ELFa(4_4 ( <<@_D<  B00 RՑР -LR __c_main() returned|Qc   ),@@(LQ 0/ἄ_Rc -0L MR0 40 @, *0"Sp! "00# 0T!oR 0PS 0 $0S`F!0S 0 $*0Xb0 R2p'0S  0T!oR 0PSv 0 $0S`F!0S^ 0 $0SL "00# 0T!oR< 0PS1 0 $0S`F!0S 0 $ 0 R2h)p'0X0S]J082p'0S  0T!oR 0PS 0 $0S`F!0S 0 $0S "00# 0T!oR 0PS 0 $0S`F!0S 0 $082p'XZ0Sh  0T!oRZ 0PSO 0 $0S`F!0S7 0 $0(S"R$ 0 $0S "00# 0T!oR 0PS 0 $0S`F!0S 0 $XZ0  0b, 0Რ qR  0T!oR 0PS 0 $0S`F!0S 0 $0S "00# 0T!oRp 0PSe 0 $0S`F!0SM 0 $0S<  0T!oR. 0PS# 0 $0S`F!0S 0 $40Y:0 ,0 ,F 0\0 ,0 ,F2 0'\~0 ,k0 ,TFa 0\:0 ,!0 , F2 0'\0 ,0 ,0 ,lF 0\0 ,|0 ,eSFr2 0'\J0 ,70 , 9F- 0\0 ,0 , F2 0'\0 ,0 ,F 0\n0 ,R0 ,;EH2 0'\ 00 -LMP 0* Qp  / 0p@ 0TGT`P0 T@ 0TPp0 T p-LMP@.. 4\8` #8$ 0 p Xp -LM0@!#P  0 (  -LMP@^ p0`  h  p-LM@P U!! `  U 0 Rp 00p -LMP@\ p0  hɺp  -LM@`<6V #Xp V * 0 RP: 0Q@-@%Qʔ000SS !0Q  k\`!0Q <\00000 d  -LM`,0KPp0 0PA, $@00K=;0 0P&40K 0(0PT4 (pA Ƞ,Ƞ4 08 X4 ( T  , Z Y4(0 80 4X0 $40, T, $@(, 0T, 40T, $P ,0T `Z -L Mp`, 0 P1<@T  0R PU0 R X 0Z0R0S 400000 R Z$0X 0S }P0S,0S 0S0@ , kP -PLM,8  Z09c`<0 p10@ 0@@ڷᾷ  0 @4@0@0xP 1U] |o$0( 0$0R$ ( $0(0(0(P(00 T0 $@  0 tT0 $pJ0 W p 0 T0 $ 0T0 $08 R <0R~0gaZZ 0-LM@0 0 0PP$G0 $Q0=;0 0P .0 00(P" R 0)(09 PX QT00P 00< $(,0  R<0Z480жZZ[<[ -LM -LM`@]pW0 P  @0h04p @d0T\XT 4K0 , (P 8MpPP ߳ a ha$ha`Xh -SLMp`@P P0  F0@(K 0( 0,`0 0$hagahahaP0 R D0 R80 P $00sQha ha$haha p-LM P\@` d0T X0T L0T D0T pp 00坡PEWFW@@W@DW@ -Lh\   -LMP$`Pp )  Do$0@S00 "$0S0` 0,@ 0 o 0  @ 00(@ o 0-$@P(0,P(0(0x T$ L B$  R $0SJp,0S0,00 Cp(0 ?p堵gad[ p-LM00`QPP440Q@@S  j8@4Pp80S 0-L,, Q@ \S0lP8 d0`@ 0VX#0 -LM\`pVe ,PV[ U@ 0  @  0 H00S =08@U@ @ 0T P 0TD@0 TP@ 0T@@0 T 0@  0 x00,`0 `0S\d Զd `[ -QL M`pP R 0S,S0 0S,SS000 P@ ( 0S(0S  R0 S0S5 Q'X#<Z \nP`  ͷ$8@@ <  <`4`  <0 S X^[ -RL Mp`' 0 S ! P @ 0TD@0 TP @ 0T@@0 TP0 0 僀00 @, 0P, ,  b I00, @b   @?T0h@T,0@@ 5 @-,@Q p000000000000 ,0, 00  0 00  -LMpP 0 P`@,  I 0U40 0 \ 4  d < ^ %@,P @ 0TD`@0 T,@P` 0TPP0 T8@108 @0 o=-\ \  00R 0 0 -LM0P ^p@ 0K  `4\ $0K^$0 0;00` -LM@ \p P`, 0`i -LŸ00`000@Pp0 T 0TUt 0 T0 $P@ 0T@0 T@0 T $0<<P> 0T@0 T 0T@0 TlA0 0C\ 0  "!80 00 $1C&  0 "!0 0 RmX;0 T0 $P@ 0T@ @0 T @0 T $0 P[c[c'[c[c0 -L,  -LMPp@0 T0 TP` 0T0 TP 0T0 TP 0T0 TP0 T0 TP0 T0 TP0 T0 T p-LM@ 0TP 0T 0TP 0T 0TP 0T 0TP 0T 0TP 0T 0TP 0TP`U 0P PT0 Tp -LMp"4 d,0 0@T0偖00 P@0, \8 @T008p僂 0  @TT080, 0\0 80 \4 @ 00C\ 0  "!p0 00 \0C& T 0 "!00 0 Ro9[c[c[c[c0 p-X0LM@PH`0 PT0 Tp`h -Pp @L` 0T@D@0 T 0P 0T@D@0 TP @ 0T@D@0 TP @ 0T@D@0 T$0P! 0 $ 0T@0 T0 $ 0T0 $ 0T@0 T0 $ -L M0 ||!\, 40 p@M ,*0ST1  , *W8E0E@(1 0S:P`劀0S0 0 0PNU@ PU*00 ,*00" 4 x03\ \0@D P gլp00 i P -1L M! 14 10 1 @00dS1 0 , X1q , 0 X1!R,00 )  iP,00  P0S0 0P` V {0˯@ 0l@, 0 04 0@ 00C\ 0  "!0 00 p0C& h 0 "!0D 0 R ?8[c[c[c[c0 - L 0$ 0 $ -LM  0@ 0 0T p-QLM0@`  `pQP* 0 P(U:p p-QLM0@`  `pQP* 0PXU:p p-QLM0@`  `pQP* 0P\U:p p-QLM0@`  `MpQP* 0 P,U:p -QLM@嶰0 屰[[ -QLM@奰 墰[\ -(L  -(L  0-" _  P0L @ 00h! p-LM@ :P` 0:00PY YR` cUpp p-LMP@`V0 pdZ:p0H@ 0S' 000K  c 0H@ 0?' p-LM@` P1:?XP 0s UP(0Sp(00PS 0U 0 0 :0P 0UPp -LM0S.||#0p#0lC0 0 0C\ 0  "!00 00 3C&  0 "!0"0 R0S 00 7 90p`%`K% [)0S ) %0K , 90@P&PK& [)0S ) &0K 0VS UR Z  p Z7-0pWp12gZ'1,@0pW 00P7 0000S 00  000 >9000 0`P`PDH$ ,0K$H ,K+K*@K12g1, VU0005M[c[ct[c[c0 0- @LP0 00җP0P0C& R 00#!t000 `0C& X 0 "!04 0 R05[c[c[c[c0 -h2LM PRT2 J D ᤎ0S4200h0S 22  8A^c 4$` ,p@dP,` 000S2022/`VOھ2p1  p,@`0,K  `VOZ`@0S2`VZ鵩00,0K,pK 0(@ *pK+KV T80< IP 202" P2022$00$0d0 \`偣0006P |La_p Ltj8\ha p-LM4@PU @$ `00  $ 0!2c1,0  0!2c16`,pXP $ - PLp0@ 0`0G坖p0p0C& R@ 00#!t000 `0C& X 0 "!04 0 Rn4[c[c[c[c0 0- @P0L00P0P0C& R 00#!p000 \0C& T 0 "!00 0 R00h24[c[c[c[c0 p-LM$ P0S 0 $p4 `  0DPT0T $0 0$0 0$0 0P$00$0p -LM8@6@ 00S<"Z -0LS0@0p- 0PP00P=WP`U L    ( ݬtj\<<\H\ 0-L@LPB 60( 60( 0h6' -0LM@p! 600 ` 600 PZpd3 <# R600Wڀ0?3S -1LMp@+p`0((0) %0K%[R%0K P )U d0 S pWf60++'0K 'K$0 0((0) &0K&[R &0KP ) -`0VLpP@ 0DPT dT0`0 60V D0PT -!圁LMp0P00$`V" 4 $0Q Tq0LH1Hӫ<Ы4ͫ$0 3000$  $  0@p00C\ 0  "!0 00 0C&  0 "!0 0 Rin2@0D PT$0 0$08[c[cuT\\\h\x\[c[c0\ -#LM08 ,0 p0 P 4 )3RR 0 A= 0 0   h3 ,0S \,宍0S 00g 0S@0 ŕ0őSS000@0000&2R& $ ` @0S6`V@DZX 0@00  00 `~0S6V`VZ6 `0S61`VZ0S0 00S000 @0 00   p pR00B"0P0 00    ,  R00 0B$`000 0 @0S   60S0 ` 00`(1 FP0 0  0 S   50S0`00`0 FP0 VE00@p x0 FPk40Sh@@j0H 00OK "F,#P000/Ꜥa\p -08`P@L p0 T P0  0@e0 -08`P@L p0 T P0 0@e0 p-LM`P@2PUOp 0 @|P!00 `0 0T2 <20 1$2\\<\\\ p-LM@8P@`4  00 00S p  0S > S 00p000 dթ`p 0 00  (000C0 ]8]h] -LM0P10#0@8PZ 0ha0 0000 H1 ,0<11p  $00$0 R 0$ 0 00  0@ }p00C& R 00#!000 l0C& d 0 "!0@ 0 Rh^-\[c[cha[c[c0 -LM4@0S @440S -L M$X @R0  l0@ $@P hJ]] - L - L ^P@埡0 0Q0p0P0`0C& R@P 00#!x000 d0C& \ 0 "!08 0 R,ha[c[c[c[c0 p-0LM 0@00 `R0P00 00C& R 00#!|000 h0C& ` 0 "!0< 0 Rphs^,[c[c[c[c0 0-0 L@ 0T00 0P @TP 00C\ 0  "!x0 00 d0C& \ 0 "!08 0 R0J,[cha[c[c[c0 -L M`P@P 0T A/0P T 1T $ 020 T$2 N 1W $5  0T A8 0T QP!0` T b 0T Ac 0T 1 $  p /0 T$ 1W $ 00W T  0T A 0T  0T 1 $G5] -LM@(0SID8 0S p0S`/ 000!PU ”(0S0 . 80S' 0 `0 @0(00C0 h匢0 0”(0S 0 00(0 0 <(6pb p-LM`JOPPU@Zp -LM$1PS`V 0  ;0!@@ p&0 1$# p0  00@ 11`Qw  Ru 0A?00 $0 0<<00 <2•(0ST000( RB$2@7 X!0L T$2 1 $  /0 T 0 T 1 $ $2 1 $ 0 T1 0 `0 @0( 0 0,0(• ՟75b -LM 1p $P` `V00P00S 1b R$ 1@c $\0@1D 0@傡'@ 0@#hb -L4MDpK@o 0 T0qS u1S MS< 6S 1 $ J 1 $   /0 T 1? $ 1@ R$@ 0 [80!!S 1d $ 0 [80 QSK AS|aS`2S$ 1 $@TT ` {K 1 $`1PU ˜(0S,0S Uh T0 `2"   0 `0 @0(1p 1 $ 020 T0 [80< 娠 1= $ 1`> $ 1PQ $ 1@d $`P@ 0 傠 1< $ 1` $ 1P> $ 1= @$@B[ 1@e $`P 0 P 1 $ 1p $ 1` $ 1P $ 1@ $p`P 0 @4 " 1 $ 1@ $@    1 $  1` $ x& ? "`|: 0T Sl S S 1 $ $2 d 1 $U 1 $0 <<0 TH  $0d)@T 1 $ 00 TTQ 嗟 1 $@T ˜(0S 0,00[ "4 0 `0 @0( 1 $" 1 $ Q@@? 0T 0 TS40 [80M 1 $@T ˜(0S0  $p0C!A 1SAB0 ?0  0 `0 @0( 1 $ 1@? $@AP`U ˜(0Su@ 1V @T0 )B1 l0 B 0< $@$<%< 40 ,֞40S @TO: 0 0   ,0,$2 ,2r 1 $ APP0 T  0T A0 TT 1 $ 000 T 1 $ 000 T,!00,, t40@T: 0 `0 @0(hS S  1 $ 1@Q $1@ 0 H$cS? 1= $ 1`> $ 1PQ $ 1@d $`P@ 0  1< $ 1P $ 1`> $ 1= @$@B 1pe $ 1@d $P` 0 @hߝ 1 $ 1` $ 1p $ 1P $ 1@ $`pP @0 p豝 1 $ 1@ $@ , ឝTb0ccccDddd(eLe`epee$eef f@fdffffg#[ 000 @  00 0000˜(0S%0 04 0 @0Q T0}|0 2h 3 3,!|ph |1 $, b!1317! b00" 0(˜(0S (0  $0 (˜(0S 1 $0 (H0 W _4  cP @0()D T凚 -LM$2`A p 1 $P$2U & 1 $@1@T –(0ST 1< $$2  j @/ 1 $  0   0T 1 $ 0 20T 1 $ A00 T 0T 1? $ 1= $ 1@> $$"p00 #RAp ApBp@|K  0p@$ZF X@ 0 0@ @> 0@ @?0@pPp1Z PUZ |Kf 1b $ 1@c $@D1 军  0Ty 0 P  2(0 Q000 0 >0`8\\(\ [ 0q 0 P  0 P   |K0p@7|K  0 P  |0p1! ,0 00 0 P |K 0@ 0 PA  |K 0 @ 0T6 1 $ A00 T  0T A0 T 1@ $ p 0T 1 $@1PU –(0SU `PK .0@,@q5 j 0d囚! 0 `0 @0( 1? $ 1 p $ 1 P $ @@ 0@ T 1 $`U@ULt 1\  R! 0XP@ 0 @w :0 1 $T 4 $2  PU `2S3   D@K5  0T 1 $   /0 T 0: T 1c $ 1@b $ @0D  0$2  0  h2ޙxۙpؙhՙ0 =0 1= $$2p00C2 t  ộ Y 1 $ 00#0 T   1 $1@!@ 嗙  0TT@@   0 `0 @0(B{N 1 $ 00#0 T 1 $AZPAB 1 $p 1 $$2B$2h$@hhhcR0^8^X^l^^^^^_$_D_h___0__ -LM 0!00< -D2LSP `p 1b $ 1@c $D•@ Q@" *0S*0S* Q : Q` }WxVp% $2  /0 T  $0"  0T A 0T 1 $ @0 T 1 $$2    00 T  0T 0 A0` T`V 0  T A0 T8 0` Tz啖]phh -LM @0 T 1 $ p0 T 1 $  0T 1 $ - BR0 01AA01LS S+ PPp T /,|0A_L P@`  `V@PZ0q/ RS2h -LM`$P@p!W 0   0S00\3Q 0Q%05  0i 1 $000 1 $0 0@-$@ 0000 00#0P00S 0S( $”  P\ 0S 0R 0SR 0S $2 0S 0000P00000 tl0$ pR  \ 0S  Q 0S0p0QtR $2 0S  0R !Q 0S0 0S0  R  $200Q0R  0S0 0@- PU#>@'  0R # 000#>T0 0R 0P 0QU # 00PRQ $200000 -LM  R  `Y,0 4 , 0 p0 1ȡ  \,  00,   0  5 ,SR Q. $24 M Y@ 0 @@@@0P/@,  0̠0 @0@%+X `\ 0 L卖 0\4 r { 0 T$2 0 T 0Y00@ 0 0 000 p0@@00S 1 $@0 0 00 TRhhi2 -L M  ȡ1p\P`  0 `R00S 0V00P0` 0̠@@*0 6T 0y 0 THi p-L M@PK` %U*0 ̠Pd*p -L M QpU`3 @K M@014 3[1   p   @0 #.[ @@   B( R PUW 1 $q 1 $<2p W 0 TZ 1 $  /0 T 0 T 1 $PpU' B@0( R'U  1P$ A0 00 T 0 T A0 T1 Wđ  l ( 0 T 1 $ $2y 1 $r  n(Y2M5 -L M1 @p $$2, 1 1  $ 1= `$ 1P> $$p00#"A AB0$2  1< $ 1 $2$ HR10QP:l-B\ 00  0020 -LM@ 0 @pi 0-LM0 $ p0 CBPP0,BA ? 1SAࠣB࠳ 0P0 -LM$2@   0 T 1$ p-0LM|220@P`3 | / 00|0 c7D' 1 $ 00 T 1 $ 00 T 0000`"2p 1: $P( 0  0 22  002|2/ /0|2 70 1 ד' A0|” @? 0?|"0  0?#   0? |"`媓0 P奓 1: $0 0嵑iR0^iij j -LM0 1` \ 0$0 \, 0$ K(0 0(0 (0Kt 0, SQ< (0 @S@  0^S  $2pW@T  0T,0  ,0KpT ($ ,0M$ ,0  & $0RA-@|p`@SPE όOop| MPrP 0 Ѝp@-P|b@00όOP`0M0|bR ЍpG-M@P`p|Sό@PE `pO_o 0800< 噯 0|2Ѝ -LM0 `2|22@ $ @0 0: T 1W $ 00W T T -L M@K@ 1 $PU ”(0S 1< $ 1p $ 1? $`PhV`  0@,0F 0 5K00UPPU A 0A : 1 $ 00 T : 0TV 0 W50<0 o ? `b| 1 $0 850 35ted_P` 0 `0 @0(jXjjjjk(kPk -L M8pKP 1 $@`20CSl|"RHe T T   @0T5 `" Q 0T40S.Q% 0BQ A 0T• A /0… T Q 0T  @0T2|"  @0T A 0T  0Tp`T`V 0T23 R |2S 2S0`2v 1 B$@'NP2@02 |2bST|  0T 1 $  $0 0#20# `$ 00 T 1 B$@'NP@p 2P02 V; 1 $ 000 }|2pSr 0 T 1 $ 000 T0`2r5|2S8^ 1 $ 2S "|2R 1 $ A000  1 $ 00 T  `"0T A02 $ 1@ $ 000 k^kkE-|bPU@p*?0^ 0CSW^ UP:2SPH0H 0SWZ 2SP2SPef -L\M 0!Qp00'.`@L@ #Ps P ``HX`````````````````````````` @Y00T00S0|2P50S`0 US ? @"|4 RP/ 4P @0 P, K00K, @4 P@  40KPS40` ,0 ` 06P@ 40P R`0L0 @L0S , 40|]B`` R3 RP3x#P00#h#h0 P00S 0H H0 0DP D0 H0\D @ < \ X0 0< K@ KD0KR@< H0K@` 0P( <\  RH0X R 0L <0 D0 @0 H0 @0@HD @0 @*D0U0@S  0  0<DP@ H0B|BP<Bp1T ZPX!0@8 K8@  ` 0P1 8T 0P8 0PLT \00 @6@B|B1B 0崎T0 L 80 T8 †|†T "T @ L rqswvul(lPl -LM1 P $0Z,0  •(0S0 1 A S |$ 0 P@ 0@00 @B|B0,0 B, 0P`  0`A 0` 0S B|B,`  0P@| 0 `q Vb LŸHB"V 0 @4@ &@ 1 $ 000 T0:  T,201(!JR (!00000<00 0: $"p0C!A  1SA B 0@?0 @[ k 0帍 #@ 0 嬍W 0 `` 0H 0 `0 @0(llll@P@ P`jP<ˇ  "bB>CNC 0@]@ P`PP" 0-0 0 哃o0 R 0S 00^0S@嚈 0啈 7MnNnLnn p-L MQ`U5 0SxPHDT 0H4 0pAHDTC,$ 4@ĕL`A$4$ĕVPpphAN -L$M0SĚ1c  q@P "bP@P 0@ P`PBH4 01,  H b,R ^0 P@`0,P$00(2,˜0 0 0,  P\L00 ,1P  1  1p!8p000 o@Lo -LM` 0p1 !7$"P0 0%> 0@e 0 P@,2P e0 mه| 0ep ЇH ,–0X  `AD ‡hhRoo(oR0o8o@oM`ohoSto -LM p< 0T AW 0T$",2#5P ' 0 T 1Z $-.08 00 T$2b  0T A 0TP2@T,2 `@@K?TPUP 82 PU—\(0S+P <2 PU$2 1 d0D T A&40E T Q&80F T &<G Tb A0H T &40I T Q&80J T A&O_@ PpPhO2$"02 28?*08"2X X22`V X2:8282"< <24" RP(4A P $2 |4B P < 0T AW 0T44 R,2,255Ã,2$2 1Z $@,˜ ,˜ @0,2 0 ˄,2$˜<,2340 00 , , `p3V $2P3 1Q!  L ,2 $2 003 , 4`?V"00?" 1 $$˜86#(pD 0S8 1p $$˜00Z00Sp   Z000S$2   0S0 $2000 0$" 0000 p0#2p p0@S00 S   R0000000 p0 13 $ 1@2 $@$˜D@@4@ B 11 $ 1@0 $@D@$˜0@ . 1[ $@ ,2 0,2, SRoMot2p 0-L1 P@ $` 00T 0 00 0 0T05 0-,2L6@_,2! 0 T 1 $ $2V 1 $ 00 T 1 $5 PU! P-  1 $  }  /0 T 1 $PU  1 $hM,26,20$2  1 $ 1 $5  0@00   9  0 00•(0S 1S 0 ! 00. a 0 0,2$2p0C!00J/0`0<0(!Ri 0@*X0 0C\ 0  "!0 00 l8C& d 0 "!0@(0 R} P-0 7G0 0C\ 0  "!0 00 7C&  0 "!0t'0 RJ0  <ip0; 0  11` ' 0 T 1 $ $2n,2b 0S T 1 $ I 0p 0  /0S* $&0F0 0C\ 0  "!0 00 5C&  0 "!0%0 RD@K } H0@@ 00?@ /0 T 0 T 1 $1@ @po0 1$# p0  00@ 11`Qe  Rc 0`D?00 $0 0<<00 <2•(0SB000( R0$2@' #0L T$2OF# 0 T 1 $ $2 1 $ 0 ~1 0 `0 @0( 0 0,0(• km2 2hBaSOQ1  $0 (;Wq1 1   1Ÿ  1`2 @000," 0  9,2QhVO@00C\ 0  "!0 00 1C&  0 "!0\!0 R)(! 00C\ 0  "!0 00 0C&  0 "!0 0 R2 $(0  $0 (c  $0 (S00 p0p[[c[c26[c[c0w57bMb 0-@QLP  1 $@T n0T 0w -LM0X(,0P @ R`0 R* ;n000$^ –0  00 P 0 0, 0 ( ,  n q0,0 0001 11  1P 000," 0  9,2dQhNN00C\ 0  "!(0 00 1C&  0 "!0 0 R. 00C\ 0  "!0 00 |0C& t 0 "!0P 0 R000[c[c[c[c0 -LM0   00 AT hM @T -LM Ч 0' `p0P000  $p0C!A 1SAB0 ? 0 0Hqm 1? $40S,  @T:0A/-–(0S 1 $ 1  4 $ 1< @ $|6 T*1@T –(0STT 0 i08464(m0 00&0 S 06h!(M 1 $ ( Ep00C\ 0  "!0 00 5C&  0 "!0\%0 R /0 T0  $"p0C!A  1SA B 0 @?0@ : 0T,  A0 T0 Pl000 4hL 1 $ ' Cp00C\ 0  "!0 00 3C&  0 "!0|#0 R H /0 T 0 `0 @0(&–(0S0 ,0S 1 ${0@  00 @P0 o0 t0l 0,0 0 H$lo 000 0  00 @ @,2$ $2p0C0! ?0@ @0 -k4  0 T? 0 T 1 $ 000 Tk1  $0 (g1 $0 ([, 0 4xk40@T:F\kTi[c[cwL<wwMb[c[c0wxj0xDx`xxx08R 00 R Ѽ0006 -L⸢DM 2X  @DK  `D01Q 8 ?O[q1   0#[000  0H H K0H @R H0 0@0T@ L0 L@ T H0SP P0 ? [ 1 P0P LKP K0^@HPT0K @T^P PL \ 0S0ȅ0ȅPT L0@  @X0@0X 00C\ 0  "!0 00 0C& | 0 "!0X 0 R<0[  000x[c[c6[c[c0 0-!LM0@: ,2 _”(0Sc18 QPT BU<  T2}S 2T";0T20 1 $@T20T2 $2 0 1 $0$2  0T 1 $} 1 $P$0 0 (56 -L,M,2`   0H0 P 00L < D @ 0r80 03K03K03K02KPK02K02KPP %> ".B 0EPU80S080 U  0T 1 $APA  0T A 0TU' p$2  R U 0 200f" 0 1 $  ,2030,2f"p0R 1 $DP 1 $PP 1 $TPTp 1Pp $ 1qP@ $@T0D@YT0  P,2P3,2PPc g -LM2&P`, Y p 0 p@,29,2 Wp W1@ 87#,00,0 ,2  @0 8#0S $2| 0 00p T0   0 0 pT W$0!000,"@<#4,2" @@@@<,2",27,2$2 ,2 203 S%S( 0Z T,  A002 T,  Q"403 T 0 0 T A)401 T2@ "20@ 0"  0 8 #q2gR -L,M0L0 00PSp` @0  0T$"$"  J, 0 4 8 s i @KD K<0KH@ $"0H0 ,2@ @@W@\T HPO DQA Q P 00S @0L0 00S,0S L 0 000L0 040 S000 0T80SL 00L0 LU0S 0 T1 \0 h$"@@ H@ D@ DH `BR` 0- 2L0SP $2 00  T 1 $  $ @ 0T@0%> 0BR 0 0 Q\ # 8#8SR0SS00000 R0 0  0S Q0000S0 -L M8`,0K(pKP00*p` ` ,@T D=.8  ,  4@T <08@0 0`  @TP = 8<D P@ TePyyyy -3bLM@1`p5aWHPfPy  p!0W@O e z -1aLp P @ @H0H S1H0yyH@1S!( @p00C& R 00#!x000 d0C& \ 0 "!08 0 RhAIA[c[c[c[c001 p-L M8`@1~0 0 02  P@ U CeppLz -010LM ` PHpH@0T .@?P0 0C\ 0  "!0 00 0C&  0 "!0l 0 RQ1101!101[c[cxz[c[c0 0-1@h0PL 0D01P 0yτ1@0hu -PPLU` p1Ah0ffP h@\111T01 0 PPUD X0 BaD1h@01 $DhDDuMb@w -L,Ma@pTP 80K4K0* H0,P Q008 ` H04P @ :H<0K0 0 P@ <H0P Bd<H 8  0 p/dH 8  0@8 d  0 dzzz${ p-LMP40YPY VW H`#0S00ŅX H $180gP00pcT T cc`c0Sll mll ml m m mm m m m m m m mmdc\XTP0 c,aHxX{d{{{{{{ |(|@|P| 0-L@X0PHPSmmhnpna 0t  & &lx@5HPPPPOPU  0D R\ R 0LH X00hJ^c0h$ t||||}0}<01 S1:<0O -LM ` p@ 008 0, 0Zs S0  6 X+ U@00C\ 0  "!0 00 5C& | 0 "!0X%0 R0,0  0 0PP @00C\ 0  "!0 00 4C&  0 "!0l$0 R졅01, f]Q01 04 01g/04m/010<D0, 0c q/ k?!K000 K/Q #34c0c8"  3 $\HH3@ 000@0@0C\ 0  "!0 00 2C&  0 "!2  Q0! P! P 000 0 0,P@4,(0S 0   $0  (f/]!(0T0,  100 @ !(0Pp(0h!00QsP 2 44@a,@E#X  `@00C\ 0  "!0 00 x0C& p 0 "!0L 0 R000 [c[c[c[c0T}} -LM@]PY p-RLM@`Pp0@Tp -!L 0@ P@a 1!}[c[c<}[c[c0 0-0@LP  0 101FP0P0C& R 00#!p000 \0C& T 0 "!00 0 R00h[c[c[c[c0 -LM`8@QhpA$0S (0S    $0 ($16 0S $S 0,0000i  0S0(0,00 R 0S $00bS fS 0S0Sq4 f`0`i阩}P 0S P0S -PLM0`pp t@2SQ 2SH 2S 2S8iY` P iQ`1# 3K`Õ!0?0c0@lT0`@0^ 00 @? @?0H405dp0\hPd F`0ai*@   L@gfff p-LMb0P  B  0  0 }3 SK|||||x|x|||}  0 0 3 030 3 030  0 0 0 0 3S p 0 _ 0  03~ 030@ 00   0 @ 0 0 0 ,( ]_m X_]\ 0-P0LLG_H0@  < 80@ 005_b -"LM0`, lB^ /@Ts 0@0\..@  0,0  3蠓Z p\ pp0 , @P\  p0,PU@ZpZYx122 3S  R10 R9!   ? Y @,0S / 00   0 00 o/^ ? o00@@ Z 0Y @0ZP0 HLS00l? ^c_ -LM0` Pp#0̀0  4 ? 0 6\6,6/@#b  j>3 S  00 0@ pX&?@Bcd\P@@] 2W[3SSQ H0   00t 3[ @/0, , [Å30+ [0@43 S1 D0 (D%00 %0 5>  0 ,0K0/00$]$]0* [3 S0 3 S@ / ğ0 A 4 0A$]IpP@ 3p@0p@W 0 ,=#=,0@ J003#10T00S` , , [0Å+ [0@>3 S; ß0 ` 1B00 W "0 @00  90 0e"J]0 =00 L`";]8P"6]0* [3 S0  HT !0 C cC!]]0W !0 @00T1  F JLFp!\$0 B ? BH!\4@0 00 =<.#=<0S 0 0D@30  0  0 ph \L @ ?Ac\IJ@/0`0 @\@@BMbqnvW 0- @P0 00L \TP0P0C& R 00#!t000 `0C& X 0 "!04 0 R00h<[c[c_[c[c0 p-,1LM Ra 1@ 0 00R@0@0C& RP 00#!000 0C&  0 "!0t 0 RUL  W D!< 0 0 0pꔤa[c_[c[c[c0 -LMs `0@ P0 3Up,  eP`w ,P@o , 0 0^ 0 0 0D @ S3H `0000p0 @@ 0/0 00S= `00C\ 0  "!0 00 t2C& l 00#!0L"0 R,0 P P W  /N[0@0 < $0D0 >P` |Vx1T 0L1  000 R  0 00U` 0'A00C\ 0  "!0 00 0C&  0 "!0 0 RB @T1 `T01 P0+0 @0[4[0[c[c[c[c0`a  -pL0@`P#U0P0? R PU08 Z Z4T -L M, t0, ?Q,0Xn , 0p3`0 0  @ 00  ! 0 3 00W01 P/PP 30 Q   R R8 0S0  0S0 - 4<#0 0C\ 0 !3 0"C600" 00#!2  QX#0QI \u P!0 S P P] 0  0J "0 0C\ 0 !1 0!C600! 00#!1  Q+ R 0S0000P0R00S(0 4YQ,0000 , 00 0, ȀoX 0S Pږ 0S PP |*U0O R  0 00WP 01 P8Y0W[c[c`a[c[c0ht -LMP1 `@ #p̀/PⴠFT / 0 20 4 < 0/@0D  0Z00 1 P /0PS0000@0T 0 S00@@@ 0 0 0/0S ozoCY -LM@P `p0ᴠ3Z̀ 1 P /!0id9H0(S\ ,0S H0X0 0@0E 0,0000\1  (Q6,Q488YN0U ,0S  Z000oK0SPZ 1  R 0 0 0 0 S 00pXH0>0SD0(0D0(0o%00C0 $X,XxIЀ܀ -0p L@0P3U`" 0S000I0S J0 R0 0C 0 0 0R 00000 0 T1 0S 0-@P0Lp d d`0@@ 2SS 00htWXUX0$ -LMQ@r Q"2p\03` S- PU 2@a "0 ,1X((&X0 2PU:X2X2PU:0PU`PU0  0  0Pu0PUU_4<,PX -@L0Pp`% @TW@T 0#@ R  T0,@WTW0,Pt -L M@ P84Pp $4  `0@X@pP3U`1 P P  R 0S  X ?   1Y  ? Ȑ 0 P` p8#?@RceUPP`Pl 2WjPP` W 00  0& R0 2  0h0 @0 0 < "D0240"W(" W0@ Q0 1  00 @0 !V !V0 0 0EP@a0 LV0 1  0 0@ 00 M V  V0P V0 x0  0\ 0@ 00 &8L V,8 V0MbLN[W -LM~0P2S& "R ?0S cV 0"000\n\N0 0  D>  0"2 oDV.@VQ20) "=  0@00 0 0 00 =  0h h-VT X-VP D- V0? R••A Q& Q Q0S00Q0  ?0S aSM  U0A :|<  0X0 @0 0 ? R 0  <  00 ;  0 0"00 +U +U +U +U02 R | U.> 0SȐ• 03̀"Qvtįį`įįįįįįįįįįįįįįįįįįįįįįį0 2S 0 " 0D (  ? u0 }4 a?U02 :U0 k0Su S# 0 h ,U0 9  0t0 @0 Ed i.U` i.U0 d U2 R00 000.0@00 0@# `)?@Bcd5S#P@@! 2V3SS   0 0 0 0D@30 Q,  0 0 0 3S 0S  |R0 s0G T0 00f0 000Y R87  00 @0 0 000 0 @5 `'?@BcdR#P@@! 2V3SS   0 0{ 0 0D@3#,&8T&3T000yR04 uR3080 %@4?Abc f 8 ADbR0P` f8YR0 e A4 `T0003 R? շ0 ȵS00ȅ0$000 4  ,00 @0 0Zt$Sp$S8ğ0 S•|S•0 2<0"D PS0 <02D "(S0  000"?R 0< 0S0\C 30@Sz S0 03  0 0 @0 \#zS H#uS0SB  S0 iS0 3 ,2@@ u0@00 0Q1 P/I0S J0 R0 0C 0 0I J 0fH"3S@0S00 $(S000   0 0@0 S0 0 1 Sp0 6 S30  9R0 %  dR  R.>Q<S0X? R00 S R00R00S 2RmRP,PԂ,<lMbRaoăԃ 4Hp8L` -LMf0@V0@l 2S 0 a`6  0D6 "2S$0a0Ɵ00  PS R0 S Sy 0 @00 223 SV #$0KR ##0/.00( [' [0@)3 S& 0  U00 4   o000 0$R$ R0& [3 S0 ~"0 4  0$Q0 00  03   000wS Sl"00o"0" 0@Sy  S]<0 0\S  SS? R   #Q"I00J2 "H”0 0P0"P2"202/000 0 P pX"?@RceOPPP! 2W3SS   0 0 0 0EP3”0 0P0"002 ? R $,!(Q 0<<0 Q2S o.Q0 0  0t0 0@ 0 0vTt P80h\ P0?"HP]ih_MbЅ -L(MH0`0P 00 Q 00$0S ^ <020pFȀ@' 0 0 D?@@ /0SS  0,05 -qP.000 P \0 _ .> M0 D=  =D>  00 ->D  0/00CS5ػt0,0 P03@P 0S R0S  R 0 0 0 P00S1  ? 1/00CS񟗭$$d OmȀ  ? <R+;/ 2 S? wPPfP3Sa20  0VDUG *0<<00 9;  0? AR#4@K52M00*0S00 =)C40 -B040 0 0 R<K< 40R  80S 0 OL$ *wO3 3S*0<<0 hOB0 P@]O YO0/0 0S0 0 0 000f0 ?O0SaX  0庠 P 3@Z ,40  9 082< ?"D  ?X  Q RBT pT[0@U0. 3 S' 7  8  08    8  0026'N'N;S `H  2 Q sD 0,N 0  NN T J0@ B N6TT  {T0@q jD7  0–,0K P, , 0-.0B 0< 00, [+ [0@13 S. 0 &F00 T5   ,|Q%KN,0SgoS0  00%4N0* [3 S0 $NN00@0 84  x85  03X @$0K#/Æ0/00( [' [0@+3 S( 0  D00 L3  o00 002B<`#M(P#M0& [3 S0 @ /0 3  0"M"M/@ Mq0@$3S 2  3 @–,0K P, , 00-.02"aM^M0@`!0000  T2  0BX!DMAM]K0|!:M I0SX 2SH ? Q00 000I Rt 0k d1  00 @0-0 02H M@B( T`Ȇ܆ ,`tA 7 !     ȇ* G / ,F H K > <l k Ј (X `|hV0B;Hl31Ԋ8x؋@ L00  p0  00 @0 | !L4!L00 0  00 @0,0 j!nL<!iL00 l1  0t0 @0@ 0  &$"LL@8"GL00  .0 0?<0040 000`000 0 T P 0 T 0 T 0D 0( `0 `s0S0 0 0 4D 0( 0 ]꜍dԍ p -L M0 p@ 0R , 00 QP X 0Uʨ00CXUP 0\ C Q,0 P 020@ 00 ?@0S @ 0# ##Ƞ+)*(0 0T 0 T0^,%0S, P@0U20 0>0ʐ0 010 0 !  0?@?<0 0@0 0X0ʨ0U0U 0?0 \A 0\ Q,000 0PQRS 020010 0?<00 00o0S, P0U20 @0>0ʐ0 010 0 !  0?<0000 000A0@- PP @ @ P  0 0,,,,S QRP0-  00   00 !-NJτR 00d0 ` 0Q@Q8Q(QL00D 3HQ$Q  000h't p-LM`$09@!0!@TR@0Y> @0T10  @1 @0Th@1 @0T X@1 @0T H?#/Z?B!PP10T!X1RO RO R0000 0 RHP@#0SPH11@TPU0)(0S0>, \p0 0:(8& 0P80 p # \@Z? 00|P@0!Y>!0@\T0  @h @T0|P".@40|!.@0|ugt | ܏ -LDM0P $@P T T/0000S 0 ,(AT 0,0P*:P:@TpW , ( L 0H0 1D 000 X  X R0B ( 0H$Ƞ 4 $4`8 4 ;0 0$ W 0 $@0 \04 $0P< ` P 8  ?4o4 "50 0> W0P0 6 0 0, 0 X X0ST ! L 001{P^ ,0S T R0p0, \DH M 0p0, \t O?4 W 0 # !"8 >?4  P Z XQ < 0, ,00C, \X0S <4;8˟W@ <0h  ?00 ,@@ W $ y 0SS;@^ ;^ " ^ @ >Y0,0ZY :  Q00 0M  > 70p0t:@QK h:Q @TA T. T 00 0@S0P@Q0R0>0?, \OP@ P  0?p <  P P  0?T  R00C##̠#,IJH0K 0=?]>0 $P Y 0J>00 @0|@>0 S@ѵ@`ѵ`ѥTT V00TP ,000D ,000 0?zV00T  R"TV 0DSY :Tpl=aT=pY,@0 (00 @e, 00 DY ==6@ Rm W6RR 6R4 000$0@@5 D@ $0 6 H $D@10L S,0  (& ,H10S00  L 00P 0pF?, \MLD H0=CD H0}=={=;75@\ x5\0, ,0PcHd=@ <5 000$P P `hh!"=x @ ?=J0 ,0@, ,0c4 t80(=WZ W X@@8=0$000 04 T0?R#000 0=>@<PW hL<D 0 $`< h?s <5 0@+& <0, ,0@ @c, <W 0x! "$# (,<L<8<0<(<0, ,0@ @c, u<w640; $000; T$ H ,p D L 0p tT!c#4 1q TXV T0T;<< 0T.(PP4|L`Бhh Dp DXl@PTxĔ(𫪪L -L M p01 h!,X@T T T 0,0 `V    (0S    $0 ( $ `V' V 000     0pp(o (0S $ $0 (P,@7 0X0[YZ,`  0 " 0$ @ $ 4  P(0S81N/S081pp8q  $0 @( [;0,0 0S0 0qQ;,@m 00S0hTg (Tbt000 0 0{00N00 ppT0HH0FT -LM`0p @P h@T0A`(@0S F/ :頕 -LM4 :440#0KS80 00 , < <0Su8<00Q8 <0 48QU @T00 4 0<1 0 00 PP0 P:TP40@QU @T0040D10  00 PP0 :TP0PU+ $0  0$0@, 0X0  x: 0p0CS00 00 , x: R0000 0P pTp0 1`V0@00 0 / TʄQU 00 PP0  G:@Y<0 0S40#[ 00<48000<0 *4#JT,Xt -5L앟M 0 p0`0 0, 0QU hR0000, 0 4 @ p 䀔X- 0 A0S P U540   ,$ `H5 ,9 0"""Ƞ[YZX 0  ğ @  $0P@(0S    $0 (:0000 PP00S000)C0 0C\ 0  "!0 00 3C&  0 "!0\#0 RB@T C0Z 0 R6 T) B0 0C\ 0  "!0 00 2C&  0 "!0x"0 R y00 ,0S 00`S 0Q0 4 0   00S, |@DTʣ 80pA,00 0C\ 0  "!80 00 $1C&  0 "!0 0 R驿, 008 <P,  <)4䀔000, 8<0cP8, ` 0@@T 0Z,[c[c  [c[c0܏ -L M 8$q (H P, 0 08Qp$1pU  0 !01 R PY0 R0@Q00  , R  0T0 0S $00` `1S `VV 0(`S 'W ʇ0(@ P@ p'W(W V000S 00  0 "00 `0 SP QR 0 S, 0 S0Z 000SJ R0D1C 000 1QQ@4 !010 ###Ƞ0`J/) 0S ( W{ $qpm@000/ 4 QhF/ R0<1 (~Pp P 5\< -@Lhp0P  07 `000{$00$0@`0`0C^  00#!t000 \0C& T  00#!04 0 RF[cT[c[c[c0 -L|M<  0PD  2 'DP 2<@80K4PK 0P@ @ 0,P<  X<0D 00 8 :4P<0D00@  0 P<0D : P<  s@ @D0<@0 0  0@  P4@V@ Q< @ . D0< 0H  0  , @ @ @00;2DH 0,  0,0 t0 0 !P0 T?00@0EPT F X0G0\ M `0 N00Q0R0S0P L 0T 9 : ; A B C 80<DLd0O0helfp g x0 ]0|0^` _a0b0c0dX0Y0Z0[0t \@11 RL8 $ #4"( 3#8(0 < d3 \<0L>1D3 /8ß!0S!(\  0D00  00D0  0" 0Ÿ000 @C\ 0  "!|0 00 h2C& ` 0 "!0<"0 RD@ 4 ^@  1 0<00J D0 0000C\ 0  "!t0 00 `1C& X 0 "!04!0 Rus<  5<D0$<D0 <08 0D7D4<  s5<  lm5<`h5< Pc5t LP[cTX[c[c[c0ԗ <l p-LMP1T! 0SPO*HaRV R0000 0 p P`! 009P10  P0P 0/!P1 0 P10P1pP! 0!0@0|80P!@0 !?\pP -0L`pP@4@P@' PUU1 X1P0X1@1 R 0S @0  R0Z 6PU0m`< 4 80 4! w2 ؘ 0- 80,#@L(Pf 80,#(]0h4 -LMP0p @Rh8`P 0Sa:X!30b0C02#1 T1T1$0CRR*D!1P0!,P!A'&P A!P10C0  P10P1 0  T!0$ B9T!T10 #PT1 ! T100P0 m$0!00| -LM0PpUA00 `0V Sd 480R`08 @08  800X1`0CX1 -p0Lh3d0d3\0\3T0T3L0L3D0D3<0<h3$@Xp -2L0$@2P,0 T$2, $`\p$”, $0D38 huhv3:꬙ؙ 0-$2@,L $2PU02PE88;80hP$2 ,$00 0 R 42R@042000UPE42@042000 0-@2<0 L 2P $”0, T8;800$”00,$$”0,0 T -LM+nP`p$B0, T$•,0 T}$2, $$•0, $0pW`0<"V @0<"<2<20<2 2 0 `  0-$2@L, $0 $”?0082820, T82PU0$”0, T82PU -4< BLMR`42 8  $–0, 080K4s3@ 000)PP 011 01$0  1 T@00C\ 0  "! 0 00 3C&  0 "!0"0 RU 0S?2@ 000($@0@0C\ 0  "!P0 00 <2C& 4 0 "!0"0 Ri$ R 1 0 +10 ,(#0Sb|•0x3; XV@`Zp5<5|•9x0 0-L|Px|0 X|2x ,?0A|•x0 \|Bx .;X0 -Lx2|P 2X|2x (|B Ƞx 2,hX|2x ,? pL   X ?  X~ ?  Xo Xd ?  XT 6 SB X@ |•x1 X|2x $|•0x0 TX|•|•x :x .;X|•x0 \|Bx H1X|•x0 X2|•x 1X|•x 0X|Bx 0T`0vh `0v"&h0vl `0v"`|0vl `0v"```T0vh `0v"&hu``h 0 v&h`0"e 0-L|Px ;X7|B00x X7 H@ ㇰ|2x (  @}T}T4 |•x ;Xq|•;x X7`0h`|•x t0X|2x (7 @|•0 89x X&&?꠆ 0-?L@ 2PSh 0&X &0h@0P R0 %$%  ,T̛ p-L M 0P`K`@![x2RS Dh2R+`2RX2R E RH2 Q 8%? p@ ?U  " %p ?U  "1R11R 1R11R R ?U "1R 7ʀ1R, t1R l1R8 ? U " H@1R 41R,?U  " 1R ?U  "U? b R ʼ0R 0R2 ?U  "& R 0uڀ0RtV`U`WPUP`WQWRde`ebeFvȜUP Q(DVX`-2π< PP2 << 5 p-LMbO\̆'^,0/4<2N>"Tz/^0 " 2^̌ W  22%%p -頢L`BP027P 7V,0q00 2`Vu -cL M┓@ 0P0px0NPP `011 01$0  1 (@00C\ 0  "!0 00 2C&  0 "!0"0 RU @ 000 $@0@0C\ 0  "!40 00 2C&  0 "!0!0 Rm$ R 1 0 +10 ,(`ǘ(0S P,000 00@1 0 @ǘ(0S 0 `0 <(  $0 ( $0 (ǘ H#\7鵪곪][c[caa[c[c0a -LMW`pG(0S< 0 RpWP W#Wǖ  l ( -0L Mp,0 Lg0@T 0Ǘ7( YRY(2UAI7 h00h0 007 `@T|2x8 ,P |2x0 ,  |—x :X|—',0x8 \?|—7x L1X 0U#h00h0 7P d00d0P P8P&0 R  ,00 ,00,0 ,0@0 ,0 0,0 ,0<T,0 0,00,0 = 0 `0 <(s0 -0LML4W`U* G<( R\|2x$ ,P,07l  l @(0S w (0S$0S 70WWU5;5W[00$0(wWU |2x ,|2x$ ,P7 ,0|B a0x$ \|–x ,0Xǖ  l (0 -LMG7pTL) 0Q$J0! 4S,ĕ(0S g (0 S $l00l0'? B' =$0'@cTZG5;5$0(ĕgO[04 p-LMP|2x $`p 21 V  3"|• ;xX1 RI 'R9|•x/ 0T DD1 R<00,!|•0&; xX1 R |•x ;X|Bx 0X|•x 0T|•x 0X ,0|• a0x$ \'|B !4x$ \|•x- @0Tpĝ0` -LMPLp|2 x(L! h RE 81VB |•;x X7S3 #  0 R   0O0.00p00p07d@d0T0S 0S -LM0@KP? |•Rx 1厏X`Lp@|2 x$@T-0[. [,[+[h t0 0t0h|•x 0X|2x $X ? R |• H0xX? R $04f -L M, p, Ǒ0 P( PP@,70 0cS?T ,00 P00 0 ( @T T c3@ 0P0p0bPP \1 01$0  1 $@00C\ 0  "!0 00 2C&  0 "!0"0 RXUP  R@l@ 0|00$@0@0C\ 0  "! 0 00 2C&  0 "!0!0 R"$ R 1 0 +10 ,(0 R00 27 0cS5;Ӱ5Q 0 S00000A J0C 0 iP  01$R Z 010w00 0 $,0S 408, P 0/- pb净 -'匧LM 0`00 ? LpR  |–x ;X$勨|–x 7X@_|– x0@TTP@|– x0X@TPZi7Pk 6 Rd  |–x/ 0Th6|B<  T6xX<6 RE |–x (6X|2x $5@ @@H|–|–@$H9x X5 |–9x0 X5 R |–x :XO'|B,0x8 \|–<5 xX> 5 R |– x5X2S|–|– : .;xxX4 R |2x $|–00x@0 T|–x :XO00R|R00x ,4X|–x @0X|Bx *;X|–x 3X|Bx 3X|–3x X7S\|–x 3X|B 0xX|–x ;X|–x :XY |– 3xX5B@05%+%00C\ 0  "!0 00 2C&  0 "!0l"0 R\24o8|–x $2X[|–x- @0T|Bx1 X^'|B,0x<$ \|–x1 XL!@|–H$Hx9|–x X1X< Ad00C\ 0  "!0 00 0C&  0 "!0 0 Ro銣|–x ;X-[c[c'<0h~v[c[c000` -L? R / 00C S <<<<? C   -P?L |•R`x1 pX|2x (|•@x T1X|2 x,H$H 0 0 0  0P04xԋċ̋ԋ#00|•x $ 060060 R %0?  R-00|•x $$0'0 4W d000,   -l3LM `3@H`LP0 P 3pC'0 0C\ 0  "!0 00 2C&  0 "!0"0 R鄢2Tw|2T[*t2TH l2T p88B|˜x @2X|2x $5) = S =@S 58C8p22  |B x9 X|˜x 1X2 |B9x0@ 505 0S %4Pp5@ 0 R >pb0T 0T0. @RX0SX0T}? R / 0 pr/[c[c[c[c02i 1i i i 5i i 6i( -p0`0p0L|–x0 pX|2x (@PH$Hd X*OC0S4L -LM`pR(0S G (0S7$2S,pW`Z`pT(0S G (0S$4SpW`Z iS04$0(GS02$0(G p-0LML`4|Px ;X|Bx :X|•x :X|Bx 9X|•x :X|Bx .;X2[|•x x0X|Bx ;X|•:x X7S4e5=5phWh -P9LL$M 0@040`@00C)L\8 <  0  "!0 00 8C&  0 "!0(0 R0@Kp 0pPP h郟  }Nǖ~>0@04 p0 *,P ǖ~'7 4P ǖ}>00p  0 Pǖ'7 P@x\+^ǖ00Pp  0 P@PTǖ~> 00p 0 PK^@Pǖp00Pp  0 P@PTǖ>0p  0 P` PF7`_O@ 004?S 6    ;85%55 ` R8 5500808 $5 080%O` 8 01 800|–x5 X|2x (p4K 0p3[#2020CP O%5 %?l"4$p2t"8 T"c  0p%\"R "0""2PS ? ? (4 Rq %0O0aV"RLP `PdXd`d# < J? R! 788#007l|–x ;X|Bx <X<2 R %< ?  R-0<0 $ '0 Z#< 28 `0'0| 0$v0 Q 0-m 0thp2  ` | 0#[ 08V(2 c 0M]*`1@ 000@0@0C\ 0  "!0 00 1C&  0 "!0  Q( Ş&O1 ?P|–x 1X|2x ('  8|–0@9x Xꛞ[c[c[c&[c0|@0 0@ @ *0,PE< ,6 4P00@  0 PP{<,,6 P_p@< *> 0   0P11UDR<R02p@ڼ Mp]3M<@  0 P@2p0W2pPpW*Kz 02[ 8#(# ??P|"2$4  44@K0 \ @od k`4@p5X$X4 0P$000 @`1  (X2 R 02[#0SX2!^0X23@D23H"L2#3,r 04"R' ! PP!  HP #WD#0<02,? ?!0Z *0 >2[ [0 Kj[@00CZ PᶣK@#[0tŸPC b 0K6K0 N"[3[4w 0 3[[  BP0U3K@QPRU $0< @$=0C!L=_MPP <0$< <0)8<, 0@0 @ 0<0< p 8<0,0<0< 8<, 0<0,0L   (hd |,ԟ4T p-LM@!^42S @`!^ ^Dp0, -LM48p 0X``FX64P@@8 0X480 X<480 X3V`48 0X4@80 X 40 8( 0 48X`V48 0Xb -L M00 00 S40 `, 48 0X@pDY74@ PP8 0X480 X֝480 X͝W@ʈBT#4 ,0pDX74@PP8 0X480 X㯝480 X㦝W@4 P @480 X㕝40 8(0 pD7048 0pDXW@4 80X40040 p40 \x -L M5,=@S\p, ,0}S5;ð5`PV <  0PV`V 0 S00 00C0W !L`p`8P=<(0S0 (0 000X4   (0\ 0,  000   (0\<(0S,00,0 \0 0<( $0 (ꄓ3@ 0x00f Pp \3 !!$ !0 00!0 0$#@00C\ 0  "!0 00 2C&  0 "!"0"0 RWW  RBh2@ 0x00 P"$@0@0C\ 0  "!0 00 2C&  0 "!!0!0 Rd$ R 1 01+00 (0,0, 0<< @<( <@(<(0S 0  0<(Ϙ͘`[c[caa[c[c0a -L M@5 @p, 408 $,408 ,0 0T408 $@ 4 80, T H2DH ,H”0D9H \.H2DH ,H”0D0H \H2DH ,H”0D0H \0hH2DH ,H”0D0H \H2DH ,H”0D0K 0-LH@D;H \H2DH ,H”0D9H \H2DH ,H”0D0H \H2DH ,H”0D0H \PH2DH ,H”0D0H \H2DH ,H”0D0H \PUZH2DH ,H”0D0H \~H2DH ,H”0D0H \nH”DH 0\0 -L@`pPW5H x H2D,H”0D0H \LH2DH ,H”0D0H \P \H2DH ,H”`D>P \H2DH ,0H 40H”D,H”0D:H \ -PL@p|H•D;H \bH2DH ,H•0D9H \RH2DH ,H•0D0H \BH2DH ,H•0D0H \2`IH2DH ,H•0D0H \H2DH ,0 8#hH2DH ,H•0D0H \@ ` -LM\ @P`K*pK&> \  \ 0  gY2[2[#$0$@ 0T -LMQHH@DDH H "::\H2DH ,H”0D8H \H2DH ,H”0D8H \ -LMH@D9H \H2DH ,H”DH ,H”0D8H \H2DH ,H”0D8H \H2DH , 0-LHDPH :\@@TZ0 p- B0LMB`Ppz@ -1夁L ` 0@ P0@    PpI<W3 @E@A0 0C\ 0  "!0 00 0C&  0 "!0l 0 RW~CP000@;@TZ[c[c[c[c0 -\1LMTq 0 `P@ 00`U c _ [ W S O@00C^  00#!t000 \0C& T  00#!04 0 R[c[c[c[c0 -LM&@0LQ`SPP0T0 QppW0 2 R T U U  U Q!1 Q QQ Q' ,pK]0*@KS)PK 0S [H–D 00 \H2D0 ,H–D70 \U $,4𴠠H2D ,0 P 긠꼠ĠȠ̠9H–;2D8 \@㵏H2D ,P@Taġ -L M0KP@ &` T0BS00S0 SppW SK S# S.@K-`K庂K  0S H•D400 \H2D0 ,4 4 H•7D0 \V(4<DLT 4 H•D4 0\ ,040 0 0 5;H•02D8 \@H2D ,P@T 0-&> L0BS@_R 0@00t2000S70t20 -LM@x2   ? &> R 0p 0  0 ^  -LM\ ?B#<0 c {`,<兒,  @ +(2Q ;445  H2D0 ,H–0D@00 \5 jH2D0 ,H–0D00 \ATP @  0SI 1 11PT@50}? `1 ~? ̖(0S10̖(0S H–0D \d040+0 0(0 0 +<(E 1 115<5H2D0 ,H–0D00 \H2D0 ,H–0D@0s@'t@ -LMH`D1 \HB1D4 \5p p H2D0 ,H–0D@00 \5 S H2D0 ,H–0D00 \H–D 0\HB0D \5 ,QU@ P  U0S &> R t P 0@pU@PH–D 0\HBD0 \5<5H2D0 ,H–0D0H2D0 ,H–0D@0 -LMHPD0h \HBD1p \H•Dh 0\HB1D4p \5p`  H2D0 ,H•0D@00 \5 x H2D0 ,H•0D00 \5[ H2D0 ,H•0D<0 \H•Dh 0\HBDp 0\H•Dh 0\HB0Dp \5 -AT @  =S CcrT@H•Dh 0\HBDp 0\H•Dh 0\HBD0p \H2D0 ,H•0D0L  RR@ 0CS R R R R &^ R 0BS R 00h J  -pLMW`P) H2D0 ,;0SW FW{ &> RT T3 H2D0 ,H•0D<0 \&>$+Q XH2D0 ,H•:D00 \H2D ,H•0D< \H2D0 ,H•0D<0 \&>T*QH2D ,H•0D<W H2D0 ,H•0D70 \H2D0 ,H•070 D\9  H2D0 ,H•0D50 \H2D0 ,H•070 D\$9 R &n0 S H2D0 ,H•0D70 \H2D0 ,H•0D50 \H2D0 ,H•04D0 \0 SS1H2Dh ,H•0D0h \H2Dp ,H• 8D8p \T1 H2Dp ,H•0 C SRK SSH SF T@ 㠈H•D8 0\HB 0D\H•0D0 &n\0 SS S pphH2Dh ,HB0D0h \H•Dp 0\HB0Dx \0LBD[H2D ,H•0D0 \@<' -BLTp 0S @TT 0`V P0`VP 0H—48Dx \0`VP 0H—48Dx \0`VP p-LM`P 㼵P@ N 0Spx00@  00 (0  Bp000a p-LMP` ㌵P@  R00R$00"0 Bpa p-LM`P jP@   0B0 p 0-@DLMP LO@\  0…0 -LM"p0@ `0@WP0S0p0@PU@PU@ 0S S 0P0@U@WF SWm -LM<`S &.00C S[     ( <  ,K@8 0@J, }/ 0@B̖3Mp>@0 p )*0,PD'̖>0, )<4P!̖)3=0p  0 P ̖,)< P@ )2PO̖00@p  0 PP@?Uڼ̖>00p 0 P MP @̖p00@p 0 PP@Uڼ̖> 00p 0 P@}|zx34P4 5h3h#0d3 `#`00 4`1 X4=00& RR Rw 3#823O<"@2 "2 Rr0  0 SS(–\x29x200"00S00x2;x2p0 }(–\8 &> R# {&> R# &.00CS)"00P2TH2D ,H–0D0 \ R !040/", A`b<V<Vl5;5 P  &.0 0CSW1 R1N   p0 0p0t00t0 t00t0< t lx0!ↁt l0T( R ̔(0S! $PP̔(0S,?#< B0,`c 0 0 0(104 $0  (̔m0S 40 R,0 0 0 0(fa{s -p2pr  L x2@ 4oc  u H2D` ,0 P0Sa 0SV 2 RO  R ,0 000S 00 R<x2  1 R- 1A]00C\ 0  "!T0 00 @1C& 8 0 "!0!0 Rm~00Ba s 0  S |0  K0 H2D( ,8SP<S&> R N,0  0 [c[cb[c[c0gfff 0-&^0LS@j SSB |29 S|2"H2D0 ,H”0D60 \&.0 SS 0H2D0 ,H”0D:0 \H2D0 ,H”0D90 \H2D0 ,H”|"0D0H2D0 ,H”0D:0 \PH”D( ,0 P▁UUsVT0ꤢ -LM4p5PH2D( ,20SHD8 0\H2D( ,1`0SW pU H•D( 0\@=8    t d@Vd0T,0S L2<S H2D0 ,HB0D:0 \H•D 0\d@'d0T0S H•00D8 \0SR -LM܌̐@  0Pp(0PW`,,x2 ,U00Q00Sr<0 &NR00R  RH•H• 0 6DD\04` SS" R R00R@@T  H2D ,H•0D \x2`(0 S00000000/0000000/000000000000000)H2D ,H•0D9 \x2 |2 SsH2D0 ,H•0D60 \H2D0 ,H•0D40 \H2D0 ,H•080 D&N\ 0B RS&> R H2D0 ,H•0D90 \H2D0 ,H•0D0 \7P ̕(0SH•,,0D \,HB,0D; \H•D8 5\HBD0( \H2D0 ,H•0:D0 \x2 e-H2D0 ,HB0D00 \H• 0D\ =t@5D@05%+%p00C\ 0  "!0 00 4C&  0 "!0`$0 RN@D 00S x2 $4 44Bam3  zH•Dx 6\HBDx 0\ $0 (QXCp00C\ 0  "!0 00 3C&  0 "!0"0 Rm>zH•Dx 2\ y}H•Dx 2\ p}H2D ,H•8#8D \0S H2D ,H•6D7 \H2D ,H•6D8H2D0 ,H•0D60 \H2D0 ,H•|"0D0{H2D ,H•0D9[H2D ,H•0D9OH2D ,H•0DDH2D ,H•0D8 \H2D ,H•0D: H2D ,H•00D \0[c[cc[c[c0gfffb  0-@L_&> R ,0  000Sb p-LM@`_&> R 000,  p 0S00 p -2LM 2@P4`0 lP|2pxB'0 0C\ 0  "!@0 00 ,2C& $ 0 "!0"0 Ry1TU1T?*1T, 1T pA% = S =@S @0 8C8pp2|2 %p2  (p2 @ e505 0S  *4Pp5@p D0T 0Tt0. @RX0SXX0T/0Ip[c[c[c[c02i 1i i i 5i i 6i( 0-p0@0Pp0L4 0S00h4 -LMP4@T50 =5H˜D,HB:D00 \H˜D8 0\HBD 0\H˜0D \1`P?pB(0S \ (0SK$2S@pW`Zp`D(0S \ (0S&$P 22(C04 pW`ڈ ̘(0S $0 (!*D$0(\*02$0(\bj p-0@LMP P .8(`P00C& R 00#!000 l0C& d 0 "!0@ 0 Rpphw,[c[c[c[c0 -L,MdŸ0#,0 3RHRL@`@0 0BSpp Q? 40 20" @ 40W1I H  !1"2!1"2 0X" R03S SV㨂堂% ~ R  0T2ST12cWP+>   ,0 S , [S @0pBT -L4MS , 0  HbLr$@@z0  Tz !0T z $'!P ,0 S d,A $  "0T @ $0@dtycT 0T H0T 0T @0TJ  0 @ LK 0  @U(LK 4P 0T I0T @0T 0TI  0 @j LK 0  @DLK P i 0TꜤa',P -LM0 L2Hp40 0< 08 @ "0 T4 @0T<04 T< B404 T0DD4 @T04 T04 T0d3@ SV W+K,K @T%pWZ4 $@ @^@ 00 <L0SV<@ R8  ,0K+pKlOP Z8 ,0K`008  @D,0K TT"@@OOPZ0@,0K@D+KCOW \ pW80d<h -LMP8@P#h2@0 TL2H,0  p  0 0 , 0p` .Ϡ@0@nH$Hp@p@dH $h@ -LMCLbsHR@D 3T@@  @ -L M `@ ,0 "0PT` 0T&40 T0 TG40 T 0T Z, 0 `olN,` 04 -LMP` p "0@T @0T0 T(40 T0DD @T0 T 0TYd@  0 TN $@@T  0da[ Q-L@0 ?-#@?Zc?!NP  ARN `PO_P`` ??CS0cS@  p-LM@ 0PT 0T` $8  `$VpVp -@㈠4p@  0LT5 Q+  $  0P T  0T0  T0  Td/w  $ P0 P0000S  0 T R 00R(HIIIIIII0  T  $0@  T@0  T0@ X0THßH#,0 S Q0Q 3 r  T <  lwPl 8S080m0$04 40|0 00 `\0 Lz0@  $0`  T  $Z0P  T  $`0 @ TP@ZTU0  0P0  T  $0 0R50  T!0  T  $P  0T  0T $ 0P00 xv0 @0 0 XPia_XOq_@aģf,[hԣ4Plia' 0- @0P0L00 4 0 TP0P0C& R 00#!p000 \0C& T 0 "!00 0 R00h|r[c[c[c[c0 p-0LMPU` ,0S PU@ 0@n 0n8P<TlevpM_XOq_ -1AL` Q p P-p Q) P`00C\ 0  "!0 00 0C&  0 "!0l 0 R r0@p(R 8S x[c[c[c[c0 - LMHȟ4 4 , P, 0 "((`8 0qW @ 0008PP @00C\ 0  "!0 00 7C&  0 "!`'0h'0 RX7X'p0 ,0 l0   0 Qd 00040_ p0 00/0 0C\ 0  "!0 00 6C& | 0 "!L6X  Qh ,@6aq 0 0C\ 0  "!0 00 5C&  0 "!5  Q6q0  0S 0SpP `pD%D5P@ p  0Sp0 p0 }HQ4Q >p 0p00! 00p0 H0S Hp 00  HlK@TPl K0  @TT000  T0Hp0vHꜤap[c[c[c[c0Ф 0-0L 000p0P@  0p000C& R 00#!t000 `0C& X 0 "!04 0 R0(l[c[c[c[c0 -!L M0000x0ppt`p0t000C& R@P 00#!000 0C&  0 "!0l 0 R\\V @@W 0<`@ik[c[c[c[c0`R -PLM@E 0RA 2P 8p `堠 V VJ +<W0  p0 (BP00C\ 0  "!0 00 1C&  0 "!0!0 Ro|k0 0L \P00C\ 0  "!(0 00 1C&  0 "!0 0 R$ V*АЀP0 x p0 0RTp0x 00 h P`" V:d0ae*k0400 T[c[c[c[c0,/ -LM`84@P㈀ $8 ,   $pR <<30 l P 0S #0 0C\ 0  "!0 00 2C&  0 "!"0"0 R $ 0@~0Uh:x t0 0Rt0x Y  $pP $0PS %P+0  , 0  , p0 0p0| R,0H⋿, h0x!2 $t fh08(0S100B;0P` *0-@@0*0+) <0 90- 020  F< 0h ?A3cC  0 (<0 _y<"0  0 B?(8Mb( -LMP`p /P@ )0"S S 00)0q l1 ,  (p=P0S $(P -LM0Pp $hP`> $020 lAT0 L0 T0 !4 0j0 <0@T0 0s  '0s @D_TT -0S 0S2Sia i +0S 01 00 (00 $ $000H ! { 0 v i ib ii-00CS񟗻0,,,,,,,,,,,,,,0,,,,,,,0,0,,,,,,0,,,,,0,,,,,,,,,,0,,0,,,,0,,,,,000,0,,,0,,0,,,00,,,,,,00,0,0,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,0,,,,,,,,,,,,,,,,,,,,,,,,,,,0,,00,,,,,,,,0,,,,,,00,00,0,,00 p-LM0@SP`0 00CS'ꐪܪ$P p P P P \P"Pup -LMPp@`l0 T0S/ 0T*0 T+0S0 !  8p "p T,0 T 0T 0 -@LP`pl!0 T @0 T0  -LMp@P`00CS%<̭9 -0  d 0p 0S  Wpl! 0 $p p00 p -@L0P; S`p> $0S; 0Sخl0  ( p :hX ;w 0p0 (0$ 0 p 00 Sp -LM0@` P,0 t$ d 00(0 $CW> $ $p8@g(0S.0) <ŸR0 S@ * @T J000 R:0@0 d 08(0S0  0 B?(0  0 B?($p $0<<0 T $0 l1 3  $p $W 0 0T꺠Z 0sp p 0T $  $pJ p-LM@`P0S$ܲ$$0H pp  o 00   [ -0LSp! 0 T@ .l`@P0S PUN000 0p 30S S  -P@ P`L -$0\0'0 A,  X$!p 0 \0 \ 0 T XC00 T00,0R/ 0,  X0aqJ -`L0p 0@P(0l \ 00\ 0p P$ 0T -`L0p 0@P(0l \ 00\0 T 0Jp P  0T 0T -LM0pP/p@*  `$T)? T $0 P)00S 0  T 0i? 0@S)00S 0p P 0 T 00 0  0 p-LM0@P` 0T 0T 0T\ 0S    php -4!4qLM0`0004@P0S8 S 3 PUNZ@PPU @Z@00C\ 0  "!0 00 l0C& d 0 "!0@ 0 Ri4W`[c[c[c[c0 -Lp\P` 0S 00 $0 $@A@0  T0 T0@S  0S  00 S0S  0p  m 0p P0 \ 0p  $ @P 0p P0 \ 0p $0 `" @ z p-LM`@P $  0T0 \ 0 $#P_<ľľľ000 0sp p 0  T 0_pP p M 00l!!  0F 0   p-LM0@P`,\ 0 p"p 0 T $ $ 0  -LM`@pP 0P0 k\ 0p _ $ PR XQ00RP6RQ.0l!P 0S%00  0P  i !  0i 0p i}P 0 \ 0P 0 T @- l1 d0 Q@   \000 S@505 3:S0 0" p-LM@`P0 T 0phG -L@P`0 p  05p \ 0 i0s h^ p-LM@P`0  0\ 0php p-LM0@`P 0T  0  d 0P 0T 0p@-@l0<000@0@-@l,00P00P0@" p-LM0lAP0 S 000<0`0 T0 Tp p-LM0PlA`! R 0t000S*Q0 2 0 <00 T0 Tp" p-LM0P`@ 0T $0 0}N\W@T $p -LM`VPp@2 V *0 T9 -0  d0000@0 T1V *0 T+0 T,00 -0LMP@`e $;S $ $0 00G@@p 0   0T 0T0 T0Ȁ00  0T 0T0 T 0 0 i: T p-LM<@PT` h⹬)0X0   8(0S     0 (8 $  8(0S|  $(0Sa8@T\\)00S@      $0 (0, 000Qmph0,00S4 00 o<000  0 B?