch2: invalid screen %dwsdisplay_switch1: screen %d disappeared wsdisplay_switch1: not switching wsdisplay_switch1: invalid screen %dwswaitwsmoused_sleepwscons: copybuffer memory malloc failed pcvtwsemul_vt100_output_c0c1: ESC in kernel output ignored \[>24;20;0cP0!u%5\wsemul_vt100_handle_csi[?62;6c[%d;%dR[?13n[?21n[?27;1nP2$uwsemul_vt100_handle_dcs: bad type %d[11~[12~[13~[14~[15~[17~[18~[19~[20~[21~[23~[24~[25~[26~[28~[29~[31~[32~[33~[34~OPOQOROSOpOqOrOsOtOuOvOwOxOyOIOMOD[7~OBOCOA[8~[6~[3~[2~[5~[4~[1~OjOkOlOmOnOowsevent_readwskbdwskbd at %s mux %d: console keyboard (mux %d ignored for console)cannot load keymapwskdetwskbd_detach: %s didn't detach %s: event queue overflow %s: connecting to %s %s: disconnecting from %s wskbd_get_mapentry: %d(%d): bad entrywskbd_load_keymap: %d(%d): bad entrywskbd_load_keymap: %d: recursion too deepwsmousewsmouse at %swsmdetwsmouse_detach: %s didn't detach wsmux_setmax: no memwsmux_setmax: no memorywsmux_attach: error=%d wsmux: attach out of memory wsfont_unlock: font not lockedpckbdprobe: reset response 0x%x pckbd_enable: command error pckbd_disable: command error pckbdpmsprobe: reset response 0x%x pmsattach: disable error pms_enable: command error pms_disable: command error pms_ioctl: SET_RES command error pms ttcompatCLGET: returning %x getflags: %x compat_43_sys_acceptcompat_43_sys_getpeernamecompat_43_sys_getsocknamehd'(xrx !!!<"!!!!!!!!!! "! !!p"(!0!8!@!H!T!\!`! D! -.#<I@&+*('DEFG>129M:N$< / 7$%403,3$3$4$$ 4$84$4$$̃d84$4$$ <}dT}d4$$~d4~d$$dd4$$d,$$$d,$$$ādX-$$$dd$$0dHd4$$ dl-$l$$dl-$4$$,dDd$$dd4$$ dd$$ d d4$$dd4$$؇dd$$d0d$$Xdpd$$dd$$ dd|d4$$ ddP$$dԨd$$dd$$d,d$$@dXd$$ldd$$dd$$ dd$$ĩd,$$$!d`*$$$!̮d*$$$!dd$$!d,,$$$!dd$$!8dPd$$!dd|d$$!dT,$$$!d,$$$!Ȳdd$$!Pd,$$$!hd,$$$!d-$$$!d-$$$!dгd$$! d8d$$!p hd4$ $&| d4$$&dd$$' Xd$$' d$$' xd$$5 d$$'4 Pd$$'L dd$$? d$$?d d$$?| d$$' ػd$$'0 d$$' $d$$' @d$$'p Td$$' td$$' d$$' d$$'$ ܼd$$'< d$$'| Dd$$' xd$$' d$$', d$$'ؽdĽd$$Add$$CldXd$$I(e@e$$MTele$$Mh!p!x!!!<~  ( |'ᅠ" <  !!!!!!!"-"/""")"H"a"d"e"## #!#%% %%%%%$%,%4%<%P%Q%R%S%T%U%V%W%X%Y%Z%[%\%]%^%_%`%a%b%c%d%e%f%g%h%i%j%k%l%%%%%%%%%%%%%%%%% %% :&;&<&@& B& `&c&e&f&j& k&-"*"U<"~# # # #)#<*#>-_ { }xYYvw E--   <<cr39AAAAEEEIIIIDOOOOUUUYaoybuiltin@ `P0phMMM0NXNNMNN ! $( ,H666788@t$%!%!%!%! %!(%!0%!8%!@%!H%!T%!`%!l%!t%!|%!%!%!%!%! &!@0&!D&!X&!@l&! &!`&!&!&!&! &!&!'!B '! $'! ,'! 4'!<'! D'!L'!T'! %X'!0+`'!@2d'!P8h'!`>l'!pDp'!"eYj$@@h>@@h@<`>` Bh@xM0Lp90j^Q 1W jvQ^Q09`0pj^r0@~100MW@ 1eX` @xj"` x@ h x jjjxP0jHj]jjHj]j&z=znx=z=1=21NyeXfxf1f21f|@fhie AWe@aj^Q q xe@z=zx=z jeAe^e@ h j "xee>00  0T0xee4T4x 44 x4@ 10z0?|eX y0jp]@j>] y j]]x0 yjp]e@@le "|e 0e]?*d# e]?*d"De"deBD@je 0e]?s@j:0jteAdjj]dldtdtjbtdt#dJtd^taj^e]QqeBD\|Qj`]Q\dT|^lAj^e^D!j^e^DjV]0eAX| 1f fQ4L=(d|e> 10eeLj"j eeTj"j eeeLj"jeeUj"jl0QuQ]Q 1e6E?>6ue^Pefj Bnj jDj^ j];&1;\nj ee^eTf &eFjj `nbn|n|n|ndd0fpffv`f=d(e`F& ~nbe^e^e^e^00000004l21l21l21l21l21l21l21l25~& nj nB~1jv4jv e BfAfj^jA 10jvFB 14A~14e"1jj hmXmXm Hm  xm 8m xm(mHm xmm"m%0l%l* xm- l1 xm20hm2 xm3Xm5l7 xm8l< xm=lG xmHlK xmLlO xmPl[$@hm] xm^Xm`Xmihmm xmn0Xmn xmomp xmtluhmw xmxmym|8mhml xml xml xml xmlT hmhm xm llm0hm) ll9hm. xm/l2l7l8 xm:l>pl@ 0l@ xmAmF xmGhmKmR @mRlSxmT`lUme0`lexmkluxmzlzm| Tl}lDll%0l xm l xm% ll ll xmmml 0m xmlpl ll%@ll xm0l xm hm m) xmlahm xm0l xm hm xm0l xm hm xm%pl`4l xm4l xmxmm xmm xm$l%HmH xmIlLlN8mPhmV xmXhm[ xm\l]0pl^xm`4li xmk4lo*0(mq"xmy& (mz"8m xm4l xm 8m(m(m(m8m xm (m(m(m4l4l8mm xmmB8mRl xml xmmk:ml c4l xmpl xm0k xm xm#0Dl/K xmA8mY8mZ xm]l^8ma3 Z]agikkm!oo0D!4D!7:>AEI NRW\nbIh|nu|d4{'''!'''-'3'9'>'D'J'P'V'['a'g'm's'y'~''''''''''''''''''''''(( ((((#()(/(5(;(A(G(M(S(Y(_(e(k(q(w(}(((((((((((((((((((((()) ))) )&),)2)8)>)D)J)P)V)])gg)**,PXJpKTF|PQPNQRRRCERST XP$9P$P$P$oQ$o4Q$o`Q$$pQ$oQ$sQ$R$ę0ILHH'PYp 08 >488   alb a  <8Tli  h     LWl`  X h W  h    и H  T@L  Z X[ ] ] $|h  ܷ 0TlC$C$C$C$|D$ C$  0 \D$D$D$D$d@B  $0#!P!d!$&L'D$ RS(SLSRR  T!DR"!$!X!"`!"d!&"l!ԍ"t!|!!d"p!{"!$!u! "!|!p!p!!"!P!,!{"0#!0#!h`HH` <l,L!t!!d#!# !!ȗ!!ܗ!!!!! !!Lp!!4!H!D!P!X!`!h!p!!!!!!!!Ș!И!4'"ܘ!!!!!! !(!0!L!X!`!l!x!!!!!p!!ܴ!!!ę!̙!ԙ!!!!,!4!L!d!l!t!!!!!!!ؚ!!!!!!!$!8!D!\!t!!!!ԝ"!!؛!!!!!!$!4!!@!L!T!l!!!!!̜!!! !!(!4!L!T!\!l!t!|!!! !!!ԝ!ܝ!!!!!д!! !,!4!L!d!|!!!!Ȟ!Ԟ!!!!0!H!`!h!!!!!!ȟ!!!!!4!L!d!!!Ġ!ܠ!!!!4!L!d!|!!!!!ġ!ܡ!! ! !4!\!H! !T!`!l!|!!!ȝ!!!!!!̢!Ԣ!ܢ!!!!0!H!`!x!!!!أ!! !(!D!d!!!!Ԥ!! !(!D!T!d!t!!!!!H!,!D!\!t!!!!Ԧ!!!!l!!$!,!4! ,> 2lockf@` !!Ȱ!а!ذ!!!!! P$d> Q$ęR$ T$4 T$ęU$= @U$= U$ ,P$= ygO$  !ȳ!$P$س!PP$ !|P$ !P$ !P$ !Q$ !,Q$  !XQ$ ,!Q$ 8!Q$D!Q$P!R$ \!4R$h!`R$ t!R$!R$!R$!S$ !@S$ !pS$ !S$ ̴!S$ ش!T$ !0T$ !\T$ !T$ !T$!T$(! U$ 4!8U$ @!dU$ L!U$X!U$h!U$t!V$!@V$!lV$!V$!V$ĵ!V$P$V$V$,P$XP$P$P$P$Q$4Q$`Q$Q$Q$Q$R$ XP$T P$H P$H P$h Q$ę4Q$@ `Q$@ Q$@ Q$p Q$ XP$ P$ P$ P$ Q$ 4Q$ `Q$ Q$ Q$ Q$ R$ę XP$ P$ P$ P$ Q$ 4Q$ `Q$ Q$ Q$H Q$ R$ę XP$K P$q P$s P$ t Q$t 4Q$u `Q$u Q$Tx Q$z Q$0} R$ę",0$(! X 8 ! \  ! \İ p ! h\ м  !00  0!@@  @!X 8 L!\  X!X 8 \!\  d!Z0<l!ZHH @      ?BEFF'' EF''' ?F''F'' F''' F'' EF'' ?EF''' ?EF''' ?EF''' ?EF'''' ?F'' ?BF''' ?BEF''' ?EF''' F'''' F'''''F''FF''FF''F''p=ek$k$k$l$l$$l$6l$Nl$jl$l$l$l$l$l$m$>m$Rm$hm$tm$~m$m$@P$d> XP$LP$P$TP$Q$4Q$|`Q$LQ$LQ$6Q$R$ę XP$OP$gHV$0vP$`gP$hQ$Th4Q$li`Q$4jQ$@lQ$T7Q$:R$ę XP$TP$P$P$Q$Th4Q$`Q$ Q$Q$Q$8R$ę R$S$tLS$S$S$XS$ T$<8T$dT$ T$= T$TT$U$@@U$`lU$аV$U$,,P$U$dU$V$= zhHs$P$ Q$d4Q$`Q$ Q$Q$ܓQ$ R$T$TT$U$@@U$`U$,,P$ zhxt$P$ Q$(4Q$`Q$ Q$Q$Q$R$T$TT$U$@@U$`U$,,P$V$= yht$556$:=@,EJAqCcKA cKA cKA 1rlAcKA+S cKA+S cKA 26AcKA+S cKANcKAN3o(AcKA+S cKA+S cKA+S 4 AcKA+S cKA+S cKA+S 5AcKA+S cKA cKA 6sAcKA cKAwcKAw7&JAcKA cKA cKA 8H_,AcKA cKAX cKAX 9hCcKA cKA cKA :5AcKA cKA cKAX ;<AcKAX cKAX cKAX <'*AcKAX cKAX cKAX =K@wcKA(cKAB3 dKAG VcKAF#cKA kcKA k@H =!cKA!cKA!cKA! M!cKA*#cKA*#cKA*#p!cKAF#cKAF#cKAF#Qb!cKA[$cKA[$cKA[$Xh!cKAs$cKAs$cKAs$hi!cKA %cKA %cKA %T0!cKA%&cKA%&cKA%&Ҩa!cKA6&cKA6&cKA6&!Q%!cKAV'cKAV'cKAV'!cKA(cKA(cKA(!cKA )cKA )cKA )Lc!cKA')cKA')cKA')ܹF!cKAQ*cKAQ*cKAQ*Ӭ!cKAT*cKAT*cKAT*!cKA+cKA+cKA+2!cKA,cKA,cKA,.G+!cKA,cKA,cKA,b!cKAL-cKAL-cKAL-}9!cKA}.cKA}.cKA}. V!cKAq/cKAq/cKAq/ gh!cKA/cKA/cKA/ 6b!cKAG0cKAG0cKAG0 *!cKA50cKA50cKA50 @t!cKAx1cKAx1cKAx1 F!cKAb2cKAb2cKAb2 }4!cKA2cKA2cKA2 2}!cKAB3cKAB3cKAB3 b^7!cKAs4cKAs4cKAs4 6!cKAR 5cKAR 5cKAR 5.q.!cKA5cKA5cKA5|!cKA=6cKA=6cKA=6G9t!cKA6cKA6cKA64w !cKAn7cKAn7cKAn7"-8!cKAC8cKAC8cKAC8VW!cKAp89cKAp89cKAp899!cKA9cKA9cKA9 !cKAi:cKAi:cKAi::%!cKA3;cKA3;cKA3;JM!cKAcKAcKAdj[!cKAcKAcKA)<'!cKA-1cKA-1cKA-1uPQ!cKAcKAcKAU!cKAZbcKAZbcKAZb`!cKAcKAcKA !cKA,cKA,cKA,e.fx!cKAcKAcKA쌫!cKAJ]cKAJ]cKAJ]K?!cKAcKAcKAmp!cKAwcKAwcKAwFjz!cKA'cKA'cKA';JV!cKAcKAcKA/0!cKAcKAcKAN!cKAh cKAh cKAh ʅ!cKA! cKA! cKA! {i!cKA cKA cKA [!cKA+S cKA+S cKA+S ո!cKA cKA cKA  Uʌ!cKAX cKAX cKAX  9!cKA cKA cKA q!cKANcKANcKANL!cKAcKAcKAX!cKAIcKAIcKAIT!cKAcKAcKAOi!cKAvcKAvcKAvWo/!cKA IcKA IcKA I VL!cKAcKAcKA TZ!cKA9zcKA9zcKA9z!^Bc!cKAcKAcKA!Į*!cKACcKACcKAC"c!cKAcKAcKA"(!cKA*ucKA*ucKA*u#.!cKA cKA cKA #!cKAWcKAWcKAW${#!cKA>cKA>cKA>$u TT!cKAcKAcKA%d!cKApcKApcKAp%9f!cKAGcKAGcKAG&ؽ!cKA9cKA9cKA9&Ϸ!cKAtcKAtcKAt'"/!cKA kcKA kcKA k'zb!cKAcKAcKA(2[!cKA8cKA8cKA8(_!cKA4cKA4cKA4);!cKAecKAecKAe)!cKAcKAcKA*$W=(!cKA(cKA(cKA(*v8!cKA/ cKA/ cKA/ +gq!cKAU cKAU cKAU +S!cKA`!cKA`!cKA`!,4F!cKA!cKA!cKA!,!cKA"cKA"cKA"-pi!cKA*#cKA*#cKA*#- !cKA[$cKA[$cKA[$.=%!cKAs$cKAs$cKAs$.,!cKA %cKA %cKA %/4_!cKA%&cKA%&cKA%&/]I!cKA6&cKA6&cKA6&0J{!cKAV'cKAV'cKAV'0~SO!cKAc'cKAc'cKAc'1[/X!cKA(cKA(cKA(1Z !cKA')cKA')cKA')2r!cKAQ*cKAQ*cKAQ*2}!cKAT*cKAT*cKAT*31!cKA+cKA+cKA+3ޏ!cKA,cKA,cKA,4?!cKA,cKA,cKA,43ɡ!cKAL-cKAL-cKAL-5!cKA}.cKA}.cKA}.58!cKAq/cKAq/cKAq/6وj!cKA/cKA/cKA/6s!cKAG0cKAG0cKAG07c!cKA50cKA50cKA507+:!cKAx1cKAx1cKAx18 !cKAb2cKAb2cKAb28hs!cKA2cKA2cKA29B[!cKA%3cKA%3cKA%39N\!cKAs4cKAs4cKAs4:xrn4!cKAR 5cKAR 5cKAR 5:!cKA5cKA5cKA5; ɫ!cKA=6cKA=6cKA=6;Uhr!cKA6cKA6cKA6<BrKr!cKAn7cKAn7cKAn7<!cKAٟ8cKAٟ8cKAٟ8=o!cKAp89cKAp89cKAp89=V!cKA9cKA9cKA9!!cKAi:cKAi:cKAi:O8T!cKA3;cKA3;cKA3; u\ !cKAcKAcKA !cKAcKAcKA%2!cKAcKAcKA>_kacKAZbcKAZbcKAf(+Ƃ!cKAcKAcKAfYacKAcKAcKACE!cKA,cKA,cKACacKAcKAcKAC!cKAJ]cKAJ]cKAC]acKAcKAcKAC6!cKA'cKA'cKAC3|acKAcKAcKACR7^!cKA;XcKA;XcKAC^5acKAcKAcKAC|g,!cKAh cKAh cKACC[acKA! cKA! cKA .3!cKA cKA cKAWRacKA+S cKA+S cKA  ^!cKAX cKAX cKAWd/acKA cKA cKA +X!cKA cKA cKAWceacKANcKANcKA x!cKAcKAcKAW-acKAIcKAIcKA v"!cKAcKAcKAW~(acKAvcKAvcKA ?t!cKAcKAcKAWY(acKA9zcKA9zcKA %|H!cKAcKAcKAWxacKAfcKAfcKA zY9!cKACcKACcKAWacKAcKAcKA "P!cKA*ucKA*ucKAWt#&acKA cKA cKA  $!cKA>cKA>cKAW ycacKAcKAcKA  !cKApcKApcKAW !̖acKAcKAcKA  Hu)!cKAGcKAGcKAW knacKA9cKA9cKA  NK!cKAtcKAtcKAW kacKA kcKA kcKAW =!cKA8cKA8cKAW macKA4cKA4cKAWyx!cKAecKAecKAW9_acKAecKAecKAWF2!cKAcKAcKAW _acKA(cKA(cKA<!cKA/ cKA/ cKANacKAU cKAU cKA!cKA!cKA!cKAmacKA"cKA"cKAY!cKA*#cKA*#cKAacKAF#cKAF#cKA,p!cKA[$cKA[$cKAacKAs$cKAs$cKAT;!cKA %cKA %cKA2;'acKA%&cKA%&cKA!cKA6&cKA6&cKA΍acKAc'cKAc'cKAZ3!cKA(cKA(cKALacKA )cKA )cKAomw!cKA')cKA')cKAacKAQ*cKAQ*cKA9!cKAT*cKAT*cKAu\acKA+cKA+cKA.#t!cKA,cKA,cKAN?TacKAL-cKAL-cKA__!cKAD-cKAD-cKA&NxacKA}.cKA}.cKAJ=!cKAq/cKAq/cKA^xcacKA/cKA/cKAi!cKAG0cKAG0cKAacKA50cKA50cKAn%9\!cKAb2cKAb2cKAq^acKA2cKA2cKA`!cKAB3cKAB3cKAlEacKA%3cKA%3cKA !cKAs4cKAs4cKA`:?acKAR 5cKAR 5cKA Bზ!cKA5cKA5cKA acKA=6cKA=6cKA!v@!cKAn7cKAn7cKA!K ٥acKAC8cKAC8cKA"8!cKAٟ8cKAٟ8cKA"I,acKAp89cKAp89cKA#!cKA9cKA9cKA#ːacKAi:cKAi:cKA$TTQ!cKA3;cKA3;cKA$N acKAcKAcKA%g!cKA-1cKA-1cKA%|;acKAcKAcKA&s!cKAZbcKAZbcKA&qacKAcKAcKA'(!cKAcKAcKA'/8acKA,cKA,cKA('!cKAcKAcKA(JacKAJ]cKAJ]cKA)Z!cKAwcKAwcKA)NacKA'cKA'cKA*!cKAcKAcKA*#acKA;XcKA;XcKA+;N!cKAcKAcKA+.acKAh cKAh cKA,$l!cKA! cKA! cKA,acKA cKA cKA->?!cKA cKA cKA-8acKAX cKAX cKA.'!cKA cKA cKA.acKA cKA cKA/#:!cKANcKANcKA/OYacKAcKAcKA90,!cKAIcKAIcKAt0hacKAvcKAvcKA91LgU!cKA IcKA IcKAt1acKAcKAcKA92!cKA9zcKA9zcKAt2facKAcKAcKA93ٍ!cKAfcKAfcKAt3 RacKACcKACcKA947!cKAcKAcKAt4R!acKA cKA cKA95 !cKAWcKAWcKAt5`4GacKA>cKA>cKA96=I!cKAcKAcKAt6,-acKApcKApcKA97!cKAcKAcKAt7]acKAGcKAGcKA98lQ!cKAtcKAtcKAt8PiacKA kcKA kcKA99U%E!cKAcKAcKAt9#acKA8cKA8cKA9:d!cKA4cKA4cKAt: N{acKAecKAecKA9;Gѷ!cKAecKAecKAt;EmacKAcKAcKA9<!cKA/ cKA/ cKAt<tacKAU cKAU cKA9=t*z!cKA`!cKA`!cKAt=PdZacKA!cKA!cKA9>G!cKA"cKA"cKAt>acKA*#cKA*#cKAt?6&!cKAF#cKAF#cKAt? acKA[$cKA[$cKA@ev!cKAs$cKAs$cKA@R9$acKA%&cKA%&cKAA?S!cKA6&cKA6&cKAAcLZacKAV'cKAV'cKABf !cKAc'cKAc'cKABlacKA(cKA(cKAC,O!cKA )cKA )cKACWacKA')cKA')cKADO,!cKAQ*cKAQ*cKAD[acKA+cKA+cKAEV!cKA,cKA,cKAE1`acKA,cKA,cKAF!cKAL-cKAL-cKAFLacKAD-cKAD-cKAG !cKA}.cKA}.cKAG0acKAq/cKAq/cKAHS!cKA/cKA/cKAH3ҴacKA50cKA50cKAIEn!cKAx1cKAx1cKAIbYfacKAb2cKAb2cKAJz#!cKA2cKA2cKAJacKAB3cKAB3cKAKTk!cKA%3cKA%3cKAKYKacKAs4cKAs4cKAL \HW!cKAR 5cKAR 5cKALacKA=6cKA=6cKAM {!cKA6cKA6cKAMacKAn7cKAn7cKAN2!cKAC8cKAC8cKANskacKAٟ8cKAٟ8cKAO!cKAp89cKAp89cKAOacKAi:cKAi:cKA44T!cKA3;cKA3;cKA4w+acKAcKAcKA4+!cKAcKAcKA4acKA-1cKA-1cKA4Β!cKAcKAcKA4poacKAZbcKAZbcKA4"  !cKAcKAcKA4<acKAcKAcKA4Sa!cKAcKAcKA4nacKAJ]cKAJ]cKA4#Q!cKAcKAcKA4TacKAwcKAwcKA4e)!cKA'cKA'cKA4jacKAcKAcKA4'!cKA;XcKA;XcKA4.N2acKAcKAcKA4W !cKAh cKAh cKA47{acKA cKA cKA4 mF!cKA+S cKA+S cKA4 )acKA cKA cKA4 RB>!cKAX cKAX cKA4 2acKA cKA cKA4  !cKA cKA cKA4 JacKANcKANcKA4 <!cKAcKAcKA4 acKAcKAcKA4 epc!cKAvcKAvcKA4 pacKA IcKA IcKA4bk!cKAcKAcKA4racKA9zcKA9zcKA4@*Q!cKAcKAcKA4b%acKAfcKAfcKAe!cKACcKACcKAZnacKA*ucKA*ucKAeg!cKA cKA cKAJpacKAWcKAWcKAeq!cKA>cKA>cKA[8acKAcKAcKAeߴp!cKApcKApcKAWacKAcKAcKAeD?!cKAGcKAGcKAAMbacKA9cKA9cKAe=X!cKA kcKA kcKA`acKAcKAcKAe F!cKA8cKA8cKAOacKA4cKA4cKAeL!cKAecKAecKAacKAecKAecKAeb!cKAcKAcKA($acKA(cKA(cKAe7b!!cKAU cKAU cKA!acKA`!cKA`!cKAeڢC!cKA!cKA!cKA#)eacKA"cKA"cKAe q!cKA*#cKA*#cKAnLacKAF#cKAF#cKAeAU%!cKA[$cKA[$cKA'/acKAs$cKAs$cKAeq^!cKA%&cKA%&cKAOacKA6&cKA6&cKAesi!cKAV'cKAV'cKA' acKAc'cKAc'cKAݚ?!cKA(cKA(cKAt, acKA )cKA )cKA/ !cKA')cKA')cKA/ $ acKAQ*cKAQ*cKA/ !6%!cKA+cKA+cKA/ !acKA,cKA,cKA/ "Y 6!cKA,cKA,cKA/ "X acKAL-cKAL-cKA/ #x=!cKAD-cKAD-cKA/ #RcacKA}.cKA}.cKA/ $c!cKAq/cKAq/cKA/ $dj@acKA/cKA/cKA/ %yTG!cKA50cKA50cKA/ %QduacKAx1cKAx1cKA/ &ڱ-4!cKAb2cKAb2cKA/ &ӶacKA2cKA2cKA/ ':!cKAB3cKAB3cKA/ 'B֫acKA%3cKA%3cKA/ (ڞ!cKAs4cKAs4cKA/ (s[_acKA5cKA5cKA/ )չ!cKA=6cKA=6cKA/ )acKA6cKA6cKA/ *j!cKAn7cKAn7cKA/ *g_acKAC8cKAC8cKA/ +X!cKAٟ8cKAٟ8cKA/ +?tacKAp89cKAp89cKA/ ,8!cKAi:cKAi:cKA/ , C2CacKA3;cKA3;cKA/ -[3!cKAcKAcKA/ -@+acKAcKAcKA/ .1 6[!cKAcKAcKA/ .acKAZbcKAZbcKA/ /5Ѡ!cKAcKAcKA/ /]CacKAcKAcKA`!0㚕!cKA,cKA,cKA`!0ՆacKAcKAcKA`!1E g{!cKAJ]cKAJ]cKA`!16cacKAcKAcKA`!2Z!cKAwcKAwcKA`!2 +acKAcKAcKA`!3!cKA;XcKA;XcKA`!3TacKAcKAcKA`!4bJ!cKAh cKAh cKA`!4ayacKA! cKA! cKA`!5oc1!cKA cKA cKA`!58;acKA+S cKA+S cKA`!6}4G!cKA cKA cKA`!6SacKA cKA cKA`!7!cKA cKA cKA`!7acKANcKANcKA`!8e'!cKAcKAcKA`!8xqacKAIcKAIcKA`!9^R7!cKAcKAcKA`!9nacKAvcKAvcKA`!:-!cKA IcKA IcKA`!:k^acKA9zcKA9zcKA`!;U4+!cKAcKAcKA`!;ײ/&acKAfcKAfcKA`!<oJ]!cKACcKACcKA`!<r~ZacKAcKAcKA`!= 7%!cKA*ucKA*ucKA`!=`acKA cKA cKA`!>P?V!cKAWcKAWcKA`!>~>acKAcKAcKA`!?N!cKApcKApcKA`!?})acKAcKAcKA"@bu!cKAGcKAGcKA*#@("acKA9cKA9cKA"A@ y!cKAtcKAtcKA*#A4)|}acKA kcKA kcKA"Bu!cKAcKAcKA*#B۽acKA4cKA4cKA"Ck!cKAecKAecKA*#CacKAecKAecKA"D!cKAcKAcKA*#DheTacKA(cKA(cKA"Ex!cKA/ cKA/ cKA*#EwjacKAU cKAU cKA"F2!cKA!cKA!cKA*#FCiacKA"cKA"cKA"G !cKA*#cKA*#cKA*#GmacKAF#cKAF#cKA"H!cKA[$cKA[$cKA*#H6acKAs$cKAs$cKA"Ip2!cKA %cKA %cKA*#ItIacKA%&cKA%&cKA"JD!cKAV'cKAV'cKA*#J4zacKAc'cKAc'cKA"Kӕ{!cKA(cKA(cKA*#K!"ZacKA )cKA )cKA"L]#|!cKA')cKA')cKA*#L>#acKAQ*cKAQ*cKA*#MT!cKAT*cKAT*cKA*#M"racKA,cKA,cKA*#N0!cKA,cKA,cKA*#ND\acKAL-cKAL-cKA*#O~!cKAD-cKAD-cKA*#O䪗!cKA}.cKA}.cKAT1!cKAq/cKAq/cKA⹅{!cKA/cKA/cKA+*GK!cKAG0cKAG0cKA!cKA50cKA50cKAacKAb2cKAb2cKAC0!cKA2cKA2cKAC?fKacKAB3cKAB3cKAC%!cKA%3cKA%3cKAC߻+acKAs4cKAs4cKAC-!cKAR 5cKAR 5cKAC`kacKA5cKA5cKACցV!cKA=6cKA=6cKAC]qacKAn7cKAn7cKACQ[!cKAC8cKAC8cKACatacKAٟ8cKAٟ8cKACd9!cKAp89cKAp89cKACQ~"}acKA9cKA9cKACo!cKA3;cKA3;cKAC6RacKAcKAcKACxЛ!cKAcKAcKAC!cKA-1cKA-1cKA-1*!cKAcKAcKA,W!cKAZbcKAZbcKAZb!cKAcKAcKA dKA> f:Uܞ` NZmGVN?Y4P(4!fNG䲅|"g+?OJrbgc'fqAF1+bPh1 ? ?15Sa81S 8oș\:N&@Hn+)Q|DVZr_Fem[ =-hiR5ղf@֟4B:9# 9&z]`Sn \,A[Ho. O KejReDKe@8w,OJ 4! Gb~ !.K6b.Ӵ`Zˉ>"OO^>ښik{\vNkwȉ0yg;9``a %H3,ZnXӵPo/;f!a9f"S3.s'Au6)N?[}βSK<ȟU?R+MSw5_SM%/q"gJ%T2g}N6CTg_cX `w*B+fL1.{x5m7BN@xwAJ3OXm@)So݇qAj5Xɧ5`Fd^?<N*Sjl,4~{ |(*OشDv?{+V8yKpF^fip[/&T!R;ty)Bf+:t [CITdV^T|q P! /N/v_ %fH}sot> |#+y|+4kT|U͚˵3*̄VMzy PjbړnH4y:V.aZV)dET@h(Lr9RjGth== ЧVࣕ6P\]R~)Cw焞D.pX1#$I$7=+N==lg` kۚLq1}Og@]?3I^w庢qOHH(@ hL.|?z`vF$,k"RqUqN!WB\qh\KJ}YxImwV&eĉUe_6VnpJ)%(mHv./x5ב0w5eiij VnI>u\_0=ۯKV~KU_CzX DLD@tx{Dl<#H$L3)Ae93mXPe . .. catchmodchgrp cp dd df edexprhostname v ln lsmkdir mteject mv pax tarcpio rm ksh shsleepsttysynctest[ip 0 IP icmp 1 ICMP tcp 6 TCP udp 17 UDP  . .. pppgroup2spwd.db protocolsOservicesO disktab fstab resolv.conf` hosts ... ... ...ftp-data 20/tcp ftp 21/tcp domain 53/tcp nameserver domain 53/udp nameserver www 80/tcp http shell 514/tcp cmd nfsd 2049/udp nfs nfsd 2049/tcp nfs  . .. bin dev etc mntmnt2u sbinu tmp usrvarinstbin .profileFH  install.md upgrade install install.sub ... . .. bin mdecusbinushareu . ..grepfgrepegrep ftpgzipgunzipgzcatlessmore\sed . .. . .. . ..miscukeymaps . ..termcap ... . .. tmp db runemptyu ... ... ... ... . ..chown disklabelvfdiskfsck_ffs vfsck fsck_ext2fsreboothaltifconfig vinitdhclient vdmesgmknodmount mount_cd9660dV mount_ffsv mount_msdos mount_nfsv mount_ext2fsdVnewfs newfs_msdospingping6routertsolumountkbd wicontrolv dhclient-script#!/bin/sh - PATH=/sbin:/usr/sbin:/bin:/usr/bin T=$0 [ "$eo" ] || eo= hex() { case $1 in [0-9]) echo -n $1;; 10) echo -n a;; 11) echo -n b;; 12) echo -n c;; 13) echo -n d;; 14) echo -n e;; 15) echo -n f;; esac } alph2d() { local t="$1" local p="0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ" local sub=${p%${t}*} echo ${#sub} } h2d() { local s="$1" local f=${s%*[0-9a-f]} n=${s#[0-9a-f]*} echo $(($(_h2d $f)*16+ $(_h2d $n) )) } _h2d() { case $1 in [0-9]) echo -n $1;; a) echo -n 10;; b) echo -n 11;; c) echo -n 12;; d) echo -n 13;; e) echo -n 14;; f) echo -n 15;; esac } unt() { arg="$1" tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" while [ "$tmp" != "$arg" ] do arg=$tmp tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" done echo $arg } dodisk() { [ "$DEBUG" ] && set -x n=$(($((${5}*${7:-16}))+${6})) count=0 RMlist="$RMlist $1$2? r$1$2?" [ 0$7 -ne 8 ] && l="i j k l m n o p" for d in a b c d e f g h $l do M $1$2$d b $3 $(($n+$count)) 640 M r$1$2$d c $4 $(($n+$count)) 640 let count=count+1 done MKlist="$MKlist;chown root:operator $1$2? r$1$2?" } dodisk2() { n=$(($(($5*${7:-16}))+$6)) M $1$2a b $3 $n 640 operator M r$1$2a c $4 $n 640 operator n=$(($n+2)) M $1$2c b $3 $n 640 operator M r$1$2c c $4 $n 640 operator } RMlist="rm -f" MKlist=":" mkl() { [ "${mklist[$1]}" ] && { mklist[$1]="${mklist[$1]};mknod -m $1 $2 $3 $4 $5" } || { mklist[$1]="mknod -m $1 $2 $3 $4 $5" modes="$modes $1" } } M() { RMlist="$RMlist $1" mkl ${5-666} $1 $2 $3 $4 mklist="$mklist $1" G=${6:-wheel} [ "$7" ] && { MKlist="$MKlist;chown $7:$G $1" } || { case $G in wheel)g=0;;kmem)g=2;;operator)g=5;;tty)g=4;;dialer)g=117;;_lkm)g=61;; esac [ "${grplist[$g]}" ] && { grplist[$g]="${grplist[$g]} $1" } || { groups="$groups $g" grplist[$g]="chgrp $G $1" } } return 0 } R() { [ "$DEBUG" ] && set -x for i in "$@" do U=`unt $i` [ "$U" ] || U=0 case $i in std) M console c 0 0 600 M tty c 1 0 M mem c 2 0 640 kmem M kmem c 2 1 640 kmem M null c 2 2 M zero c 2 12 M stdin c 7 0 M stdout c 7 1 M stderr c 7 2 M ksyms c 43 0 640 kmem M drum c 3 0 640 kmem M klog c 6 0 600 M xf86 c 2 4 600 M reload c 2 20 640 kmem ;; xfs*) M xfs$U c 51 $U 600 ;; tuner*) M tuner$U c 75 $(($(($U*2))+16)) 644 ;; systrace) M systrace c 50 0 644 ;; ss*) M ss$U c 29 $(($U*16)) 640 operator M nss$U c 29 $(($(($U*16))+1)) 640 operator M enss$U c 29 $(($(($U*16))+3)) 640 operator RMlist="$RMlist scan$U" MKlist="$MKlist;umask 77;ln -s ss$U scan$U" ;; uk*) M uk$U c 28 $U 640 operator ;; tun*) M tun$U c 33 $U 600 ;; *random) n=0 for pre in " " s u p a do M ${pre}random c 40 $n 644 n=$(($n+1)) done ;; radio*) M radio$U c 97 $U MKlist="$MKlist;[ -e radio ] || ln -s radio$U radio" ;; pf*) M pf c 39 0 600 ;; pci) M pci c 71 0 600 ;; lkm) M lkm c 35 0 640 _lkm ;; iop*) M iop$U c 73 $U 660 ;; fd) RMlist="mkdir -p fd;$RMlist" n=0 while [ $n -lt 64 ];do M fd/$n c 7 $n;n=$(($n+1));done MKlist="$MKlist;chmod 555 fd" ;; crypto) M crypto c 47 0 ;; bpf*) M bpf$U c 22 $U 600 ;; bktr*) M bktr$U c 75 $U 644 ;; audio*) M sound$U c 36 $U M mixer$U c 36 $(($U+16)) M audio$U c 36 $(($U+128)) M audioctl$U c 36 $(($U+192)) MKlist="$MKlist;[ -e audio ] || ln -s audio$U audio" MKlist="$MKlist;[ -e mixer ] || ln -s mixer$U mixer" MKlist="$MKlist;[ -e sound ] || ln -s sound$U sound" MKlist="$MKlist;[ -e audioctl ] || ln -s audioctl$U audioctl" ;; uscanner*) M uscanner$U c 69 $U 660 ;; usb*) [ "$i" = "usb" ] && u= || u=$U M usb$u c 64 $U 660 ;; urio*) M urio$U c 67 $U 660 ;; ulpt*) M ulpt$U c 66 $U 660 ;; uhid*) M uhid$U c 65 $U 660 ;; ugen*) n=$(($U*16)) for j in 00 01 02 03 04 05 06 07 08 09 10 11 12 13 14 15 do M ugen$U.$j c 70 $(($n+$j)) 660 done ;; ttyU[0-9a-zA-Z]) U=${i#ttyU*} o=$(alph2d $U) M ttyU$U c 68 $o 660 dialer uucp ;; uall) R ttyU0 ttyU1 ugen0 ugen1 ulpt0 ulpt1 uhid0 uhid1 uhid2 uhid3 R uscanner0 urio0 usb0 usb1 usb2 usb3 ;; wsmux|wsmouse|wskbd) M wsmouse c 63 0 600 M wskbd c 63 1 600 ;; wsmouse*) M wsmouse$U c 62 $U 600 ;; wskbd*) M wskbd$U c 61 $U 600 ;; tty[C-F]*) U=${i##tty[C-F]} case $i in ttyC*) n=C m=0;; ttyD*) n=D m=256;; ttyE*) n=E m=512;; ttyF*) n=F m=768;; esac case $U in [0-9a-f]) M tty$n$U c 60 $(( 16#$U + $m )) 600;; cfg) M tty${n}cfg c 60 $((255+$m)) 600;; *) echo bad unit $U for $i; exit 1;; esac ;; wscons) R wsmouse0 wsmouse1 wsmouse2 wsmouse3 wskbd0 wskbd1 wskbd2 R wskbd3 wsmux ttyCcfg ttyC0 ttyC1 ttyC2 ttyC3 ttyC4 ttyC5 R ttyC6 ttyC7 ttyC8 ttyC9 ttyCa ttyCb ;; pty*) if [ $U -gt 15 ]; then echo bad unit for pty in: $i continue fi set -A letters p q r s t u v w x y z P Q R S T set -A suffixes 0 1 2 3 4 5 6 7 8 9 a b c d e f g h i j k l m n o p q \ r s t u v w x y z A B C D E F G H I J K L M N O P Q R S T U V W X \ Y Z name=${letters[$U]} n=0 while [ $n -lt 62 ] do nam=$name${suffixes[$n]} off=$(($U*62)) M tty$nam c 4 $(($off+$n)) M pty$nam c 5 $(($off+$n)) n=$(($n+1)) done ;; ptm) M ptm c 98 0 666 ;; tty[0-7][0-9a-f]) U=${i#tty*} o=$(h2d $U) M tty$U c 54 $o 660 dialer uucp M cua$U c 54 $(($o+128)) 660 dialer uucp ;; st*) n=$(($U*16)) for pre in " " n e en do M ${pre}st$U b 25 $n 660 operator M ${pre}rst$U c 25 $n 660 operator n=$(($n+1)) done ;; vnd*) dodisk vnd $U 19 19 $U 0 dodisk svnd $U 19 19 $U 2048 ;; rd*) dodisk2 rd $U 18 18 $U 0 ;; ch*) M ch$U c 27 $U 660 operator ;; cd*) dodisk2 cd $U 26 26 $U 0 ;; local) test -s $T.local && sh $T.local ;; ramdisk) R pty0 rd0 cd0 cd1 st0 st1 wd0 wd1 wd2 wd3 wd4 sd0 sd1 sd2 R sd3 sd4 bpf0 std ;; all) R ccd0 ccd1 ccd2 ccd3 vnd0 vnd1 vnd2 vnd3 sd0 sd1 sd2 sd3 sd4 R cd0 cd1 rd0 tun0 tun1 tun2 tun3 bpf0 bpf1 bpf2 bpf3 bpf4 R bpf5 bpf6 bpf7 bpf8 bpf9 pty0 xfs0 ss0 ss1 ch0 ptm local R wscons pci iop0 iop1 uall tuner0 radio0 audio0 uk0 random R lkm tty00 tty01 tty02 tty03 crypto pf systrace wd0 wd1 wd2 R wd3 raid0 raid1 raid2 raid3 std st0 st1 fd ;; wd*|sd*|raid*|ccd*) case $i in wd*) dodisk wd $U 16 16 $U 0;; sd*) dodisk sd $U 24 24 $U 0;; raid*) dodisk raid $U 71 71 $U 0;; ccd*) dodisk ccd $U 21 21 $U 0;; esac ;; *) echo $i: unknown device ;; esac done } R "$@" list="$RMlist" for mode in $modes; do list="$list;${mklist[$mode]}" done for group in $groups; do list="$list;${grplist[$group]}" done list="$list;$MKlist" if [ "$eo" = "echo" ]; then $eo "$list" else echo "$list" | sh fi wheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root bin:*:7: news:*:8: wsrc:*:9: users:*:10: auth:*:11: games:*:13: staff:*:20:root smmsp:*:25: popa3d:*:26: sshd:*:27: _portmap:*:28: _identd:*:29: _rstatd:*:30: guest:*:31:root _rusersd:*:32: _fingerd:*:33: _sshagnt:*:34: _x11:*:35: utmp:*:45: _kdc:*:59: _kadmin:*:60: _lkm:*:61: _spamd:*:62: _radius:*:63: _token:*:64: _shadow:*:65: crontab:*:66: www:*:67: _isakmpd:*:68: network:*:69: named:*:70: proxy:*:71: authpf:*:72: _syslogd:*:73: _pflogd:*:74: _bgpd:*:75: _tcpdump:*:76: _dhcp:*:77: _mopd:*:78: _tftpd:*:79: _rbootd:*:80: _afs:*:81: _ppp:*:82: _ntp:*:83: dialer:*:117: nogroup:*:32766: nobody:*:32767: Vrsd0hWsd0iXrsd0iYsd0jZrsd0j[sd0k\rsd0k]sd0l^rsd0l_sd0m`rsd0masd0nbrsd0ncsd0odrsd0oesd0pfrsd0pgsd1ahrsd1aisd1bjrsd1bksd1clrsd1cmsd1dnrsd1dosd1eprsd1eqsd1frrsd1fssd1gtrsd1gusd1h . ..MAKEDEVttyp0ptyp0ttyp1ptyp1ttyp2ptyp2ttyp3 ptyp3!ttyp4"ptyp4#ttyp5$ptyp5%ttyp6&ptyp6'ttyp7(ptyp7)ttyp8*ptyp8+ttyp9,ptyp9-ttypa.ptypa/ttypb0ptypb1ttypc2ptypc3ttypd4ptypd5ttype6ptype7ttypf8ptypf9ttypg:ptypg;ttyph<ptyph=ttypi>ptypi?ttypj@ptypjAttypkBptypkCttyplDptyplEttypmFptypmGttypnHptypnIttypoJptypoKttyppLptyppMttypqNptypqOttyprPptyprQttypsRptypsSttyptTptyptUttypuVptypuWttypvXptypvYttypwZptypw[ttypx\ptypx]ttypy^ptypy_ttypz`ptypzattypAbptypActtypBdptypBettypCfptypCgttypDhptypDittypEjptypEkttypFlptypFmttypGnptypGottypHpptypHqttypIrptypIsttypJtptypJuttypKvptypKwttypLxptypLyttypMzptypM{ttypN|ptypN}ttypO~ptypOttypPptypPttypQptypQttypRptypRttypSptypSttypTptypTttypUptypUttypVptypVttypWptypWttypXptypXttypYptypYttypZptypZttynullzerostdinstdoutstderrrd0arrd0ard0crrd0ccd0arcd0acd0crcd0ccd1arcd1acd1crcd1cwd0arwd0awd0brwd0bwd0crwd0cwd0drwd0dwd0erwd0ewd0frwd0fwd0grwd0gwd0hrwd0hwd0irwd0iwd0jrwd0jwd0krwd0kwd0lrwd0lwd0mrwd0mwd0nrwd0nwd0orwd0owd0prwd0pwd1arwd1awd1brwd1bwd1crwd1cwd1drwd1dwd1erwd1ewd1frwd1fwd1grwd1gwd1hrwd1hwd1irwd1iwd1jrwd1jwd1krwd1kwd1lrwd1lwd1mrwd1mwd1nrwd1nwd1orwd1owd1prwd1pwd2arwd2awd2brwd2bwd2crwd2cwd2drwd2dwd2erwd2ewd2frwd2fwd2grwd2gwd2hrwd2hwd2irwd2iwd2jrwd2jwd2krwd2kwd2lrwd2lwd2mrwd2mwd2nrwd2nwd2orwd2owd2prwd2pwd3arwd3a wd3b rwd3b wd3c rwd3c wd3drwd3dwd3erwd3ewd3frwd3fwd3grwd3gwd3hrwd3hwd3irwd3iwd3jrwd3jwd3krwd3kwd3lrwd3lwd3m rwd3m!wd3n"rwd3n#wd3o$rwd3o%wd3p&rwd3p'wd4a(rwd4a)wd4b*rwd4b+wd4c,rwd4c-wd4d.rwd4d/wd4e0rwd4e1wd4f2rwd4f3wd4g4rwd4g5wd4h6rwd4h7wd4i8rwd4i9wd4j:rwd4j;wd4k<rwd4k=wd4l>rwd4l?wd4m@rwd4mAwd4nBrwd4nCwd4oDrwd4oEwd4pFrwd4pGsd0aHrsd0aIsd0bJrsd0bKsd0cLrsd0cMsd0dNrsd0dOsd0ePrsd0eQsd0fRrsd0fSsd0gTrsd0gUsd0hVrsd0hWsd0iXrsd0iYsd0jZrsd0j[sd0k\rsd0k]sd0l^rsd0l_sd0m`rsd0masd0nbrsd0ncsd0odrsd0oesd0pfrsd0pgsd1ahrsd1aisd1bjrsd1bksd1clrsd1cmsd1dnrsd1dosd1eprsd1eqsd1frrsd1fssd1gtrsd1gusd1hvrsd1hwsd1ixrsd1iysd1jzrsd1j{sd1k|rsd1k}sd1l~rsd1lsd1mrsd1msd1nrsd1nsd1orsd1osd1prsd1psd2arsd2asd2brsd2bsd2crsd2csd2drsd2dsd2ersd2esd2frsd2fsd2grsd2gsd2hrsd2hsd2irsd2isd2jrsd2jsd2krsd2ksd2lrsd2lsd2mrsd2msd2nrsd2nsd2orsd2osd2prsd2psd3arsd3asd3brsd3bsd3crsd3csd3drsd3dsd3ersd3esd3frsd3fsd3grsd3gsd3hrsd3hsd3irsd3isd3jrsd3jsd3krsd3ksd3lrsd3lsd3mrsd3msd3nrsd3nsd3orsd3osd3prsd3psd4arsd4asd4brsd4bsd4crsd4csd4drsd4dsd4ersd4esd4frsd4fsd4grsd4gsd4hrsd4hsd4irsd4isd4jrsd4jsd4krsd4ksd4lrsd4lsd4mrsd4msd4nrsd4nsd4orsd4osd4prsd4p memkmemksymsdrumreload st0rst0nst0nrst0est0erst0enst0enrst0 st1rst1nst1nrst1est1erst1enst1enrst1bpf0consoleklogpxf86 dumb|80-column dumb tty:\ :am:\ :co#80:\ :bl=^G:cr=^M:do=^J:sf=^J: vt100|vt100-am|dec vt100 (w/advanced video):\ :am:bs:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :@8=\EOM:DO=\E[%dB:K1=\EOq:K2=\EOr:K3=\EOs:K4=\EOp:K5=\EOn:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=^O:as=^N:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:do=^J:\ :eA=\E(B\E)0:ho=\E[H:k0=\EOy:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k5=\EOt:k6=\EOu:k7=\EOv:k8=\EOl:k9=\EOw:k;=\EOx:\ :kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:\ :ku=\EOA:le=^H:mb=\E[5m:md=\E[1m:me=\E[m\017:mr=\E[7m:\ :nd=\E[C:rc=\E8:rs=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :..sa=\E[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t\016%e\017%;:\ :sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: vt220|vt200|DEC VT220 in vt100 emulation mode:\ :am:bs:mi:pt:xn:xo:\ :co#80:li#24:vt#3:\ :@7=\E[4~:RA=\E[?7l:SA=\E[?7h:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:ho=\E[H:\ :if=/usr/share/tabset/vt100:im=\E[4h:\ :is=\E[1;24r\E[24;1H:k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:\ :k5=\E[17~:k6=\E[18~:k7=\E[19~:k8=\E[20~:k9=\E[21~:\ :k;=\E[29~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=\177:\ :kd=\E[B:kh=\E[1~:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:nl=^J:rc=\E8:\ :rf=/usr/share/tabset/vt100:\ :rs=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :..sa=\E[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t\E(0%e\E(B%;:\ :sc=\E7:se=\E[27m:sf=20\ED:so=\E[7m:sr=14\EM:ta=^I:\ :ue=\E[24m:up=\E[A:us=\E[4m:ve=\E[?25h:vi=\E[?25l: export PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ umask 022 set -o emacs # emacs-style command line editing rootdisk=`dmesg|sed -n -e '/OpenBSD /h' -e '//!H' -e '${ g p }'|sed -n -e '/^root on \([0-9a-z]*\).