(8xX -LM<@T o0  0  ht -LM P0 ` 0@ v-0Ss 0S̡(@00C\ 0  "!0 00 1C& x 0 "!H1T  QoSR0p4@0 T00P00C\P 0  "!0 00 0C&  0 "!0 0 R 2 00 0 0 @TR;[c[c[c[c0 -`L@ Pp$0@000 T p- LM 0@S00P`p AB1!10d@2@dB`0@$T @a2a3c13D@ /&b00(phꔧdʚ;CH p-L$M8 (0K$`KP0  0.*` ,@Td .< 8  (  4@ T$ p.pЧ -`LT $0 0T Tp @P &0P Up T $0 0T T $0xR'x3S %  -,LM, P`)p] 0TjT0] TbT] $@@GXTHpW$Z] 0TLT -LM P@0] ` pT:T] 0T2TP P] 0T&T0] TT0X`Z] 0TiT0 < 0   Q0--0L@P  Q 00|8S"=@H 0-|8PS@L  H(sKX^0饱PP, p-L Mh@V PK 0[P ,0"  000(^ `08 q00pp80 -L MH`Tr; @ 000X 08P0$00 @0@0C\ 0  "!0 00 1C&  0 "!P1\  QP0pK 0[P? 000@0,0 0P00(@T 0XZp0 0C\ 0  "!t0 00 `0C& X 0 "!04 0 R~ O|[c[c[c0 - @Lp0` 0P0A 80Xp0p0C& R 00#!p000 \0C& T 0 "!00 0 RhO[c[c[c[c0 -LM4 < @@ S!78 ,4p  B8 6P, 0 90>0P`*@D S : R#: ,Jc0 @`p`B0 Xp0C$ 0P8 ,04 0 P@ 0P0PP`  0 0B@$B -L MX`Ur; @ 000X 08 040 0 @0@0C\ 0  "!0 00 1C&  0 "!P1\  QN0@K 0YP?q 0000 ,0#  0P0(0(?^ Xڨ00C\ 0  "!t0 00 `0C& X 0 "!04 0 R~ N|[c[c[c0 - @Lp0` 0P0 8 0Xp0p0C& R 00#!p000 \0C& T 0 "!00 0 RhKN[c[c[c[c0 -LMp, ed— hl2  d2h ,* B: @P0  KTU  D0\20\2 0PPU$0Z0PPU&0Z> 0'(0 0YP@ p2 x,[03[P @ 090QP @ 090GP@ 0P90=0E?0P!L |0U90|"#P0>U 08P2x"PUd—hl2  d2h ,d—`hl2  d2h4 ,0 d—hl2  d2hH ,4 d—hl2  d2hL , l8 ,`  P81S d—hl2  d2h ,d—hl2@  dR@h0 \P[d—hl2  d2h ,PcUlldBhl2  d—h 1\VdBPhl2 P d— ,0h\dZdBhl2 P d—h 0\P BPd—hl2  d2h ,P U @P1|Pz>Uuro Xd—hl2  p2dB ,0 0h \d—hl2  dB$0h \d—hl2  dB$0h( \dRhl2  d—h 4\dBhl2  d—3h1 \dBhl2  d2h ,`dB, o`hl2 ` d—0h \dBhl2  d20h8 I,$I00t#N>C 0CdR0l hl20 0, Ȅ 0   d—h004 \3dbAhl2  d—Q0h@ \dBhl2  d—4 :hH \dBhl2  d—P 8h\YdBhl2  d—hH 40\dBhl2  d—h80L \40#YPYd— hl2  d2hH ,P UP 81@T0!0040 PHLH^0H8 ٤dBhl2  d—h ,0\dKYhdBhl2  d—h 1\PUJA|PU@DZ@8]ȨRPd8@%I$XH,0 bVW -LMHTe | H0S8T| NB|@8.HS H0 0-LMdR@ hl2  d”h 0\0 -X6XLM P P p{ P( F0 0C\ 0  "!0 00 5C&  0 "!0%0 RoJed‘0P00hl2 P d2h ,LHT dBhl2 P d—0h \2}X00C0d—Lhl2 P d2h ,d—Phl2 P d2h4 , TP$d‘0`00hl2 ` p2dB t—,0 0h \d—hl2 ` dB$0h \d—hl2 ` $dB0h( \P8SL(R dB`hl2 ` d—@0 h\XdBhl2 `倀 d—0h \dBhl2 ` d2h8 ,TH"00N>C 0CdR0l hl2, ` H d—0h4 \dBhl2 ` T(!d—h36@ \dBhl2 ` d2hH ,dBhl2 ` d—h:H \dBhl2 ` d—P 8h\WdBhl2 ` d—0H h\2rW 0L(0C0T(P(d—hl2` d2h ,Ad—hl2 ` P(dB@00h \+[c[c[c[c0=%I$P "= R$0 R0 RLa_= -PLMP x"RpW 0``00VdB hl2  d•a0h \3` T2X"0 T2X"YPJ4@T2V0CT2dB hl2  d•h 0\303 9$N@ho| 6t1@`6\!dB hl2  d•h 0\ I`X80 X8OP`X(0X8d hl2  d2 h,x"``d hl2   d2h ,`P x"pKܨl$8 0- LMQP dB@hl2 d•h @0\0#dB@ # hl2  d•h p- @LM`0P00$)`0`0C& R 00#!p000 \0C& T 0 "!00 0 Rpph8H[c[c[c[c0 -QpL@P`,8S  0 R`(8S 0$ $Rp0S`@` TP$p@pAT -L MT20T25 00%0(8,H,,0 (00C\ 0  "!p0 00 \5C& T 0 "!$%0,%0 R?`T $PpU 0SSW`,P 4P$U  R00R\ Y T20CT23 `4 @0 p0b@0 L @0 倠0 `#> 00ZF 3Z5 0L0#3@ 000K#@0@0C\ 0  "!x0 00 d3C& \ 0 "!,38  Q =G0Sp R000R!B6S0 !0^p@P↠"Q 00c0 C20000#:2 0D <@0 Tp -LM`0Vp0PS"= QdBhl2 d2 h,3 `VZ00h2JN0S  -LMd@ hl2  d2 h,3 h. -L$M`%% 0 0 < p D8P%P, @ P@ $4D@08 8 2 00 $0880, T4  ,K4 <0 ,0P @, 4040<0<@  OD240<0,  0 0 4 0 22$p<!,\10LP0,0,0, ,0 ,0,Q,0$p000808dBhl2 dš0h \0S ,1 R) A00C\ 0  "!0 00 0C&  0 "!0 0 RDP@9| t0 l0 ,!  ,(0[c[c=[c[c0,Mb0 0  Q-L 0S S 0SQ 0 0 Ի|-0#1?$ˀR 4   R 0 0 0 !1?0P 0SP-(0,#1?&̀R, 600, R000000 !1?0P (0S,P0@-@"-0 hPR 0@U0x p0t0@@ 0- @LP0 00@P0P0C& R 00#!p000 \0C& T 0 "!00 0 R00hC[c[c[c[c0 -L M0`"-@0TP, 20@  ,0R CPpl Y4 lP0 _ 80 0$,S03( 00 0*  Y <x   !<00  NP3A!P000P0P0C\ 0  "!|0 00 h1C& ` 0 "!0WPS  @ $0S U0, 0@ BBr@ P0P00fpFP0P0C\ 0  "!t0 00 `0C& X 0 "!04 0 R Aꔤa[c[c[c[c0 p-QLM@`PpZT 00 @DRT0  0 @DRTʃ0p -LM@FP 0h -L[c[c[c[c00 $( -LM@JCP 0h 0-0L "=@P R P$0 R0N=T 0-0L@P80h\4 000 -LM@CP 0h -LM@"-0P0S0 4p0< 3@0,K8``j,P060, 060,202, , Z̡1$L` ,0 V00 $P, Q00, 8090dBhl2 d˜0h \0S $1 R1 A0 0C\ 0  "!0 00 0C&  0 "!0 0 R |0 R=P@T ᰖL0 D0 ,!ᬖ [c=[c[c0,Mb 0-0L@P680h -LM@CBP 0h -LMP "=4pWV 8@P`N D1$p0!0100<0@,  00C 0021帒 `$PL@ 0@00  8`09000C\ 0  "!0 00 x0C& p 0 "!0L 0 R< 04[c[c[c[c0$0S0$0 -1嘁LM0 4@0P<`@0 0Rp vJ 1|P 0S S 0S 0 A 0 0 0C\ 0  "!0 00 0C&  0 "!0 0 RQ 0/- 0b1x# BQx#84ok<[c[c[c[c0 -LMR, `4o PP0@ pᳳWP*Q*001x#Q: Pp11^@:00!@000|"0 0  @0@0C\ 0  "!0 00 0C&  0 "!0 0 RQ *001x# Qx#:,0@p00 Sp0\< C00By 0( <25(  4p0< ^000P @<0 8@0*Q< `0!< 0DPR < 0A,(0"A 0 P4p <0 @ 000` 0@00( 40 , 84 09000C\ 0  "!0 00 p0C& h 0 "!0D 0 Ro ;0  o-[c[c[c[c00 "=P  -LM園P 0 @ 0SS* hB00C\ 0  "!40 00 2C&  0 "!0!0 Ro:004p090L`40S_ 00C\l 0  "!\0 00 H1C& @ 0 "!0!0 R6?H@ 000>0( 90 @0@0C\ 0  "!0 00 x0C& p 0 "!0L 0 RoN:M: `40S [c[c[c[c0  p-LM 0@<0`0@`P 0004~P0P0C& R 00#!t000 `0C& X 0 "!04 0 Rp:[c[c[c[c0 0-0L@P80hh -`V`V` pP0UL`p` j@gd 090S APP U hkXiajaHP -LM@ u0 00\ h)l 0- 8x 8#T0%PLT0AT 0S 0Z 8R(0 4 jaia - 8h LM8#0!P @0 A0T S  t0S  jaia -L M @ 6@l@2 -L M@ 0@l@2 -LMD0`#((0"t1'ATw T0StȀ(0,40X0>40 <8dppÚ 88#0 pӆp|WEV@2 0-@0P @L 4P 0000P0dU -LM0s@S* 00 0000 -LMⴁq`PU @!0@床P^PU $00<0$0@T0 P8:00/ P@0T,1pP, a00/TU# 9T0pD UA DA Da0DSR `TWpD@T7pD0s" @00DR Sa0D_TS7ToPOPP tPTP P xPXPP@(0P܄a݄aTaԮЅa -LM||`P0Ulp@ቢ0T UPe U PUP0U00 J P 0-@PLP < 0S) cP  P h 00C0\@P ) 0SU00h_0 qPP8D 0-L1L0@S8!0CQG!0D]S' T T T T 00h 00000P@00 0 0 0hm p@x0 0 S 0CRL000 (00  x0 0 0 lQ u< -LMS@ \00S SL L0L L0P 0^0?l 0娣 0hpx p-LMP@PLU` phN8`K0 ,$0BPp_R  -L MP@0T(*$K(pK,`K$$0  $f , @Q h0( \$0T\ (0DS<0T:,0H]_ \_د$<(Qc -PL`i Hp:P@ 00CS 0} @TR@0Sq Sf SZ 0S 0S 00 m4 S 1!0S 2!8S  Z1Q- 2!8S( 1 RT T U h1Q 2\!8S UP!000@1@兢,1@@DT$@D}TC w 00CS0 00CS0ڸ0 Ra)]00  0 00Sv h00S 0So P00S 0Sh HpfaaԅaaR<܅a -LMp0@SSHP S 0S iX 0  nPti T`0 Q00 28 6S Q 000aa 0S00laP0pQr  8 80, ,0 0܅aa؅a uaaaaD0<08 pQ(0 0a؅aa uaaa-L0H D0pQ, ,0 0aa؅a uaԅaaa 80cR   (0 0 0a؅a uaaa p-LMHP@ # D T h0\ `` T` T0V D0\ P00pP 0 0-@@L08PS0S00000 - 0L@TT xP\ lp`bXd0 4P 0S<00h#p h_ca  0-\L@P 2S P(0P2 000 p-LM`P`@2S@T<phԠPT0"2 000pT -LM@ K;40S0:00A0 R0  _ p-LM`@PP  0S  p鵜P   -LM@ P0K  0 -0 SLP` :S0 `0SZ @ p2bS@TP t0`0`p0@2S @T:0T0 P0$ePa -LMP`@V 0FS \o/P o*ᯟp0S  SPr -L M0PS` :S0 `0SY @0P , 0`K p R2S@TP xW0`p0@2S @T:0T0 P0(NPz -0LM pR K >TP@`2S@PT P Wp  -0L Mt`, p0 @–R\ ,0K@T00 ,0 S1051P5a -PLPM`\p 0K@  0SV 000a -L1L`MD0 PP(0 `pl KpKt KpP 1l R*t0S@hK 0@@ (0S (堁l RW xK| K0P x| P@hK0@@  a$İа 0-LM(P@ 0@?0a-00 Ca -L\ a - 0L0S a -L\   a -L\a -LM$@Ta -L\ a -0L0Sa -L@PMK!P 0Q0StH 0 90 RX7PTaP_H\@Y<<0 4S(Qca԰uaa@<؅aa p-LM`P pP@0T:tPt@0T*dGP 0 @T:@p0:P 0 @T:d(]_ \_܄a -LM@KP -LM KPK -0 SL 0  -L \   00 -L MaPhBKP Y PS@KCP QP,2,) -T LM@HT 00  (0R pl8a 0 0p P-PL` @T pP 0S @TP@ 0P0`0 000 $mc0S th, -p`L@PTp ^P 0S0W: ` @Th> 00htЪ 0-LMl@0S`0h,X*PU I@P@D ,, @ PU0tDX\Ft -LM@0h 0-LMPKP@@&  h0 0-pPL0S`00S @.0 . 0 @T0000ht0 h -0LM@`TPp P 0.S 0U:R0>0>0Up1 @TW 0@th -LM0PhS` /S+ bS` `$pK 0S 1@x $ hw$ BPX @ @0f0P,`lSꈲuaua 0-LMQ@<00CS |080 Ao0-0P0K0,0 /oPT Q 0QP0 R000(P$0-a-x -40LM @R @> :La_ 00Cs0 -@L`0 SpP 00L S0 @0V0 0S0 S@P 0 a0CSa0RS-P@›a@0a S_R@ zTh鶛$"X" -L4M0 sS, `@HKTI   a0@S0a SR0S 0S0S\ + a AL00lL0 V L0SZ00V00S 0S + a0BS aB0SA o1 XV@xq ?0PS`LK0 PBTU@P !0001 ,0S ,}&pX T KT@ T0cP T K0T0 0X PQU0:S000 S 0a0CS0000S _0a0B`F~00C ZUSꜤa!hfP -LMr@W41R2p U8`40< +>㳀Ϡ@4+.00 000E ?PPp$ 㮘0 S0 0x0@0p0~5 \Ƙt) U+> +> 긯Ԟܦ" -L3 S   -0L"R"0 03S p- @LM`0P001``0`0C& R 00#!p000 \0C& T 0 "!00 0 Rpph.[c[c[c[c0 -/0LrHR`LX"0H@Tt"$@T2S -LM@  ㍖000h̠ -H3L M 80HbL4(3, /003 /0 X"0T2   0""H0T" 0T" 0T"  0T0" T2SHB0d" T0\" T/0`" T" 0Tt" 0T/0X"A0 TP~@\"0 PTU@4pK 2P@x"0 PTU@4!40O000t" T0X"0 T0   PP"0 T0" T2S0X"0 T% @ %5;5H0 ,0S P,y|" 0ToꜤa -LM5=@S 2+.0Q{ @T 0S0000  B 1p 8Pf? ˜2 \$Z  P0+0 (<U!<3?"PH1    Q $q/HBLb0PX"0T 0 0Xh"0T%8l"0%\Tp"0T/0X"0T00("Q 0 80 $(k5;5̔ -LMHbL@_0B0X" Tt" $1 )Rc 0X"0 Tp1p!”0"c\TM , K 4+[0[^0'0c "*1/0a0` 0 A S0AĀ \!p0^:0^* L("(P+ [ 00C0Q0ԇd"0C0 T0)S 0< ⟔000, KN4 -LMHrPL8`O0X"0 Tt" $  0t" T40  t"$ 0 t"Tt"  0T  2 R; 1h00h02S' /0X"0 T t" $" $" $" $h00h0l" $@Z h" $ T@p00p0t 5 t ;D $500C(0 $1/0L"HB, PX"0,T0 0 0Xh"0,T%8l"0,%\Tp"0,T/0X"0,TX0+>("P< 00 $`h" $l00l0 -2吂LM|2Q`@PpzX"Q]*P2QH H2Q* _0 043La[c[cPa8a[c[c0 0-LM0@99 90:RP9 HP0SP U P0/9P[?09P 09<9 0@9@0909 09090909090@909 040 0$ 0 PR0a/Kc -0LMR`(0 P1 HP0SP U (PP5 ||=P @ pP  @yP   @q0 PR(Ka/0( G-M1vΌ \0000 0c?0cll0 Lb1a/"ba0l A ?#όO$/LNpBNa|P0PP 12c!b  <`C<2c2c!dV!B0 Ѝ*Q989QA0!0Q0CZ 0-LMP@0l0C0K00K00K0 0K0 0K 0K0K Kz0@-0 @  0@- 049 0@ 48<0 0@ 4 8<0 0 $*000 0-PL@ڃ 0h< -L M, 0@000 0 $0T` p,?*Z2V/00Ǵ`0㸑 P Sa,<DP`2P`V  b0p0@00T:$0 p`,, 0S000  $0,0  00a 0 P22P2pf`0pf `㜐 ˂P2 Q2P0PxLTaHa -0L@dap SLh,P$0  ("Q *0$00 0 e0b 000  ؂ 0W0 00000`PCpP 2P0`PxLpaHa p-L M$0P" ` a d!0S$0  S! 0@0  $0dp$0 pxL0@-0 @P $0(,# 0000CP 0$ 0x00 p-LM0@S`P0- P$ P00 |00 0 0000p|P}P P0 0 |00  |P} O@- @ 0p`P$4@(8, 0U`00C\ 0  "!0 00 4C&  0 "!0$0 Rw 0@$/,0p,  PP ,!U  R0   @0 S@0t`0@0 0t`93@0P00K xP00PH00d0 /0  0P 48{F6,013{ ,-{, | :2p<@la[c[ca[c[c0 2pahabTl 0000t   0-@ P L@P00 4 0 0 D0s 0s 0s(0s00s0s0 s 800CSHH0s -LM @  @ -LDM`p(P0|@0  90:#:0* 0 0 8 l P 0H0l 0 80S 0@0D0L $ 8002@ 00"Q0d 00 2@00C\ 0  "!X0 00 D2C& < 0 "! "0"0 Rr 0P Kh0 `0KX0 @0h@0d @0 8KX0K< H 00 4 ,@ ` \ T D PH0;c@`1x! P0d @0c\!,!C610# R841c1 Rd 0d d 00 0@00C\ 0  "!0 00 0C&  0 "!X0d  QN Ld}2  1d \[c[cha[c[c0LaPa8a -LMM`4 0 0 S8! q 410@1 0S80 004lL! @10 D y41 0H  `Vp 0bX01WV4!0ST@0 R,!00000)D!2 R!`KJK010^ 0 3R8!l0SKOK00H!@ @8l0S`KJKV -LM00Q   07zfE -PL0@ Qp`:@#R D3S`D3@#0CD30  FP?< p-<1LM@\`0=S`L RB?   BR R3 P0S&0S V0/0000 ?2΄ !B00Lxp?` `! P2 BPsP  -LDM4 00 080 8ȟ8@P 00H 4(P`00D L0 P0 00 \HdȟP00C\ 0  "!00 00 8C&  0 "!'00 R7'70c40S@3H 0#2 PL0 P P'P80BD'D70^ l0 4 Po ^PU \d*!lD2!X0  @00@04   00U \F*!l1!e@X0P @00@04 000  , 0 0 0>.0 N^@PT \*l,1 @e00  0000  GC?\*!l0!X0  @00@04 00",00S0c,00,i0C|DhEF p-L$M@P0`   K0`P0Sp -LsM , `Dܡ  ! 1 儀 |` KpPPȁ ́ @80S P104 ,0S p,dU0 0PPT0@ 0 0PP`@K 40PPoP  KPPC[B *D 0@xPP#[@P2S@ Tw С 0J0C p Dq@!TpAkK1 0 jK! . . R l>K! \33 5 Ƞ P!>Km kK1.0Q@ pb 00Cpp!@Dq1T#[@T; 20CS0|2(3(3(3(3(3ȑY: 01 bpnKoK  m?KPH\5 :0\*  b 0 0b$10#[1 @T0 0X *ܡ  =P P&pH0!>0kK1 ̑  c. . j?K!#[ ̑ -Ꜥa -BML M 0`3S 0D4 , KD\|4(KD$4$  _P 1D RBB)p  0@kP@3 (K! !PP"0PS U3 410  3@ 4 @<P( Ph3(K R 0S2 B.K BBK0N\N  B 0C @P00T00ST2(K 0 2PU92 0C8$ @ < S)x6777T8p8CKL C>KL N0C@4O 1s<$84!1 8!Q<4%000 0a00b 1551%2PU1(K0S@10$1) ,0 S ,wS  (P (@BK@+@p44@QD1D$(K 2 0" 1 008A 1s<$84 !1 8!Q<4%000 0a00b 155 1%) D$  @V \*B>K0C  0CvP@ B.K B B kP Ꜥa`!X! -LLM@Q@D1U d0 ` 8d0K00ipW R)O)lPp@ `K @)=)0`0 0<X0 \ 0P0 T 0H0 L :D0 @ 080 04p < 00 0$p (p ,0 p0S -L MBpBP ,0 (` 0@P@"@2V*0S @T:@W (( 0 PP: 'p  0P@0 S 0R , kP -L$M (14 @ @D Pp 0S o P 0 @S@R*0 S  R:R*0< S S4  Q Q 0S8 0 # S S 00000 0S S SQ 00 Q Q Q Q Q < 04S4 0!D0;H0  D  0 0Q@ H0Q0 T0S08 ğ (10$(1 `000 R00 D`00C\ 0  "!T0 00 @4C& 8 0 "!0$0 R0 ?@ ' `8 p<0S 4?@  '< `{p? '(10+`00 0P@0@4!(10(1 @$f(1! 0(1,H0 001D  H0 10 0 (10(1e 00(1 04fZ `M P ?'0S,ŸL2, ` 0 b02B&! 02 S7 1b1 R000q`00C\ 0  "!0 00 t1C& l 0 "!0H!0 Rni ?L G'L0 0 01 `nYT1?L K&L.,K? P@w(1, 0(100,0, $,0, (00(0,,00C,0,(0 ,2J[ca[c[c[c0aLaPa8a3 p-LM@P0c0? &Ad`A n 0P?&`p p-LMPU`% *@0 PR@ U: @0\0 ?&00@p -LM0PUp*` @0 0000 P00X0#02SP` -LM PR@0:#:S(0:#:S#j&jV \*Pp  @ Ȍ qΌP00 ``P@0  -L$M`. .\@0  @,  @Pp@ 0P 0  00 Pp ,0R   . . pH -LM@. .\ 0P p`@@ ȌqΌ 8 p-1"LM1! @00> 0>0Q`P 1.*!a!00`G/ 0B!0b0!P PPP0Q*!a!00` 10G?  B0 P P0PpF -`5`L$MLdR8BHHlV7/ʣر+<(MEş00S 0 0$ 0 P8 R08 `<0 < D0夔0S0 4 @`D 0 l$l4, `$010 T alpH L@ LP@/ 0P24 $04 0O0`V000#3@p@A QY@Q0@00 K30K@cFFPPp00 0gTP@`0*`2880`^,3 >0,!C1)Q<k L0S P0SB"P 000FաUGP0P0C\ 0  "!p0 00 \2C& T 0 "!00"0 R  OMN Ÿ|0  P@G0S P0 !@E0S}:10S3Pa @09@00 PPX 00 8A@04q0@0 0  P 0 @00@0 0 Pm Eaa"%ahaa|axaaa!$hwa acaa0aTctRc [c[c[c[c0aaP,a8,!@baTHa`a aP0 6P0 .P0 &P0 P )iF@;0PK0K0PK! %l,1@0@9<1@F -@ LHM0, X 00 TK0P0 T ( P0 S$ jjD D -LK/K KT1 l < dQ 0P 8P XQ HP Pp4/H0P @` D P P R   R?0@SD刎> P 0 bp>B&! 02 SL1b1 R0D00D  nP00C\ 0  "!0 00 =C&  0 "!0-0 RH00H0 D2`Vp H0#K`PPd7 42 冨Pp?K` 0"R 4"僫P42p@ ?WpWKH00\F < @ 0 b0#60`00\ 0. "&0 P0>0#60X  T00Pp[42OK2cX2 T2( 2 KX"P2<$PK  㿧PE  B|1S0# 42 \T42 0> Pp p@00@0, p0)0,   R ,07,02 ,0<,00  0  ,0X'P' LL"p 0 y  <,0S KP1<X"H2 K( <:P%,0 ?l 0S H R < S <@0S,06,0K < l? r,06,0騅%@(000640 00000 0  0\@U@00C\ 0  "! 0 00 4C&  0 "!0$0 Ra _ PM ,0@7<,0LT2` 0" 2 0 " 082 0S/KK 82 3_VPpH:R# KPpD 0@ Pp#H@"D00D082帀8"82@"82$ 8(00(08",00C,08(0,`VŻ8/<B 8X@H#0\F ̂2 @ 0 b2B&! 02 Sʐ1b1 R00000  \R@00C\ 0  "!(0 00 2C&  0 "!0!0 R]8\F 1 @ 0 b1B&! 02 SCh1b1 R08008  4Q@00C\ 0  "!0 00 0C&  0 "!0 0 R JL"p 0Bd'P ^ y X u< 8Fta!8a_[cLa[cPa8a[c[c0a+>30R 0R0R,07  0H,0S.j00C ?v ? L -LMp$K4 ,@P  `@x PT4(  01 B10R,0 P@( ,K cQ'00K@8,P4( 0,0 B0RP,0 ( 4K  IP@"`V@J,K >Q'00K@,קP0 ,0`V0P,0 Z  (@P  -LM40H<`N@~VpNP0p p@ (<. <0@J p` @@0SQ< 됐<(KL <0x !0 `` `V D 0,Q(00, 0nQ8dUP -L -LM40`S  ,0 (H,0@*;,00 1 111$ @0S  Z8 0R10<0<0<0 Q 0 0 0S0 0 0`T@ T Hr(-LP,0 + SU@"[O? H @Q@0 @H0 vh0  , H@H@,0 1gT0S' , H@(0S B H@,,0$1@@0@H0ShJ,,, P |0S P0000$oxP.vP $ u >H,0,DF8A$ Naaaal 0-\P@LT]D08 S8008< @D@T 8 xR<0<0<0 D,0 0H10zHS,oD 0@Y*++ -LM0pS$!P0`0c00 T@T , L@T^ 0P" 00*P @ q 40S $1a R q (0S 1\) \   4 5,0 Q1K0  9   4 :,0 Q O/0K400 400Q2 Q)XP  PP `X`6( R ,0B +`0`  $R$ #O?` @H m5@H PO? K  PzB (0Sd錸H0-STL0L QL 0(0RP0P0P0 T RL T0PTHP䘤a -LM@@[GH  R 0 0 0 L RP0P0P0  }  00CS0 P<=G8 00C0b00Ga[c[c0SSc -LM@) P 6 P80Q 40S $1 R Qa 0-0-LM@0lKP -@ @P@ 0 0,ό,&MU00a P0-L@4P+P04 Lꔤa -p0p`PVL  sP@  H$ p0P`@@JȬa+̸ 0-XX0@ TL  P0 RP 2@T0+Ȭa -LM$P`p@G0 00 00 00 p`pp 0- L  0000 1SP0PSP& @0 0C\ 0  "!t0 00 `0C& X 0 "!04 0 R0[c[c[c[c0 -L M `@P <<.00 000 0 04 0700700- R  P0ES$d@0 0S  0  0T]0`} 00 * \Hm 0 0CQ 00#!000 0NÃ0G@ă. B&, "00 0, ŸL PPG "0 0cC61 Tp,@ @ 0 d R0 d 0S P00B00C\ 0  "!0 00 1C&  0 "!0!0 R* L1\A00C\ 0  "!(0 00 1C&  0 "!0 0 RRE@PppZ P P ppT P p pP P  P P p pH PppDPPpp>Ppp:Ժ[c8a[c+cLaPa[c[c0 -P1Pq L1 bB&!<1`LP 01Aa  S 00S0PP@00`0P0C\ 0  "!0 00 0C&  0 "!0h 0 Rh H0&4 @`0La[cPa[c8a[c[c0+40S(0 !/B! R, R, +̄_ p-LM`xPL 0K !`6 KH0@@<0 @00@ A0pdU+_+La4aPa -L0à PP PP @P@ P P   P   P  P P   P  PPP 0-0L@0000P 10 ꔤa 0-0@ SL@P0000 0S ꔤa 0 0 c-  1 00*00 -RLM@ R`$p0 P0000< P00 0S` pC$`! -L$M00 X5P00Qp6 Q< , 4 00 D%`0  00 4@005000$@E00000004`00C\ 0  "!0 00 t4C& l 0 "!<$0D$0 R0Dp40,p0 80 S 08 a R 0007 0D @0 @000$;T0 < 0H00<0S0 D HR00 P4 004;00L u,0#p0  00  4@0"@00  000002p00C\ 0  "!|0 00 h2C& ` 0 "!02<  Qu dH 00C00   4 R 4 <0 C 0l   40 l \S 0Sn 800S80 WPH!0@ < 01Q 007000400+ !@00C\ 0  "!0 00 0C&  0 "!0  Q400500 ',0/, Pꔤa[c[cH[c[c0P -LM:t@y? 00a!Ce -LM\0@Sh;a<0S8<0 p-L MQ/|A`"t1) ``@NTA?#)H1 @C0Q?# $1@)80!S 0SAP @ 0R@@%9 0H@@9 0P@@9 0@@ 9 00@@9t p0@`8paa aada|a8aha-0P0S00``T ) )`T8aha[c[cPa[c[c0 -LM@ 00S 0 Ah,00P 4 RHPᔤa<0 40 P 40 S8P aa<0 40 P 0 SPda|a -LPp@P`$ $1P   $@ RD0D0D0 $0S $a0S@0 @0D00PD0^4P P 9T` $1 000p00! R00!`00a 0 10P8 0  ($1@ !B,00,0 @ada|ala -LM@ @RD0D0D0 $0S 0$1 -LM 0@ `R x0S0x0 R000 00CS0 h9 9laa -H0P$LQ@p ` 0S T@T $Q 0S L@T100CSW00000CS0 R00000CS0 -LM@T  10S @@T@R   @@T -LM1`NP,@Kp0 @9,4 0> 0, h @ `2Ld p@000P<A|#lԾQ( -LM0Sn0Hb0 R 0R  R RmPPw 2nP@g ^aPT T 10HPS 14 T *A0nS& aS @0(T00S1@T,1 h @wSl0S  P$$$1 1U4pP,0p0l R 0S΄ 0 @ 0@wP 0d 0@|@x@t@pi@LaaTa\RXp(,t4<DLP̼400H400$00 0-LQ@P 40Q P $$1 R 000$ 0-LQ@P 40Q P $$1  Q 0 0P 40000$000,0700 000 0-L0\0P   0@\!:JP@0 p-LM$14@ Q ` BPU  p4L400p p-LMP`U6P1 40P. P@ Pp$$1  Q p,0  0 R U4P 40U phP $1  Q p$@p -0P` QL@p ؒpT  В`X  ɒWV  -LMPup@`S 0UP u 0U 0 U 0U P>v 0V 0 V 0V P-w 0W 0 W 0W Pu U TQPv 0V `w 0Wp,0<,0v 0 Vw 0W -0P`QL  @p FpT  >`X  7WV  -LMPup@`D 0UA u 0U 0 U 0U fP/v 0V 0 V 0V UPw 0W 0 W 0W DP u Pv i`wp,0<,0v 0 Vw 0W -L M|   0\   Kq@ T00 0 T -L M|   0\   Kq@ T00 0 T p-LMP`@0S ( T 0T 0T P0T P T EB@@@,0<,0p R0Sp p-LMP@ `0S 0T 0T P @,0<,0p p-LMP`@0S ! T 0T 0T oP0T fP @@@,0<,0p R0Sp p-LMP@ `0S 0T 0T <P d@,0<,0p -Lp`@'PPUK!GP P,0<,00 R*0SR:0 0S 000 >P -LM4P@800a 00CS0&5a 0-0LSP P @%=000 0-L@P P=000 0R0 $1 V 0-LP@P0 0$ ϒ?P,0  0"R   0-L0QP)@1 Q 0P P0@ )T 0D000Q^0 0P |0 Q P 0T@P$ P ( 0@T@PPa -LM0SP`p5 S P@ T  <@S0S0 0@T 0 0 S @TW pP$ @T   @@TpPa p-LM`0PQ \ 0 0Q \ p !UP0UP0PUP40@ PP0000b!P0P0C\ 0  "!0 00 l0C& d 0 "!0@ 0 Rp p[c[c[c[c0 p-LM0(@KP `ᡎP0  p0 -QLMp@G P0 S  0R`0S  0REP,` Rڐ0V 0GSH 0L10S0S0P 0R W   Q0 PQ0ba>0>0  0t0ab0PP0<@0 /000B04 P,, 0S  z -L8C8$M`,PPKS``@KC\, 0 40  0  "!0 00 2C&  0 "!0x"0 RPK@K 0 @0@0 ,@4 00pR000 00 2H@K\1 pǏLpPKM20S@#-Q QPn`3% 7P KW/ 70@PpK- 7"M2 0S @##mSPU`!q p0奎 @K3' 7 {7,@  _74pW 8<@K  P à ]C@TPa`~ pà&X7@K0 S74@@pK 77Yl@B[c[c[c[c0a 0-LP| 0\@ H 0h錍00H@0@- @P0P=9@ =C 0 0P=9@ =C0 0 S  0 \00Z0?B p-L Mp`@PT 0X L0@ 90 0 pP}/00_ax- 00CS01a0@-P@Q9 P7 SM ,0 4 ^- Q \ 0 Q \ 00 0Q Q \ \ 0 Q \ 0$!$ 0S -L M$$@ O 0@.鄿-La 0-LP 0$O/@Z90810La$0$0$ 81081 0-$0L8!PR @$@0$ 810CS810$0(1La -L M@PD^`$P T T,pKX* !, 0 $ (0 1 $ 1$00$0 1$00$0  1$0@0$0 T  0000 0BPP 㺋P , $00$0 $0 0$0 A-P2Pr0@$01 0PAa0!000U8<0b 0110 010@ 1 10 0 10110 010110 01Q d1!4 Q20U 00101 1 0 1(A00C\ 0  "!0 00 0C&  0 "!0 0 RA_1 01 R 100,0,000,040S 0 0S ,07,0,07[c[c,[c[c0D- 1B#20R00S1 11R, p-LM@ $PP `D9 @ 1 0 1! P1 01000 ! 1S0 1,07,0P RPp, 0-L((10 0P000S; 3S* P@00C\ 0  "!0 00 0C&  0 "!0| 0 R0鴾0!8< !S08<1 10[c[c[c[c000 0-LM$@!1!010P8<1 J0PP 0錿 0-LM$@P1 10 1Q#P0 K :P0 1101  !00 S 101 !01  ! 01 K 0 ! 1 0 咊P 0-LM$@P1 10 1Q"P0 PK P0 1101  !0 S1%Fτ"0#1%( 3(F [P -@LQPp% RBP` @ 0PTr 0 R0 b0h -LMPS`p$ $1@T 40S@TX, Ġ T\0P V R$@T 40S@@T,  0P V 100CSPa P-Lp`P# #` P @T U 0 V  V 00V U U U @@TP@ U 0 V V 00V U U Uhe -PLM@ P h p-PLM`P @T U ,0 C@@Tp -L M,A P`p$@ 10(,q$ai%0!<  < !@ !101! 1V0 1 0!10101, -LM@,`Zm t  ^, 0F s1\1 10  "0S00ć $1 RF 0380P0%700, 0Z0 HH20  10S] S. 2 T2  B0 0C\ 0  "!0 00 1C&  0 "!0!0 RoW,   V! ^ U 000l0S  5,0HGZ000Z l0S010=.02S200ć,   20Z00S,10Z00S H0,0O/`0 5^ 10Sm,[c[caP\a[c[c0 -L`!,03P & 6 0@ , , !> S_ $0" 1 S S  |40 0040SB  $1 RHO?, 1 B"P00007P0P0C\ 0  "!0 00 1C&  0 "!0|!0 R {0A01O0 P000, =HpCP00C\ 0  "!0 00 0C&  0 "!0| 0 R, _ P\ 0@!@000W+$o2,[c[c[c[c0, H*010,  -1LMP@0  p$@  $1S0,0 ,1(00 0100 ,0 Y`a 10  1011  !1  1V0 1 01!1 0101q00C\ 0  "!0 00 0C&  0 "!0 0 R0 <  < $ Q001$1(1,1000,00 0 阺oꔤa[c[c,[c[c0 0-P@L4 0$24 23 0h괿̿ 0-LT, 0*00@0, !@P0h$0$PP>, -#LIM0,  ,0 `  006:D R @0S pß,0 S `,N00A  D@K 0Q0P0Q  01#30K- 0 @ ` Pp 괐JK  0Pp80S p h0 @W \, $164d JK2P@CK0 0 JK 0 !,000R/2,c0 pK|p 84$tp $1|@K\0 (!Tp X 06P0 &L  Ơ0H 圍Pp|0S'T@L0TJT@ P ,0  Ppp P`mPp L0T@&@,H0P "b 0 pp`Xp  0Ppx, P@7[0  pPPp*,  (0 R"Ꜥa`b>, - LN -LM@P`p-T0EP@S2222222222222222222222p $ 1 01410ᔤa4 1S01 Q0 0 0S00 0S 00 0 P -QLp`0S @PU 0 0C W0SUP!P P 0 e00 0@epe0 SP 0 0S  z 0-LM0PS- 0SC)@ 0R0 0S S 0 B0 0@0@ 00 K` „P 00 P0-LP@T*@T:YP 0S* !0S:0D00/ -L@`p P>P0 Vp P  00 00S0@ R0000 0  p-LMP @T @Tpp@T ` R0000 0 V@T 0- L@PP( 0 S600, $0R0000 0 , -(1(qLM0 P P 3a@T @T@00C\ 0  "!0 00 0C&  0 "!0d 0 Ri錷0`@T @T[c[c,[c[c0 -@ML0(( I@# 0I@Ha a -LDM0`SP\` p 0B Sz!XK!P@DX00C ShD:;;;;;;;;;T0娡 S PF\  0HP@`"X*\`0 \KA0TK 0 @Q X0 )T  Q  S@ \ 0P@  0 \K 㾂P@`\XTP-D@wP@x<Halj, PE$m(P -LGM<\, P`p @ 0B9S9x=T=x=T=T=T=T=T=T=T=T=T=T=T=T=T=T=T=T=T=T=T=T=T=T=x=T=T=T=T=x=T=T=T=T=x=T=x=T=T=T=x=T=T=T=T=T=x=x=x=x=x=x=T=x=T=T=x=,0 S ,0BES񟗳>>>>>???$??@8@H@C\@XDl@@LALAt@@@@XDXD AAA$A,ADALA`A`A`AtAAAB(B@BXBhBBBBBBBXDXDXDTC\CxCCCCXDXDXDCCCC D<:04,4 0ğ0 L@nP00W00SP 3 0u 0p3cßqßoßm3 ̠|ße 0[ 0V0 S<0U KOKE ᳁PP3Q 2R  04L 0@2 2 (2 "0L 0^X"T"P"(2^ 2R  0kL 0*ANK 08 PP8!0BSR L 0@wx!t!p!l1 Ϡ7L 0eL 0^L 0W  0R 0PPeL 0F?-= AꜤa,XY?TY aHaapaa `aalaY41813|a,aa0$aHaaa,0++-adaba$2 -L M@ \QP@@ 0L SEEEEEE F FHFFFFF1 -1!0 1!06!0 0b6 :PD10S<1P$1$!l0   A 0@@00S $KP $0-阀0S p0 pP0dSd00SV Pa_Rc!̄_c,Ra,taDa, p-LMP@`  0STRPPP  0T0\00S p p p -PLM0 @ 0 SR0 \K  0 @0@-RM@P 0-P\ \Ѝ0Ѝ0@ p-LMP@`  0STRPPP  0T0\00S p 1p p M-PL0@ 0 SR0 \  0 @ -LMP  -LMP -LPp` @+U  0S*T S 0Z030#WQ$U T 0S: J0W0P00S ~0 00@SC 400@C -L@`pPq+T 0 S:U T   p-LMP@`P  0S:T\P P ~ 0T0R00Sp k~ p p 0-PL@P 0 S:R 0\  ~P -LMP@p`& V00P ~P P`FU@ /V0 0`F ~P0@PU0h00h  002y?aa -L$MR, 4 00 8 p04pS,H0 Q ^0S`%@ D0  P4 2< @T 10S UgP$OPPPQ$QO40S" @T<0S0<0 @2 , R00 0b0 Z0 8 R 40S  H0S @ D0WS@ 4@ 4%R%.#~PD0@ 0CpbD0 \1W8PR/~PR8/}P{GpG,0 $1 R$1 0S 40,0 $1 0Sl00 Q0 Q Q0 SSPS ``@ k@08 D0 R0aa p-LMP$1`   @P 0S*1 0BRSo0 @0S0c 0($0$!018,C/S;* X"00C0H0S40\2$1 ?`"$, ?  R; l0h2x0S0 1l2|0p20@S$1  Q020Q4%0 @@ =/@@ |B&%0 @ %0/@P P0p0h2,0d@S$A,A0A8ACf%XBR{ -LM% U%  0 @( 00@ 8 $0@ @$H 0PP@@1X@ ` (0@d0, h 40l0H0S40p0$1 0S40t0$1 |@x 0 @ 000 00040o)0 -$11=, / $1 R* l00x0S00|0|0@`00 @ 00d ̊ h0B0 ^  .0@0 1!$!1(1 !,!10#03O/ M? 3 * N*$1 @$1 0BRS01111$ 0 R`00`0$ 0 R`00`0 R P  =100CS> @0.00S0t 00K z_!08 K0 , 84001! 0nO 0rϊO 0vO 0~oO Ί 0O  $0冏O !(0O ,0O 00O 40O 80O <0O @0O D0O HP00 TL0L!0S,0 =9C =C0 ,0 , 00 2$"0 00C0,0   (41 !01 !0@ ,1@1  00 00 >!` `0X Ql0V/@. )003>6?B12 -QLTMPQ0DSaP U 100CS,0   f  000  80K`0 \ H D T P0K p`KX @` < XKFP`T  40 T T4,0p p0 8 0px x tP 1p  0APd l 0wSu*dKt {P`rxP K0@@ h0K `0 `0KH \ X0 T D < XKP`[h0SS  PK: @ #: Zc`KX `p \P T HP D < XKP`@P@*0S @T:0l00S0*d zP`* d0 T h0d 0h0   `zP` pd0A0 d0 p x0t0Qx0 t lR:0l S: ` L(0dKt d0 z`,0  {TT070- -LM, @ ,06Pz0S} b PU ,&PUPiPb2|"@`@  @P2  P@U`@ p ,0"S0f "F'v&,0 @ `C(4 8  @ 0H $ P ,0X 4 ` <0h D p0L PTpUV00PC00,0  } zT 0PU ` ,0 @'4 8 0@ 0H$0P ,0X40` <0hD0p0L PT`U aaa,,aR8 -LM@-QM @P\0 PЍD0\ 0S \ 0P Ѝ@,, p-L M\@` Q 0 ]ppQ0 \"\ 0 1PU P P 80K00,0 0080pp 0ppT!  `lP0 S0@@0X@0WP ,0 0R,0w  10r [PUdl0Sp  1 @00@0 a0 0C\ 0  "!0 00 l1C& d 0 "!0@!0 R1414!, 0 ,0# =U,0 W U  R ,0 10  PU $ E00P#X pUl0S010\PpxLa_aa[c[cxa[c[c0xaa p- PLM`00@00l R 10S, 4,0;,0@`00C& R 00#!x000 d0C& \ 0 "!08 0 Rpph鍫 [c[c[c[c0l0-SL 2?\ 00S00 0Rl0xa -1唡LM0 0P0t!0p`@T l0S+ @T4A0 0C\ 0  "!0 00 0C&  0 "!0 0 Ro$ l 0`FS10S0S,0吀010 ဆP P000V8[c[cxa[c[c0P\aP^_a -LM 1r1/AbP( $ (@Kʨ1 RQژQ0P\ 0P1 xb#hh!`(000 b0 0<cQ=9 @ =0 , ,0 0 ,01 Q=9A@ =C`00 0 C\ 0  "!0 00 0C&  0 "!0h 0 Ra}0QMb~<auPK 8uP -L M`P (K %uP(!2a3c$0SUd!`10@1@ P  ,,!(0 q000 0CU!0@d\@@P 0  "!0 00 0C&  0 "!0 0 RQl0ϠBl2l3c13D 0( CuP, [c[c[ca|a[c0C -LM0`S@cQ1p(  0S2 4KŒXAp00C\ 0  "!$0 00 1C&  0 "!0 0 R t霨0Sx x000hh1}8,0  O?Q0A 100aP\aP^_aD `0< 0 0S0#0(0 R0 aP\aP^_ p-LM`0@0$S$0# `0P00`00P0P0C& R 00#!000 t0C& l 0 "!0H 0 R01S,0 և ƇpS[c[c[c[c0@-@@@@@@0 00 00@-aaaa -LM0@S`p>0S,0S00S7  0PS0U 0S PPp0Si0h 0T0S <4sp0( -`| -QLMp0 4 ( ,  0  Q0$ ` V P0S 0 S 0B8S$P0S`V0 R ,Q $0S PP0,`@08JC8 1!Q4K 08SVa - Q-Lp 0  Q0`V @0S 0 S 0B8S$@0S`VP08JC8 1 !Q 08SZ00a -LM|P04 H0( 0 `00 ,0 $0 JPp0CHAA0YP4K 08S,  -@Pp L4`V 0 h$W  0&- p-LM @`PU 0 ph p -PLMp 0 QP @@YP` Q0S00C $@@00 PW2  X  0P @0S S $@0SP e 0R0 S0 0R,0 S00a a -LM`@/PpU `PPN 0 S0 (0 @00B 0\! P7$` 0\V@@Tʄ@T@ 3P fAV 0 !R0,0 g 0V|tW 2S00S   1S Q$8px -L P@p0`SZ 0S-QP V`0S S1 $0S R 0(10  0@ % 0A  T1S RR 0000S Q0 0Q B 0 R00$P  a 0- 0L 0PS-(@ 0 0(0P (@ 0- 0L 0PS-(@ 00(0P (@ 0-$0@SPL @ ;P4  0@ P0 0h'w4ah -xpL@`T 0P$ R U@U00000 a 000a0  B Qa p-\0LM PR` $0S@ T  pP a p-p0LM PR` $0@S T pV V -P Z>a -QLM@0Q 0AT (00@T,00,0 -LM,0@0CS,0  0 0Shq -0LM@ 00  0@@a-$ R$ $@@0^*$0S $@ @0S:$0S$$$@0^:T T0S$0S$0S$ $@0@ R:^:T T0R$0S82P *0P ": -LM@D 88#| , `0 aPDq <8q004!01`  ,0 0< T` R6Z `T<  B?+$X Z 2 8`J0 0,82,@`<P* P< (0R0#l,0  0 aaa P0-LP P0 RD0@T ,P @T000aa -LM@ @0900000 -LM00@S(  en  i0 Se Rd `iH00< @0 00 0@ ,aaa -LM@! LR 0@00  0 $0 BR  laaa  400Sh40% -LM40@0CsP40B ,Kh(0, 0ahS00  `=94 = B4 00 p004 0pQ=9A =Cpp 000K Z UPX8@` p@0ʏ 40K*IH0P@ ,?B< 0 ꔤa 0 ꔤa -1Qp  80PXLH`@ @`詭0p0t0p0p0C& R 00#!p000 \0C& T 0 "!00 0 Rkq[c[c[c[c0 -LgM∑ 0,0 A$ D!(0("4400@$04 T` 0(r$!@0A* p P0 200-K0P$0*K?K "R .K 2 S0 S |Ax0L0 ,0S \,SL00< K4I_a\aq_edA<s -LM ZP@Z/ 0 00  $Ыث4, R  00SS S 0 R$0t$0\t-  0_aT -LM`@pPP   pP0D 000 0  0@-_8 0S00 R0 00  0 __ -LM@PP `Vt QpPk1 ^ 0S^ ^0FS 0< 0 -^6 PP!00D000 0C\ 0  "!0 00 0C&  0 "!0 0 R0 p ^ 0 !^ 0S 0\_a[c[c[c[c0@@ R4 000 S00 __ -L M8@4^ 0 PS00_a\ 0-@0L@PT P @T00_ -(0LM@T @T_ -L MV, 0 XP. ,PG@0U 0(p$`,` 0 S0 0PE U `, 0 0 X0000  0000t 0  #  KP@ 0-@LTP  @T000@T R000   00h -SL`P@p0 0+ 00S00C 0pQ  0S W 00CQ 00@@hRW 0R 0000 F0Q 0 R  B 0S00@@P -LM Q @Pp`B: 0VP+  R 0S 0S * R 0  0004 0P  # h -L4M@, `gP0 @`aT@ P T P 0Pp0C08 @8 T@ < 4 H :P 0S*P\ 0S: 0aPP00@P ppLp D ,Q 9*R7 0S# P0@p P0iE0Pe0W 00CB SX 805 :XpW@  0*R8S0#03 BR0SbD0 dR0S f|@R0#03Q0S@ <@ 4  Pp0eP00@TG:P BQ?:,Q< 0S$ p @P00iHh00U 00C SH05 :Q @ B ^X 0 :,^HPS0#03 BR0S8pL0d0f s  *@R0#03^0S@ <@ 4 L@0 0Q\<@4  000 0 P"  0#0P 0 Ph0@8 L 0 h -L @`PBpF PI \*PB R?T+ 0T! T U *0DQ 00 pp000Q0D 0W  U*00 U R000 Pp  Jgp -LM0@`p& PPpU \!0W PP  P @R000 P0`  W p`00C\@ 0  "!0 00 t0C& l 0 "!0H 0 RT00鴖h[c[ca[c[c0 p-LM `S 00F  00 R 0  000phA!P 0 00{P0P0C\ 0  "!p0 00 \1C& T 0 "!00!0 R0 pX0 0S0 0  @ P 0 00;P0P0C\ 0  "!p0 00 \0C& T 0 "!00 0 R ph[c[ca[c[c0 -PL M@ L 0@@T  @T >  Q0-L@0PA 0R w x0 0 PR0 R P P0000 0S0SS RRaa0aa-0x0 R0  0^0\\00 0RP00aa0 R00a0 aa -3LM0 3P p\`쒟O B00C\ 0  "!0 00 2C&  0 "!0t"0 R'000\  AQ 0 `\ @1@!T DP` 0Q 0Q`0S)@0T✑!6@3P` 0R XA00C\ 0 !$1 0!C600! 00#!0 0 R@00C\ 0 !| 0h C600\  00#!0< 0 R#[c[caa[c[c04 -0@LP0A p 0 Sp) `P00C& R 00#!000 p0C& h 0 "!0D 0 Rw![c[caa[c[c0 p-LM1@sP` p0800 0< 00 00 0@0C& R 00#!000 l0C& d 0 "!0@ 0 R([ca[c -a[c[c0@-0@0 00Q000 0 S0  0S00@00C\ 0  "!t0 00 `0C& X 0 "!04 0 R@ۓ[c[ca[c[c0<0 A P 0-0@ LRPD0Z!0u 0hM00000 (0aaa1 -QL@X F1Q |1Q l1 \\10 Pq 0 Da $PB0 0C\ 0  "!0 00 0C&  0 "!0 0 RU0 PPT0Q 0Q T 0  0 0S$  00000}ff@wt@a[c[ca[c[c0~fvt00  -0L S@ 4H\p 000000  xx dd PP << (( ( ," [c[c<@-0 S@ &  00C& R  0 0#!l000 X0C& P 0 "!0, 0 R@角[c[c[c0 0-0LS@P00 > 0R03:00S 00 0 0P000 0 0 p-LM0PS`  0R:0S00p@00@0@-,M@ 0P000^03:0S#\ 0^ *00  0S   @00 00 00 0000,Ѝ0\ 0^ : 00  0S   P0@-0(M @00 Q \ 00  0S  0000 00 0000(Ѝ \ 00  0S@0 -0pS0`0C0D0< L0bD0 R000Q  0S00``80 0C 80 hM@h0p)@0P0  P0P0C\ 0  "!p0 00 \0C& T 0 "!00 0 R r[c[c_[c[c0 -LM `@|V`Pp0S:000 0`0{ 0@0 0WpUP@ 0  40 Ph 0 `0L 8,0d$pT`DH000P0 RS 0 /">CXh05|%03h05 5P%(PB2|P5p% ^`(Y`d0<0`^PlP t0RxPPPPPPPPPP 0PP00 X@@XP0\0 @X (0 Pc<<L 0 P[ -a_a0-\d_l -LMX @R\0T \0\00X \0 P PQ  Q4Q0 (00  0S00_0-  p-LMh0|0P` p0@0 0000@0@0C& R` 00#!p000 \0C& T 0 "!00 0 R F[c_[c[c[c0 -LM`L HpP~ PU2fP@  PUT  L0HL 00T P d0` 0 d0l0HL 000@Tg R0000 0 D H0 B0D H0 R00C0 R000  R 0PP0 00 S  R000 R 0P 0 P0b0D, 0Q0:.0S"0Sd0` 0 0S0hP 4+HL P*]`% 0-L(MT0h @ |0Pp0 Spa\h 0 0S0PPP 00C0D00 HD0d0P A H 0d0 R000Z0P!04 0S0T0  l0 R000  R 0008<00CP 0 R000  R000<Kp 0 S:`Pz -<@LAPb_P`@-P@  gpWT  00V000`F400 R0"40%T i -LM0$(S00pP 0@`p `@ h0) xt 0Q0xxZ0@ 0j@<D00@pD0 0@0 p@@ 0@0 S80p0S800p -D ,0LR@p:PP  `VU  0D, 0Q0:U p0S000 Q0-LP, <@@D ,0R0:0 Q0-PL <@@40 p-LMPH`Q`3:Qq 0L`` <@@yv4p -LM0`S~@0T80  @T,K PU 8 00R8 K @,1 d@4 $0pLc^=9 =4p 0 00 40SKPX8P LqP R000 bh0p 8PUF @0000@0@0C& R 00#!000 0C&  0 "!0h 0 R D0<,0lS:{8-[c[c_[c[c0 p-0@LM P0Q00 0S0 00`PP00C& R 00#!x000 d0C& \ 0 "!08 0 Rpph7[c[c_0-[c[c0 0-@LP 000DP0P0C& R 00#!p000 \0C& T 0 "!00 0 R00h[c[c[c[c0 0-LM@PT $ 0@T0 -LM0SPp` cSlSpS0`S(h@ $0`@T,L<D H0V 0Sh 0SL 0S00S7X h0( Z% X"  0,`V  @P PU@Z`VXXH(4h  8<Lp -L MT@0`VP  h0 Q I` 0`BpW 0`V R @3` 00p`*pWhh( p-LM@PT`  P@T @T  P@T@T  P@Tp-$00 (0,04800  0-L@PG R0000 0 0 p-LM@`P ,08 0 B8 ,00C ! \0 0pP 0SP00000=PP 0Sp( P `p -LM`pV 80080 0 1R 0 0`V 0SK`V,A,1P    P0P0C\` 0  "!0 00 0C&  0 "!0 0 RViL 40 040 00 ``0S`[c[c_[c[c0 0-$0LS@P0h( -LMP`Upb 0S 800C80 0B! @P 00S$0SM0SY> 400C40 R000 0 0  R000@ @0@0C\ 0  "!0 00 |0C& t 0 "!0P 0 RZ Pr([c[c_[c[c0  | -LMR@p R0,0 v nR 0Z0QQP1! 0P00 ,00,0 P U Pxa00C\ 0  "!D0 00 01C& ( 0 "!0!0 R%Y00U00SP P ,K BVP `0 S %`%!* މRZQPZ00Q0S [c[c0-[c[c0 -LQTpL`0S C3 1@ 0 00@0@0C& R 00#!000 0C&  0 "!0| 0 RZ选0S P [c[c[c0 -LTP q 1`   0@ @T d0 .X@T00@0`00C\ 0  "!|0 00 h0C& ` 0 "!0< 0 Rh d '[c[c[c[c0 -pLP`@XX^\0\0\00X\ 0X0 \\ 0  `\ VV000ᆇ0 L ^+c0圆+0  QdU0 c0叆dU -LM@ 0@t I --LMxP0Sp`A \LH0 R Jri^(@ 0@a<-_ -LM@0 HD00S S (SC^hJh?^- --!LM AP00`00C 0ppP0P0C& R 00#!000 0C&  0 "!0` 0 R P0\ 0 `p&[c[c[c[c0a p-LM`0@< 4PK0 o0\ u40[S  c0S >\ 0S ~p霤a --1LAMP0` 0ppwP0P0C& R 00#!000 0C&  0 "!0d 0 R T0\ 0 pDꩇ[c[c[c[c0a -<1`@P,1Pp  U00SL 10S@Pp00U00S&$10V00S VV 0 RW 0V0Q00Sh\T0\/PW  0U00a|a- --L0LM,  $!0 \ ꔤa,0 $1  R000$!  P 00CS0 la -p-LM@TP` 0S 02p )P P` --LM 0 --00LM Q0rx -p-LM@XXP 0`@^00@ R `p--a p-LM@\PX`  0PP=00@ R Pp--a --0 L M@T@ K ( T0   -L M@@T ( 0 K T0   -L\Mϟt  Y  0R p h P l , 0 h p H X H0 %PP p H0W0H0 X0 0  X0  pX00Y00S 0 H0 0%SSRO HT \  pH d ` H L H L  0BZS1l   h   $  T` 0 x P`\  \ \  h`d `0V`S`T`T| \ @fT@Dp PX0W0  X0 p X00Y00SP } T@D`Q X  X p X00Y00S` e |\r dh @bT@Dp 0PX0W00  X0 ` p X00Y00SP F T@DhAqh  p P0W P0 X0 0X0 > pX00Y00S & h  Brh T0 \ @fT@Dp PX0W0  X0  p X00Y00SP  T@Dʯ:X ,0S ,xMKI\@fT@Dp 0PX0W00  X0  p X00Y00SP  T@Dm(`  #cT ` X0p 0W@0X0  p X00Y00S  XTX p X00Y00SL009L  D@Kx(0`x D0[ Sx  p X0W0  @X0 pX00Y00S v 0S ! x0@Tx0  D !0O0Y XPp <,WX L pX00Y00S O x 0@ TX0W0  X0 1 p X00Y00S@ 6 x0@ Tx x@Tx P X  >X p X00Y00S   jh  dx 0 Sx0 Sx XD@K &bD@K&_`\H 0  H0 `0 HT T 0 0 SH\0 ܥ0c\0 H0T T H+0 H*QH L  L@00L S H L1H 0 L0 RL 0@C0Tpp0 @0Tpp000 HT0 0T0 @HL 10L 0 B0@C RH \@ }TT T  m 0`00 Vb WT0dp 0ãT0 d00Q0S-0KP0  R0 :R 3P0 h l% >P &B`PbP P(K 0a0Ch0 1!`PP0aP T  00S000aP V0 P00cP0 0 "`PV PP000lP  U- Pu`` TT @ 0 Po0  PoTT T  0` ` wT00   T@0 00  0 P`P`T00T0 T  0`  T T@ 0 P`0 0 P`Xl T   0`00 T 0 00S T TT @ 0 P`0  P`0DK P 0 h0 ` D KH0T @H lR H  TT0 0/T  0X0/ +Ꜥa <PXT 0X 0 T@ 0X 0 0 X0 0x0Px0L0 8 PuoL 30 T0P` l 0x T0 L 8H  V 0S# T   0`00 V0 S -Pu`` TT@ 0 Po0 0 PoR, T!x0 l L0  0` T000S T Vn-0Pu``0 iTT@ 0 Po0 0 PoL R D0KD KP0 h ` /t0Y00S00P0 P 2R W P  P PaPh hp ` PHh l  w -L% -@LM 0- @LT0TP2000@, 000  0 0 00Ƒ@0@0C& R 00#!t000 `0C& X 0 "!04 0 R0E[c[c[c[c00@- 0P^c: 2#80S$H*,0 9,00 0P\a -LM,0P20#0R0Sp` 0Qc : <"K#80S $H:@@L0S 2[02KDMP ៑E-Ƞ@0Sp0 p `P@ 0@s  0R0 s$0@S$P10 R$0 @$0@S 00C0--- p-LMh`@qP T0T Q 0QUqU@@0p_0@P--,0, 0$ Q 0÷---\a -LM0(h h`\@\ 0 0S<:80 b000 4a--\a000 Q 00--\a- 0 S-L< 800( S $S ZhV-Dr -t0@LMA \E0S  ,h8$6h2 -LMA0@Q!ڀ!0Qx @ ^d!00^G@HTHi P`KPhKA\ d0` h0P=9@ =C` \ ` \0 D >P H >P yL >P r@K<0K8 KH0 40KD X0 0 K,0K@KT P0 L a[c[c[c[c0aQ?B -L$M, ,@ p8 0 4 < H H 040ZD 6D2a0S0CP8c% U#UP@,  ,<0,0 R,  1@ 1 @ 1,0( 0C,0  Z<0H0S<0 H 0@  #E 0-04PLS@ SP0鷨P l 0R0000a p-LM@P< 0C0P04 A !P0000l 1R, ,0@@0,0`P00C\ 0  "!0 00 0C&  0 "!0| 0 Rpphr10S !D0(  [c[ca[c[c0a -LpMW,0 P`*0 S0!P@  ,00,0 ,0( 0C,,0 0Sp`VP:,0pp 00 -LTM0d Pp0dS0!h XH0Kp0  Pl dl p=PP *p0 R0:z 3 PKBa2a11J"c11L0 P PXK⮃L T0PX0`#PP L =9@ =CP L0 t ,0,#@0`,0h0p nh0Sz# X@KቃXP0\ P K`K\ 0`cPl=9 A =` ` \ ` \0 2Rڄ"002c2c3t0 lRl2@0  , @ 80S' W0SD00CSD0@0 (0+Q @0$Q0S WpW Q @@  81Pt @0@0@(0@0F<@0@e :p@ < @0^ <@00Y*0#p@@ 80Pްt 㬎@00@0|| 0Pp@0 p@0@0@0@0<@0a0Q$ 0Q |0Q 8000T0Q L0Q0800S@0@000@0}ff@ s@~fs -LM$@pA`|0 Q>x  0,0CS0 p|||la -LM`lpT0 O \I\9夠 P000K<P00C\ 0  "!0 00 8C&  0 "!0(0 R#  0@D  D @0言 $P ";p05i  R @]P0SW 0S PC)W}p ^W~p\W; A0GS p  @ p p  pWpW p 0Wm0!0<"p! uW Z?x }W Z00xW W W{Wt 05 0 (0r05WY   ^DAp09_(0S-@20W0S 5   x0ph 0@$  $ 9h[c[c[c[c0paxa#q_\a -LM p0Pğ 0@d 0 d HP X X X X D a0HS H@ > 0; `0HSwwwwwwwwwwwwwwwwwwwwwwwwwww4yPq_ -LM0@  (0 P0S0 -1aLMp @ P H0Spp% 0  0S H0Spp 0  0S p 0H PP @p00C\ 0  "!|0 00 h0C& ` 0 "!0< 0 Ra[c[c/[c[c0 0-L@PP 0 -1aLp  P @ (QSQMp0 >;-p0.( Ap00C\ 0  "!0 00 0C&  0 "!0 0 Rh`mp0! <!p0HQHPᬵ=HP  ( [c[c[c[c0q_ . 0-0(  SL@P* Up0@0  (0Sژ0  P H0 P 0 0S0Pp0@0p0p0@0p0DTp0@0p0 0-0@P L p00p0/P0P0C& R 00#!p000 \0C& T 0 "!00 0 R00h`[c[c[c[c0 -0LS0 -L  -LMp@  0 Q   m ̌1 0p1'P00C\  0  "!0 00 6C&  0 "!6  Q0S  0006 ,0S D,÷9\P00C\ 0  "!0 00 5C&  0 "!5  Q0#  \`P00C\ 0  "!,0 00 5C&  0 "!4  Q[$P00C\ 0  "!0 00 l4C& d 0 "!44@  Q0$|0$ R 0 XRd 0U 00aH0 S/X X!ڜ0PH /=P`0ß=p0Od P d eʤ0H0 SXh0 XR,H0C^"P0 B H0 S;ژ p"2HpP00C\ 0  "!t0 00 `2C& X 0 "!(24  Q 00S#0+[P00C\ 0  "!0 00 1C&  0 "!`1l  Qv [td!?0PX_]P0pH|H0 SmxdR1d#pK P ?  , ' x0P$ 0! 11F0S  㜝x0@ t@9P0  q0ZꜤa[c[c.[c[c0aha/#.a -LM 2P0S@ 50 -R" B?D0CST@0?0S @   t  -0B= ?  8CRԡ!0p000p 50>*,Kmp =P@ , hP@0p 5*DA0p 0 0C\ 0  "!0 00 0C&  0 "!0 0 R-=`b0V``V=J`VZ Z0@   p0  :p0\#[c[c[c[c0 Q0-L@PA  UPE0 -LMPPc ``1 (`(pK  P@ (N P@`P@ (= P@p0@:p00 0C\ 0  "!0 00 l0C& d 0 "!0@ 0 R0>0=rY[c[c[c[c0 0-p0@ 0L50 "20#0 P0S @P 0P0PU00S P ^U?@0hU0 -LM@p0 6t hyx0s S0s-t0 A!`?̠0 S S \h\ !h3 3#2 11>gfffON -LM`P,"0$"111;/"b111A|0St xQo @TPi zPP@@T10S4 S1 1R0 0l$K0, Kၖ HAN=0S 0 $00!0 $0 q?B6c$ (N=0S(0 ,0 0 ,0 ( (0?B6c, h01c1 @R  1P2;P 0 <0(/0"bTo uDi cQ4T\hp?BHhP0@-0 1@1P0 SR0C BSRP 2P# 0DS00 ER  R R 0R0S,  ,00 4 40R0,0 R4 40R0P` `0RS -!qL`0@ 00p P( (R3 P. `A`00C\ 0  "!(0 00 1C&  0 "!0 0 RW @`00C\ 0  "!t0 00 `0C& X 0 "!04 0 RW[c[c[c[c0 0-LMP  0NᎪP>T00  ada -p1pQp`L 0 S@ 0> 0H 4q`00C& R 00#!000 0C&  0 "!0 0 R  ( H t00 h @0T0 0@C W@[c[ca[c[c0ada p-!LM0@0C0 hQR 0\10  0 (H010 ` 0 b1B&! 02 S41b1 R0@@00@@`00C\ 0  "!0 00 0C& x 0 "!0T 0 RpphV>|da[caLa[cPa8a[c[c0 -0  L~0 Q l00  (00H >1>1=1p00|  x0S0 0h0$0(Qdaaa -LMQP`/00CS @HPX000 Pi-p0l0h0PpT0T@ 0 啣 pxaha\apadaa -P@pL > 0E/>1 `W>p 0 0P0   -LM0@S0S000A?m>㺇g>㴇 p-<1<LMP ` @T Q` 0 0c/.!1CQl 0S0000DS00 0@P00C\ 0  "!t0 00 `0C& X 0 "!04 0 Rp~U[c[c[c[c0 -p1pLMR`PpL0S 0\@l0% @l T@ U00S 00`d d0Vp /0SS@0 00 0C\ 0  "!|0 00 h0C& ` 0 "!0< 0 RiU0[c[c[c[c0 -1qLM @ `^ QU 0P e= ^N ?