*/{ s//\/dev\/\1/ p }'` if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES mount -u ${rootdisk:-/dev/rd0a} / echo 'erase ^?, werase ^W, kill ^U, intr ^C, status ^T' stty newcrt werase ^W intr ^C kill ^U erase ^? status ^T _forceloop="" while [ "X$_forceloop" = X"" ]; do echo -n '(I)nstall' [ -f upgrade ] && echo -n ', (U)pgrade' echo -n ' or (S)hell? ' read _forceloop case "$_forceloop" in i*|I*) /install ;; u*|U*) /upgrade ;; s*|S*) ;; *) _forceloop="" ;; esac done fi in/vi ] && EDITOR=vi export EDITOR fi [[ -f /etc/fstab ]] && umount -av 1>/dev/null 2>&1 umount -v /mnt 1>/dev/null 2>&1 welcome if [[ $MODE == install && ! -f /etc/fstab ]]; then cat << __EOT You will now initialize the disk(s) that OpenBSD will use. To enable all available security features you should configure the disk(s) to allow the creation of separate filesystems for /, /tmp, /var, /usr, and /home. __EOT fi set -- $DKDEVS [[ $# -gt 1 ]] && _defdsk=done ask_which "disk" "is the root disk" "$DKDEVS" "$_defdsk" [[ $resp == done ]] && exit ROOTDISK=$resp ROOTDEV=${ROOTDISK}a SWAPDEV=${ROOTDISK}b #!/bin/sh delete_old_address() { if [ -n "$old_ip_address" ]; then ifconfig $interface inet -alias $old_ip_address $medium route delete "$old_ip_address" 127.0.0.1 >/dev/null 2>&1 fi } add_new_address() { ifconfig $interface \ inet $new_ip_address \ netmask $new_subnet_mask \ broadcast $new_broadcast_address \ $medium route add $new_ip_address 127.0.0.1 >/dev/null 2>&1 } delete_old_alias() { if [ -n "$alias_ip_address" ]; then ifconfig $interface inet -alias $alias_ip_address > /dev/null 2>&1 route delete $alias_ip_address 127.0.0.1 > /dev/null 2>&1 fi } add_new_alias() { if [ -n "$alias_ip_address" ]; then ifconfig $interface inet alias $alias_ip_address netmask \ $alias_subnet_mask route add $alias_ip_address 127.0.0.1 fi } delete_old_routes() { route delete default >/dev/null 2>&1 if [ -n "$old_static_routes" ]; then set $old_static_routes while [ $# -gt 1 ]; do route delete "$1" "$2" shift; shift done fi arp -dan } add_new_routes() { route delete default >/dev/null 2>&1 for router in $new_routers; do if [ "$new_ip_address" = "$router" ]; then route add default -iface $router >/dev/null 2>&1 else route add default $router >/dev/null 2>&1 fi break done if [ -n "$new_static_routes" ]; then set $new_static_routes while [ $# -gt 1 ]; do route add $1 $2 shift; shift done fi } add_new_resolv_conf() { rm -f /etc/resolv.conf.std if [ -n "$new_domain_name" ]; then echo "search $new_domain_name" >>/etc/resolv.conf.std fi if [ -n "$new_domain_name_servers" ]; then for nameserver in $new_domain_name_servers; do echo "nameserver $nameserver" >>/etc/resolv.conf.std done fi if [ -f /etc/resolv.conf.std ]; then if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >>/etc/resolv.conf.std fi if [ -f /etc/resolv.conf ]; then cat /etc/resolv.conf > /etc/resolv.conf.save fi cat /etc/resolv.conf.std > /etc/resolv.conf rm -f /etc/resolv.conf.std chown -RL root:wheel /etc/resolv.conf chmod -RL 644 /etc/resolv.conf return 0 fi return 1 } if [ -n "$new_network_number" ]; then echo "New Network Number: $new_network_number" fi if [ -n "$new_broadcast_address" ]; then echo "New Broadcast Address: $new_broadcast_address" fi case $reason in MEDIUM) ifconfig $interface $medium ifconfig $interface inet -alias 0.0.0.0 $medium >/dev/null 2>&1 sleep 1 ;; PREINIT) delete_old_alias ifconfig $interface inet 0.0.0.0 netmask 0.0.0.0 broadcast 255.255.255.255 up ;; ARPCHECK|ARPSEND) ;; BOUND|RENEW|REBIND|REBOOT) if [ -n "$old_ip_address" ]; then if [ "$old_ip_address" != "$alias_ip_address" ]; then delete_old_alias fi if [ "$old_ip_address" != "$new_ip_address" ]; then delete_old_address delete_old_routes fi fi if [ "$reason" = BOUND ] || \ [ "$reason" = REBOOT ] || \ [ -z "$old_ip_address" ] || \ [ "$old_ip_address" != "$new_ip_address" ]; then add_new_address add_new_routes fi if [ "$new_ip_address" != "$alias_ip_address" ]; then add_new_alias fi add_new_resolv_conf ;; EXPIRE|FAIL) delete_old_alias if [ -n "$old_ip_address" ]; then delete_old_address delete_old_routes fi add_new_alias if [ -f /etc/resolv.conf.save ]; then cat /etc/resolv.conf.save > /etc/resolv.conf fi ;; TIMEOUT) delete_old_alias add_new_address sleep 1 if [ -n "$new_routers" ]; then set "$new_routers" if ping -q -c 1 -w 1 "$1"; then if [ "$new_ip_address" != "$alias_ip_address" ]; then add_new_alias fi add_new_routes if add_new_resolv_conf; then exit 0 fi fi fi ifconfig $interface inet -alias $new_ip_address $medium delete_old_routes exit 1 ;; esac exit 0 MDFSTYPE=msdos MDXAPERTURE=2 ARCH=cats md_set_term() { } md_installboot() { } md_prep_disk() { local _disk=$1 _resp typeset -l _resp cat << __EOT $_disk must be partitioned using an BSD or an MBR partition table. BSD partition table or MBR partition tables can be created by openbsd. It is more a question of firmware compatiblity disk portability. (Once we can figure out what filesystems ABLE can boot) __EOT while : ; do ask "Use BSD or MBR partition table?" BSD _resp=$resp case $_resp in m|mbr) export disklabeltype=MBR md_prep_MBR $_disk break ;; b|bsd) export disklabeltype=BSD md_prep_BSD $_disk break ;; esac done } md_prep_MBR() { local _disk=$1 if [[ -n $(disklabel -c $_disk 2>/dev/null | grep ' BSD ') ]]; then cat << __EOT WARNING: putting an MBR partition table on $_disk will DESTROY the existing BSD partitions and BSD partition table. __EOT ask_yn "Are you *sure* you want an MBR partition table on $_disk?" [[ $resp == n ]] && exit fi ask_yn "Use *all* of $_disk for OpenBSD?" if [[ $resp == y ]]; then echo -n "Creating Master Boot Record (MBR)..." fdisk -e $_disk >/dev/null 2>&1 << __EOT reinit update write quit __EOT echo "done." echo -n "Formatting 1MB MSDOS boot partition..." gunzip < /usr/mdec/msdos1mb.gz | \ dd of=/dev/r${_disk}c bs=512 seek=1 >/dev/null 2>&1 echo "done." return fi cat << __EOT **** NOTE **** XXX ************** Current partition information is: $(fdisk $_disk) __EOT fdisk -e $_disk cat << __EOT Here is the MBR configuration you chose: $(fdisk $_disk) Please take note of the offsets and sizes of the DOS partition, the OpenBSD partition, and any other partitions you want to access from OpenBSD. You will need this information to fill in the OpenBSD disklabel. __EOT } md_prep_BSD() { local _disk=$1 cat << __EOT No special setup should be required to label using BSD disklabel. however if the disk has previously been partitioned in another manner, it may be necessary to wipe existing partition tables before proceeding. dd if=/dev/zero of=/${_disk} bs=512 count=10 disklabel -c ${_disk} __EOT } md_prep_disklabel() { local _disk=$1 _q md_prep_disk $_disk case $disklabeltype in BSD) ;; MBR) cat << __EOT You *MUST* setup the OpenBSD disklabel to include the MSDOS-formatted boot partition as the 'i' partition. If the 'i' partition is missing or not the MSDOS-formatted boot partition, then the kernel required to boot OpenBSD cannot be installed. __EOT ;; *) echo "Disk label type ('$disklabeltype') is not 'BSD' or 'MBR'." exit ;; esac disklabel -W $_disk >/dev/null 2>&1 disklabel -c -f /tmp/fstab.$_disk -E $_disk } md_congrats() { cat << __EOT Once the machine has rebooted use OpenFirmware to boot into OpenBSD, as described in the INSTALL.$ARCH document. The command to boot OpenBSD will be something like 'boot (hd0)bsd'. __EOT } #!/bin/ksh MODE=upgrade . install.sub resp= while [ -z "$resp" ]; do ask "Root filesystem?" "$ROOTDEV" resp=${resp##*/} if [ ! -b /dev/$resp ]; then echo "Sorry, ${resp} is not a block device." resp= fi done ROOTDEV=$resp echo -n "Checking root filesystem (fsck -fp /dev/${ROOTDEV}) ... " if ! fsck -fp /dev/$ROOTDEV > /dev/null 2>&1; then echo "FAILED.\nYou must fsck ${ROOTDEV} manually." exit fi echo "OK." echo -n "Mounting root filesystem..." if ! mount -o ro /dev/$ROOTDEV /mnt; then echo "ERROR: can't mount root filesystem!" exit fi echo "done." for _file in fstab hosts myname; do if [ ! -f /mnt/etc/$_file ]; then echo "ERROR: no /mnt/etc/${_file}!" exit fi cp /mnt/etc/$_file /tmp/$_file done hostname $(< /tmp/myname) ask_yn "Enable network using configuration stored on root filesystem?" yes [[ $resp == y ]] && enable_network manual_net_cfg cat << __EOT The fstab is configured as follows: $(< /tmp/fstab) For the ${MODE}, filesystems in the fstab will be automatically mounted if the 'noauto' option is absent, and /sbin/mount_ is found, and the fstype is not nfs. Non-ffs filesystems will be mounted read-only. You can edit the fstab now, before it is used, but the edited fstab will only be used during the upgrade. It will not be copied back to disk. __EOT edit_tmp_file fstab munge_fstab check_fs if ! umount /mnt; then echo "ERROR: can't unmount previously mounted root!" exit fi mount_fs install_sets finish_up :1 $(hostname -s) 127.0.0.1 $(hostname -s) __EOT ask_yn "Configure the network?" yes [[ $resp == y ]] && donetconfig _oifs=$IFS IFS= resp= while [[ -z $resp ]]; do askpass "Password for root account? (will not echo)" _password=$resp askpass "Password for root account? (again)" if [ "$_password" != "$resp" ]; then echo "Passwords do not match, try again." resp= fi done IFS=$_oifs install_sets while read _dev _mp _fstype _opt _rest; do mount -u -o $_opt $_dev $_mp || exit done < /etc/fstab questions echo -n "Saving configuration files..." ( cd /var/db [ -f dhclient.leases ] && mv dhclient.leases /mnt/var/db/. ) ( cd /tmp hostname > myname _dn=$(get_fqdn) while read _addr _hn _aliases; do if [[ -n $_aliases || $_hn != ${_hn%%.*} || -z $_dn ]]; then echo "$_addr $_hn $_aliases" else echo "$_addr $_hn.$_dn $_hn" fi done < hosts > hosts.new mv hosts.new hosts save_comments hosts save_comments dhclient.conf for _f in fstab kbdtype my* *.conf *.tail host* ttys; do [[ -f $_f ]] && mv $_f /mnt/etc/. done ) _encr=`/mnt/usr/bin/encrypt -b 8 -- "$_password"` echo "1,s@^root::@root:${_encr}:@ w q" | ed /mnt/etc/master.passwd 2> /dev/null /mnt/usr/sbin/pwd_mkdb -p -d /mnt/etc /etc/master.passwd echo -n "done.\nGenerating initial host.random file..." ( cd /mnt/var/db dd if=/mnt/dev/urandom of=host.random bs=1024 count=64 >/dev/null 2>&1 chmod 600 host.random >/dev/null 2>&1 ) echo "done." set_timezone finish_up #!/bin/ksh FILESYSTEMS=/tmp/filesystems SWAPLIST=/tmp/swaplist MODE=install . install.sub if [ ! -f /etc/fstab ]; then [ -f /etc/disktab.shadow ] && cp /etc/disktab.shadow /tmp/disktab.shadow DISK= _DKDEVS=$DKDEVS while : ; do _DKDEVS=`rmel "$DISK" $_DKDEVS` if isin $ROOTDISK $_DKDEVS; then resp=$ROOTDISK rm -f /tmp/fstab cat /dev/null >$FILESYSTEMS cat /dev/null >$SWAPLIST else ask_which "disk" "do you wish to initialize" "$_DKDEVS" done "No more disks to initialize" [[ $resp == done ]] && break fi DISK=$resp rm -f /tmp/*.$DISK md_prep_disklabel $DISK unset _partitions _psizes _mount_points _i=0 disklabel $DISK 2>&1 | sed -ne '/^ *[a-p]: /p' >/tmp/disklabel.$DISK while read _dev _size _offset _type _rest; do _pp=${DISK}${_dev%:} _ps=$_size if [[ $_pp == $ROOTDEV ]]; then echo "$ROOTDEV /" >$FILESYSTEMS continue elif [[ $_pp == $SWAPDEV || $_type == swap ]]; then echo "$_pp" >>$SWAPLIST continue elif [[ $_type != *BSD ]]; then continue fi _partitions[$_i]=$_pp _psizes[$_i]=$_ps if [[ -f /tmp/fstab.$DISK ]]; then while read _pp _mp _rest; do [[ $_pp == "/dev/${_partitions[$_i]}" ]] || continue [[ -n $(grep " $_mp\$" $FILESYSTEMS) ]] && break isin $_mp ${_mount_points[*]} && break [[ $_mp == '/' ]] && break _mount_points[$_i]=$_mp done >$FILESYSTEMS : $(( _i += 1 )) done done cat << __EOT OpenBSD filesystems: $(<$FILESYSTEMS) The next step *DESTROYS* all existing data on these partitions! __EOT ask_yn "Are you really sure that you're ready to proceed?" [[ $resp == n ]] && { echo "Ok, try again later." ; exit ; } _i=0 unset _partitions _mount_points while read _pp _mp; do _OPT= [[ $_mp == / ]] && _OPT=$MDROOTFSOPT newfs -q $_OPT /dev/r$_pp _partitions[$_i]=$_pp _mount_points[$_i]=$_mp : $(( _i += 1 )) done <$FILESYSTEMS for _mp in `bsort ${_mount_points[*]}`; do _i=0 for _pp in ${_partitions[*]}; do if [ "$_mp" = "${_mount_points[$_i]}" ]; then echo -n "/dev/$_pp $_mp ffs rw" if [[ $_mp == / ]]; then echo " 1 1" else echo -n ",nodev" case $_mp in /sbin|/usr) ;; /usr/bin|/usr/sbin) ;; /usr/libexec|/usr/libexec/*) ;; /usr/local|/usr/local/*) ;; /usr/X11R6|/usr/X11R6/bin) ;; *) echo -n ",nosuid" ;; esac echo " 1 2" fi fi : $(( _i += 1 )) done done >>/tmp/fstab while read _dev; do [[ $_dev == $SWAPDEV ]] || \ echo "/dev/$_dev none swap sw 0 0" >>/tmp/fstab done <$SWAPLIST munge_fstab fi mount_fs "-o async" ask_until "\nSystem hostname? (short form, e.g. 'foo')" "$(hostname -s)" [[ ${resp%%.*} != $(hostname -s) ]] && hostname $resp ( cd /tmp; rm -f host* my* resolv.* dhclient.* ) cat > /tmp/hosts << __EOT ::1 localhost 127.0.0.1 localhost : (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h ELFa(t4t4 (OOOOOt#t#DsDD$$sssd 444OpenBSD -LLP@0! MP@ -0P 0LS`@p0 o]/ P000`P`0  R \ *0  0 R Q:00@q!OHq! 0S SX 00-SL@  @1S@DQ@Dt @Dt0` -LM$@0S0SX -( L0S 00h:s  0S00s -LM`pQ 0S5/p@PPPQ #P Q088 8aQ  OH`` p-PLM@@P` ph 0-@L :PP \2]\O 0OSP8  (0%0SP]O`h`, -"Ē<LM`00 娂R 堢2 pM#P=〢xxS "PU 8K`0   ^ 8 @0Ÿ8@ ( Rx  0p0000S0  10S0 0 B W1!0S:  1 R0 1!00 0 X" @0S 0S > 0F" @0S 0S 0  ! 7000  0 t0 R|N\8 p>8 `u@us uh0' L'u\ vl'''X''(@(d" -L 0 @uu -L0u -Lz P00u -Lo0HS - 0L  b0 u@u0@u - 0L  P0 uu0u -L0u -L0`u p-PLM, ! `,PK(@KF 0( `'Pd( \ 0 0,00 P00Qp( =  u( v(! 0-LMK Pp@J P ( 0b0CSꔋ ,80DS 0xS S *S 0 |=0S"P0 H=00E0J0A 0 Zs)P p-LM KPJ qd P8 0b0CS+llllllllllllllllll`P$K4 V U"90 5= 0xS S *S 0 &=`P0E" $ VUp`P%%K5`P*%F:`P!%O1r 0 kZs)P 0-x0L\lP dP 0aAq 0A q 4@0 S *0 v@uu0 R0 @uu -LM|0PS l @Q 0 S Q 0 SQ0000CA 0 b 0@CR5 q衟0R !\b QU*P U 0Q0M*P U0 U0a00C00Q*0 S 0 0 aL 0 0R0 * 1R0 00 R 0 S 0000 S 0 S 00CS0  0 S Rt00 B0  U  0R*bJ\ *P U QP*P Us@uuu v@v p-LMxPt` \pp00l0JL00 @@S  0  c5L0 00@uu@v vu -l1LMP\ T @0@DtPC 0@D t E$ 0PRp: a00CP:0S S1 P"* 0 0 0P* 0p0bS0P* @R000b{J ]0e@ pJ0 0 0 @P:0 S v@uuu 0-PL0S0MY 00@CT:0S S TtP5* 0 0 PP@a@ 9J0 0 0 @DT:0 S @u )u -LM#d$\$T6P0 r D@00Cs0 -00Cs0X@huHS -XsLMPH30443 R0 CP#00 R 20Sx0@9DP 2  00ra P 0 Z ; SL x20S !0' < \R\BX R0000ӑ0Q@$ihRB  R0000ӑ0Q,A  A Q0000ӑ0QxQQ0000ӑ0Q0`@%,"" k$a0P 0CP 0CPW묀0  0FP_0 0 F P  Q W FP 4\]:@u\HSu8) u@)`u v td`v@fuP)P`) 0-LM@KDP0: S  0g6p 0q0S000,L KPT"P0000 Wm8@P -rLQ 1 Rs*Q0a Qaa  0J \PA[ @0 Z  0+ 0 P0    00 0A001 ?0 00 0 0p00 05 І P 0000 \000 00<0 0 0   Wu@v u@uPvu -0LM Q' 0Q" 0Q 00@ @ R  R *pQ b  bI000S h 8vX \ uu -lLMP p XP`?40@_ V0, 0V0 0 0 0S 0pf  !900V0 iR @!*R0 00bG0Y000 00 0 < m0S` 0 _Vu@vt)))P -p"LuM0d yK,0 f1!0a S `!  B! 1 =9 =1 . P@0 r/ p`Pno 0 HP PoOK!dPP6A I R wK t1 RpVOKd0\!y6A IwK P $1$P@K!0de6AHv/K0吀K, 10ϠAl 0  p`0d PB6늁H 0v/K  U'40 ,0S H,GD.A?o!`v)\(**(*MbXv<*x* -LM⭀@M몀@ -LFa" -LM01 0`p0  P 0 pWp@0P`0 0S0C00   Zt XcU0 `@%,"04pq 7@uHS uP* -L Mq0^ O `0P@SD )P @0 PS 0S'00 K3K40,0 p  0 @ PS ~V0 P 0@ PS 0S T 0S 0S2[ 8c8X0 K00 , P0 `@%,"03pqumP p-GML M2 `@P d "dp?@E 0P8ԥ̥ܥ````F-K0 B BJ0 @bTQ7ANK@D@DP傅P 4 04 04 =K0C 0CT $ d m;PZ0-S D6 8JT0$(ETqTo!+ |!*@Q++++ -L06 N0^T+` -LM`PP( @(K,pK 0  (0@S @T -L M0@p00 0Sf قPP 0S nSW =`P0`0@Q P QIQG  0V0P . 0' Y0  0000V 0`0 ,K\, ?R0S@p @~0"Sl 0<6Y000 LPH00D 0oSP %6묙,,D,L,\,x, -llLxM@P`pT#cpA P0@$S3갪ĪЪت`p2`2`px2t2ch2 R\2<2L"0QQ@c 2 Ry`K~Pp%S0S#pPU `@FUP@Tjo U P1 R  P1S j:0pS `K@P40: S S' ?P0 R 0  DWP pjO0S  D SSpPPLS<?5wv,`w@wv wv |!@Q,,,P-,- -LMp K@~@T` P P@ Tj_ 00T 0-x0L0PS0@Q  nP 0S(0 R00 R0vv P-L` 0S4nS 0@ ,P@=l0PP@p` ,Pp@0oS` %RT-vv -蠟L0S 0 R0 R } X @ Pp`0DS 0 PUjOvP D0\j/T0 Cjoj>vv w p-L M `K P@ 0s  p龀pd-l- -LM pPo5G"%$0 0o -pL MP, 0 嗀 0Ct2 0R `00 @T TsA`ATu TshAUA`Te Tc]A ZA, 0d00SP XP@D00 ,.  hMd1 R/ @Tj' ߽X`PٽT0   P@0 P*To&  `P@0p P@P@ @@ }?Y@At-w|--@w--  -0LMPpP`)0 R @;$0 C 0 @0 R |W@ $0!@Tj_\ K$K,@@@C$00 wv---@w-..$. -1L4M`, P!10 00 0@C,0P 1PTBp< AH0`JZ/ 0@K 0C@`T9 T7 _@ L@T) T' T@Q@T T I@F@ 0@K,0<T00 JZj 2@0 ,@ '@ 0мP@̼0  0PKY@vH.T.`.-. p-LM`@>PP H0S pP000P -LM`@P0p. P@ z0S T  0 $$] z.` -0L L PO`. -qLMʠ`0 P6 \P0d .40( 8%P<(@dl @ed, 0C0  $H0QZ T@ Z @D  wTD/ -HL M, 0 [PnP #1RL0S @D@030(2?Pp g@*?B`@$?v#,Pc P 00 0b0  0 0$ D0QZ T@,Z @D wSD/ -AML Mh6 ``f@Pp, L&H_po ?0@8SxꐽԼ 8@85 ,`Pzp0S QP4 R'-CP4;P4 8$ 0@bT<4 Q T Za aP`4 / @A0S$  A0S   APP 0SP(0  P6P<4 08$ <4 <$0R08$R0S =P 8NTTMPP B.K B B8:P@ 4Pzp?y0S 4NBK@@yP 8$RP@0DrP@Tj_0Tz<2 R  08 4P,8P1 R]BKHHP` }P5 P0 ` + 0   @P 9P`| 04D000$ 04~ 04T  0TP` E0P` @ @P  @P  @P tP`x0 lMo!/ |!00'+\+@Q00$0t 80H0T0X0\0000,-+ -PLMP #P` @ pKa@ Y80S@@,| 00S00@9鬙 0-P@ 0LSP  0S0S0 tV -LM M'}KpG pG, P@5~Pr #T@U `` @P 0S 8PP @KA <0A؉ 3) 0QqA9  {9@X tN882 ,0S ,_;{9@T,p@R P. 88KAA {P9C42 R uOK9PT|P ^9 LH|aMK@D0 @D!,@ozw0Sd 2|0Sw0S L 4&|,#|g8uKw9P+]KZ gP^K  `P@V0 Ry IKA 0C{pPD`?0StPP@+ 0=LT:Lo!+DH:00,0BW11 1H1P1`1+\+ -L4MXTT `Dp0@, p{ 0DSH  T X' R  0S7X z @TP 0S T 7 DX7' 0z0XWSp >PBO0@g8WX<' 87 zP 7Q' 6Xz  6X&z @ 6X&|z  h6XdX&z0S   R 06X(T0L&yz0S$ $  R 5X0&iz0S( (  R 5X0%Yz0S, , R p5Xh0%Iz0S0 0 R 05X(T0\%9z0S4 4 R 4X0 %)z0S88P 4X$0z4Xz ,0S ,90Sj H4X<$<`-PH X Lp >P \ >P(0BOSl !l Rp^ 3Xğ 0$Py0Stt3P d3X\#0p =P`0BOSl Yl RVp^ 2XTßP0H#Py0St t ,3R 2X0#yx0 x2Xpd"yx0 L2XD8"yx0 2X "vyx0 1Xp"kyx0N 1XP"`yEp8 t=PBOl0 t1Xl`!Kyl0 H1X@4!@yl0# 1X! N=P0BOS 0 0Xp!`yTKPKD&0PTxX@@90 ! P y40H@KLKL0 000Ky1  xo!x1tVl21XD1X0111111111111122Yd 2(20242]<2TahL2X2`2dh2p2t2+|222222\22\+ -LM` KsuPUp@ OPP TGP UjO 0 0-x0L0PS0@Q  P 0S(0 R00 R0逗 P-L` 0S,nS 0@ ,P@*5l0PP@p` ,Pp@0oS` RIT- -PLM`p 0SP35?<@<<@@4PP 0 p))I2 -LM@p`PC Tp KwP  0S -SH0=1@ !@!uP 0@0@鬙2 -L M$$@$$$ $0@eI22`3L3|3 -L@ ;PPdP%PP aPpl ;PX ;P` @ 0I( IX0T03/33 p-GML`1 M Xa T!P0@4 8!Xp ?P -K BoP B I1Q0@cTQ?ANK@D0@D4 yP# $04 04 =K 0C/PlsPx Pl cs0$L*-P@ 4NHzHo!@Q@|!J3 |!/4444+ -L0. T$dH 5` -LM`PP( @(K,pK 0  (0@S4H -L M0@p00 0Sf vPP 0S nSW =fP0`0@Q P QIQG  0V0P . 0' Y0  0000V 0`0 ,Kb, ?R0S@p @r0"Sl 0B*Y000 LPH00D 0oSP +*묙,,D,L,\,x, -Lr -ML M.0~`P,0 .Wp B0@3Sdddddtddddddddddddddddddd,Td|ddd <dl= H>@ B:P  <:P  6:P 1N<< = =XLP d x=,L :P < \=,<|-<< << ; ;; ; ;;,; ;;,;;,;;,p;l; \; T;sP; }@;<; v,; $;b ;,j;x; c:q:+\:j: `b0FSQ :M>KQ0C0C pp   InK`F`F}3P@ $`kFY0S 4: S < FMKHHș@ ( 9Pv9؉9^@h9 9T D PQ R$ U9 P^ T Q R U(0  ܤ0J   H/Z 80380S5 0S  8 R 8 R8 R  % R\8 h8 R`8 R 5 Se  88 Rk i U Up80ly( X00R00S7 P 0@ P 10135:3P 5 X7 R 0B$ 70S4 \7 R R0$ 70S4 7 R 7 R\$ 60S4 60S4 6 0 S4 0$ Sa4%S04 RPؔ6Y> AG5 Д0AP,  <56X@JP 15dV000TU 3 5#:,P( 505V00X@6h1h ?  56``U 0#5 %* % U UU 4S X0 4  \ P  @4ؔ  YRJ^   4$X T \% P ؔ PY0 <U U%1 ATE Uc cc4Xe 00S.K05 \pt \ IC6<0S@#/Q 0SKoP\0@  TS050P5 P  P㬄 X#%*X4dPP<5 4< 05 0@RQx1' <%!q0`J  0  5 SP L S3 p0# U Ugg Ug gg G4X 0H,଄  <Ja 84` 0} %P@V`!X:5 S S V X X42 v \b 2\b`$"#00C4 D4R 00UV `Ps4S\004 e$ V04 0S03$ 54 5 X4 (4 $ t<Qp ,0 S ,2o! |![иd7x77777 77@`7`6678 86 @`@QP08X889888 9L9x9999:D555LTX\dhltxgfff 6 6@6P[| 6P6666677NK@SNK4@@4 V I/P  4$S440 $ 5    ^ % Ue0Vf*0U U00R00SU $0R eVU:PU L U0#03RQ $$?p ܤ P%0W^  Pd \0#03\030"S3  `Q2P,<"(PK0d1P ^ U * X  PQ ܤ zDp 4P  5$ UP2Q 4( Td0 25P%$P ܤ0 0 P B24P%40P$(3R ^3  X4LS \ R 0\J>Kܤ0C@R0 00aAU0!|rP!d0B!U0PBBBB@B`BBpB0BPBBBB|4(KM.KP B4`( Kp$(0K4(K4(K-K0 B$@5 (K 4D% 0K.KH5 4 B#4 `5 4L% $D PT"$`lK``V! ` pK @X K DP,Ġ KHQ. ,KL R$D @5%(PK(`K@d! \!4 $ X! $0@ P \ 5 )0R`06P$(6R0/ D!b0 $v> 0Xp6BNKx6Q%̠%4%(@D@D0 P5&m" 0S66TQ$0 N0o00  e T |3ܤU0 U 0A AH7(KJ.KP BX7(K`'(0K$"$d% $$PT0!l |! D! `0 @ p lKd`V,Ġ@ `000 q%4$e4]$ 0` > 40QAV>d8U U Uʠ 5$ V:%V#AU8'L40S@.cc21T5l ,1P0!01S030S345-*Q$H9U! $UT  h9Q eVPR 9U  T 9R UP9R R/5 PBNK@D@D*5! P /p$ e .Pa4: S ܤEnK`F `F @P0   %#`\d4S: 8j\d4S0 T(Z44 嬄 D D ~gF -LM@(KnlP`4  3Ppp0W0* R00S 0rS`Fv (P@ 3P0@Z`F T )P $P (0vj?(0 @(0 T0#D:H0L: -PL`p@PDP @T:T @2 "0Y`: -LPgM/, `+wPBp  Q q00  R P\ 8Ÿ q00  RP 0`SpSapCP 0S.S  "00Y00S ,0S 0S 0S $0S5MK  pI w8pW0SH00Y00S(0 0(0,0S0,00S' 0S $0S ?P $0 ?c02 $00 ,0S ,O.0 {$, u (l oX xdP@ <4Uo0o!4q|:edA:A:77::: -LMpnQ5Q/wnQ& pn,Q0S hA4 0cnan`8|@|PPXnhVn<Q@QnLNnDKn<Hn4En,;H;T;l;;;;;;;; Q-0L $ Q*  !;; -LM`@p.j $KP'j0S0S 0 !$0 UR#U; p-LM`PU@ T<kPP UTUpT;- 0\ \8 0000ӑS^ 0 ^0@f Br0 BS 0r0 -ALM3 0 08 0 0 0 0t 0d 0T 0D 04 0$ 0 0 0 0 0 0 0 0 0} 0x 0ts0l n~>`;0<H<<<<<<< = =0=H=d=|======> >@> -LM00PKa@ 00 `E PpT 00PUI `@uT> <T1  0BS^V 0(` 0 0 0 ?R(0  -R   4K P@ 40 R0 0(@?> 9> 0P0 0( d 0P L">< 0` PpT>LFxFFFF8? P-L A > FF 0-LMt@ 0PdlQ .j@ 80hl0(0 }l 0ST>G0GHG -L M0:,0 P0, 0S,0 1 ,K( FlP`* 0S' =Ppw 000K PPcU@c iTJ lT? oT& A0S 0U 0SP,0SP0AS0 [ 0 0S4 P  20P000 oT (0P P00(0 0P00 0  0P000 iT 0P TmP00$0X /P000 .,,0nh?PGT>TGXG`GhGpGxGGg -LM `P0p-S000P(K 0(P P@  0S 0 Q (<u<p \FG D0h0S $ "-,0 0$  -LM@妿00$0 C 0+ 0 -00 $0 0 0+ -0 D0- -L M0KS0@0,0  K 0  0 0`t -LM@gh0 00S 0 $: 00 $ 00 $: 0S00  <<  00 0 -LM@5h0 0 -LM0@S  h*= 0 << 0 -LM@00$08  0 0(0-K 00 $ 0g@+$jH -Lhjhn -LM K00"}P;tH - LoP;nt (H - LaP;ot 4H -A0 LR`P pPJ RDA R p P3 RA R pP R@ R pP 0S 0   0 p  0$  $ 0 p $ 0   0 p  0  0 p l?@BD -LMl \, P`p 0LSD ( jg@-T 1 iW%X  @zW $8W8zW $8qWh8hW H8_W $(8VW00 NW $7EW@ $7<W  73W  7*/W00SW $ T7W 47W 7 W 6W  6W $ 6@W  6W $l6W@ $L6W ,6W  $ 6W 5W  $5W 5W 5W00 lWP5W $05W $5wW 4n@YW00cW4ZW $4QW@ $l4HW L4?W  ,46W$ 4-W 3$@W 3< S S 3$ W  |3W $\3W  <3W  $3W $2W $ 2W: b0S Q KdeW " @ ^ 0K0 P" XK 0SXL1 ,0S ,'KeKeeK ea0S @K00!dk 0Sn}i S  Selhd`oI p: @g4g( go!LLLDK4KJ,JLLL@HLHHHDHTKLM$M0M0B4Sl4ScP0SZT0SRP@\0 S@PFUں(PU@0S PU@ 3ia  0@0p 0 X 0S S@!18 0 0S S (   0   @ t@ \@0 M0 lETT^U$UTTTTTTTDTUUU_U U0U8U@ULUXUdUpUQ 0000ӑKS @f -L @`K+. њP<@pK8@a , 00p( 0S 0ٕ\ م!,P, H 00S S ,(8"4\ 8!R,`00CS0,p 0 0, oL,0 8Q M! ,0085!PH ,`*0 CR ;,p000 08@0!0 @,0`08!P ,p*0 CR ,00,,0) CR , 000R,0R,0R,, 0 CR ,00@fxU_UUUUUUUDUUA0R ,Hr^ `,h0K0C 0C00 . P6V4 @ 0S44X0N ` 0S44l 0 0S44H 0 0S0  44044 @V 0S@40@4 - { P+Vp@c 0S` B^KPEPE 0%04S  4 44!\0Pp@G W00R00S=-B~KpG pG  @P" 9V `= P  5 P   / P  ) P  # P   P   P p  P \ P H  Pn 4 PZ  P@  P'  P  a0BS0S8a AR:R `0A8RV< B.K B BD$ r@D4` 044 SV b@ D4`r044 S<$V<4 `- OV@U` *0S OP &PU:q60  00S044 o04S44S d,044 0< 0<$ PU< UgV* @ `D4)<$PX V"  @D4` <$4 <4V (%D4 <$@:|,@@ 3`,@40@4 ,V* @D4` <4P V D4 <$4 <4@  D44 <$0aC1 0 V,@@ WlO,@$ @$ ,0 @qS 4,q $9,@40@4 )2,@40@4 ,, B^KPEPE0 044 ST  0,@$ @$ B^KPEPE0 |044 SP  0H,lB^KPEPE0"i044 Spt  0+_B^KPEPE0H"U044 SptB^KPEPE0"G044 SptB^KPEPE0!9044 SptB^KPEPE0 +044 S<B^KPEPE0 044 S4B^KPEPE0 044 S0B^KPEPE0 044 S8pB^KPEPE0 044 S,yB^KPEPE0 044 S;;S(| X,440CSpבxʑ a+@ @ (o!YYp7P Z4P^ZA8ZDZHZPZhZtZZDE7ZZZZZZZ[ [ [_T_4q@[p[[[[[[ \ -LM(0S`d ,0S 00SH 40S Q| 80S0 ,0<08S804 <Ph (nPaPY (gPR8SIPU@0a Sp>P7<P-00S$0S0S8PU@U2 \aP 0 *PU***< * *8**x*l*`*T*w*<,\<\P\\\\]8]p]]]]]^,^ -L3Mp0moKPe/OK 0 e/ KK?KH2 01 2e/$1 (  0S o!@^ -T1L(ML@@K @ 4q0$Q@K`@@ 0< 0C 02 0H 02 00.  0 , (c |$tt  5 0`0XB )o!L^D`l^t^^^,_x___`P```aaHa82P *0P ": -ML M N~KpG ) e/9 , Q  bP \P  SP ) KA ᎞K BAI I  !   P@j( K0PS44Sl +U(K0S (K @4@44 @@ @\40*S:\4 X4(KS:X4 0mKS(K00 Ue/뎎KH9 )4P 00CS00  ä0U)(K00qRP@ hLP 0@pS1S@]@]@]@]@]@]@]@]@]@]@]@]@]@]@]@]@]@]@]@]@]@]@]@]@]@]@]@]@]@]@]@]@]@]@]@]@]@]@]@]@]@]@]@]@]@]@]@]@]@]@]@]p dVp0( KBNKa@D\0 (K@D . 