>1L 0S10`\A00C\ 0  "!0 00 0C&  0 "!0 0 RT^N 0\` ^N 0 0H`F V0`bк[c[c[c[c0p@-H1HQ` Q000 0 QR @0Scc \ 0S00 ll 0Q  RR  @`00C\ 0  "!p0 00 \0C& T 0 "!00 0 Rpp@CT[c[c[c[c0 -P"PrLP0@ 00 `R^ R0SP 0 0 0` 0 @\   ; ?>1 @  0 0Q00  0AP00C\ 0  "!`0 00 L1C& D 0 "!0 !0 RS?>1 @  P0 @P00C\ 0  "!t0 00 `0C& X 0 "!04 0 RS[c[c[c[c0Rp@-@) 0/.PaCPL  10C00&0b 0R000 Rp0a # B0!00p?>1 A! p Q-L`Pppā!000 R- R0SW 0 0V$ R! 0 @cR@cT@ 9`dPp 9 00S 00 0V  R@0 0C\ 0  "!0 00 0C&  0 "!0x 0 RR 0 AYD P0[c[c[c0@-0@S 0 00\S Ch0P 0\Q 0 0c/.!1CQ<0 _@- `0R   00\ La/.!0AS1@ _ p-@1LM8@ ` R 0S00C0 00B 0Q` 0n/.!1CQl0S0 0P@00C\ 0  "!t0 00 `0C& X 0 "!04 0 RpER[c[c[c[c0 -!LM0p 00 RAI 0S 0R/ A0 0C\ 0  "!t0 00 `1C& X 0 "!04!0 R,p Q@D`KPDK@0 0C\ 0  "!l0 00 X0C& P 0 "!0, 0 R Q[c[c[c0 -`,0p$1P LP@U @ j 0ck @m -LM`,0p$1P HP@U j 0k @l -LM`,0p$1P HP@U j 0k @l 0-LM@,P$1 P \0Q T0Q  0Pk0$1 Q 0,0000at qt @-,0@$1 00S   @yk@ 0-1!LPS 0 0S-@ T* 04@S!T:PU R0 0Ո0@0@d@ ll LP0h aB0HEhX_aa_a0|a_,0 P 0SPa -LM@P  P*0S S 4P: p-PLMP@` P P* R T 4P:p0SRV`0Sp -LMQP@!P P P U \*0S 4\:*00S E 00*Am۟ -h0LPpU` @ T*0S4@  T:PUa p-t0LMP`U @ T*(04@S T:PU(0ph@ a p-|0LMP`U @ T*$04@S T:PU00(0aph agfff -PM@L` 0|p@@`p0 @X 5 100]$0hXa8a@(,0 <0t$00a - 1 a ! pP0U0L0 @ T*,04@S1T:PU@p00C\ 0  "!0 00 0C& x 0 "!0T 0 RD 000XO [c[ca[c[c0a -1LaMP p0"   0P00@T܀  Q101!  p00C& R 00#!|000 h0C& ` 0 "!0< 0 RO[c[caa[c[c0 -(1L$aMP p0"   0P0妾0@T耟 $ Q1010  1 p00C& R 00#!|000 h0C& ` 0 "!0< 0 RN[c[caa[c[c0 -81L4aMP p0"   0P0O1@T  Q101!  p00C& R 00#!000 0C& | 0 "!0X 0 RT  VNN[c[caa[c[c0 -!Q p0!00L 1@0C1N 8P<0<0< 81 0 10 `Ap00C\ 0  "!0 00 0C&  0 "!0 0 RM (0S $0, $4$8پ [c[caa[c[c0a P-L@I a吡吁qP 000! 10C1O 8P<0<0< 82 0 10 $@墾P00C\ 0  "!0 00 0C&  0 "!0  QTM (0S $0, $4T$<d= [c[ca[ca[c0a -1aRpL 0"   0Px0 P@ 1\!1 101,p00C\ 0  "!0 00 0C&  0 "!0 0 R T 1 =)01!$ 00!X 0h0Ó P !L[c[caa[c[c0 -LM -LM -LM`0 p40 < WJQ1  < W V8J 0W:pcW`0,KZ,0 8 V7 4@ 0 \"  ePP $ 101   !ᐔ@00C\ 0!!\4\ 0H$C6000 "!0$0 R8UP <P 0!0g S 0! 0  RW0$00$3 0008!818P8 0<`1 0S 5`1P1l0:@ 00c|0 S01W01R@1@! > 00 0 d dR0 0pd0 UX XPO!000PXhAh1p  \ йP` 100A00C\ 0  "!0 00 0C&  0 "!0 0 R?0  0Wp Pp $Ҷ[c[c$[c0 -LM0  0  -$1$ALMP ` 0; 00    0 5`` 0`pP00C\ 0  "!|0 00 h0C& ` 0 "!0< 0 R+?o[c[c[c[c0 -LM0@EQ!` 000 1 0 * 8p@`00C\ 0  "!0 00 0C&  0 "!0p 0 R>YP  0p-[c[c[c0 p- @LMP 0 000 P0P0C& R` 00#!t000 `0C& X 0 "!04 0 Rp>[c[c[c[c0 -1ALMP  9p 0  0%p p`P00C& R 00#!t000 `0C& X 0 "!04 0 R@>[c[c[c[c0 -L,M0 00 , 04 0P0R8 H0 @ 00`p`W50 0S. D  0 000D0 80S 0S 40040P @ 0 :00: 0  0倐0:0,,,<$ P 000000 P0 0   @ 00R0S0000  C 0C0S H0 SL  0@WvVs@Pp@0/ 0ORQ8Q00S H R0@0ZZ: P0 0CP  0 0#!: 0 C60 0t: 00#!L:X Q@,0K<0 `8Q ,@Tk: 000 "PP 9 !!$ !0@@1@ @) 0 0CP  0 0#!d9 0P C60 0@9 00#!9$ Q&܀@@W00 Z00SHX00Z @@P d , T00R00S 0d0  8 8 P @<0P, `p000dW4;70770L `00C\ 0  "!0 00 1C&  0 "!@1@  QZ [60x7_#|@L 0@@4 0   @Pp Q! 5}pZ00W00S@ PT E p-LMQ@P ` Q p T  0pQ -L4ML@2 @022P02[tat!p 000X2022GPPK0d2[02,0$0@p00C\ 0  "!0 00 0C&  0 "!0 0 R 0 00S<50,2ᚊ)[c[c[c[c0 -LMX`p,0 P \ 0 S*U* ,0K0 0R ,R "R RU 0S0 R00000 \ 0S ,0K0 0 P R R@R1R: R R  R RU 0S :G@0CT@SBC4CHCd1)P| 7 P01PL0T@0P0T\@\00RU 0S@000 00\04  ` UQ!i401#8S#00Sl0W  P0W}S 0S 0S S bP1T1 -LM^P@p \ 0S*p 0L0 T` 0 &T T T B0 00`T@T  TT  T 0 0000T8 0T  T0T 0T 0 P 0T 0T 0T0xP 0ᴫ@ᗫT0 3 003\  -LM@@ D0<vl@h p-LM!40r$@ r p0L@0080 0`00$ P 2$0200C\ 0  "!0 00 t0C& l 0 "!0H 0 Rp3(0|@11[c[c[c[c0$10@-14 @0$00p0S0p0  Q0 0 0S00p0PS707@00C\ 0  "!p0 00 \0C& T 0 "!00 0 R00@s3[c[c[c[c040$ L 0  191# 3S,000\0Q0@-14 @0$000S00  Q0 0 0S000PS:0:@00C\ 0  "!p0 00 \0C& T 0 "!00 0 R00@3[c[c[c[c040$0  C0LS 0 Ŷ  191# 3S 0 ,0 0 0S 0R40$# P0 00   0-0P; 00  UL@  0S 6ⴇLd0S |0h[LS0S 60h# -LM0@00 68 ᆇ|6L30S  -LM0@00 6. i|L0S  -L ML0H 2cC0Q0^, 00 m3#0 SfʤPD ¦0 @P@0@ <`0 3 @pDP@P0A3 <` @pD#PP`P@P@ @ 0 0 @ 0P, R L 0S60,@00  0 # ɢaQ`aP1T1R33  00330(0 (, 0 Q 0\30C3( Q,0,0,00(,0   0\30C3 | F -LM0@ 00L<0S  -LM"2 " @F}$ p-LM2@  ,P`02@ @F0`eP2 02p$ 00-@LP׾202"00 $t$ 0hQ0< s2+ p-LM|`@PP LP \0 S0\00S;0S p$7pQ@-L  0@Q  0$R @ S<1P0H L07Ra -LM@00 0Q R 10S \  -LM @R00Q  0,0 0100000S0Q0 ! !101 -Q-Q 1S( S  0,0 01000000 0R0Q ! !101 0Q -LMR`P  10 @X 0R@ B 0CS0Q\䑟1 ,   Pp 012 02!  ,!00C\ 0  "!T0 00 @1C& 8 0 "!!00 R4W0 0 0 T`X@  0,0 010000@0S  0,0 0100000Spp@p/$[c[caa[c[c0 R0-L@A 0R PQ 0\  C 0LS0^00S  0,0 0100000S  0,0 0100000S@@@0屦 Q-L@`Pp 1 0\pW0S00 @TW U 101hhl0SP !1R U. 1 \  00c<;  80S/ \!1R U@ @ 0   1P00001010@0@0   0  0 00$00 00a\U0 -LM0@S0S -LM@PT0`,0  VYT Q 0,B0a 0100 0c0p 0`a00!3 10C1 8P<0<0< 8 0 10 唣@呟p00C\ 0  "!X0 00 D3C& < 0 "!0#0 RVTi QWȂȒТ 0,B0a 01000c0` 000!2 10C1c 8P<0<0< 8F 0 10 ,@8`00C\ 0  "!0 00 1C&  0 "!1  QT Q T@,00 @T 0S@@@,00. (0S $0, $4_$-q (0S $0, 7$4_$˞!0 f0 0  f Q,0S,@0,0 I,@ ([c[caa[c[c0a -LM0PS@[ 0qܑܡ܁0  0,B0a 01000c0` 000! 10C1U 8P<0<0< 88 0 10 <@m`00C\ 0  "!0 00 0C&  0 "!0  QT0S 00F- (0S $0, $4_$<)[c[ca[ca[c0a -L @M Tp,0 ^P`Q TAdAd1P  X ŜH$P0P0C\ 0  "!0 00 0C&  0 "!0 0 R#$ R 1 0 +10 ,(<`8`1@ @  ť0 0 0 ,00u,(ܥ[ca[c[c0 -LMp`(P_(K, KCP@0K (0 ( 00(0 @T0 (0$ ((00(0( ,00C,0((0,,00_y,A(E. 0-LM@ KPUK0 0vPP  ,00C,0(0, R0$APm 0-LMP KP@ 00$p @,00C,0(0, , -LM0`S  ,KPP0 KPP#0 < # #000$@0PT   3S#PM 3S0P3G p8 P@ 00 ( 8 1_0K4 KBPP40pt0 plL80 00 0 00" 00$pw@HPP QN ,  0R,0  PP? 4@0DB(_< 1 00C\ 0  "!0 00 1C&  0 "!0!0 R ,0( 0C,0,zo+,K PU0 (00(00,00C,00(0 ,b@@0603 0R3( @  (00(0,00p , 3SI3SG x 6F 0 J~PP3S83S 45 50#0$i[c[c.[c[c0$ -LM0@( K,0 PPo( $`0A?AS ,K0 PPQ,PPK0A?AS` 聟! 000  3Sp6@!F0p}PP 0 3S U0S3lA0 0C\ 0  "!80 00 $1C&  0 "!0 0 R000( ,00C,0((0,Pu,*(0,  B, ((0,$,,00C,0((0%,[c[c$[c0 -LM `P ,KpP@  0KP@t( 8K]4K HAP@d804 D0 0040 4 弑<K, 40$  3AP@G<0 < 00<0DK<00 $ 80,0@0 _P@+0SF  oP@!4 (00(04,00C,04(0< (00(0<,00C,0<(0 v],, ?<#C000 D?4C0,0 0P Y],P~0,P@ . -L(M 0@` @Kp8 0 8 K4@ , ( @P <` p9 -LdM0DK`p  P@8 P#PPKP !<pP@0 Kc>P 8P0LꜤa`bXʚ; -LLM @T`PD0 H0 l p LP D` PI pKP@`P80S&@  0 0<P@|pW- 0R)@ 0  0! P 0P0  p 0 $@, 0=@0TS (ʚ; -LM@ 0)R  0S S00 d 0- @LT P P0S S 00S00 @S 0S00  0000 P0h庙t0 R P0S 0-@LP0S000"0h5T -LM0 4 0 0C#q!18  `;S40 0<0 (UZLZ<@ P,K  ,!%8P@)0 P,0U1W<@ P0PU,0   B A8 < 8 0 4000 (uUS PUJ 7PUZZ( (cUp8PU<@P0,0 ,PUꔤa4a -L Mp`0S 3R 0 S 0A#140  0a 00c<  80S \OKB2P   "h|$P0P0C\ 0  "!D0 00 02C& ( 0 "!0"0 R$ R 1 0+10 ,(<`8`1  np 7e! 0@40X 00P (,K Q, 30`K\(q 0 PE2 0s 0s =0  0@D0 00000 40 X  PXڜp0`K "0 H 0X0C 00@00C0  B  P$00 00a\U[c[ca[c[c04a -LM ROqa@0T0  0:0@T@T  ` * 00C0 0*S E @TPUh1 &Q@`TP R Q@@@TPp  0S @TZ@WP9@TZ&R00$0S 0R0 @, 0 0 0, $Q \0 R0 ` < Q  0Q,aa8aa0LP ꘖ P-L@p T 1S Q@T 0 S\0 R0S0` 0C#1V P`X`VPP   0 S0*00 * 8aP-,, 0 0C0, 00C0G94a -QL  ^* 0S  ^: ^# 8 R 00C000 p.0 B6C00 T0T08 . BAQ00000#@axaLa\ala -@ ML$Ÿt0 @_  0Q* Q:聟1 Mg@P1  %p `V@vP!t0@2!0| D00 V8H0:80 8pp 8 :R00? <.0 B608 0. B600`0S 0000@tP0 S00@@ 0V 0  ?C`? 0P0 000x S 0 S<0X X000a@a@a_paDa_Ta\aga!CebaLaHadaXagfffPa0HŸC& 0S0 0000@00"R 0 0SAŸP 1!0Q100(Ap00C\ 0  "!0 00 1C&  0 "!0`!0 RhX00500\r0@ 0qSr00!000O 00 .0 B600 p08 . `B000000 @\08 . L[c[cdaLa\aHa`ahaXa[c[c0xaXa@alaPa-h0`0#X0 P P0 S P\0S00 paTa -DLM88PÅ , 8 0 40 $ʃ30aV  P0SO `V,Q, K4P,8`0C0S0 8t3`TPPPP 000HP0P0C\ 0  "!0 00 3C&  0 "!0"0 R0m\0r S|2@ 0000 \00 # @0 0CP   "!$"000 2C& 2  00#!0! 0 R{ 7y000000@0 0CP   "!x!000 d1C& X1  00#!00n`LMVP80Sg 2*r,K , 00:00,0Q ,00,00p, 880H@lHT@! d 8 , 8 800d80,<08 S< ,ń80S:S1q1!@0P00, )a@00C\ 0  "!0 00 |1C& t 0 "!0P!0 R<', 00000@00C\ 0  "!0 00 0C&  0 "!0 0 R,0H8 H f80, 0f80,0<, 8`00:00, $(da[c[cXa[c[c0 -0L Ms吓, 0`||#|ßP0 0Q0XXß 0RCH3H#0Q= 83 Q9 ,C$#0m2P @ C\ 0  "!0 00 2C&  0 "!X2  QT` v\2@T5PŸ`@ 0` "mP00C\@ 0  "!0 00 1C&  0 "!l1  QTs <"00\ 0R00@P00C\ 0  "!0 00 0C&  0 "!0  Q0\h0P0T0X040@0<0d0`0l00 000 D,@Ln,[c[c[cla0C8100 @00000@Tg 0R8Kq+, 408b00Pc A=9 =@ @ < <0 @0So0 P   R0 P '0L H 07lWꔤa|a[c[cPa[cla r07 SRX 00S*0S$R"*r X00St0 0 0SRr ʄsus0suu0sXR0S0 uq000 0scgT -LM 0R ) 0 `R 0 4 P?p`0@  ( P0S@ 0R 0@ 0 R@0  0-L @\ P( ^,0,0,00(, 00a \0 -L,M,0$ 000 `P 0S 0+P@ R@@T }000 0pCW :0S/S W0g 0c #0% %0 0 R2  0 /R @00@0T0S P@s f 020("S\ 0S0 0U0SpLP0K P@KH0 @00HK00 4 ,P Pp L D 8 'P@380[c  R?@# *\0× 000o0/S @0 YN}pR G}pT00<} |p>@ ' ;0 p$}d }P}pGWc:0/S Y0+6 {)aa -LM$P$ 0 0#40 @ Rp8  Q R 4 00  ( @0 < @%, 0 /S N  , 5R  /R  2R0 /R, KR, ,0 lR ?Ó00b0 /R07 00S09940S009900900S 0:00  0T 4 T <0 0  0@ T0@@00@0` $00@060 %P R R0 i7ã000b0 0 i00 0 R090@8 Rd RR R  00rk00CS<< R;T0@ 780S2 T0@  (3(#0S V@0S70 0K &P  @00@08Q   }&0l20S 0 0 i 0 ( |`V   0#0S  8 R|`V   J&00K Z0@@ @ p<QT0@   @00@0<@@@00@0T 0.S0.S0:, 0/S  0b0i007, 0/S 0 b0b080SS0S8 0Q0R00SE@090"a @ -LM80@0 p,0  # `0SdV 0 R #PP p N00ZT0@  P0  @00@00`0CS ZT0@ ,0S T0@ 0 @00@0,0S 0  }%00@ < RP & k% Cl -@ MLll 0dPxX0X @T0@P@LLL L0@@@@h -bbb_b|bbbb Q-L Q ^ Ȍ 6P0 66 -1LM` 1V@p ~P $`VV }:P@}"~0 P?60 P ` 0@0 P0 00@0$(0@0 }/Y 02@02a -|0LM0Sh0@T 0S$@TP0 $ n _02H- P h0S Pl 0Rb p-L M 0@004h0l0 S000t ` 044 P 0  PK P 0 0 0 0h0p__b0S  0"S  L00 \ @0D0<0804000,0(0H0$0000 00 -L M⠃S00 3@0T40 ,0|s0t3`,  T LC RK@C R 0SD (C`00C\ 0  "!0 00 2C&  0 "!0"0 R=xP } 000@8@,눐4@,00P0@0@@`PR !P0 XPUA`00C\ 0  "!0 00 1C&  0 "!0|!0 Rpp00P)U @0S=XQ\0\0\00X\ AH00H0`00C\ 0  "!0 00 0C&  0 "!0 0 R 80S 4$0|0<0sH@'b_a[c[c|bb[c[c0bT0S ` Rd0d0d0 QT0` S`00d d  -PL`Mu 0Kp d P0@0  P8p 0P 0 P Pb -LM800CSP2P"p2?0P`@T | 0VW @T r  2  0 S |000@ 00C\ 0  "!0 00 1C&  0 "!0l!0 R|0p `| T0|0| p|0pP < +< <0;<0,! 8|8 80S@0S  -PT Y80S  m"  40 840 儐$(t锤ab[cPa[c[c[c0 -LM@<0PX p   <<00!YH @00Q00S< !000L RR X R\ X1J \0\0\0Ha H0 0H000C\ 0  "!0 00 0C&  0 "!0 0 R@0@0 PP @ 0X0 BR00S@ d X X R\ $0[c[cb[c[c0|bp@-8!8AP000H L81P \H 0 0X0 X\ 0`P00C\ 0  "!0 00 0C&  0 "!0d 0 Rpp@ 0SX0 X0X0\00\[c[c|bb[c[c0 -LM@0H 0CS@@0  hS! #!@0S hꔤa 0-l0@ P BR@ L@P 0%0S8 0h!@0S0hlꔤa-H0 L R@0SXP^\0\ D0\0 X\ 0X0 X\ 0L 0L0b|b -`LPp @T T0S`@P T -LM 0P@  <0 D0S 80S @0S 000 800CS0 4 }ꔤab -L M@0 K  0 @ P< -L M@P@U0@0<0`p48<,<0 ;`<U5 V-W c P#U @00CS@0L0S0t 4  @%<0, 0< <<0iY\5| 0 P  0  b8 -L@\ 0ꔤa -LM<0PL` <<0$0W yT0S800CS|\ 0S00 S | 0S S{0Q0 <@ | |p0Q | 0S QW Q<0;<0<@;<0@T 0 P0 |b2 @ 0 b2B&! 02 Sʂ1b R|0 |000|0 |lr@00C\ 0  "!80 00 $2C&  0 "!0!0 RV0|0@0 S8 JH0G a!000L R@0S X R\0\0\00\0X  RX T1X0X \0 P\$A00C\ 0  "!0 00 0C&  0 "!0 0 Rh3|5| t] Sl&8 80R6W9p2LT[cLa[cPa8a[c[c0|bdx@-2@H?0\ | 0T \80Qb -QLMp@`P$K40 P@T$ -LM@<0  | 0P |0  R Q8 80R@ 0P0R00S {@ 0-LHMQ0P0 @ ^|81L@ D0U|< 0X0KWOG ? 8H0/' <0 X0[S0S  6| 0S ^0,|WK&|XK@ m{XK@ h{XK@ c{H0XK@ ]{H0XK@ W{@ XKR{< @ XKpL{< @ XK\F{< @ XKH@{< Ꜥahh 3< (8HT\dpx -LMQpp5^ 0\ 0S $\-\ Ap0,0S SQ|0\ 0S $\\  0( hO- 0 hN02,2 -PLM0 `S 0 0h!080 X T! 0P@ 0!T0 0i04` \,  T0S ,KP%80`pUP@ ` ,P@W,p  @o k0 0i0 c L0 R4`89{00 00!!f. bb03b-|0S<0  0 R | 0 S  R8 80R0S -LM\0PS@p@0  0`004P z 4 @0<@0Sld RiSgRe0@ 12`ᄠBvX\ ~P@( \0R\0ń0d R>@!T@0\ 0   0V0P@@T@ 0004P z0401_30 R 0S  R0\7@ \ $ \` /P@d0 Rd0 0Dza -LM@0  01#3 p-LMP!`@4T  (300`VPZp p-LM0`@P  0p20P@0<@0@0<@00 0-@0L @P R  01 R P 0\ 0@0  0-LP@P P 0S  i<P @  0S 0@ 0S 0 @  -LM⨠`p@T  0P R0 U@X LyY @y ' P  yꔤab -0LM @000C& R 00#!000 0C&  0 "!0t 0 Rduy`0` R 0SDDhhy@ <[c[c[c[c0aa -1L M 1R ,  " ȁ đ0 !0p!c1QtPEU:a0 10S00p0tPEU*W , R 00 000 >0 'R@$y1@ 00000000@0@0C& R 00#!000 0C&  0 "!0 0 Rp XH,0SDxꔤaa'ga@a_[c [c[c[c00@-QMP0 @-PT \ ,P^Ѝ0Ѝ0@Ka3 -LMA\-P   -LM@pPp `pPH00H0 0oRPp0S P- L p00Csp0 H Sp HhETv( -LMP`p`dd5 000hP V P0SR @R VP P0S00<000000  Z00:00$U@4T0 0C\ 0 !  0`$C600T$0  "!04$0 R005000#0QP@ S0 0C\ 0 !  0|#C600p#0  "!0P#0 RlQ  V P0S4RrVQP u2B0 0C\ 0  "!0 00 2C& | 0 "!0X"0 R] R P0S R P0S/1 00! @00!l0S㴑> 1娑@00C\ 0  "!l0 00 \1C& T 0 "!00!0 R@0 P@0 0@00p Rl0S u@00C\ 0  "!t0 00 d0C& \ 0 "!008  Q [c[c[c[c0@Ld -LMr嬒P 000l@T 00 ` @RZ3 0X" 80S@ 0 @0]P@|PU  00S(K T|PUT {`0 @TS(`,PJ 0-LHM D040 X \ 8 0 \KP7P@ 0PL00 -LHM`Pp0@TdK   D0`@ @@ d <0 8P P@  0ST0 0'%T@00@0T  p-LM`PP@ P@8 0R@ p @P H -LM@(p !( KK PP 6 00 `  @0 0 P \ P p  000 kK  PP PP \ R0 PPP  uP ( 0@0 \܀ 000 $#  0K⤐K0 )K9KK  @0@ 0 @ PP' P 090@T4 0 00  P T0@ P80SP  PP   E @Kd )m p0K 0%PP  0 (00(0 ,00C,0(0v , Is 3`b -LlMp0`$0 @/PUK $0 S $oO D0P dP `0 \@ P@KUx@hhT0h0T 8K0$PU Ꜥa| -LMC0,0 pPP/P@ 00  l( &K K P@` H`K bP@pKPF@ 0@K K P@p 80S-@ 20S 80S@  P@ 0K P@   0  @Kl  `d Olp`K 0L P@i 0 P@` D0p0D000 p0! 0$3  X0K``K0 $K4K DK @0@}0 @P@ 2 a,0 S ,N K 090 X @ (00(0 ,00C,0(0P&,G0SF&  P  0 P@DꜤa`b3 -LMԀ0p$0 `L.P@ $0 S $&N@PK kP@UPF 08K K P@PK  @Tp ʾꜤa -LsMp0`$0 P.P $0 S $MzOK /PP@F 0K{/K PsKT@Q0 P@048j/1 劾Ꜥa -LMP`-P@0 RK 0K@ 0 夀 ` &P@pW@ KB P W.*d Kk 20:#: Q0 <   Q @T0 0' K K0K @00  Q㄀ 0`b p-LM0P@0  0K 0  @ P0|`KSd j 0|0 00:#:x0 0 K K0] pK 0R p`b -LHMd@Kp `@0<0 ` d @ 8` PU%T@80Q0 `P @ <0 d 8` ~PPT R0P 0 0 @ KP P~@KP P T0R XTPom -LMP`ap0+@TK&0 @  ` 0 6P@0@KSd %j 20;;|0 0R 0K Kp @LbK6 0R @a`b p-LLM@ 0 `K`80 \ ` <` 4@ PPP<K<0+0 L0 0 0 LP< Kp pL L0S p -LhM`0@VPPJ 0SE$8 RA 0RppS, S W0SSK 0 PWlKlK0@T0@W0@T  -LLM0 `pP/00  0pK0 D0H0 l p L Dp RP@`Q `l`@` P@0  @4 -LM` PD0K0  P pKP@ 0 @T0+0S<@ p N0 -LM` P0K0  P pKP@ 0 r@T0|+0S<@ p "0 p-LLMD0``K@80 \ ` 4 < PP  pPR PP -LtM`0Kh0  l d` PP pHK80SP 08 0b00K @@KH0 D 0 4P 0P ,` 8 P -LM` P@0K0  P rP@ p0 0  T0@ @0s# *P㄀K|d Jh0@0 0H @D0儀K 0, P@00CS@`b -LlMP` K6P@  0$p 0N  eT0S @0@0s/ *P㄀Kd g0@0 0@ Y 0,  B, (0 ,C0儀K 0P@00CS@`b -LM0P#Q` K  @00   ` P@0  p p T0儀K@@Pd   g0:#:0 0@`b -LhM0`#88SP; KP@  0$p 0 T0S @0@@Kd fg0:#:|0 0b@  0,  B, (0,QC`b -LM` P@0K0  P <P@ p0 0c zT0@ @)0s, )P0 R 0儀K 0P@0KT@hd g 0x0 @ t 0@@㄀K0s3`b -LM 0PK`0 0 0 P P@ p0 0 T0@ @)0s, a)P0 R 0儀K 0P@0KT@hd f 0x0 @ t 0@@㄀K0s3`b -LlMP` KP@ 0$p 0 T0@ @)0s8  )P0 R, 0儀K 0QP@0KT@d Qf 0x0 @ t 0L@ 0,  B, (0 ,=B@㄀K0s3`b -LMpKP`Td !fP@,@K 0K40040  @0K0  ` P@ P0 08 OT0@ @ (0 "c1, ah $ 1d0 \ ` 0@,K 㪸P@,0s0,0 $0s0$0 `b -LxMpK`Ptd ePH,@Kp 0K40040  KP@  0$` 0 T0S @0@(0 "c1, ah $ 1d0 \ ` 0@ 0,  B, (0 ,|A,K BP@,0s0,0 $0s0$0 `b -LMpP @0K0  P ZP@0 `  80@S @T0 ;匀K @T@d *e p0K 0&@`b -LlM`P K&P@,0  X "00  @$P0 04 K80S@ P@  S,00C,0(0,@@K4d dh0K0 0@`b -LM` KPPx p  0$@  0 > P ,00C,0 (0, @ -LM0"P`D0 hK0@ d0 h <` P@AX18!Q K0@ 0 ` P@]PpU 80SQ 80S@ X@X@T$ KW gUdDKTTywu |G\`P4A\tgd0 0wTP 0 0oU %0 0e@KTXD K0@@80S@DKTET64,,a p-LM0 `P0 K0 0  P P@@T|@Kd c0|0   ++x 0K KP@ pKP p`b -LHM0`@0 0dK< `0 d 8` P@ TP8pWP@ @KPP PP@ <0@@T0 00 0PT@ Kn@ -LU 0  F0x"FP5`P &U0 Q70  Q 7Q1p  0 S @00g ȡp00C\ 0  "!0 00 1C& x 0 "!0T!0 R?|@,K 0PPp Y0|0,000K0 ᮠPP ,JE|p0000,圿PP  00, ,0 00000,.)|B 9@[c[ca[c[c0 -LMP@0| S`p 0 0<0  07 PLd 0 0#U<0 00| R#PP -LM 0| `P0<p0  R  0奣 @ 0 00<0 -L4M0@^ 0 0| @K uP0 |0@K uP0~f p-L4M@P A|0HK0 `|0 R$ |0 `A 0HK| \$ p uP uP - L  Q00Q00 -`|PLU@ps 0 00CS0h 0 00CS 0] 0S 0S WpTAT1T 0 b<1`B&! 02 S61b1 R0PP00PP0 0C\ 0  "!0 00 0C&  0 "!0t 0 R0|0[SLa[cPa8a[c[c0 -pL|@TJ 岠尠4Q414 ` 0 b1B&! 02 S71b1 R0@@00@@`00C\ 0  "!0 00 0C& | 0 "!0X 0 R0|0`[cLa[cPa8a[c[c0 -LM@Y Y<|0 Y0S S  (00S 0 < - -LW0@-| q  qL@H0 800@< $  2 02$ 0|D=T=;T!52c~HaȀ2ca10 0\რ+ <@4TP *[O[O @@R: 0``( AP*0 P@:00@C "b"b0#l00X d2111H"c#b1 `130$SQbb$$@-0PSpU0 0 000@ S  p`U 0 0R0@0 Sb0 S .000@ S  LpL`U 0 0R0@0 S00%&E-` M@p 0 0 \0 0.\T.0V0 Ѝ.\ D\ 0 S.S\Z\RP J0 S .S RP \ZUv R0`@e@c\ 0  0S Wpp0S 00Np ^\\pPEP*0  0S Wpp0S 00Np^00P0#02SPp3^_000S00W V @V^P 6!10F000nR^`VL 0 S 0n0 lS0d~0^ 0*0^ 0:bP0u S .S PR y0.STWVM$0@-P| U@B .U@ 01 c0 C  0 R0Z  0  01 PJ0 R0Z PJ0 R0Z P J0 R0ZP0@0000  0@000|@ S .S A-@pP@  0Xx= ?0 1 C@nT0 7#30 T00SP-@T`,J 0P$0S!^Z@TJ 0P0S^Z@TJ 0P0S^Z0S0S &p@-@?\00\0AS`P?@01 P0 0RPu2 0?0 1#0C0 R0; /R0 0S"QZ0 R0( /R" ^ 0SQZ@0 R0 /R 0SQZpp@Np00a0C0p00Np00a0C00a 0C 03  QZQ p R .RAQQ 0Ғ?AcON -,0L;0 0bb -0LM0吐pP`,0 ࢂx 0  AT 0U @ 0V0W,0S  , 1P锤abb@- @  0 201 R 0\ R R  0^0T,0S bb0S R00  -LMt<0 L4Qp0@0 <  PP4 ,0KP@C3`  0 S P00 s`00C\ 0  "!0 00 |3C& t 0 "!0P#0 R@L08(#@/,0P, @ @4@00 E@ ,YP@ ,hT 0 0Z ,0t t0sn 4K  00K P@ \4 BP40 h 40 i 4 0464 0464 0464 0474 0474 0t4 04 84K,0 0P140PH@ `0T*^ 0p ^ ?0S 0P4 H0 @0T `: ?P40P 4  4P,8 -L M$ ( h0 pe h0b t t0RpF R` 0`t0sY h0S t@\ T0D0bD` $K0}Pp,$H0 P >  o?P7t0 qD0 4Ht0T$p T q! (0$孬 (0K$p Pp( $\ W (0S|DC ᑬ<0T$p<0R8D -LMQ@p``#T\P 0@30e^X05< 070 0`PP X 0X H V00\T D a0N 0-LM P0@0  @0 -LM,0$P0C0`p,0 P(K,KT PE5 0P@40K(, 0ǪP@-0X0H0 R $0U  P 0 PE AX0 0S 0 P@ 0X 00U00S0 -LM00<0 8 @ 80 @0jPG 0K , K0uPp9<04K,0 0lPp*40H@ `0T*PU  0 @ H0 `0T: ᧫W@ I>P 404pᖫ4咫P@\ -LM0p`P(K,K 0 P@(0K(, 0P00,H 0R *@T T 0S H0 0R:UPR N -LM⤐Kp  | PP@@  0S   @T8@0@-@T2PQ @0(0$ ,P@|`80S|0" 0Q}0 Q @0 LM,0  0P@  0@0U 0V@ T40 08  0,0000 05t0s/ KP@  0@*P000@KY 0^Za=0Y TZa= | oA00 03@ K0Z 0 Q10R`\ 0  0)P@  o _ -LDM|` p< $PPH P8 V5 k0@ 0@@P rU @00D0  0PPx04 8 5 @0 K0p6PP0 ,0(H  P 0崠 OP|0@@4PD 0R 80S P8;A< ZS4K,0偨PP4 00;00040H@8 7<8 P0 $@ ! 041   042 0 $" 04400 $" 042 $ x0 1QS 2S2?S8 "QL  0488<,0 0$(,0 8Q8P 020%L Rc840S_0 4SZ82 t0  048<840 048 00020x08 t \ 6 8tp\ 5 @Q? 0A<8 H0P70@40\T 0 H>@T,0X P&@8,0!4@  8L0HX,024 80\p8 84 0@` $QP08<@@@>8@D@@8 @D00c6>`08 p0HL x0 3P Z Z 83 \0 8 t0h3\@Q8 808h0h08h>8 l@8@ 1@\0BX0` @8@` 0RT4崨08 40 xQ 4K+0RPP40H@ H;P2 80x04嘨040 8 <L g80<`8PP@08010DQ8 80010d08 0<h l |0y ;P ;P ;P{/l0h!d 4 88<|020C8Sa81 \0 t0a\0S^1R80 \0 t0R80  t0\0 I8" 4!0` 4` #,$ 88<<0D& %0Q4x0P 0 840,0鼤ahdlt'00 -@L p{P`0 A|`PQ`տ<;@0 :@0! -LM0K"@P0   p-LM@`0P0` ` H0 0P T P0Z 0H0T` w>Z s>B| o> D 9p p-LM80@SP0 0<l0S 0\S q`V p 00S0 b -LMQ`0(  $0 ,` d0@Sph, K 0STL y 0P$  $Z< | -LM0@ 0K-P0 00  0000   0-@P L@P00 4 0 0 -LM䑟0 ,0 @`t0 pS$ x0RP#N*K Z9\ KPPC00 K0 !P0 PK  DP @P 0  < 0 0/&00  K0]PP0  啾0  ,0 S , t5pp5LKN KO0KJK00FKH KP0[ 0P0KꜤaa -LM 0@J5Ya p-L M@0@SpPP `K0 000 0  0 00lj i000n00rp h0 0h0 -LM 0hh0`0  0 $  10 !   0 m -L M00PKp00 000 0 00000h t` Pt0s<h0($200 h0 0 !1@00#!  "  000 ` 000 0PH` x0 @000 (8 Dh0@ 8D000L` $ 0x0X 00@ 800(0 pi 80kx0S1\T \D<0L aP` 1 E,$P` lj i00r0n0j0rp h0 0h0Zm -LMP@0S` p0s 0s0s$0sH0sL0L s0s@0s 0s0s80St 0ql  0P(0s] 0 0R P \00 P 00 (0s (n0W00s 0rp 0Oh0 0 h0 p 00 Q mPh0h000h00 00Dp 00 Q WPDh0h0 0 0h00 00h00s0s -L,M@D 0匀S0`e 0Sh0إ0<0 x0 R0S}*T ;, P@X0` 0@0 @ lx0Q1!< 0`Z!RR\ T00b380   RT2 \` a4KD0 ,0@04`0@ 0b SP1 P!T@0H 6 @4NT0SU<\D T0@  000;Tx0 S\` a` 4KD80K 0K, K0P@4K,0 0徢@ -L ОP.\ K P'@ PK K 0@ PKD @ P QP0  剷0  0 ,0S ,g. _.n;[0 [ 740w 5 <0QLKN KO0K0O0 JK0F0FKH KP0[ 0P0K6Ꜥa>`a -LMP` V$ P 0@ B`T/-P`ئ! 0 @`˦- -LM@ .- -hLWMH 0 ,0 `! `A L! h0\! 0d h! l! p  KKq1d!0t1 P 0@ 0 7 ,0S ,OdA `H0T SI 20 Pl1 P P\'P80BPWP7`   Rh! 00 w`00C\ 0  "!0 00 6C&  0 "!0&0 R{H!hA0@Hl `1t 1R2X1  t0s dpW \=K/=KT X 5`\A`PXd`0x a0`Wp!\P E\ p1K`N/KO?KPL 9QK8@!0PL D@1@ H0bP!S0!Px1 0U*0S S0p1  Q @pA 8 H Px1  @ 0 PU:.dA0SpHA R0l0l0t!d0TA00`MKx XxQH0 0LPH0 t0 pĂ0 4ȌD \p<3 (K 4 ]p\- KK 0A?(KA/(@K0K0000d0 Sp! :MK PL h1S lAh@D 0lA T0h DD弝A?( K K?K 0 48<S<1ST \D a0C<X1`p 1HF,`$`d2 (@K 0Kp!MKp D偝r\/=KQ<0R0@ @@ S\A RrWnKA_t0 s<041 14 (KW 3 W) (K00000d!0S:MK4PL @ 0h1S lA@DlA Th1 pWڬ @0@ MK 0(KKK,0{5@(0KKK,@h W @PD P  P?  P< P Pp  P5h  P2PX P-P P*ꜤapPa[c[c[c[c0xLa0aaaaa`a 08   08 08 0-LM0 P\0@ 0  ^ \  \ T bQ P^ 0 -LM`P\ p80@0CS\TP0\@ | | 0L!D0400A0!P000尡P0P0C\ 0  "!0 00 0C&  0 "!0 0 R=00T \T0`\pP0T0T|pH<.T@ i1:[c[c[c[c0 0-0L@Pt 0@63 0"P  0 0.$(30R 0-LM 0Px @ 40顩00  B00R0 0 0 / / 0 0 0 0     ;0 0 0-預@0 @$0 @ M! "Y lpb"`0%&&/@&0O% & "!! @!0P @`! ЍCCX8^n좙N - QLM, 0 40 Q :Q Q 08 4 0, p Wc3@ 0t0"0.)PP X1 01$0  1 @00C\ 0  "!0 00 2C&  0 "!0"0 R80aW0?`2@ 0p0"0($@0@0C \ 0  "!0 00 2C&  0 "!0!0 RH$ R 1 0+10 ,(p00C\ 0 !  0@"C60002 00#!0"0 R Ap00C\ 0 !  0!C6001 00#!0h!0 R޶($@L\#`(*#0  0  &Q 0 0 @p00C\ 0 !  0| C600l0 00#!0P 0 R阶[cDa[c([c0 -LM@ D0S H0S \D0`t`\0 hL -LMⴁ 8 8#( P4 @R `52 P(0 S P(,JK K/K 0Pp,X 0S<@0AS0 $K  P 0 000P0P0C\p 0  "!0 00 |0C& t 0 "!0P 0 R)h(Ꜥa,[c[c[c[c00 S 0 4   0  - 8L8M#@Pp;0S`6T 6T 6T0;0 s6TC 6T 0S F&P 0008 R' fP00C\ 0  "!T0 00 @6C& 8 0 "!0&0 R 0\P080E%P 000P0P0C\ 0  "!l0 00 X5C& P 0 "!0,%0$5T 5T005T000P 0{4T' 4T 4Tq<0@04T 4TfL04T0004  xD , o,\4 Q$ 0 00 @R0c@00C\ 0  "!0 00 3C&  0 "!0h#0 R@޴H0l3T .`3T& T3T0:0 D3TQH(3T 3T00S0<03T0D0o0S 00S0@02TO *2T" 2T0L0 0P0 0Tt2T82 02+@T @0S0 0 2T 2T1T0S o0S1 0R R   Q  0P =Ph 0Te 0Ta 0T] 00TY 0TT 0%:0SN80T t0TG :00TA h00kB @sB@vB hB iB [c[c[c[c0jB@fB@qB@f@tB@xB@nB@wt@oB@~fuBpBrBzByB}fwBgBvtmBfBlB {BH@ -LMP0R,(Sp?P:|Q|1@  Z ,(Xa@00C\ 0  "! 0 00 1C&  0 "!0 0 RY 飳` VA  fPAP 8P80@  Z ,(a[c[c[c0 -1L@pTP`Y 0S$ (PV 0R`@TVE 0S= A1P   0V S.`PP00C\ 0  "!0 00 0C&  0 "!0` 0 RP $b[c[c[c[c0$ , -APLp 88#A!` 000 R:0S 0S  0Ps $0S0 $ \_@p`00C\ 0  "!x0 00 d0C& \ 0 "!08 0 R鲲[c[cDa[c[c0 8-8@#LPr1`sp 0<@800 0@00`  `P00C& R  0 0#!x000 d0C& \ 0 "!08 0 Rc[c[cL@[c[c0 -LM@< 88#" 000`0S0`0  Q0 0 0S00@00C\ 0  "!p0 00 \0C& T 0 "!00 0 Rh[c[c[c[c0 -LM@< 88# :0S00 0 P -LM@`TPp 00000 0(\0 @Ti<0Sp4 R-L`Pp U @V@1 *`VPp(8 -QLMp`P " 0 PR@T 00000 0(\0 @T"<0Sp P -LM 0 K0  0K -0LM$ 0 $ K0 K 0K -L M Y pp0Wp`XP4  R400400@0 @ @`0K@000,0 j0  尡 4:0S$P X 00S* P0  $  Da -LM@ P 70  0P00  70 -LMX0@0CSX0P(P,PhP P  -LP`p @00P, d 0 `0'$bD -L@T 0` S V@0800`PU ,0S PUQ dp0S S l0SQ Wh 0$b_5 q_,b 0-LMQP-P P@K00, 0iP0S000-0T@K00, 0TPQ0 Q0H@D@,0 P h0SlP,b 0-LP@T t 0 P@t $( hP@0lSl00p@p ,bl \p0p0p0 -0 @LT`P p 0S @T p0 S 2! 0W*'|Pp $b - L 0pSI (1 `V 0S `V 0SV @ P 000'P0P0C\ 0  "!0 00 l0C& d 0 "!0@ 0 R}$b[c[c[c[c00@- P Q:lP7 Q*@0\ : 08 <40P 0 00aS a00R R 08 08 08 000- Q:lP Q*0\:00 0P00 000 -PLTM@`P p@@ @0S񟗱^ ^ ^ 0^ @^ L^ X^ `^ ^ ^ ^ ^ h^ ^ ^ ^ ^ ^ ^ ^ p^ |^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ 0_ <_ ^ ^ L_ ^ ^ ^ _ _ ^ ^ _ ^ ^ ^ ` ` ^ ^ ^ ^ ^ ^ ` 8` ^ ^ D` ^ ^ ^ x` ` ^ ^ ` ^ ^ ^ ` ` ^ ^ ` ^ ^ ^ $a ^ ^ ^ ^ ^ ^ ^ 0a ^ ^ ^ 8a Ha ^ ^ Xa ^ ^ ^ ^ ^ ^ ^ da ^ ^ ^ ^ ^ ^ ^ la ^ ^ ^ ^ ^ ^ ^ xa ^ ^ ^ a a ^ ^ a ^ ^ a ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ a DpB `0K> `0Kq:070A4 p0.0 c+0\ 0@$0  g\ 000S 08< 4 Ud Kd0S 0 0\0S0 āUh K \P*U 0 P: cR 0P*0 /%0\*W \*0 RUil K>l000} 0 RUUp Klp0w x0P:UD 0 P: cR 0P:0 ~ | `0Kx `0Kqt0àqǠo0<àl<ǠjhpfldbP07*0q[U 0 P: cR 0P* 00A S@-@**\ *!00S db db b b b lc b b 00@S S SX!0S * R:!0R0SS `S0SS 0@S S S 0SP `S PSpS S0  Q Q Q00S*00S:00*S:0Q @QH@ - @LM h_| -LM( Q0`0  0 R1S 1 R j 0R0!R0q40S 0S 0R+d\ 000R00R00 A  vP !P11 0AP gP P0P0@0@P 0a!R0 0! Ro.) E% & >% 0\0 {#p@d@h@l@d\@aP -LM81SA$P$U0Z0J0@(@`   p(@ 000 (%0U$T00` q l0R0 000  08AV@ @@ p `F0V l@z p-0LM` 1PS. 0@0 00 081@0@0C& R 00#!t000 `0C& X 0 "!04 0 Rpph霫l@[c[c[c[c0 p-0PLM `@0T00 3@T@`00C\ 0  "!t0 00 `0C& X 0 "!04 0 RpphW[c[c4b[c[c0 -1qLM 0`0O00PU ,0S+PU@00C\ 0  "!0 00 x0C& p 0 "!0L 0 Ri @A<[c[ca[c[c0 p-0LM0`PS@ 00P  `0S 0 0`PP  0`S00@ ph "d@<b4bd p-0LM0`PS@ 00P  `0S 0 0`0SD 0 `0`00 @ph !d@<b4b| -L M<0S 0 0 4L APT# -" 0L00%80+S%2"0 2"`0 rPAT  (#P P!U(/d\T R0 @20  0 P$B B R0000 0 0Sa 4 P  PQ Q10$ $01 \1@T 0 R 01<Q.@TA&0 0C\ 0  "!0 00 0C&  0 "!0 0 Rmĩ< R@0@ h0@0 < @0 X[c[c  `bl Ch b1c4bl@a[c[c0 b -PLQp` 0@S` TV@0@S0 0C0` [000 p-LMK`x@T  0S  Pu PT p -L@YPpM P`F 0SA 5p@ /@ P 0007P0P0C\ 0  "!0 00 p0C& h 0 "!0D 0 R -[c[c[c0 -0LSp` 00C S `0gS0S0 C RV> PgU; 0S8 U0S6 0@T r!0S  @T!PT UP\ x 1`?Bc00L` S g0 U R0PC\XP0S `@gfff, ,00S0 000`@0b Q00 00C00b -LMЀ`0 V$0  " P0 @PPPTU 4pK " tP`PU@00T00S$0 S $霤a0b`@ -LM0@S  4P, f 00ahbv Q 00 p-0LM`PV @T 0  R @T`Vp P 5 0S 0 S Pp4b p-0LM`PV 5 @T 0 R @T`Vp0S Pp4b -LMX- 0pW @T 0S @TpW PU 0`\ *0 0#\:Z  P  P 00 P$0  Q 0 4bh@p@l@H0Q P 0 RPQ4b -pL W`4 @T 0S @T XR 5 P Q  P0PP*0 0#P:P P-L`Pp @@T Q P P@ @ 0S0C 0 @@ 00\ 0 $0\   z 0-5P0L5ᩩ @T V@TQ 0 S00 00C0Y0h)# -LM5@05Ⅹ#h. -LM@# h 0-@PTL @XT00000 -(1(Q(! `@0T0L0p $4R0C/@T@`00C\ 0  "!0 00 0C&  0 "!0l 0 R\0hi(40S [c[c4b[c[c0 0-@0L@PT ${P @T004b -LTM⤙`V, Pp@[ 9VX x9t VQ Jh90SPD9V t,0 S $ ,ttP 8%Vx 8V 8V 8VW 8VI \D  0 x 0, ♨5 \H\(P000;@P0P0C\ 0  "! 0 00 7C&  0 "!0'0 R -LPt0 \  APtz t1E  <'q< 00\5   F&P 000P0P0C\ 0  "!0 00 6C& x 0 "!0T&0 RtMF&P 000HP0P0C\ 0  "!0 00 5C&  0 "!0%0 Rt1 X50SP0SZ  P$4ATy @Tv t0 Sq0nT0S cS S t  4D4$` 0tPK00% % 5 05`0`0C\ 0  "!0 00 3C&  0 "!0h#0 R @T 0S 0S @Tz'ꄤ#S SS_2VJ 52V 2VzPOt0lPKp0K@ >sPu@ @ `@ kX@P40S  X0SX ;U2V2 VD'PPB P 1V1V*1V 1V 1Vt0!$p1Vl1t0D TWp\ t0 @1V 41V ,1Vl@K@ et0@ p0KrX 0V 0V0VR(Ꜥai$ixi zi FixIi i i i [c[c[c[c0qϖl@i$i i i$Fi@Hi Gi i Jii i 5i i$~i i 6i(KiŠi$ -L,M!P P0U,0  1 X 0S P @0@ 0RPCT PXP0Pl1 ,0S `,P0pD1XU.LK$  n 0S7 U@` 0S<Kc$ PU oZ 00pZ@ PETUXUP0 0eP  0 o> po<K ~oP PE p Ꜥa4b -LM@Q 0 S00 00C0>U -0LS`_PU .PU PU  PPC  PpB L@T P5 @T( P@#  G000 0 $ 0@000@00 pp  0P T>0P/S80P9S<b p-LM@`TP P @TpT  R0000 0 P 0S P00CS00 R$ $0l0$0  $0:7pP R0000 0 ( <b -LM⼀ 0R$0 0@T 00@T$0 S p$@`TP 4pKV `F enPP@TꜤa - 1LM@ T$ P -P @T$0 S $wT  R0 @T 00@T@`TP 4pKV `F$B nPP@T<ba -LM0@S SL ~PT(  vP h0St, -1L0Mq@ T  PU @TaPUG 0@K0 / K00K  P@ <(P8A0S@.T`PU' L@K d  P@ <P$0S@ T 0 S | @7@0T @T @T<ba`b- -L$M@0Q0  %2 400S40 0 S h<55P2K4 K 400CS40ʰ5<55 Ꜥai -QM 0P P -Ѝ0 Ѝ P0  Ѝ -L$M@APAU@@ D@ p`2@ XR@S 40) 40 \0S @40  TQ 4 R*TA@@@ RT T x 4PK  0P P 1  5 D0S02K D 0 s1  80S $00c~  RXu 1000@*K  B >@0 S<K 6b2P    1QC000S|0 00|00 005   @) `rP00C\ 0  "!,0 00 2C&  0 "!0!0 R R1q01P00C\7@7@ S~ 0 B0 0 }  0g0g$0C0C  ]PU!0RD N@4PK @BKO 04PK  PLAP02KD $/@0<K @0 @@0T\@PA@ 40KP80@0C`80@`a[c[c[c[c0ʚ; p-LM@`PT ph -LMp`@ 0$   R \ 0S  R\  Po  P11<<1000 x000x0!!48< #X5 ,6U5  UO 6U00SF0SA0S> 5R: R1 00C B 0 !  80S$00c  Q@T 1000  S0 0C 0 0d0d$0C0CbT iP$t000d74P0   0Sn P00C\ 0  "!l0 00 X4C& P 0 "!0,$0 RFT `000 0R1000S@0@0@0`00C\ 0  "!0 00 t3C& l 0 "!<3H  Qr iT000{P0SH000 00 Ğ2UK 2U"r040|b壇x2P0   0S) PP00C\ 0  "!0 00 2C&  0 "!0!0 RQj000 00 u5i 5H!Hq0704aQ01P0   0S) P00C\ 0  "!0 00 0C&  0 "!0 0 RP꧝000 00 #  cPt t@l\c[c[ch\c[c[c0h b5݆1cC@-@@:@0\#" 00  @Z00_|@ 0--0LP@0 UX0 TVP.8U 0 R0180 0h00@0  8000E  /q?0  -LM!@R \0700!R\@-@ *,  0!\ "0! ":4(@-^p`*#!^ ",!1 #: (t( 0-0LSP@/ S /0  0S0S 0S0S0S 3000  00 00l d0ST L 0^ 0 000  0 @@@@ -t4LpM P00`K8K0p 0P@) 0dP00C\ 0  "!0 00 3C&  0 "!0#0 R\00[ 80[A)lCP00C\ 0  "!80 00 $3C&  0 "!0"0 R+T 9 0S   @P0xb00P00C\ 0  "!<0 00 (2C&  0 "!0!0 R 7 P@@    00 p10S!00r?A0!TA !P00C\ 0  "!0 00 1C&  0 "!0 0 R4餛@P00C\ 0  "!t0 00 `0C& X 0 "!04 0 R7z[c[c[c[c0 -t3LpsM P00`K8K0 0pP@A) ,cP00C\ 0  "!0 00 2C&  0 "!0"0 R3T q 0S  @P00CS0) (BP00C\ 0  "!0 00 1C&  0 "!0!0 R  R0700dA 10C1P00C\ 0  "!0 00 1C&  0 "!0 0 R4鼚@P00C\ 0  "!t0 00 `0C& X 0 "!04 0 R钚[c[c[c[c0 -@LMh@ -1A`L 0 S P00W |q`00C\ 0  "!H0 00 41C& , 0 "!0!0 R/U+  0$0 X0%0 0 0 XT0V U@P'8 0UR   P[c[c0a[c[c0ȁij Db -<0LM @P0 K}0Db -LM`Pp@ 8P 5TP 4 30Sl0|0l0 | Q QXßTCTs 000 0R~000$#S`0`00`01020p   0SW Bp00C\ 0  "!0 00 |2C& t 0 "!0P"0 R/d0x 0d0 x 00C\ 0  "!0 00 1C&  0 "!0!0 RGE000  ™000,Q`K00C\ 0  "!0 00 0C&  0 "!0 0 R7  $/1K/x<+K40 3A }461c[c[cl\ch\c[c[c0h bQ0P0ȁ0Qx0Q *p0Q  5RA05L00R  R R / 0Q0X02i 1i i i -  0@  -@L`p  PP @  0` pP0 8 p-RLM`@PPU@p 0-L P@\p 0  0P \ 0 ~PX -QPLMpP` J WH 1RG 1RB 0S?0@S000000@ PU P@U 0S @T1!  P UR*01P UR:$ Zd0U0P00S @ P ` `T @P` P5i 6i( \ 00S \P p-LM0 PP `@u  0#U TpT0000 0  @ 0S 1 \1S@0S 0  0S -0S 0 00Sp@-0 PbUe Q@ * 0`R@ Q:Q*0SQ:?T00S eP*0SP:Tppp p-QLM`P@ 0 P @4PT P 0S P 0Sp0@- @0PS1!^d0 0S1\@ *0 0#@\:00_ -LMPp0 S,P 0  0PP0S 0 0 ^0 R*0P  R: 0 0SP0 0S0SA^@PgU 0 9 0YPUPP`V 0 0Y`V,0U 0 Z 1!P@ 0 S @T 0ST  ]P XP @-0S<@ 00  @ 0 -pL` P@ 0\* 0S\:0000Q0\ f03 0@@ 0  P@@0P  0   P 0@@  -L MP@`0UPR` U0 V|Ք f p@T0TS@DT0TS $P`U"0WP 2 ,AWkPP0DUpZZW ! 0Pp8 |10@0X  d1, K0X,0pS0@ T*0S! T 0 0P0P0P 00P Q 0`0^00 00 00LT@ T*0S | b  F Ppg  00 FiaPb_dBHbXB_ 0R P* 0R P: p-LM0P@S0` 0 T\  00 00 0P0`@p p%@Lb -LM0 @ pQ8 Pl@ 80080l0S 40  0p0  Z h@K@p 0 d` , 00 0[c`b[c[c[c0b -LM@ R <0S 40 -LLM0 , 00Ly C@M[c[c[cPa[c0baB --L|M 0,  `PSp` `   0S1  @KT0 TF 0p0 0@7 R3ڜ0X0S 7 V 0 ;0QٸU '7X\7 ,0S \,ka*<9PV 㸸8 ʷP`7p  0 a;0S0+p0  V W0p@00Y K0@4  > 0 KL0  0R`0 % 0 S"0S 0 SPcP &1P p0@S񟗈@ L L D D D L 0SpK KPp R L $ ` 800C800D KKP㔐p80080 00 0 00 D 6S? x | 00 <0S0  0 | @0x 50@0p0  p  $ 0K0@P  "P@ `K 040L0$0 0O7pMP@K""0P0KP NK qd@ -p;3 AT/p4   P  0 p( P 0S P 80080Q 0 S00R0#S0Sm SKPp R{|PdxP\ RPZ @ P P 0S? 0S0C 08 @ 00 0 <  4 0 0 4 $L @0S 0S0SD0d@T  0L  L  0 L @; K   K@4 P  5PP 0S0 xP0S P  PEp} xSvQY S P@  0 S:P 00 :PP7( Y뜤abBB|B,a`b,00 00 0-@PL(00  0 0 $ 0 p-0LM@`,PyT*\0 T0#03 P00Sp@ 0B00R@@ 0@-LpS񟗃@ @ H P 5PX`/V+ P@ @>1P 0$ 0A0Q0  i9@ T0S0尀060A01P  $ =$P0P0C\ 0  "!0 00 0C&  0 "!0 0 R$ R 1 0 +10 ,(<`8`1@5`>L~T|z[c[ca[c[c0 -L`M, P Y YpYTp LpUP@1P 0$ 0AQ0U p P@ T0X0U00S ,0S 00S 00S 0S P Pp0SP, 0U00p㵵 -Ll`P^p@P@0  T0p0( 0 00@  0hbBB|B p-0LDM X@KRP@p2P`TD @405,P0 0~bBB|B -LPDMh@l \p P `hK@WV WVWP 0   hKT \ H P@2 $00  h00WV WVZ!  00hK\ `0 d sP@ $0 4 l00h  X4 0,0  0`VbBB|B -0L@M \@KR`p@@PP$ @d`t$q  0bBB|B -LDM0PS@pD ``K@x< 00 D\\0 X T P @0L0 H 50@0 0 0S `V 0S40L0X $ <0@4@0@@`0 0 NP0p0@04 0 -LDMhKP @'1`V  R 4R `V @T 0 T K0 SpT  X 0S8@T Z  0Z @T0P0 H0 \0 P 0 \0 0 H #0pS P 0 S 040$00hNP0004T05D 01h00 yNP0004b -L$M@PPp QDK `1!H 0@ 0 l^8 00p < D ^Q@N^G H0!A0H00C\ 0  "!P0 00 <1C& 4 0 "!0!0 R,P80K  W8  000gS0:  10 ?A1c0㏳ꪁ 1S Vd  V @!Tڤ(P [c`b[c[c0gfffh -1Q!1pL 0000P `0@T R 0R+T@p00C\ 0  "!0 00 t0C& l 0 "!0H 0 Rh;C[c[cb`a[c[c0 -LtßP0@S0pH`X0 0R0D00 8K43(L4 T < T0SX0 Sc300$P 0 3R3Y t@<TYT `0, S Z @ TzY t@<TY0S04S `b##211@2`S[000,0%S 0S 000`0R 0Sh` R 0,S < R 0,SR00 0 R. 0,S < R' 0,SR! t@T  0S @T 0ST 00   00CS0 0 , , 0 000L00,0% 0S0R 0S R 0,S < R 0,SR00 0 R 0,S < R 0,SR t@T  0S @T 0ST  0000S :S0 0 Rb bbQ -D1Dq ` L 0 4SP   5@* 00@`00C\ 0  "!0 00 0C&  0 "!0 0 Rh.yp  @@a@ #211@,0@[c[c[c[c0Qb00CS 3 3 \3 \3 \3 04S0% 0 \ -qL0`PSN 1圁 1P  U`  t@V; 1 0    0; 0Z00 0@P0C@ 0P00P70 0C 0  0|KK {PKP@ @ 00 0w[c[caa[c[c0ab|0 R p0Q ,0( 0S <Q00Q 400 0S <QXC b0S  S  0 S   0 R010`0 BS RA* 0S RR0Q 0Sڂ 0-@LP>1P P .  b T 0@ T@d @T 00 0 "4 40i8#8#$ 0$  0!0i 00 0i0  BD1 <1.Xo0 ,0S ,40  00 0P  0 0@, T00T0Tz`Ꜥa b b -L M 0@p@A`0d` 0p0#!dPK%0 0d0  0pp  -LMKhX? B8c0@ 2c2c@2`ϠAl  8 #, E.Mb -L MQ@`*0S S 0`鍱*xp0 p:``P PU.P'PEEE p-L M@PP 40`00 @K@0SL LIP808 bPp=p:pdF 0- L"48<P#HP1 T P"48<#HTQ00ADT@Q<0X@| 00 T@ RL 0hJT:<0X T0L0P0SSP@0EE -LMp0P4`K$0 ) 4P0S L00P0 $0S $ 0@P  01D0<0. 10 S 뜤a btC - 0L =PEEDb - LMR 40 S 0 0 u -(!XL"x H` P y htU H -LL!!Q#7011A!1 ȠL1 L0A0 x!0hp00 cT1(0000 c( L ! a c0#7%c!c1c X@008 #HT 00 0 R 900T| ?A7c%c!c1cW XEنx_j_h_l_p_yn_&(`aFr_Ft_ 0-P0 LR0 0Qc@0 0 0? B7c011@x0 l000!T 0)L0L " 0F/u`at_h_n_p_Eنl_r_j_F 0-LM0P [[@[0[ P@0|_ -L$M0pK@ 8K%0 !@ Ÿ  0@ pPw Q eB!2b2c621b1c \ڸ0P*0 RO 04P:1!1!@P @@7dQs3[S@ ` B1 2P13[ S @,@"!@00Q@0 ( $ 00\ eB!2b2c621b1c1\ 0T(($ btC bHEXFF bh bx bb,T b0 b< b\FdFD -qLMQa@0 T00 0 S00 00C000CQ 0 "!000 t0C& l 0 "!<0H  QT 8bh b[c[c[c[c0 -LMY0@S y000 R^` 0@SX00X0 o@0X000 0X>0S3 0S0 ' t 0 00t !P000 "48<#Q000 R000 0S  b"t8X~ P["P 0%0S q Q 8 R(00(0  oQ00S 1ȗǟ 0  Q  00C\ 0  "!t0 00 `7C& X 0 "!('00'0 R^ 7PU 0QI PUP0#$0$ h("( "4 4Z0< "48<#8 4 p6 0hƟ00 00` C \` 000 0  "!0 00 6C&  0 "!5  Q a!$)-"("4 4Z00S 5  Q hP 000 @`P@U $@00@0` "4 408#8#$0$ 4 0ğ00 00C0\0 0  "!d0 00 P4C& H 0 "!4$  Q40$040 ğ0 10 `3 0ß00 00C|\ 0  "!\0 00 H3C& @ 0 "!3  Qoo`"  0P00 00d C d "^ 0  "!000 p2C& h 0 "!82D  "Ÿ  000 0d 0C \d UD A 0S 0S 0S`00Cl0\0sP@`Y 00 0 R 0S < R 0SR t R 0S  R 0SR1|00|0 $R(00(0 t00t00%p00p0^P@`000TP@ b bGHF[c[c b[c[c0x b|FxF b btC@-0@P H0^ 0%0S" 0 R T 0\ <P5 X0^ 80^ 00^ (0^T 1<1400 0R b `F -L M 0p 01 cQ  0  0 R~ 0Q0R  Rh P, U  "48<#0!$(,"P:,P PU, R3 0 "48 <,$#8(!8 ,"hCV ڲ "48<#V7 _ "4 408#8#$0$  "4 40f8#8#$0$ UA 0@ $(,.4,8 <"(!(#8R`c-ڲ0#$04V `  R000P |%00C00f8#8#$0$  "4 408#8#$0$ ,0S , 0S00p,00p PU,  ,P "48<#X P"48<U#, `V0P00 001S Tt@ `4`v0V0C0P   @`k00C 0VP8#8#$0$00S 00  000  R000 3@ 0 b|3B&! 02 SNX1b1 R000,c@00C\ 0  "!0 00 2C&  0 "!0"0 R0 0 0! 0 0 0!B Z @ 0@ T ] ֏$" h00h0 0S0 0p 0 p02! 000!00C0Q Q00z\Q\1@  t P00B 8a@00C\ 0  "!0 00 0C&  0 "!0 0 RY 00S0<0 0 0 0 0 0  00 00z] q b|F[c[cLaPa8a[c[c0 bPax b - @LTp a P R0p00@ F0U0C0 DAR0<00 01P 0 b1B&! 02 S41b1 R0pp00p`P00C\ 0  "!0 00 0C& x 0 "!0T 0 Rh\܎|F b[c[cLaPa8a[c[c0 -brLM 0ܢ00 0 0R0 00C\ 0  "!0 00 l2C& d 0 "!0@"0 Rx02 R $R00C0@g T  000 00C0\0 0  "!0 00 1C& x 0 "!H1T  Q5HAP 80S0C80*000 0C\ 0  "!0 00 0C&  0 "!0  QoB\?\ 00 08\000C0\0[[c[c b[c[c0x b b b -dbddr 0  QL ( @00C\ 0  "! 0 00 1C&  0 "!0!0 R[霁00C0\0 0  "!`0 00 L1C& D 0 "!0 !0 R;A0S Q000S0S 000 00C0\0 0  "!|0 00 h0C& ` 0 "!00<  Q m[[[c[c b[c[c0x b b -LM|P0S ppp00/"?CQT`1@0000S 00/"?CQ@Tx bxF|F b -L,M@  D 0 01H pC0WL0 `@T T WOX00X0SGDT GT phW`H0S x3 R@X.PU(PE0S,C( P H 000P PD @ 0D"P00P00iP0iPT T|2 R8 PUT0 0岲P, PE0S P T P 0 0H000  R H 0D0 P ḲP ۲Tx D XPi4@K 2 [R3[Q0S 10[#0 210K[8K@  }10[0S% S 2[0<KA <0 m20[020K@0iPpS20[3 [0Si t [d9P. 20[020K20[3 [0SX0L0@ 0߲P H  BHFGG bPF p-|@LMPP`D 0U`D 80S0C80 <`000 (P0 P@p b b p-LM@0`+TP p 0D #10P_G p-0LM $0 (K0( K'K1KPP+ 4 10 S 80S0C80pH00 R0`V @T 00 Q @T`V80S0C80p&P80S0C80p4b -PLP& W P` 0@10 0 pD00 P@PE0U :0U0*00G_ p-LM` 001PC@ ck 0!0e 000e00 000p -LM1` P@,`  #(00(0ow P 0SpW  0R 80S0C80ds000 0 0D0\ p 0#$(,"(DRD 04 P 00C0< 0Rv "0 S0!0" CP"(00(0l"Y$00$0Y ,00,0XM APAꐴ ȴ `  ,0L00`L0X I400 0P Z00Q00Sw Pt@Qq 4 000Sk4000P0,P ,0 `a 0 .pH/,  0 b b b`FLF -LMQ@` R0BS)ꀶ  U 1 Rt 0h6R 0Hpx-4 0Ph٤q0 p0@S P0S PU`PΉP0p0 ph0@P PLD 0`ض {aPFFT b bXFdF\F bh b --)L4M0 ,0 X 0 QL X`H0 P p D KD `H @001H0 ; 0S* \ @*\ 0 WP ) P 40  0R 80S0C8000P0 0 00 0S r P P T \ T 0S p@T 3R ,0 S ,Ҭ5)@0 R  3Q H0S <Q H0SQ P U 5SP1pP-pT 0S0  T 0S0 R ƕT 0S00S R; 2Q5 H0S <Q/ H0SQ P) U 5S@ T  0S @T T0pT;p 1P7pw 000s 0RP@ 0 <0K; K0@K80 o@Q  0!R 410cSb. l ? X  |P h0  HP2|@t 0h!0bS5t0`1 S`500 1R 40 :|0S  ](0?0 ѝ  0RpQ lLP a0lS0VL8Lȟ @ 0000|  @_X| 0 |P h0  HP40 ' L@ 0St7 R  0t0P0l't0yt   0L@}k '&0 ?08ZHPKd`K⮸㫸0S S  D0@ @KG0KH@K 0\K 4Kd@KcKK0 &Q Qw ! 