0<}o!Ld`dddd e,eLexe p-RLM0@`+ a@ R\0"(\` ph ^0S  0 SS S0d0T!\ phm (<<P0, 0 ph,`Lee`eef4f -SLMp 8Ka`N‡PV(VT` Pc 0S0Sy  PK 0 SSZ, [RW R08 0R 0i @T0 4 0 S?0S< 0S P408    P`1 R 0SS 0J(U ` V P+01  0S0S" U <1 Q *(1 Q :0S S R000 00000 0& ((PU2UP 0S S R000(U @@P000 hLe`fegg4f -L M4P(@pR1 R R R(R,R0R8R4R<RRRRl@0 @@R8`V0l p@a8`VgD`VV(V8VLV`VxVVVhVhdW\lWP` -LM&KPpT b[P1^PD1@0!P * U:U: Q:Q"P^^@(1 Q:00Q$^T 0`S 0!@l0Q` PS 0S`0S@0 -RLM0`pl a@QgJ(T` igR 唀R 0Q  0l!00`1 \ p; p0 3 P 0S S" P0bS0c00 Ri7 P i*0 `0T< 0Sh. 80iT (@@<P0`Lee(hdhphhhh4f$i@i p-LMKP@ [PTPT`0 R*0R*0@  [PNp 0c -a0L0p@TP  1Q pP 7P0 S R @000?S T S 0?S h`+ NX0 ` BR X0  äX0  _DtiP` -AML M4 8 , - MK 3(K 8 BnK`Fs< `F P  RpS3(@K @T 0 0S S@D00(K0?S (K0*S 3(K RTD   0SQ"0000ӑcS &S %S 0@-S+S@84 0D LBK0A0A[P@L0"S 04 Rf<4SZ0 0MK -q8+\ 8-Q `@  00* <\' ZP@/48`V%0 U/ ܒHP V  @0aS@ lZ  0P ,0 S , 軒 跒P@<lⶍ0 &L000@D0ހ ݓMK4h <0|gbSe4@D( b<$ 00]??Ao!idii_P`Y@0@D0ᰀ( O 诓-K0P kS gS844(< @DmS/4$(4( 4480<4 0(K RO L( K0?S X0  BR X0`  äX0l (m -LAM MhB>K0C0C4 , @2(K0PS`V2(K \ @ p  0@R1(K T1(K `\e 1 ,0S ,y 0h h0C B#b"Baa  X8 < HOLRLH 0pp+, 0pp$Y 7 BKJJXp@8<$)O;K  ,CeP 0(K;K, S QQa B RR24  4 mD00CS0X0  äX0 o!iiiP`$j -$LkM0Ke/ ,0 4dN0!PP P@ P' @T`t\NX 0@@N T8@ 4T00CS00  ä0 yT`@ WPP  P,#3P P@t x3x t,@0\#\3P P@t 3  t0@8 # 3P Pi@t 2 t}8@4"2P PS@t p2pk tg4@<@T44T" L2@ 7p@S pb <PRR0SS T * R 0 dR0b00S@<@P!1P P @t T1T$ t Dh!h1P P@t 0 tTD0 ,0S ,k 0  e/x0 a00J h0h@ H0o!PjD`:tj ZP`jjkXkkXk`hZxkZkklZ,lXlZll$m4f0m -8@TLPp60S S 0 (S"H\T& B P`$ 8@T0S S 0R8#H\T@<0 P @Wnhm -LXM|`K@X pPP 0rSP5I |0@Sb00C8S+J)JMa嘁@M T@ p1GT0\0CS0<0  0DD PP 0P* @P" @TL 0@L T@ 0 T00CS0 @00T `Px0K @1SO,PemmD`P`kXmm Zjj -LMp<P@ 0P@ @p <P*`f ax x0P@ @p <0 fP0 0`mg((0 m(n8nhnn4f` -LM"KP< @0S0 @ 0耟  2[ 8#Rp`#P1 0 QS*10@  P 00!10 3 P!H0@ 0R!705@20  0  0 < 0 A-p刀0 P0b0`Q0S S ^ @ 0S0T0%0n 0%!Q -0LD0C6S[ (08@HPX`hpx\HhH@<840,($  HHHHHHHH~H|HzHxHvHtHrHpHnHlHjHhHfHdHnopqDr4svxy0{|}~<H܁P@d̃<d؄$Dhl -L`pPAT 1SPUA)@@:P   p-LM`P@PQ@TpP Q P pQ -LIMMJ~KpGpGP @ , 1JnKS`F1A@TP  P0rSP /RP@ PrU @1 ,0S 4,C BKI0I0 0!P @0@@ O PP 4S JnKⰀ`F10 "\a0@x Tʄ1SBKII  0o!D:l2hl` -2LMp`@0P0 $ \0 P~ 0 ~ x 0p ^\ :` 0X ^< :O, KdW `h0Ԉ4f -LM`pP@0 0 08!0 01QQ p: p 02 X P 0 0S e_P V 0 SS Px0`000< 0S40H. 8 0\t`hdh4f -2LMpP0 0|0`` `@t P0P tT @(F  l`h4f -2LMPQ  0  @ j@t 0& t 0T:` pW; 0 ! \l< X0e @ ,0 0Uh` \4f -2LM`px \p0@PP@ @| <0< |+ $܋`h4f -2LMP 0 Rp`0 0` `@t 0 t 0 @ 0xpx!t}P` @P @T<H 0 0T @0h`4f`x Q-Lp`( P% P# P! P !@R EPP M@T! 0 /\ P>P oP jA4 $0A$`4fP0S  0 S  -LpMpK`PW0sep @@T X 0S@ 0@0P-HrdAedA4T -LP\p@` 0B0C3SOlܔܔܔܔܔܔܔܔܔܔܔܔܔܔܔܔܔܔܔܔܔܔܔܔܔܔܔܔܔlܔܔܔܔܔܔܔܔܔܔܔܔܔܔܔܔܔT <0( ,0P<0( ,048  1hW <0( ,0P( 0V ( ,0P<0W<0( ,048 ( (0R, ,0R0 00R4 40R8 80R< <0R@2 44 4?P$ o\`x؍|4f0 P 0Z<0 0T2 -L8M0U@p 55 u  % 5P괖xTT$4@  $Pp 4Q 0SDP Ppd8P(D0: S  S  S0 0p{ 00 R000Sg RȘȘЗȘ?;#003 <0S c#?;0P@ ?LD T@ ;00S  ?+83 0S,3@T c ?h2"@@ 0S H2 AR;;S" ":00S 0S 2Ql2l"d2T"H2D2qB0S0||\ KV1Ps1 0@ 00 ~B!0!N@ 00 otB0!@@g1*jB0d!6@T P!*P00p 0Q  OB0!@0 0T  P9B0 @0P 0<0  H0ı@ @``@ر̱ m8@ 4Hd -LMc0Ss0S 3 R S0S3 Rx3 R lCP~CP,K E0S 3 R} 0 0R R B 0 S "000 R2 R0S 00CS00  ä0O00`V< |2|P  Pd@ 0S 0+0 4r00Ÿ0+ P 1q  B0 @@A P10 0PhP1` @ 0Xj$1 Wu@d0AMPQ0: SM8 @TH0HG@C0 R㬀 00CS00  ä0|0 )' ݻ808 $0ı@@Ա@`Dȱ س@(`0 -?MLMt0t` R   0S P jDp0S?KK@D0P@D?+gPo!`̱ı p- LMP|Ut`0   p~@0T ;Pࠡ@ ~>бıl -\0L RL H0 @R0,0, 04>01>  0-QLP) 0S-<0  ^gP@ڸ0 T ;;S0@0T@|0 t=0Q@\ 0T >00  5gP@0 0̱ı@ ȱ$ -b0LP@@xr PP PX"000SQ갣HHHUڅ;;SNU8U0011 U00R@@T U 1 Q P=?!0|!=l1 h=\}=,?0S ?0S ?0ES U0P0 0} R0Q/9PU?0 S ?0S ?0S ?0S00PX;=00 000̱ıб@DH|ȱؕ -1LM R*ʔa0S& !00CSYxx0Sp1  0SK0S0 0  0S<<[0ȌlȠ@$ K$ @ P@0 HP U0S \p0 @0T@_0 0@TP 0Q00000̱@@`<lım -P@LM0 U 5ࠟP.0 R  0p`W 80 S80S*0S@0Q>@ <000P̱ıЖ -L M䁟P@P!0SꬩXlUTC<0000U$ha 0P RQ R 0EQ>!N< 1 R r> T:P0U$`0 [0 njlȠ( w`0P@( Kd$@ PH>$0H <<Ṯı0ȱT|mЗ -?ML M0S?KK (@D, q@Dr q!(K0?[K<(PE0 PE00 PAO0 0PR?KK(@D@D?+dP`E?+dP;@@ (P+X@ P000 P ,0 S ,K=0 ;`;=t ;=` =X =P ?+dPʅ̱o!ım З8` -LMtNK@D0 @D (0 sP~ lP \T0SP4 R D4 R8d8@ uP(0 S (:@ aP  [P 30S S S 3 ::#NK0@D0CS:@D|:x:t:p:l:0S\ ,0SD <3$ K\; ,3$K S0LR5 &S0ꔰddo0S2TsT:<Q:0M:,K:Y:0S :0S 3 1$K\ 0S/:0 S80Sa0S]P00l!0h0>:,00:0!000091  0 98|09NK@D@Dt< A:n< ;:o!б ؘ`ȱ4@`dؙ k$Ddܰܚ  ̱<X h؛ -LM$`KPp@CP)O0P" T $"$WUT $""d@$IG 0>P4 ""@Ա$Y4D -bML0Mⴁ0b]K(0 $PEP$PEOa0DPI0 PDl1 R P= P:@pKCP)(10 CRbMK$@D S,@D0 <P<'P +P b- P0(x & (0S T(&P'P  o!DdP` -ML$Mĕ0bmK,0 a(`FP$`FPu0DPJ0 PE1PBp5 R /P;DKK3D -LM\q0`SN H!3#c1c0cAT R$0S8 Q0S. T P T $`P 00T 0$`00  XPl0(&PC3dAd@d@000XRP D -LpPP 0S ,0SP!&0aV 0S [P0S$0 0@0S# V ,P00 0$ 0 T %P(@_`PP0000@= -LpPP 0S ,0SP %0aV 0S P0S$0 0@0S# V P00 0$ 0  %P(@`PP0*000` -LM@, 7aMP@ 0S  -1LM 0 bM@ ^0 - ! ^  ^ a0 :#:900 P \0  ^  ^ ^  ^    0-LbM(MPbMK@D$@D0p 0 d0 KX0P  0 1@0 0 0S 80o!\ D 0A0- SPL@ 0^0S8  R0S7+ 02+0 -a- `L0Q!0p@[ P30P d 0p QL  +4 $+ PP \x0 KS- LQ0P 0鼣 -PL@LPgb=0  |1  d1  Lq0 41  1$  1*  00   0A0a-   am` ; P0@09P0: S `0  ,h 0S HP (,$0H8 W! -LTMr0 $0 @!P2b- 0LS`P2`  0L`pPKS񟗞a=0A 0 PP2 HD 0W P,2 0O P 2  *$0 S $1  09 P1 01 P1 0) P1 0! Pp1$ 0 P$1* 0 Pa=0 0 P; 0 PLPP00S S S S  Pd0 )@0l A 0 Pv Ao!0ģq (,$$L0 mS- L0P 0p0 mS- L0P 0x0 R -2LM pR@ nPb0   E 2  > l"0 7 T2  0 <2.  ) $262a-  am` & 1>   P F $04 4!N0 P V $04 4`!f0 L1^  P@:0@0P3n000cCP) 0: S `@0 0S@P0 ` `,o 0S P `@0 0S@ Pn#R (,H8$0 |0  -H$L|M0 ,0 ) P $00CS 4   4圐K R 0  P3=6K 0 P7#00CS,,,a=0p`P@00S@b-P ``06  P03 ($3 0t P3 0l P 2 :(2 ,0S ,2 0U P2 0M Pa=. 0E P`2& 0= PDR>0 04 PF 88# 0) PQN0 0 PV 88# 0 P^ 0 Pp nP/P*Pn000cP@P00S S S S  P<00cPy0 'sq0b= 0P@60 0 PL [b=0P@06\  0 P o!0q ؤ(,$qQ-H0 4S Q 0 S  q -LMPpPb@03 R 0#400"400"40 0"40  0"40  0"400"40 a͠$ 0 `48 0`  !H8 0Da=$"$2T:0D0P300cQP*!0: S `@0 0S@P1 ` `,o!00 P `@0 0S@ &P0 400 400 40 0 40  0 40  0 400 40 a͠$ 0 `48 0`  !H8 0y (,$08H P& -%L0M0 (0 H P4H@ AR4  0AS8,88HPa`%<%8.K-0K.[- [%<$,0KP0K+K(,0[+[pPPČ%H8 0P`KPH0`P@P`b- 0^ H3 &S(0 S (0LS#H@4B0KAKB [A0[4Pq 80D KC0K 83H@@ 4#H0 4@0K?K@ [?0[4P#H@ 4>0K=K> [=0[4P" 4<0K;K< [;0[4P" 4:0K9K: [90[4P" 480K7K8 [70[4P8"@460K5K6 [50[4Pa=@,@8@4 K30K2K1K4[3 [2[10[ $4(PpPE400K/PK0 [/0[4UDKP2P-000cP@P#D1H`0S S S S\H  fPH<00cPLH0 e%EC0HP H 0 @@,@8. K-0K,K+K, [.[-[+0[ 4H0P@b- P0@/HP b=0+ K. K- K, K#o!08`l (,$ -0` LK$KP >P0eP| 1Pb'd 0QpL0L P0, % `(, Q0-L@P%uP/0 R#0U0 R0S 0;0 R0 R0 R 0a  00h0P0L0L P'0( $ гԳ8(, p-LKtM @`KP>P   \L0  Fp$p&0 00$ P- 0P ) -LpM`@KPP X0PpWH0P 0R ,0 ^A$P@p -LtMpPK@P1 R* 0R5 0: S, ,PP t& 0Q` P X 0x @/$XW&0L #$P 0R #@`Ԧ -MLp4M h4p , t *@$00C S 4PXl4 P3 RIKII 4S+P) &#0@P \ |3 Rp3p P0L## 3 ,0S 0,`$3P 2 Rv 2 }BQ R0P0 R0S"0;0 RXQ B0S2 R 2a  0!82h P (P0S(B B0S2 R + 0IKAAP!~0S$h1 r+ 0l%4t!8#g1b1 0 BnKP`F`FU!;4: S7{p@ Pp>% 0#)0 %  x "; t X o!``(,гԳ880d p-LtM`KPNP 0@T0: S +Pp$L 0"pmPVp$ p@ԧ -LtM0@/SP @//,`@pKT0 ` 0S;0S ĵ|0\-0S0S!e 0=  -@LpMS` Pp0S 0 R KP0Sl00d0 Rd00HPb$00 ."[$ 0'" гԳ  -LM@0Sp `0GP =$0S 9$04 "$0 R6P@ -LM@0Sp `0P $0S $04 !$0 R P@ -LM!@SP# 0h!d -LMRp, `1 0S00000SPP0e0 peR  V@*0S@T*0S T00- x@ x@@T P`W,0c# 0 s!pWSP  /0p\3!x/0HQ`# 0 v  p-RLM`0 Pp)@0T<  P]# 0ph(!V#  0-0@SLP 4 0R0a 0h8 -ML4M!0QP,0 pG`1 KK`(@D@D V k#  JP p R0 RPa- 0S0S 0  0 ,0S ,zK(A4A P a=(K0Q p0| 0QX0P"4 0@  " 0$ o!` (L  -0 0R00000L R0000 R0@00x0 Rl\h0P PP0 RTP$3 `@` h p-PLM@` 0S p+PP l@P0/S00H 0 S8 @`0 0 PPPPp ꘩`d0 R00T0T QH0  \80 R,0 P0 @ @ 0-0P LRl0@T 0S @T00SU0 ((P`ܩ`H3 -QLP=aq R1 0S  0S0! @0S00 0 p P 0jP 0WP! 0` !P P 00@`  H -#L M0PSr? P 30C S8tt(tDtt\\tt2 R 0, K@00KP0,0 00 L 04"C0 "= 0"bMb=0@䡟`l `0 @p 1堁 * RU 3 R 00  +wP0 `ç 0`!姼0 L1 /! 04!  Ra- 00 R0 0 R  R00 R0 00S  0a @0@00PI00P@ @ @\x  8 -P1LMP`U; pP@5*(P00CS00Ӥ0(p  T:0P0D@00CS00Ӥ0 P p ICT p>8PH P  P@P0  P _Ȫ -2LtMxŸ@0pŸT S, Pp$T ܱ0 CR 00c2 ,0S ,0R Y  @K1 R@(08&B`P0 \*L -$$q0LS`P P: 0-S00 00 0S&0@T0  ẹ:TP 0 0:S l R1 0 LP0ᩯ?0C0 hZ@ |!H@Q``x p-LM0@`/)P00 0Pl0S  H0Sph( 0 phph* -LTMptp % p 00@JS񟗊-.................-.L.X...............//..4/@/L/......-X///./.././/.//0.00111(101.1p04q$D$TM0S`?0@0w,0S 3w3 @mPv  4 su4Pm\h43 Pvb43u,3u$33t 27Pt2C Ps2s2r2rBp2P8 2p2pH2p 2|2 p~t2@p{l2pxd2|u2|{P1@ 0S `Pa0CS"p00000000000000001` 0S{1P1P1P1P1 s0t1p1{1PzqT1z+L1y(D1y%xP0a,AH0pK @p Ƚ<1P@x E 0P@ PUH@ 05 0' |! ` @  D``@@гԳ\`TEt`,`n9P`سlDܱ@Q 0 @BXL0@0t0 X X0 t0SI0S| |0 0S@3@3333 0S@0P0 0S0 0S @0P 0$!0S0<1 iP1 RH!d1 p[W Q ! R 1R B Q JA1A0t0 001A0t0 01A0t0 02B0t0 0 - 0PllLM@, 0 4 8 0D(=p 00@JS񟗾66<8<866<866<8<8<8<8<8<8<8<8<856<8<8<8<867<8<8h7<8<8p7|7<8<8<8<8<8<8<87<87<8<8<8<8<8<8<8l67<877<8h7<8<8<8<87<88 8 8T8(8D8T8`8t8|8<88vf$P040 K6066666|6&640Y8 H6 `6   w4 8CP8 4Q(6 0 f5b6&6 \0X5  0-S 0 , 0S,  5000 B5%=585#P64\ 0L0,X%000(H5$(54%, ,5R Q@b# %5 00CSTY 0S88;;YpP0 Yn 80I`0< 80 VN  PD<P< vPpH P(84 RYPW ø3 , RpC0S 0S P 0SL30 fόcP@| @l eP R2P 2"PPp PP `P 2`0P<0 20H CQ0"Q0z L2PpYPS Y\ 8 I`0 @0 8 V= @Q P3( PB!FP P P1 RY0  >P@ @h P P0 FMPP P `P`P@  7P.P~ \0S `HЬ |! D(4@@`@H@ܱԳ@@QP`س@_ltt lD` -LpM`@pK@e 00RPP[@P0: SU/00 0D (T00SP  H:P -4L$LM4$䄟P4 $4p $Qp 60@DSp@LALALALALALALALALALA@@@LA@BLAlABLALABLALABLALALA`?LALALALALALAHBLALALALALALA@`?TB\BLAhBLALApBLA`?xBBLABBLAB`?BBBLALALAB3x3x#000d3+ X3pH3@c@廠P@ P 3 R S Mb尒ŸH0pK  p 幹2P@l 7 2` @ pp`VH@ L2PH2b 0-S 0!0S "22!0291100!101|1!0&H!1r!!0QS C CTCTCC R PP R860S,1 $\P 0 R   R 0 PP  `@@Գ`ȭD  |!t tTE`,``HL`ܲP`س@Qܱ_  p-0LM` |@P;[d0 P0R4BDL S00CS00  0p phr`<`5 P00` -L0L R0; R  `h` P-L 0S!2P1 0PS$ p,ղPp`=ϲP@ P  ppP0VPPS0  U  0S( 7 Ꜯ`@ p-LM KP qd R0\4P0 0b0CS#G H H H H H H H H|H HH H H H H H H H H HH`P$K4 V U  0xS S *S p`P0E" $ VUp`P%%K5`P*%F:`P!%O1Q0r 0-LMKPcP @"#  0 S R kPP   BE0 0 C 0 0  p-ALM- 0aQ 0 0 0 0) 0x 0h, 0X$ 0H 0{ 0$v, 0q# 0l' 0gP 0a 0\( 0W 0R% 0M 0H) 0|C( 0>0`! 9I`Ȯ4TdHl,X -4@LM= 0 08 #`| -p@LM@ 0\4 0LE 0<B 0,0$= `<t -MLML0P`(0  0S ,d(0 S (; @Rpx 0\S@ S  R HR WPP`  ;PI000S  \R 0R 0S dlP 00@0@0S PS" GS0000S 00P 00PPP=E0 0gS pS00BNK@D@D ;D 0+z(v o!@\d س -@TpL 0S `PUP P@@0`S 0 p`PPP P $ 0-\0P@LT 0 @T0U$ WPT`H3 -LM0PS x@T l1P0000 <1`V0S`" 1 R @T 0T @T 0TT 00 0 AQPp  R/00` @0/S`0 0@4# R/00p@ p-!0LM0PP@ 0 R 0 R pp0 " 0/S @T|0 Rp=PT @`H0@PpUP00@` p-0LM`0@P?P6 *P *P 0S p*P P Q  P Qp*P Q P0 R /QPpQ @PQ@-0 !S@@T0]P P 0-S P]P ^ \ ]\ P Q0 -r`0LSP 0/S^ 0S 0/S6 1 R1 RlP`10SS S h!?X 0P`810SS S +0  P` 00CS0 R.000S00K @U <0C<0S.000S0P0@; 00C0H   -ML MPP1 pD$ nK`FO,($ 0S ,0S}0 S0 K0S$ .S @k OP \U$0 S t$d`0 K@TPMHJo!,\ ܰе 0 p-LM@P` 0P D0 L\ 0 pPࠣ -P`L/Q@@e Tp Q@:0Q Q0@*0CQ:0QQ0@*00 0@ -LcMZK MpKK K(@DKK( @DN*K", 8ƭKWLK KPH0`K: bK(J,J 0 P'02(K  UT1*00UT1:T3 0 PPi1!(K(K0@cTP 0S 0Y pWp,0 S l,T *0S 0TP*0S0T0* K\ 0 1(K R K(S0(K RK*K:K(FZKX:KZK(8:0S  KP KZK(8T`KQ :K(0Vo! T\\h` -LMpXP, @ *0S &S  \S 0T*0Sh /R9R,00`BVP"0S 0S0 `bV0dV @\S R0P -LMp!1PU|PP 0S`QDP@ 0 S/R< 4aP2 T,/00 1  bPoP 0S_____0$0 R80 h@T0 0S/S @ ,~k̶Զ @ܶ0X0X P -88L|(0 R Px p-L,M(@KP P P Pt <A8828Ÿ@@4`K@PK$Ÿ0 0 ,0 4 PV PF P6 P& P0  40 P PprX!?p@0S P@0S P@0S P@0S |P@P sP 0K   0K  w 0K  k 0K  _ꔷPp` -x0LM @R`0 R P0 RP PaP` p-PLM@3 R0 (a0S= 0#S4 \S. #PP$ 0"C12d1@cP 0S PP P0! 0px]  `W 0#S@ @P,P  />3=X0X P#3!"c1 0c!R 0S R(/>3 p-PLM@3 R0 (a0S= 0#S4 \S. PP$ z0"C12d1@cP 0S PP P0! 0px  ` 0#S@ ɛP,%P  />34X=X0X P#3!"c1 0c!R 0S R,/>3 -PpL`@ 0Sd /PPp0 S 00C S0u 0SP@j U 0SE00㠪0S1W 0S !0 0P!10@ @@P000 RH 0P , I D P 00000 0S MS CS000 0S 0 cS mS00dv,QW0p0@ .QT@}  ( 괸`̸ Hd@-0\ @a 0S)  S   0R  0R \\  0 S0S 0 S0S  0R `H -LMP 0pS@ q 20  00S| 0SṍT`q @P_0 1 !.B=R pGV0G SRmmpmm8mmlmmml 0!0!>C111v>C 0C0 !0!>CP00 1 !.BR00 R0S P&0B00 1 !.BR00R0S P0 1 !.BR P 0 1 !.B;R Đp010!.CDR Pk?C@.PT @}4q 0-LPL@DT  0d0S0   ع -LM✁`Pa 1 R 1 Rl1l!11a11acAT pP0 S @T0 0RT 000h0$qv -dpL0S ` AT@0`V01P@PU p-LMP@T0 pv0Sx`t 0 h0h X0Pz0h 00 4 0 G$ P` -ML0M (R04 ,0  2 ,0S ,4! q!8 0AT ~KpGR0pG8 @TP@, Q0 ߿0Q  P  D! T4a=  8,1008 A   谿0`PS 0S020S  ՏPT 4a=0 S0ń 8  $ o!Gк  0-LPL@DT  00S0 J $ -8L@T`9 !0pAT PP! @T 9P@ 4P /P 0! 0AZXh T  P J P  X -t@L0`SpPP s0AT P @T ᛦ  0-LPL@DT  00S0  @=Ȼ -0LP -p`LP% 0Ƃ"S12e1PcAT 0S @T 0ST Q P@ 0`0 10 As@/>3 -1L M@\, `p? ̡1 0, @R@\`0 PPI P 0S: Pda00S0@P! 00S00S AP 00 0 0   0, PhPP 0p p00  ` WPP 0X0@ P 00  @T 0-LPL@DT  0+0S0  `= p-LML`0S P0AT  0@TPOUp` -LM䀟pPP, / 0"c12f1`cAT 0S @TP@ ᠥP pP ,000! 0A(ox0ST `/>3ļ 0-LPP 0A"#12b1 cAT 0S @T00 ST 00 000`/>3 p-LMhP@d`t` pP0$0P80p ܳP  -LMԐ\`p 0&P@@0KU0 0 @( 80 , D 4 0@ D0DKP   8P$ 000ܳ0d -MLM||0 S, Qhp0WB*P 0Q:1KAA 0P21mK`F0мQ*NK@D@DL,/L<P 0Q0 R4<S @0 R0 R <8,0\0pW:0 W  8| ,0S $,Tܳo!гԳؽ p-@Q0@LM@C!1`@P  KP*0P0:0 R@U K0P0,*0P0:0@Wp ~ -P 0S\ \P00S0 BSꌂ800L\:0000L \*P\:000L\*00L  L 0 00L 0@- 0P@CRXlt00L\ :1!P@00L \*0\:000L\*00L  L 0 00L P-  *0 R: R$0 R:  Q0-LP0 S\  0S @T0   0鬫  p-LM7P@ & PP @P`l 00CS`0 T 0gp 00`, 0`p@ P -LM@, P, (#, \,3cpp0K0CS d, R, l0  , ,2  t , ,2|   a, a ,`2a-X2bb0  00 02R(0 ` >0R 2"00<(@ /R m   @<0S@P `1`) (@0/S  00C0L`1 41) 41  5R K0BS` 0@Q KP0  @P00 9p 0 0 :0xx 0, , 0LP , , E$ (,H8    -|3LCM p3 B, RP$0T<HTT,3 R 3 ,0S ,$BP0SPcU :"KRd K0b S Sx 0CSU Kd 100KK 0P>KdH2 0P >Kl$20 P  2 >Kt10 Pa=.K0 PK"K 0PxKP P,0 B@o!@ (Ŀ,08cQQ0d SdCR/R0 0S/S0S lQ00Q0S p-LM`P \ 8P@@E"00p-P@@E" 0-LP@Pâ0Sp0  \0P 0ֵ80 0S(  6 \lt h --LM$@0S S*僶 p-@ALMTPH0 \p闈`0S  `ǝP`p --0P|0  QLl@ 0S \0\ X嵓 H*@ 40D$ 00 `س -0-0P L0  \P@ 0Sx0x t凓 d)TڛT H|@ x080$ q00 `س -5LaMO?(PKx5@(K, p@ tA F,P 0%(#B!5! te ! %px D0@3SPPPP`PP0PPPPPT`PPPPPPPPPPPPPP̝ PPPXPP PpP|PXdD1 [KTl!R0 0; 04 P(@K P 0 0|SK "P 0<P H+ 0 Cˌ0 [Kl! R00@0P000kjd㺒 㸸넒5밢/ P@!?P!ډ/ ?P!. ?P ~/ ?P00vQP ㉒ GPA1 [KAl! R0g00j0\!00 00_00\(AH1 [KP @ l!L1R0E@ˌ0 [_KP l!O?(KR0/0<0x@1 [_KPl!|0R 0l"A?{Gz?o!, |!LtP`P$@Q<`hܪ`'$D@.A0 pbW0`0pppDA0 Fh O FDQ @` 0@0P` Hq00St| xQ1 01 P 0 0 R* 0 R :0 1  0<2S!000 0 0p1!@  @@pP` hB@i]  0<2S";0000 B>BS$  #0 $ 0<2S x(@'(PKdA (KPYoK P0 `A \A XA TA PA LA HA DA @A 忮P\C000 3>K 嫮PVPCP_K|#^?K@|A *PHx!1RS@$0勮P0;CS0,084Q0S|  X<\JdGA |A!r 10C1 2At0\ |T0 02P@%T00< KcK0 ! X`VKe/K:1  < K eK R p0S: 6 % 0S S5  1 刡  00Ì bK 0Pʱm 04~<&r,6,T&=K@PhO\&Y?KP0C PۭP Y?KP0C PͭPw(]?K 幭 G(K0K0@00 O? 0Q 0 \U@0  0 W ]?K哭 7 ]?K剭 P@ 00 OOK, @,  0-LGP:?0^  x0\*5P0\@ PL0@ DL@P@4 ] ܪ` @ -LM@ @ -MLMXXb0PpH,0 pp03*0* 201 0 2 1  Q P1@ԡ`0 810 @@0P0?P P$JKx!(@D@D0h!`P# 0P ,0 Q  ,& `8#8P#$0$ @JK(@D @DK<:(<2: !<(K0<:(<2:(LL!<  0o! @(LT -L4MD 0K`D 0P@K0 Z L7  ց  ,D h0S '0S0 0R0; 6"   R000 0p 6F 0 B0p0 \Ɵ0 ` kDX@0S #S $0 0c@BHX@000CS00  ä0 wS7 S@PHUp|0 ă ā Ă< 4 <( "4\,<PEU, pH'W 00CS00  ä0cwPHpWp!pW T0W6 'W00,tP|0 ă ā Ă< 4 <( "4\,<bpW0 PH 'U00CS00  ä0$wJ pD 0T VPhß030p@gU0#DHLр$H 0 \ DP0S.W)4S4#0pW@ *0 @S0pW:0pW@ *0Sp 0W:P@K0/PKP@0/邘0 \ 8K48 < ( 4" <( "4, ! 0,< `Rc@0 , =9 A0 0 0 =,0 2a, 3c#0OPK< LH0`KqPK@ P K`KPKH 0@PK\,!L@0SPK! !H0Sh0L@Sd*PK`T0 A 0010Z1P7  ` pdP``hXMDHPHP@dMQڲ0AQQ00  8#8LȃLȌ 00Ѝ -ML$4Mx4Q (K @, \ 0 CR 004%K(IITK(JJT$0 tx * ឌ0# o* ᕌ#0S`V* X}<VP@w<X0 A - AP@i<V0 B8#0 = *c *_Q 2 R   (,0 S ,82@2@P0 ϕŸp`0 ȕ6@PK0L X0/0ḕ)K@ B0/0/P@@娕0/P@@ 0/ᘕ0/P@ @K0LP@0/@凕)K0 BP@0/@KP@P!<0 @弯 * @i @W @P@M  奯f  ᠯ *Ƌ3K (JJ0 㒯 *㸋 0RtK(II l*㫋Y@Ao!P` xdx*HP@,@\ -L0 K M00, 000K 0  p/? 0@ @ _` Q @0 RQ   -LM@㼚T (0Ps0P -LM@QsĽHHнܾHHX``hQ DLT\ľ̾Ծph^0S #!Q 08@p+}`X#PLHDh84 0#$(,"(h 0S S0Swusqo0("#`l(L`p(Lh|(@PpPx p-L M0@0aP0 !P)) 0 C}>}tVP`F `00CS00  0p phRs({V`F<Xd`P`x -0L M0 K0 m P@ }0888 խ(|0 ̭P -LM@0 01R4 R(  0 $h- -LxM0`S qP10  0D0SJ 0S TKPKLKHKDK @KK0C4  01FAPo \ $  0 =00S00Y X |6#1@% "X`P$R<1 ,0S 4,媴 0P@v00h0 0@6  0}P`Zx 0i&(0CC1lh0`00S  pw 0;SHo!`dl -MLM0\C\L#, 4 @(  P@X34#A6T< 4 ` #140\F" $p`B6# AV#1%Y X @0 0 ᤎ X2R^ Qd ㈴\0 iD80  \0  _ >` @p- 0-(0@ LRP 0 ,Z, 00 0-(0P@LT ,:P  T00T0S 0 T @0@ -LM@0T0 T00S0 T@oQppfhcd0 R T\0K0 [n 8T (O@  , -0LM@ 0h \ 00CS ,(( 00 00 v D@P -PLMp 81 Q  @0P*0DS9@T:0T j V- * VĀ0 0bPP( 00p$KĈ$ 0 0 h640  H0F  V00 R@@`  0- L8M00 H0 <0 80 40 00 ,0 (0 $0 0 0 D PK@ HK@4 O$0$  00C000@  -LM@Pr0 `0"pM b0@SB,dx1 b 0`ip1 h V\!000`01@ m0U>0(!S 10`00!0`00 0@TQ :P 50 R T@D  0;T@Dl!zXa T0 R A(h |!(t`x@QEE` p-L@M P`Ku0S 0S  4 p -LM`t`ğ QS, @ Dd 0S 0S7 p P0S 3 ,0S ,J= 0ṢģL0S P먓0S 0S0\CS Y0S 0S @0S @C 1 D@! T 6`Vh!h1h!X0 d1@L@@0,@ \@ ,0KT@ P@ L@ H@ D@ @@ <@ 8@ 4@ 0@ 6`TP (0@T*0U U@\K (0PT*0U6`V =&ꀠ?>1 L!\  @YP ?>1 A! @TڑRڎ`t  -LMpj0W0 W00S`0 0S 1S4  4p0S@600CS:l$0S X V@^P X X X  X P@1(@Q0 T @P@6#QBP@T1X@QtT PY #0001 01S<  XT3  ) X3(&P3 L# p6$ 4$0 R "0S /$0`0 P0S22   {ԩP 2p pl P BT 0H0 P0Z$ 㔯2 R 1 R ;T\0# PX @@T%@DT M1 R w P @2&6h!0 `<1 RD(K0 i@0 $50S 0SQ P 00`(< 㣰P0S0S  p7 P\ "mtt@`  ?`4L\lH3D -LM@PpPpe`VWY!?> DR.000 0. $0`F0V$0@X L0 S00*P (@ R00  0R 0S R0R0S P 0 R  P` X0 S00Dō<<%  H3D -La8M0&0Q 0  p 0KL P H D @ < 8 4 0 , ( $ @0(0PU *0T0 T00SP (0@U:6pW<0P 40H@ PK0S  `@@ -LM`VPڴp崀@PT 0S  0T @T R 0S `FVP 0  0P 00@ -MLX$MT0,0   BR, \    P $PC3EKJ 3 J0ß q3`R( K#d `$ *B>K0CMKH0C4 HP RP`V:0#`V*0CP\ `V:;2 ,0S ,f0S 0 S s S "y P" j  00C0 |"lf Pd  000 00C0  0RBB60C _1 (K KK$ @$ @-0\4  X$  0堑w6 0SF@B0 RT P00O0^$`1F(00 P Pq Pd P 0:90|so!@p L ܰ`DH3D @8T -MLM$p\0,0 (`B R 0S L0 S8(K 4  `0 A?(K  A?(K T KKP@((K0Q 0@ P$ ڭP^^>KMK `l P$ $\ 0S  R0.S $0'$00@T0T0 T00ShW `'XE X ,0 S 0,00 00CS񟗯 \\$0S&&L0S7 `04  00C SLdlt| 0S 00C S(,T4T<TDTLT\00&E P@@%00C00000000      0S $\@NK @D@D0 S^K PE0 0$~4 R $\00 PN$0SK0 R$ 4 RN$H P9 10: S0   $00@7$\ R  0.S00[ PXp L0S`34! ( K `0A?(K A?(K KK( $\0 0 Q0hNK0ᴀ$00$03  0`0C0 8@@@TP X; U 0S+ 0 SP $00$0P h"00C0l"T>KMK P,"D(000.S !8 6Pp@L0Sj `0g 0Sd HP[>KMK @dପ$00$0,1  0`0C0 ë崀:(w<s80.SR 00Ph L0S& `0# 0S 0@0P$0 o! `kܰ@@(0<HX<T $$0c -!0L1pCW:@`V QЀ Ȁ0 R 0pGW*0 R PQ 0 R x0 UP$`@H000<0 00C000 @   0-L8M`Q QT!00 @D H0 @0 <0 80 40 00 ,0 (0 $0 0 0 K0DS0@T0@@ 00CS.TT 0QP 0S P0  00dHK HK[h0SHK4 00  B0@ -`LVP)P>1 1ER# @T 0S @T.!0EX00C0`FVP 0  @00婣T -LuM؆0,0 b p! ]1PW1 1 1  6 \ᄦP  (` ,6&(Pv !,6"! 0&& :&6 rK2 f?K^4 Z(@1^*P P ?> P  RN+ 0`F<0^:6^  ^<ş 0P<,5% \?>1/1L.QAN 0 40\1嬤 01 0S  1, 0 S  0\` K_K<$1k,6 1R rKx P0S#1W& Ph0SR1#H&ߩP86 P90S 0S % T1 0S 8rK> Pß,0 S ,5C1! 0 000S  ReK P !&-001&ᑩP h~TxeK P &  !00! &pPu ]1{W vi,6KQ01,&K `,6|AQ000P0SH1 SDH0S%1 S!.0\!5 2! 5:? >PN0ׇ? >0N0CS101 ,6 0g ,6!` tX@0 H;o!``X$`,8@L@LT -PULp`:4@$@TPZ [U:t| 0 `0`0 --L ۵` p-PLM@P`l0l R ἏT D0 Rp80  0  y㴵`O --L  --L  -LM@nq h --L ㅵ p-LtM/P0@TK BP0: S p0`rS? ⓦ 0-/L@PU+D0 00{/00(+q+q00 -LUMpPKPP@lK80S-0: S  SU P U@P P@0 R000K@P h1: S@ c$^H: P-L }P 庴 -QLM@ ʠP T 婴ᛠ -L^{P 围 -kMLM7 6@, @6K0A䆟 A 6 P|P6: S &PK E&P0S| |6 Rq 0 S i\R0Sa L6L&@HfHv@@ @@@@ 0 00S P5P(0%<00PC0S0S X5 ,0S ,嫢L%e.K B BP \P @0@T H6<4"D0# sP@0@Tşş%5@0T06 v4 RД3S (0 త4 @@TZ0Q $R |P0S (4 R &6P, ,4@ &PT6&  S0"",3 0|P@ Uh 6T#00/>10@ᕛ3PL ⋛x3PTChG T3P= xP03$- 6SR ,@!0@T00 "2 VB00P0"S P ox26klPP\Hd,(PPO@T J/ $y1  LPP>, $&R0S%"0!S$ ㊴puġPL~wo ,oo 뚙?Ao!(((H `@T`|(Dl``@@(  LpLx$,8HPdH3D -L M, Zß ?x3吃 ;MP hc+ #L3R,D $ pW,$  0bW@)0EOa.6 0@Ɔ& 6F@V3 ( &$6xr 0(& 0D00 XB 0+00 0S2PU 2 00  0 0 00 ,0,0 00000 330330 33033 @0L@0 D0PD00 550550 55 ` d0 1 R,d0\ +ӤP 0 R,wAP@kU*0 Q@tPU:aA ,0 ```Sx@(`<T@-@0 0   0 0 0$  (@$, (@0@, 0000 D@0HD LH0L 330## 330## 330%% ` -PLM@ 00 R$hv$ -LMp@w`@v^ Pa0@S pd1P  0PUK T q,10  00S 2W~Cp pG R R0! wc.ḣ`fP%UPẠ0FOa.U&pn  0 6 & p@⤠b0PV6@⛠ $CP4q(P -0LM@H Hv{P0T 7m, edA-L0(&S  d0 P0S\P P1 Pa S\Q 60Q` -L: S  S  S H0 R4Q S S  S S`T -1L `R` RP@@ ѱTd1 RLX1 RHL1 RT ,1 R $QXp/00CS0X0@ӤX0& T 00CS00 R0 0  yTYT nTNT ㎱YT00yTP z PXGz@4(e(h_t -0 @LM̀@@0 ` @@``娟PUPTp p {@xP00TQ  p0WD0@@W` 0-PL@T 0&"0S @T@T# 0 @TT  d 000X 0000 0 @P@0` p-l0LM@Ɠ0\S` @088 000 0 `Pp` p-LM0@S` PU 0  0U P 0 PPt0T p 6 Ul`P6@ S6& "," Z 6T `D$0`` 0-L0P LR @  (b$P 0n # -LM8pP(2G 2 R b  ? @_tTo 1 RP a@T T rP坚ᛚUp@ U QW!0Z00 lQ3L1 R% PZD1 R 1Čo 1 !@PX0 d@C@0PP  ?t@0@ 0P PPUgH`(`` `(H`@| -L$M0 !0P@`_ᖄ@K &" $"40 D @K0, ݌Qd4 ,4 P[ 0@0K,0̌QM@4 8@ àH4P8pT54 , R0,# @K@_@K0 ᨌ 0`Q 00Vs# ᵝ@ᱝ0P 88 x 4@0pW P8@囝0@80 0` -PLM, 00 ]@_l!@K0/a,@@K,< QQG 0 0PP< ,@`K 0@Q.g0pZ o ڮ@ 0R  @@K0 `@0PK_tp  4,\A0 Z<,S00 ,K`p@-t@00CP`P``?>!@\1 00CPp010  p -L8M 0@K0 ,0  -RSL4M@ Ppl h\\1  BRH csT 0, P \0 , K X T L H D @ < 8 4 0 `HH\KP@ 0 P0 X T0 PP 0p /  0U0?00f f_`` W/00f V:TPU L0L X0 0 TP  U \KH:`@cܰ -L  - L0  hx` -L⌆~xhzx -LM0@S HFFFF00S lh0 R \ P0008SVPLT` -L`P똡嘁q@!epb@1 PGGGGGGGGGGGGGGGGGGGGG@@1@@@0 h800@@@0 0QQ0 R|0 R 0 R|0 RP0 R X4vP LܫH0NDO` P`@Q8)@ -0pLM`0@PT  žPp` @PVu0S@<^P`@$K 0 \`_@t P@ -sL` P00CS00@Ӥ0tE U T T 3 R^ T0M CR `o000- CR 8^00@t$3 0 0 0S= 0^ CR /000T C@?R 00p P0@0@|2|t"0`000R P, P0RPp0 CR 0@0R P0RPp0RPp1 R 0^ CR X000I CR 0000R0RPp1 R 0$ CR 000RPp0 R T 0 R2 0T0Q0S* Dl g0@" eX`@u@0啪P`4q`P@ 8) -0尀LMp0P@`T  ポPP @`0U0S@ 4PP@ 0 \`_@P@ -LpMa 1Rp%  7p@ PP  ᧫PP p @T,P0x0 K(P L@ P 3ҕP80  P`8)`P@ -6LTM pP`, Pp@ P`F  P`FVP ڌuEpPpx%0t00ZXXX ?pV H%0p0t0@4 ʜP V PuPMV,DQ40S  @  B\0SR\0S 4Q p4Qt  \ 000`FVPD. 0S\ 0SV HS, 4 R4 R  o3 &tP㌩[ o3 tPT01S3 Rxt3 R P@Kd ܚ@KT ؚ0#"0 [P$S3 R t@K dK 2Qr P Q `FP 㗋P   `FPr aoP QIQE`VP+V  NVJu1  _oP`FPp $0S ͛P  ǛP`1\ 㽛P H 㷛P1  㬛P`F0@V@P | oP  㓛P 4 o! x HT$\       @  8<@DHLl p-LMPP0@S s<`8` 㮩P@p00p逶  p-1LM a@PP6 rP0 rP 0  rP 0 p UP p rP < rPHpP,x i @i ~i zi  -L M@,K5]P `0 T nP` њp,PP V 0SqX20  00St HnP PU,o^VZy  n 0 RV A00000 0000  n  0 0S3 X nP  RY# \1@T 0R 00 S 0  A0S  0R $0S 00S P o 000 @.  AVP|@0  0P 04200 cZ4qH   ` -L4 0m,0, qp H  zi  -8L 0wm,0, qp H  yi  -LMda@(PK(@ $@ @ H qp4I (ᘒPpA (0 $0 p qp6 $0( PS0$ T`@`U 0 CR 00$0PU@0p0CS00  ä0ᖒ <cL0 R\L㓦 xi P`P8 -L0LM@@0@<0\ ,0       -LM 1 PX" T" $ \" P" L" H" D" @" OK&>KP X T )P?K K>)P/8`Rdb@0T0 S0 Sň l`2K ɗd2IK ėx0x pPh `WdW $0S D$嚔r, 㛈o! TH Ji -,0L$$ p0Sh Ii  -0L    -0L    -@0LM4@00 0p0Shs  i  -L  0000   0-0P @RLpP 0S00S TP0 D0D0 @ 0,0  )    -$$ 0L00    -L(Mp0@PK` @ 0 eK $p0S k3[| DT 0 X K pP 0S 4 Ǔ(;o!  i H@i 8D Qd0d0 A00d0d0 -L M K@p0@,` h$P@\k0p \  0Slh p@hD P0t@l0 0(w s@B Th p-0LM `0S0P ؗPKZP'@T 0S @TV 0p[pl? cP _@0  (c&01S 0000001S 0/S dZ@@ @@0+S ,  H!i T@P`"i H 0-PLp0p@\`  40PP00+S ̘t  H  -L4MxŸXK `^0S@R@< @@@ @@@@@_  dcP` p`  _0 (s|1A $T Q X0S Q 0SQd00CS00  0 4,>,U D!cP ^@0 ( ^s@:L01S 00000?01S ;0/S pY@@ @@-0+S 8"@  H!i d@0 P`p"i H -0LMAQ00p00`a0S PU 0 啉C}0S K  }i 00 vz넶| p-L MK,P 0 A`+0SU0000 P00P0S 00p0P0@P0P0 `20p >z넶 -LMR@!x 0S   @] |Q<0 CR P000S% 0CW3? X 0, CR 1000 \ `0 CR 000 \0S@0> CR 000Ri=0 Rd \=0R =0 S0 S0R<P` 0-L(M@Q80K4 K@ 4@ (@ $@ @ @ 0 , @iP80S 屈0S 8H0 00SQ0S 1#$0$ c 0y  y딶h| p-L MK,P0 A`50 S"U0000R00R0SR00 000 BR0R0 b20p {p By딶0@-@QP 0S\\   ^2  R\ 0S\00R P2 R0 0-PLM^ K0K@ P0S PxS*0S S1[[#$0$ 0 x  0-LM{0K K  @ẩP0P\ \^ 0\x^\1[![#"0 0  -LMP @0S 8  P 0   x=|8  -`MLp@0WP0pT000 @".Ġ$48 Ƞ̌< ,Ƞ!#8p@.Ġ Ƞ$4̌8<,#^ :,48 <#^Rxh^ $H -@0LM 0@0 }T hꤶl 0-H0 A0P0L ~ 0U00 00h괶t -L 0q㱕` p-LM`0@0 0PK 2K00 ,0 (0 $0 P/`p [Q00[00[S S8 8 N 0S ރpo!  :i  -L(M@@K0 (@ @ `ᖄ@0@8#HP0\㸀 p@ 0p<0KK0< 8 4 0 _p| t BK_p (0S L(嚃@ 0,wo!   :i @9i  , -0LMЀP0\p8`K $0 @$ K8 4 0 , `_0s t O[l00d 2K_p $0S @$R4Ɣ(Tw@o!  :i  9i < H -LMp@`P 40K 04P 0P ,P (P RKg_pl d RK4P 0P ,P (P Z_p 0S ,  ㉔o!  :i 9i p  -L(M`qD@KXa0T  $0 D0 @0 <0 80 40 00 ,0 (0 Z *_p7 4P1% Z|P0 +  _p# PU 0S ҂80@PTPE@TU ͕x*@00PEU00SL,00S ,0S o! Hi$ -L,M@0 8K0 0 80 40 00 ,0 (0 $0 0 0 ^p 4 R 80PD0D@,0 0S $ro!  i Ķ -L(M`p P0@ DK $0 D0 @0 <0 80 40 00 ,0 (0 ^0s4K X 2ZL }^p 0S , 8 㬓 o! i i  -L8M@PK 0(@ P pP`\P@ᰀ "L0K, 0L H D @ < 8 4 0 A^pp h H@ 8^p (0S @(4g 0 uo!  i i , -L8M@PK 0(@ P pᡂP`\P@ᰀ "L0K, 0L H D @ < 8 4 0 ]pp h D@ ]p (0S @(威4 0 uo!  i i 8H -L8M@PK 0(@ P pVP`\P@ᰀ "L0K, 0L H D @ < 8 4 0 ]pp h @@ ]p (0S @(]4ђ 0 ]uo!  i i Xh -L,MpЀ0`H0K@$  0H@ D@ @@ <@ 8@ 4@ 0@ ,@ (@ l]p| xP[CPH@  @TP< Z]p $0S 0$$㉒ o! i Ķi x -L$Mp崀 `0P@@K (0 @0 <0 80 40 00 ,0 $ @+]0s X XL ]p $0S ,$ـ M o! i i  -L Mp@`P <0K 0l` g0STR `Q0SK R pG견:>< 0o!0 0Th` 8\|0 @ -L(Mhq0@PK`a @ 0 ĂD BLPC3[0 ((!0uP"P  0 S o 00 0 t 0x 3KLPD=8T 0<=8 0o!i < i 0H -LPM∡0H@Kp|P `(0 HP DP @P 01 0 R 000 ^0 0-@0P0LSk0S 0' ; 0PP 0x 00P 00G;8H 0=;$     -!LWM0,0  pᅀPUaKJ/ qd ET IP=WoK0PS @W 0]KS  @P U00R00S-]0 ,0S ,mm \\ K.0 .0 T \ ϩW;D0D AƩN; 0$ 8o!0Ji(4 D  -LdM☑@q, KⲠP0K0`0 ` p@ 0K K` `0P` 0 R  )000 PPPP0  0S 0 0 .0\ K.l`K@ V0 0p ᬎP ,0S X,l V@T:0 o!  -RML 7 M(% 4%  ǟ7 ȟx,  ,  0 8 < @  t' Dp. H0@/S$0|h  8D0:;;@00S lVA0C2SE0<00S|090;0:0; 0:080gş80:( 8 07`FKL L4EG.Kx t :  B0p l P 0 n5 .09 J@ _0:;8B TNKA 4@ 70S 0 R 4%RQ #NKA 1D4P|ß0 R 4 R Xh 0@0[lP00<0=,0, "NKA 12\3 R 4 R0 S  "NKAl2`P0S2 4 R.". P"z@L0 Vy/ gmT 2P00(|10 \kP ,9T kPp!NKA -1P L0 R 4 Rk (`rꅧX@@ a080 00V00NKA 11Pڠ0 R 4 R Pø;d0 0:;7/0<0:;:?.Ao! |!= <XP`x'' @h@Q`=> H>H=( Hd@== @>=P>$<h'ut P|$D\ >>p`>`= 1 bZ bZW0% 1PGFKL@ L@@@@@@laG~K@pGx t : 0p l P0 R11 P0Q5  Cm1 }@P50 ,%R0 KL@ L@@@@@N>K@0C, @:0C D P$0S \0 0 )UP,"0  NNKL2@D@DP)` 0T `{UPD2) 0`pUPlj;j|4 0S Q0S22x 0 .0% >5 fP$  #0 5@T @@T WDTH$0 00000000@j@TP@0D @E@0 4 R1 @\ O>K)0C* Ups $KNK@D0$% R44:0  4 4: 0 TPPX0 8EP00 0 s0% 0% 05S8%R 454 00) 0l0   ,0S  < 4 (%R /<5P(%`6 0s 400) 0   0Q4 ZQʘ&0) %R @0SX&\KPEd&@0@zTP6&0@oTP&ONK@DP) 0 PaTP6) 0PXTP(@ @+ % 50C5 | @ q F F (0@ ,x00MKBKK DhDKL@AI L@ A 0IH D L @TcPU\0SV(0 NH@0 5 @XP> Hx804 =KL0Cˠ 4 $5 4 HD5 D 4 P L%$Ed  R 0S9LPڔ0   吨ꢤ0S FSꙤ0S t P@,E:0=KEK0CL0C 0 0SL: Ri g` K0Cɠ@ 0Ch* @zS y05 zPP:`@ +0V@0 )0 VSPL%[WPhO.K B0 BaPTW4VEP4  `J@TO^KPEPE 0K P@540SMEP$z`*T4eEP~ LnETd`<Phd p04 -|<@O>K0C)0C D RP [KNK@D k<)O>K0C Rp F-N>K0C 0C( R8 <-00 tT x$"`=` &Pp % 1 PP JDP 0 ;E,%0[-PxP0  P$ 000P =  -LM8P |0 R 0 l00 L P 00 @4 @ @ @ 8D K R@@=d0<00    0 = -3L$M R 0SS@@@@@@@@@pp3  g\\!00j0Kvg_3 3 .$(," \"(!̠0!0 `.2 p22@80K8P  0 0@ ,@ 4p 0P0?@ P`2 X0៦0P 8 y,P@K<@@<4 Ġ̌(<"4!