0 S- 00 %0 S   08P p  DX P?8|101;   R P5@T2 0R #3Rʌ tK 0x P P P  aPğ1010 St1010媍P 0 ?L( u@ q0}, k 0H0KGK D d0K$KcK0`0 06K]3 FP  ~ 0R00 R Q`#101 %0P0 X 0 0S0 0 0 n 0c `C0t0 0<4(<"4!P@ ᙗ4 P0@)QD0 )0 01 000Q000 D001  B ᤗ 00C0P P 80S0C80` \ꈯ[c[cGbG[c[c0 bb0b 0-0@LP  P0P0C& R 00#!t000 `0C& X 0 "!04 0 R0=[c[c4b[c[c0 -1ءLM  ,  \AT: q 9R09D0 0010`  0P 0Q000 D001  B 00C0P? P 80S0C805 ÖŖV@, 0@\10 0C\ 0  "!0 00 x0C& p 0 "!0L 0 Ro]=[c[cb0b [c[c0 -0LS`p Sz PL2喴@"00002@p 0T00 H0TS, @TAp00C\ 0  "!0 00 1C&  0 "!0|!0 R< ȱ0Sp  PQp00C\ 0  "!0 00 0C&  0 "!0 0 R<0 P@  !QvL0L 0 0#!jGb[c[c[c[c0b,b -7LWM@ p, K0  AP` 0 0R-  @gR@00C\ 0  "!0 00 6C&  0 "!0&0 R \< 0bS@000c0CS 9R09D0`Ɵ 001 0 0<Ɵ 0Q000 080 D0801  B ᖕ%@00 C B\  0  "!0 00 5C& x 0 "!H%0P%0 R 4 P 40@h @,h00 h0s0s0 #0S S P0S H0 0PP 0 0 δP P 40D@D0t t0S 4$!0(00 R?""  4` t 9t0=t03 Pxg P0SP1 0 0 !  3& ,!0#?08t#000#:S?9 S7 100! 00&?0ࠔ@Q  10cS2X!P@ P P 80S0C80ڈ 8z8| ꤬7 aP P 80S0C80 8Z8\@0 }6xPF  0` Z h0  H0000,0 080<P00:p@00C\ 0  "!t0 00 `0C& X 0 "!04 0 RY:[c[c[c[c0b0bKJIGGxbb b -2LrMP @$ KFP` 0 0bS(TBP00C\ 0  "! 0 00 2C&  0 "!0!0 Rf: 9R09D0 001 0 0 0Q000 D0@A01  B ᫓P040 C B\  0  "!0 00 0C&  0 "!0 0 R0P@ P P 80S0C80X 79b9[c[c[c[c0b0bb -2LrMP @$ KP` <4<("4!<S( xBP00C\ 0  "!D0 00 02C& ( 0 "!0"0 R9) 9S0A90Q9D00 01 000Q000 D0@A01  B P040 C B\  0  "!0 00 0C&  0 "!0 0 R0P@ P P 80S0C80X suꞪ69[c[c[c[c0b0bb -LkM PX@LP@@N@\ ß X ! Up`D@ \#t0D SD K1nK `P 0S o/KPP` b@0a Y Pl0L0Pd @0 0@0d P勨PP  ! UR Tằ1p ᵱi᠐00y U 1/@ l0L0D= S909D`0`S5 000  @[P P P 80S0C80 (屑峑1P@ ԩ)90d@  @ dm0[ 0 " 000  QlP0S0 000  QP0SY FDQ @Gxb4b b -LMU0pS4 `0  S(0 80 , 0)0S8  0V>PVP6@ 0D00ʧP` (1 01$0  1 @00C\ 0  "!0 00 5C&  0 "!0|%0 RGV d0 0SV H%0  U0S S P <4(<"4!<0<4(<"4!<  0 4#$0$ 0 0 :#40  0 R \40(,!$#, 9sU 0S` SI 0S? S' 0S|0S S /, Q<@40 ,  0ۼ#0S;0, P48 \ 0`40  4!4 8<#` #8 0U 0 4 #0008  0b!$(,4" "( !8 嫇U 80" c 0"4 40 l2@0`2P <4 00 0i$00 l@00aXW<4@ 0d00N$@T@00C\ 0  "!0 00 3C&  0 "!ß#00 R$ R 1 0 +10 ,(<`8`1@}`N3L3 #TP0O2PŸd00d0t00t0  00bSŜ"l0p000l0p0ՄR2@ 0x00P` \2 0$2   (@00C\ 0  "!0 00 1C&  0 "!!00 RYV !l@00S V x1l@ 0 @008@ 0`00㍢$@0@0C\ 0  "!0 00 0C&  0 "! 00 R$ R 1 0 +10 ,(<`8`1@`22ꜤaGIxb[c[caa[c[c0aF,bXFa JG0 S   ,0LAP!h0,$TPK,8,$#$,0h@0. @h@ @PT@KSPK  44 VKRK5K<@hP t` k T @g 1  8(<"4!< h P0 Zy.S<l I  : 0S7 \ 04006.Zm40 㺦 \0|\ | ^x\|",00` St 7!2! 1%\@0 P6tP X" -LMN? @0A9O?d 1\  Q xQx< 0?0&6 R06 :G -@ ML 0@5 0@-t0 d0c`0` XX0 ;Q<0< 0R<k.hl(èb\bGG@baag  -xpLW|V tP6 P # 0 0㼣 0 0 P 㲠1 00 00@, O Kl0P:0`0#$##   0 P 0(`Q@ ᾥ0+ 0 8 "8((<"8 8!("(!0QA"`A"Pp t1SS USP 0T!0 00(0S8A81P  , 㵠$P0P0C\ 0  "!0 00 0C&  0 "!0 0 R$ R 1 0 +10 ,(7!t00 0CP   "!p!000 \1C& P1  00#!(!00! 0 R?P 1P@ 0 000t 't 0 0CP   "! 000 x0C& l0  00#!D 0L 0 R0Z--@b[c[c[c[c0b44 0\0!0000 SQJ -LMD@@6S S6St0 R`06oL0S|h 3QAQ @QF -L,M0@S`P(r 0S R 0S0S0S R 0S0s VV 0FSqgV Vc 1 R UY @ \H @ 0R:`PKdK(0`@XK0zP( L0 Ꜥa[c[cxb:GXF[c[c0<FrE@bdh -!a P0L00t @0XqN/,0P0,008O/Ɍ0L^1 Q0 30r00r0@P00C\ 0  "!0 00 0C&  0 "!0 0 Rh(h0,`0 a \*P0 \:00<000[c[cxb:[c[c0G8b H -!aL MP 0@00t /40040\Q|0@ S \QX1pWL1L!,0l0Q=*80 080x0L!0 ?08⻁@P00C\ 0  "!0 00 0C&  0 "!0p 0 RiY(<00<<0! [c[cxb4bG X DP @0 2 @Rp00C\ 0  "!0 00 2C& | 0 "!0X"0 R  2 ,0S 0,_#5X: @ 0 2 000 @ 040 Ap00C\ 0  "!0 00 1C& | 0 "!0X!0 R/ K#040 00 0(K 0 S S X pZ. ᦰ,0A804 h 00!00 00C\ 0  "!0 00 x1C& p 0 "!0L!0 RY mSh 0 B0 0g  0f0f$0C0C0 P 00C\ 0  "!0 00 0C& x 0 "!0T 0 R_1(0S9p[c[clH\b[c[c0MЍ -LM Qp` 0Q0V00SQ񟗅h  4 < x ( V Y Z E5P  ᪭xP0P0C\ 0  "!@0 00 ,5C& $ 0 "!0%0 RX4 Ph0 44  s t *hTh$@ 000h  +  Y@d@00C\ 0  "!0 00 3C&  0 "!0#0 Rx hv  h0 E 0S 0S$0S(0S 8a00+K,$,"*)0+ K 0嶀0*K *0KT*0[0+K 0%0 P0#$0$ 090 "4 40S 0 B0 0  0g0g$0C0C %bTFb-QM 0*\ЍedЍH --x2LtTMp 0 Q,0  pP1  00 0 0@S0510205 :x0K x [0S 000E ,0S ,sw0[S 0S*P0p00 HK㐌dK㍌0 "bV? V 000@@0K HKdKc@KG@K\0K z% tKPo 0 `k1/<1t [000x  ㈌P11<<1@D0K GKd@KH@KcKG `0KHbabt@ -3L M0SS0 @ S#3QQh3 QQ Q(!08# 4c43p  (  3PP 011 01$0  1 Ԣp00C\ 0  "!0 00 2C&  0 "!0`"0 R}Us 1=)01!0 0$!0@ 0$00  i0O!0S. S ,0K@I ,K+@K00P@a0` 0 !( B("("48<##8041   @K @00@00  1#$0$0 a I  440(! 10L 0007$ 000,%b [c[caa[c[c0TF-QM 0*\ЍbЍH00@- 0@00 00 vT2#Egܺ -LM1^0@!N?P1p@`eZp:U?ZZ oT @Jy?Z@p G m fpP -L?0@0c80 !<\ P!TP 8PtU"\@P P<p 00"0PT   !202T PT0PT00T Qp00C\ 0  "!\0 00 H6C& @ 0 "!0&0 RsT0@ @PP@`TLPT!U`ş` 00"0嬁P@ 5" "PPQ`00C\ 0  "!,0 00 5C&  0 "!0$0 R"0 PL0 'PP^\ l 0l@ 0 ដPp0<0 &^H`0P h@`d0d , Ġ `P̌$Hh, 8#$X`0.$%Čd@S&,#4`$ 0(̌4#Y 0 84`T @ 0@`TT@  0X`0p0 ? 0# 0^P@T L 0lPPpT \p ՏppWPPTP~hLPKH KT0KX@K8` , X @A#PPpG P 80hcVW Q Q004qpW4(A(!P000P0P0C\ 0  "!0 00 0C&  0 "!0 0 R 00@0040000 0`0A`O(cb[c[c[c[c0 -LB2!0P4X0 32 00S0C00S00  Q0 0 0S004Q414 p 0 b1B&! 02 S31b1 R0@@00@@p00C\ 0  "!0 00 0C& | 0 "!0X 0 R 6ꔤaH_\[cLa[cPa8a[c[c0<0@Q81   40  a R ,00 00@Q191 0 S  -LlMX2! rP r82 @K80d 017 A 0*1:TPU U U\ 0xPU* 0 0 33.sPP':@ @0:'9)z: l0P|xtpPPPP|Pm 괈8   "*sP@ 012 02!  `0 0C\ 0  "!,0 00 8C&  0 "!0'0 R 0  0(ꈇ7  | "rP@ ` !2 02!  40 0C\ 0  "!0 00 6C&  0 "!0&0 R 0 P 0 X <0 R 1 /90 R 1ee/1`PPL%@ 000  #R60%0Uh ,#0Q0R00SX R R'`U@00C\ 0  "!,0 00 5C&  0 "!0$0 R r #@00C\P 0  "!0 00 l4C& d 0 "!0@$0 R G< PP#000@00C\#ꬓ 00"0qP@ 3 !" "PPQ\0 0C\ 0  "!(0 00 3C&  0 "!"0"0 R0 0 aPPn2 0x0"0qP@ \2" "PPQ4"0 0C\ 0  "!0 00 1C&  0 "!!00 R[0 PP PƳU!P1 0D0"0QqP@ (1" "PPQ!00C\ 0  "!0 00 0C&  0 "! 00 R 0 P0 PP LJHU4xc[c[caa[c[c0t| 0-LM@P(U\|x |00\0\3T0@0 R 0S$0,@0$0 R0atc -LMP@ T0P0h p-SL M`PA $0: PPU@0$0\0- 0 @\ 0P@ V  00 Wx$0@0@$0Tt #T T@p@ Fx@0$0ݲpٲp 00 -l5LDM0d0 `T R` ) PP 0S$0PpW @ 줟0$唳 0@$080$`0uPP$0@`0Se l4dP80 ,P L0 XK\K@H K0X@ vP\PO0V0#U00S $0C#U U0S\0SX03 U0S PPL08 0bL0 UU u Q0 U0  00\wyPPPP U 500(y(L0KT0 P@@0K0T K`PH d 8 P DP 4P 0 , XK 0@ H KX 0V0#P00SP $00,h Q,2 P@0 B#U U8 R9UL<4(<"4!<!1RL 8 @@H K0X P#PP p Pp8Qm  L0 aL!w Pb 0((!wPW0 b0 w PpP <PP jPpW 0 0d 80 , L0 XK@ H K0X@ z#PP$0 NL08 0bL0 ; 锤aXbʚ;Hb <@B -LM`PP@Y 0S$K( K@T Tt #T \0P0$  $P(0,0 0  a^0 00 Ů0"S Ÿ@0( !$0 2@T 0S 0P @TŸ@0( $0 (0 0,  00D"00S9 440(!014 p1Sd S]h x0 B100 0 $ 411h  411x  0h05$080x1000/, 0b0p0Wu P:Ð0$00$0 ,B $0 40 8!h0N0h04 ^n!x0CN0x0T~ T 0S1h x 04K,K0K P(S4 Cs4, ucXbcPbhIbH@BX -LM0˟d dT, h q@l P 0 m`hPp <@pd0l 4 x0 | 倀   p 0^p  t 0D0 @ p 0PS010H0 HDLTKPKht0l  @ p DPLT0S p੟T0ؙ 00 h0e0(0, 8 l 1S0$0Ŝ9$ P @0 lɟ `00 ``P0 S T0S 0 P00C\ 0  "!0 00 8C&  0 "!8  Q\0yXZ XXS l8 0d00 R00@ȟ00 0 00C\ 0  "!0 00 7C&  0 "!7  Q$  $ 0C&  0 "!.00 R8(0SS800 `0004p 0 0!44 0h<  80S$00 00h =]@ 0͟0 "0obPP 1 01!  l- @00C\ 0  "!d0 00 P=C& H 0 "!(=(  QX0P 0p 0L 0 0 `R \0SA / P 000<4(<"4 !<0T,0`H<  004<0 440`0`Q < 4( <"4)< `08P, <$4 ,< !$ 4*,%<Z = Z` 1V  80SF \\;@ 0H[00D "aPP 0 1 01!  *0@00C\ 0  "!0 00 :C&  0 "!:  Q0P 0p 0P 0` <4(<"4 `"<V# m  80S @ 0 0"0iaPPሉ 9! !岑)@00C\ 0!!L9P 04)C6000 "!0)0 RVIP p 00c,  80S0 R@1@! Uj 0`d0 0 V   P00`eV @T0@@T0 00 0 08 40(0 0 0p40 $00 a7@ 000"`$@0@0C\ 0!!`d 0H'C6000 "!0$'0 R $ R 1 0+10 (,0 $000a Sq 0 0c<[c[caa[c[c0cc -LM,0 QP@l 1b  80SR V000 P 1 0 P0h@-|0 p0 aT08/Q~?}?LAb<8 #100  T0S T`agfff -LM@P`p B 0\ 0R^10020V60C E"0 P ` @R 03 0 0 R0000 0 T#W 1 ! ?CF@-4pPp  0 ?P0 00 NP020Q ĬP  弬P00 0020 "XVUUUx -LtM`psPP0A0 0!P300 NPuU鈀K PPD0@0 0hKdP DP h0 oK@B18!0<`0 0  0hP g?K0K4|KRT@hR`R`@ `LP딤aaab_,a_ 08@Lp -LdM@`| KpPxKUX$| @00@0M0j l0  0p 4 d `0 t@ ׉@t0 0R4| 0P|UP QP -DLMğP 0`00p4,?70Ḅ0P0P0C \^ 0  "!l000 X4C& P 0 "!0,$0 R  ,XDT1P#0?Acd'PX2`Xd  00SdSh0d0h0   0S 0S?0S 0<Ӡ0ՠ0SS0S8à00 $0S?0S 0<Ӝ0՜0SS0S8Ü0  (0S?0 S0;0S  40SS0   80SS0   @0S S0  H0SSױ }?}?   L0SS11ױ ࣳ 1} 0R0  P0SSױ ~?~?   T0SS\1X1uױ ࣳ pD1~0 R0P0SY0 0 $ 0(0d , h000 4 080 }?@ 0H ~?L 0P T T0S@0S Qxt 0@*0lj 00T0<[c[c[c[c0cgfffat -LYM0_KP` ,0 zP@$|1Sd SKX m`1@9T`1 !0SN@0 P 0`<.` x,0 S ,3d!@RIKh BP@]KKY 0AP@0KZ`KK08Y 3P@Z`KaKxt!0lP@!0Kh 00H  0`!@0ꜤaTM -LM`@,0 B2p  0 S P00 Xp00C\ 0  "!$0 00 2C&  0 "!0!0 RbKp0Q0p1!`UN 0h0@0  @d0p0}/L000D1< ~/0001<  O  JZ ON,Z OX O ` 0T0 SX  9P0P@ t Ỉ Pnᯈ[c0a[c[c0c -LMA0 pp5R`0 P0 Pv)0S  PP 0500 50D`u0  $a( -LM0KL @ uP0   Q-LP`p# @T T0SP `@Tl0S )\  00Sp- -LMQ@P2P PA0 !V@6-R 0S:\/!P@VWV 0/h閡 ?0TMb-- -L Mp`P 0K@$K (K,K0` ^Pp q$弇 -L,M0T!0, @0 80S:SS R hƟ@0`,pKP``H 00 !<00@ 0`0c<v  80Sj T< 0KDP@01 00c<  80S E5p  x "DPP \ !1 01!  0p00C\ 0  "!0 00 4C&  0 "!0$0 R00P00P 000,0 0,0 0,00,0 8 <PPRk  P@ P<4(<"4%<0 04K8`KP` 011 01!  vP00C\ 0  "!0 00 |6C& t 0 "!0P&0 Rd00`00` 000,0 ,` ,0$ 0,0 (<4(<"4!<0,<4<("4!<00q 5 Qi 01@00c<P  80SD DED5P  8 "b>P`  !1 01!  tP00C\ 0  "!0 00 4C&  0 "!0|$0 R00`00` 000,0 ,` ,0$ 0,0 0<4(<"4!<04<4<("4!<001@00c<  80S C3P   "=P` d !1 01!  8sP00C\ 0  "!0 00 2C&  0 "!0"0 R00`00` 000,0 0,`0 0, XŸ , 00P4K T08PK$00  00aSʢ2$00  00aSQ01@00c<_  80SS M=P   "9P` (  !1 01!  T}P00C\ 0  "!0 00 =C&  0 "!0-0 R00`00` 000,0 0,`0 0,00,0 <> J$00  00aSʡ01  00c<  80S N>P   "e9P` 011 01!  P00C\ 0  "!80 00 L?C& T 0 "!0x/0 Rt00`00` 000,0 0, 0 0,0q 0,0 5   L8 R55 !<4<("4!<0 q<4<5<( "4!<0 q<4 5<( "4!< 0<4(<"4!< 0(<4(<"4!<0, r  4Ba<4<("4!<000,$,!$#, 4 r  D4Ba<4<("4!<0 $00 @00aS?1@0 0c<v  80 Sj THڬS3p   "8P`  !1 01!  Xp00C\ 0  "!$0 00 3C&  0 "!0"0 R'T00`00` 000,0 0,`0 0L0 ,0`0,0 <4(<"4!< 0 L0,wAv$00  00aT$00 @00aTo1   0 0c<`  80 ST A1P  | " 8P` `011 01!  4qP00C\ 0  "!0 00 0C&  0 "!0 0 R00`00` 000,0 0, 0 0,0L 0 ,0 $00 @00aSʠ0;?c2Mb[c[caa[c[c0L -LM pT0! 0 < 0 ` ` T0@  00CSn80Si0 0 @ 0 0P` 0 M00P@@T 000 $ P0P60 @ 0@|PP VP 00V 0K00 0qPT 0R ,0S r00( `P 0@ ^H $   0K `R O !<00P 00c<@  80S4 U< KK&PP Yʔ!0P 00c<  80S U KK 0PP 0K✠K⠐K  P`j ag 0娀  aP00 P0,$,!$#< K  0\P㨀> yV( V( Q  R  9QQ 70V00S T0@ ``Q  0;0000  0S 0SX00 ᑯ`0K  P R @  0aP00 Y0,$,!$#LT@TژH`x0@ l P0 P0 3 0P0R00S   <S T 0K╾P`x0 0R0 f 0 @ aP00 N0,$,!$#<<0崀  aP00 %0,$,!$#<Hx0 ;R0  |060K  0P㴀 b0K  =PYK  0mPP 0K  (PDK  0 VP9 x :Ptw <S( 0   *060T 0KP`00\0 0  aP00 k0,$,!$#0@K MP@@P80@K @P@@P80 HKH mP@Hw$00  00aSg01@00c<m  80Sa U5p   "+P@ t5! !Hp00C\ 0  "!0 00 5C&  0 "!0$0 R 00 @0@ 00,0 0,P0 0L0<,$,!$,4 ,<, 4  (<0lq$00  00aSʓ1@00c<w  80Sk WIڤS3   " +P@ |3! !P#0 0C\ 0  "!0 00 3C&  0 "!Ÿ"00 R'W#00@0@ 00,0 0,P0 0,00,0 P<4(<"4!<00,3d432$00  00aW$00 @00aWE1@00c<_  80SS Q1p  t "*P@ X1! !,p00C\ 0  "!0 00 0C&  0 "!0 0 R00 @0@ 00,0 0, 0 0,0 0,0 x$00  00aSʡ0b[c[caa[c[c0cL -LTMT T10NP S`P X \ l dP H0,$,!$#<h0  0@\l l0  QT 0 S<  T ,0Kil@T0 4 T!<00P@00c<$  80S U< 0K,KPP\\00!0P 00c<v  80Sj U\00K ,K 0PPl@T+ 01@00c<  80S ^>`   ")P@ 1 01!  }`00C\ 0  "!0 00 |=C& t 0 "!0P-0 R00@00@ 000,0 0,0 0 <,<4(<"4!<, 0 rJ 01 00c<>  80S2 t\t<`  h  "&)P@ L 1 01!  |`00C\ 0  "!0 00 ;C&  0 "!0+0 R00@00@ 000,0 0,0 0@+,00,0 (<4<("4!<001 00c<  80S Z:`   "(P@ 1 01!  z`00C\ 0  "!L0 00 8:C& 0 0 "!0 *0 R}00@00@ 000,0 0,0 0,  , 0001 00c<`  80ST \Y\9`  P  "`(P@ 4 1 01!  y`00C\ 0  "!0 00 8C&  0 "!0(0 R00@00@ 000,0 0,0 0,  , 0001 00c<  80S W7`   "(P@ 1 01!  w`00C\ 0  "!\0 00 H7C& @ 0 "!0'0 R00@00@ 000,0 0,0 0,  , 00(q- 6 Q 01 00c<  80S PVP6`  D "'P@ (1 01!  u`00C\ 0  "!0 00 5C&  0 "!0%0 Re00@00@ 000,0 , ,0$ 0,0 (<4(<"4!<0,<4<("4!<00q 4 Qj 01 00c<^  80SR |T|4`  p "('P@ T1 01!  (t`00C\ 0  "!0 00 3C&  0 "!0#0 R00@00@ 000,0 , ,0$ 0,0 0<4(<"4!<04<4<("4!<000CSh01 00c<  80S R2`   "&P@ 1 01!  `r`00C\ 0  "!,0 00 2C&  0 "!0!0 R00@00@ 000,0 0,0 0I ,0,0,0 H0#((0"4(,8#$ \0 4K8pK`   "c"P@ 1 01!  ~`00C\ 0  "! 0 00 4?C& < 0 "!0`/0 RV00@00@ 000,0 0, 0 0,0Q 0//,0 00<4(<"4!1 00c<t  80Sh UHf6p   "!P@ 1 01!  嬕p00C\ 0  "!x0 00 d5C& \ 0 "!08%0 R%U<00@00@ 000,0 0,0 0\,$8,#$,00,0 !,0 0\ *꒱$00 @00aU$00 @00aUc?P 1 00c<v  80Sj UHc3p   "$!P@ 1 01!  |p00C\ 0  "!H0 00 43C& , 0 "!0#0 R'U00@00@ 000,0 0,0 0,0T0,0 <4(<"4!< 0 T 0,*$00 @00aU$00 @00aU1 00c<`  80ST Q1`   " P@ 1 01!  \q`00C\ 0  "!(0 00 1C&  0 "!0 0 R00@00@ 000,0 0, 0 0,0T 0,0 ꐰ$00 @00aSʠ0NS$00<\T優-,'cMb[c[caa[c[c0L 0-LM@ 0KPP 0s0x -LTMT TT X L  T0\ !\0T@0Q<` l0 `d h \\0h $ 0@ ll0  QL ( S<  X,0K\l@T0 i X!<00P@00c<Y  80SM U< 0K,KPP5\00!0P 00c<  80S U! 0K 0,KPPlP] 01 00c<Q  80SE Y9`   "P@ 1 01!  @y`00C\ 0  "! 0 00 8C&  0 "!0(0 R00@00@ 000,0 0,0 0,0h0+,0 " 4001 00c<  80S 4X48`  ( "#P@ 1 01!  w`00C\ 0  "!0 00 t7C& l 0 "!0H'0 R00@00@ 000,0 0&0, 0 ,0R0&,0 H00&00000 04K8pK X0<P0  0aP0<0 '0,$,!$#LdP@d@ 4J`VRl\b h _ 0\``XPK 0PPX  `0@K >P@@0<aP0<0 dP X <4<("4!<PPP0@K P@8@0@K P@8@`HK 0H 9PH` n 0,$,!$# 0@K P@)0@KP@0@K P{@0@K Pp@tF$00 @00aSEb b_'acc`a[c[c0[c[caa \0s^ 01 00c<R  80SF dPd0`  p "P@ 1 01!  p`00C\ 0  "!0 00 $1C& , 0 "!0P!0 R00@00@ 000,0 0,0 0!,00,0 \ȡ<4<("4!<001 00c<  80S R2`   "P@ 01 01!  r`00C\ 0  "!0 00 2C&  0 "!0"0 R00@00@ 000,0 0,0 0,  , 0001 00c<s  80Sg S3`   "6P@ 1 01!  s`00C\ 0  "!,0 00 @4C& H 0 "!0l$0 R&00@00@ 000,0 0,0 0,  , 0001 00c<   80S T4`   "P@ 1 01!  pu`00C\ 0  "!0 00 5C&  0 "!0%0 R00@00@ 000,0 0,0 0,  , 00\(q? `6 Q 01 00c<  80S V6`   "rP@ 1 01!  w`00C\ 0  "!<0 00 P7C& X 0 "!0|'0 Rw00@00@ 000,0 , ,0$ 0,0 \(<4(<"4!<0,<4<("4!<0\0q <8 Q{ 01 00c<o  80Sc lXl8`  x "P@ 1 01!  x`00C\ 0  "!0 00 ,9C& 4 0 "!0X)0 R"00@00@ 000,0 , ,0$ 0,0 \0<4(<"4!<04<4<("4!<0$00 @00a Sʑ01 00c<]  80SQ \Z\:`  h  "P@ 1 01!  z`00C\ 0  "!0 00 ;C& $ 0 "!0H+0 R00@00@ 000,0 0,0 0, 4 , dv$00 @00aSʣ01 00c<[  80SO \<`    "P@ , 1 01!  ||`00C\ 0  "!0 00 <C&  0 "!0,0 R00@00@ 000,0 0,0 0, 0$00 @00aSʥ$00 @00a S<01 00c<^  80SR ]=`   "P@ 1 01!  L~`00C\ 0  "!0 00 >C&  0 "!0.0 R00@00@ 000,0 0,0 0, 4 , 0>ꗩ$00 @00aSʢ01 00c<[  80SO _?`   "6P@ 1 01!  |`00C\ 0  "!l0 00 XAXP8 80D  <aP0<0 ő0,$,!$#`   "PP 1 01!  ~`00C\ 0  "!,0 00 @?C& H 0 "!0l/0 R00P00P 000,0 0,0 0,0尟0,0 u$00 P"00aSʡ1@00c<t  80Sh THڴe5p   "PP 1 01!  `p00C\ 0  "!,0 00 5C&  0 "!0$0 R%T+00P00P 000,0 0,0 0,0X 0,0 <4(<"4!< 0 X0 $00 P"00aT$00 P"00aT1 00c<t  80Sh THڔc3p   "PP l !1 01!  @p00C\ 0  "! 0 00 2C&  0 "!0"0 R%T00P00P 000,0 0,0 0,00,0 <4(<"4!< 0 0,n [m$00 00aT$00 P"00aT>1@00c<_  80SS xAx1`  l "PP P1 01!  $q`00C\ 0  "!0 00 0C&  0 "!0 0 R00P00P 000,0 0, 0 0,0 0,0 $00 P"00aSʡ$3[c[caa[c[c0L -L\MT P T0\ \!` @0`0 P d 0Tt0 p tp0H $ Q<   ,0KX hP lP p R0 P !<00P 00c<A  80S5 U< 0K,K⌤PP` R0t!0P 00c<  80S U \00K ,K`0lPPp\L X0s 01@00c<  80S ]=`   "P@ 1 01!  }`00C\ 0  "!\0 00 H=C& @ 0 "!0-0 R00@00@ 000,0 0,0 0,,00,0 X 匜<4<("4!<001@00c<[  80SO @\@<`  4  "P@  1 01!  {`00C\ 0  "!0 00 ;C&  0 "!0x+0 R00@00@ 000,0 0,0 0,  , 0001@00c<  80S Z:`   "NP@ 1 01!  tz`00C\ 0  "!@0 00 ,:C& $ 0 "!0*0 R00@00@ 000,0 0,0 0,  , 0001@00c<  80S{ PYP9`  D  "P@ ( 1 01!  x`00C\ 0  "!0 00 8C&  0 "!0(0 R:00@00@ 000,0 0,0 0,  , 00X (q 7 QN 01@00c<B  80S6 W7`   "P@ 1 01!  dw`00C\ 0  "!00 00 7C&  0 "!0&0 R00@00@ 000,0 , ,0$ 0,0 X (<4(<"4!<0X0,<4<("4!<0X 0qf 6 Q 01@00c<  80S U5`   "P@ 1 01!  u`00C\ 0  "!P0 00 <5C& 4 0 "!0%0 R00@00@ 000,0 , ,0$ 0,0 X 0<4(<"4!<0X04<4<("4!<0\4K0 8`Kp   "P@ 4 !1 01!  `p00C\ 0  "!0 00 >C&  0 "!0.0 R$U-00@00@ 000,0 ` 0, 0$, , 08 #$,00,0 ,,0 0\` $00 @00aU$00 @00aUl;?P81@00c<t  80Sh UHڐc3p   "P@ h1 01!  <p00C\ 0  "!0 00 2C&  0 "!0"0 R%U00@00@ 000,0 0,0 0,00,0 <4(<"4!< 0 0,qp$00  00aU$00 @00aU1@00c<_  80SS xQx1`  l "P@ P1 01!  $q`00C\ 0  "!0 00 0C&  0 "!0 0 R00@00@ 000,0 0, 0 0,0 0,0 $00  00aSʡ$7[c[caa[c[c0L -LΟ@0 Z D   P40KŽZ`8  P!<00p 00c<~  80Sr W< 8K4K]pPlp Zr 81@00c<f  80SZ ]=p  |  " P@ `=! !@-p00C\ 0  "!0 00 P0kHP1$00  00aSʚ81@00c<^  80SR S3p   "P@ 3! !t#p00C\ 0  "!00 00 3C&  0 "!Ÿ"00 R80@8@ 8040 04P0 040, 040 $00  00aSʢ1@00c<|  80Sp WL R 2  t  " )P@ 1! !   !t00t00C\ 0  "!t0 00 `1C& X 0 "!88!00 R)W%80 @8@ 8040 04P0 040040 P0P <4(<"4!<0P0,\\$00  00aW$00 @00aWbL[c[caa[c[c01@00c<a  80SU `P`0p  l "P@ 0! ! p00C\ 0  "!0 00 1C&  0 "!((!00 R80@8@ 8040 04 0 040P 040 y~$00  00aSʟ -LM  T 0  Q  0;#;S H 0,$, $,#,0.0 x t \ 0 0@P\ |0K0s` !<00P 00c<  80S Ue< K|KPPL1@00c<@  80S4 ]=p    "P@ <! !Ἄp00C\ 0  "!0 00 t\`L Kd9 ^P%@0 0@0 )0K KÎP@H0K K 嵎P0 KK 婎P0 KT DP@@ 0a^00 @<4(<"4!̃0 a^00 0 KP ]0K K nPS@0K K aPFZ@ 0 a ^00 D0 KP1@;H -0 KK =P"0K K 1PK  K0`P  q0K K P]z $00  00aSP b2[c[caa[c[c0L1@00c<x  80Sl UHlpl0  x "`P@ 0! !00C\ 0  "!0 00 1C&  0 "!04!0 R)U%0 @@ 0|0 0|0 0|00|0 0 <4(<"4!<00,A+>z$00  00aU$00 @00aU -LM@`pc0#0 0P  \, 0 @0 P00C\ 0  "!0 00 2C&  0 "!0"0 R ε@08 0R@0000   P40<"EPv 0``PW000 zR 0 s刵1P 1 1 bB&! 02 S5ʌ1b1 R0@@00@P00C\ 0  "! 0 00 0C&  0 "!0  Q0zyY P0 0 ,K,0@\ym S@A[c[cPa[c[c0LaPa8a -LLMTPP@`p ` d T0 P  X  \ H $ ,0Kf`0PS0 H !<00` 00c<9  80S- V< 0K,KP`Z0d!0` 00c<  80S V0K,KP  0P`T04K8K* P@0X 0@0 0@K @P@pg0@K  5P@0P:1 0 0c<r  80 Sf VIu5   "P@  !1 01!  lş0 0C\ 0  "!80 00 $5C&  0 "!$00 R"V,00@00@ 000,0 0, 0$, , 08 #$,00,0 *,0 0P {zw$00 @00aV$00 @00aVt)?P1@00c<u  80Si VIژs3   " P@ p1 01!  D#0 0C\ 0  "!0 00 2C&  0 "!Ÿ"00 R%V00@00@ 000,0 0,0 0,0 0,0 <4(<"4!< 0 0,v$00  00aV$00 @00aV1 00c<_  80SS |a|1p  p "P@ T !1 01!  (p00C\ 0  "!0 00 0C&  0 "!0 0 R00@00@ 000,0 0, 0 0,0 0,0 zv$00 @00aSʡ(b[c[caa[c[c0L -LC2"/P!008BS@ CK?#404p$@WDtCY8 ,0 <  004,  `3T@,.P@1@#W<&P@1T@XP2@p"S 0 S08 SL3 R2PPP2@p"S 0 S08 SL3 RPX P"00 SPPP#00@ SPDp.U,@PD `P"‘\00pS04pS ࠡ`P PP ‘\00@S04pS ࠡ`P  - PL\`@pP 10SBt0 0Zz8 0 T 1P-m@ y`,@\`pVP3"0 SPPP#0 SP8 0P`X8 T`0l!`!R @ R D0| 2a 5@1`& -LMPp  P,P ,@`VPUPa 0 P` ,@V,0`VP 0 PP`,0UPV -LM @PP4  T 0cSP\q8 0 B0C0 Y0 0 0! d ,K0LP`,8"HPQ@ 8  3S aM2  0 T0XP<0 0!8?\>`0 0/ ?> 00cR#`[ P80iW00\!8?\>`0 0/ ?> 00cR#i P<PX!@!400C40 g!40040T0XP%0 @?Q>`0 0?>0 0c$00C$0 P B 40P 00C 00@0 00,oL ,|,LXU `a -LM @Pp4 PP0 00Uz 0 0 ! 0d 0,K`KPh,"H`0S 3S LY00U 2  00U T08 UZ P !40 SPUUA 0 0GPp7 ^!?Q>`0 0ς?>00c  ^$00j$0 P j 40  0Z0j 0 40 j0C40!400400,x$K,Y,EL 0 ,?pv0 8 Z00 ?Q>`0 0ς?>0 0c8 ^$0j0$0 P 4  00 0 40040,K0 ,pU `a -LMR pH @D 0Pd ( 80P(X`0ZC 4R`0 7  0*00C0 P B 00C0| P @P 0 0` PE3 RX0  200000C0 l3 RT000T0 0C0 0員 800c 3 R`0` Z" PXQ0 P%R4 |080 <  2@ @!QT000T000Sj \28Q4 X0 20 0<,0 , @P0 z0` v4 40@P`,P0S4 @T40TX P, 0S30 Y` 0`<`80iLq4 T52000?00s2 q4 T52000@0@ PR`0  0PV.L5sX50 0S`0 RQ0@@0 0 lh`00 DD@T,P0S@TPU p -LM `Tp 1S0 0 ! 0d 0,KFIP, 8 80"H@0S 3S 8Jh$% 0WP0SPU 0PG0UC0SPEUT3 Q, 8 Uʼ000  P@ l?p >14 PHX P0 ^ 0 S40\4 \` 0n0rP02U8(@8  /P80PU,080 , 8 8I80`V`0P,080 8U  -LM P`P@P00 0 0 0! d ,K0HP, ,倂HpZ4  3S I 0S H2T  080  8 @>Z!\000/ > 00cR#= 081 a4 ^Ϡ\0.A00/ }P  l1@R\0/ pPI <1 Z\0`000?0A0@ P@0.Z\0!00> 00c# 00 0C 0  P B 0 P0C0 ,H0F Y0 00 P 2 020 0RU `a @ -LM p`0PR 0O0  0d2\O8T 0A0U2Sʼ@r0 $0X: %00 00 ! 0d  ,K0GP,,$H@T 3S H4  '00U 80A040 ?80 <448T`0.!48000?.a 0 bS1P4 0< T0USZ% #@?T>`0 0/ ?>1LQ l3T`0 0?>0 0cZ$00 0$0 P R  0 0 0480 24R`008008?.a 0 bS1P< 0j 2 `R4 `0RA P00,G$08 0a$08Pl 0l  000 P 000| 4@Pu@P0 k0` gPE{X1 RX0  2000000 1 RT000T000 0 0` T`0PB P 0 R`0 |  0A000 P 0 000| P0 `U `a -LM @p,0 Ws*4 0 0 4 ! 0d 0,KRFP`, ,x!HPX 3S GL1  01aY\000?0p0S9. 0X\000/ 0900 0W0p500 0   P4  P000 ,F00C0 P B 4 20C20< T=S0 igU `a0P -RLM`, p{ @k?Q1 Q`000.,0Ae8崁/.  b  B020!Pp1 @R, `08P/.  b  B020!P5 00`,,08P0 eS0Y`0.!00/ > 00cR#0@g0P 0 S P Q,0` X, 0@ 8,0, @/>QU OD)h)G-M$PP0gl0h `Qpb?>1 E   @$?p > 1^ࠡD T! 0  S \ d@E? >j1^࠱D T!@  LP \l0 \ 1 Q0 110b1X10l1$5S!0SL\ T3Ѝ?>1 E -0LM 0  -LM pP@P 8500  Y b R00ZZ00 PP Q P P@ P ʤ0 5R5=:\9:0 PU00 U00S Z 10 0@TPP`S PP` 0S:0S: P0   0gDPP ET/ 8%0@0L 0@PT R   0  H  0 xK@ PP 0x 0 0  0S:20S/*@5L 0@0   xK 0rPP P  0PSF 0d x02T0 0<H 0@P0@ |0Kd KPP |0` 0C!|0 @t KT   0 0 dI0 K0CPPR``KH|0  \A T Q xK00  PP4x@0dI@ 0 PE d03 T0 d0KH<`X0@PCPP ?P00SA 0 B  CXDD0t@KT` *0 y00 T`:P00 ViD 0!0 d00!Q0Ad0D0 K0@CP `0KH  CD  0/ r~D PT@ 0!0xK 00 uPP x@P@ 0 0 PSE d0 3T00 00!0A NCC0<H0@P6D Px  0 K 0BPPZ0 0f0 0 E d03T0 0 xK 00  PP:x@0t@ 0 XPD d0pK3 T0 H<b0@PBPP!` !@0 0 00 xK0   0=PPP  厜 0 Sx0 0  B C85@%0 L00P ,D -LM0`K@0 @PRsT0@0 000  00@ 00R00S  T000T0 U000U0H0P@ N  ,5SAڸP` 0p0 0 0$@ux`0dCA0 ~85@0L 0 @0Kd 4@KK1" 4K1@T S0   000@ 0 EV%$@P P@ 0K 00PP@^ U P0 #0?Q5:^:P0@ ʙ80S 0` HQC @@85@0L 0@T0@D 0OR:Q:P1Sd0P@00T 0S 딤a -L4M0 P0 80 P T 4 0\ D H0 t0@H@T H 8XH00@ 04D@ L@ A< 00 m85 ,00,0<0<0 <80&Q0 >< TPIz<iEPP08<|HT 0 PP  P$P80Bd4 P  QD 00 ttP00C\ 0  "!@0 00 ,4C& $ 0 "!0$0 R0 D,thA@ T0@ @<N?PPT Dt H0@B4T 0cpa@DVHTp 80SRH_aV]D0SS b3 @ 0D2 bB&! 02 S;1b1 RD 0D D 00 xR@00C\ 0  "!D0 00 02C& ( 0 "!0"0 RP  T] ㋏<00 :00?d "L0,K0P P,0TU T P  0R0d ",KT0P0PT0 ,0PP P0L0 00P0 I\<z?Kg]4 _D @P P  P  P P P  P  PPt Pl P<e?0`L딤aPa[c[c[c[c0LaPa8aa0aaaaa`a -L M `PP@p  P 04 OR5:P:0 00 ,K0=P@ Z,85H 0,  ,?85@0L 0 A-P8@T`p T ?>00c0Q3@T TX0X  0S  R1 018ĠOD)h) -80L0CS%Ȥ,,,,0S0 #Q00 L0 R0S -80L0CS!ꈥ|000 10B0  2 R0  00 -80L0CS!@\x4000 10B0  2 R0  00k -80L0CS!T8TTT0S1 S20#B1  0S 00= -L7 -L. -L(< -L"\ -L -L -L -L  -L -L, -LX -Lt -L -L -L -L -p1LMhQh!00`SP@D1DqSP@ ,PU   KQP@ U  P@  0 0 R  0 00 0!0@Y *  H Q q  00C0 xQ _,aa_a@b -L|M` Kl P& P@ p@&4$0S Q 10 pҝY 0  @0@3@00@  =S3@0TA@0T<Y$ @0! 0 Q=S@0 0  0 P@ ,帋,LLQ @0(0$ ,MP@p80S@ T|0" 0Q@0 Q @0 LMs0  0mt@ uT@0K 0X | | 0S@TT0KY C)ZaTKl \H 00S @0 p=Y YҐ  0 Y @000000LY@K0Y )Za0Y (Za X@ D KXP@ i1@d Zs0  0s@ duT R0 l@  @(@03@0@D_l -L M@@T,U0 R\0  0ZP4P匀`p0 0 0$@x`0dCA0  ,K0k:@T 0x,0 H 90,; S -L4M@0@pH D@  1`r 0H @@2ZP tU0x@ KsP@0L(@  ?DK 0*:PPwD2H\%R0 R1Rh0 S\;1PT3h PT3)h0 SD 00:00DE;(5D02H 40@P PUL #8 P R4 i0@d 0 DK9LP0P L0 +D0HD;80P Y 0$%R ,0YT ,0Y$%H0\8 K4 00 8 ,` 9S H0 hdTcȯ -LDM|0R `0pVPP ;UP6 V q@0 @@]YP sU @00L0  0JrPP000 KprP00L(@ ? 4 < 4@K  0*@49PP 40H0@0 \5Q" 5Q OP|0@@4PL 0R !r<0S (<%Aa:,c@0 R5Rh0 S@0-0R0 0L0P0@0" @ C@@LL5s00 P P V V< @h <@0\%44R0 0@<@40h H@h0 S4 00:004:<4P L @ 4@ @W@H $5S,0 AXP ӈXH@\D P)8 H@ @R4 l0@@ 4Kd  0 X 8DPP D 40H49@4P 80X H0\@@$%R ,0D\T @,0\@$%< h!@@0S 0Sl0 0 l @@0(%:D @0<@`t0$0d <( 80,0\@Z|0@LP@LC] @80K!*&8@a@<S΁>`K@ 0P K Q0O`0@\4 O PKP@05SP KL0S@@@0 0 @0@0000< 0%P@P PL@ ,L @@,L@P@04 鼤ahdTTcDlE-0 LS03R %5p00P5,5S ڬ4S9Ӭ4հ4S@0Ӱ400tA/SpPo5@"p%$\ZH0L0SO/͎ -L M@0Qp `: P@ҍ X 00#00 P@р Lf|  0?W 0Q Gp@PPNKH@0:@0  -@0L Pp  QP@`@0 S@`V PP@P @ o0 0p@ q  -p`P\LP0d -40( 8$@<( @`@, T0C0H0VZ  Z Bl  D .T p-LM0@SP  80S 0hl0S  N`V p  0Up0S0 *qO -LMq@@ -R`P =S@ 8 K8 4` , 0@ P8@0<K#=0T00 \ P S  <0 PP ST 0@ @ n  0 p0S  Pp @ =SPP 렿( -LM4 qP8 8 Z4,0K<Ÿ xL@T,G`0T"0 p@00@0, `,001 1PP@ ,DOT P 0 0 0$ @fxr`0dCA0 0K05P@ ,O078  x J00 H 900 70 ,0K4P@1S ,5S9Ѿ)1 !,080=0S01,0T @000,N80PccHOLcTc@-@1T0, T:F@W 0000!  -L MP, 40@0 PPp#8  R4 g0@d 0 7 H`p,QE |680p W 0\'d0T   c @000h 0t7`00h HJL5H sP5,5S,>QS. L60f50P0 SHŒp011pGWS500P000 `a 0-LMT@PTGD 0 0((@0h _c<-@-QM@ 00CS | P0 Ѝ@-@Ѝ $  4R8ROO -L0-0<`L0 h0ckPl T l DP8R\ -LM80S <<4 0 00Ql pp`0,0 R@ 00300@Tl R@ 0 3P0S~ U@Wl p 0Sr0 #SQ`00C\XC 0  "!P0 00 <3C& 4 0 "!0#0 RD ~P=2 0`00l R ,0S0C£`00C\ 0  "!t0 00 `2C& X 0 "!(24  Q  0S00 PPQ00j W P0Sx 0S p0S 00 10SHP00300e000PQ3000`00C\ 0  "!0 00 0C&  0 "!0 0 R, R 2 0 ` lP+ 0S1P nP |00S @0 ([c[ct[c[c0da 0-PLn@T 0 08@0c -LM@`oh -L M @^ 0    Q -LDMT@d ` d0 h P`P匀 Pj@h pTXpKU\PK  0P@q R\ "1 (`!R0 0  R` V` 0h S0, 0Q0 0 B1RP\ p; X@i T3 U100d0P  0 200P @  H\@0X0T00S 0S $0`V * h0^1 ,1 S 0DS\0 pU1(0` 30000$ `V*h SH,!0 0Q (00 3&T00 8kL0 ,00,0R6P@ 1 V2Pꔤa -LM00 T0, 01P<0 00 \b0 \8 D0 Dp@ L@  ɯRe <$0@' "p X Q@  g B@ 80SG@0l0`  c4 @ ,0bR 0 4 0 D0 , .@ 40 @ 8 S% <0D $@ PD 0 p0  0 :0OW@ Rc",0'&4 Pe P 04P ,0 00SD8@ 0`0l0bc4  -,0 L 0U0 0 `c\cXc-X0X  00P0\ P0^P`c\c -0LMxxpP@`0 0P 0T P0U$  GP 锤a`c\c -0LMTp@ 0`P{0 0!R 0U R00 R 0@@0V0 Z{锤a`c\c0S R00  -@1LM PR`@ @0S@9S 9S0  iQ  6I 0T @0phP 0 0000)0yp1  T J3 0-h0L PR @0SH@7 0P>0GzJ3 -LTM ` @0&p  d h ` l ,0 0080 `X 9: S\ 0 @d |gPP  T0@  00CS ` 5PPh 0RR<0 4 D0 @0 p  0 004 D0 Th0S1 PAT t Q t  t 0@_SA0S=p0H0 pt0?L  $4K LP Q0[T@,P,0K/00PPmp4Q;;S 8 @ ,0H @0S 2 R40S P  T0D R00000cCQD Q080 < 4 P T0D 0R  R 0L0 0L00 PRP p Q0HQH 0〠 BH 0,Peh0SSp  0S0h #70R00S`0  50d  fPP*4Q't x0@;DP P?0/;?0|0 X+Q   Xl g060h0S 8<P 0R P x8;;S8L xP0bx0.L@DK 0 `@`P*D0S'\ P P`YX0T DQ  R 0.SR 0.SH0P 0PX -L8M0`\@ p@: \@7 P@0< K8\08 pPP`P@@T0D R)0[*0[S""[0R0 0R@ R B@00T@ K0P@ @P T @PB@..- -LM@ KP 0 0 0-@DP L@\GP00 4 0 0 -( L0S 00_ p-LMP` KP0@0 9S !0R 6BF@ p 0- D0@L 5 PP0sh02 -p0 @LB 0   PP0sh 000H r A08P$CP20D 0  R  0S  000  0-LM0@ PR0KaY0 R 0 0000 H@0 t0  000 0000 H@0 0  `a -LMDpP@ 80SlLLllLlllT0@ PW 800S  ! 0}F -LMp0P$K`X0 RY 0T 00$00H H 0$@p1  0000  9:0  1 0 ! 0H0 0(0 , 000 4 080 < 0D0!@ 80S; ST0P $  1LO$K48 T0 8$0H0 00$00H H 0$@0  `a -LM@P0S` p0s 0s0s$0sH0sL0s@0sD0s$ T0@  1R ]P R0 2 RD00000D Q  20S q T0@ q 0Ph0s4 s 8 00KRj gR` 40pPN4, 0S:00 S*(qC T0@ = 1R P \0  0#`P(q00000(s00 000Pq T0@   0.u f 00sT0@  R0s0ss~YD 8#8ST!880$0Qa -@P1 LRp` ᐁP! R 80S   fP  9:9): )<0 9  ကO -L M`0q00 AA0ppx Sn QPP A 00T000 1Y,0 00000 PP 00,  0  qPP,, 00PP$ 0 PPP<YT000T 0S9;9Y 0S9;9, 00 AP 00,J0   W X  ῀PkE p-LM080S 00S 0 \ `T  ? ?p? 0 0Ju` et e -"LEM0`,0 8 Rpq T T0RhW  (^P[P1 PQ0QG0 0 0   0P' 0 0CA  0垵v =ew 8eW  `>0 ,0S ,MOK  0P _____Ꜥaa -`LOM`0 P,0 <P e_V>8T>,0 S ,屟/>F> R T0Q\ 0`) R&0L) R  P' @!b]P@89D L )RD8 0SL!ȟ0 \X  @![_@D9: S x ~d<1L H S0DH1 0)D0 0)D 0P@\ 0 8]\@!@8'_LP!0TRQ  RT " TGH1S<=@0L0@0 DP@@0 t OK +9P@5<1H SL 0H1 H^ HL 0RD0R ĺDH 0S L9 . 0Q* L1Q& H1S@! H!Ri=L1f=~=YD000@!8\PD0 0 BA00 8L=H9: S Y@TDL9^ \ #6HP@Y' TPL00C0H!T0\0C0L9 0C 9 H9 0C  9<1 0P@u c=KP`P1 p 1! 1P` P` z 1 P; ;H,0 S <,0I00P1 8  )0)0 0) 0P`XT0D 1RSK@0L1  U?K@! 0@ <P`90 0 0 P|T1SKH # 0P`1T\P`MOK aTP 0u`V y a P10`~000)0A B0)0 P:T\Ꜥaa\XR@R -LMPp@` Vf |0S ::00S Bu Ya:: wP 10S 10S 00C0  B  0P#w .aN*)0 B00)9 0C 9 T0 @ @00 2*000   : -LM0P@ 0  rPp0s`T0D`P 0 @A  0 A:    ppWp -Ljp\:> xo` @TL T  TG  TD T Th  T=`  T:TP T5H T2hPa[c[c[c[c0a0aaaaa`aLaPa8a -LM@T0D0Q S1S 0hJX 6 0T ?k  0T 6k0Tj -LM`@\80P0CSTP0QA q 0|0 2D 4 A!P0009%P0P0C\ 0  "!0 00 1C&  0 "!0d!0 R=T0 ;YPpTq<HIT@p00@;0004P 000$P0P0C\ 0  "!0 00 l0C& d 0 "!0@ 0 R}= :[c[c[c[c0 -LM@P0#Ƞ Ƞ0,4 劶 9T其 1!<}80S Tnu\< - L 0000 x5b - L 0000 5b p-L M0`@ PR1!0p KN0 R 0 00 00 H@0 |0  000 00 00 H@0 0  4b`a - L 0000 x5b - L 0000 5b p-L M0`@ PR1!0p K6N0 R 0 00 00 H@0 |0  000 00 00 H@0 0  4b`a00CS %%%%&&&& @00 0 ; < 0 0-LM 0P@ P0+0 -LMPp@9#68Q0'0'0'&&0'0''0'4 4`V 0 | 0040'687P`0$KS<00<0NH$@  0P4 2b -LEMDŸ` , @00i N?KPP ¬ 51 ,0S ,H81 p  01 PP PP d堬 1 850i0001*"818)  3 0PPMOK  8 0PPP 0  |5810tdd` o50 00 )818 8  vP wP9;9Ꜥaa 2 1s s 0080<00 s00RpRR< 0S00 Q0 0 0S00<0@Q` 1  40  aR ,0000 0S@Q1 0 ! 0,00 00@Q191 0 S  -LM @` PRp$ Q 0R 0V`#V($@`.l6 P  0$00  d 0 -L0M0 `P0Sp9 : S? (@@  0P@& T0 Pp0@Q +R"0 0S0050500 L D(@0ˆ v哱1hc`a H 0-FLP墱\ ,0Sq 0 S R 00 -LMP @ 00Q ^ 0RP 0SZ(@n 0" -LMPp  P,P F`VPUPa 0 P` FV,08`VP 0 PP`6UPV -L M @p,凒0PP 0Ɣ&0,KyPV$,0jH`PPUI j?>1 1@R#P P; j!0bR0S- PP0S$ P ]PP?>1!E , B 0H 0C0, $0"Q ,t -L M P,劂@BP00  0ƕ&0,KP^,0TH(` (`ူ>1 1@R#@  d> aq  P/ 0lA0 P@-J.!1D0,0C000*  R0C 0,& 101,(0J"p `ӬP;  $ ,d -L M @`P`$% U0: ߱ , &$KuP$0$`Hp?> 1@PR#  0,0 00D 00$7$; 姱į -L M @PA \00\0SC(ɯ,6倢0 Ɣ&0,K$0S-,0(H`妯Qp Q ;  ' 0,&0 00 00 Q,& 10C1X0,R< R,F; d b4 -RLp`$P@ $P``A0Qd P 0l1 P0PL6P @ܫP;  Pt -0LM ; \ -L|M0   0 Q0p  0 Q0 Aa@T &xK0yPPx00x 0x|K 0PP 0| 00 p &0P0x &|02T0 x0<H x0@P0Kd KPP0` 0C0 !@tKT P   0dJ& xK0#PPNx``K H0QA T  g 0|K 0NPP/ |@dJ@ |   0&PE 6d K3T0` H<宫0@PFPP0SL 0A x7xx%0t@KTpJ:Q! (0P ʀ0dKA`0&0`x 00: 00x0 @PW 0$B00 :0Ad0D& xK0Px `0KH xxb6Tp:T=0! 0{|K 0PP |@@0| 0 pA x0P&0P 63T00 00<H0@Px0 &K0)PPT& 0n 63T0 0|K 0TPP|@X@0t@ &0POx &|0pK2 T0x H<巪x0@PxOPP`|  00 0 TD -L M @^ 0    Q -LDMT@d ` d0 h P`P匀 PB@h pTXpKU\PK  0~P@q R\ "1 (`!R0 0  R` V` 0h S0, 0Q0 0 B1RP\ p; X@i T3 U00d0P  0 00P @  H\@0X0T00S 0S $0`V * h0^1 ,1 S 0DS\0 pU(0` 30000$ `V*h SH,!0 0Q (00 3&T00 QL0 ,00,0*P@ W .Pꔤa@-9 : S 1@@0p-:  S`P \0V@1 u L0S d<0  dPpVq -01LM PR`@p @0S<9S R;pST0@ !$KF$0)0J0  (P0S / 00 zp \13 -LM@T`@  0pKmFP 00 T00 P HV@0 1 0 0P 00@(` 0@Dp,V0Rଫ$師6&4K0P@ 4g000$@⒫40 H 7Y 4_4 `a -LpMX` _8 0BRSR< P. K0 X 4W10Ɠ&0G P৬K 0 #P    nn  000  076P &v K  0P  0 Fnxn0eH< @0Ƒ& F @4 6P@#!B0 6#1 |K a, 6< 40 DℬP 4K1S40KPU BZ P U ,0PE U 0C00 0 0K< ]|K< YK <XeX"0 4 @ 6 #1 c< 6P35@ a B8 ` V(4K1@DS PUZ P U,@` VPE U@D   0 l00 )00G 6$ 04K&@0K"1K H4K1P  S0  00  #WC  >Q000  0T0DP0OTSU0S  U 锤a -L,MH L 0 40 8 \`8 < @ p PFF$1@P U@ 4X@ 0  0 00D ]D@  5 ,00,00 <80&Q0 :T`FN fP@-4H\U8 PP  P$P80BT4@   R< 00 hd@00C\ 0  "!40 00 4C&  0 "!0#0 R8 &<,80&"!h! B% MLP<@L 8@ 6#1PCU bpaPEV@Up4 RP@[aV\< RS R3 @ 0<2 bB&! 02 S;1b1 R0<<  <00hb@00C\ 0  "!40 00 2C&  0 "!0!0 RHL1 c00 :0080&L0,K"0PL@,0HL H  0R08&",KH @,0LT L H H0D 00H0 \f16_b< @P P  P  P P P  P  PPt Pl P e0PL僨딤aPa[c[c[c[c0LaPa8aa0aaaaa`a 0-@PLB/$  0000 D000000 -LUMT0 ,0 08`1 Q`0p h 0l t &`1 B@000@T `UoK TW?KT1 @ P XA DA T  T$T80B4P 000P0p0 LP$P00C\ 0  "!0 00 4C&  0 "!#00 R0S ᜤ 0 \q JPd -D1P0c0Wx1 $*@TMoKPd  T`!>K0\ |wPd l1ğS t@t Pl1 xU:h!2 2@ 2 b2B&! 02 Scʈ1b1 R0pp00p48@00C\ 0  "!0 00 1C&  0 "!1  Q-0@h!P0S:`!0S:PP R d1Spt0a0 d 1 ,0S <,}0a 0/a$t  `l 0t!p! K7P@`Qx0 0R@`pd0S0@ 0Pp@d ` px0V`0MKS >K>Kp @Pl!dG0P0@0|0S |0`P/VUh1 0@ J H F D B @ > A?(K <Ꜥa  -L M@0Kx RK/P 0G000Kb0K/P(000G000 -LM@$K_` 0K pP#0 0 L0S+ `0( 9 #60C Stiiiiiiiiiiii00$JG0000000000 0  -L@ 0R F? @80S IW8FW01鼤ahd -LMp=P@+Q<` R% 80 S|00>< Q0?@4, W WW@0 :@0!HP303! -PL aP@H p T>0 0?@ ^@ -1Ld1#pR@R(6L 0R&H d0E PU0S: RP6SS!/ Sa, RPQ0S6 0&U  0`0f 0 H 0T c 00   TZ 㣝Z 㟝 D ʘPQPכS 0-80LS@P0 0l0S 0LS  0S 00  >0P0r -LMq̠PܐY@8 K`'8` 00 , 4P U 8` =  0>0S `?T 0S80 0 `P`Ur`a( -LM4 08 <0 < {8 P@P3 4,0K>PP0C030ßp   P 0`0 Sp00C\ 0  "!0 00 2C&  0 "!0"0 RGeTh"0P,0`,   p<  p 吀唀JPP ,U (PJ ,F0 B$ 6&0K0kPP ,080$ 00 H ㈜;000S0414 ,0K4JPP @00@0 R0 0S0050500,T0@ 000,8 ,^8 00YP 1I#qG H@T`E80@pc[c[c0a[c[c0Htclchc`a p-LM`0\0 \@@TP (0&\Fp0  KP @p 9S Q 0R 0F0pp 0000  - -LMpP0+p@+`HۛU p -L MP, 6Z p&ƕ R0`00&,@0H崛,0S  6pV0Z0X00S  -0#LRL R0SR T0 S5S L嬛`0 Qd0 S- 0F2 p-LM`p0!P 0 6P@ 000HqO08@x@p20   0 0S  -LM   + ;! -L Mp0`(KP30H 00(00H H 0(@1 0 000 @ 9:#:0+ 9 0+ 0H0 0( ,0 400 <08  D 0100D0 @ 80S; ST0P $  0L@$K48 T0 8$0`a -LM@P0S` p0s 0s0s$0sH0sL0s@0sD0s T0@ |)0S 8]PI00D01 0  00 D 10S 00  qk T0@ T 0P"0sX 80SS PSI 0p"P(q; T0@ 5)0S \P \0 0;P (q T0@  00000(s00 000Pq T0@  000sT0@  S0s0s -@P9 LRp` \P! R 80S   r\P  9:9): )<0 9  [O -@qPp))0``u[SL `\P );SR0[00Ri 0S9;9Q 0S9;9V;U \P -@L80SpP` 00 0  U us Pp+0 B00+ -P p80LS`N T T0REV  9P8@1+R.00&0 0+0 0P +0 B00+V  ;' SP A;<;7;3;.;a -L\MP@H D T0T `R0pX0 \ `  ;H0T HP ; D Q T0R0 0 0 P X 9PDx8L T +RL00T 0 0d0  X  ;L9: S H0P T S0L P0 ; L0 ; L 0Ph 0 Da9hX D:T\0` P ` R  R XCPQHk TLHP?0  HK P4H0P ST  0P0 P0S  PT 0RL0R 偖P0L 0R T9 + 0 R' 9R$ P9S PQ'T $YL000X Dj8P L+0 B00+DD&P9: S YTL YP`Q00 S T0T+0 B00+PY;0C; ;0C(; P 0P000H00 0 0u DK  TDPY yL P PT YT0S PPD`P00 S PP; 0C ; P 000T@; 0C; 0 00 @ @K D 0F6P.0[S L `#m"[T3R`040 0 0@ D 0&6 T P P P;SBY =TL 0R` R00 S T0+P2RT 0+00PT 0~PL OPE `Q00 S T T; 0C ; T 0`DX e90 7H0P0X00S+X#0S T L0R 0 0 L0 X D@9TL 0\ 0/0 .RdDX -9 07X "980S 8H D00 0 0Q 0DK 0 . D 78@ `|.. -L020 k3 ( p-LM"V@``  00b0eS $0S 000  p\ -LM@ b HP$ !ẋ0 $R01 0$0 -L@ MT, p$PnP1``0@Sd\0!10 l1R0011  0S@SM !R1 B 0 0 T@T+Q1``0ASdQ00!a11\00!11`  J 0T V00!11`Q @T, 00QP00!11s000  -0LR@@``TPp X$ !@RT01 0@\ 1  ! 1 @ 00CS0  Q00Q0S@ `FR00 -p@L`ᘆ@PAU0$ I  A0 0$bp G0S b0 G0S0 b GP0 b HbH嗇0xc$  ?#>C@0c c_ -࡟LM|0x 0PbU|0`2,0 1, 8Pp` a1  0 S @00L l00C\ 0  "!80 00 $1C&  0 "!0 0 R$ P p0S00@@ , <x 0 0Q0x  p0Q0p   bG@8=4ZcdU[c[ca[c[c0_0 c  |00`|0c-8p0P0 0Cp  0  0 cc 0-@LTP 00ST 0S 00 0C 00TTp  0pP0002 020|L7@0 cc -LM 0@SmH0 S p00Cp0cP0 R0S2B "0 -0L@pT` PU  PR00R00SU@TP_ p-LMP |P` P p@ H `202/ 0 -(0AL0$1@TPop 0S @TP \0@S000@`p@ ,0SDc p-LM0P@ R*p0@S 0a!p R P 01U`P V000V00C00S R000  *Dc0L -LM @R)(0 Z$$ aV p@P0S@PUZ0`ᶅV$ ZcF|o骅mGp00Cp0@T  0>0 S   -L MRP,A`  |*00΄S {D  0o 0 0~dU  p-LM@ ,Q,00`0,0*z*0,1pdU0 00@- @58 0  0 @2(  0P 6@c -bLMr, 0@00,0( tB00C\ 0  "!@0 00 ,2C& $ 0 "!0"0 Ri?4́,000C\ 0  "!0 00 1C& x 0 "!0T!0 RF,@1*0PP?00p  10S0 ,0P04,0p00C\ 0  "!0 00 0C&  0 "!0` 0 RT 000B$~[c[c[c[c0dUc  0-LM@P Q 10S Q\ 0Sl, - 0P PY,0 0 1C0Sac  a -0P@LT`p , 00S @TV 0 R@W m!@U0S10S SL0 Q* Qp `0SPa"clU -1Q0@ L , `(a@00C\ 0  "!p0 00 \1C& T 0 "!00!0 Rh10 S, 8 p@00C\ 0  "!0 00 0C&  0 "!0x 0 Rh 000n,H0* 0hT[c[c[c[c0cdU -|0LM\ d y\0+ KK! #8(dr$ |c0 c c  -LM8 04 S8 p0CP:wp 0`ZC%Z0>0>0S1#~0Zp<0  40,K P<   X00 P00S 0 X3ZP<@e, T @!8 ZL!< P d0p` @000 `TX00  O2P0000,t 00K X00 0P<\ !$ 0 ,2dU+a" -2LM ,0 0`cp,@p娐PLA P 0x,p^,K 0  n TP@ 0 P00(| c c0 c__T_cTc'dU0  -LM>\0ǠȠŇ@`P'0 ` p P` P000]U 0 0 )00 05P({ PP `    -0ap #6RL`QP: PP@ 2% " ZU:%@T  P PU@  0S:P 0S*2 "!6Y% -0a #6RLP Q@: PJ% T: R p$`QV  @P 0S:Q 0S*% -LM.0 L (0K^ #̌P@# 0p` @@ PD ,1, UL0`pc!  0 #@T  ~0 04 jzZEUd},4H0 h p0S ),0 0dU Tcc 0.  0 -L M0@蠟`p P000 `V00 0P0000 . .,0K PP `X0 ,PW  0 b0ꔤa+" -L$M>L0℡~(K0p!p@0 `P `@@]PJ<1, WL04 c P` 0P@  4 `"VW00S,,4P `w0 @@@"@Th40 44 4 zG0) z0 c'dU    p-LM΁TL0K! 0@`P `@Pp0 c' -LMPNPA@Tp`Lp,K, X0   \$ 0,UL0 c'8 0 p-0@LM P S00*pP0P0C& R` 00#!t000 `0C& X 0 "!04 0 RpD[c[c[c[c0 0- @LP 0* 00P0P0C& R 00#!p000 \0C& T 0 "!00 0 R00h[c[c[c[c0 -`L0S0 !,B$R0 00@T \p\P 0@0 T0,  S(<@0hL. c̄_dU c c0 .D  -LMXXqXXX 0RF@ rT@P`TP P1 0000@0C 0 ^  0!!  0 C6000 "!d0l  Q,Vu 0(4 T cdU[c[c c[c c[c0P  -414qLM  a  P@0T!6U @_TP00C\ 0  "!0 00 0C&  0 "!0x 0 R h 0S,!V0 0C 0[c[c c c[c[c0 cp@- 0@ 00`000 C \P  00#!x0 00 d0C& \ 0 "!08 0 Rpp@[c[c c[c c[c0 -L$AM1, `  0 SP000 p`00C\ 0  "!0 00 0C&  0 "!0h 0 R0  ,00y q1P[c[ca[c[c0 -`@LM,P00LP (@DH@@P@!0@-@@@0@00 00R 0PP`@0p0C& R  0 0#!t000 `0C& X 0 "!04 0 R iX [c[c c[c[c0 -L M@00 Ѐ`p0 P000 `S00 -P0000 ,0K :0 ,P 0 ,ꔤa+"000 p-LM0@0CS0pLP 0$Q$1$ ` 0 b 1B&! 02 S31b1 R0@@00@@`00C\ 0  "!0 00 t0C& l 0 "!0H 0 R phjJ1[cLa[cPa8a[c[c0 -LMPU 0S 0 0`0UpU @S 0SK 0S' @0 R 0` 0S0@  0V@@@`vPUPU 0S i0SP0a0S0  0UPR@T@PH 0@T 0S 0S  0R ` 0 /0@S0@  0V@@p`@T 0SP00S0  0UP@T@pP -LpR 0Sc0R` @T` PRd R 0S 0S 0S p0 0Q 0S!@ T0 0R0 0P 0S0@  0U@@@PPU*@ P 0R 00  Sp00S0@  0W@@@pPU R0 0}0Q 0p r0S0@  0W@@p`c@T@P{ZP `R[ R 0SR@Tu 0Sr T 0S  X0 0R0 0P 60S0  0UP'@T%P@` 0 00T Sp00S0`  0W```p@Tx t@0Q 0p 0S0P  0WPPpP@TP` -LM `R 0SPXPU  0SY   @pT p@TPXPU  0S@\PTp 0Spp 0RppU @~@T p-LM`@PP  0@Q : RP T0 0P \PPRpP  0 Q: RP0S 0S0SQ  0PR 0P  R 0P P0 Q0P ,0RP $0 $0cc0S  0R 1P 0R 1 0-LP@@T0 0-L@P(0Z0,PS 0h0 p-LMP@(`,0QV php 0-0L<1PU9 0010 0x@0T00Qx000C\ 0  "!0 00 0C&  0 "!0 0 RT0 T00 h0 P \k@TPHk0@4SsLa_[c[c0 c[c[c0dU c c` @-T0@`p0 0 0x00 0P0C& Rx 00#!000 |0C& t 0 "!0P 0 R@,, @l[c0 c[c[c[c0 c c -< W 0 @0 0 ! 0 !@,0  @ ^0x 0_0000 Z +a" -L M@p00 夑`0 P000t!`UG00\ Q!P000P L0Z!Wp1 W p!, KP,  , 0W3$0Z*:P 0S P0  0 $!$0 S(0SL0S40 040,00P(,0 ,0) , ,ꔤa+" -L MP p0 `0 @000x"`F0d"d0  P000L0P Wp1X!Wp!, KP,0,  , 0Ws,pQ@N 0S*40000 H<00 S 0 B@T 0S:Q@7 0S4*$0XM:08`S0 8088 <R ,40< 0D0SD00CD0,4000 $ 0 ,D  00Y00S@T 0S:0 0x 0 \ $  00 P 0   ,+a" -SL M@00 pY0`` P0004!`!F00   P0000L0P X1Wp!X!, KP,0P ,P 0X!,`U 0S *$0W :00@0PU 0S:0 8 0  s锤a+" -L M@p`0 P000`!`E0L!L0  P000L0P X1Wp!X!, K`P,0P ,P 0X.,`U 0S*$0W :YPPU 0S:0 d 0 {0 4 0 oC +a" -L MPp0` @000%`EE0p 0 d@P0000P L0Wp!X1X!, KP3 Y,@^ 0XV,`T 0S*D0S= $Q %* R6 0S3R@ 0S:,@T 0S*$0W :D0S@T 0S:0  $0 0 $ D000 #0  a,`T3 Q0*D0S40  80(0S0p X$0W:D08 0RD0 $Q %* R 0SR@ 0S:0000  ,@TI QF*D0Sc @T Q:Y: 0" 0 p000,T 0S*D00CD0@T 0S:,@T D00CSD0 @T00  x 0C $ *F@000$ 0 -F 0 "000 F$ 80P T $0SD00CD0@T $0S% R J 0  0 +a" -L M0`Pp @000#PC00 P0000XHP,@U pD0SPU000 <#0  $ Dpz000@ 0 "0 HP,pU 80S D0S$  0CPU2 H &RY ,46 S\ P 80SgPU0 000 [HPU? D0SJ PUY6 0 I000)U@ 80SD00CD0PUHPU 80S PU0  0'D00CSD0 0 $ D0E0000  D $ 80P D^4   0(\ $@@D0D0}0  0 ꔤa+"c -L$M0ß@00 0 @ L0P Y1Z! Y !, K vP 0 ,P 0 S*,40 $ ZQ 0\ 0P S:  Q< P[*L 8 (0R40 + 0 ( 2 R$ $0 a Spi piW HD DHP` @T 0 00CSjYY[[[Y00S5 zW $04, Spi pi 0`\ 0 , <0 40400@ @4<P< P  Q: @0 4<Q2  8 0Sʼ2SD?00CS0<0@ @0 0f딤ahUL  -LMp KP`@PT  *,R 0T :800S$@ T: -LM`p$@|^ 0P@ c -LpP @`b00S0 4W ^0p0Bp 0 0 000 p-LM `P0S @N @php -LM P`0S   @4 @oe|`p0 @000L!`fA080 bP0000 06 LP 0-Ԑ`p0 @000 ` R0ԑ00đ\0 0R010201<0 0R*000000aclUNN -L$M0 0 4 S@P` 0QT, K%P`>,0 $@0\A 0 S:2\7*Z`!>20K0  0 @EP 00 >2Q2^:40`, R ,00C,0,(0,>Z ``0K  0 0,0 @p` -L$M`4 :#:S @>0. Q< "&0D P@  H 0@ H0 KbP @ 8 0,@PL@  1 0<S-*$<0Q*0 Sb 0S_$04 <S1( (0 $Q#0V)0K*)K j⭵Vp:00L00 S  0<S: 0H b4D V@L V8 (*80S0)0K 00 HaP 0S)KZ )0[ S  )KjpqV:0 , 000c P ) K @ 锤a -LM 0  S 0` p @ 40S0@0S0 (PU`p >0~pW  0h:#:S P:SQ:Q:J q   `PS7 5  0 &P 0SR  R ,0( 0C,0  ,=  0 @`` 0K %P000 P q ,0 0R,0 $ 80SS SPS P9 QS@@S- 0   000  : 0K  03PH  10S     0@ |0 1P80 J,0( 0C,0 : O,= VʦU^  R  1 0R-* B (  -LMP`@53 0S0 *"*@S>0N`b@P $*T p  00l 0 , KP,0$ @D( ` 0 Z 锤a -L Mp0*"*0>0>0S0 pbMZG WE: WC00 @0` P000 `:00 P0000 0P 0,0K 0 ,PdD 0 o0  0 cꔤa+" -LM ! ^>0.@  aR0@  GP@ P @@ -LM*"*>0b^@0  P@ P@ -L0 *"*0>0>0S b^ {{{{{{{ 0 '  0  0 -LM*"*>0b * 0H ,6S# `p0d,$#&@PQ : 0`\:ZP  c -LM!>0 a 0* >P   -0LS   0 ` P P # -L  -L,M00 R0, P8 < 0@00 0S ,0>0>000  #20#0 Y030"<Sʠ < p`4 080 $&0,< 0, 40 FP@_0Q; Ă`p0 @000"`900| P000@0 L2 H)&R R ,46 S @ ,  0!0 ,0 0wP@,t!0 4Q 0 80S  @ hT4  0  ^ 4 R Tge 80S  |0@ 0 EP4  8 0  T|0 0 14 , :#:S <0Sa+"c 0 00[c[c @-@00C& R 00#!l000 X0C& P 0 "!0, 0 R@[c[c[c0 -$1$qLM @`Ph `%60AT 0 S, @TP00C\ 0  "!0 00 0C& x 0 "!0T 0 R 0S0S[c[c0 c[c[c02S,2 R 000  0 " "00C02 0 R l0 000 202  B 00 0202 R  0cP cX c` c2-0C22HSD000   202  B P cc -LM2@ P0 00  202  B 2 0h0h0   @@2402   " @002cP cX c` c2 03 R 0+ 000 202  B 2S2 R00|00 0h 00  0<02 0   R  0X ccP c` c20220250@-04 "QP h@?!l!0 ^:0A^P 01:?01c10@|U c -LM , 0 "X00 ZY"0@0ŸT0d0l h`x ^ `Y0  a0<"6AB4  8 {W0YCQ< <0 b40Zi8 1P0@8 04j Xf4 "*p@0&04`  8pj0>00 00>0 0 0P  P00( ,0d 0 @\00`T@@0DPXL@L  00 0 c8#\4@Z0 cP c|UDa cB}DacDa cUH -PL R: 00B 0 0 P ZcX -LM,a> 0R^PA0 pW 0gS*Z@`0S:>0 N@ T *$PK0S J $T:k|8Ph5*DD@%0>0>0 0UDaDa cTc -LMℒ0SP&J1l `!db@0SP> 0p`S@`0A8 PNLZ0S J1` @ 0R:P@DLZ60 0 R    R  B1PP @P0UTiY 0R( 0R0S*0B60 0 B0CR0  R  B0PP @P0U 0R*60 0 0R0  R  B@0PP @P0U|U c0 c4 0-LP@KP@ T0 -LM,  \00 4 W 40SbX%Q*!p WN `Vx!0S`VT!0VZ: R`4A (A0!X:`V!0P0fUq څ1eAD PEU @, Z 00  00O0 0040t 00Z00 oXXT{Z @P 0<0sZ4opZ(XcX|U c cHd -2L M0`V"` 0C`V PUPUTBd1D">0> ,0 `p,0P0,0 { `V!`0V0ؑ1 0 ` 0E V `h0dP-Q^& Q 0 0 00 0 0h `0! 1 h `01 0h` !60!^` V00@0000C\ 0  "!0 00 0C&  0 "!0p 0 R `0W 4 , o4oY|U c0 cdU[c[c[c[c0Da - LM Y0\ , 0` @,pP 000 pY8 00\,{Y(yY$0$dotY|U c ,0 c8 -LM0K`C <04 R8 @0R D0R25X 00S, 0 Q00S(0QP <383L Q ,3 Q 4p pV V>W 0!PU R0000 0   B 2 $00C$0Z 2 00` 008 08` 04"0KY 0 "0I "P2 Z 280Q2XK 1a @ h0`"& 000 0 xP@0@0C\ 0  "!<0 00 (1C&  0 "!0 0 R  0P " "000^1PUhV`LL0!PU0ZQUVQ:cx ca0 cbP[c[c[c[c0 -LM`^pR B2P   0 h` #6\0! 0 0 00 0`P00C\ 0  "!(0 00 2C&  0 "!0!0 Rm R 000 0 0 " "00C0"0 0"WR 0"LP D1"p P @h0`"& 0@0@0 0 `P0P0C\ 0  "!0 00 0C&  0 "!0 0 R @ 0` " "000[c[c0 c[c[c0 -LM2@ 0` V022P  䂟 0 h` 6\0! 0 0 00 0rP00C\ 0  "!h0 00 T2C& L 0 "!0("0 Rr R 000 0 0V " "00C0"0 0" 2a aR 010  0 " "00C02 0: R H12 000 202  B 2S02 00C 02<20P0000@0@20$ 0R00 D iv R d0V( 2 0 2[c0 c[c[c0cP cX cU` c -`LMVp At00TPPU `V2  "  0S 0$"{22 -XaXqL0$ R0D0 2@ TPR1D@h R0000 0   B ZP 2<20 0S0@@@ 0$ 0 0$ \0 R 00S0@@@P 0 00 c0 ca p-L M K0 "Q `KP @/1l1 0^:0A^P :?0s8 c! 01pV0b0 0Tc|U c p-L MP`@ 5@@@ t0l l0@@X0X ET`@@1@0STp cdU@c8cDcDaDaU -L$Mp0 0 4 00 P4,P Ǡ,K 0 PP\`0 젟 @L T 0  @@/\x0  , X,@ 0P4D 04 4 00P#jVJ0,@ctDaDaa0 c|8cDc -d!L M0P0 J D@08`p P000 !` U00R0S 0̠ W0U0V00S 2T 0  TV U0P0UA  V 0!6 P0 U00R0S  0 0  0 0 -`0@LTpPP P W* 2$"  2 02610@T0 $C02 D4!202m/2  0 p   0!6 1000 X0 0,A0 0 0J/8 c -LM800CV!   bp ` 4Z00@#:0#T7H@T 0Z0!02 02 @TpX 00 \PJ Р2@ Z00S !2022@02H@Ta$P,HhhhhPhhhhhhhhhhXhhhhh`hhhhhhhhhhhhpx -1qL!MQL 0Q 0@0`1 H. 0P@,00C& R 00#!000 0C& x 0 "!0T 0 RigR40 a[c[ca0 cc[c[c0pp 0@-d@0/C2b,S03S0#S<0<<0bQ/BR@ H@0cVUUU -1LM|!xQ000d!C`A0\L0 0  "!80 00 $1C&  0 "!0 0 R0PPp `@ 0Gp,101yK 0V`0  @ ?CSD00D SD0\4 ,0PR0S-[c[c[ca0 c[c0cVUUUc -L MDrDDDD <00\0@y P\"001 @00C\ 0!!  0!C6000 "!|1  QLU, 8 0 08 @0B6C Wp  402"  Q  [  Rg 2d0 `0K$ T  T202&,08! W8!  2  0a h0K @0 0@0!6 k K ; P 202 @@ T  K 0 !6D 0 P  ' 0!6 0P P@ @@ 2(10(1~,10,1#c -8RL101J@R@0T1A d0SsqP1d0Sf@D 0 ^pc@dlh0PN 1@T ZW ڸ X@ ZW"0S00 0C00"`Zھ" 0 P  W<1pG0<1 0!6 P 2J02 J `2"02p T00R00 S n8,P101zc` cP cX c - Y3 LM>A0 0 fMQQ:34 (0  0aS < 8 00`VԢ'PQ B/ 1b10 ^:0A^P:?Pu &Q` TB?!l!0 ^:0A^` 01:?0S p,1c(f1P12" Q4 0*R0#  R <P, P\ , 4pABP2#40,!0Q!0000 00C0" $00C$0" rppp" 000 PP,00S ,0 8 l0 < RP@0RD 0S@G*48,KP0lP,0 ec|U c0 cx c -LMp@T' P`Q0000 0002,00'0@"0$ 0R@0$0 D @Ti0 ccU -@0LM@T 0( T  N@U p-KcDac,a c_DaHc8c - L@T`P 0U- @T 0PQ @00 0S 0  00 00 @0D4P H$!Q0`Dd`d00d00\S 0  00@T 0S,q,1, 0 b1B&! 02 S31b1 R000Ġ00C\ 0  "!0 00 |0C& t 0 "!0P 0 R a \@Dac[cLa[cPa8a[c[c0@-0\ P p@@4S DP \Q DQH4H40H4H4DSDd00Cd0Dac -X0LM\  0R \ @ TT000@Da p-d0ML` @P0 K@ @f:P0,d(4p6JDa-X0^ P ($\,40\DP ^Da -EML M4| P$ |4,  p0S S |^P@-P `V 0FKP4 @|4D @L$ p t H4 P@dd00C@S񟗘L44480S|0# @|4 3 ,0S ,.p%PP@ @ \Dh P\c #gF00@d80S|00 0080S+  ix\ IBK@$@0P|P@ 80S \\ @qI|$0 PP@ 0 |Q@\ p PP@  Tv @rB~KpGpGG>K0C+ѠP@A fT1`|$P@]0SEBKAG>KA0C+㥠P9 1` Y( PU! WpG 4 O#J6; 0P@An0$P`@(DTU WpG Y$@<0@d 4 Ꜥac_,8aLDac -L|M@0XpP 0 0FP@80S S @0X 0 0E%$ d2!b10S pP 0OP$K8 4#RZ 0`E` 0 VP @QCN@ 0 !J0P C@\0PP@7 0R50X @00@0噺 0X!000dh00h04!T0H0 $4>0CFT0 008P`d)J&JBH0  8P 0K 0P@qp KT$;H PP@cT0P H0L$4 R00P4q꼤a g_Ulcax|c p-LM0@( +($00PP(0; (P` 0 00p@80S$ 0@ P0  l厺t$h00bh0@;P aL0(,$09057\apA @ G뼤acDa -L M @ 6@  -L M@ 0@ -LMT0O$K4#&:@UPI ($@@b0O&8#J6$Qkt7 QoA!P000@{T`P0P0C\ 0  "!h0 00 T1C& L 0 "!0(!0 Ri @0 040@+00 P 0002P0P0C\ 0  "!t0 00 `0C& X 0 "!04 0 R iG[c[c[c[c04 -L6LH$M@08 0(Ɵ< 0$Pf? @ @0@0C\ 0  "!0 00 5C&  0 "!%00 RW@ 00  <0O8僄< RH @ H D 壛 80L$@D ?4 D4K 00K, KP"00s, 8  LD ?C4`Pp40D, 0 ` Pe>T\$p0p0CH0UP\@ 0!! 0$C6000 "!3  Q<0S 00;00 4 0 0S 40C4h8>@0S08cHc -LMld0STX1`VN P@T 0DDT `V0Y0PP00 $ R0p0Ĕ,K p p4PD$RH4H40H4H4D$S D$DT0H4 R0@DD@ 40 4 l00l0($,0cDa -LM@[P$40$4 p-pLM@` M(Pa0 05P( 4 0f 4l  fl pOFxc00  -Ld@Mtq 0Kt p00L6p PPp00p0c -@_p#:0#$Z0'LMF, 40 4K8 ,0@ 8PT pp@ 080\0P4P$L0Q  <<8@00C\Pd 0  "!0 00 3C&  0 "!0#0 RU 3#090003, 00pT3THpp@ 0hß00\p@0@0C\ 0  "!0 00 2C&  0 "!0"0 R4, Q6<0801 d0h2`p Ÿ000p  p 00C\ 0  "!0 00 2C&  0 "!0!0 R_8Q 1!L00 Q2@0@0001X08 RI00 ;,``01@ 000\ R44\ \P,<@00C\ 0  "!0 00 0C&  0 "!|0  Q}b[c[ca0 ca[c[c0a!Ce,a -@1LMp4w$K PU \ D `\@ ?00$0 @4p"D0 \4{ $0ĆAPP $E@s\K\H $B_a -LM0 `>0^$ P0l$ R(: 0S$:06>0. U$ & @0 b$Kp @@[P$0 0c#& $ a8C  e$0 0e#&BA- p0Q:>a2 &#l"b0QPop*H00p "F!V: U p -L@8 @0`<P` P0Sp -LM -LM@8 000 p S0`P40 1 s @:Pp` W400S,  W 0 040 2! "0,00 1p P`P 1S @:Pp` W0W 0   %\0  ,  0!,0 @1\ B,:\, # \ ,K 0P@,0"@ ",ѱ,01,2202, ,F -L4M@00# T p` Ẁ"0 @0 0S 0S RT P00SX 0X 0R0t T 0 SX0pP0 0 0S*pe0嬡@@0K`P KH  4 Lp D 0 8p , `PI 0S>0HK 0 0P@/ U8 W00W00SbP R00Q0#02SXT'0 0C0 S UdX0 aZ9 0HK 0 t <PP TX a p-LM0 PU@ p0 S@`@0P0@0   l ꔤa -L M0 p` 0S 0S0000P p-L M4a0P $ 1 @0T0 U+ T0S( (@T@T 01 P0S <0@T0 ph0  (Q,0,0, 0<0000S @0 0@0000S0@ꔤac Da(Da0S@-*@,  0 000@=UU RQ-L 0P0000 P 00S000; RQ-L P P 00S00000S; -L@M\TK K < 4 <#:0K [0*":("000x;8 0-PLMU^ KK @<4 Ġ<̌,ʠ#:0KK@ P 0[S*0":(0"$000M;` -LMT2@P H2R@p 3S,0S00S}40Sz80Sw 0  QV 0`Sh0Sg 0  0P\ 0R,0  0S0sJ 0SI R 0S0S0S P5 02,\ ,48 <#R: ?P, 00VP @0  0,\,, P , #W010く/2ca(c -LM0@,0 @0  0  000 h01!p 1!pZW.PW&UPE!00C0PP*p 48<#hR\ ,,00@>VP cW1l:`PX UPE000P:Pp 48<#hR\ d,,00@VP꺫C:P p hClC`CdC(c -L0M∢ 0 ( L H SP`0S/50S 0S 0S0s ,0S00S40s{ DKD`K<@KH0K Pk H0, ,pLKP L0S10L0 (0 S h(H0S<0H0 Ha,0sS$[ 00S40S80S0 0@@UP0,0S 00S 40S80SQ  l0` x0cl RV0<4< 4l :0 l 31ꜤaX_ -L4Mß Ƞ, 0(,Y`P\0 "P 0S PŸ,0 S , R 0S0S0S R P0s ^ HK ID0YRX T0 Ÿ@KY2\\ 1@ 0TL0 h0p W@X YR,0S00S 40S80SH0S 40G 0T00\00S @0S l0:0\/  s6P@0S X 3S@0S<0S80S40S ,@K Y6PZ 3 SP0\ 0RP0 L,@K C6PT <6P(HKsꜤat,xc Z_- p-LM`P@ P500P3,@0 p p-LM`P@ P500P3@0 rp -LLM☁0\PKp`@K|A$0 ` 558KX@TKD@0`KP ?@K[@K@PKP\PK3P@3W `\ $0S $| 0k=W` 800C80` 80S080`D2`\ @V 0S0C 0 0` 0 0@`k20 4W0,  $@Q8Ꜥa,- 0-@Lv1PP 40 <0%wU800C800 p-0LM@PT` 0 \5PPUʜ@TU pG1P 40 <0% 800C80phE2cPx0 Rl0 P P 0S P0S 00Sh@p@Q@- 0`SP*0SP:P *0SB  RP *R 0S2 P*0SP: -LMᐈ@ppT, P` `8T VX P8T D8T 88T48 T (8T$8 8T*8T8 T 8T 7T 7T7T*7T 7T7 T Q 0Sl 7TB7T<*7T .|7T" l7T{ p7T d7T uD7T V 0S-,0 S $,- d0lY Pp P; K`P4 ` 84K40[S/ Kd@KxK 1P 0 1\@0[d 0@0K@["tp0  K@ KT0 P UrP 0S \00\0t0K K^rPpQ6d5T T5T5` (K`P3 ` K0[ pS (K@K K  1 0 1\KrPp 0P WY r\00CS\0`4T? !T4T L4T8 r 10aR001#0p 10bP001#000|3T 3TV @V31.7jVy @J31 qP#0000q4#0000L|g!3R/W2TO 2TZ1Z2T 2T2T |2TW Z p d2  R): p @2  R*0S  00SP 4#$0$  R 4R00$"48<#P g1T X1\1^d1Tt1T*81Vd1T T:X10SPW  0n$1T35e [aWu 0T0 T 0T0T*00T 0B6FꜤaku$juPliHLi0UiViii`ei@gi`di@fi@ii"i !i i ixFixi %i i Ri Ii Qi Si Ti `ai Gi Mi >i<Ni0WiHPi Oi Ji(Ki -\9LAM`VP0p, P 1  5 -0S S/cH0S U8 Q1 HPTP,蜠K E 0[S -0S h@ 0 SRh8 RU5 H0S |0SH|0[S\ q'0000q'00 00 0@P  =d00d 7@ 0 0Y0  p7 ,0S h, P0005S Y  P d0 5hK14$#Ġ0Č6xK7K4p0 0K0K0 .Kl 倀KlKt0 P 0FS0 000$1 0dK1\K0HKc0KdK1@Ɵ.D@KD0HKCKHKG0K-P@  7P 80S0C80Ų@T 80S0C80Œ0 .K00 P@ 00S 00$10h5 H0K P[ 5} DşHKv-P@7  N7P 80S0C80@@T( 80S0C80 .K xP 0S0 00$10Pp4 R(6 $0  ` 4-GOK@1H0K1 d0K1 (4(  0  /P  - .K<P 0S0 00$103 R   $0|3-i@K@0T3(0 H0K0 d0K 0 V/P  U -I2 R a$0 Y hK 0P 000 ` 71P0 82 R 08L 3Pp 1 R0 1 0% o3 h3RUS  PP7 ]000( 0 )0 X1(  5 p0`00|00 RP 0S  0SP00 0PR X 0 R #30 R 0[S0[0S[Q4#$0$)K$"48<#Q $SꜤa[_`ax,,Haa, d2c p-LM@ Pf0 `0S R Q000C Rph n0P0`00 0p$0 `2$  p-1QLM` @  R0000 0 T00 0S S 0S SS008"40SD0@ R9 \00C\0 0@ 0 )p 0S0C 0( @`00C\ 0  "!0 00 0C&  0 "!0d 0 Rpph麺V,8 C2[c[c2cx [c[c0  0- LQP 0 @R T0hc 5 -LMM$0YZ,0 0P X1  4Q x4Q -`4 ,0S X,0S^0S[F/0SSV0SSRQO3XS O3X0P p@/`Kx.  G3 KC3U00  3  R0TK\0KPhP 0@ X !xK %3U0h0  d  .P` 0@QP@0pS0S 12XKOK.0)v2Xq  SK 20T1 `V OK0 S `VT\ 2T< PU p ` 0S0C 0 00 R 0PV PpP*0ST PU p ` 0S0C 0 00 0@0S00PVPpP)/Ea!@-|0\ 0S \ Q @ 0 0R 0 0^@0 0Ea p-LMp`@PT 0S @T 6@,0 0P0 S00@@ pEa -p0LM@T 0S @T P ] P R0600 hEa -LKMğ0ğ,0 0P! 00P1 \` 0S\,6 Pp 0 0 PU 0S:PU6DD0 0C\ 0  "! 0 00 3C&  0 "!0#0 R P1003 ,0S ,{0SU P 0 0 0R 0OOKp0p0+ T! T\MK00 3 (K P!00jP0S+9KB0 0C\ 0  "!0 00 t2C& l 0 "!0H"0 R% R0600 0S0C 0) A0 0C\ 0  "!0 00 1C&  0 "!0h!0 Rh(DS/KT1PA0 0C\ 0  "!0 00 0C&  0 "!0 0 RP700/괶0S\p W s+P 00 0S pꜤa[c[c[c[c0(!1i -LIM✁0a!$0 0p P 00CS 0/ hAp00C\ 0  "!40 00 1C&  0 "!0 0 R $0S $RJ R000 P 0S0C 0 MOK*KK00X0 K LQ/K 6'Ꜥa[c[c[c[c08!2i -pL@P 6 `V70 0 #@T6@  -LM@P6Y P RP0S0S 00S0 0- @LTP 0S@T00S *P@-`p000 @0:P^0) S^0S \PP\00A000P0#" 00  0#" 00  P0S\U_0DaU_ -LM0@S S  6*PP P 0P P P0P P, -LM@P P P 0-P0L@T P0 )P0@T002c-P* 003P: 00 ? >-RALQBp`L, )PUe 0 S\D@ @\P0 S Ꜥa0-|!! -L M`0 X, 0 2PU8 O@KT1 PU0 R) 0 P@ 0X0Ÿ,Ÿ 0 0>> Y 0 0>>P@ 0 0 0>P@ 01 @T p0S @T00 R YDJ P?J8 $1 R 0 0 \ P00Q00Si"QPW,p 0@ 000, PʿP, p0bSʳX0 0 R PZ'-04bp%cX/cX_! -LMw, @pT`P 0S$ @TW  @T 0 R @TU0 0 R`0 h0 RP6,0SW y  Pp0X_ -LM@  @0T0  0 R @T0K ^%T0SA  AR 0 RQ R\0500SX XS:00S S* S00S S:00S S* P4bU_ 0- LP  . @' ''  'fJ0 -LM@J   h -LpMpxPK0@X 0 'qx0 p`K}Ნ +0 00   00#0 Q  g霤aaHa! p-LM P\ 0S \pQ  R T00G\`@\ \Z %P QP ;PTT@ v'P , p'P T# T 00#0  p  \'P00 0  00  0 00   w+#PT0S '000   P GPT@#U_U_ -LM@pPvPT T oPD P1@T T dP, @T+Pa0S$ )0S 0 @ `$ PpP@ P`p)$:+0 h`0S h$0$ )@`0S$0$ < `0S$   4b[_"@"t"""" -LM\`0@KP$x(0 o& &4%#000K 2 8K4 KK |0 h qPPK< @0 X0KWK,@ < 0@ PF@,P 50 000K`2&a M@K@KKKK 1 !0 1\ڴ0[00K [ K  sdP (0 S (  dP/P t0 R0 T( KP ,0 R  (Ꜥa,#[_4## -L|MPK0`x@$p$0 % c%LKhKK8@0 @P 0KKT0KSKp0KoK,P (P 8@ OP $0S D$ 80 0\0(Ꜥa-,#[_# -LM⸁QR Q$ p`]\ 0 l R .R Q 0ll RL .RJ Q?QDKPK [ $ [000[S  A0BS 000S |@KXJ%)K 7 [PK2g9%00l0 0 $"4 4  0 )$0 S $ lꜤa $ p-LM(aT 0R@0 P 0BS X0 S*0 R$  0S  p'6T0S 58J0 R $  x0 R ZPYH,KePPꜤa[_$P$`$U_, -L(MĢ0p(0 *J PU 0` RP U PU `0S4 VPDPKJ$0Ÿ.D pp 048<@x 0  @<$( 8$0@0D@0 0$L@ 00L@0 @  0L40`(0QD0 0@ D0 0S"@ R@T 0 00SZ @@$ PP9 $ 048<00 <$ 0\0  0@4<2DL   800,0#2P,6  0R0P00S@T  0S@T Q  0cPT  0cPP000D ` VD @ 0SX0@T 0"R@ 8 }T8P w0S P0S__Z @0`CW0(0C8#88#$(," @"(  e#( a#8 0Vw* T#80 0 B0 8SBD 00b'0"00C080! S P 0P U8 X'H0@\ 1 0@80Ɵ4 6` 000 00C0\0 0  "!|0 00 h6C& ` 0 "!06<  Q8 aPP #_8^%ş0D 0b0%00C0H R 1 0@ş@08 [4ş45 0,00 00C0\0 0  "!0 00 4C&  0 "!4  Q|d$ X4Tğ 0T00 00C,0\0 0  "! 0 00 3C&  0 "!3  QF#3  0tß0x0 0@0CT0\0 0!! 8 0$#C6000 "!2  LR R:07`P@ @"PE( !0 0@8 8 s@ D 0SL0@ 8e(0S( pPmWmѨO!00C0\0 0  "!|0 00 h1C& ` 0 "!00#08 HQW 1 0@M80HP1D0  0! HP E,0K8 ecP<080 { , 0R0% t*LEaEa%c[c[cEa[c[c0X_c8cX_c%c%c -PLUp `2X !@@>!( :!0 >Z P$4D 00b0 00C0HZcc0 0   00 80<808 8<<80808 < -`sLM T0, Hß00 0 0R0 #00C\ 0  "!0 00 2C&  0 "!Ÿ"00 Rb8PU U 00C08P<0 Ry U\\ 0RSKpA @a0@RSD0SA La0LRS00L S:WA @a0@RS `A@0@ \-P+^pG`PP@W Y @*0.S@00U* T:4 00 S*40S0C40  40 S400C40 00c 0X4N040 0 v0 , o 1@ 0 00 $@0@0C\ 0  "!0 00 0C&  0 "!0 0 R$ R 1 0 +10 ,(<81궛괛[c[caa[c[c0a -QLMP`pd V00UPT0 SRJ00SSFPES`FLSH0SBj0S>0S:0 S6?Q3 ?R0Q0E\) R0FP$ Q$ @R" Q 00S00S !P0pi0\0jS\ 0jSg P -L Mp, 0p  4p 0SAR0 > 0`V @ T 0 R @T40S` pV,0 `Y0P P P  0   P  000P P040 4b -LPRM40 020 pP 0$< 0 W8 `x U @T 0 R @TWPU0X0`P`80#2   X0#00 &PK EP<  0 <  4 R- R0' 0R0"00c,$,!$#,,  ,Kv  r00S 48 A 4 8 100S00,0 08 04<#$ 0P<0 <  <0 4b`a -|#L4M0Pp,0 Pp 0R0% :Z- HK0 H0KG K0c HKT0 i@T: h0 A@TW2 h 20S']O@HKLP0 iP4LPP |2 ,0S t,&L@Lh@0S  PK 0e L2P@ r0:S,0S00S40S80S , P0S 0S$0S(0S T PQ 0"0 # W (!0LPX  h 00S!XN@P0LHKX 2iP XKPP0P0 piK@L@h@0S  PK X0 L0K dTPP7 L 0R0% 0*뜤a Qc?  &%cʚ; -$(LM0'Q,0   (\ 00S:p:00(L00 (( 0@℠K 0 9 5K P` K`KPK* Kg 0K@K K`KPK  U 0 6@T 0  P0 @T0[Sp RE  ` 0: 0000@S1\6   0:( @@g 401K<1 0NP Q 1 0@Q 1 0C0@\ 񟗗ꤶ8Phȷ(@X0S 1 0@\ 3 ,0S ,0S1  0@0S10S10S10S10S10S10S1 0S1B0S10S10S10S10S 1t@K ? KK0  tP 80S0C80 R01 RI|K0 0[0S1@  TȠ }0MP+^TPK(@L0( LL 00@S*LPL ( ]@0 R 4@40(0@Ꜥa2cX_4&[_D&&&, -LM@P`}pz @0 Ea& -&LAM0p,0 `@0PK Z - H6 R<6 R 0R0%P r:Uh  KK 0[ST 0[SH 0[S 5 Rş@0 I5 ,0S ,gKx h0[0S0S <5 R K 0 ,UH@KS 0@K KG0KHKzP` 0P 0S 4 R80S0C80ŲK KKV (@K ^ P80S0C80ž0[`S 0[@S KK K P00  3 R K KK*NK(H( .D.Pz!R0 ! 僑Q U0 00 S T3 Ra KK@ KKU0PI 0P P !@! 0K@5 !R3삟! 20SPBdPK@K `K  0KxK c0KdK0K0KKK\KK KK FK !0@P@K KK0 0KKE o N1 R K KK m 0[0S@@RT1 R K KKd.= 1 R K@ KKx 0 I 0 R K KKj0[0S4#$0$.K0[0S4#$0$-K0P@ E?K PP p P  0R0%P |*L 뜤aX_X_[_h$c&'D'''(Y_ Y_l(((()c -(L0R@!0 0 h 000 @IPUFFP 0Sl P 0Sa 0SW 0SM !@( B("("48<##80@@ 0:4( 40 0@@oP Y 1 0@Y 1`P 0@ 0@1P@ 1 ,0S ,G00S000 00S0 0 000S000 00S0 0 0aH mbAHi00ST\R 0SO 1 0( U * `hBWEU EP000 L0 r L@00S L gexꜤa#cX_[c[caa[c[c0ach) -LM`@PT :Rp/U U S*` T eE \(`P Q` * `S*`0S` C @ `0T0U00SD - 0L PX_Y_Ia p-L M@PP 40`00 @K@0SL L>P808 W Pp2p/pY_ - LMR 40 S L00P00 0 w ) - LMR 40 S 0 0 _ ) p-L MQPPP 0@S0 `phh4P 0<Pp*p 0 php(Y_c -LM@00K p" 0@ 00 "@0P ,` U0@K!!  0K  ?@0@K  p0 -LM`z 4z0@!0c48z0!0c4<z0 0c4 Dz0 0c4 D@!390Q 00R D zP pZP, @0F PP A0 R ~p0H, 00 S0 L 0C # 0 0 R " Yp@ꫪ`a -LM, 0PR* L0Qڂz, 0S*@Dp`@40x @T4<@0 ,0H 4 800 _,`a|Y_ -LY_ -LM @P4 @ dB!2b2c621b1c00Sڜ0P*0 R 04P:l0l  m(Lh\ dB!2b2c621b1c1\ 0U_p$chX_Z_1c) -4@LM c0hcPc| -qLMQa@0 T00 0 S00 00C000CQ 0 "!000 t0C& l 0 "!<0H  QT 1c[c[c[c[c0 - LM(080 0 4 !  0 S'='=P@ 0S ! 0@4`P0@ 'R`00`S x+0@0S1  B0@4 ! 0@@T  R0S 0S$0S *0@0S 1 Q 0S0s R0S 0s Q 0S0S0SJ R0S 0S$0S? 0%  R2 R'  R R  R R R R 5 \ \p ty0S 40ZP L9P@ 80S0C80H00 0  0Q 400S 8 R  04,0 PU 4, (0AS:(Q 0S a(!E40Sb Y\ `0S 0S0sN 0S0S 0sE ȟ0@Z 1 @ 0@7@U wgHL0 S4K8K @T480\ ǟ011 X7PP0@0S1 0 $@04 & E6 RYA  P4 Ɵ@04  ,04 (00yp&0@,K0K4 K80KP4` 04%,0S"&0@0S 1 8 0@40S 1  0@4 0! 0)S0(P 00Ps" 05 R@5P@ <0K( IP4  < 0R0% *'$40@0S1 8 H<0T R@04 1910 l4 R;  @ 0DO0!  P4P@ 0S 1 0@40 P 0S)P3 R ß0@ R p L0@0S 1 80@00S0SP@ T  /P@T400S6~P04 8 40]00S  !48<#,#80 400S 00S !48<#,#8 0 4 00S00S 04 d1P@ ~00S 00S 04 00S 5+(pCP4 K!0@WX 1  0@00Sl> @ 0T  # 0@04S1#=#=` p%c&c&c2c1c2c$2cX_%cX_U_p$cP/cZ_%cx%c%c[_)1c &c%cDb -L MPp 0)S0`(4P 0 0A( Q0%(":P `@D 02P`P @0 00K( cHPP 0 0R0% *,0K( SHPP , 0R0% *x%c -RL M`p40 @0S SP V g* }pP P`eV@1P@ Q?SN SVZAP 0/0K 00(<4<"4!<^00 S: 00g0 @P,0  00g0 @P,0  0g0 @P*0  0g+0 V R*K"[P"48<4 #8V0Pˆʎ%c%c -0L0@Sp S >S S 0@ 0S 1  >0 @0`P``0%c -LMh@, P{l 0 RM 1 0(@3T CT +T'  PP0 p3T0000aa 0V#3T T +T  )0_P@e>b>,0 S ,<T R>1P@ <T (YPP  00Q  )0^0S1>hDK )0D ^Phh@`K @ [R R Y 0S )00 ^Phhf?0[0S03K?0[0S )0^PhhMꜤa*x%c -L M,0K@ 0 R@3T+0[+0[b弢00@ 000fPP 011 01!  Xr@00C\ 0  "!$0 00 2C&  0 "!0!0 RkUX#U !0 00l<  80S =$00 00lX* 0 0 ? @ 0,00$@0@0C\ 0  "!0 00 0C&  0 "!0 0 R$ R 1 0 +10 ,(.1@01 K  |0K! !P1 @01 v00So000k00Se 00S]0 0 0Y 00SS00SI"0410 RA>00S8 00S/" 0410  00S   RA@0 1<Q<1 2   000S0 U 0S Q1  0S U 0s00^ P Q 1 P0@ R 1 0@5S 0@\ 1 X 0@3l P 0S/P0 R U 0SY 5U| P MꜤa%c&c+[c[caa[c[c0a%c%c%cp@X_Z_Db&c+0SP@ T LP@Q 0S  C R X0<0 X0s*0 P:00S^0S 5 000 T `P0@3 X 0@ P   LKLK  g-\K  &0S@  " B\K B@D,l7(h5(d3(`1(8#8#$(,""(  pK Pppp `K ! P  dK !P  hK !Pv  lK !Pj  - RLM, LbL@ 0@00yPP $011 01!  q@00C\ 0  "!0 00 1C&  0 "!0!0 RSUM X Z    v,0P@ 0,00-$@0@0C\ 0  "!0 00 0C&  0 "!0 0 R$ R 1 0 +10 ,(c*a0  [ʚ;8- -L`P@\ )R1S*P 0\0T00S "T T PP0p 0 :RpW 0 :Rpp! 0 0pT \ " -@0`TLpP) P$`U` 0S{¢U"X yP P`@"{㨢~" @{㺡@ꔤa -L4MT0pP,0 D5\P W`@8 0FSATUU0V$XT R 0\0 0S$0S \,0 S ,0S@T5c@PKzPP` d4 R X4 P 5`S10`0-0T RTKYT 0 Sr3T0[ 0 T RXKFX0SX0[0ǕT 0SP0S0S0S Qd 0SQS0SI 0HKL0 0 H0KG K@KLKL0S <`vV 5S0S$ @T 0\  @T\ K۹P@[ 0S0 000@0QPT00J00S4#$0$ 00S1`1 Rj1 Pe `lP 0(T% 0S"P0S0S0S Q; 0SP 81 RA,1 P< 0`S @T1 V 0S @T' ZPT  R000 儹00S1#$0$ P  5iPp7 $0P 0 0PꜤaaX_+h@p@Db p-LMP`@ U  U U -p0 0V0 0pL0 0 0V00V 0 Q40X_ -PLM@  R Q000 R5h -L$ML0QPp,0  @00 Rp 0S ` Rv Rs0)S     0000cS 0,0 S ,]00CSY\h]]]]$^ RO 0S 0S> ,2 Q6*Q 2 Q/ 0S0S0S 0S HPK5@0 H0KG K@KwP Q 0$R 00S  100S1#$0$ *R  l00 SY R 0 0R 0" 0%* R  0 10R f R0S 00j < R 0 10R0S0SꜤa+h@p@ 0-0LP@ CSd0+PU@00C\ 0  "!0 00 0C&  0 "!0x 0 Ria_\0  )H0L ?0#3 0[c[cPch4b[c[c0[_Mb -L Mp0`S, P@F PC V 40 40T 40 }PqTZ!1  ,  0  0L 0 4@@Y ,5G 1!S:R+ 8C8Sڰs 01P0 S @T 00!1 1 Ba  0@004!410 !01!1 0 ! P@ H0PA@èP\0S @40c@0P\@P\I P@` 80< 0CR80HX/Mb[_[_T0GS S S#S 5SS ʇSS S p-LM@!`\ TP P tp3000  00  00p#P00pQ 0 0S XSUpPUd$ (F p// -SLMpP@` R00Q00S3R`U-  P$ W W *`X ͏ 0X0P00S` U '*`   -1L M0P40 1, 1`000 101`PpU0 @W(0 S(:PV(`(@U(W ,0X 0 4 0A 00C\ 0  "!0 00 0C&  0 "!0 0 R0i]0 0D D ᠰ00!!00 $![c[cPc[c[c0 -3LM0P@0 34 2, 080 20 028 pW<  ,0S 8 ZMT@PT @08T#X1e< 18 < pXW,0S< 00  < 40R00 8 @ 2B 00C\ 0  "!0 00 1C&  0 "!0!0 R8\8g @  P?L00X  80 0< $ 0438 r0 H10aR001#(0\000P , T@PT 1e 0( S`"X@TS|0 0  ϯ08#XǦ, [c[c[_[c[c0/ -LMX0@,0 `p XKj hKf 0R60帐 0 弐 Đ 0% P@ h:T^ `xK Q0S@ u0S.0Sş@0 g|,0 S x,廷XKrd 0S hKiD $50S xK_  XPU @$0X0ST0SP0SL0S&[4R t0S d0S`0S\0[Sx0[S S pG@K P R010 0S  0S 0S 0Y0R00Sh0[ xKSppP`z K0P@BY U0 00 S 4s0S[ xK U0@0)PXK `PL T;X0ST0SP0SL0S 0XK@ @002Q0@0 XKx Kg-dŸXK$P"Ġ0 0Č2 XKx KKX0ST0SP0SL0S(XKⅥ H@KxK@K0 H0KG KP@ 40  00 R TVf -P` 0  p0S 0 R w0[0S4#$0$'Kp0S0P@ 0K PĀ@  0R0%@ *H!뜤aX_[_H$c0 080P0h000,181t11c -LM`K  0 , L 0S VU0@  0 0 @iPp  !1 01$0  1 l@00C\ 0  "!80 00 $6C&  0 "!0%0 RoW 0 0S"W V 0S @00 0     0@00 :0` dK0HK@  0V H0Kc KG Kd0K\PK  4 R0S R 0(S@@K   0KK %P @@K (` x0(0     0  Rr Rh ^H 0@#$(,""( :( @@x K0R0 $  K@_Z 1`P 0@ 0@\@0 \ 80S0C802 ,0S ,<  P U@ 0 @@ 0P 011 0 U @ @  00S0 0 0 00SP2 R P 80S0C80 ᵣ0 TG  ᑣPP@@@@KJ4#$0 $<5K4P %KX` T0 P@K\PK1 <1 KK吠 1@ 0D00$@0@0C\ 0  "!0 00 0C&  0 "!0 0 R$ R 1 0 +10 ,($@0@0C\ 0  "!0 00 0C&  0 "!0 0 R$ R 1 0+10 UꜤa[c[caa[c[c0acT3[_d3aT05S S S #SS GSS S,0 P 0SPJa 0- @ PL30h4D a -LMŸP@Q2  0 n 䁟0S00 0Sl 5Pp8| ˅P`H 8] Zhl1 p ` `R0 0U0 0 p @ppp 0Sy= 1ip=00b 0 0 0Ba0̞ 0$ x0Þ `P\0$0i0⸞ <P00$0(\_JaX_[_Mb333344 0-|0L PR0@P@ X R 0<00  0| ) 0 CS 0h\_Ja -2b p P PL p P@ { H"0Sl 0RX0 S0 S RL0"00S= R0 10  0| 0S0C 0( Ap00C\ 0  "!x0 00 d1C& \ 0 "!08!0 RhSm0 0$ VB 0 0 0Ba0 R $ 90 xPt0$0.0ݝ TP$[c[cX4\_[_Ja[c[c04Mb4435P5 p-L MP0`b@T6 ᴝ 0$ 0000e᠝ 0$ | $ l R 0T00  0| ) 0S C pphphx5556Ja -LM00 0 0 @0@ @@V -PLM@ |0 0R h0 RK 0P $0hQ 0Shy000 ;\_[_@66 -PLM@ R000h_%6 -LpLM0P,0 `@ <KT2 l Rl@2 Rh 0S# (2 RŸ@0 1 ,0S ,2P @$0,<0S80S40S00S5 0R0% A:P7 d@KH "]P%` R 0 l 僡 U0 00 S 0 R <K⬜U0 J@ <Kl  0@0 R 0P@ h0K 5 Pp h 0R0% *(}뜤aX_X_[_X$c667H7c -LpM0@,0 `1PK 6 R 0 0S# 6 RƟ@0 -dƟ,0 S `,偭 8P5 @$0,{0[S 6 R K# m0[0S 0R0%` Y:VO @KPE kP= 0 4 TPK8( LNKLK0T<0K0 43K[T 8 4  <4(<"4%$Q0S !Ef:0$?0D@$#3 000  04 8 <4<("4!<0P;PP @ P,d0Si A TQ 0S& @Q  0 A U0 00S 3 RF K⑛U0 D<0K@ @90 $(,<4<!4"L T:0SX  X SP1:PT0@S 2 R X 0P2 R K 0 R 0S  R0S\ 0SX SR 0 SB K`u0 K0KK0h [0  #h K0h [2 00h0K1\K 0$(,<4M[c[cPc[c[c0TP0SP p-LMP` | ~P@  T0T S@`0T@ phSp \0|00~ 0-`0L@PT 0S @T0XX0\ P [_ -L MpP`| }P@k `n` U@X(0T00( P00ZXXX1  0R00 -L<8 Q q\ 000|H D000 0@0,0 R 0 傿`a[_X>p, 000 0p 0000`a -!QL@ 0 00 p1R`( da@00C\ 0  "!00 00 1C&  0 "!0 0 RhG0`V4 #0p (@00C& R 00#!X000 D0C& < 0 "!0[c[c`b[c[c0| -L M0 @R 0S  )P4 0 0 PPl0 RP X0 Q H 0S P00 ,0$0  h@p@PcJa Qc -L4M4`@0P, `p`PLP 0P ST  0S0s 0S0S 0s HK㐻0 H0KG K  HK X 6` VB h0 m` VU: h 30S/P0)@HKLL0 vPLPx3P@ P,0 TS L,I@Lw@0S  LK 0*`P0@!   0@T;\ Pុ0S 1 ( 0@00c 㑠X2P@r0S TS,0S00S40S80S , 4Py0S 0S$0S(0S X "Pg0s T0@P 0 0a ϖP  0@JU& !0GP@ h 00S)P o@L0LHK PFLP 0P@ 0L0 P7@L@0S  LK 0v"*Pca Qc? Pc>Pc%cPcʚ; -LM0PS`@p 0SP0@S6P4 P 0 R T p # V00R00S@ 0xP臃0\ @P rP P p @ Z_xc Qc- --((LlM0` ,0 0t p |0 0 P   Yp@ lKnPl Kt h 0 :R 1  80S $00c ( `V 10(00@ X @p0K  7P;H0 0 @,tK0MP  <H0S <0&0p l  000 !̠` !4! 0r00p 0 :R_ q9 |0\"*0t0 V6 l0KR Y /ş,0 tS ,傠T0S PP 80S0C80Qx0K( P70t0  Px@ |0 ( hh000 pKOt 0 :R5 P@ p0S 1 B 0@\ 񟗗 8Ph(@p0S 1 0@0S <210Jp0S1  0@p0S1p0S1p0S1p0S1p0S1p0S1p0S1 p0S1Bp0S1p0S1p0S1p0S1p0S 1t0S10 70'SC 0( B(0 0B  0f0f$0C0C 0S0 00 !'P`00 Ꜥap@>Qcc p-LM)RP`@ :R@ph P pP (iS$eS S  0@phb@phU UP p ᇻP 0PP k0CS -L,M@, PPL ^`p ^  x4XU 0 L0 Y 9L6 ,0S ,匞ЦV@ 6 PL ' V@00C\ 0  "!l0 00 X6C& P 0 "!0,&0 R BPL %@00C\ 0  "!0 00 5C&  0 "!ht%00 RL0rp0@ 0H000S0006 %@00C\ 0  "!0 00 4C&  0 "!4  Q  R0 0SL 0GXB  OsPBX( $4 VV PJ أ4 @ 0 b3B&! 02 S<ʂ1b R0 0000 \S@00C\ 0  "!(0 00 3C&  0 "!0"0 R00As< 0@S 02 R 0S 10 R 0S0s R 0S0S0S ᩙP 0, 0@S1 R 0S /0 LKH0,P 蹓P L0S p00090~} S80wH@K0@K G0KHK|  0L hS 0SHKH@KG0[S婸S-0LIE 02CꜤa>>[c[cX_X_[c[c0 QcPa>Z_LaPa8a4bt,> -L|MğPp, @ @S 3  l`K P `T 0@S 00 9X  3T3 ,0S D,农0S/00S 0S 0S$0S(`V 80K0K@K0 [0 “P ,H0@K@ےP 3Sv 1k  80S $00c[ 0 ZpWR 10000#0Y"(`0#0 81#81#$102$1 1 ! l@  000 !40! ` 0! 0HQ<d0 ㄹ ‹ 0( 8,0h 0,000H  T70O0S: 00 B00 0  0g0g$0C0C |P 90S61030S  0S$0S(0S90& #,0 0 hꜤaa>\bO- Y I* Xb$\(  O-`Q* @@ P@ @Pp$DL%T\ @pP$HH @ PpD%\TP ` RPbin4_cksum: out of mbufs p pgQMW@PФP``$($,Q@Qx       x         @Q@ Q x        Q0@cA@0  0  0  Q@A 0Q@Х@PP484<   0 q<- -RLM@ i6 -RLM@ \6 -RLM@ O6 -pLMDaDqP P 010 RDL 1@0 0 0 0b]@0@0 C B\  00#!0 00 0C&  0 "!0\ 0 R,L ҷ>T [c]_$uah?(Qc[c[c[c0 -\0L0TS 0S p00R0S 5)P锤aTc -LpP`P@U U UPEP PE0R0@h閷pp00? -LMpQ < 4 8 < P, K00K.PP ,  XO XI;0t1%j 4R6Fcj,8L10 T @!8T d 0@T0X X 00Y4< 8,00 R, H0080 R 0h HX10 :n#:RJc` 0 80 U>0 R 0TcTc|Qc? -0LMPp`:0P:X@PH  P PE 0R08@8i߶iU<|Qc? -SLM@2~s H00H0( (0 -L0 hJa0 ]_ -LP/! !(!0!8!@!H!P!X!`!h!p!x!!!!  $(,04@DH嬴? 0- <LM00CP@ SN("#####<"h"h"""1? ?0 0 01 K"0 0 ,1  ,x; ,$0 S"""#0 L  K20C0 10 MUU33? -LM\@  t\ u\\Q10` R`` J@`z, 0 V. @   | l,0q6S P Q q0` QJz Q sY QPF @04  @TZ00e/C1"/ 0bl SxrPd ,0T,1D,`(Qc ? @<$@<@X@\Fh@x@@@ -QLM@|xhlkhh`dP_$@ZH4,TD hP@@@@ A4A\AA p-LM0~n0`pf8PP( 0f0V@0*` >%Vx( K,0K JTZ:T)+ P, 0 00( 0S 0H dUTcTc|Qc -LcA -L\A00-@P 6 018#811  R R  -0LPJ -LM`pEPQ 0 0S @QP|%> p02SN H%%>!D @A0AS= R ;%4 0 , %00 #0BWS .11111111111111D.111111111111111.1/1/11111t/111/h.//111///1111111/0$000<0P0\0d01100000011001011$1`1 0ts0A0CS Q X@@0S $% , R|2xl2D PL4 8<40$ 1?3?3  0  0x0!pn x ell%10?30 @U0P%  0?200  024PH-4hDtD|D|Fo<DeD``p&8d44}X4h4@ED4DDAD>DDDDDD 0-@PL> `Sl h0 $$ à 0 < 0 $00EDx4DD -pL`@Pu$ T 4 Z DU pP@TXD4(4PE EEEEo -L0 Z\@`%Z' !00St 0t  rW\PD  e/ERDAAA -O8@LMpOSP!b$ $00S 0 hdX@@  fE@RDA$EEA -@$40$&S !PL$pdxl dVH,E4EEDRAAA}.@ )4000 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 2 R 2 R 2 R  2P00 R@A0P0A R- Ꭾbs_notimpl_bs_mmap: args at 0x%08x - ၮbs_notimpl_bs_r_1: args at 0x%08x - tbs_notimpl_bs_r_2: args at 0x%08x - gbs_notimpl_bs_r_4: args at 0x%08x - Zbs_notimpl_bs_r_8: args at 0x%08x - Mbs_notimpl_bs_w_1: args at 0x%08x - @bs_notimpl_bs_w_2: args at 0x%08x - 3bs_notimpl_bs_w_4: args at 0x%08x - &bs_notimpl_bs_w_8: args at 0x%08x - bs_notimpl_bs_rm_1: args at 0x%08x -  bs_notimpl_bs_rm_2: args at 0x%08x - bs_notimpl_bs_rm_4: args at 0x%08x - bs_notimpl_bs_rm_8: args at 0x%08x - bs_notimpl_bs_wm_1: args at 0x%08x - حbs_notimpl_bs_wm_2: args at 0x%08x - ˭bs_notimpl_bs_wm_4: args at 0x%08x - ᾭbs_notimpl_bs_wm_8: args at 0x%08x - ᱭbs_notimpl_bs_rr_1: args at 0x%08x - ᤭bs_notimpl_bs_rr_2: args at 0x%08x - ᗭbs_notimpl_bs_rr_4: args at 0x%08x - ክbs_notimpl_bs_rr_8: args at 0x%08x - }bs_notimpl_bs_wr_1: args at 0x%08x - pbs_notimpl_bs_wr_2: args at 0x%08x - cbs_notimpl_bs_wr_4: args at 0x%08x - Vbs_notimpl_bs_wr_8: args at 0x%08x - Ibs_notimpl_bs_sm_1: args at 0x%08x - x p 00eIꮑ R ,0 10 hx\ CyP^_aTa 0-0 L@  ,0P   H0 RH 0hz0,caP^_`a_2-@@Pr?0RW` FFFF` B`p Bp` B`RE0C`R9`G4G@GLGXGdGpG|G` B`p Bp` B`p Bp` B`p Bp` B` B`p @R B`p R BRR `,HPHDH8H` B`p Bp` B`p RpPP2-B@P00O0RW` HHHH` B`p Bp` B`RE0C`R9`I,I8IDIPI\IhItI` B`p Bp` B`p Bp` B`p Bp` B` B`p`p@R B`p`pR BRR `$JHJ P dKP8\00S 0,!X0T  P L  HD  @<  8$4 ( 0,, 0 (4$ 8 < D H\  d 1 100 1`08<100g p-LM0 @P0 "!HN 0L`, @000phyq Hph ꔤac001X\ -L,M \P` Y\ H0C 0q H$&R   R  R0Rႁ0僁0#q W 0P0 L P KpH00CH0 p 020P0LP 2 HK A `@ j8!*P \$6BS -L,M \`p V\ H0C 0&q H$&R   R  R0RႡ0僡0# XL P P KpH00CH0 p 020P0LP 2 HPK A @ i8!P \$6BS@-,!@0 H@: -1A `L0 SP0 0- p`00C& R 00#!000 0C& x 0 "!0T 0 R-^P[c[ca[c[c0$ 0S00$Rc p-LM R00A00( $1P 0 b 1B&! 02 S41b1 R000`P00C\ 0  "!0 00 t0C& l 0 "!0H 0 Rpph*- _[c[cLaPa8a[c[c0 -` LMT ^LL @Q Q\ 0 @o锤aa (1 R 00f$RcJab -LM0` 0 !HAHP1UP`!p000PG4 1 UPR,1`t1AT  0P= @Tp4 H` 0`oW R ,0 10 p\ q0.0 R҉ R ,0 10 p\ gqd壥Tp  0]o `mꔤaac$RcP^_E^P  -`,1LM 080@0K(2PUK  <PU Kp0(  PP  CPU K0@ @ P_0CP00P0GH 0-tPtL0n@Q011!!PLP@0,!0*4  40L0C0lddRcĄ_tRca|QcpRc`]cTcaTȲ_,FdUDF@a_batFDa_8a_Q&sssssT T @Xp 0@D@@T@H| x*t 0@ 0@@ 0 Q 0XpG|QcRcGGGH -LMPpU' `V @ `\  0V PPP  @ @N@@P@ LL@N @@ @\]c]c -0LM0KSp8 <0 00 , ? `00V1* P&Q @Ϡ/ 1b10P:0APPϠ$:?0s1c4 1!00  0j 00V:< 80 R< R40KS0n40 0|U c ->0LMnd`p4 >%P@L 40 R08 &8 P00U* V 08    0Z UJjF:804 0S80 @X, K00K`QP 0 0 00< 0SH dU|QcTcTc(H>0 >0 $dUM0@- 0@^0 0@T 0 P^0@ЍS0@P ! -LM8 \` 0p 0P0c <0  \V@ i 0@2Z, K00K , 0Sv 00 R!(8.:(#8 #: 4  08080S 4\@>0. T:00R \ RC 0 0c4 :#:  cP!\4 4<  000aP0S Q @ 0 R@ ,040`VP@0V 00 ^\ <,0 0S0":$:&4 0  4 KoTc 0-LMP 0 .@K PP@ PPP*40 0\ @4:Q0 : @0 \0 0 0@-P@P`p. ^  R00\:\*R:^ >00 0 bS0!>0>00>000 0S0l0l -L@㬀TPp`  (0@T -L@, TPp` ,@ T -L@㬀TPp` 0  @XT -L@, TPp`1 @\ T@-^@>0.  Q:00R^  -LM@`TSp R a :@TVPbUP!W W `e L 0D@WH|QcRc -LM`0VPp R a :VP@bT@!W W `d L 0D@WH|QcRc 0-`@L\0P 0  ,0R 0 0S0h阞xRc|QcDDH -LM`PV r @0S  2S @2S2S lphsdp0JS HHHH\0  ^0Y0@T0 PO1`VAA0S 1 R$ 1 ?#+0AB%@1 Z 11@T !m%t" h81\ ?# $1H1@Q1@!+B%0@ P00 0X 0u" 0|  !cm۝d7Rcd(P\MlM|MMMM< RcRcQcQcRc: RcM4:MXM0NRcRcdNNNNNNNO Oaa! 01 ,   ! 00 2l 01  ᔤa`a_P^_|QcxQc(TcTc`!`($68`@d`03 6 !03! #@-p` PDq!03 `aPc_BCHd$MQ`pp50q0q180K0@<  0 P |Qcca:atQcdUT\aPQ8QhQ p-LM( \@SP`8 0 壚 ៚ (嚚嗚哚厚$剚4冚00S8@< D |Hxy,h哘drH Tm LiQQ:QQpR@QRDRlRxRRRRRRR -LM \Pp`@  @p, 0pc -LM, ^0P0p @`H   \f 0 `p0 ,1@  -l!LM000 0.!0 S@C$1Hpx,17 X1: `N @0 PP 0P Hm P   0c0.S4  0S00Tə  @0 R  0H 0@caQtQc p-LM@0P`XT" T 志K0V0P00S 0[0ppTK0V0P00S 00pK0V0P00S 1[0p|Qc S 88#4S S - LM(4P`0Sp @"0p 0S2  0S'P U ,1P R0S  0S@T00S p1 ,X!HD!@ 0S  P 0S  0S D 0S 0P 4$0C 4$U 0S  0 S  R L0@p4H 0S  PScTcTc|Qc -P@LM`pg 10S 0QPP 0SK SI \W- 0S! 10#VR0 Q S 1D0@S0H 0S 0PT 0S 0S|0< p 0S \0Lp `V  Tp@p锤aTc|Qc -LM8PU` 1L D H 0S 0ppUB X@ Ta !T^  *(":1("(Q 001 R``(40C(4 :#%,40C,40 01p R T, 0 R( 0R%  w0PzU@X8@ 0S 0S| l0,@0S L @, 0S $0HꔤaTcTcTc(Xa|Qc -LMl媎0 @000 ( 0 0$,4( C0S0404@4$Wa$Xa -L,Mph P4 @# P9",KQP 8i/ 1b10 ^:0A^P8:?0sh1c, 1! 8WL   8 8Q 804P : #5 @ QH D H@( >0S @# # 8@Q h/ 1b10 ^:0A^@:?0s'c!001@ZH @0 L 40RP @0 U^H7Z P T  `< 4S44SSD0 SH0H0S S 6!aV@0`0ó @0` W  @0`00@0< D `00Q00SH  0S H  H 10#R0 S 5D<  0%W 5 Y^D0S8000($ ($D U` |5W} 5 Ry 0R0u @SP XE0Sg@5 YU  8$0 )2 Q  0SKH 0S? H0 0S4Z+ 4S44SSD0 SH0H0S S X4!AT@0`0ó @0` $W  @0`00@0 7 300S 3 3H@3H0 t3@\ 0SY P3PS *<VP< H  2W 8< v ʏ0  uH 0S6 `4D U1 L0S. 2H(L4 h2QPU^W `2 YH2 PT  "< 4S44SSD0 SH0H0S S 1!aV@0`0ó @0` W:  @0`00@0< D `00Q00SH  0S H  H 10#R0 S 1D< 0@ 0S 0P c00KS0l00 0+ `b)*(":1("(Q 001 0RX0l00Sc|U cTcSc\;|QctQcTcTc(Xa0SLS -L0S7<K1 Q V$ 5 R 0R P0@T:TPP  0 SP 00dX (HW:4L000S < KH P 0S0S 0@(4$0C(4 0Q\ `0 (DKP C/ 1b10 ^:0A^P:?0s#c!D01B@TA  4S44SSD0 SH0H0S S 2!QU@0`0ó @0` V  g@0`00@0Y 0S 0 0S00 \0 ` `喇X<0S V 2 R 0R X0z0X0 0S !HPP \@0K !< K‡P XzX P0S$ 0p0 R0S\0S 0S 8 ` R 0S  10  H 0S!0S@ <K1@T 0SP00P0 00 x Hh 00PL aY0l00$ P dTcTcTc|Qc|U c\;(Xa - :8PLM#ʠ (Pp#8 001 0R0*"%`Q000p0 U\0 R@0H0@@0TcScTc|Qc -LM PP/*%:8#*!%( f V `!R#8 001 0R :#U@p*0SZU@:00g0l0 R U:Xh<0H,0@00p0TcTc|Qc@-0$,@0S!*4*6 ,<1(P 001P : #P 0S ( 8. :(#8 #:T -LMP0 ` 00S@e00 T # 3U8 4` *%:8#*%!( 0#8Z!R 001 0R  R Pt : U#o*@Th Uf 2$pQ b/ 1b10 ^:0A^p:?0st"c!,01bUNX2@ `R{Vp2 @0  @4pS44S@SD0 @SH0H0S S 1!AT@0`0ó @0` YH   _@0`00@08 R(40 040 8 Z U:0Um:8 R 40S 40 0S1,  0S 0 0S  0S 000S 0   T0H},0KS0l,0 0h$0H|U cTc\;Tc|Qc A-LQ LX\XLX\hX -LM@0@0@ -LM@00@@ -LPM!(`Q%F 0 010 P40 > :#5p W8 7 \ 3 >0 U#F3 Q pϠ/ 1b10T:0ATϠ:?0s#c!,01" R 8\ 0V \ 0U\ 0 @00@0 U  8 2 RxI $4  0 2R  82 R2Z  2 R   0SW a0 18@ 垌>0 嘌@ 双0HH8H,0KS0n,0 0{ #F0Q Ϡ/ 1b10T:0ATϠ%:?0s c!001" Rg 8\d 0V \]0U\X @00@0  b00KS0n00 0|U cTc|QcxRcDXa_axSSS -,0L ^  08ꔤa|Qc -!*(":LM1p(Q"( 001 R0*"5P#F(K` PϠ/1n10T:0@T`Ϡ:?0sT c!(01P  0Z0a00|U c - 0,Qp@Lt1 T ?= ?0SN HH!00`00  "! AR00  00#!0S  S0@ 00 0C\ 0  "!0 00 t0C& l 0 "!0H 0 R m@0Qꔤa[c[c|QcTc[c[c0 0-0LS@P 0SP200T* 00S 0 R 0T 0 R 0S 0S  R00h00 0T   0 0 0P00|QcTcaT\a [a -LM 0@S000L00|Qc -PLM` 0S 0Sz00$00CS$0. V( 10S 0 R V 1 R 0S 0S  R00x00 0d   0 0 040s1$!V,q& 10S 0 R *I0  0 0$R444444 i@00#!0 hP0 0  "!0000~TcaT\a [atQca`a_Wa|QcP-0 R0P  0S 0S  R00L00 08   0 $00$0T\aTc [a 0- 40Lt0U>0d 00\PSPP L@0 @0HSc[aTc|Qc[a p- LM400U>0 00PS`@0tt 0 SPR0Up@`HSc[aTc|Qc[aa - 0L84@4`N0@ @Ā@0pSp$00U>00 @RP00 D@HHSc[aTc|Qc[a[a[a0 0 ScSc -LqMXX||1 0, P `% *XTP1P@T @a 0$"*>!00\:@T060pS:<,, @ 00C\ 0  "!0 00 0C& x 0 "!0T 0 RHSc[c[c|QcTc,[aTc[c[c0 0-0 L"*("1("(P  \! 0 SP0:#%0;U>0H0 @@R4@ 000HtQcTcTc|Qc@- 0 0 0 21 0 0s#0@$ ! 0#:8#*!