Č ̌$>=(> >@=`=H>=H= 0 P -L jPJ> -AMLM@p, 8$ TF*PU 0T  z3 PC*U5 0S@? A R:0dU7RPE6T$*BnK`F`FqD1D @ 04^0(! (W1\ J3 P0PE*ST:U @@0 ,0S ,#eT:8$0b? S84S8 BnK`FBKX`F@ @ 04 P  3 P:o!k4q  -LGMMmKS`F0 `Fp @,0 h 嫆I.KTp  PU Q $3  ,0 S x,dv0SW 2   : 0vpl  Pt N 0S4 n 4S) \0   p$"000CS00  ä0 Q0 U+ |P a!48 0GRh p4PZ|T #*mK`F`FFKp 0@fP h$p0 SPU1(K Rm ((@h4p$S:P0 : L6P`UY US p 0hS*0V,$,!$#\C0 U|`\) V$`|4PGQ00S V )0 CR 000R,v,vph ZV,v,|vڣ`gP@h4h ͣp\h | 0* q2  0 3Rh4p$\h 0:qp hS\ᣣlP td0 0R 0q3`dc R000 0x  0 0 Bx 0 09`   um4 DclL`P$0 &\0Sx\p\h P*0P Sp$h \:B>?;IK6tT0H` 0` G0K@` <` 8` 4` D` HK0@K00 HK98EKAA 'X\, <4$ ,==xP`>ltd<x -LMf@0 @ 0 PR56D6p67777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777776777 7(70787@7H777l9Q55556\叜 0S < _0u$  048<("#0S SP0S S F 048<("d`6SPLH-@<840,($ PPK% .0P  .0P . Qq. Lq0dpC 04SM 8L9T9\9d9d`2  _  R$ R <W 0PPK .0P 0 ƞDRWPPK .0zP pU 1MK⯞ @D K@D @ @ 0Xt Ptpnlhd`\X呞 叞 04S99999傞0   Q1qo!(T|@`0@P`tcX=(4HX@ht -L@MP0q DH0`LR!R 0 18,#44$<@PČ! @P@KP .0P. | p .0PL.   0S , ]Ap?po!c -D0 ML@( <@@E0 R =c0` 'S0-LP@v(@0dSK<Qh=d>d>d>d>d>=d>d>d>d>d>d>d>d>d>d>>d>d>d>d>d>d>d>d>d>d>d>d>d>d>d>d>d>d>d>d>d>d>d>d>d>0>8>d>d>d>d>d>L>d>d>d>d>d>d>d>T>d>p>001@T0d*Sʜ0h~ 0$0hi 0`\X^0H <80hR0,N \(08<\px -LxM0`S qP10  0D0SJ 0S TKPKLKHKDK @Khm@Q -MLMp0` 0 ANK @D@D0 M`[PU[PP .K BT B7P<mNK V, 0S [o!W@  -ML Md0K @.SS@0, @8 P` 000.SS0 B00S i3P0@8 0S@8S.K B B%0.S)0~KpGpG.SS 00.SS tA 0`S @3P`0SV.K B0 B4O @8.R0@8 `p^KPEPE0 Mp`[@TZ[P@.K B BD7P `FR0 |slx P(`J WZV <H( ,0S8,Zo!$ x8 W`L p O   -LM`0`"`r00P0P,PPE 0S00020 A_$rP000K ]20 .0S <,:,8,6,P v @ _0SPE %,U 0+S-S0S.P-P .U@PE P[U`@PE0ShPaP rPmP ~00S 00SQ1 ()l<;DP=Pcj__`T"O@ `_`"h"l"p"Ht"PG?f|" p-LM@^P `2p -LMS@T00.0"0 S S0 S S0@-S@  TAN Ra0NS\ 0RAC\ 0^0 S -d0LMP@@L0 5<00S 000SA/;bk>``>_ -L0MԂԢ 0Pp(0 PTPK 2b&J0S @@,EPH nP6 2P- PD2[KP) XP/ P) RP, KP- M P< 1P/ KP) CP, K P- > P3 K P- 8 P0 1P0 21 .1 +|1 (p1 %d1 "X1 L1 @1 41 (1 1 1 1 0 0 0 0 0A[?[0HP @@[0G @0H P 40K9K3K6Kd<@T KXkp (0S4(X@?o! h?`?0{!`a`b" p-LMP`0,@KHP 0 0 &A 0SXpo!## -LM@P  00R0R  00Sh%F -LM@P hS00Sh$F 0-LP@P $00S0h$ 0F -L M K4P@![A[R0 ʐP x0td P00TT0@LP 400 PP00ht@` #(#@b,# -LM 000000000000 0000 `0`圢0A> 06 pIpq QcPa 4S4S 4?0 CpP@uv*c0A>@t 0 001 0*l(pP|U*BT A.0O0P000B>0,10S 4PU/0K000 t*>040 00S 00S" 00 0000000`0` 0 0 0 0000000 0000 `0`0 $4SY*0F@eԺ#к#bPh -pLM@ 00s)0@к#@-`@? 0"00\ 0S0S000\F -LMZIp q  Z0Y0:H!O 4  6y†04 S4 S* P%0 4 S4 S0 4 S4 S*p 00 0 4 S4 S:T0O YA. P ` `6& 0I6Y$Fh -x0LM@ 4 BN@Ap@0t hz 00NpFh 0-LgP" 0P0Q  0R 0R Q(00A> 000 $$0F(00S00B>0bF@-(0A> 0$Đ6I F -LM@$0AR 0  0R0$$R 005:| L0$$R0$4 A  0@0 0$4 F 0-PL $4S0C! 4S4S 4 A> 0@0P0 A 0@d0 $4T0$0AR 0  0R$$0R* 000hcF5=?0/9P6 0S000Ժ p- LM 4B>0 pQ 0P@00QP`@BN@0 A>0A> 00$d0(@K B>R0  40 40 0Apqph(pF$ -LMJPx 404@0  0000 0 00 0 F0 00  0?\00F -LMX@ 0S 00 0jN @0S0 04hF -LM@0 'Apq @ -LM̀p`P@TC@!EJA>B.A 0 0$D4 dD P  40 40 4sto>F 0-tP@0L 4@ 4@M@ 40 04TM0@0h0F>00 FpD0 00000Sp00000S 4qp0 000 4q -p000L00 0S0  Pt t0BP@ qL0 0000 0S8 0(0$ B 4q $G$$($(0 $ 00 0 I(GI@II -L 00 0@I`I p-LMP%~T$`$@000wT000p@I`IoT(G -`Lp00S 0P@^Tx 0 0S %ST0 0 00(`S@0S0SI@I@b 0-L@LP 0LR 0 0CS00 00 00@I`II(GI -鐠p0 刀0b? |`PUL@0S 2 T0 P0b?U0S( 0f0@m@b`II(GI -錀p0 儠0b? x`@TLP U uS0 @0b?TU,0@ 00c0m^@b`II(GI -PL0`0pS @S 0 R S 0 0CR00S 000$S000I@I@b p-LM|` x0RR@S`0`P0 0R00C0S00`00S f0SpI(G`I@I 0-p@LPiS`0P0aSD P:00@P*0P0(GI 0-t@tP0LS 0S 0S0800 P0S00I(GI - 0L00S WI 0-xPx@0LS 0S S0S0S S 0S 0S S 0S0S S0I(G -LML@00 S00 S S 00 SSI -H0LM0@S ,0@$ 0@]00(GIII 00 GI 0-L@dP| |zz8{z@||{{|$|H|H|H|H|H|H|,|H|H|H|H|H|H|H|H|H|H|H|H|H|H|H|H|H|H|H|H|H|H|H|H|H|H|H|H|H|H|H|H|H|H|H|H|H|H|H|H|H|H|H|H|H|H|H|H|H|H|H|H|H|H|H|H|H|H|H|H|H|H|H|H|H|H|H|H|H|H|H|H|H|H|H|H|H|H|H|H|H|@|0h0hlA00S S y00S SJJ p-LMc0@/Sȁpppp(Ёpppppppp(ppppppȁpppppppppppppppppppppppp p00@ SdP2@@pR0SP"!T0@ T +T Q0Q000p@0#@20Tv 420Tr 0Sob@0@0S4PP Cc7P-0K0K /0@KPKPN0D;SJ4<ppppDppTpppLppppppppppppppTpppppppp4ppppppppppppppppppppp<@x 00#0U T TpP 0#0CScPpJJJJ`a`DJ 0-L=#P` 0s0s   0h(0(P0S @00>@0_ce 0-1L R 0R:f"0 0R 00S 00S 0 P2 0 P @T&P@:  h00S 0SlOH0(0P<5 ;$0 0JJd K@d c>@K@f@bt$ -0LMK0 !`$ - LP x0P0@0P00P "P @00S SS g h,JJJ 0-H@0PS80L0 ,0,R:_!0P00JJlJ$ 0-LPO@@T:TT*0 -LMP@@`0p   P0p<0@ Z* P0P0i-   Pp U !W iJ$ ->LM0.0?-00e=@]@0 S=@= +=0SB0SeXC`0SeX@e XM0S P P 0S#0K$`K$K P P 0(K(0 C@(P]T0DcS#ꌍ܌p̔X84H,<ēȍ< ,0xd4̎ȐtT< 0Lg +0S0S ; J0S0S-:0S:  *0S0S : pJ0S0S  0J0S0S0 :0S 0S0S9 )I0S0S I0S0S0 d90S 0S0S<9 9RI0S0S VH0S0Sh80S8g / 0HS8 00 0S 08 0R0 2(0S0S 7 u70S77 7 n'0S0S 7 ]t7 \ %P SHG0S0S0 B '0S@00S0dS@d0/6{ 0*0S0S %, "0S 6 #0l d(0Sa_ 0S5 0S0  0S5 0S@0E0S0S X5hE  Q 0S0 z5U@p000000S0S 4T@p00 000R00S0 J@$t4@Tdp2 D0S0S VPz 40S 30S0S0S330K00 vC0S0S0 8PT 0S0Sd3`3d0S0S@0#P(J7 3@U P P 6+$ (2 2 "00"0l6 . 0q2`0P 20 PP P z 0\]H2`0P 820 PP P  0!0S0S 1 1X!0S10գ?0O100 R0Sx 0 0b 0S0S 41 (1 0S10գ?0O 0 000 `00S  0S00S 0 ^`J_JhJJ``,f f Kb ccPe$d$D$$%>JKp$%`a`%(%@% g@bcc@fL%@K -LMP@-*0PS S0@%pP`@ JPl`0S 00S0S00U00U@0 0ST:l% -L!h/޺ R-0`pLP  ?@T0 0@0D00 - L 0Sh`Kp%0 - L 0ShK% -L0S h%@-Q@002*0 SS(PP gP # \S0gSf0S0S0S 0S0S@Q:d p-LM@P`Pd 0dP@TfPdp0 `K0 K 0-t0LM@PK 0S HP   0S 0P00KK -0L M젟 0P`(0 + 00P& PUKL P-L 0h> -"LM0`PH"0S V IH@,K0 Kp0@ PPP|00S@I HP2@0,0 ? P8  8K8AX 0 /A  AA  ~DP, 0d8K80 X1@0S`P ,P (8K8p 5yPYP ,3 ~AZ0 00 0 0`= 40`,`0Pi@0SPPp0`0S vA!t0U `00S8K 8p ŤEA>@KPf&>KL_@`>>_ g -LM@0K` P8Kp ~@PU0P P@ A PUk8@0P``> 0  '> 0  )> -LP`pWNS`V@ZP PT 00 h 0 > 0 > 0-LP@"P@ jP0h0 -LM@Pk>Pd p-LM@P`P U P V P ph+p -40L\30S  h]K0&@ -Lphf -LM@[G0 0R`0S! 00R0@S000Sp> -LHMp0@ 0 P  01pq ``K@ @TPP@T 0 S  aAo!& - L01pq0  0  -LMdp,P@00CS00`Ӥ0U` V e0H v R00 @>EP@`00 -LM@tPp% 0S" `V |E@yE@@PT 0`2Y>$@S>~@*t & -L4M 1@TCT0K X BT0`TD0`BPP T0V T0`VpD0`*PU #E@ E@ `H 02 >T0V00HTKWFX> =` -1LM0S0 4  1p W QP`  DP 0|S`D@D K@Pp8@ 80S0%S 0sS a080 @Dp00@DT:&@=TY P)K 㞣P ~)[40D@00PP~0S`e`&@ -,1LMP, UBR~hPp; |D@ yD0,@uD`@Z0 %S0sSZ    ,  ,UDP@00PMDU:@7=T oX~`& -LtMK@+P@x0: S@@= p-LtMP0SK` D@ `0S9`d00S0: S C*@i `i  <p`fp -LtMK@=PH0KY00Sc 0-d0L0ST00pP@u TU 0000bh c 0S00>@c -L M@000 p`P00T,0  300CW 30SW200CW 9B2 R 200CWUV Y0S x20S `1UVP n@ R R J20S pWWJZZ`P#p`Pv0X,0 p@q>P ,PL1AP-00Y000 # 1 00S0uv   00S00S0   00S: 00S 00S1pWZ00S0   ,0S 00p 000 00SYk 0 o ` ee`c&X@cagb ch -LM@`PpTW 000CT0 @T Jp`PvY ZE@TZXZ!o< ` c -01L M0pS` 10S P; i>pP@+u)V 0AP 00S PP@$ 0pP@u l0 000 0d c`b -LMp`pP@uV iE 0S<00S,00S 0 0S00C@L de'`N& P000P꠽ -P0Q0L00 00 000頽`L - L00 00C0`L p-LMP`(/@0  000p P0-L@P@ 0T:0h:0>0PPᠽ0PPᠽ -LM@0S00`L p-DPLM@`T Pp@Tp頽 0-LP@P000P0000000000   -pLMP@u) 10S1!00`Q0 )P*jp@ WP@< P00 P8p0t T ?  P 0`V00S<00 P``V&0P@` P@@P&@Ex00S00 S 0 P@ P pEP@eLbh`fc@d`d -pL MXrPp20S200QPW0 P@P u20S @ T T10: P@ P p1@0`PP` x!0$ P@ p`PP,  0,0 @6Pp@ 0000  %0 P` P m @0Q P 0Px00Sl00 @,@ @0PU`XW,w  eL`dh`fc@d p-pLM`Pv eP=p P P@0P`40`0@0P`p P P0`pȺ -L0SH hp0 s 0 0  Bh'` -LMp`pP@u P |00Sh0 tW V P@(0 f K! fc 'D' -L M@Kv O p-LM`pP@uxGpP@uPph UT0 phd''c p-LM`P@P  P puP@$00S/ ph f -L M`P, , XP,0@cT A dxwP@ Ho6pw0x00XW0A ,0@T)y z  V0 U0 1 ,0c@0;p`Pv ,0@T ,1 ,0@d@ 0@ܠ,@00CT Tp`Pv XW  000S o80@0CTF D0@@^ 0 0@@'` c@cc f -hL5` 0S 0 0S<0040   0+0 '@NLLL -LM⠀0圐p97댠`47P00V@@TP P7V7  b=  b=`PpLLLL0 0DS@0 80 40 00 ,0 00 0 dM`MMMMNN -L M@@0 S( P@p`p`20S, 2Ÿ  00 r0s 0SR !0S0S1 01 00p 0 00 0S/@@K 0=$1P a,1UP0!c0@P*P 0 0P00 0 0  0Rph0 00d0 0000 S 0 (0S8(8do!dL`MȺLMLM' p-LM0`SQP@0SPE P P@P0SUfp0SQ 0S0ASQ 00S0 0S  -qaQL 0@ l0T@lT@S   0^ࠡ0nP 0 000 h0 00000nP0<0 0n d0 MM`MGLL`c@P H@Td\$0 000a b ab@P $0 000`a`b@a p-0LM0@S 0S PpP pp`P R`000SP PT R ,0000SS PpG`ML -@LM80 00 B0 @00`0`MLLM -T0LM0@SJ@000S P @TZ`ML -0LP@N -QPp1MLP0 0``P!A0P000SPh0S `1@HT1@0@T @1@a0 0CRP  UR1000S S 00@0TS P0ø 0D Rڴ000SP W00P00S U PT P00C0LL0 0p<0 0P000@MNfM@bL`MLL -0LM00@0T0p` Pcڴ10U 010`@18P`  TJ1U RZT010Pe0 DPPE0 0U00M`cȽML̽`M -p@LP`P 05P  T0P0@` "l@h 0RX0X 0 ?R D0@0 000c N N@g`cc@bML`M P-L@p`5PU U nU"0 Pa50Sa uꈥ\ |0L 0R 0SPUQL0   RRyxw0 P50000050Sp 0S 0S0STQڨ0   RRPO0 P0 00& 0SI 4Q!0S 40S0ST0   RR(0 `P000 3 0S R0S300PSU T P0 :P000 ßS0 0S_T2QW T g 0 P_T$0S 0S a 000S|2Q00  C\2LB 0 P 0 P000=_S0S 0S  0S  0S 1 T "0  P  T  0 P000 P D10SLSS G >PC <P2 10S ST0 )0P90 @@0@0@0TP 0 PX 000P 0 yP  000@g`MMGLL@MfغM@b 0-@1@LP T00 P0S1b Q 1 Rb\0 00R 00S 00S00S 0 000 00000 00 p00S d00S *00 00T000N N`ccM@bbbf`MLLdNP00S 00<0< 80Q0(000000Md'dLL0 0 M`c p-pLM@0`t oPPFp@ p1/@0t T T000CUP800@)P@0 V000pLL -@0LMTP0P *@0$0P0PE0+ P` p Ulp@ZP\ 0 *0Q0B0Q*0Pd(0PE0`X0000LL@-p@T* R  :P0b0D 6@0@@0@0 NUNN< @-P 0S 00Q N -L``P@ T 0S0S*0 S0SB @ T 0S0S:p R000 0  `0St0 @ R0 0S0S@@0 S$0 0 0 NNU -L^ 0 '`N -LMH@0S dR 00 000P00 U@U -2LM0pS px} XW"Z 0S 0S *Z 0S0S:0S0S0$2Z 2 00`PQ PU`R?Q=PP;1 `XW `1`P0 00pv  0x@0XW4  0 V;U9@04P 0 `VU [0`P0 00pv  09@0VU80   dN@U Uh`N -LMZP,"PU 0 S 0 S *PU 0 S0 S:0 S0 S01U 00 p ` Q `VpR+Q)Pp1P(0`ZGYE $1p0 00px  0@0P`Z,Y)pP ` V U x0p0 00px  0@0P` V U0 Nh -LM P@p` P@t0u00X00S T00XtuP@tTU@0` -L M0-S eGECY,  ;:!`1P 2LPp% 0S" 0SIPP` 5@5@@HP 0`=#.U0S%PI1.   Y L `40 , od\*& (c 400S AUa0@S<0 -A @L2$0R20pOS( -'PLM! $P .P ^P@0 00 ]P|@000C 0`@`000T@P@ 0s0s(`U'`>X(( -LP 0-LM@ PKT 00000> -L M@K0,sώ0s 00@3U> -L M^@K |0^0s 0s\0000 H00 0400 S P X>c -LZP ,0, 0S >8(@-, (02 S@04RUU 0-PLMP0K K@XP# 0S00R0S$ 00  0"T(X P-L0 ~ h{XH: 0-PLM@Y P 0P[0=0C:SGLhhhhhhhhhhhhhhhDhhhhhhhhhhhhhhhhhhhhhhhhhhThhhh<hhhhh4hhh\lPhPdP`P\PXP@8P-040K 0(10 e0ggg@DHePPPP0dPPP> -@LMTd ThL0 !@<840,hx(>`((()P) -LMЁ0P@$0 * TTbA`? 00B S10 0C00B S0hQQ@`,0,SVVE1C B(1`$1 <qK 0S#T`VPK K"3@30@1`  0`V@Kx30@t3 ` PKm3@j3P0@`0P KHP  $0S4$.o!LLȽ̽)))P) -PLM! P P( R0 0 0S 0S l|T0T Q0000K (0,0 K0K00K0K0 eܺݺ)) -l0LM@QT T@ hN$0  he)>0 R00f` -PLM$ \ R 00S S  P$K ?0000@0pS $0@ D$0 0RVtttttttttt$ 0+SppW0$0 q1 +P0 (K$( $ 0+S0(0 1[\X$0z@0C$0 6a0DPS``-P@<0K0P 0(0 000CS4 4L W'P000"W $00Se S$0 $ 0 S 0$ (K8$ $00SR $K 00S($00SHYX>) -LMP( `P@p@@P0U 0@ 0$K$0 1U0  0 0S SU(00SPPU`  000CSW h````UF U IU F 0 0 S008U4 U 7U 4v1 0000vp1 0 00X0ESDU U U (K, K,0S 0 000S U(U 0 W000CS0010$K0$0 U 0  0  (*@*\*4qx**cQ PP -LMG@0 X* -LP0 0S00 -LP  0   0PY -LM0K0 =* -0L0hY -`LPp@`0PSE 0$S T; 2P80 0C$S'00@f > 000S -L Mp`P0-S@@000C S U 00V(KX(`  00B S10 0C00B SU0@0X`* -LM@ R |00S dR 00X0 0P0 0H00 R 000 $ Rؽ `@f33\0S R 0 R000000ӑS$0Sؽ@fA0@Sa @0R0-P00 p-LM@P` X0@0P SP000000STg0Spb Y -LMK -LMpgU`/@/@@, 0P`% -L  M0KA 1@ _P1$a0d P@00KT0d  U0K 0  -L`P@M\0K0 0鐆P@ !) 0 K4\0d 0\ 0 K00PKF" $0K p-D1LM00@`1 (1 p0S! 0DS (0<800CS dlt|@T U7`KPP0DS  0@phcg p-LMD`DP0@S 00PV=P0  Pp @Y>c 0-@ L08PS@00' 0R+0@00g ?] -LM@P P -Lp`$M姯Z, H0  `vp0.0K.K0 50 P@0@@hp`0Z-00hH  ,0 S , *o!3 -Lp`$M姯Z, H0  `vp0.0K.K0 0 P@0@@hp`0Z-00hH  ,0 S ,)o!3 p-LMP0ϰ0 0@` 0K K\0/cC!b10@00R0a\-00a  0S)po!gfff3 0-LM@P0$@K 0 O. 0S )0o!3 0-L M@P0@K 0 }7- 0S })0o!3 -`LPPp% %P0 `p`0nS dS sS@P pPpP -LMu qP@f T T Tt h -0p L \ `P@ 00S 0@0 S @ \00ShL D000@000T(0 hg>_b@a@bc 0-L@Psj 0 0$g p-LM`0PS@ t00SX 0@S  @00ScH(0 0S0 >p>_@bcpT00C p p000C 000C?001`@]0@-H 0\8001000\0 010`@]0@-<00 CR,0010 BR0 000`@]0@-8 0R (0P@0100 R0`@] p-L MP` 0@R$K0S ]%0 /00$0s 0s 0 01$ Kp``]@]0@-P 0S0S0X@0^! 00S 0SN00^0@]` 0A`P<00 r0s  P@]@-p@0\`0 0r0s 00000\0 `@] 0P PPB@` -LM\X@TLD@0 840 ,(0 g 4!!@!D@"H p-LM@,@`P8 0S BPl   F:0  p`^H^ -0LMK0K00K 0-L M8P0@K 0 . 0S f'0o!3 0-L M8P0@K 0 N 0S P'0o!4 0-LM8P0(@K 0 n 0S :'0o!4c -LM@u q0r00T00S 800T@qr ` -LMB@6P񟗔L@LLLLLLL@LLLLLLLLLLLLLLLLLLL4LLLLL4lLLLLLLL4x1 t1REX10SH1D1< =+B01$1@0S, qpq' P0lp@q ]QP@@ P0 SPN@@Bp q  (0VP`^]c c>@d@` p-LMB@6P|Tpx \pP@u2GP@UʰP2 R B@0`PP`VUP@UʒPL2  B?@0%2z2S P@@r@0`PP`VhUfP@U`P^ph[0P@zt0 u SR?P@09 ap0 s2  0 ^0 S*P(Qph`^]<' 0:S S@.S ?S  \SR R 0-0LP0CP@ Sf0B0C2S=0 00 0 PE000c -<<LM0pSP0:S %S .S) ?S \S . `V $K00!c(PPDP`VPE $K@@!O(P (0S PW00P:g`^]D0@ -D0L<080`00 ,0b A0 @bbe@ag@`(0$0 0b0c0A}@bb@aH -0LSPp`@7  r000000S R000@00ӑ0 T00R00S@D 0S 0S nP0S000S&10T00S 0T S@D004qd\00SH00S800SSS00S _@gf0S r0000000S0S4q000  $00S00S`_^^ -0LM0@SԀTpW.0000Sp頠`00CVP@tu 0 0S  0`0CVp@c^`` -$LM0s0s@ !1 P@R00ol00ShP`00CV)pP@u XWp q   Q0 P0  |Y$`00CV`Ⱥ@c` -LU0S, ,h0S000hV^4 -PlpL† @"60SX f L0ST@@0SZ 0P^^84`_ -LM@P=@0 ^^ p-LMP `@ (0K l0 0"T\XPP (0 00 p`_^^ 0-DPLP @ T000  00L_^@-p`P@Q|0s 0S 0S tu' 0S$\!:00SP00S0Q 0S 0S tu 0S0S*QdȺe^L@-0S  0S 0R0S ^ 00S0S:@T 0S 0S 0R 0R@m@ -LP@ M`, K00 yp`PWY Z 0S0 S` M Z  0 S0 Sp`A , 0S? 0 S, @0 P`R @0P`, P,0S, 0S @0P,`00 ,  0S0S , @0 QP`R0QSW -LM\S\p`@0 :< P @0R^@00hï @ 00 0hï @ 0<K%0SP0PS @K 0P<K 0O<\ 0 <0 <\L00S0 0 T@_c _ -LM@K<0s0s m0 c -Lr 0 0S0 he^ -LM@P  pP@uiP@0pX W``/P@,0`'WP@  apP@u|0`0VpP@u p u `VJpP@u gc` -L,M@@K `Pq@K` ph200 <q8 r 08@ T<\  Q R`( 0@0C 0, K `P @0 1 ` P @0puv R@0KD10S D@0dS0c S0 P @,0K4 K0,m@K,#0"0P00S`0P00S Q   H  4  , 00@z00CS0uH00So4, 00  @~@THhde -QLM@P` 0S!