(#800Q! 0 S@ 020000tQc@-`Pp !:H$$X 00S (| $:1(P 001P:#50 000!S$010 0-0@P$L 00 0S0ڀ0 R pP ` `000@0  0@0$0)$#cScTc,[a [aT -3崓LM00p 00P$0, 0 ppp p0S P U:YZ @:4s4C<,c00#S$ 0" "0"0"00a3C?6C#Z!"00#Rea!\"0T2@P"@L2  @@U4Ÿ4 0,,P2}0 "R@ȂŸP 04T0D@} 0@}0!@宂0 @ }0!@堂< hPJT:kꆇo`P@) E1? (P 0 01  @`P 1 000R ;P= ]9W 0p(Ā omJaTc|QcSc[aSc[a[a[a TcpRcSc[aYa,[a [a([a,T-Wa8WaР$Xaxa_4T(Xa8<\W*!L P@lT hh1  0K00 , 6PA0PiUT4@ ,*q4 $*(":1("(  Q! 0 S*"%0 0000S0PJUT:8   48 80<( S:H0 ZaXadUpU]c\]cScTc|QcTcU@0 R !0S0 Ra_ -L^ ^ 0 00^..!<0! R$0H00 0Tc|QcScSc -L@\p`( \" P$: RP $&0 U.!L0! R40H$ᗃ0P0UTc|QcUScSc -LM0!>01@ +.  0 ;>00 @0+. R 00@0HTca_|Qc -LM40 >0P, 0 0 S S @ 8 < Z4 # 00Z 3 #@46S``V 0088 00,^>>)*10S006J00 Z4!H,): R xG PP? 8#8ZS#0 @)`p@V ?>0U.!!Q 0@ST0ȌJ0 0H 0)6< 00U>!10 R0ʌ0 Jh0H\ ȂT0T 0 80 H0@ 0<0 u808 0 80 ,0(嵂Tc|Qc V8VScScScScScSclV0Sc -``LM0pS P0  @P@/00 RScP0P0S  \:00Q0SSc0@-l0@P 0S P  T :00U0S000Sc0 H 0R0 0 0  0 00. 0U0. 00 |0t t0t p0404 00|QcUScScScTcScScScScScScScScScTcScxScSc -L$0 0 0ScTcScSc 0-80L@T (PT Ń0DT0$XaTc< -\2LMP, @ D,<, 40$ 媃080 00 8 ,1( R 0S 0040 < R< 40 6R< 40 80 $Q8 0 X 0@S@T1S ?@4 Tf?p P@0D (h 01!R.P I P $4DP>S 0PP0!?#=?00c?S >@Tjڢh6,@Y@ BP@CPmPFP$$TcVVVV0[aVV -LM(p`1S`>V#1(KPQ @/ 1b10 ^:0A^P%:?0s c!(01B@T H4$4D\݂8@T W 0 *4ӂ@TX0l000[a|U c,WXW -!LM!:1(P`U!0 001 `R8pJ$JT( 000p帀00 0+; 00 :P 0 R 0Hp@:#:S P@*:#:"*S:(21@(PX0 P 40 P [a [aScTc|QcYaSc - 1LM@@pPP1 KX'PU$: 8 #!( R#8 001 0R0 U.! 0 R*}P0H `  0@(P4 0 cTcTc|Qc0  ")0 )Р)0 ) ) -LM@p zP 0SPTT0 R0 00b81Q00@R_a_̄_a_xW -LMB2< r R0S tRP "88 #$0L姁H2`1P 0S@ 啁th P0Up7*!A06T&*46!SAQ  Kx1 :Pp`UJ1 16T:0U00 pW0#02S0ES ;9S +( "88 #$h(0S} dTXc_|Qca_a_W TcW^cTcWW@BWWWXX$X8X 0-LMPK P@ 008@|Qc -LM0@X|Qc -0LS S  -,@L,`P. pᡀ,!.@ ,1:404,1L@H@,!L 㐀0V800`H`0 0 04\ -LM 0@F  ha -:#:LMS`@PR pK D  OjVJZ~Tc\X -L M00' H ~p@g0>0L ^| PU@`H@ $@K,0  $ 00ZUzj_~0^P <0,0 mL 0L0H p9~Tc0>00lP  10VdU -L,y@\0%($-!R!$S ^  -LM@0K KK0S(00550 4 0-LM@P K0K K0S(0055 0!4P0 -LM5 @R4$ R R @0BS 0BS X0z00 @4zR R  \\\ Q-@ L<0A ^  0  z  x\0\a\\ p-L MN \@ `P0`PTp `p=T\aP\aN  0O   ! -- -i`@0P @!1 ! ,Oi<ЍG-qԁA 090 1C&   Q 00#QY l  030Y P000 0& P0P0$0(@0,@04$00 00 ` 0 04 P(@,  0R  000 X0C&   R 00!QY\\a[c[c 0000[c[c @-@00C& R 00#!l000 X0C& P 0 "!0, 0 R@=[c[c[c0 0-0 @P00C& RL  0 0#!t000 `0C& X 0 "!04 0 R0[c[c[c[c0 -LMpW!聟00@00#!a P00U00;00!00p 0!!0`00 0 0  "!}00#!000 0 0  "!g00#!060 0 0  "!Q00#!0X60 0 0  "!;00#!X\a[c[c[c@-0  "!X@X0  0 "!, ,00Q@Z[c;0 -0L Md C\0@T 0Q @0 ZE0  "![c[c\\a -PLM Up8` +00@!T  000(`,00p4PP00#! 00 @@X4 @0Qd 0!!x 6v\\a]a] -LM4 \!0@  "! R0000 0 0!!\\a -L "Mp"0W00 1C&  ,  x0@0p0`00 W|0  Q 0@!!@0  "!0   ! 00   0  "!PU ,, P(`V @0 PUV 0!!L0P000 @0C& 0 , 0 0C60p[c[c[c0\\ac -80LM@/040\H Zc -LM܀004/0\px{'{W 0`0P40@/G$,| 00`pW@gp02.040\ @W wZc[c[c[cL] -0L`DuppP*Ppp3:5Wl@ 004\0p0 40\0 040\_Zc 0-L0@L2P00Ϡ(0Bl@D 00ZcC[c[c[c -LM q0\ P S  0`v @< <0 00!A  8@B@@0Sp 0SX0 T @/HH0S0taaZct]Mb]H]]] -Q@LP <0Sa!p00/0004,X!0<0a8t0,0S0 =9C =CS 0\) Pp 00C\ 0  "!0 00 0C&  0 "!0t 0 R k0S00 R@0 0 0 Zc[c[cRp0(X@00C\ 0  "!$0 00 1C&  0 "!0  QF0p0p)N0p0SRp0 lK0.\@^/, @Tp Wp00p03RNꜤac_[c[c[c[c0_ -L Ml 2"`  $(0QS0@4p$ R RK S KS S d2d"#8C@4, R0,0   R@  R`    . 0\[/,0\Z/0\! 00 !400L P, XT H0 09900( P0 P 0.\,0[/\0Z/\00@00C\ 0  "!0 00 0C&  0 "!0 0 RD80 o@tK S ʖ Sh Sfc__N[c[c[c0 - 1LM p` lP!1\ @ldhpd hP00C\ 0  "!0 00 0C&  0 "!0d 0 R U@ HPh02@T[c[c[c0,/ -LM0@4`pp, ^/,^.,PY/,@UO X p0  hQ,d0 PPh  Q 10 <  0 S, ' ܐ0 0C\ 0  "!0 00 0C&  0 "!0h 0 R s000 ,00 ꢹ[c[c[c0 -LMl0hhp@P&0pP` 0 0 nc_p\ct\cc_@a _ -,0L( &0p\ct\c@a K R-L`p@0 6KR- R+ 0 #8 C< SP P  S@P  S`P P P BD0.@P\0[/\0Z/\00 Jn @K R ʖ R R_N -,1,a4 p 1!@PL^/,.,0Y/P,@p00C\ 0  "!0 00 x0C& p 0 "!0L 0 R@U ʸ[c[cp\ct\c[c[c0 -8184 ,1(!P` ALp^/, @T0.\@^/, @T@0 0C\ 0  "!0 00 l0C& d 0 "!0@ 0 Rm0[c[cp\ct\cP`[c[c00 -Lbm(_ -L[m@_0R R | 0\q 0 Q  -LdM,3x0 | t3| , j t0_40t#0 02  P;.XK  @0S S P@0'\00pntgtX2X0S0H1H!|n<2  |50|5(2  |5@0|5|5Y@C 2/@ H_50%0Pnx@K j!t 0/x0Kl KP |n100|0\0X0lL1h! 0 =P Y DN1 ,0S ,,P|n!0`/͊_0@@%0nnP0`@#Hh P 8`p@5͊P%00|dKnꜤap\_d_(x__d_,xYK__~_JHFD4`T` -1ap @ $LP P00$ ;004P$ :$PpAp00C\ 0  "!<0 00 (1C&  0 "!0 0 R3쀟 0PUb p@0SP 0@ 0UP0U p@0SP 0,@ 0UQLm< [c[c[c[c0_M g__q_,0;X -LMD`!88#|!VPp02J /+b212b2c2cJ!{~TŸTp 0002c2cZ P 0002c2cJP0 0 S1   002c2cZ  1 !02c 2c"bJ"bZ1Ϡ Bl02c2cJ:_ Ue2e2cd!J \1 P1Pa`n(@2`!J0!!Gp@0/K30K,K40K- K.@K0PK1K2K04K400C\ 0  "!0 00 0C&  0 "!0` 0 Rgxe_e_CA 000X0@0Z <0TWp @h$ o0f5f#/@!bP Exf` lW`1CADLs  \@a2we_S  %00S Y00 Q  048 000S 08< 40@Y00 R  048 00 R  0480W0 N -L M,`K@PJZ0p0(0K([pZ,K0 +KP pP -L$MP @4KD@` p#Z``$U-Kz4K 0 3KP `p,@K -0L@ p50S hx:Pu0P" P 0`V U004P< (0;4P00@ @00 0SV hP 0,0h~ -LM0$ @(X , 0PQ LPQ XC \d;\\8\0,L3\0,HRef fx4f8f`ftffff<fff -8qLM@PW 0Uă`9 U 0 N]U <0?R0S0AS|h|| 0@0p| (\P0c0T  \0D 08    0^a|e_TXd| -@LMMT`pP1 )@T 0 S 1S 0S0t P[0S h\< 0 hT 0 ;б0 - LBNBP@V0 0Q0p0P0`0C& R@P 00#!x000 d0C& \ 0 "!08 0 RD]c[c[c[c[c0 p-0LM 0@00 `R0P00 00C& R 00#!|000 h0C& ` 0 "!0< 0 Rph[c[c[c[c0 0-0 L@ 0T00 0P @TP 00C\ 0  "!x0 00 d0C& \ 0 "!08 0 R0D]c[c[c[c0 p-LM0`@V@ P7 P0[0X Z ,0S꜑ $0  B0[0$ ph 0Y0X 4(VZ0[0lyZ0,XsZ00 0X 4(Y0?Z phbZ `ز -LM`bP < 0A^0S  R0ˠʌ ʌ00ɌH0 `AP<Q!p0000   @0!@ 400  Ap00C\ 0  "!|0 00 h1C& ` 0 "!0U d>Uv\>U*T>UP>lL>UH>5h:T 0l; = ,0S ,4>U: =U Q=UK 2=U) =U 0Sdh 0hu|=U t=U  0i 0  0 =U :<U =U30000000<U- <U :<U T<U0<  <U :P<U H<U 0,o v  ;U M;U< ;U ;Ur  By;U ;Ug n e/SQ>t;U h;UV 0k@;U 8;UHQ #  DIP 0<;:U=:U"*:U :U"P$:UQ Qc00 "  d0 0@-<P 0 A(000#<9U 9U< 9UyɟP 00`0 R0@0% P00C\dY 0  "!X0 00 D9C& < 0 "! )0)0 R0FSL8` 8 8 bB&! 02 S6ʸ1b1 R0@@00@lȟ`00C\ 0  "!80 00 $8C&  0 "!7  QDT3  0PJ x'7 `7 bB&! 02 S4T1b1 R0@@00@ǟ`00C\ 0  "!0 00 6C&  0 "!6  Q 0S6 0! 0#$0$   BR !7&6 P 6 bB&! 02 S1b1 R0@@00@şP00 0bJ10000 1 0,$,!$#, \@Z@0SAt@ 000 R0P0 $@00C\td 0  "!h0 00 T4C& L 0 "!ğ($00 R]  0@@@+P& #3 @ 3 bB&! 02 Sʤ1b1 R0PP00PXß@001 <4(<"4!<001 0#$0$ 0 S0S0002@ 2 2 bB&Pr2U 2U   @0D,S 0\PKP@PZ0[Y [$ R !)zP@ 0P@`@K P 0 P0!  6[#$0$&K NU0U 0410U 1U 00U00U| 00Uw 0Ꜥa,f_ Q@c c c c c Q hc@c c c c c c c c c pd sd ccedA c@rdAc c cmdqdgdfdhdcmc cc[c[cha[c[c0LaPa8addQ @QQ` -L$Me0 `40 I4 I d0( 00,%820< 40 0@0 0 e  \I  VI0 <0K?X $47<0@,PK0@@I0  @P)0[* [0b0S80 ڃ1 @ TT T $T80Bt4P   P00 P00C\ 0  "!T0 00 @4C& 8 0 "!0$0 R  0PE@ 1  0 48L8 Xp*ʰ1  P 0 48"U0  0dU@0@ <0s0pWpW<0 8XWIW0!038YD r2 @ 0 b2B&! 02 SP|1b1 R0000R@00C\ 0  "!0 00 1C&  0 "!0!0 R<0@  0  0!(0("4400$ 0 40 T" 08< 4f08< 4@K2  @T T  T  T T T  T  TT Tx Tp GQp|WEVPa[c[c[c[c0LaPa8axa0aaaaa`a -L,M` 0 ؀!4pKP@ .-H%4K@(0K P P@P# [$['0[(["[(,&[!P[8<%@[$ 40 RQ  0cP  N -L$M@4 ` ,@ pUPP ,0K ) 0K@@@ pP@,0S@@T,4 ,0 , 0^ @@ 0 [ N -LMP`p $P P@ $0K   pPPPPP $\00S 00  00   -L$M@`p 0@ PPb 0KN 0@@@@ pvP@0\@@T  0,0K 0+ K  *K)K4K@@@ pTP@0Q@@T, [00 0+0[ 0  * [000 0)0[ 0  40S T 0 @e 0  N -L$M,`KP @pFY0,K0 (K$pKP @@@  -L$MP $ 0`L  DPp8 (K$0K @@@ `P@$ R@@T00$000$ 0S (0S T0 x@ 0 I  N -L M0pK@` F$PE.KD$h$t*0K0 -`K,pK+@K)K(K P PP @  p-SLM@P`/ Q+KP2>K 0@T@c@cPUJK!@0L\ 0 @p0N^J0D@T;pp -L M0`KP p0FG0KP*K @(K8)K0 -K,pK+K@ @@ N -L M(`KPp  F@K}(K0 pKP @@ -LM@}̠ 0@ @ -L M0@KP `pEBU0K/[@/K&.K)K4 Π0 -pK*K`(`Ki -L M0PK` p@ECV0K/['Ġ/K)K8'KP0 *Kp (pKA p-L M`  0@PU 0 pP nP -L2P -LDT;D1K0T@8K Rp8pK2K@ 0K/@K PjPKP 唐  D@ Pp0 P ἐ @帐@ P@P  帐`P吐@8Đ 嬐< 4(ᴐ, $ ᠒ .RP 堐 $RĐ@@ @婓Ȑ 0 *@TP @ P pPp堐  0   000 Z@,0 S ,*霤a0u -L,MĀ0pP8@K/K $0 CCRP0K)K|0 @0K`ˠ*PK` @(@K'`K*P4 [30[ 0 $0S $j*霤a0u -pL M`@ P0KP 0$ ^C [CR@0K&K(Kl 0)@Kp 'pK@T  0G0u -LMp0P@K`+K  0 'C$CR,K%K0P@,Kˠ @$@KP#PKP@ [0[4 CRK 0kG 0 S  )霤a0u -@L$Mp` PP,KP 0( B BR,K%K$KP0 @#@K oP@  04 S 0@ 0!G0u0S\2n -LMK 0ElP -LMP1P010@`0\p1X1T!0S1p<11S1ա91š 0 000AF .v .P@) FT T F 0jPd  mFF PE@ E0TP@F  @f_f_f_<hh,_Ը -1ap @ $LP P00$ ;004P$ 廴$PpAp00C\ 0  "!<0 00 (1C&  0 "!0 0 R3쀟 0PUb p@0SP 0@ 0UP0U p@0SP 0,@ 0UdQL[c[c[c[c0_( g__q_,00 - 8L8#Č MP, 7/P@~ 0 , Ԡ(1Ppr`V7 0'X Yp Y0 80  Y0 80 0`0V0 0 00,1!/ -X 8X2 R`p0X Y0-.0 MX Y-. Pp X Yp `0 -Pp000 P0p00 0`.lf_ 0 !4-#LP`.P@: 0p0P# U0 60  U0 600(PUP 0 00 000 }0. O 0<0-%Slf_ -D`!88#Lh!Y.Pp 4pK ?00&((*&<&%4K20K1 K0K/`K-K,PK p0P /00 0 00<H0 @ 0   PP@0S . 0D0S2U6 !p2U t2U l2S  0 00<01U 1U  ?K e/C1UE 1U 1U00 "   QL10S 00p2 0.P  0 DP0U 0p00!.|&4400 0 00Sh 0S00000]D0U^ 0H0Qlf_QQ @pd Q@mdedAsd rdAQmqdhdk~gdQ` -L (>0`@K(0 TK0 0@pK,0 Q8d0804 %0 0S\\=- |5 w(!0BP9 bB(0 4< n0* 0X0 0d,*((0 "4400$ 0  0 X"80 ,0S <,$ CAꜤa@PpeWEV\ F -L$M(K@0PKp==(KP`0&$$X$t ʠ,K+PK*pK)@K` .K-`K+ 0- 40 L04@ p0CS00S 00S 0S P P 00  dA0PPAH P0 (AAlԹ@KL 8 8-#DLp$*PP) @0d 0  0S(0 4 @V **0 P@*0qP@ lf_ -LM`P8 Pd,88 #$"Pt00pU0YQ @( ?P< K ? ?2P` 0SX`p.4PK <(D&,&Ƞ&*040K2 K1K0K/`K-@K,K<0:00 0 x 0 0 P08 $ (<0,000 0P<<(`alf__a'R \ 0L_S BR\00 -LtMP, Kp: `VD @ H 7 %00S2 S 8 0# R 4K@80K  @Y8\ 0?0Sl @4K P<0K P@@@C<^ 0?0S; Y ,0S40S< 0 0 S $ S  S a@ DH0R@ Q@ SP>X0  >H S S  S S S  H 40D S@ 0 440 Y@0D   0P48@P  04H0  >D 4K 00K @ @0^ 0?0SY5 PPK0@p K` KxP #-0 @ +0 0004PPJPPf_  -LM0p P@@0 KH`U@ -W@ 00!=00  7H 0 ^L R P0R00<P <0LS7TTTTTT00` 0R00<800LS00;0000;8 Q 40 ` R  R  R 00 000R 00000` 00` 0R00<< -D0!#p0<!4#2PLaL 00T 8@;P:tAt!P000( $( (0$0p(U4P0P0C\ 0  "!0 00 0C&  0 "!0 0 Rh A=04000<;00`@`0@ P000SL PP0S P0%=P0f_[c[c[c[c0,X -LMH`p0S 0PU $ R(0(0(00(0 00   00< ;000@ 400S    00 0 <0+@400 000000 P00 7(K6800000<0 ( K(0K0000JK '0[80'0K<; 8 $&0K% K$K  0 < P0 0  Q 0 0³00 0 004`F0?<` -QL M`@p% Q00? 00$PK4H@$K`&&T0 "K!PK `Kp@@ @L00 0<0000#> -L0@ ^`Pp ^ 0000 P00V00Sa0 C 0^0 -`Lp$MV, K0@ 0P 40(KP V 0 0H40H(K0 $`KPpP P -L$M`0p, K@P(KU0 00#>00 4H0HW@@@0 (K@`'pKP P00u - `404 L@ P0p p0BS X 0S 0ҵ޵8ҵ<ҵ 400$Y 80 ( 0@ 00W 000(0@00B  00W 000(0@00S/40 0800 80 -L M@` p4PK 0g1`V00 0TT0S 4 00rcp`S㴿겿00"c1a ᾎ ጇU -L M1@Ϡ PNlpa4PKV8\0p  h!8 n /T40s 4!,!?L3cS 08T0S$ ,0S0\ f1W< V0<0  ?B3cS!3$0J0$008 b>0 V$<bꀄU U080SgfffUDaMb 0-LM0@(()0K[ S 0K )夂(^ PU 00++ 0KK吂$0 Q0(()KP[\0K  )Pw( 0- @L aP,00 0dS0@00@00"ɾ 0 T0 08) -0P2c1RL@,p ` (H4D 0,0T (0 0S0T00T0x9)4 -LM` @\ Ƞ!$C"a,Ƞ@Qp 0 @ @)0,P@000y$0T0 0`0 S00* -L 0!0 0T  00 #(0 0 00   0000@00 `d 00 (00000d(0Qc(00@0I\0SdX D(0XS 000<S$2S\hdx9p(|d0@- @,PU @0T00\0#(# 0$ 0 T0PXP08( -LM `,Pp 0K NĠ@ KKPKP~000  0T0 p-LMP`!"a,@  \40T0p7 0 0 00 T0}.? p89 -PL0 aR@,p `  4d00,0B 0T0L(00T0餿840 ( 40(S"4S_40 ( 40(S"4S_ 0_ p-LMD@`P/ /PP U @pp錄_( 0 PR ጄ_ -LM#P@ `/\0@T 0SD S8 @T(///0Ŀaп0< Q-LP8 `Pp@aFQ00`V00S00@0@T 0S S @T`+P00+P0|P 02$04 4-aܿr p-LM@0s |`|P#40!cS!0S0spp0 0S S000__ g_ -LMٹ| B0 @000C 0 0\ 00#!0 00 l0C& d 0 "!0@ 0 R A[c[c[ch=!La_[c0 -&LMf0弆 ,0 /0 6 r "4"@ !$"R@pK0`&PC/PPH ,60(&@T e. 0K 5@Pn .0: eܥ܅pKⴐK.Q R a ..@ 000*P@0@0C\ 0  "!<0 00 (5C&  0 "!4  QU$QU0 S*R  0~P l40SQ .Pd R R b u.@s.@ 000奔0*P㟔@0@0C& R 00#!000 3C&  0 "!|3  Q~U 0K8\[*P 0SQ   p rS S@ 0R@0 0D0 dp0S  0CSSp0D 0S 0Sx  P00SR 0S 0SPx x  0S 0SPx x   00  0! < Q08 0000,0S0?0,080S00, 8WEV -80LSP`p (0S KKT r> 1R0S PPV# )(@2@R0`! 0R 0R: 0S  P 0 0 V08$e/Z(e/T(WEV -LMp( @დD@8P&X, `L T(0 "<00 @  P@jHo@ $( 0S 0S`v  P00SR 0S 0S`Pv v  0S 0S`Pv v 0 01,0 0T0,0 @0(0<00  ЕP@H( @0e?C\ 0R 0e?C@T e/'000 Ვ@00:00ސ0S|P (HWEV -LM(`< @PtD8/\") T0S`Q@ 4<0(` 4# S0 S00Y0 4 8%0@4000;0000 0 ᄅ_8_0ᄅ_08_00 -L%, -L%@ 200 R 200 R 200 R 200 R 200 R 200 R000 200 R 200 R 200 R 200 R 200 R 200 R 2 R -XALM 0T!  0T! 0T! 0T! 0T h0T  0T 0T (0T 0T 0T 0T h0T  0T鄅_-4 0,^0^ 0$,aaTlR -LM܁ Q 00#QY Z  030Y P$0P00 0 0(p,` p0@` $40 0@ 0 0@ 0 $4P (p,`@  Q 00!QY 0SYQHPD@000! T0 T4aa,^c_d^c p-RLM@P9  `!0\0\00S\r pQ< 0SddddpT0S 0Sr00V0S` #4aa -@LQ`8 fPPH T00T0SV#|1!qPegggT`0HM.$04 V000M.TP4 0(,04@0@!! 00 PP@0  "!鄠 $04 V00T 0V PV@S D#La_4aa_a p-LM40@S  S R 1Q`00#! R0000 0 0!!K0S0p #4aa -TLM@ 0Q@0 Zr 0 @催 04aah0aa@0 0,^c -0Lp 0AS`0t 1QU ,P(`V @0 PVU$04aa p-LMP`@U*T @T`p U*$$8#8&@p8_ -LM0@040 T004 $ p-LM0`@040P T0P40 Tp 0-PL @ U   0h 0-L@P        H0 p-LM`@``P }Hvp00 0-LM@040x 00PU   #0g c KL H#DD( @ (K0  $@ P u 0#$<<ejhk -LMpzsP`Us 0 0$  0Q< $P< <800S`P 40PP<00S<0   Zz ` <4<8  4  @h h0@K4@ , @P 0  P $000S$ 0040$0$40D`(00(0 j!8ppd sr-LP`p  0 $@T uv u 80U 0@Tv D0VW W P :! 6! p-rqLMP`  0 $ R uv0@ u 80U T pv D0VT404040@ ! -QLM@8 0C?. B"0" " H - 0L0\ s0 00 0-$@0 TLP,00 L0 P0@T0 0-$@LTP L0 0@T0 0-$@0 TLP,00  L0 0@T0 0-$@LTP L0 0@T0 -PPL0@& 00 1 ` ^{'i$8 80$8P 8T0@8$0P 8$8 4  T0  hK UP p-LMT P0`@H \ 8  0$ P@0 8$8P <8V @ $8P@40 }TppT0 p0h@T0 00 T00T0| `X08<#30$P 8T0@ \ 0 <$ 8P< tx p-LM(0a Pp0@000T8TP0$4P L0@0@0C& R 00#!l000 X0C& P 0 "!0, 0 R phL[c[c[c[c0 p-LMPP 5* 0` p8 $48@P0$ 4@@ pd R0d0 `00S`0 L0`@ppp p-LMT0@![Y$80 P8}?`$8P0 4P ` 2cVH0S T0  p8$;P8 T0hT? -LL  -LMPP 00`Rp< L@$<0 T ,000@ 000@0@0C& R 00#!000 0C& x 0 "!0T 0 R i醧, \00Q0S [c[c[c[c0 p-LMP0`, P@ @@0W0T`0`W@P``p 0-T0L @PP X0  v k _ U\0   B 1   X00H  00hT 0@ T d00<0H 00vT 0@ T d00<0H0 0f\0HT  0d0T 0+ W\0T H 0d0T 0+ I\0H( 0@H0& 7X0H0& .X0H0# $X0~H0# X0sH0"iHPQ- -LMT0@h0S 0 ?C5A0P 0S0Q T  (RL#R!&R$0RA0R#& -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 000. 000008P0 $4P0@8$ 4T0@@ \0 -P   006    0000000  < 000 006 000@006 000 0008P0$ 48PP0$ 4 -L>P  V p-LM@P`/  |(0tH0 L8 P`0 T0d  $8P4 00 X0pphX VV 0-(0PL@ F 0ES  H0"S 00 H0"SHp H0"S 8P0 $408$;P 80% 8P0 $4V>8$0P 80 -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 0 00000$8P0 4# 8P0 $4P0@8$ 4@ 000 006 @006  0000008$P0 4@ 0-@L8P0$ 48P0P $4$0 S8P0 80 -L)P DV p-LM@P`  t(0lH0 L8 P`0T0 $8P4 00 X0pphEDV8V 0-(0PL@ 7 0ES 4T H0"S 00 H0"S5p H0"S 8P0 $408$;P 80% 0 -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 0 000008P0 $48@P0$ 4@@@DT@LXdp000000000006006 -LM@8$P 08 -L2P hV p-LM@P`#  t(0lH0 L8 P`0T0 $8P4 00 X0pphNhV\V 0-(0PL@ 7 0ES 0܈ H0"S 00 H0"S>p H0"S 8P0 $408$;P 80% $0 -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 000 000008$P0 4  00000000000006 -LM 0T@=P  @%#,00R0S ? tZ p-LM@P`(0H0 L8 P@00T0( `R ph $8P4 00 X0pphoV8 0-(0L@P0  H0"S0ES꜌hx0%0b_p00d -LM@8$P 1<8 -LM@`P L%?> p #C2(0H0 L8 PP00T0P0 $840  X X0 \0  h,hw$8P04\V 0-(0PL@ 7 0ES ꜎h  H0"S 0TX0 H0"Sp H0"S 8P0 $408$;P 80% %0 0-0LP@)P 0 0q 0Q 0P00 -LTM0d ` h 0 l0 p  d00 80dp d0X40   p <2P P Pp X  Rx t t0   p 1("(RP Rt0x0St0  @<  0t X0 0P0 lh0Z`0 8@ \ D `LA,M9p P J?Q,1(Q Z00 q\0 2  0 ,  ${P  P@0   0 (0 BP@   :P P T , 0 2 !; 2# 0 @  @ ,2@ A0 @ ,2 @  0 ,25,2eP@7' 1! $@0@0 m KP@$2 ? 0<K PP ӈ 0<$ @6<@ (P T 1 $$2("_0 000 T 0  (2? P $2@ :P0t @ =@K$ 1 $ 0 ?0T$2  w00  T,2 =0#0Z00S0@0  `0Z T 5@0@ ,2;,2 0  0  4  4  $4  $$"`4    ᖍPᐞ 1 $4 1 $m?$" 1 $ PP0 T 1 $ > $ 1@ $@D k?0 T 1 $2$",207,2a 0 @  $20$2  0RT pzlx 1 $ Q@@0 T  [0T Q0 T  x0T! 0 T 1 $ $" 1 $ 1 $ 1@  $g 1 $$" 1 @* 4K8K0P@ @@UP4 8 T 0,K0K@ @@PAP@@X]A,d(RB$Bt<5DBdBB!\8#\Q( "(R0SS S SS((00000000000000 p-LM2 BP@ $@ 5 D` \4TPp 1$  -P$L p`:,2V4,24,22@ $2@W @ @X@@VHH"Z@@0@  1 $X000 V000 T" 0 T -LMPpP`M  0phPB ` 0T A 0T  0T  0p}G 1 $l p  0T A 0T 0]'P@ $2 , ` 0T A 0T  0TZ 1V! W00Y @  0*@ 0@"P?P,27,2 1 $` 1 $  1 $ BBBRA - 1L` $@2  1pb R$ 1@c $@D (LC@= 71+%2 03 1 $  /0 T  0T\PD8 , BC( 4 %ž0( 2$"05S(<2-A %>( 4 %ž0( 2$"05S(<2 -LM@P$2 7$2(A%>,"%0( 2$"(€ -LM@P0 0 -LM@P0 0 -LM@P0 0-A (%> < ž0($" 20% S<(("2,28,2 -LM@P0 0 -LM@P0 0-A%>,80 ž , "$20S(20(2<2V-+,("A%>$ Ɍ@ 0 2$",€( -LM@B 0 SA%>Q 0 2$" (,")<2,"(P0 2$0"0 (2 0(21b1`-" 0(S,,BA%>" ( 0 2$",v-" 0(S,+B@A%>" ( 0 2$", -LM@P$2 7$2 - L98D -LM"@0S SB  'A %> XD -LM"@0SB  S 0A %> ,2 0,2 SC XD -LM"@00CS ,4<B %> ,2 0,2 A C D XD < -LM0 `< 0@P  2  S S  ,Z  SO $K 0K P (0K 0$ 0P $ 0( 004 0802=0<ᎩP6 0,K P,$p@0, (P@  T t} p{ dw ֩ 40S , *0  DD$uDt<d(E -0`4pPL 0T 0X="<"2@ 00  L@ 똂q0<>,@@ڠ岎X,10 P00Ss @2  E?,2 P 2 & , F? 2219  1?E G? 1K1R  1X^ > 1d1k  1A?< `05 AϠ/\& ۀ HT < @0,BP@_  I0TL `0T P0Tp0  E?\0#T0( 2 < F? 80FL ,0UAC!"B -L@  8 < 04S < 808< 0I? wSu 80 8 0AB p-LMlP@T G 0 SP Rp 0-LP@@T0 -HLM($H"(P`p, ("(-K"0[![ (0"("K"0[ (0"(![<@K"0[! [H$H0  0 80 -(LM"(P`p0 X (0K A[(H@ (K0[ [0  (K0[ [0  ( (K0[ [ 0  (K0[ [0  0- @PL:X 0X0 0- @LP(0 08#8 X0 0- @LP(086#8 X00 @- L0 ( 00P0S0P 0 ( P 0 8-#x@L@`P1 V 0FS 0F`` (!0 X (0!0 Xp  V `F(  0F0!0 X  -L@P`j 0 8#h] p0]  <X` ( < X0V8#h0] h 4B0>3 -0L (P0 P00 p-(8BLMS@P"(R B`` (008#80 X pp p-LMP`  $@ @p p-LM@P` @0 T p -LM400pK@P .`  04 @0 [PR @0  0K@@4  ("( 0.[Q R.0[S/0[S@ 0 -@K/0[S,[8 P0(",0K8 0-[0>\:2  .0\ -K8 80Sp< L^< 80S @ -[e͠ 0-[0, [ 0p<0   0 I?@p ͠ 0 0 -[ 0  {p<0  d忀0I?p~ 0 0 0 <0 ῀Rq -[^pW  ,[ p< 0 p0  < 0 <0  5@0I?@,[CB -0L M '0K& K( K%K$K@0`4p<`P P U(0K@2(0K$@KB -P@ 0L`p~@ 0h4 0-L@P 0 @R2"0B-\0΀ L0R00224 NS0S"$PBC -LM0@P`$004PP (pR  PU 2UU 0E8#= $0| 2 x  P 0 RPi  P :^^ C^%^ ^^ Z^U^[0 00  , <S  (^^! 0 000 00a 0  pP  P*0   X<S  (^^ 0  ;;S0 a0 P  P0   0#000 0   l0^ 0 00.P 00C 20> 0`00H ABEF -L M40p0 P`X 0 8@ 0 00S ,0  Zh0JŇ(́@Y,0X  *00 0 0 0  -L,M (`4 8 04< V@ Q 00 00C8#XH 0 0. K8 8- K ;1Q#xH 8 L L0EU8(0K8Q #XD +K,K+ K, K  @@;1("(#x 00K/@K8H 1D("(0 _H 0L8#8QH0 8 4@ <  .0[Q0E"(+PK,PKD .0K+K,KP -LMp0P@`04 0 % ;1#h 0@$ 0 0$0 @@ 0  0"0x 4 0 o   "D 00C 20> 0p@00B p-(LM"(@P0 `X 04 X 04 X0 X0 X0 X0 X1 X1 X 04 X1 X1 X 04 X 04 X2 Xp$ @0C1a!cP0$I-\\< <0   0S`\0 S*0B\ -P[Q(L"(`pm%X@ g@@$@P@@T -p@T`LP: 0P@ T: p-LM6 `P>@ p6 0O6 00dQT@p 0-6 L@P6 000h/ p-LM6 `P @p6 06 0d T@ -LM0pS` ;QX%(@dV` p-LM6 `P@p6 06 0 d T@ -0`4pLӠӀ@Pe0S Ӡ 0S t -L4MH 0P04L0 vP 0DKS@:;1("h  #xH\  0 0 @R*Pa<[A0ST0 00@    ("(0 k L0P>T -L,MH 0@04L0 &P 0DpKS`*P(;1#X<0 A0S 0 `R*00d  H@\  , 0   L0 -0L\M91 0`4p ӀP, 0P0 1 ,0S , P@  0@ | K0OS|K4@|K  0]Ka^KX@ zKxK`K0 @0 0 |KP00  000Ӏ| KGP`=  P A0Ꜥa0F -LM00p40`@R!@P2`O0,0 L 0 PA0@U0 X (,0P0,0 ,0P0,0 ԠӠ, -LMH$H40 00f -0LM<`@Pp000, S04@P00S 0 00000 0$0S 0 R 0 J 0 S ,  0B/00 0S , o&P 0 0 0 -LM@0S< 00S  0P @FPF -LM`@ 02Pp 0UV 0UU00000U/ U = 40 A0o LP U DP >P-000 4P-000  )P U | !P-000X P000 4P, 000XF`FhFpFPFFA\@-@ 0R\ 0 00[c[c @-@00C& R 00#!l000 X0C& P 0 "!0, 0 R@[c[c[c02`Ẃ0 ᴂMb8#8- SP 0S P 0S\^ 0\4 -L000d 00400 6 <80`05pP \p  (0K80O^W P(@,K@$K</8' 0-L@PF  ,0\R0h (0 ,, -LM`),P )0x0 S0  ;$000d t4R h4R`4R*X4R P4=B 0CS000000504 4R 3R3R*3R6 :=B 0CS060#3QQ 3Q 3Q 3Q 3Q Q 3Q33`00<0 880pWP30#Q00Q@@T㨀Y3QV 3QS QQ  BP80pWO^ Ptl0p@ 01 4 8 h%"0  l5S  lB,0K0K @>l5S ZP l5S `l5S  4 8l9.p04 @  P A,0K0K  @ l5S `00l!:00` q0UT1R:L1R1MRJ41R 1RD*0R01R05:; R9 00R0R 0=B0R 0R *0R :h0Rd00R |0R Rp0R h0K/$$$!$$$$%%Q&R&0>@L'8$$S&%o&'qq -LMl0p@  2"r,`9r d2 pL"0U RB = ,K+ K@12d1 ,0K @T,[ P+[@p12dQ00@TY lp0@  |! 0 T0p 0 ͠ 0S Ɨ+K,KR01,0K, [+0K  0 ,K+ K0,[+[ 0Q ,K0 0Q 0 ,0K+ K|0+[,[t 0Q 00+0KT0T 0Q, 0S0!,0K, [+0K  x>AX_b_]_e_ -LM8 P8l0@ pl0@pD l0pH , l0pT @ @p$41 0@00 4 @9848 < p,@!8,27, 2<O^< p4Qlp 0@ l@p 0D lp,0H l@p00T 8o|4! 0T0`d # 3 QQ 2Q 2Q 2Q 2Q 2Q 2Q 2Q 2Q 2Q 2Q 2Q |"=A 0CQSsh2Qp `2Qm X2Qj P2Qg H2Qd @2Qa 82Q^ 02Q[ 1RC 800 ( &  1 ,!`, 4< 04 < R <eX @9O<  0R0` P` @9 R 000 0R0玁0 0 0'0  R0000 0S0:0 0 S:'0 00'Α0 0 00 b$!$J$K$$$$$$%o&S&'h_ -  808 0 0 0 e_b_]_X_E-08 P` @TP0 p0P:P 00^0:0SS00Q  00QQ0 0QX_b_]_e_ 0@-P@ 000 000 00e_b_]_X_ -LM4 `)NP4Kx0 S0 1!00d 0 405 1Q^ _1QZ 0601l`0 080< p@ 8 8 @80pWP  g0Pᨀ 80pO^W Plp80@ 8  0h%4lŕ\ ,0K4 @0K@\8 8 lŕ4\ 00,0Q0K/AttpJL'it -L MP`0l0p00 0H 40 l0pP 0l@0c,Ÿ2p@ ,  p,@ pWOYlp0H l@p 0P  |! 0T0g! 00 4 2 00, 8  R00ą 0g a 12  07\00L000Ũ0 ` 12 # 0# 04h0 PQ 0 0Rg0 000g0 tL -LM)0`40 P  0 l0@ l0P 2%XU 2U 2Uu |060 0x0 S0  60+SL2 d000 008"040` <58480pWP4 ZP㨀80pO^W Pl0@ p g0280 h%940  l5S `A,0K0K 4 @Ul5S qP l5S Nl5S  4080lp 0@ 0S00U0?S0{0w0Sp0U d0Ui\0hP0U H0U_t0K/PL'LLLI1G1Lw11 -LMP@l0H pl0pP 0\"0c2#pp 2  ,2  2Q2 R020ĕ!0SQ00ė`, `VY@lp0H l@p0P  |! 0T0f# 00 ? = 00 6 b"f, Q0|  Q  Q  00| 06\00L000Ř0 ` 12 # 0#d0 ,0 s|00Q fjnn_u____{_ -LMlpQ0 @3g1pP `*0 S(0#4 0 P @ p!p1W0`4p@0P!QWL5Ť4Fڤ4S$(> W 7 04 0 64S@,0K0K @4S 0AP W @ PP  < 4P  0&$4 jJJIJUL -l0`LpP l0T p 8 pW P@4S PONU @UU <P8 8 p -`L)P`p@S0 <00 x@880T +80@TxL -LM*0pS(0`#4@ 0P @ $x0 S0 !00 !Qc [1Q0 1d00<01 `04 8580PU@ 4SONP @80Ul@pPp <<p <T0 00 T0l@pPp 04p lPp@x 04x 6 D0Q40 00 0 00KHF/DY\I -LM8 8 0 4 ,4可^4 0Q8o?80| 0! 0T200,0  a002Q 0S0@0 20,0 04  00 8l`0ppS4^VPTP@  !,22 4Q[PXP8 l0@pAs@ 80pPl`Q@ @0sPAp40  0P Q55 @0080p@l0As@  @RA80@*R40ȁ60S4040pAlP`s@0p< 0 @A 44< ml0x p8 @P00@  ꓍___ -0LSP p`l0plPp`@P @00P hl0pT lPp`@T $L4<T -LMpP{xvx0 S0  `1 00X16 d00<0H1lPp@ 4 5`08 00 l@pP 00 lPp` @ $H@8@8 80PU@ 4SONP @80UM</a -L$M8 4 803a410* <0 (0R8#4 @ 0p!@0  h1<\0 4ž<PE 8 20D0 D0lP @pp `@A 44  Z8@ 0 @0<S0$0@,0K40K<@ @<4S4<8 @0 $,JJDKPKXKhK'$M 000d 0 506 050%`0080h <* (0R#4p80`pVSP \`  ,0K80O^V P@D0K@4S `xTx$`0 00lpD0l@0p ,`0`0C\ 0  "!0 00 3C&  0 "!0#0 R /kS#`0 00lp@0l@40p 8`0`0C\ 0  "!0 00 2C&  0 "!0"0 R4 j2B"P0 00lpD0l0p HP0P0C\ 0  "!0 00 1C&  0 "!0!0 R jA!P0 00lp@0l0p TP0P0C\` 0  "!0 00 1C&  0 "!0 0 R xj 0  p p8p0  py|` 0 @  0 0@ QPK</(n0p'[c[c[c[c0lM -Lp  ,0^\RQ1 t1 1Pt@  0\ m8Q81` 0 lp l@0p `0`0C\ 0  "!0 00 0C&  0 "!0x 0 R i T0 ,,ķ[c[c[c0 -Lp 0,  Rdp?T&0L!01QxN  6\l&0 01Rx  <\l%0 01R| 0 ,@0S |qhqqqs \m H0m0S   l0S] 0  0P4ğ  UP 2200T200C\ 0  "!H0 00 44C& , 0 "!0$0 R 40#P P m+)h 0 $  $ 0 $ 0 P $  0Ty (dB2P 0 lp l0p P0P0C\` 0  "!t0 00 `2C& X 0 "!04"0 R@hQ1` 0 lp l@ 0 0+k H 0 !k $ 0 @ EPs00 2R0m  0\0x0 S0 4 d"A> 000d 0 506 D2D"<`0h 8 0(K P`   0($ @P1(p@ (Pt U! @18 3d1TP@o0S 4S `HU 8 (Q(1` 0 lp l@0p `0`0C\ 0  "!0 00 0C&  0 "!0h 0 R] g[PlMķK</(n0pG'GGHt[c[c[c[c0 -d!L`1M, H `, L1L0,0D!D0P 04 , |040 8 8P1 @0e!pS1#D 0   PP%U4 80 0R4 80 , 0 , 0, 0 , ||0,t t0 0 0, x0,0Lx0 o+-(.ķX(p\N -L03a`^q\0@@L0 hŇ`}PU$T h%(_N -L M1 p`$$t 1,0 $, @0 Q 1D!00 0 0 P$  op04 <0M>000 P$013$0@ P⊡ X00P  PPX, 001  8  004$ķNO_$O -LMx0@  001<@$0 01 $ p-LM0 h0 P@` 0 <@Tp 1 0  -00L!|0D $ -40LM|@0D T -00L!|0L $ -40LM|@0L T -40LM|@0T \ -LM`P)P L2pQ0 Q0 j@0q dP@b x0 S10 !000㘡d @40 0`<58 @h(PB L1L!  @7/ 430( K,0K 0 0 04S t/jP 4S 0-lp 0|,K (0KXPx@Dx@POK/TJDKPKpO|O'OOOxL -LM810,0 3p P `,@0(`VOl0pL 01pp,0wpP  Q10hY |! 0 T 0w 0Wp <040 P0S RQ0m__0@-p0"R 0\P0X@00"R  ^0S0( 0R%9ba8_$0(#00"(R0 Q(0S009 -LLMp0lpH  80l0  )PP`  85 0 l0@ l<  0`K80 P@% 4 0S0060 $0 ux0 S0  `4P00X$X4d 00 040< 85P@@@  4lPp``0P @$H@P @88P 8 W80X` P80OnX `{Xl0? X: 0  4S Cd0KhK  @4S  0P Xl0l 0 l0 l l@pPH l 88H 4S `l $Dn02lPp``0H @H $D@<@4H 1l`pP`0P @P @00P lPp`P @$HP @ZlPp`T @T $L4@<T 0 Q 0   0 l0@ l0<  8 `KPH D 00   6LU06`@06@baFK/l'LpULP -L Mp` .,P, l0pT A 100p0@000 0Z_Yoh |! 0 T % 0S000 PR0C 000 ,00,0 lp0 ,00!,0000@l0@Q@ p@A0  H0!80,000,0 0 R0 0ŅXDd -LMP@2p0,0 `,@0YO` l!p@ 0Zo |! 0 T0,0 .0S000 PR0C 000S0,0 0\ 긏1 1 0 00lH p 02 0S00ą,00LS hhd0   H@0  0 0 $)XP.4: -LMp"P4 x0 S20 "l@pP00d T 00T lPp`@ @@ $D@@<4@ x!l040` <85 p D῀8l0p@ p`l@PP@ @PP00@ 80`VP P\ 080`O^V Pĕ\  (0K L@,K@]ĕ \ 0K \ -LMu0 4 , ,0C, 叏 R, 40S00^lPp`@ @$D0@ @L<4@   |0! $ |0!0 T |! 0T00 7010!08 @,lP@Ap`D@@  822 , @lP@AppE@` @A844 ~0 RC0S0 ,0,4  0.4 ____ p-LM|0`!$ |0!P $| 0PP!0Tp -LMl0pp@ 8  Y P `@4ZS PON U @`  |0$ H8+0S$ 8tPP -LM`)tPH qx0 S0 (!(1d $!000840<56` 08R:0004o80pWP \ 080pO^W P/ĕ\  (0K T@,K@ĕ \ 0;`K/,' -LM0 l0pD 4 ,`0Xo,Q oA00|,! 0T00l0@80 A@ pl0D@ p 00)  &  0, 0 , P0@00840lP!@ A1@ plD@p 000   00P, 0 , H0 -LM4 p< P4x0 S0  <0S000 < 0R000<0S006000#;00d #l`pP040` <85P @P $L@@4<P lPp`P @P @@00P l`pP@ @@ $L@4<@ lPp`L @L $D<@4L l0p 8 8 l)p08  l0p 80   <0SM80`VYP wP㨀80`O^V PJ 0S h%4_ 04 l5S < 1RA0K@4,0K @wl5S4 0Pl5S '80l 4p 80 lPp`H @H $L4@<H K/L' -LMT 8 l0p0 ]2"0 40 , ,P,可P, 8T l00p4 R o80 |4! 0T@,`01 0.00 0000 d 00 0 H 00@,0 10! P0 4,  04 ,80AlPpZ@pt1 `@A 44 8H lPp`@H $L@4<H @ \000 QS0L00 0S0@@000 8H l0p0 PO 20 S2Ʌ0SɇGj_č_n -l0`pt L8 XP @4pS PONU @5 (0S  8 P -LMptP *08 S(0#4 0偠 R R R R R  ]x0 S0 #3d #000` <04508  SR6 R R t04 8080PU"@PS ` l0p4P 0 12#  P}80PONU @ Rm R' R% R# R! 0BS8RQlPp`X @$L@TX !@ @4<X lPp`P @P $D@<4P l`pPT @T $D@<4T lPp`X @X $H8@8X 80@S4 ,0K  , K00Kll5S 0 0 j&&h0K h% `8 0BSR:80S0 6040ꅠ80ASK</,PL -L MPX l`p@ 87 00CSi꠨$$$D0DSW1堑, 00 p,@0pWOXom |! 0T l0 !p@ 0  00 0bZ30 0S00ą  0l !p@ 00,  Q 0S0@0 0 T DD0D@@0@8e00000_D_P____h_|__P__Ď_ -80ZLP `@p|0 $ 0S 80`ONVp @ &0S0 *|0 TP -LM0`(|8PP l8P d8P \8P T8P L8P l0pP 4  hP@ '7QQ 7Q 7Q 7Q 7Q 7Q4  4 '7 QQ 7Q x7Q p7Q h7Q `7Q 40 H 3000 (7R 7RR 7R x0S 00&A>000d @4@5 Ɵ RR VR vR R 6RR \6R T6R R R R R R @6RRy 46R6u %5QQm 5Qj 5Qg 5Qd 5Qa 5Q%] 0`  <08 5RRN 5RK 8`%\5QQf P5Qc H5Q` @5Q] 85QZ 05QW @5@%<545  8p〆  W%8 lPA` p80ld@0p 80pW 4RR x4Rጄ |80 \|0 $|0 T|0 $|0 T80pW P P#80pO^W P0d#`3QQ T3Q L3Q D3Q <3Q 43Q lp40P 0"2QQ 2Q 2Q 2Q 2Q 2Q 2QQ 2Q0 4 '$ 0  4S 0\"QQp 2Qm 2Qj 2Qg 2Qd 2Qa 1Q^ 1Q[ 0KB  ,0K@4SI !1QQ% 1Q" 1Q x1Q p1Q h1Q P 0T!QQ' D1Q0# 4  '4  0 0QQ 0Q 0Q 0Q 0Q 0Q =A.>:  06@0K:s꜀0 L0P 6@060000:00FhMhbiMibuuRurK3M8M0M/Tɍ_΍_Ӎ_֍_L ܹ T$$ -LM`60 t3RR^ h3R[ p,@PpWOYov|! 0 T +  2 "   0P2 2  <\W  l !p` 0 P2P"008 $2$"008|0 $l0pP @ ;:   20S`1  1 R20SU!0S00Ƈ  20S T1  H1 R20S020ƅ(!0S00Ƈ  20S0 - 0 R) 0B|0 T0 G  000S |0  00S 9| ! \00 0B0208M0Mߍ_ٍ_ɍ_΍_Ӎ_֍_jn -(|@qL` 0 T| $0@3 , 0P^hz| 0T   T  0S00 -LM|0` ,8pWP @4!S PONU @;2 7#\  0p 8P -8 ZLp `4S OnX ` 4S 0 0QQ$ 0Q! 0Q 0Q 0Q 0Q |0! $8 "P8  l<0|A  0T|0@ $  hMhbiMibuuRurP -p03a`LMP5 @ i|0$|0 10 T5%$|044 \ -`pfL  P 0mi|0$|@0 0< T| 0\ -L4MP pV㇇4V 0,K P@` 0,$4  848  p, (Pt 40S |0K  0 @@ķPPxq 0t,0 00@ @@誷P@ LZ|0 ,Q(#(3d  005 0#40060` <l 2\0H ,2H0"2TL P08Dp4"P 8!  03it1ਠ 㘠h%xp P<H 0 1cA< 4 0#@ 0@0/8000 P0`@ PLV 00P P`@P8 LV<  01ca l1 0 @0&.<000 P $8 P80U@0/L000 PD   |0<D ,|@=P0<0D \!0\ F(Pt<$QPQpQ3+p(GGxQQQ_R -Lp`,@P0PUOZm Ƞ 0 000  00CQ 0 "!000 X0C& P 0 "!0, 0 R U[c[c[c[c0 -0`L0@ ,80Z @ dPp%U@  \ 0 80P -LM`p0@pAd|0A< ,|=P0<0 \Q 0\ -QSaQ0偀PR@L$|AdAp`,0L \|0< ,400|`< \ -LM@0 `|P1clA 0< r,|0<0 \@M^(0S P 4$0(@$ -LMx0@  001c148$0 01c1 $ p-LM0 h0 P@` 0 `48Tp 0a   -LM`)Px0 S0 1!00d 0 405 0!>C0CS$,060H1 < `008!pS00W80P \ (0K80pO^W P  0 0@d  :9d x@,K@ĕ\  0 4S 0S00K</P -L,M, "0 l0p@ 4 l0pD l0pH 08 l0pT @ @`00 00"0!D0 4D0` 8 n,0 < 4 8 ,@4YOlp40@ l@p 0D 0!Q lp80H lp0T <Q,o@0|< 0T,DpT10 0(H0 1L0 0H T0 40!2P 8T 40 8 ( & 0S!PL0 bH1< 0h< l0, p00  0200 00   H0<0< 0  < u000r -80ZLP `@p|0 $ 0S 80`ONVp @ V0S0 |0 TP -L MPPL *0( S"4ppx0 S0 |1|!00d 0 405 00CS$DDLL0600!0`  <08 `@ dP80`ONV @0 R l0pH l0p8H  $0K x$ K(0K4S 0 0 (K00K</l' -L MPp0 R l0p@ , t3,l@ pD , !00 p`,@ 6pWO`0 R$ 0 R lp,0@ l@p 0D l@!p,0@ lp 0T |0! 0T00) ' 0 R  22 2 1!,0 0, 0  111 2 00% # 00 0S h1h!002,!, 0  0'0 ~$1$!0,04", 000 0S 0 002,!, l0pH l0(8pH Op0p 0,04", l0pT !0, .ֺƺɺ̺Ѻ -80ZLP p@|0 $`80pONW @ $0|0 T0S  S ZP -LMp0l`P ) 4 @P =x0 S0 1!00d 0 4 50Sa bSS^ eS\ 0601 `0< 8 :80pWP  g02P80 娀 80pO^W Plp40P 48 0h% lŕ\ ,0K @0K@lŕ\  0\  0 484 `0S SoS0K/L -LMPl0P plpX l0pp\ l` p0j!2#0,0  p@,  @Tό,0Slp0X l@p 0` o|! 0T00  0 000c1`,  0$, V00Ft `000`00c1s00  00Q ``__ -LM8XpP `@4 S PONU @`|$08F0S 8P -LMlp0`@ l0pP @P8sx0 S10 !00040 1d  6 `0<58Ll@0pP 80pWP N\p $0K80O^W Pl0p@ lpP ,@(K@W`K/T' -LMP`l0@ ppl0P pl0WT X p0 ^07 80 0, 40 ,A)^όlp 0@ l@P p 0lWT X 00p,0So|! 0T00"  0S40 00 0 55$$‘0 ,@ 0N,@ X000H000S8 00  04@0  Q0$0#(@0"(R (0#(#<S R P -L$M `p  ,ĠXX 0b0p0<,` HKH 8 4 D @@ V@P<??7 -LM`, 凯0 , 00 r F͠ 00, P   zP@0 S –L@@  P;H –  P < B(0S/, 00 ?Y,00  F= ,000 00?Y0 –(0SF= $0 (F͠ 0,, #$0 (7 -LM `4p(0S"P0@T00U0 – (JJQ@DC 0t –(0S. t20,000 X20 –(0SXh00h0 4d080Pd0m –*F= $0 ( $0 ( $0  (h0 0h0l83.) $@, 10,000 00 –(0Sx F= $0  ( –(0SF= $0 (F= $0 (@xS<SSSSSST 0-4h0L0h0P (0•08#8 XKK2 ( @TU 0000T 0• 0 \2 (0•08#8 X2 (0•@08#8 X0'T -h1LP`04@S) 0 x{.R!  p00p0t00t0 t00t0t0l 1 t0l Q,q  5;5P0S0P R$ 2$2 ( pWPH 000W 10– 0 \ 4T -$!$Q p0a0@00L0 (0E (@崠p00C& R 00#!000 0C&  0 "!0h 0 RhSGzB8000[c[cPT[c[c0 -LM4p5P% 0X2 ( Ht10S? jka10SEP010S 10S p0!0p00Q 2 (0•08#8 X2 (•0 08#8 •0 X0S   Vjxp߿hۿh00h0• 0X$ "" `T<|TTTT -LTc MP@ 0P, 080IpPP 3 !!$ !0pp1p p࢟@00C\ 0  "!0 00 2C&  0 "!0l"0 RU|  R?(@ 0800$@0@0C\ 0  "!0 00 1C&  0 "!0!0 RW$ R 1 0+10 ,p(pP` P,GT (0S 2$ 2,`VPZ i kt$u Y -L$M0@ 7G3"pR 3R 2R  Zg @χ0,K @@ ţP@S7 χ0 0K @@岣PL278 04K P (Z|—x, 720 4$ @14 p (P06T 1-t(|2x, X!  `   @  P< 8    0  0  0  80< _07T0`0R N:0` 0 Pa!02>E^0P<  0 PL\4|4Pl:!'PX4_P@- ^ =)? R ᬢT6-02S 04/2Sؤ/<  m`0X,P_T2*J?PUxUUUU|V(VP8 0-LMP? @R$ 0KS0  P R  0S000C080S040S 5;500 0- @P0L00P0P0C& R 00#!p000 \0C& T 0 "!00 0 R0?[c[c[c[c0 -LM0t0ğ@0P`0 0ᗞ#@0@0C\,  0  "!0 00 3C&  0 "!tß#00 R, R,4SL3UD3UU*<3UE 43U , Ÿ@ 0001 @, H "@00C\ 0  "!0 00 x2C& p 0 "!@2L  Q > @ 25 050 RH=, ,04S5@0,0 @0  2S+ L!@H!00C\ 0  "!0 00 1C&  0 "!0  Q > o 0U 0UZ0. @R 2S X0SX=t0P0d0UF- 0, .k>)[c[c[c[c02i 1i i i 5i i >6i( 0-@L 2P ,0 040$k5@05rp00p00PV 0-L@0P{5x1t1,   d!`!< 00L1  B!2 SA4 S0( "0*\ AP 0h/P (0hE: P  5@05%l0+%' 030|2 S( `%04$JxUtVV 0- @P0L00P0P0C& R 00#!p000 \0C& T 0 "!00 0 R0=[c[c[c[c0 -,",0P00 L0 ,P@`0p)Q00C\ 0  "!0 00 1C&  0 "!0l!0 RP= =5@3`V@ 0S)A00C\ 0  "!0 00 0C&  0 "!0 0 R=- 85Ou02"(0;[c[c[c[c0 -@LoP} 2 ,5 0S) 0 0 ? R 00"R0 00dS  S ? R060 060#00S00&0/00/0S0/+ 0-PL  0 SD0S6%%%@%%%|%%%%%%%%%%% 00/00@C00 06Sx0 h0 T T006S  0刵 00 00V -L\MC 0h  S`p d pt i0 STĖ?0` K@0 @ 0 PTĖ0` p P@`3( QĖ@T\hP d@ Yl #\` ,0<@rP`0L00 2 !PUPt l0`0l0 (0l QĖĖ\8"4@T00"d0b0`00p t `00TĖ(0S 040 Q 2Q!!0\2 S p ? R_` $0 (0,0 \0K @T*\0K 1d P@d  P<4 t r P T KL4 0 00 UPT :4h0T$`@474T$04T$0`44 044704HJ88 - 2L@ 1\`! ,=᳠ X Up <42 0!X \(P"x U]P0 "@\^P \pa= 0P@ mJ88J 0- @P0L00P0P0C& R 00#!p000 \0C& T 0 "!00 0 R00h:[c[c[c[c0 -? RL  + 0B>>Q P4$0bS4% -LM 2@l2\`d" , 2–@\P@"C.,U  2"rR  , 2"聟QR@  ,T 2!, 2@!,T 2!,P 2+, "@0+\ 2"R  4\ 2"R  4\ "4 \ "4 \ "0+\ 2 @,͆@0 輔88844(4 404 p-LM 2`,, 2 P0@,5,  PP ,0p \ P0\p -LM 2@,, "0,\ -LM2 S, `0pZ ATP @ ˯K r0S5`<5V P T`@V*K 0 2S ,0S ,  2,, 2@0,\ 0A @>-: 0p01K![ t <@8#X N[/q!y012 s<:CS񟗮Dkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkklllkkkkkkkkkkkkkklkkkkkkkkkkkkkkl0S S000 S: SS 0T00P00000 0 0000 0 00 0 -LM@Q00,d0R \0R Q000 , 0 0 0({ -0LSP (0S 0 0\0,0\ 0+\0 @,@-0 , p R R R 0BS񟗡mmmLpmLpmm#00C Snnnnnoooooooooo -0 ,0*0 \0 ,}o- 0BS0 R R 0 0\0 ,0S ; U0,, <4<,\0!, :!\  #-0 ,0*0 \0 ,P  3 \` 3 0,, ` @ 0,\0,,@ } @,`V ' 1 \$, g' X N p-LMPP` p0S@T n Rn @0R1R,,@0\T 5:0SY  RGR R (0S$  `RR 0!,(0 S0!\ @K V KR1[[`0`S "Q* 01K[ K10 , 0 \  0,\0 ,&,; z%0 0,\0 ,, ,^08 0\P(8 -LM0@S 0S S0K P ![,0R 01K![P -LM0K P PQ  R00R1S00Rhf 0S`0( p1\0, <\00 1\ ;.\0`0@\D!0Z/\0@$!\.0\1S  @;\ Z/1\0@\; .0@\;| Z/ 1[02 \1[:  S00v00r`!h! -0L`@ ,0PS^ 'P PP~0SHwy yyq0^/0\ 0 \0 ,lp*0S 0 ,P P*0 ,P1U2U0p00p0Pppp0Sg'  -LM0@ ,0S10@ +0 \P P0 SS SS S S S 00 K31[01K![00a-0 \P -LM0PS 4P@ c*0,, <4<,\cP@P@`K P@0 S Sg1[ :1K ![0P@0S% L0DpS0LS00: S)   P@![ 0  WH W  P@;1K![W:*!K1[; P@1[01K![P@}  P@v1[:1K![ P@l![0*0Q!K1[: Q1[: 1[:1K: 0-LM0@S 0PK XP1[;1K![` !KQ0x~}}~1[ 01K1[ 0R1K1[01K![P 0 2P1[` p0R1K 1[<1K![,!K![xP?1[`01[@0 -LM:@/0:*R/0:P  KP1[<1K![PP0S00P -LM0@SP Q "PP -LMP]P@) 0BS:R2 0S) P@ `pK @T @T 1[(08#h VP@]P@ $P@hP@  -LM K@yP  K rP1[>1K1[![ 01K1[,@01K1[!K01K1[<1K 1[<1K0S각  1[;1K![P![ 1[;1K![+!K1[; -L M0@@ `,P" K [P@2^-2[ :2KRR2[2[<<2K0BPPS"[2[*"K2[=Ã@0Ó\\Ń2K 0 \ 0S&K P@ 2[`02K"[=P2[@92K"[3P@.(0S4 BKP$pK @T ^@TY2[^(0E8#X 0SP P2[( @T >0EP@88#X 0S  P@2[p02K"[P@ P@2[;2K"[P@00CS0S0SP@ P@rU&K WP@f2[:2K"[*"K"[P@f꠆ -LM0@+, 9:7+\0 , 0-LM0PS00 , K@KPM1[ @@1[9 SL  SL 0 \0 -LM0@ ,0SX0S0 \ 0-LM @0BSp0SR 0SP R0S0PK P P1[   KP KP![  1[  h0S 00K KlP1[SP; S ; S h0SS 1S 01[; S1[; S0 -LM0pP ,0` ,@0DST0ST| TP 0DS@ 6T 0^/,P' }&0-,@0 3@0T0^/,P0 , @ l0^/\ @0 \@0p0S0p0 l01^/\0 ,0A`0 \P` 7 S&pK P` P`{2[| @00CSs R0SLRH 0S<LP`\0S (K* Kp2[S 0S 0,,0 0,\@`W0Sk 00,,0 0,\X-P`! 0 \0 , 0 \0 0\ v0-,@pT0S00 -LM0@S?`p0)00 PU 0S "K P2[P  PdQ Q2[@002[  0 ,?@d0 000 p-LMP-@`K \ \0 1[  %0D8#Hp p順 -LM 0@6 \0 , h$ -LM 0@6 \0 , h$ -LM@8 #80CpP S,U  `K 0 066 0 0  0\0 , $P -LM0`@ ,pK 60' \0 ,vP8#hm0 ,0 0 `w0PUXm p-LM 0Q0CS .\@P`  ph\P p p-QLM@`P.0S0(6 \@2!$0 ,@?Tpp 7; 0 1gp p-LM QNH0^ $H8\P `#H phP p p-(LMQ@"hP*0S0(B6 \@#0 ,@ T:pp 9280 p p-LMPP`g0SB0 , 1@ \0 ,8#0 0\0 ,r#0 S S phI0,, <4<,\0 ,0L@0 \0 ,(?#0@0 p' -LM@_P 0 S  KP 1[91K![P# 00CSaP  0-LM K@PP 01[8\0" KP[\ 0 B\` R ,,,,,8888D\ `0RP2PP0\ (0\ 0\ 0\ 0P A0 A A A -LM @0S  0 S0 p-L M 0 00@KP6 P p1[`K0 0P1[);5 R0   !P1[*:6B& 0K K P2[![002SPS0nS0S000 p-LM0`K 0@ PP p1[K 03 0  P1[0 P[@0)C3 R0 =30 P1[*:6B& 0 p-0LM0000 00000@SP`K P p P1[ 00CSRpp0 S0SS0 0 -LM0P ,0`0C,@p SPPPPXXXX00@00000 020 0 R 0 S;51K![ 020@000KTPp1[;C51K![R0  0000200<@000000000  0 0000 00000 0 0000 000000000P00;00f 0\ -LM0@00  \0 ,h1! -LM0@00  \0 ,h! -LM0ȠP ,Ƞ`H0L |4,,0,@S$ 0- S* $PK$00$0 $  $0\0 , p$0 0$0  \0$0 -LM0@ Ƞ P<,@ T$ `*$pK8#Hh0 ,0`0@$0 qV: -L`P,p@R0 ,0PS S%@T T 0P0 \w 0P0 \0P0 \0@P0 \0 ,30#P 0@P0 \? 0 ,30#0@T0#02SP p-LM0@ ,,0PS,`' S p0P0 \0 ,P  0 \0 ,ph0P0 \0 , P0 \0 , P0 \0 ,P 0-0LP ,,0@S ? S  0@@S 00h\@0\ @0 \0 , @0 \0 ,n@@0\ 0-L@P#A0 R08#X0U 0U0 -,PL!x(\@"hV00 gV0S P 0S P0SJ 0S S [X*  !80X:P!0WSQ   !X* 4 <X0: 0 PP 0S  -(p"LM WP!`*1@ 0 \@Pㆀp` @ 0, V : (-L"x\P! `: 0 @AH@`P@ 0\PV:, -LM`p`P@U00 < ,0@NT:順, -0LS  0,7P -LM0PS` pK@0 08P#H 1[?T08#h0VPpK0 1[0# 1[[SɌ# 0K2꺺 p-0LMP1K@`K0 08P#H1[![>T01K[H 0K a c? P,0S pp麺 -,L!H(\`"Xp#U   dU R R P,0S  0@D 0T@ h' (-"@TLP!x,`:P6G XA0WSQ  I !CT*0 "! 808#HcP T:T: -LM,p Ƞ,Ƞ H.P ` B("( V$+*  !0 @0 ,0208#HTT 08#hV:  ("(  B("( -LM0`!,0SqP 0 ,@ PU:U < S  7 P\U:U0 ,@ PU:0,0\< p-LM@K0 `P@\0  [ Ƞ4P0![00 p p-LMP@`K0 08P#H! [T 1[#4000CS @08#H T p0 ,00#0p p-LM @P ` 0S1+@ 0\ 0S;@0 P0\U`:p -LMpPW @*1` 0S1+@ 0\ 0S;@0 @0\T`:@ 0S1R,@,0\T:@ T* `W0 *lp@ T`:|0Sl0 2" 0 20 3" 0 -LM@"0PSqR,,, 0Rh 0RR,,0\ 0PE!R,, 0SR,,0\ 0S!R,,0 -pL0`@P 4T8@<+Q@ \ 1R ;@0 0\ -LM@PP` 0P0V,,0\ 0pA!V,, 0S0V,,0\ 0S!V,,0 -PPL`p @0TP1V,,@0\T:!