-P 1,0<R A0S* 0S!0S001 &뀁p0S  PP1Wp 0S  01A 0S 1 0S{  0K(0s$@tl K>0 ` PP` h P00 R00SH0  0K 0P 4`_H4e^c@_ _h4c -L4MP@pß00K @KP  R0S `  D `VD r0s tu h20S R0S0S *tu $200@_0 K0tu 0S0S*100@_10!0S0S00 ?SRp00pWÏ0K D1t u  y0z 0 U T P @t u  U0T0 " 0 @0K@  Pl q0s  ,0S00S0K@0K0 K0@ K 0^_Lp@-`^@P  \\ 0S 0\ 0SP@Up^p 000h 000h 000h -@LMTP oDl< gdah]08H8`8 -81LMXH @@ K{C@3 @\:mS0  @`Pp$0S0S 0 0?00`0  X 0S L0DS$0   ihH8c@b`_`Nd|4 -LM0$ KK 0 0 P$ - L  P00\ h -LML0K @p@T0[S00KT[ h -FML M08GNK, $8$@D @D0`PX '??p 20@FS=<CCCCCCCCCCCCCCCC8=CCCC=CC=CCC;C@>C>>CCCCCCCCCCC>??(?CCCC4?CC@?CCL?CCtAAACC0BB6 R6 J6 R0&<0tvKA F$P00Q0S 8}0@9vKA 0$P00Q0S g0(8uKA $P00Q0S Q0<:luKA $P00Q0S <; 5D,5 ?5 ;tKA $?Q0S 08:$000"000;~0@0{08x`4 R$  KJ p pGJ HT$ 0 Ps /P* P P$0004SP0;000@P P3 R3 5P3  080@0 P8  Pl3    P<3    P3 R0"< P P070$H P P060$T 060$P 070$L 0 70T H L 008rKA 7$P00Q0S (n0$000qKA $P00Q0S U0,0|qKA $P00Q0S t?0 0$qKA $P00Q0S  )000 1 `bVQ$BnKp`F`FO^P  4P $0=P *X0-S  -F-o!'@i6HhLh6 |!6677hl07@h4H7Dhd7|777@Q+X0+P -L4M0 4 00[ ,0 dZP@K0@RP@P 0H0P 44 R 0@ D0  @ D t0H0 0D S ;0 oR04  0S00@ I8#8L0 T3 M 00CS0xS0 00 P@7b   <000<0SB0S "0P W00 0 ,,L< C444 00 0dBD@0pt_,`2 R  4@ 0SY ,K ,0D ȩPPI 8D080 ` 1B< @K0 00!P@# P 1 xs,q@ R tld1 RH@4@0Sp $ 1 @bTQ04  0QInK`F`F04 MPDDT0 sT pP, MK@D@D 01[0 )NK @t娄pY ,0 S ,0  p 3MK@DY@DD*,x P XZ W\ p*o!0C |!@CLCxCC@QPCCD -LMp0R@ 0 P`# UTP m"^K@0  0 S ,   Uo!FTGtGGG -OMLMB xUhr  , u 7 ?K@KA L%0 B% 0UK 0 P[UOKH H Q *CX^1(K R qP0`S @"0 @P\a 0PS@X =PP01PQ? % 5P P P 00P@00P0S P U 0, BQp0  ,|TK@ ?K*4W`io!GiGP`(cGH(HHH -GML M!0p,0  KJ`J*K@_ ?K0 K@_0dpW  0SS?A pV`P$ZWy0 ,0S ,o!lHxH P-L@ p0 Sp p `P RP P4  0@Sp0!R9 -LlMȀ0@K pd$0 `0S" W0`CwTP|DS0@` @)PhTPd }) $0S $ o!_YHE -LtMpp, `PKY 0<< 0 @@WW V!d=P; 0W0@ 0[?S. Y  KP 0@ S @RT00T0ST00T0S\0 ,0S X,`LV@V@F Y o!HHH_HHHE p-@LMVX`D00CS0X0ӤX0 PpP x@00CS00Ӥ0 Pppu YUyUp74  P`I_E0!400   00!$!Ƞ ! -AML Mp , @@ @4$ BnK84`F(K $t8 `F<$  8V w RS3(K :@T40 0S S@D00(K0?S (K0*S p3(K RTR " 0SQL#0000ӑb0CS][\\\ ^\\\$^\4^\\\\\^@$@D<$ 000P-S+SP84 0T QBK0A0A᱆`PQ0"S 04 R[<QOh0 ᆘ84+S  8-\ `   00( <P% NZ`P)@H0 ~g/ ;@PQ  0lS @aZ dU D1 ,0S H,F/ `P<$b0 MQ000<4 @D~@D00< z@D< t@D< p0(K R ?aR( K0?S 5X0 T BR X0`  äX0 8?Ao!_idiiP` 0-LpM 0Pp@K <0s |0: S S0 #&IP^ p-LgM`0@0 Pu @T.K 0st |10! 10t!  0S 4zpU@%o!edA@ILI -PLp@@W` pT P 0 0S 0 R   -L Mp" 0 @9T`P # Q0 aP@'0 ]P@\T TR 0wT0Q `PA@9dIpII ?0@- |&>t0@Y.@P?/@@B@DRPN`,0 @`VP$@Z -@L MX &>opn003X$`pZ p-LM&> @`@S ~NP PwU$@pI -LĠ[D 0Pp`0 W ,v P00 -LĠ[D 0Pp` W, %&0 S qsd -GMLM 0`p,0 ]MK@D@D 0Pr0 )K 11.QQQt@0SPU`MPOHO@ ?_0fO4qKi(MLMlMM 0-@LP'O0lH -LM†@0`t(0 OoKp_ 0(0 S (9o!MM -L  0-@L0S P0  PO0S0M -0LM@ % &> ~LUM -LM@|00  00S ▣P11>. \\$ ,IO QL@O4qM(LK 0-L FPhP`@` 0S@L@T@ 6 0(JFM +0\bdblp p-MLMa0P0 P@0 p* AK@@+0ZP! TAKAA 0r00000S  r\00000S 0S@\0 Sdpo!4q&-Q* rh000000S  r@00000S0S QQ:4q p-PLMU`l l0X L 0@0PP0P 0pNi,N p-LM0| @Pp`X0S00 0 0m@P @]  pPi -0LS S h5h|4N -0LS S hEh4N -0LS S hh4N -0LS S hrh4N -0L <O`dN -QLM,  10S 1 |1| 0RlA000q,  00S S@1I0S+ 010S',  0PS0 @p`N0 0^T@@$UPP T00U,  d e@  @*xPl0`@+X0 0, I80 0!0 0 0@  Y rorrtsDHNLNs p-LM`P@P 0 SP UT0  mKP00@  lpt rP -9L M0`0fS eS gS |)x)t)000P@00GS񟗲4444444444Ѓl؃(4PX`| (T u5 0 00 R5 5 5R9ʨ5 ! 0 B 5E ,K0, R( P00R0S p AW85 8EP %00%6 ,K0, R P00R0Sp44r44  4|p4 d4 Bt$p4 h48d$`$000jPP0 0 0# 44\00 0_4R4PCM3JI3 3@3   <3 |3333-3 d3(3&3$|3"x3 t33l@ P3H P , P &3 w2P0@S@" 2 ,pp620`V20S] "0Ss`F`1t0@S "000P2382 42 "0T13 0 `1Q0S000  00gP T1 P !P10S 8PK(0S0 00S,0S P` Pq0僐Z410S V``V < 0R0! R00S8A RV3 00S/00S+V# p0SR 0 00R00SR IE0 0R00Xh0 : -00C0r@ootu`onr@rq`tnnnPG -@L` P1T T0q4T0S` 0U  R00000ӑ00Q000 Q0 Q0a !00S  R@000ӑ0!0a00Qts@fd -L M@p  00S $S 0 , 4 0 , 03 $ 0^S00C02` V4P P @ P0F004 4  )   0RJ rL200000S r$2P000PU0_S ,S ^S $S =S -S :S /S 10S  R10000ӑ0.S 0?QY004 S0 3P0Q810S,10S,  40S Y04 0b0C S 0Y40 0i0bC h0Q0Q a01 l00S  Rd000ӑ0!0a0 Q4S`sPP4qs@f@s@rd -LM@0p@R`,@ *$R 4Sf 4S P`PR S Y7Kp20O00O4S  0 0 Sr400000S00S_S   P0S r4400000S0_S 0 S 0R r300000S0_S0 Sr300000S00S_S4SPk P bpW00cO0O4S @0 0 Sr200000S>00S_S:   P0S r200000S(0_S% 0S! 0R rH200000S0_S0 Sr 200000Sl00S_Sh  Us 0b00S10PcUj~pZ0O00O4SL @0 0 SrT100000SA00S_S=   P0S r000000S+0_S( 0S$ 0R  r000000S0_S0 Srh000000S00S_S@,@  0 S 0 b10PU,4q -L?P~  -LPt  0@-@TP* ^ \00S.^ H0 0S \4000 ӑ^ 0@T:0ss@f-\0Q 0\ a p-1LM0`S@PP10S U t0 CR 0R0 S 0@00ܻ,EP$10S U 0 CR 0R0 S 0@0忻0DPU 0 CR 0R0 S 0@0T奻L@0 00CS0 ph閻0  0psP`srP -LM@P@`p!%pF@K 0PDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD(DL` 1p1' 0`0 R0T00 @b0Q T00S E0 R 0 R V @PG0P@S@0$ |!Puuu@uu@QX0,- -LM K@P PPpJ011a @h@T '0D@SPUjoFZXP TPpH: -LKM MCNK@D0@D,0 p F M>KPKKPPAAfP@4: S  S D0,0 S (,[mK`F`F P@ P P  P@g 2 R^2 R BPN PQ 0G0@<@ 8@ ;0K4@ 0@ CK0 8KKK N$ 0N<K D @P`! !04 1D MNK !0P 0 0thD}` FC@Pp @ R@0 0Pg :P  pQP :0 2P Tbb (P@Y Ph;mK`F`F P=o!Q0QX0uuut0@ 0C^!\ 0S \  Y -LA^K@M PETMPEp` | #_0 S\0 K`00UA>K 0C O IlY(Y -LB^KMMPE@p`D 80τ KBK p$G -MLM`p ANK @D@DP8 ,0 KpA.K B0P0& R0-P@L4 \ 0 0hv8YPY0 @0 SA@Qa0@7 @SW @  -LM0P0S  ƴ0XSxS`pW` *0@B@@p갠 -LBnKM`F`FMP@!\ ,$0K +. hB>K0C\p % G0$K0, T00S x P Z ʖd0X $K0\#0$ K0@0XSxSZPhYYYY -pL`0@TP) 0R q0 0 @ R T^ h=0@TT=pW`4 =0@T=4q$ZYx Y -LM0S!Ƞ R 0 S  Rl l0 QAQ 0H< 0,<R T,Z@ZTZxZ 0-PLH<0@0CT]0hY0<0@0CT[LW 0S<ZZ p-LMPp<0@00CT`Pph<D< :00CT@00CT$ [Yx -00LS  S s<hp<ZZZ -AML Mp0  p4 08 ß3( KBNK0@D#̠(0K@D5p B^KPE`PV00(K8083( KV0 9$#0(0K0h3V2( K0̠0(0K pi V2 0Sp>g $9"(K00hWXP! 00 x<p< @ 0 TP@;D;<;0 ,c;V] 1SCV& @0 S; S6 7S1 nS, _;;60S @ 0 0@00 R  ;20 S|84!(K0p0hWP08$44 ;1 8;;1;10@ A`; 048 % &@@@?81` @ ZZZ [<[P[l[[[[8[[[\ \ -LB>KM0CM0CpT"PB`(0K BK+I"ᰠ (0K+ !尀0S$ @P!, 1 (K  ;00CSpx~ @ 0SX) @!0S% $P!<0 (K :0@0CS DPx(R P 0S,(0K 0R000'G dP 0-LANKM@DM@DP !{1̠ K, :: ::::::::}:z:w:t:q:xn:pk:hh:`e:Xb:0___`,`P`p`````a8aTataaaaab -MLM!0LPK@ K,0 L@ H@ D@ @@ <@ 8@ 4@ 0@ (H尀H X0K<0 P X@ T  p\R T PKX@1P8!8 :X0pT0 2@P`L L0`9 w s o (""( 00CS00 ä0X0pW *80 ,0S d,j饰9H o!pi DVP`VVWWxVDbLb`blb|b -0L 4 O`b -$3L MP@ ,0  04 <0 80 00 0-S !, ?4 J8 " p@g TP r0S `T> TP` 2SiT/ LT<  <  T oT00000  lT@00@0 vT|qP0S 葟@ 2S P2S 0" 0 8 R㐑, pT| 2 TT 00C0040 @D0q810  00S !P0S @2 PR,.2S< R%@0S< R000 R00S @0S 400 R00S <0@ 0 - ,,6,,w%d d |!4q p-L$M`<@K0P  0 <0 80 40 00 ,0 (0 $0 I@ p 0[S Np  o!i Xd -L(Mp0@PK@`  0 0@ @@ K<@ 8@ 4@ ,@ (@ $@ @ gp 0S  !  o!i hdD -LMR@!x 0S   n8@] |Q<0 CR P000S% 0CW3? X 0, CR 1000 \ `0 CR 000 \0S@0> CR 000Ri0 Rd \0R0 S0 S0RP` -LM@͹0S Ĺ0Shd 꼹0SP 0S@ < P0  $~xdL=|d8\LwT9d6 P-L 44M4 $0$ : 0g`$g\g 0-LP3 @@0@U  ((+D %g`H3 P-L@Pp`8ڄ"pS@5 #P.0PPPPPPPPPPPPPPPP8PPPPPPPPP$PP@PPHPX1`111111a Q@b1j1 RS |%x10SHP @*P800pBr00lD:j g } |{{`{@Q {zg  -3L,M `R@Pp?T/TP0-S  @P( 2 @@KDK@  0< 0 8@ 4@ ,@ @@PDPv0SgV VH @ *0SY L20S@T:s2LP0S   RR 1 R00H00 P'H 1 H R!0S0 L |A60S0C00A P66L@35?2 "6'30 R 6P`  0 @@PD0pxEB?l S Q O& K2 00H/ { @}`{ {ggg`gh(h@hdh|h -LMA@K'Q)00000000000000000000(000000000000@0  Q 0S  0R 0000ʼn`@X@P@H@@@@8@0@ |@{}|||||||| -&L6M4 P6R@`,P 00 {8P 0gS 6@DT)tV0-S dd6 0S , K qP06 R  HP U&%5 6 @DT5%0QS 0^ 80pS5w Y0pRp  r x@100PP 103S 10S 54 R0S ,Q  0S ,0@ 0gS$ 04` R4Y$ 0044 0S.0SU V| VpSd4U7VP I <4U00T00S 3 R4B44, K0@S x3 R \41 T0 0, KM/0@/SB   ,L dxx   0 8LT\d p0 02z| @T , K{ 0 @T  n@T !000!@T  @T 00 0 0@T R{1 18  8 $!@T  4{@T hyyp0, @T  040 @T  @T { 0* |/ 00]OD { @}|{h0f2Hf`}|z &`fpfQffzffiff}|hf -PLM@0.P@7 0-S 9@P+d040 h000 0 |@-S@000<P0 R b0P P51:P13:4S!<4,3-zR9 R, 6  R2 R/0S,0S0 (껺0 p o隺0\喺 m`Xl,m }@mTmhmP`|mTmmmMbm`{nT n n8n p-LMHPH`@D,$ S0,  M L@phP`lnxn Q-L`Pp00CS00  ä0h 団@, $0p0CS00  ä0@@<, 0B00RPP sP`nT, Q-Lp@P`8 \5 0LW3D 0V C,<R 3000` \ 0 CR 000 \\PV 0> CR 000Rh,0 R \#0R \ 0 S0 S 0-,@LP0S P@0 0-LBMQ0 0C @SqO ,x 0S d0壬 L  4F/K<㨬 o!nP`nnnn -0`PL@ p 00B S0B a0BSWBA0BS7BR@P  ` `Q:0e0b``` -L@LM "00P 0;0||n -L`$M@KP@  D0K@ < 8` 4P 0@ ,` ``hPp+DP 5P`' D0K  ppVPD0p|e(V V@ *U  L0 0S 0@T:H{H(dhnno 0-QL0M@PT 0U0T00SL TC T: T01 T00' 02T00 T 0 A 1 $(@*01 R1 R001 R0"01 R0"0p1 R"X1 R"T- T$ T0 T0  @ 0@*00 R0 R000 R"|0 R"lll@ L,0`@*0 H D0*`$o,o4o`:P 4勼 @0 <0 p<rl2rw(r rrr -pP0@P@TL`% 00000S 0T 0S0S\h4TH 0S 8,P@`逰<rrr 00VO 00NT( 00Fxr - 0 L0 s  - 0 L 0 $s  - 0 L0 Hs  -PL0M $ 0 0p0 0pS`! K$K3P 0S@! K$K3P 0S$0 1ʱ$0P;5P0 $ Q 0S$00aSP 0 0QPPW 00S  $000S $0G $0$0QR  0+$0T ps|ss sss`@ -CML M% P` , \ EK@A@%B3P`4 5b5 T`4 |5 t5 d dx`50S y R<5 t 050Sp `4G4Pj 50S0 0R r40000S 0S0BKAAS0 0r40000S R0t4000ӑ00S0BKLLH40S  040S 4$4Q T30Sc0 0S30S S0@03P0@00` 2P@~dW43@\4XT30SD30S `43P 20S`4 `4 20S Q 2@`4"2Q\20S@Xb0 +0Svh20Sr TR0@P0L3P0@00eENK@D, `4 0PX4S`4EMHTUH 0SE 10S< `4[3P6 p10S h T10S <14!41Q ^@10S@p0 0S00S `0@0'3P0@00P 0SEK@\4XLd㚿@0  ,0 Sh,o!ss -@@4qd`@ssss ts0 t- 0 @ 0^ 0ꨊtl -AML0CMP00 , 04 4 0P004@@S`BK@ A@"1P 04SBK@ A@"1P 04S44 2塯443PX2 4TpJ <20S2 0 R r20000S \!BK0LLS0  0 r1000 0S R01000ӑ00S044T d10S 44l 44D10S 44 44V 44BKAADV P44n""/K0 P 443p 4SP44  RQ  0|@@h0 X0 ,0S@,o!|spst @4qd`@@tLtTt -L6@00CS00  ä0 5{0S t00S h@h0hP`0Xp01P@`p`p0$0@s -AML M" P4 , 0 BK@ A@T"~0P 44D @2垮82 44( $2 2 8 峽d R1 _ 10S[ 441PU 10S  BK@R@ r100000S0 R0l1000ӑ0 RBKA00A<10S n $10S  Q10 S`0 ppe0S00S @Pp31P0P0004 <0P@8㪽<0@ ,0 S\,'o!\tlt -@@4qd`@lLtstt0 St4 -LMHCD\ <<3|8#0 , 30S>$0S 2 ϭԭ/$2r20 \0席2 屭ŸŸ"2娭2x2`l2P`2@ L0蒭<242@ 0 冭2 21@{ 0s10S !1jo10S !1]b1`X1@T10 |Ip1pqHh A\1AT1T \|00<40S(70@T Q %0@TP0  tDtttt@ uu,u@u(  puuu@u`v0v@@vXvdv`vvvw`M  p-PLM@P`0S00P xP00 \ P L0 D彬pV 0 屬pt4w(w -0L 00w   - 0L0 0 ;PP 0SdQ/ #P@Pq@BnK-0 K@`F04!┲  'P+0 K0 10S A匨 X00 G B0  !BK@P`Pt00P@ $0S<$ao!*Y YP zz -L`M|q Px t `tKxK\!*t0x 0CSD1 <%81@0P+t0Sx0t00t0 x0Pt0SPp@K O`@x0 @t00t0 x0 `P \0| Vt0Sx0T  P0 0S< o!zz zz{{_{${ R 0-L@0LDP0lP 0000}S$0`P04{ 8{d{ 0-LMMlPANK@D0@D0 P DD @0嘧 0S$0 0o!l{{ { -PLM   KKR)P 0S |0|0 nl0 0PH00}S <0<0S 0c0${{{ {{ -PLM   KK)P 0S |0|0 5l0 0PH00}S <0<0S 0*0${{{ |,| -PLMX   KK (P<800 (0  '4|L| D -PLMX   KK ʾ(P<800 ަ(0  d|L| | -LMM0BNK@D0@D`+,0 V+JpPP00U00S BNKB.K@D BQ@D BQ 00Q+a 瞰*PP00U00SBKA0A@-0K4PP ,0S,o!P| -PLM   KKE(P 0d SKK<(P 0DS <0<0 X,0 0xt||  0-0@0P 0 0RLP0|| 0-0@0P 0 0RLP0|| 0-0@0P 0 0RLP0|} -LM4@0S k0S  0-T@L0LPSH Pϳ40,0P 00 }` P- L<80 ӥ,0  hr} (}{ -L-800S (0( 0S00 ` -PL M0 , ,K0K!v'P00 1喥=00!p4 tAt唥#d14  40SDAL 4  0S$A0倥嘴P`4  0S 0PU @g0 PP@ d ,,040@ L0 P0R  4}H} `}t}`R tY -0L = 0}@  -0L 1 0}  -`VLt Pl@lph000000H000V ,00h}` @-p0@S @ T00R00S0S `P0S  0SQ0ѷ  Q00R00SU000S 00訨 0-PLM  1A00墤 P KKi&P 0S 0 0冤 0 00 P0 q0@0S 0 S  @e@00D0HD 30 S , ,,0@}}}  p-LPlM@ `K01 R R; 0S8 0$S \S0S@+0^ 0R 1N 10 1<0K  R 0S`0K  0R@T 0S0 SR 0S0S0K Ac000S 0[S@ $S \S0S0$\( r$300000S 00S 0 S 000S1C0K 1SQ <0K`K ! 1R 00 1R@D0 S,S : ]S8 0\S- $S' rP200000S 00S 0 S 000S1C0K 1S <0K`K ! 1R 00 1R0S 0 0S,S ]S0SU @@T0 0 RK ]R \S0S0 R ]R0S2:0,Sq ]S@n) r000000S 00S 0 S 000S1C0K 1S <0K`K ! 1R 00 1R000S1000S(0(,pp4q} -$0L \00.0~  -0L ! 0(~  -0L  08~  -TL P D00}S8080S00( P 0  H~ P~|~ 0-0LMS0 lKP@tPu @0 \ ,0廢0客000~~~N  -L MTr0$ S( D P8"$K(Kj$P $0S (0 2凢 2 10S1(0a u0S1 0 1s1@0 P00E0X1 `1!!00 00T11 PU @!00CS00@Ӥ0u@t0 S@  1 0U UP 00PUP00CS00@Ӥ0U@ T tt 00CS0F P0 R0@0`@L d`((_ 0-PLM   KK#P 0S t0t0 d0 00%pP@0<u   P͡0@0  -PLM   KKʑ#P 0Sp0p0 孡 0%0sK0  ( 0   嚡 0   0R4   -LM00 @P  0 0hwl( -PLM0 ,  !,K0K?#P ,0S00 0\0 8 $P0 sP  0S 4Kp^ `0 p吀@ 00 h04dP_X400080S \b@\`tLt -MML M<ğ P,   % OKAOKA$@"P4  S0X C4 yP@ 0X30X 4 3ݠ3 NKI I tt#Ӫ1Tß5 01 PU  r@300000SP0QcL 0$S \S0? = r200000S@ 0 r2000!0S00@C4PE0CS 4At"0 f፪4@iQ4 Z% P 4("  f{4 `000SP0S0q000p`1g1`CP 0S 10SX1VP1 1h10S ,A0J =010S 1U!  0֙V BNK@D@D0!ǽt1 @4 < 8  XACKT1APA@4 PP4CKSAA4$ 84 1!0?2cS D40`4 !D4`$0RD4 D4HSD0`$0Sr` ,0 S,o! ȆxzO@, P"Dr|t Q P-L`7 P@ 0pSP' +Q 00 %Q r00000D0S  r\00000D0S PP0pS@00gX4qp000000S00@ p0 00000S70@W0@ 20rP000000S00@r$000000S70@W0@4q -LMl @L0SX  E0S<  >0S$ B0P 0阂xz -$LYM0@,0 4p@` [K  l4Kl  0h d `A _pP0%,L@K 6P  0P$LK 0  %P#LK P0ゼL0[S LK 0W_PU u  ƨ Qx3 p1Q,,TLcpA@#@3T J p10S S_K <弲P,I2 C7P`Ȣ& PP0S U 0S S_K <呲PP,DT 8`@TV H 1 p cQ .0pt1 @]/KpA zP/ J0S x ^?K 垵P ቦxA00pღ0dQS PP H10S 08 0ȗPP㠥P | _?K,iP00S p0\0 p0 ,0S,o!@P( ЃăP`ȇt l -LMd@c 0 0CS00ä0((0 0 S  --t1tq0LS00`& XAXNL P< 8 P< -00CS00  ä0 u弹P@T0  "㢦 @w-夹0  P0PSTユ ,4@  } -LAM M8B>K0C0C0 +, $ %@$ \ p< 8 4 BK J4`J Un0@S񟗾dDP 0[tDPp 0P墖:u04S440S (D(噖($ U; #0SS5V4X24UV 4V00V00S30S#30S X X0Sp3|3 `X30 CR 0R0 S 0P0Xu3 00000S "01000C0W2 0BSpRdppW00X00S u2 00000SpW)0U0 U00S@$p0 @<2QP4@ 5dW(UpX-U848S1  8 V-0K`ZP4A PP210SS5V4Vڐ10StA0 CR 0R0 S 0P0%l4$RB>K 0C c R+#$ȟ8Q 00 S Y44044 1V 0  <@ 0 YR0 00S <$`0RR0F<,0 S x,<# 0 o! dlU4q  -LMf00 (@(0 t噤렊 -JML M ͟@͟KK`͟VSp=͟N_N<,p 0P@004 <P@0< 0 $ 4  Q 0-S<$1TU< *<@T $g d< `<RP