( 0r` p-LM0@Sp0,,0K rP>![0RR 01K`P1^3 @R ԹԹԹXXX0!2200@S D,D,D0!22008#Q0!220!22p -LM0@0C S((((ܺܺܺܺ P :  NP0S S  0,\0,, 000 -LM0@0C S((((*P0,\ -LM0@ ,0S:SS 0S S  0 \ 0,0S -LM0@ ,0S:SS 0S S  0 \ 0,0S -LM0@),0 T(,0 8(,0 (,0 (,0 ',0 ',0 ',0 ',0 t',0 X',0 <',0  ',0 ',0 &,0 &,0 &,0 &,0 x&,0 \&,0 @&,0 $&,0 &,0 %,0 %,0 %,0 %,0 |%,0 `%,0 D%,0 (%,0  %,0 $,0 $,0 $,0 $,0 $,0 d$,0 H$,0 ,$,0 $,0 #,0 #,0 #,0 #,0 #,0 h#,0 L#,0 0#,0 S0#,0 ",0 ",0 ",0 ",0 x",0 S0\",0 4",0 ",0 S0A,,0 !,0 !,0 !,0 |!,0 `!,0 D!,0 (!,0  !, g@@@@@ @(@0@8@@@H@L@P@T@X@\@`@d@h@l@p@t@x@|@@@@@@@@@@@@@@@@@@@@@@@@@@ @4@<@@@@@@$AAA AAAA A - QL0T  Q(P \X - 1LS   S\+0\1 *\;;0 ;;L \1S \ 0;1 \XG-`0M@O0L 0P 0  @P@ P(P,PP00 ^`@0@00 `P0@ Rf  0P@ t0\K @\A \4 \! h1\ X1\ P1\ 0Ѝ0P@ @0pW P@0`PU` ` P `@0 P J0S(1S 0@0S0 -LM0@S:S0$0(00S) 0 ,,0 R( Q 9 S0 S00  000$0 S0 00Q000 $0( 0 0 0-0X@L LPP0 \0@P L,0 -0X@P`LLP0p  \0@PL 0\ -@L M@@ 0`Spဠ7 S 4KL oP*K040C P08P#X2[0A 8}S HZ!UT I0j8 #H7#H  0AS0 0* K%P2[=3S2002P0Pn0n00H𫪪H p-LM 0@SP 0CSp`K P![9 S0 0 P1[x    KP1[00 -LM @0LS K\ K 00P1[ 0200P1[? -LM4`KP@ 㿊 0S T0S4 L0S \( KP@@ P@(-P@* P@3,P@"[P@L ( KeP@ P@h-P@&Kp K@T#2[92K"[)"K"[08P@#X3,P@"[P@00*K, KP@2[S{6K8 K0S/ L\q3[1Sn&K  pP@`eU  08P@#&0[pWWd`X:N0L0i <P@E 3[1S&Kp @T2[92K"[$08P@#X00P[/ N5 -LM@Q 0S0K P1[L'S  R  P P p-LM 0@0CSPp0 S Su`K P pU>0 S S01[01K![P p0S S p aP1[01K![P p QP1[01K![P p1[01K![P:S/S S0 S S1[01K![P p #P1[01K![rP1[01K![hP`K P p-LM0P S@p`K PT/1[01K![DP0S S p P1[01K![.P p P1[01K![P p1[01K![P P1[01K![P 0-LM0 S@!K S 0 KP 0 PPK P1[<1K![P P uP1[;1K![P![ p-LM`P@0!, ,0@T:p 0-0LP,,@ 0,,0 0@ T T 0 0 -(LM8"0 #Pp 1 R Z,`K)C 0b8#Z4 *@ 0  8#H T 0 0 !,0"+\08#Z:40S @4 T04'070 8#H T 0 0 !"+,0\0  @0 !8 "+,Z,  0  8#H T 0 080"+,0\0j0c 8(#" p-LMP0x`0@0D 8#H T0a0@ 1!"+\08#HT:p -LM0@,, 0,\ -0L ,PT[ p-L MH @0$H 0K KP!K!K`AK\ 0 pK\ K\PP *0 0R:0` -L@0SP``0SP <0pR` `W0 IAMT p-LMP0PSp0 ,8S@ pw`V P0P ,0@0 @,T p XT[0[ -LM P P@ !P@ P@`pK @T S@THN1[0S 0F8#h  P@ P@,P@ P@ P@`  U@T N@T4 1[0F8#h@BP -LM(0 S@ 0, 0 \ -LM(0 S@ 0, 0 \ 0-(0LSP2N 00 ,0d H@T 0T 0-0LSP @ T700 ,0 )@T0T - L' 0-@TLP' 3P 0 ,0 0\ \0L , 2PU0U 0P[ -LMT0H S@0, 0 \P[ -0 SL,  0, X -0LS0  0,T[$ 8 #8S 08 ,( #P 08S0R,8 S ((0"(R,8S(0!S_ -L M p0 4 `  X  P   @ , < 0  d&  0 0  ,0  00< T -7$ML⸧ p 0`P< , υ ,K 0 0mP , 00K P 0$ @60 P (P0 Ą(@&L$8#8S z$(6"(R{ !6R x6Rt6 R. $ d!"(ᣄTF0 0C\ 0  "! 0 00 6C&  0 "!0%0 RS 5 S] 5 ( RRM RK X &> R5    l5&N㨅0 SS& SS &> RR 0B RSR5  %0S00҆ , 4Px29x2 @ 01 @ 0x d$&>xx"&><4 dx"牆$ 8S S]x"/ &>dx"y3R& 3RL3 S P4 ~x" -&>x"  4;Pl Th34  ŗmx2 < 0&.x2$@3 S1 83 S 00# 8SS %0D Sx2:x2x2&. < 0x2$2 SDx2 <&. 0x2>Tx2&>;x2ŗx2?&.0Ňx2$x"&>*H2 x"$P2R ,D2R! <2R42 (R R $2Rx2!&>x  < 9  8 Sx@1R 11R 89Sx" / &>dx"Dž$P1 Sx" &>0,dx"ᵅ1 STx2&>0  0 P xH,Õ<0K,pK0D0* ,P@ 0,Õ? 0 <  D04P@ #,ÕD?0 0  P@ ,Õ84#D0 P@ tl `303LT <8}dB|_Fxd((^D^|^^^h_$Bt< - 3 L$!$ -LM C $0 T -L -LM Ð@$0@ \0<3 -L M 3`$T 0@S,@p<3S D3 F? l1 R001 P1 X0SP PR ,@I `a00XP!U00R00S@U2I? PePU T0S # 0PUYχ 0 0S 00 4 PUT T 0U 0 13 p-LMPP!4P L0@`TeLP XPephee@T4 - @LX `Rp 0PS 0 1< h` ePQDeX0MX01X P1SeЬĬܬp@-|` @P  0 Č$ L0#Q `P8Sp0 S0S S -LM@ 0 S0 S  -LTMP$`0p0P,0 @he |de hPd`  0S  @Te,4 ,0S (,G_0\@KTK\0K[K)0  Y0KVKZ`KX`KW`KU`KdR[X00P00SQ@T PK?>1 1DQ@T XcXCXT#00LßQD   e 0S 00>0S S3  ddX 0f P` 2T  0S00S 0S  ` KP ` `P L 00S 8 dV fy0T0f840` p&PPg 00>0S Sf nPd P010  P 0S}?d0000d>0S0 S`\ T @ 0T4`090 YP@#T: 0 [d  Td01 0CĠ UKV0KtꜤa< aP|R`@ $08kX̭,o , -L MT p, 90S 0S,`0Vʆ0AP P , `0VT 0 DXZ  P T0S  0S<  3 K P  Tc qP 0  0 00  `PP   c  c   | d 0SS00D c4 c0 鈮̮ D -00QLT0 Q S R 1 e!\:0> 0C0 n>S -LhM ` PPpK $P@ < R RXp0 SD0Sl -LM 0@S  P 0S0S   -LBM @0004@pPO``0P `T vP 0 Sl`0\000S< @2Ry CKA A Bf0< P <@HL8p P`2[`Af XT[T0S{`0P`D Z @C^KPEPE0<@ P@D0PDTD0@V0TD04 P 0@<P 0<@P0  08K0@ FT0C.K BP B180@T<@P t *`0S}0f @4 P< 4@$_<ԯj0L|H|\h_ p-LlM0 d0 @P`KP d0T@p -QLM@ _0S_p| -LM 0@~  ^ 0 S 0000 p-QLMP Q pP`V@*T0!@RT:0\0HP`-p -P80PL\0pHPP` V@*T 1S@ T:0 mGT 01P`f; 0-LM@P0K  T TP@ P00C0 Q *T0\ 500  <S_080錰H00L -LM50`p 0P5 X00SX0 D0 Sf <@4P@ DH80@ @Pf @500508pXp} 0-50L0@ 5 X0PCUXP80S@0fS0@P788P -LM4p^@` 00 4`)40P 0^004 40@ -LlM 4@T`pK$ P 0 04P $0S $$ A@KP^4@KꜤa -LM4@04 0( -L M@K K; 0eP -81LM<0` 0 0@40PU  k^h^0p060EϠ30 0Ā^P1 S᠀00 0Y (0 , $@ U> FQ>~00wH 0K0D|E 1ꘄȰ<^c -QLM@CϠ m? R  0S T @ h Q0--0L@P  Q 00|1Sm?@fF p-LM1 S@P\`|P50pE`]E 0 ^c -0 RL`p@ @*PX@ }P 0p000 @WP:!]E? R 1S 1S 1S m$>FO=\ =m=>FO= =00BaQ -L(M0PS`| LpX @ W*0@ 0SLK S <00p0 T:!P^P @T*0P\i@T:@T*0\O@T:L0W> P>Q1 P @ LK0|  @ET8A00C\ 0  "!0 00 0C&  0 "!0 0 Rc LK\qQ*0P \ Q:0LKpQ*0 \ Q:0,LK p[c[c[c[c0 -LMm? R`1S  K` T!R\13 0K <\ 0[D!2 0K HQ 0[P!2 0K K0`0 Q-L H0Q 00(0Q`1 W@W@ W -0PLPp@0S' p+0\1c?@L`c a5\ 00@W0@m004\D\00baba p-LM00P@K4U` 0 000000p 00C& R 00#!000 p0C& h 0 "!0D 0 R 00C0[c[cba[c[c0 0 ^c -L|M`K0 K pK@XPP< @0S<6[S4 t0S 8\X 80Kp[Ƞ 80S4^00 1S80KḀ@40Oφh P40RφL P 40Uφ0 P週ȱ 0- LP@0RPP 0 P 0S 000CSPPP 00 -LMP`@2[ .[000 4 080P@XY\` 0X0 Y 0\0 ` 0S4BPp X0S0S S0 X0Y R 00CS񟗩ꐓ 0 Y0X0S S0BSdlt\|#0ZT 0S0@T<0S~ =Q{ X Ru R00e 4D0 P iM4<@0 PX0SI 00p@\Pp @TZX 0S/ 6S, 0S' S|2Y T00BSꬑP0 i,~Z yZrZ1P X S4>H0 P P= 0 iQZ>0S4P 0 S00S=  X0S 0@Tf 00S> 00S<  i$ZPJ a > < : 8 6S(0Y0 00S PS 00< aK(,p0D\d0dIJȲв -L`p@P@PRPU@ZDAD!P000  BR ]qP00C\ 0  "!0 00 0C&  0 "!0 0 RAT PY0X1 *0  sAc@p[c[c[c[c0 -Q L1-  Q S 0S A -L`p@PPPU@Z@P`@PPU@Z@`p -LM0@S  1S01 1SP P1 010C1P1 >W -LM`pP @ 0TP@@ Ƞ,Ƞ 0000 R P@@= -LM@PP`  h0!T` 00040 R Pࠁࠓ=Y0S 0r0Ss 0Rr0 R0S0w00ZR0S 0{ z0 0$S$0 -LMP@U`1p @G0<0L00MQ0PNPOPRPSP L0 -L ML0Xp 0 8@8P`DD!LMNORPPQ@S`j -L MP0pN=U``GGGL0 0 10S U0d0e B0C f0g 0S0)0K h 0C4i0 j k000nmo@lp)PK)0[s@p0qrS  W 0P00p000 0 0PPEDd 0 P@00 0S Ax$_= p-L M0PS@- 0BSd,hT 0R0P RA R*R# T00CS000@  0PPpph90\# W W 0 T T 0Q0ph hWD 0@@@ 0@ T R 0\`@ `@48" <S^  hi0jk 48/@@3#2"0RSp#@4 K1P@ L_P0D 0c4?Xb\! 3 p&.p|0`Td2S h2S l2S2弢 0@K  L9 'P Ol2l"0p5 `2`"0  T0P`QD2l@"40<28  @<0  " 2p(> 0N,$ R "0">"K>,X9 /1A  0 0C\ 0  "!p0 00 \1C& T 0 "!00!0 RX 4P 0 S00Sh" 0@T_00Sl"00Sd"  tO< ax (6bP[c[c$t \[c[c0h -tL 0PS0` /X. X 4q4!000%@@L ?,^>8+2 0CS 2@00C\ 0  "!0 00 |0C& t 0 "!0P 0 RX H~[c[c[c[c0Q-0 Q?0 -RLM`P P$ ; 0 0 PDrD2@ 0000~EPP 2 !!$ !0``1` `衟@00C\ 0  "!0 00 1C&  0 "!0t!0 ROUI <1@ 0L00\FPP? 3\=PP? τ%\d @soPP ̠p ` Pp 4Jp  x@` 0-? LR\? ( R $@T )0@T'0 0-@LLP(000,  0 -@?PLP`p2 |2 \ l2\j*d2\Z \2\* pPB0 0C\ 0  "!0 00 2C&  0 "!0!0 R;%# = S =@S @ 8C8p2g%2  o 2 d @ 505H0 R0S 0a44Pp5@p0{50\ |0\p0PX|z`0\w, 08pq[c2i 1i i i [c[c05i i 6i( -LMp0@0Pp0Ia!p0O000 K 0S(@p00C& R 00#!|000 h0C& ` 0 "!0< 0 Rz4[c[c[c[c0 -00%P-@%LT   )pPStP:xP!`PpPP`PpP P ? )rcb#r]bP xP0x2& HI  BIP tP0t2 x2I  d,IjP pPpR ,I I꠷ @ 0-LM?@0TA KPK0K 0?00K00K0K0K@K@KK@KPPP[ -L M?@TA K0K ?00K00K00KK@K@KK@KP0 [0[4 p-L M?@\AdBT0 K  p@0 0K00KPK`KK@KKKP00 0-LMQP@ ?0@00KAĠ0EKK@KPK0KKK0KP0 0-LM?0@P K0K 00KK@K@K@K@K@K0PS0qH0d -LM0p5`,? <5 ??\ !?@?\ QU@ P5<5% ?@1;;1<"  I0S 1;;!<0U@P5t@ -L M?@ \K @00K 00KKKKKKK)PG -LM 0S4 0 0P 00\_ -L MPp`S@G G[ PR!2 `2".`2/t2/.2rr, KwP DG,@0PT,Pv 0 Sj00S(" ^0@T(@KQ!`0000 wG JG1!0@5 t1t!0 T 0pHu#0  i'818  `0`0C\ 0  "!0 00 0C&  0 "!0 0 R ]00S,"00S$"  TG< a"([c[c|@[c[c0 -LM@ @'(.0 qS0P9 1` 000%@30H#P00`00C& R 00#!000 |0C& t 0 "!0P 0 R [c[c[c[c0Q-0 Q?0 -RLM`P P$ ; 0 0㲂 PDrD2@ 0000=PP 2 !!$ !0``1` `衟@00C\ 0  "!0 00 1C&  0 "!0t!0 ROUI <1@ 0L00<$@0@0C\ 0  "!0 00 0C&  0 "!0 0 R$ R 1 0+10 ,`(`qPP? hoPP ̠0 L Pp Cp $` -@?`LPPpXX2 L2 \ <2\l*42\\ ,2\* p B0 0C\ 0  "!0 00 1C&  0 "!0!0 R%% = S =@S @ 8C8p|2%|2  ` `<|2 ` @ 5050 R0]L 0,4Pp5@p0-P0\D0PX~|[c2i 1i i i [c[c0i  -L MP0/@ qTo p00p0RB 0$K000 f$ =0S'@00C& R 00#!x000 d0C& \ 0 "!08 0 R [c4[c[c[c0 -00%P-@%LT` 1 ;"0PP4P78P`PpPP`PpPPrzbrzbP 8P082 A AP 4jP042 xA dAP 0TP0Rv ,Ap A꠷ @ 0-LMP"D@0K 0KK@KPKKKKK0 0-LM8QP#@0?00K@!Ġ0%K K@KPKK0KK0K0 -L(M`0KP@Y$0[# [4SpFAd4K8 K⭧P@ H@!08A4Pp,2A 000 P@6 0  P@$   0 P@ 4 n L@4 ( 0X -LM05P <5Ϡ000  m@/A0T00p` @ 0ȠȠ W p" 2BP `@@T@5O<5 @ 8  #8! 5 -LM @nP/NP }@ h8 -LM 0S4! 0 0rP 007 -L MBP$ KP  L@$Pz0@Ut 2S $2SX 0P($2 fP@ 1Qp O @ j)` @ ?1!0@5 1!0 T 0IAd)x1x  p0p0C\ 0  "!<0 00 (1C&  0 "!0 0 R$P 0 S00S$" 0PUu00S("00S "  P?逹(Pȹ[c[c x }[c[c0 -LMp` P@? ? b0Slr`` ἀϠT开0\D  ii]?< a Pa, -1qLM` @ @0PP[0S)xA`00C\ 0  "!D0 00 01C& ( 0 "!0!0 R5@'(tP00`00C\ 0  "!x0 00 d0C& \ 0 "!0:f0@2[c[c}[c[c0Q-0 Q?0 -RLM`P P$ ; 0 0 PDrD2@ 0000Q5PP 2 !!$ !0``1` `衟@00C\ 0  "!0 00 1C&  0 "!0t!0 ROUI <1@ 0L005$@0@0C\ 0  "!0 00 0C&  0 "!0 0 R$ R 1 0+10 ,`(`[c[caa[c[c0at ?0-LP $@B7P  0S 0P7  P7  -LMO0 S  D P7  oP7  -LM`0p,0 0@S0P 5@ R- R00RPPU 202PT ̠A,0  @,,"0=R,0K , R t= 0 4,0 y,0 Sh00h0d00d0, 1 P0 007Ph00h0 8P*$@0 0C\ 0  "!0 00 l0C& d 0 "!0@ 0 R j@[c[c[c[c0 -P?LP`p0@5DD!0W00%+%9 WW( A00C\ 0  "!0 00 0C&  0 "!0 0 Rmp00p0 `<W0gl00l0 u p0S E[c[c[c[c0Զ p-AMLAO0P `0:x P  0/"-C4? 0@ 0\X  Pt20t2p| <p -LM@? R5+Q P 5;5Q 0S000C08P5 ;$5 -L M0`5P@ 阁1p @0 @/ 005  00 @ >7PA 7P; R,2S- 5@@05%+%p00C\ 0  "!0 00 0C&  0 "!0d 0 R iP (@p0(;[c[c[c[c0$ p-LM@"> ?PP#>  oPP ̠, L Pp ;p @` -@?`LPPpTT2 H2 \ 82\k*02\[ (2\* pB0 0C\ 0  "!0 00 1C&  0 "!0!0 RI%$ = S =@S @ 8C8p82%82  ?  82 ?  @ 5050 R0E 0n%4Pp5@pC0&P0\D0PX}[c2i 1i i i [c[c0i  -L MP0/@ qTo p00p0: 0$K000 $ 0S'@00C& R 00#!x000 d0C& \ 0 "!08 0 R ![c4[c[c[c0 -0 5P=5T@,LPP0P74Pd`PpP\PP`PpPHPPHrsPbJ\rsdbP 4,P042M o:G i:P 0P0027 xY:1 dS:P ,P,R" ,D: >:꠷ @ -L M`, pP@ V Q0 00 Pi0(00 00 PP 0S0 P  0 0 @ 0p^c -L M0@S K K 0  i Q-LpP 0S00@T 0a l9P@ 0T p-PLM@` <9TA,!<0 ph99(, - QL MpPr<0Sl8P@e 00K4 K400 ,0K( KP` (04@KP  @"P@B 001< 000p R+ A0 0C\ 0  "!0 00 0C&  0 "!0 0 R04`0 0lpp@4(00 [c[c[c0 0- PRL R1<@T  030  30p0Sl0 0 0-0LS@P0Pxx ,0 S P <0 T  \0 0h h 02_q_,/ - QLM`Pbq0<@T[ t1R 0S 0 88!000p R0p00q<00C\ 0  "!0 00 0C&  0 "!0 0 R 00@t400  LM8*^c[c[c[c[c0H 00sS0S  p-L M 0@  P`0 P30S ``0 R pP0 R@@,0S  R0 840@a__q_ Q- L7` Q- L7` -RLM@PpsI)P`r T\P7Wr @ 0@@@ @P<p1p h1P7u#P H7<0l@p0471,0 q00 84 0@X(T!t0@12c10 0!/B!0  00L Q 00 0 h 0P0@T<"+45p^cx^c<ܔ__TC,D -LMd@P``p"000  0 0  0^cR@a_^c - (Lp(P"!$RO01SK RJ RF1<`VB @T$ p!20#p0 0lP!  0 Q0p0h 0P W 0 !,0 !, 00 0-]`0 X 0K<0 dp鐔_-l3,/+ -1 L R pr 1<`Vl @T 0S3h 12R0S# 0 0 0 $X1 R 0H!0 0P 01 $110 $ @0P  P0P0C\ 0  "!0 00 0C&  0 "!0\ 0 R@$鐔_,/^c^c^c^c[c[c[c[c0 -0LM`0 ^@ 7 1<@P 0@S h02@鐔_,/ -0LM`0 ^@ 7 1<@P 0@S h02 @鐔_,/ -080  QL 7 1<0S4됔_к -L M@ ^ gp$ Qp (LG!P00C\ 0  "!0 00 1C&  0 "!T1`  Qp0Hp0p  ,0 dp0W 0   0(0 Z _r@P00C\ 0  "!X0 00 D0C& < 0 "!0ꐔ_[c[c[c[c0 0-0L 000p0P@  0p000C& R 00#!t000 `0C& X 0 "!04 0 R0[c[c[c00$ (0  -PLM 0 0 PfW P-L`@ 0PU R@B $ph02T@D,/ p-LMpP!/ PU,  \ h 0 \2pd0,R 0 K P@@ ,`0h "0 T@Dp,/ -2L@`p+  Q,10 XW 0Ra R R P-L P ?#?00cSEFFFh^^P Q hQ h - PLM@`PA T9 T# ,q0@<\ 0 ?01 <0!! <0 <0 <0 <0 <0(02o@ 0(@"P00R00S0P 0200 RpP0 b_^c -LM0Pp 0弁p@,+`@+@D0S0ץ0CS`` p0  00CP0ҥ0CP0p 0l"!0pP (0 o: (0 p (00(0o_ -LMܠHp0$H 400pP*`* 0p < P)$p 6 :w0 *`*P 0_ 0-h0 !Xp0 L0  8#UP@008#HT_ -!LM0, p 0岂@*1 8C00C8#0 p04`0p0@*Pl*  0 P8  X#, R Z 0J  X_ - LM0p 0尢>* J , 0 8p C04p@0`D*P(*  0J8 P #,0XY0I _ -8!LM`p0 P@*10`00C8#8 4,0 *p )0P  00 p04`0p0@)P ) H0 !0 R8, Z#X0H_t8 -TL M`p0  @JX) 0`8#84,0 )p)0P   00 40 0Jp 4p 0`@)P) \ 0I!48#00 R, X040S0C040 4_t8 -LMܐHp0$H X0`40g)pK) 0p 8%X h`#80A40M)p1)  1@T@_t8 -H!LM0 -L@M0 48 mQ`( C PMQLQCQ _AQN -@Q (0S ( 0TPR35 nQ@1@!pg\ Š%5 TP45%D 0 0aRP 0CS00P0 0S 0 0CR0T00T0 D0R 0cS0!PcP0HQ DQ0S, 0Q01 c, JQ KQD,( 0HSD 0Q   B P R 0 R 0 BS T 0T S0>"R ! B0,0 `0T00 S0R !0 TS2 a0 BRDpHP0S 0 l gR@1@!aL^HD HPDp34fQ @XQ- "PQ(0TPpS>0 gR@1@! b\ Š%5 TP>%d45%.cQ0S$ T 0Q3S<$ pW@*L0 0/S5                     ȇȇȇȇȇȇȇȇ  ܇܇܇܇܇܇܇܇0@TPp @TTK 0X@K@IPwT0X @p004 8PJ?$i?h?l?p$? -LM@P`p 0@0 00P+ 0@`@ 0@@`@ 0@ 00@p@`00 0 0-PLU@ U$L f ^0 /R 19R00C P^L0 0 C000^L00C댽AQ$!R,00 ,R ,0,00,0 p-LM,@AP0CQK4\dddlTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT!R@ ,R@,@p!R@ ,R@!R @ ,R @ !R@@ ,R@@T@` @` 0V!R@ ,R@ p-LMP@p !0@Tp`@t 0!0@T@`@x 0!0@Tph<= -LPp@| !0@TDD@`01| 0 !0@ T>> 4S!3=8S>08S, >8 ST3T#1 $t2Q h2Q `2Q L2L2H2@2Q 82Q,2,2$2$2222Q 2Q 2Q111Q 1Q1111Q 1Q ʼ1Q 1Q1Q 1Q1Q ʈ1Q 1Qx18 h1Q `1QX1T1<1< @1}<1{81y41w01u,1s1k n1!10 101;C ꀕ_@7ľ̾Ծܾ _bap_53 -LM@ 0 S 000 h -LM 0@S0 0 -LM0PS#0000QS 0BS0%pa 00C|a2\ 0  "!0 00 2C&  0 "!0\"0 R&0 0#B Wp 0`00S@g00P0T0SpWWp  `p鉠@p0T!2@P`0Q HA00C\ 0 !1 0!C600  00#!0 0 R O@00C\ 0 !x0 0d C600X  00#!0< 0 R#&([c[c[c0  -0@PLpA 0R p) `P00C& R 00#!|000 h0C& ` 0 "!0< 0 Rܟ^-[c[c[c[c0 00000 Q- L$ 00sS0S  -LMp1 ` | 00 0SXl0S\1l0B P l0 ` lp 0 t0 0 x 0 1 P:l0 P0@00SX u P i0`\Q p $Q$ll 00lx,_pbaԕ__<0baH\ p-H@LM 0`P]$ $$P`0 pba4Hba -$0@LM@@@0@baba -T1Tq` L @R 0SC \P PUl00;0PU\\(@`00C\ 0  "!0 00 0C&  0 "!0d 0 RhƞH0 @0 ,! [c[c[c[c0MbQ -LM`0PS0S{|0S1  X@TO 0SL a!p000  BR 000 R00,0SS0SJx0p!2c1P:PAp00C\ 0  "!0 00 1C&  0 "!0 0 R0P ,0 S P0 ᭚5Y0$ 00/00~s yba[c[cp[c[c0_ q_x p-LM0@SP`E0S1 U)  lP`\P l0 QPU \0`  p0,!phl0\0PU\P  U\ 0, P`00 00%Mb -XPLU @ ?#<0 p` @cT0p  p@5+0S 0 S0$mb00m꘿ p-LM\0PS`px@V0@@T tp0x@ 0-\ @RLP0Stp00 0SX0S7  - (L(" P`&0AT" P0S `0SXpW4P`P`Xpn 騕_0X0 -T0LM (("!X@ T  00X騕_ -0@LM0X@ -t0LM Ƞ Ƞ,A04S 0000 0CS0  ꨕ_@-$ @.MЍ@ꨕ_ 0-LMP@@ 0@0CS00 -LM\. 0\ 02pXP $1` Q 40P d0\ \0\XP $1 PXQ 00S00}f|f~fvt -4L M^P@`p 4^ 44^ 3^ ?3^: 3^ 3^00 tpp 0 tp p3^ x3^p 00 P3^H  00  2^w G2^B )2^0S!1p  gP`  \ l H2^sP`0 00  000 1^# 1^y0       0 0 p1^d0 S0 ! ga5P`,0      00 000tpA@< S l0 K  $@ P`l@10< S< 0S   $L0^ :L00SW WW WW @W@WW@ W @_W@ԕ_ W WW W-00 Ƞ Ƞ,1X0Sꨕ_D0P  0(1S \0SPᨕ_ -40LM@ T0 \ 0ba p-LM@|0Q\PPSU \`V0U\0P\P \`pU 0 ( pp\`Vp鴿̿PP 0P 0!R `0SX0S ꨕ_ -0LMP' 00S P @`Pp0 KS0C$ K00 0,A(oR0: S,>   P`0R P 0$ $ G00baba_baba -@0L R 000 0S 0S 0bababa -4L,\ \ baba 0- 0P @@ @  @ @RL x0T tp  0x@0R  Q 00# 0Q 0 000 -L Ml 0 \P l :$@h`0Tel 9_l : ,- $%'(*+- -LMQ0 `P @Y TQ R0R 1pT R 00K0; S, # Rr Re R n T PPM P P@0`0UAP Ƞ ;,HnP; S) 0 @0D T  8:S00S@ 2T@ 30D8S0D8#H8T@ 008#HA0A1l2,R0U0 R0002T; 001R 1R R;00A Rx!t Ha[0080 0-0 0(0 0#0 00 00 @00 00 < 0 <T 0 ; qT 0S 0 R R0U&0U#0 9,pK 0<0 0  -p!LM04 S\q1Tq080 0K  8P`@`V@DPEAJ3[ S"[00b0cS  0KX8@ @08@ 040`၀?000 R # 3 R?H0`?À 4@ 0R # 3_ _ 4S @08#<@8oS: S>; S P 0 R0,R? -LM@Q 8Tx<0000000000000000000000 -<00000@ L `+ p\&0S \\ 0PP*; Sh!,\1R 0P: R: S:#:A >; S= ^; x   Sp , d0R P0 R:U  hK P0S    p-LM0`PP@ SYP l0\  00  00  0 \p -L,M@  `^Q 0S `^ \ ^PK aQLXPpPKa @0T*<@8oS: S >; S|p2Q} @ T:XZ WePKa @p0T[* ; S1QO: Sʠ,ʠ >; S<@8oS: S <= S= 1P: 1P7 |1P4 TP*00@ ;   S 1Q P0 R:U 1 c0 @0Tp:XZ 10 p@: S:#: >; S Pw: SZ%Zr >; SPPm0S  80Q 0`c -LMp0PP쀟0AT :P@ 0 Auᔀ `AP@ V !:0 S0SV @ O0_4_pZd ( (-"L@pPP@0 T0 `04@S X`V0p 0P -L p-LMp@p`TPX 00d@Tp 0-D0 (("ALXPU 0X004_ -LM@X@ p-LMp@pPT `00X`d@Tp-00 Ƞ Ƞ,1X0S4_@-$ @.MЍ@4_ -L M`0V,0 :4V%4V" 4V L4V@ ;4V% X0S\0S p@ppTP ,000 0 d@PPTU 4V 0x0 X@T $1` Q 40P 3VX@T 00S00P3V <3V0S SooC3V 3Vp@pT ^ 00  00d@TX@T~ r"`000P 0 P?#<00cSB  ụUPP~!0S00S'(B`00C\ 0  "!0 00 1C&  0 "!0!0 Rt r0$ 00\A`00C\ 0  "!(0 00 1C&  0 "!0 0 R逓p@pT9 00 R d@T0 0RX@T% $1 PaWbW`Wvt}f|fW~fcW[c[c[c[c0-00 Ƞ Ƞ,1 X0S!4_ -LM@P `0SX0S T0 S `0Sh& p-LM`P | P@|0 p04 p`l 0 00`x 0pp_ -PLMP@A p`d``0ph0p R0pd@\0S 000SXQW d 0R`0h0h00h0hd Pp d 00pPppWx0S px 00 W 0-`PL\0@S 000Sd pRh0h00h0h0d Sd 0p `00X0S 00 -LMp@p`Tp 0P \ 0d@TWPpQ\00 S \0 S\0 S -p@QpPpp TL\` 000Sd@TV P `(0$8 Q!0  Q:@0@-P(P  $08@Dt @\ 0 0 A\(@Dt0 -0` 0p@0T0L0P  @T@p00C\ 0  "!t0 00 `0C& X 0 "!04 0 Rh[cba[c[c0-LQ@0 0R, 0 S ba0_ba,0 P 0SPba -LM0@`PUp@ T0 0$ R, PUA`00C\ 0  "!l0 00 X1C& P 0 "!0,!0 RLW 0 RZ 0( RX kP@`00C\ 0  "!x0 00 d0C& \ 0 "!08 0 R[c[cba[c[c0 -LuM℥0 0`00 $ (0 bP(L@ 00Q00P0 %@00C\ 0  "!0 00 4C&  0 "!$0$0 R0V 00 t$000 \@0 Q0000 $@00C\ 0  "!0 00 3C&  0 "!3  Q< z $ (  VVz Vu4#V80B 000 Rb 08  80"0 0C\ 0  "!0 00 2C&  0 "!l2x  Q3088 0 08"10 0C02\P 0  "!0 00 1C&  0 "!1  Q@8!@V Vp! Vh! V V VP! VyH! VvV8!Vq0!Vn؏[ <.Џ P@0 0C\ 0  "!x0 00 d0C& \ 0 "!08 0 R頏[c[cPa[c[c0l_baaa0aaaaa`a -LŸp0@P`P@r U ,0U 0S?C0,PV 00V 0S3G00`00("X0XAp00C\ 0  "!$0 00 1C&  0 "!0 0 R4@p00C\ 0  "!|0 00 h0C& ` 0 "!0< 0 R P[c[c[c[c0 -0@0`LpSP10  `0P0C& R 00#!|000 h0C& ` 0 "!0< 0 RUŽ[c[c[c[c0 -0@0P L Pp 0(S"x) `P00C& R 00#!|000 h0C& ` 0 "!0< 0 R|[c[c[c[c0@-0S4 S/0!0@ ^@(00^$ 0lQ T00^ 0@bS 0 S00T0P00SS0t_ -LM P`'p@T K0  KKppp(\! K0 !K@~(g' K0 KK@@@m(4 0S 0P 0Q_c 0-LM0P S 0s# 7'@ K0K0b0@@@(P@ P00[4S 0'P0 p-L$M@P` V) K0 0)K (0400 P00@@&* (K0(` $ P k<p ~000 0)0K0) K```'4`<_cXBA p-QLMP# 4@T00 '0 K 00b`0@P(P@ 00P@4` pmpp0^ K 00b 0(P@00 &4@ Q0@-P0@0 " Q 0* 0 S0R R R00 0  0  0\ 0 0 0QEQ QQ 00 -`L@pPwh00000000 -LM@00KK0[0 80 K0_( -L M@ K00KP<  0-0LMQ@P( 0Q0 0 00Q 0Q 0 00KK0[0 80@ K0@@( 8 W@W@ WW -LM<@T 0_c_c 0S 0_c_c p-d`MLP@ 0Q K 00b0@@@@& p_cAB p-LM@`P%| 0 P p  % 0QR*0S b R*0S -R0 0c BSR48 R p-@P`x BRpR0 BRRRR-0^0  R R0 R00-P@cbP L0 p-QL MP@`S K0 V Ks 0K Kp@rPp`@- a0`S@@BR0-P@ 0bR3 B1 010QP:  QQ0Q00 0cc 0S !1 0S 00S  p-QLM`P@S 0 8V pp@rP`&p`R 0R\ Q- *0 Q*0  aQ! -LM`pDj P@! P P @T00PU0S p@W l`FpGP  PH 00PW pW`F48<-0 R 0Q cP 0 S Q!0-P@P !20R0-P@ 0bR03 B0 -QLM2p`S)P@WU (W # 3f g0T0e 0d0 "2R0c0 0 Z  p @rP*`ppp@-(Ƞ !8"(,ȠP@p^`b `n0 # 3\ c l0 "2R(#ȃ 0(BR00.8 c0(R0#03 8 " P@p0(R0#03.8 -LMK0KR @0S R -LM -LDM@PKP@ 4\T QP 0P KSR0S0PK0 P@[[TK$P@KK ,PT@,83K#[$8KK[[R3KL K0KKK4pK@KX d0 d@@DTd@ 0S 0d@S@d`@ p0`SL` `` \JX0@\@ZXp3QPX h h P Uh R `0d@Dh \ l l偀 0 RPh H  `\ 8R \0`FP(*SdP\l 00 L cPe%88cP\X%X@ʷ0Pe%8P d`F\P l@00 L P\P%X@ʷ000l`X\l ` R" h0S d@\ c0 Sh0`@.L0#\ ʌ0#[[[2[P T PK $[[[4[P T P KP@V8#C0HL8#90HB8#/0H8\ h "  P T P0K_p@-^`@ Pb 0 2%$^ 040p@-M Ѝ@-MЍ! !P: ZŒŒ#! !P: `B!,aB 0>ZJJJJJJJJJJJJJJJJJJ }J xJ sJ nJ iJ dJ _J ZJ UJ PJKJFJAJ=Q:Q:Q:Q:Q:Q:Q}:Qx:Qs:Qn:Qi:Qd:Q_:QZ:QU:QP:QK:QF: QA: Q<: Q7: Q2: Q-: Q(: Q#: Q: Q: Q:Q:Q :Q:QA ? QA ? QA > QA > QA = QA = QA < QA < QA ; QA ; QA : QA : QA 9 QA 9 QA 8 QA 8 QA 7 QA 7 QA 6 QA 6 QA 5 QA 5 QA 4 QA 4 QA 3 QA 3 QA 2 QA 2 QA 1 QA 1 QA 0 QA 0 \aBC`B0QA 0  0-LBP|@ 0S L| 0SPeT 0S \00LS `00000S  0SbQ1QR0@-P@ 0bàR? B0QQ000-P@P@0Q0-P@P%@ 0Q1Q3:P: R0P0QcP  R0-P@P@0! !Q@-: R (2 R R -PPPP RrPP B PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R- RP1P P1P RrP1P  B P1P B  R010 1  B R0q0`0q0`0q0`\0q0`0q0`0q0` R 0\6 R B0-81, Ġ%̌T$\D#L0P  R0 Ġ01#̌  R R B0-81, Ƞ%ȌX$XH#H0P  R0 Ƞ01#Ȍ  R R B0-81, ̠%Č\$TL#D0P  R0 ̠01#Č  R@-@08#8S  0   X` `! R0-P@ 0bR03 B00_``0 B`3`1`1c11c!0"b2c3c0acP@__ NR- R 0S0 \R000Sa@\0S S0S0S  S 0S R  0R P0Qc\R0@-P@0 A@P `R00\00Sa@ 0zR @R00Q00S ZR 0 PP ^0b0Q &,'$(#80x25P 80x25P80x25bfP 80x40P( 80x40P( 80x40bfP( 80x50P2 80x50P280x50bfP2 (@X,,H d"*' "eYj$@@h>@@h@<`>` Bh@xM0Lp90j^Q 1W jvQ^Q09`0pj^r0@~100MW@ 1eX` @xj"` x@ h x jjjxP0jHj]jjHj]j&z=znx=z=1=21NyeXfxf1f21f|@fhie AWe@aj^Q q xe@z=zx=z jeAe^e@ h j "xee>00  0T0xee4T4x 44 x4@ 10z0?|eX y0jp]@j>] y j]]x0 yjp]e@@le "|e 0e]?*d# e]?*d"De"deBD@je 0e]?s@j:0jteAdjj]dldtdtjbtdt#dJtd^taj^e]QqeBD\|Qj`]Q\dT|^lAj^e^D!j^e^DjV]0eAX| 1f fQ4L=(d|e> 10eeLj"j eeTj"j eeeLj"jeeUj"jl0QuQ]Q 1e6E?>6ue^Pefj Bnj jDj^ j];&1;\nj ee^eTf &eFjj `nbn|n|n|ndd0fpffv`f=d(e`F& ~nbe^e^e^e^00000004l21l21l21l21l21l21l21l25~& nj nB~1jv4jv e BfAfj^jA 10jvFB 14A~14e"1jj 8m(m(m m  Hm m Hmlm Hml"l%0l%l* Hm- l1 Hm208m2 Hm3(m5l7 Hm8l< Hm=lG HmHlK HmLlO HmPl[$@8m] Hm^(m`(mi8mm Hmn0(mn Hmolp Hmtlu8mw Hmxlyl|m8ml Hml Hml Hml HmlT 8m8m Hm llm08m) xlTl98m. Hm/l2xl7l8 Hm:Tl>@l@ 0l@ HmAlF HmG8mKlR @lRlSHmT0lUle00leHmkxluHmzTlzl| $l}llTl%0l Hm l Hm% xlxl Tll Hmlll 0l Hml@l xlTl%@ll Hm0l Hm 8m l) Hmla8m Hm0l Hm 8m Hm0l Hm 8m Hm%pl`l Hml HmHml Hml Hmk%mH HmIkLlNmP8mV HmX8m[ Hm\l]0@l^Hm`li Hmklo*0lq"Hmy& lz"m Hml Hm mlllm Hm lllllml HmlBmRl Hml Hmlk:ll cl Hm@l Hm0k Hm Hm#0l/K HmAmYmZ Hm]xl^ma3 Z]agikkm%2K} }}}%}2> > >>> > > >>%+2>K}  4x5x7r x@t xxxx4x5xxxxx6x 7xT8 t4j 5l@`@`7j @`6j@`4z`884t5r@`X@`PP``XXP``@4zhh5~~4|X4zhh5~~X4|r\jr]jr^jr_j\rj]rj^rj_rj|`@`H@`@@@`HHxx5r6r           xxxx(C|z%2K} }}}%}2> > >>> > > >>%+2>K}  ,LXtH H,NA8 NCD [sP .6\*6h %+2> 88888 9 7 6 97 5 9 423 9 2 9 1 0 9 9 \/|\/O|/-| n;AvXaM ְdx t|dlx  H:Copyright (c) 1982, 1986, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. Copyright (c) 1995-2005 OpenBSD. All rights reserved. http://www.OpenBSD.org s@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@netconnetclsnetionetlck!#$%&'()-0123456789@ABCDEFGHIJKLMNOPQRSTUVWXYZ^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{}~Ͼ󨷵ǎԐѥ噞᷵ǎԐѥ???????????????????????????????? !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?Ѫ?????????????????????????????յݯ????  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~U : < : H  :l d n;0&AvQkkXaM~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@,4Lh8xu,؁4txLspxvmmapbsyBUSYWANTEDTABLEDCLEANCLEANCHKRELEASEDFAKERDONLY ZERO PAGER1FREEINACTIVEACTIVELAUNDRYANONAOBJA&A&B&B ee BeBB B B(B0B8B0B@B0BHB0Bp PBXBp 0\BXBp `dBXBp plBXBP tBXBP xBXBP @|BXBP PBXB BBBBBBBBB(G|B(GB(GB(GB(GB(G  o`po`pBB@BBBB BB BB/BLoBB0/BLp B hB CB @CB ` CB lB CB CB CB C C 0$C C @(C C `,C C 0CB 4C8C @>l>>>???,?L?h???ȏ?? ? ? 0? D? \?t???@AB(CD\EtFGGGܑG G4GhGHIJK K KLK`KpKKLNؓPP P(QLQ\RSSSДTUU,U@UdU|UUȕWX Y(Z<ZdZZ[Ȗ[ؖ[[\$\8\P]l]]]](]`]]̘]]4]h]]Й]]4]h]] Ԛ]! ]"D]#|]$]%]& ]'X](])]*]+(],\]0]1ԝ]2]3H]4]5]6]7,]8`]9]:̟];]<8]@x]A]B]C]DH]E|]F]G]H ]I8]Jh]K]LĢ]P]Q4]Rh]S]TУ]U]V4]Wh]X]YȤ]Z][,]\\]`]ḁ]b]c8]dl]e]fԦ]g ]h<]il]j]kԧ]l]@^p^^^Ԩ^^A ^B@^C\^E|^G`aЩaabc,cXddeffff4gdg|ggīggg(gLglg g h̬iii$j<kXktklmȭnooHoooo$q\rrrȯrr(rTsxsssаsss0ȶԶR8DRXdx|RRRRRRijR̳سRRR  (,R4R<H\`l``RRR R R,4RD4RLTRhpRRDRDRеصRRR RRRRRR,RRRRRRRRRRRRRRRRRRRR5150ES SCSI FA1501 AD<HP\RP R4@RT`RtR4R4RȺRԺRR`lR(REEEEPpxRRRR!A  !@@@@pdȅ|Q`w23h}̌$h}w.xx!dD̲xP`xx!XxxFx@Xht& &(0 H x4tT`t|xQxn xx 0@ ,0PH@HP X`lp| !xx  x(V4VDHWLWTW ,XA\X`XpXY& Yx Zh $Z Z [t[[[[2h6hrh%i3iri$q8qH#rXhpx'35EUPWPWQWRYPY QY4RYH`\`pU`V``ebecedeeeFvpw(<L` tPQUVXZ,<L`t|   == ======$==0==8==D== P== D\\pPEHQ BX(0< HT\ h0t@P3@`3@ 3@p%5EIQa! #,183D5PC\Ah!tG 3RR)R7RGRCRQTWTq   (0x@x!L`8\xPhxUtYYu`x`xaxpxqxrxsxtxx xx$x0x<iLxXdtPQ_ ,8HT`dletd$4DThpx#%'25.B0BB"dB$d ;(;0;8"@"X"l"|" " " "@ "0"p"p" p" p "p"p "t,"t4"t<"tH"tP" tX" t`" tl"t|"t"t"t"t"@t"At"Ct"Et"Ft"Ht"It"Pt"Qt"Tt"Ut,"Xt8"YtD"`tX"dth"htt"it"jt"kt"mt``5D/T!k k(k,k4k@kLkXkk `k!lk"tk$lk%k&k'k(k)k-k.k/k0k1k2lk3k4k5k6k;k>$k?08@8H푠T홠\dl[tCu`P1PAQARAXApArABB6C7CAC$BC0EC@GCLHCLLCXSChTCtXCaCpCqCrCsCtCuCwCyCzCICiCvCTEBG DG,IG8LGDMGPNG\OGhPGtQGRGSGTGUGVGWGXGYGZGfInIBLDLEL(FL4GL@ILLMLXNLdPLpQL|RLSLWLYLZLfLFMLMDN0JNDHNTPNddN|hNDPFPRPDQEQFQGQLQMQNQ OQ0WQ@YQPZQ`lQpERFRGRKRLRHSKSLSMSNSFTLTRTTV(UV4VV@1XL3XX5Xp8X@YAYPYTYUY`YaYbYdYtYuY?Z(AZBZaZbZ`[4b[@d[Lp[\r[lt[|a\c\D]ppPGC,44<DTl ##@#@# @@(P!0D @DLD\Dh`t `|VDE FGHIMSTXY]$^0h@jLkTn`vlwt||}~  (0 C<"CD$CL3CsDTX\XdXl Xt!X|"X#XPQnoxytK@K@K0tcsg}?, ,(,0,8,@,H,P,X,0 `8ht ,`8`L`T`p@BCFGHIPps115@qNC (X@0 020<30D40<@0p@T@h@x@@@@@@F p @ ,<)@+L2T3l4|5@Ci@lhmh0T`x00LPXh p36  C$/xtrqYY0YHTdxd@ppp8$8DX<dxlxtx|xxxx   $,4<Ldl!"#$%&Fe((( ( (( (,(<(L(( (((((!`X `lt@|3@CKKLDDDDDX Ju ,@T#lH5 6.B0B>B$tqtPtX]]h(]i4]xH]T]\]l]x]](]8(](8''(86DXdpFP|p<<<< <(<)<0 <1<H<T4<D<T<t<<<)<*<.<<2<#2<%2<12$8@HPXhpx 3h3@3@,  ".6 >W p08DOI"`Px` ! "I9  ) * , 02,@@A@P`t` b d    8 P d||  $@Xt &'()0123456789:;<=>@ CH,PQYDdPhhuvwxyz{|,DDXp|p p!|0p1|2a "#&'()-.04507H<PKdP|``ab`!#$01H$ $,$8$D$T$d$t $!$"$#$%$&$($@$B$C$D$E$F$(H$8I$LJ$TK$dL$pN$Y$]$$$$$$$$$$$ $$($4$($D$T$($d$t$$($$$$$$$$$$$$%%$0%01%<2%H3%X4%X5%X6%X@%hA%xC%D%E%F%G%H%L%P%R%S%T%`%a%b%p%q% r%4s%Dv%Xx%py%|{%%%%%%%%%% % %0%@%L%X%h%x%%%%%%%%X@&A&Q&R&S&X&(Y&(Z&([&(\&(`&4b&4d&4f&4h&Dj&Xm&hn&xo&p'q''0''''''''''''''' ''('8'H0T2d@3pA3|u5v5w5x555555505<5L5\5\5\5\5\5\5l Bx!B#B$BRRpp p0pqqq(q4q@ qP!qX"qh#qt$q%qqqqqqqqqqqq qq(q(q4x<ĄHńTʄh˄| !"ART(<P\~h`r8|`s8`w8`8`8 @aa0.0v vvv ,,,ss ,!,88ssssDPP`}p}fx727d77 @ABCDEFGHIJKLMNPQRSTUVWXYZ\XXX X (1<2H%T\t   4D=T`` Ct@C|AC|BC|CC|DC|EC|FC|GC|PCQC`CaCbCP+++ + +, + L +!\ +%l + + + ++ +y! +'% + + + +( +@ `haT d t  W W WV WH A @ A   i i i i iP0 iV< CH \ l | Y 0 1           "        (  8  H  X  d  t  Є 353F 3t 3} 333X 3<      $ %8 L ` t A  b  c  5 E `Qw8      JP        ! 0 1 2 4 5 6 P Q R        ! 0 1 2 @ A B P Q R ` a b  $,4<DP X d l t| !0 !"#$%` (<txNP`lll0x] #]9#]=I]HS  (),-78PQR S0T<ULV\W\YhZx[x\]^`defghjklmn 4DXhth$h00<hL\th,8HP\lx@APQRSpqrt uv,x@yPzd{x| 0@P``p|(8HPTQhS|XY["$&)CH,N@HPX!`EWhEXtEhŀEhՌE!ƘEǤEǬE"ȴEaȼ !@  (08 HBTMyx\fpfxfff ffffffffff(f4f@fLfLf Xf!hf%tf'f010qfffffv w PZSZ3MZ8MZ8 Z0 ,Z0M8ZhMDZhbPZiM\ZibhZutZuRZurZ3Z3Zq3Zu3Zv3Zw3Zs3Zr3ZfZ&fZ)fZ fZ!f(w4w @w"HwPwXw@dwlw!tw"|w#w#wc))89Xiefu vw,x<!LQ\Rlz |3S1V3S3S3S3S3S3S=3S3S3S3Sˆ3SÈ3SЈ3Sш3S҈(3Sӈ43S@3SL3SX3Sd3Sp3S|3S3S3S3S3S 3S!3S"3S%3S3S3S3S3S3S,3S.83SD3SL3SX3ShAt}H@HCH CHDHH JJ JJFd999(949<9 L9X9d9p9|99949999909@9P99 909395 9@ 9E 9F 9H$ 9P, 9Q4 9R< 9UD 9XL 9aT 90\ 93d 95l 9@t 9A| 9E 9F 9H 9P 9Q 9R 9U 9` 9 9a 9b 9c 9d 9e 9U!9U!9U!9qU!9U(!9U0!9U8!9UD!9UL!9b\!9bd!9cl!9ct!9%c|!9&c!90c!9p!9p!9p!9p!9p!9p!9p!" "","o@"oH"o P"oX"o`"o h"o p")t")")BI") a"M "M9"M"### #4#%+@#PD#TTT#UT`#l#x#######! # hq# hr#4## b$$ $($$e0$=!<$=!H$)`$ il$t$;'|$;4$;5$L$L=$L=$L$L $L%L%L0%L D%L!X%L#l%L$%L&%L'%L)%L*%L+%L.%L6&L8 &LD&LL&LfT&L\&Ll&L|&L&L&L&L&L&L&L&L&L 'L 'L!0'L#@'L(P'L@`'LAp'LB'LD'LF'LG'LH'LI'LJ'LK(LL((LPP(LQ`(LRp(LS(LT(LU(LV(LW(LX(L`(L(Y( )/ )/ ()//@)yhy@yL)y `)yt)y)y)y)y)y)y)# )# )#)# *# *# 0*#D*# T*# h*# |*#P*#`*#*#*#*# *#@*#%*#`*#*#+#P+#P +#0+#<+L+\+l+x++++ 2+ 2+ 2+ 2+ 2, G,`,`(,`8,`H,`\,`h,`:gp,`|,`j,`,`,`,`,`,`@`,`,,,,6,-` -`,-<-H-T-`-h-at-q-v--------..$.4.& D.T.d.<-qt.."<-80.@0.C0.D0.P0.Q0.S0.W0/X0/Y0(/e04/h0@/t0P/0\/0h/1t/1/1/1/1/1/Y/Y/Y"/Y2/YB0Yr 0101,0"140#1<0G1H0H1T0I1`0w1l01<-1x020'202<-B<-ar0r<-10500000011$101<1hH1T1`1p111111111 1 1 1 1 1222(242@2L2X2d2p2|222222 2!2"2#2$2%36 3738$3903:<3;H3<T3=`3>l3?x3f3g3h3i3j3k3m3n3o33344 4,484D4P4\4`h4at4444444 4 44444555 50585@5L5X51d51l52t5B55Jp$P5P@5P@ 5Pe5P5PZZ5Pf5J5]6]6] ]] 6s06s46s86s<6s @6s D6s L6sT6sX6s 86\68d6 @p6W` a|6=6p6u6666666 6 66777(7",7#07%87(@7)H7+\7,d7/|7376797<7B7C7D7E7H7J7K7L7M8N 8P8W$8Z08]88`D8aH8fT8i`8kh8sp8tx8w8x8}8~888888899$90949L9\9h9l9|99999999999:::,:<:H:`:h:l:|::::: : :::::':1;8;<;B;H0;YD;]L;fT;y|7`;h;x;;;;;;;;;;;<<<$<,<8<T<`<t<?|<D<Y<[<]`<l<o<t<y<z<<<<==,=4=@=T=\=d=t==J=M=q=v=========> >>>=$>O0>a8>D>L>T>\>d>p>|>>>>$>8>;>b>>>>>?8?`?}?$?,?8?4=7@? H?;T?T\?}t?|?????L9?3?==?@63@?OI?J?FP?3S(0tc@ @J8.@@@(@'|9Y0@D@L@`@l@> #$sH6s#6@6 PH#6`OH#6`bF M#asM΁3swO 33i`J`c,c<3 #hM #h##acj3 Nv3 6-3PNPDF##Ɓ#a Jac6-3#hW`愀#愀sKa O#AObHFV#s)Bg#sw2|<LزjNgc-xfjn3|P`P##< #%aOo##$+fj 3cCM #a15l8?#a31 5 9=~-   x33|`B~`)1`C~"X<\"3%|>`> 3B~#:nl8?B~B؃|3/B؃|ă3&8+26##k#c 3|`  k#c-<4830| ` 3 #b cZ3cd# v3 3B##"#"(#"#"B#JaE#3 bG# 3 bC##D#sM3'##&KOO"va F$Hڀ#4#Ja@#AK`#I0I`w#]b#c3-c#Ja#APb#Ac̆_+gcz|#hH##c|#cJa6#Ac37 #c`c#|ocKARaN#Ac3 b#Acg#cc#|gc3@ bcc|+@c|@cC|g@c|#c3*c +3)Ccކ3 bڀc|{c3, .c,|3=gc D|#acrqpcrppqrqppcrppqrqppc##3H#HCڇ#c nCvwc nCvwc#tC@Dt$&$scuZF&JudNsc{cv3>gcc8+8+2 1 c26:>c26:>c8+@2@6@:@>cZ @]cs #ss#f ##bswhA###BT+%2K} }}}%}2> > >>> > > >>%+2>K}  }}}} } > > > >  >> ! >> >  @DHL  @DHL     &(`& 0&0 0 `"0 0  JtT4$   rq! 2r!qq! 0  S1B1SSA1B1B11qw!! RSQQP@064a22"208p8q8q8$8!$8J$8K$8$8$8$8$8$8$8$8%8%8%8o&8S&8Q&8R&8'8'8 t0Ht0HAt0Hit0H@dVCVFVHVIV]18f58f@8f1wq(Mq(MI16U666)R83MP8MP0 P0MPhMPhbPiMPibPuPuRPurP33q3u3v3w3s3r3pppp p<<<<@e@@6@@6S@T6U6yC8fzC8fl"ȼ @d9p Ľf ZP ȿԿ222CC @ @  "2"]G4" w! C0ae01S0 3@ Fv PQUVXZEUPU`V`)0 I$567129:=PQdh348;<>Y)Y$]$'xv|w   &'(yz{u (((((((((2222222<<<<<<<<<FFFFFFPPPPPPZZZZZZZZZddddddddddddddnnnnnnnnnnnnnnnnnnxxxxxxxxxx !#%')+ #%(*,/1368: #&),/257:=?BEGJ+/36:=@CGJMPRUXZ9>BFJMQUX[^adgjlINRW[_bfimpruwz|[`eimqtwz}lquy|rrrrqqqq)(4P@ & 4JPJ.0T|9b|9b|9b |9b|9b!0|9bF|9bccc8ccXc!0cb lc|c lcc@lcc@lcc@lcc@lcc@lcc @lcc@lcc @lccAlccAlcclcclcc:Fcd:5cd:5c d:FPc4dg 87LdXdld" Xd|d@ Xdd` Xdd`XddXddXddhddh!ddhadehvde  e(eT8eDeT8ePe @de tej1?e\=e \=e\=e\=e\=eee ee43f x f f(f8f(fHf(fXfa (f8f (fhf (fxf (ff (ff (ff (ff=fffgJ gg)g8gf(HggHgTgHgdgHgpgrHggggpgggg gh$h<8h<8h!<@h"<@h#<Lh$<Lh1<Xh2<XhG1!dhthG 'dh|hhbhhhhhh hi'ib i(i!il\ 3 p>lmmng,mDm"Tm "dmA0tmC0mE0mG0mH0mN0m# mm# mm# mn#7m,n^ >^ >(^>0^>H^$>l^%>^+>^n>^z>lȉԉ,88HcX`z p@ @ @@ȊЊdȊiȊBbBcU$8 ""($8$cA$8,@L_\l_\t_\_\|_\_\_\_s\y_\_A\̋̋#9 ؋$  74 U7Ds U7Ds 7@ 7L 7X 7db X7p P0| P|%Č،%@ČFbFbF lF@dA=dA= FA,F0B4@H@P@Xp' `odldp9 =tčԍԍ (U@WHLWHdWPHh0ĎԎ0Ď0Ď0Ď0 Ď 01Ď0@Ď(0PĎ40`Ď@0aĎP0pĎ` ll} @} } } sȅebeebJ@ gq;q; q;Dsq;@q;Lq;Xq;hq ;|q;q;q;Ȑqq;q;"Ds ,@3,Lht, 2 ȑ`h9ZbZ bZ 085 a4Ha4Pa4Xa4Pa@4`aA4paE4a`4aa4a4a4a4a4ȒaM4ВaM4ؒaM4{ {({D{#D{#T{#h{%{D{D~ ē1ԓ`ԓ8b 4@ip%@i @iTd P`:| Q`: `:Ĕؔ  $ 4 L`p#')+3 Еܕ  ( < P d xct]?ؖR ! fT;$^40D`hxxxx1x̗ܗ$ 0 @ ̗ ̗Td:a4dܣjnkm\n,mq;txp}L~<`F6zXd@@,qPtc Tw@Pl4wglx|Ānmq87|9 ̤ L@h"ܤ%Č'()g@CܠE\GdhL8S(VWi]?_\befHgj(l|umk xy  | ԡ \ i9 =; A lyb 7o 6~  Ti c g `: te  f rR v s ,= \ 9}  , o  Psfzh=f̡uԓDwc$8elnh9i<EKԛfT;AJ gL@hfBqqLo`@o' WH,}1@xEshdx@? r "$8x$p'`!(i,43f85y5xq#9؋9Ј@ AX8/?9:;<=>?@ABC D E FG HIJK,L!MN-OPQRS T/U*V-W+X Y1Z2[3\4]5^6_7`8a9b0c.e mMqQ@zy2" 3#6&$7/{%8([&9)]'0=}-?\./0+*1#'2#'345 6,;7.:8-_d<>| .'`0+*~5^2"@ 3#!4$#6&$7/{%8([&9)]'0=}-+?.|/01'*2'*3456,;7.:8-_d<>\ .'`|0^~-+?\0345d<>| .'`|0^~.\0345|d<>.\`0^~q,?azw&12~ "3#!'4{"(5[#-6|$7`%_8\&9^'0@-)].=+}/0$1*2*3m4%56;.7:/8!d<> bBeE hH iI jJkKlL|,?nN~aArR,sSzZyY2 "3!'4"(5{[#6$7%!8&9%!8'0-)}].-_/0$*2`@#3mM4%5@#7:/\8=+g= 2" 3"5%#6&$7/%8(&9)'0=-'?.^/{[0+*}]123@4#5\|6,;7.:8-_d<> 1!2" 3!4$"5%#6^$7&%8*&9('0)--_.=+1#~2#~4'@5``d\|2"#6&$7'%8(&9)'0--=.^~/@`0[{1]}2]}3;+4:*5\_\|1!|2"@ 3#!4$~#6&$7/%8(&9)'0=-'?./[0+*]1}2}34{5\6,;7.:8-_d<> eE !1@-2_ /3#!;4$":5#,6^$.7&%=8*&[9(']0), -?+'.xX%/{0wW}1qQ|2qQ|34"5`~67fF8\ q,?azw&1|2@ "3#!'4"(5#6^$7%!8&9{'0}-).-_/[0$*]1`2`3m4%56;.7:/8=+~d<>\ xje.> u i d c htnbrl'"poygk,<qf;:-[{.]}//?0=+3s4-_6w7v8z9: ;<=>?@ABCD E aAbBcCdDeE fF gG hH iI jJkKlLmMnNoOpPqQrRsStTuUvVwWxXyYzZ#6^6,$7&7./[{0]}3;:4'"6,<7.>8/? aAbBcCdDeE fF gG hH iI jJkKlLmMnNoOpPqQrRsStTuUvVwWxXyYzZ#6^6,$7&7.--_.=+/[{0]}1\|2\|3;:4'"5`~6,<7.>8/? eEzy1+|2"@ 3*#!4#6&$7/%8(&9)'0=-'?./[0!]1$}2$}34{5 6,;7.:8-_d<>\ -'?.^`~0!]/[34{2"@ 3##6&$7/{%8([&9)]'0=}-'?.<>/+*012345\|6,;7.:8-_d<> .+*/2\|4qQ@1!2" 3##6&$7/%8(&9)'0=-'?\./0+*~1}]2}]34{[5|6,;7.:8-_d<> 1!2@ 3#!4$"5%#6.=+/0[{1]}2]}345'"8;:c.d\|/? IqQ@2' 3^#!4+$"5%#6&$7/{%8([&9)]'0=}-*?\.-_/0~1,;2,;34i5"678.:d<>| /1,;`2,;`3'aAcCeElLnNoOsSxXzZ bB{cC& fF[ gG] iI jJnN}qQ\vV@wW|xX#zZyY>1'~2" 3+^!4!"5%#6/$7=`%8(&9)'-./QP01qp2qp3$4506,?;7.:8-_*d< bB{ fF[ gG]kKlLmMnN}qQ\vV@wW|zZyY1!~2" 3#^!4$"5%#6&$7/`%8(&9)'0=-'?.+*/0123456,;7.:8-_d<> mMoOpP1!2"@ 3/!4$"5%#6?$7&%8*&9('0)--_.=+/[0']1<>}2<>}3;:~4{5#|\6,'7..8d /^^[0]4``{8  R2 ]I|JR7$     K"\#@#f#\#\#\# \#\#H@\# N  _"#%\& ^' v' ^'E' (m.!K.(A([F))0* z*+j,l-8؎0ԕll(  v      W 1 Q `  @  0 2 A@ A   @  @ @   P0 P  A   h }  } } } @  85     L+ L lL2 D   O  {o  A F  @@@ @ @AA@:F:FP 43W  !      @ @ @ @ A n n@n @nn@0Df @  Q k k"k"k"k"k @^z BF |9 , |d(@ 'W W@ @EEE }WQ  k"BFFeeeZZ Z 0|`   !"#$%&'()*+,-./0000000000:;<=>?@00000000000000000000000000[\]^0`00000000000000000000000000{|}~00000000000000000000000000000000000000000000000000000000000000vt1004dewd0fXg  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^%% $ $ $ $ $%% %%<%%$%4%,%%d"e"`"  " %" #!#%# # # # ""*#d"`"e"+"4"""""<"C"!!a"""")"*"'"(""!!!!#@[\]^_`{|}~@[\]^_`{|}~|^_`#@_^_`#_#^_`^_#@^_`~#@^_`~^_``#_ABCDEFGHIJKLMNOPQRSTUVWXYZ@ `P0pH(hX8xD$dT4t L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}C#cS3s K+k[;{G'gW7wO/o_? U 1!2@3#4$5%6^7& 8* 9( 0) -_ =+! qwertyuiop[{]} as d!f"g#h$j%k&l';:('")`~*+\|,z-x.c/v0b1n2m3,<4.>5/?67*89 :;<=>?@ABCD E F G7H8I9J-K4L5M6N+O1P2Q3R0S.W X  / ,-.2"36&7/{ 8([ 9)] 0=} ?\ qQ@z+*'() +#',y2mM3,;4.:5-_V<>| '`+*~)^2"@3#4$6&7/{ 8([ 9)] 0=} +? |'()+'*3,;4.:5-_V<>\ '`|^~ +?\'()V<>| '`|^~ \'()|V<> \`^~&12~"3#'4{(5[-6|7` _8\ 9^ 0@ )] =+}az$q'm(%)+*,w2,?3;.4:/5!V<> 2"35%6&7/ 8( 9) 0= '? ^{[+*}]'@(#)\|+3,;4.:5-_V<> 1!2"34$5%6^7& 8* 9( 0) -_ =+('@)``+#~V\|2"6&7' 8( 9) 0 -= ^~@`[{';+(:*)+]}ps\_y{}\|1!|2"@3#4$~6&7/ 8( 9) 0= '? [+*]'({)\+}3,;4.:5-_V<> !1@-2_/3#;4$:5,6^.7& =8* [9( ]0) ?+' xX%eE{wW}!'(")`~+qQ|-34fF5\9 &1|2@"3#'4(56^7 !8 9{ 0} ) -_az[$*]q'm(%)+`,w2,?3;.4:/5=+~V<>\ `~)<> W  FE7JG7H8I9K4L5M6O1P2Q3R0S.-N, [{ ]}'",<.>pyfgcrl/?=+o e!u"i#d$h%t&n's(-_,;:-q.j/k0x1b3w4v5z:; <=>?@ABCDW X 6^6,7&7.qQwWeErRtTyYuUiIoOpP[{]}aAsS dD!fF"gG#hH$jJ%kK&lL';:('",zZ-xX.cC/vV0bB1nN2mM3,<4.>5/? 6^6,7&7. -_ =+qQwWeErRtTyYuUiIoOpP[{]}aAsS dD!fF"gG#hH$jJ%kK&lL';:('")`~+\|,zZ-xX.cC/vV0bB1nN2mM3,<4.>5/? 1+|2"@3*#46&7/ 8( 9) 0= '? eEz[!]'({) +$},y3,;4.:5-_V<>\ '? ^`~!]['({2"@3#6&7/{ 8([ 9)] 0=} '? <>+*'()\|+3,;4.:5-_V<> 1!2"3#6&7/ 8( 9) 0= '?\ qQ@+*~'({[)|+}]3,;4.:5-_V<> 1!2@3#4$5%6 =+[{'()'"+]}5;:S.V\|s/?2'3^#4+$5%6&7/{ 8([ 9)] 0=} *?\ -_qQ@I~'(i)"+,;345.:V<>| ''+,;`eEoOaAsS&lL,zZ-xX.cC1nN 1'~2"3+^4!5%6/7=` 8( 9) qQ\wW|zZiIQP!fF["gG]$jJ'$()0+qp,yY>-xX#.cC&/vV@0bB{1nN}3,?;4.:5-_*V< 1!~2"3#^4$5%6&7/` 8( 9) 0= '? +*qQ\wW|zZ!fF["gG]%kK&lL'()+,yY/vV@0bB{1nN}2mM3,;4.:5-_V<> 1!2"@3/4$5%6?7& 8* 9( 0) -_ =+oOpP[']';:~({)#|\+<>}2mM3,'4..5V ^^[](``{5 BOD DZEFDZEGFMG4G jE E E EC:JKJVK@#`KVKVK VKVKH@VK JH [IK MXN FO ^O FOBtOiHGO=PWQ Q0Q $R,Sf2TT  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abc  !"#$%&'()0123456789@ABCDEFGHIPQRSTUVWXY`abcdefghipqrstuvwxy0123456789abcdefghijklmnopqrstuvwxyzOpenBSD3.8RAMDISK#133 @(#)OpenBSD 3.8 (RAMDISK) #133: Sat Sep 10 20:04:46 MDT 2005 OpenBSD 3.8 (RAMDISK) #133: Sat Sep 10 20:04:46 MDT 2005 deraadt@cats:/usr/src/sys/arch/cats/compile/RAMDISK dackirqsizeiomemiosizdrqdrq2channeldrivetargetlunphydevfunctionconfigurationvendorproductreleasereportidconsolemuxslotwsmuxloopbpfiltervga_init_screen: no font vga_init_screen: no fontvga_common_setup: couldn't map vga iovga_common_setup: couldn't map 6845 iovga_common_setup: couldn't map memoryvga_common_setup: mem subrange failedvga_free_screen: consolevga_doswitch: disappeared vga: pcvt font support not built in, see vga(4) vgadrive at %s channel %d drive %datapiscsi at %s channel %dwdcspl%s channel %d: reset failed for drive 1 drive 0atapi type: %s c_bcount: %d c_skip: %d missing untimeoutwdc_probe_caps%s(%s:%d:%d): using PIO mode %d, Ultra-DMA mode %d, DMA mode %d using BIOS timings%s: transfer error, downgrading to PIO mode %d %s: transfer error, downgrading to DMA mode %d %s: transfer error, downgrading to Ultra-DMA mode %d wdccmdwdccommandwdccommandext%s:%d: %s %s(%s:%d:%d): %s physio split wd ioctl request... cannot proceed user_strat: No ioctl TagSCB %d - Abort%s Completed. Bus Device ResetSelection Timeout%s: ahc_intr - referenced scb not valid during SELTO scb(%d, %d) parity error detected %s. SEQADDR(0x%x) SCSIRATE(0x%x) non- Unexpected %sDT Data Phase Illegal CRC packet request No terminal CRC packet recevied CRC Value Mismatch %s:%c:%d: %s: Someone reset channel %c %s: Transceiver State Has Changed to %s mode %s: Spurious SCSI interrupt NONEaic7770aic7850aic7855aic7859aic7860aic7870aic7880aic7895aic7895Caic7890/91aic7896/97aic7892aic7899Illegal Host AccessIllegal Sequencer Address referrencedIllegal Opcode in sequencer programSequencer Parity ErrorData-path Parity ErrorScratch or SCB Memory Parity ErrorPCI Error detectedCIOBUS Parity Errorin Data-out phasein Data-in phasein DT Data-out phasein DT Data-in phasein Command phasein Message-out phasein Status phasein Message-in phasewhile idlein unknown phase80.040.033.020.016.013.410.08.06.675.75.04.44.03.6%s: WARNING no command for scb %d (cmdcmplt) QOUTPOS = %d Attempt to queue invalid SCB tag %x:%x%s: brkadrint, %s at seqaddr = 0x%x ahc_intr: seqint, intstat == 0x%x, scsisigi = 0x%x %s:%c:%d: unknown scsi bus phase %x, lastphase = 0x%x. Attempting to continue %s:%c:%d: Warning - unknown message received from target (0x%x). Rejecting ahc_intr: HOST_MSG_LOOP bad phase 0x%x %s:%c:%d: no active SCB for reconnecting target - issuing BUS DEVICE RESET SAVED_SCSIID == 0x%x, SAVED_LUN == 0x%x, ARG_1 == 0x%x ACCUM = 0x%x SEQ_FLAGS == 0x%x, SCBPTR == 0x%x, BTT == 0x%x, SINDEX == 0x%x SCSIID == 0x%x, SCB_SCSIID == 0x%x, SCB_LUN == 0x%x, SCB_TAG == 0x%x, SCB_CONTROL == 0x%x SCSIBUSL == 0x%x, SCSISIGI == 0x%x SXFRCTL0 == 0x%x SEQCTL == 0x%x Unable to clear parity error. Resetting bus. %s:%c:%d:%d: Attempt to issue message failed data overrun detected %s. Tag == 0x%x. HaveHaven't%s seen Data Phase. Length = %ld. NumSGs = %d. sg[%d] - Addr 0x%x%x : Length %d Bogus TAG after DMA. SCBPTR %d, tag %d, our tag %d for safety%s: BTT calculation out of range SEQ_FLAGS == 0x%x, SCBPTR == 0x%x, BTT == 0x%x, SINDEX == 0x%x , A == 0x%x %s: No free or disconnected SCBs %s:%c:%d: Missed busfree. Lastphase = 0x%x, Curphase = 0x%x %s: Interrupted for status of 0 (?) ahc_intr - referenced scb not valid during seqint 0x%x scb(%d) HOST_MSG_LOOP with invalid SCB %x %s: Missing case in ahc_handle_scsiint. status = %x Unexpected busfree %s SEQADDR == 0x%x %s: %s: Infinite loop in critical section critical section loop%s: ahc_alloc_tstate - Target already allocated DT%s: target %d synchronous at %sMHz%s, offset = 0x%x %s: target %d using asynchronous transfers %s: target %d using %dbit transfers %s:%c:%d:%d: Bus Device Reset Message Sent Abort%s Message Sent ahc_intr: AWAITING_MSG for an SCB that does not have a waiting message SCSIID = %x, target_mask = %x SCB = %d, SCB Control = %x, MSG_OUT = %x SCB flags = %xNo or incomplete CDB sent to device. %s: Issued Channel %c Bus Reset. %d SCBs aborted Protocol violation %s. Attempting to abort. Completed command without status. Unknown protocol violation. No SCB found during protocol violation Target did not send an IDENTIFY message. LASTPHASE = 0x%x. HOST_MSG_LOOP interrupt with no active messageUnknown REQINIT message typeTarget MSGIN with no active message(%s:%c:%d:%d): Target Initiated PPR (%s:%c:%d:%d): Initiator Initiated PPR (%s:%c:%d:%d): requested %dBit transfers. Rejecting... (%s:%c:%d:%d): refuses WIDE negotiation. Using 8bit transfers orderedhead of queue(%s:%c:%d:%d): refuses %s tagged commands. Performing simple queue tagged I/O only (%s:%c:%d:%d): refuses tagged commands. Performing non-tagged I/O %s:%c:%d: Message reject for %x -- ignored (%s:%c:%d:%d): refuses synchronous negotiation. Using asynchronous transfers %s: %s on %c:%d. %d SCBs aborted Unsupported adapter type (0x%x). Ignoring %s: WARNING - Failed chip reset! Trying to initialize anyway. hardware SCB structuressense buffers%s: ahc_init_scbdata - Unable to allocate initial scbs %s: No SCB space found SG spaceUltra Ultra160 Ultra2 SingleWide%s%s Channel %c, SCSI Id=%d, %d SCBs%d/%d SCBsTwin Channel, A SCSI Id=%d, B SCSI Id=%d, primary %c, shared data%s: Host Adapter Bios disabled. Using default SCSI device parameters %s: unable to allocate ahc_tmode_tstate. Failing attach Infinite interrupt loop, INTSTAT = %xInactive SCB in Wait List scb_index = %d, next = %d Waiting List traversalWaiting List inconsistency. SCB index == %d, yet numscbs == %d.found = %d, qinstart = %d, qinfifionext = %d First/Second Qinfifo fixupInactive SCB in qinfifo qinpos = %d, SCB index = %d Loop 1Disconnected List inconsistency. SCB index == %d, yet numscbs == %d.Disconnected List Loop. cur SCBPTR == %x, prev SCBPTR == %x.Inactive SCB on pending list Bogus resid sgptr value 0x%x %s: Program too large for instruction memory size of %d! ahc_loadseq: Could not malloc%s: BMOV not supportedUnknown opcode encountered in seq program%s[0x%x]%s ahc_print_register:(|================== Dump Card State Begins ================= %s: Dumping Card State %s, at SEQADDR 0x%x ACCUM = 0x%x, SINDEX = 0x%x, DINDEX = 0x%x, ARG_2 = 0x%x HCNT = 0x%x SCBPTR = 0x%x SCSISIGIERRORSCSIBUSLLASTPHASESCSISEQSBLKCTLSCSIRATESEQCTLSEQ_FLAGSSSTAT0SSTAT1SSTAT2SSTAT3SIMODE0SIMODE1SXFRCTL0DFCNTRLDFSTATUSSTACK: SCB count = %d Kernel NEXTQSCB = %d Card NEXTQSCB = %d QINFIFO entries: Waiting Queue entries: %d:%d Disconnected Queue entries: QOUTFIFO entries: Sequencer Free SCB List: Sequencer SCB Info: %3d SCB_CONTROLSCB_SCSIIDSCB_LUNSCB_TAGPending list: Kernel Free SCB list: FEATURES = 0x%x, FLAGS = 0x%x, CHIP = 0x%x BUGS =0x%x ================= Dump Card State Ends ================== Untagged Q(%d): (SCSIPHASECard was paused %s: failed to allocate DMA mem for %s, error = %d %s: failed to map DMA mem for %s, error = %d %s: failed to create DMA map for %s, error = %d %s: failed to load DMA map for %s, error = %d ahc_createdmamem error (%d) ahcahc_attachno longer in timeout, status = %x cmd fail %s: board is not responding SCB 0x%x - timed out again Other SCB Timeout%sBDR message in message buffer SCB %d: Immediate reset. Flags = 0x%x Queuing a BDR SCB %s: Hung target selection sg[%d] - Addr 0x%x : Length %d %s: Timed out SCB already complete. Interrupts may not be functioning. Timed-out target SCB but bus idle%s: Illegal cable configuration!!. Only two connectors on the adapter may be used at a time! adv%s: unable to allocate control structures, error = %d %s: unable to map control structures, error = %d %s: unable to create control DMA map, error = %d %s: unable to load control DMA map, error = %d %s: unable to initialize ccb, error = %d %s: unable to create DMA map, error = %d advccb%s: unable to load overrun buffer DMA map, error = %d %s: unable to create overrun buffer DMA map, error = %d %s: unable to map overrun buffer, error = %d %s: unable to allocate overrun buffer, error = %d %s -set: tag queuing enabled w/o disconnects unknown warning %d I/O port increment switch enabled %s -get: Chip is not halted Couldn't get MicroCode Start address I/O port address modified EEPROM checksum error IRQ modified adv_init: adv_find_signature failed%s: bad signature%s: unable to initialize board RISC chip%s: unable to create control blocks %s: WARNING: only %d of %d control blocks created %s: unable to load MicroCode%s: unable to initialize MicroCode%s: adv_scsi_cmd, more than %d dma segments %s: adv_scsi_cmd, error %d loading dma map timed out AGAIN. Resetting Bus %s: exiting ccb not allocated! %s: timed out [ecb %p (flags 0x%x, dleft %x, stat %x)], AGAIN sync negotiation disabled espESP100ESP100AESP200NCR53C94NCR53C96ESP406FAS408FAS216AM53C974FAS366/HMEout of memory %s: unknown variant %d, devices not attached : %s, %dMHz, SCSI ID %d %s: unknown revision code, assuming ESP100 %s: resetting SCSI bus ncr53c9x_ecb[NCR_INIT(%d) %d] SELATNS [ncr53c9x_select(t%d,l%d,cmd:%x,tag%x,%x)] [0x%x, %d]->%d [ncr53c9x_scsi_cmd] [ncr53c9x_poll: rescheduling] [ncr53c9x_poll] %d:%d busy [ncr53c9x_sched] ncr53c9x_sched: not IDLE (state=%d)requesting sense sense=0x%02x resid=%lu %s: QFULL -- throttling to %d commands [ncr53c9x_done(error:%x)] [flushfifo] cont [rdfifo %s (%d): %02xncr53c9x_rdfifo: bad flag[wrfifo(%d):ncr53c9x_sched_msgout %x %d %s: reselect from target %d lun %d tag %x:%x with no nexus; sending ABORT %s: reselect with invalid selid %02x; sending DEVICE RESET %s: msgin: no msg byte available %s: phase change, dropping message, prev %d, state %d %s: unexpected MESSAGE IN; sending DEVICE RESET %s: reselect without IDENTIFY; MSG %x; sending DEVICE RESET got %ld extra bytes cmdcomplete unrecognized MESSAGE EXTENDED; sending REJECT %s: wide mode %d async mode max sync rate %d.%02dMB/s SDTR period %d, offset %d extended(%x) save datapointer restore datapointer disconnect %s: tagged queuing rejected: target %d (rejected sent tag)%s: sync transfer rejected: target %d %s: wide transfer rejected: target %d msg reject (msgout=%x) noop unrecognized MESSAGE; sending REJECT ident TAG %x:%x%s: TAG reselect without IDENTIFY; MSG %x; sending DEVICE RESET gotmsg(%x) state %d[ncr53c9x_msgin(curmsglen:%ld)] %s at line %d: no nexus %s at line %d: unexpected MESSAGE OUT phase [ncr53c9x_msgout(priq:%x, prevphase:%x)]%s: waiting for SCSI Bus Reset to happen %s: identify failed, state %d, intr %02x selid=%2x %s: RESELECT: %d bytes in FIFO! [intr %x, stat %x, step %d, prevphase %x] %s: target didn't identify backoff selector ncr53c9x: no nexus%s: MSGIN: unexpected FC bit: [intr %x, stat %x, step %x] %s: MSGIN: weird bits: [intr %x, stat %x, step %x] MESSAGE_IN_PHASE %s: unexpected bus phase; resetting MESSAGE_OUT_PHASE DATA_OUT_PHASE [%ld] COMMAND_PHASE 0x%02x (%d) DATA_IN_PHASE STATUS_PHASE ncr53c9x no nexus%s: step 1 & !NEG %s: !MSGOUT (%s:%d:%d): selection failed; %d left in FIFO [intr %x, stat %x, step %d] (%s:%d:%d): select; %lu left in DMA buffer [intr %x, stat %x, step %d] %s: unexpected status after select: [intr %x, stat %x, step %x] <>%s: target didn't send tag: %d bytes in fifo [%d] %s: STATUS_PHASE: msg %d %s: can't get status, only %d bytes %s: ICCS: : [intr %x, stat %x, step %x] %s: invalid state: %d sync nego not completed! %s: unexpected disconnect; sending REQUEST SENSE %s: SCSI bus parity error %s: !TC on DATA XFER [intr %x, stat %x, step %d] prevphase %x, resid %x %s: !TC on MSG OUT [intr %x, stat %x, step %d] prevphase %x, resid %lx %s: DMA error; resetting %s: illegal command: 0x%x (state %d, phase %x, prevphase %x) %s: SCSI bus reset regs[intr=%02x,stat=%02x,step=%02x,stat2=%02x] [ncr53c9x_intr: state %d] %s: nexus in reset stateDMA activetagged DT %s: target %d now using %s%s%d bit MHz %d REQ/ACK offset xfers 13.3??3.33async siop: can't find my sync parameters%s: unable to allocate script DMA memory, error = %d %s: unable to map script DMA memory, error = %d %s: unable to create script DMA map, error = %d %s: unable to load script DMA map, error = %d %s: rejecting invalid wide negotiation from target %d (%d) %s: rejecting invalid PPR negotiation from target %d %s: ppr negotiation for target %d: offset (%d) or sync (%d) out of range %s: ppr negotiation for target %d: transfer width (%d) incompatible with dt %s: ppr negotiation for target %d: sync (%d) incompatible with adapter %s: ppr negotiation for target %d: no DT option %s: bad offset in siop_sdp (%d) clear fifo failed %s: timeout waiting for DIFFSENSE to stabilise %s: invalid SCSI mode 0x%x %s: switching to differential mode %s: switching to LVD mode %s: switching to single-ended mode siop%s: can't alloc lunsw for target %d %s: unexpected phase mismatch %d %s: selection timeout without command %s: unexpected disconnect without command != NULL%s: siop_intr() - we should not be here! istat = 0x%x, dstat = 0x%x, sist = 0x%x, sstat1 = 0x%x need_reset = %x, irqcode = %x, siop_cmd %s %s: script interrupt (0x%x) with invalid DSA !!! unknown irqcode %x %s: done without command, DSA=0x%lx invalid retval from siop_wdtr_neg()invalid retval from siop_sdtr_neg()%s: extended message too big (%d) unhandled message 0x%x scsi message reject, extended message sent was 0x%x scsi message reject, message sent was 0x%x our reject message was rejected %s: reselect with invalid target %d %s: target %d lun %d tag %d reselect without command %s: target %d reselect with invalid lun %d %s: reselect with invalid target error, DSP=0x%x reselect failed %s: reselect with invalid tag %s: bad offset for disconnect (%d) %s: command with invalid status (IRQ code 0x%x current status %d) ! %s: unhandled scsi interrupt, sist=0x%x sstat1=0x%x DSA=0x%x DSP=0x%x parity error %s:%s: phase mismatch without command scsi gross error %s: DMA IRQ: dma fifo empty, DSP=0x%x DSA=0x%x: last msg_in=0x%x status=0x%x current DSA invalid parity bus fault illegal instructionsingle step dsp 0x%08x dsa 0x08%x INTRF %s: unable to load data DMA map (for SENSE): %d request sense failed %s: untagged command already running for target %d lun %d (status %d) %s: scsi bus reset cmd %p added to reset list from urgent list cmd %p added to reset list from ready list cmd %p (status %d) reset with status %d, xs->error %d cmd %p (tag %d) added to reset list %s: unable to load data DMA map: %d %s: can't alloc siop_lun for target %d lun %d %s: can't malloc memory for target %d siop_start: bad statustimeout on SCSI command 0x%x %s: unable to allocate cbd DMA memory, error = %d %s: unable to load cbd DMA map, error = %d %s: unable to create data DMA map for cbd: error %d %s: unable to create cbd DMA map, error = %d %s: unable to map cbd DMA memory, error = %d %s: can't allocate memory for command descriptors %s: can't allocate memory for command descriptors head siop: resel switch fullsiop_stat_intr %d siop_stat_intr_shortxfer %d siop_stat_intr_xferdisc %d siop_stat_intr_sdp %d siop_stat_intr_done %d siop_stat_intr_lunresel %d siop_stat_intr_qfull %d lc%s: fatal RXD error, attempting recovery %s: recovery failed -- board disabled %s: reset: EEPROM checksum failed (0x%x) PIO mode (internal 2KB window)2KB windowchanged 32KB window to 2KBchanged 64KB window to 2KB%s: address %s, %dKB RAM, %s %s: disabled due to error %s: command never completed! %s: eeprom failed to come ready %s: reset didn't complete %s: bogus xcvr value in EEPROM (%x) %s: choosing new default based on card type %s: WARNING: no media options bits set in the media options register!! %s: this could be a manufacturing defect in your adapter or system %s: attempting to guess media type; you should probably consult your vendor %s: unknown device ID: %x -- defaulting to 10baseT %s: guessing MII %s: guessing 10/100 internal %s: guessing 10BaseT transceiver %s: guessing COMBO (AUI/BNC/TP) %s: guessing 10baseFL %s: guessing 100BaseT4/MII %s: guessing TPC (BNC/TP) %s: guessing 10/100 plus BNC/AUI %s: rx load failed %s: bad receive status -- packet dropped %s: transmission error: %x %s: initialization failed: no memory for rx buffers %s: unknown XCVR type: %d %s: watchdog timeout %s: no carrier - transceiver cable problem? %s: failed to read station address : can't alloc list mem : can't map list mem : can't alloc list map : can't load list map : can't create rx spare map : can't create tx spare map : can't create tx map : can't create rx map xl%s: warning: SCB timed out fxp: %s, address %s %s: no phy found, using manual mode %s: Disabling dynamic standby mode in EEPROM, New ID 0x%x, cksum @ 0x%x: 0x%x -> 0x%x %s: Failed to malloc memory %s: unable to create rx dma map %d, error %d %s: unable to create tx dma map %d, error %d fxp_stop: no buffers!%s: device timeout %s: fxp_mdi_read: timed out %s: fxp_mdi_write: timed out fxp-d101afxp-d101b0fxp-d101mafxp-d101sfxp-d102fxp-d102cfxp-d102e%s: timeout loading microcode %s: failed loadfirmware of file %s: errno %d %s: phy_read: bad phy register %x %s: phy_write: bad phy register %x %s: failed to force tx and rx to idle state %s: reset never completed! %s: MII without any PHY! %s: no memory for rx list -- packet dropped! %s: failed to force tx to idle state %s: no memory for tx listdcne2000_attach%s: setup failed %s: where did the card go? ne2000_detect%s: remote transmit DMA failed to complete ne2000_write_mbuf: negative len%s: %d silo overflow%s, %d ibuf overflow%s : unknown uart %s: console : ns8250, no fifo : ns16450, no fifo : ns16550, no working fifo : ns16550a, 16 byte fifo : st16650, no working fifo : st16650, 32 byte fifo : ti16750, 64 byte fifo comattach: bad fifo type%s: can't establish soft interrupt.comprmcomstartcomcninit: mapping failedkbdauxkbc: cmd word write error kbc: aux echo error 1 kbc: aux echo error 2 (%s slot)pckbc_slot_enable(%d) failed pckbc_cmd: send error pckbc: command timeout pckbc_start: command error pckbc_start: send error pckbc: cmd failed kbccmdpckbc_set_inputhandler: bad slot %dpckbcintr: no dev for slot %d pckbcihaerror %d loading SG list dma map buffer needs >%d dma segments error %d loading buffer dma map iha_init_tulip%s: couldn't create SCB SG DMA map, error = %d %s: couldn't create SCB data DMA map, error = %d error %d loading request sense buffer dma map SCSI Parity error detected SCSI OpCode 0x%02x timed out %s: target %d using %d bit %d.%d MHz %d REQ/ACK offset %s: unable to allocate SCBs, error = %d %s: unable to map SCBs, error = %d iha: invalid EEPROM, bad signature or checksum version %d.%d%s %s: unsupported OHCI revision %s: reset timeout %s: SMM does not respond, resetting ohci, legacy support%s: blocking intrs 0x%x %s: unrecoverable error, controller halted %s: resume detect %s: %u scheduling overruns ohci_add_done: addr 0x%08lx not foundohci_rem_ed: ED not foundohci_abort_xfer: not in process contextohci_root_ctrl_startOHCI root hubohci_setintr: 0 interval %s: isoc TD alloc failed ohci_device_isoc_abort: early return rd%drdattach: device name too long RAM diskfictitiousrd_idleAll breakpoints used. Already set. Too many breakpoints. Not set. No breakpoints set Map Count Address %s%p %5d %-12sdb_commandCount missing Bad modifier Ambiguous No such command Malloc debugging not enabled. the kernel did not panic procscalloutbreaksextentsmallocobjectpanicpoolprocregistersuvmexpwatchescrashhaltrebootpoweroffmachineexaminesearchdeletebreakdwatchwatchstepcontinueuntilnextmatchtracecallshowboothelphangmandmesgddb> Bad function %#n Argument missing Too many arguments ELF[ %s symbol table has bad start address %p ] ELFbad magic[ %s ELF symbol table not valid: %s ] bad e_machine.strtab.symtabsymtab unaligned[ using %lu bytes of %s ELF symbol table ] symtab corrupted= 0x%lx %c\%03o%-*ld%-*lo%-*lr%-*lu%-*lx%-*lz: %*d%*o%*r%*u%*x%*zAddress missing Value missing Syntax error Symbol not found Divide by 0 Negative shift amount ^R String too long Bad escape Bad character Bad character in number End of stack trace. --db_more-- -%*lo-%#*lo-%*lu-%#*lu-%*lx-%#*lxFaulted in traceback, aborting... Starting stack trace... %-12s%#*ln %s+%#lr[after %6d] bsd[ no symbol table formats found ] No slots left for %s symbol tableUnable to find symbol table slot for %s.invalid symbol table name%s%s Sifting table %s: db_printsym [%s:%d]+%sBreakpoint at Stopped at RUN AT LEAST 'trace' AND 'ps' AND INCLUDE OUTPUT WHEN REPORTING THIS PANIC! DO NOT EVEN BOTHER REPORTING THIS WITHOUT INCLUDING THAT INFORMATION! After %d instructions (%d loads, %d stores), radixmaxoffmaxwidthtabstopslinesUnknown variable No value All watchpoints used. No map. Too many watchpoints. No watchpoints set Map Address Size %s%p %8lx %lx Unknown size %#8n = %#8n Nothing written. () Score: %lu/%lu db_hangman/etc/firmware/%s%s: address %s dp8390_initdp8390_start: no header mbuf%s: NIC memory corrupt - invalid packet length %d : failed to clear NIC buffer at offset %x - check configuration %s: device enable failed arc4_stirextract_entropyrndrdcd9660_lookupcd9660_inactive: pushing activecd9660_reclaim: pushing activeRRIP without PX field? RRIP with incorrect flags?RRIP with incorrect NM flags? IEEE_P1282RRIP_1991AIEEE_1282SPcd9660_mountroot: can't setup bdevvp'scd9660root_deviceCD001%/@%/C%/Eisoinodefhtovp: directory crosses block boundary %d[off=%d/len=%d] fhtovp: bread error %d fhtovp: crosses block boundary %d fhtovp: lbn exceed volume space %d cd9660_strategy: spectag VT_ISOFS, isofs vnode elf32_load_fileOpenBSDexec_elf32_makecmds#!/dev/fd/%dswapperfork initcfpendcannot mount rootcannot find root vnodepagedaemonfork pagedaemonreaperfork reapercleanerfork cleanerupdatefork updateaiodonedfork aiodoned/sbin/init/sbin/oinit/sbin/init.bak/dev/consolewarning: /dev/console does not exist warning: /dev/console error %d initexecinit: couldn't allocate argument spaceexec %s: error %d init: not found no initinitclocks: unable to register softclock intrfileplfdescpldup2: fdallocclosefkqeueplknoteplkqreaduser mapping failed kernel mapping failed %d init died (signal %d, exit %d)waitppwaitWARNING: thread `%s' (%d) exits with status %d unable to allocate kthread_qlockmgr: make up your mindlockmgr: not holding exclusive locklockmgr: unknown locktype request %dlockmgr: non-zero exclusive countlockmgr: locking against myselflockmgr: upgrade exclusive locklockmgr: processor %lu, not exclusive lock holder %lu unlockinglockmgr: pid %d, not exclusive lock holder %d unlockinglockmgr: draining against myself lock type %s: EXCL (count %d) by processor %lupid %d with %d pending not locked lock type %s: SHARED (count %d)malloc: allocation too largemalloc: out of space in kmem_map%d,rwlockrw_enter: locking against myselfphysbufphysio%-16s %-8s %18p %s %5d %5d %5d %d %#10x %-9.9s %-16s COMMANDSTRUCT PROC *UAREA * PID %-10s %18s %18s %18s VMSPACE/VM_MAP PID %-16s %-8s %18s %s EMULWAIT-CHANNELWAIT-MSGWAITPPIDPGRPUID PID %5s %5s %5s S %10s %-9s %-16s usage: show all procs [/a] [/n] [/w] /a == show process address info /n == show normal process info [default] /w == show process wait/emul info procinit: mallocprocplzombieplucredplpgrpplsessionplpcredplchgproccnt: procs < 0idlestopzombiedeadonprocADVLOCKCTTYINMEMNOCLDSTOPPPWAITPROFILSELECTSINTR SUGID SYSTEM TIMEOUT TRACED WAITEDWEXITEXECPWEUPCFSTRACESSTEPSUGIDEXECNOCLDWAITNOZOMBIEINEXECSYSTRACECONTINUEDSWAPINBIGLOCKPROC (%s) pid=%d stat=%s flags=%b pri=%u, usrpri=%u, nice=%d forw=%p, back=%p, list=%p,%p user=%p, vmspace=%p estcpu=%u, cpticks=%d, pctcpu=%u.%u%, swtime=%u user=%llu, sys=%llu, intr=%llu mawn%c%5d %-10.10s %18p %18p %18p plimitplsigaplpauseissignal procfs debuggingpid %d was killed: %s sorry, pid %d was killed: %s coredump%s.corehashinit: bad cntsysctlsysctl_disklockkern_sysctl%s,denied attempt to set clock forward to %ld denied attempt to set clock back %ld seconds nanosleep%9d %2d/%-4d %8x %s ticks now: %d ticks wheel arg func smashed stack in %spreempt: cpu_preempt not yet implementedsetrunnable not configured unsupported >>> %s probe returned %d >>> probing for %s* mapply: no match function for '%s' device>>> %s probe won >>> no winning probe root device %s not configured %s at %s%s (root)config_make_softcconfig_make_softc: allocation for device softc failed%s%dconfig_make_softc: duplicate %sexpandcreatconfig_make_softc: %sing dev arrayconfig_make_softc: device name too long%s detached config_detach: forced detach of %s failed (%d)config_defer: can't defer config of a root deviceconfig_defer: can't allocate defer structurewrit%s%d%c: %s %sing fsbn %d of %d-%d (%s%d bn %d; cn %d tn %d sn %d)disk_attach: can't allocate storage for disklabeldisk_detach: disk_count < 0disk_unbusy: %s: dk_busy < 0 rootdev=0x%x rrootdev=0x%x rawdev=0x%x cannot open disk, 0x%x/0x%x, error %dfilesystem type %d not known.. assuming ffs dk_mountrootcannot read disk label, 0x%x/0x%x, error %droot filesystem has size 0bufq_default_alloc: no memoryintrextentplextntextent_free: start 0x%lx, end 0x%lx extent_free: region not foundFLWANTEDWANTEDNOCOALESCEFIXEDextent `%s' (0x%lx - 0x%lx), flags=%b 0x%lx - 0x%lx extent_print: NULL extentklogmtx_enter: ipl not implementedphpoolpcgpoolpool_init: too much uptimepool_get: %s: page emptypool_put: %s: page header missing page %p, nmissing %d, time %lu,%lu POOL %s: size %u, align %u, ioff %u, roflags 0x%08x alloc %p minitems %u, minpages %u, maxpages %u, npages %u itemsperpage %u, nitems %u, nout %u, hardlimit %u nget %lu, nfail %lu, nput %lu npagealloc %lu, npagefree %lu, hiwat %u, nidle %lu empty page list: full page list: partial-page list: no current page cache %p: allocfrom %p freeto %p hits %lu misses %lu ngroups %lu nitems %lu group %p: avail %d %p no log curpage %p pool(%p:%s): page inconsistency: page %p; at page head addr %p (p %p) pool(%p:%s): page inconsistency: page %p; item ordinal %d; addr %p (p %p) kernel %sassertion "%s" failed: file "%s", line %d%s: table is full panic: splassert: %s: want %d have %d spl assertion failure in %slogprikprintf%llx%llobug in kprintf: bad base0123456789ABCDEF(null)0123456789abcdefaddchangeddbdisableenableexitqfindlistquittimezoneverbosev--- more --- 0%o*UNKNOWN**FOUND*%3d free slot (for add) Unknown devno (max is %d) %3d at disable %s flags 0x%x ???%3d %s count %d (pseudo device) %s [] ? Unknown argument %3d can't change free slot change (y/n) ?%3d %s changed flags changed out of memory. alreadyError unknown state %3d can't disable free slot %3d %s can't disable pseudo device %3d can't enable free slot %3d %s can't enable pseudo device command args description [count] number of lines before more enter ddbdev add a device8|10|16 base on large numbersdevno|dev change devicesattr val|devno|dev disable devicesattr val|devno|dev enable devicesdevno|dev find devices this message list configuration leave UKC[attr [val]] show attributes (or devices with an attribute)[mins [dst]] set timezone/dst don't know toggle verbose bootingUnknown routine /%c/ Unknown attribute Unknown pseudo routine /%c/ Value missing for attribute %s ? Not same device type No more space for new devices. No device of this type exists. Clone Device (DevNo, 'q' or '?')Insert before Device (DevNo, 'q' or '?')Device not complete number or * is missing Argument expected Dev expected 8|10|16 expected DevNo or Dev expected Attr, DevNo or Dev expected timezone = %d, dst = %d Unknown command disautoconf verbose %sabled Unknown command, try help User Kernel Config UKC> Continuing... sys_ioctlselectpipelkpiperdpipewrpipeclpipeplttckoutqttwritettyrub: would panic c = %d, val = %d load: %d.%02d not a controlling terminal no foreground process group runningrunnableiowait cmd: %s %d [%s] %ld.%02ldu %ld.%02lds %d%% %ldk empty foreground process group putc: required clalloc b_to_q: required clalloc WARNING: mclpool limit reached; increase kern.maxclustersmbplmclplm_copym0: null mbufm_copym0: m == NULL and not COPYALLm_copym0: off %d, len %dm_copydata: off %d < 0m_copydata: null mbuf in skipm_copydata: null mbufm_copydata: len %d < 0m_apply: len %d < 0m_apply: null mbuf in skipm_apply: null mbufm_apply: off %d < 0m == NULL in m_pulldown()unixsockplsoclose: NOFDREFsoaccept: !NOFDREFsbappendaddrsbappendcontrolsemi-panic: sbcompresssbdropsbcreatecontrol: message too large %d acceptuipc 1uipc 2uipc 4uipc 3piusrrequnp_attachunp_bindunp_connect2unp_disconnectbremfree: lost tailbufplgetblkallocbuf: buffer larger than MAXBSIZE requestedgetnewbufbiowaitbiodone alreadynchplcluster_read: DONE bpcluster_callback: too little memoryClustered Block: %d addr %x bufsize: %ld Child Block: %d addr: %x Clustered write to wrong blocksvop_generic_revokealloperation %s not listed in %s. vfs_op_descsvfs_opv_init: bad operationvfs_opv_init: operation vector without default routine.nameilockfpllf_findoverlap: defaultrelookup: null namerelookup: lookup on dot-dotvnodesvfslock%s_mountroot failed: %d vnodefree vnodefree vnode isn'tvgetvrele: cannot lockvclean: deadlockvclean: cannot reclaimvclean: not cleanvgonemissing bdevvgonel: not cleanmissing aliasVNONVREGVDIRVBLKVCHRVLNKVSOCKVFIFOVBADtype %s, usecount %u, writecount %u, holdcount %u,vprint flags (%s)|VALIASED|VBIOONSYNCLIST|VBIOONFREELIST|VBIOWAIT|VXWANT|VXLOCK|VSYSTEM|VTEXT|VROOTkinfo: vp changed WARNING: some file systems would not unmount retrying unmount of %s failed with error %d syncing disks... giving up done softdep vwakeup: neg numoutputvinvalbufvinvalbuf: flush failedvinvalbuf: dirty bufsvflushbufvflushbuf: dirtyvflushbuf: not dirtybgetvp: not freebrelvp: NULLsyncersched_sync: fsync failedmounted on: %s syncer vnodesys_mountmount: lost mountunmount: dangling vnodesys_statfssys_fstatfssys_getfsstatsys_getfhsys_fhopensys_fhstatsys_fhstatfsvn_lockvop_islockedvop_lookupvop_createvop_mknodvop_openvop_closevop_accessvop_getattrvop_setattrvop_readvop_writevop_leasevop_ioctlvop_pollvop_kqfiltervop_revokevop_fsyncvop_removevop_linkvop_renamevop_mkdirvop_rmdirvop_symlinkvop_readdirvop_readlinkvop_abortopvop_inactivevop_reclaimvop_lockvop_unlockvop_bmapvop_printvop_pathconfvop_advlockvop_reallocblksvop_strategyvop_bwritedead_read: lockdead_write: locktag VT_NON, dead vnode dead_badop calledchkvnlockfifowfifortag VT_NON, fifo with %ld readers and %ld writersfifo_badop calledspec_read typespec_write typespec_ioctlspec_fsyncspec_fsync: not dirtyspec_close: not specialtag VT_NON, dev %d, %d spec_badop calleddos2unixtime(): month value out of range (%ld) denodedeget(): pcbmap returned %d detrunc(): can't truncate root directory, clust %ld, offset %ld deextend: file too largemsdosfs_reclaim(): pushing activemsdosfs_inactive(): pushing activeextendfile(): attempt to extend root directory extendfile: pcbmapmsdosfs_lookup. .. doscheckpath(): .. not a directory? RRaArrAamsdosfs_sync: rofs mod dev %d, %d, %s msdosfs_createmsdosfs_write(): bad file typemsdosfs_renamemsdosfs_rename: lost to startdirmsdosfs_rename: lost from startdirmsdosfs_rename: updating .. in root directory?msdosfs_mkdirmsdosfs_readdir.msdosfs_strategy: spectag VT_MSDOSFS, startcluster %ld, dircluster %ld, diroffset %ld (LOCKED)bpf_detachd: descriptor not in listbpf: ifpromisc failedbpfbpfwritebpf_mcopybpfattachtoo many interfacesif_attachhead: mallocif_attach: mallocif_clone_listifioctlifconfif_getgroupif_getgroupmembersegressif_group_egress_buildifpromisc%s: can't handle af%d lo%dlooutput: no header mbufifmedia_add: can't malloc entryifmedia_set: no match for 0x%x/0x%x ifmedia_set failedrn_addmask: mask impossibly already in tree Mask for route not entered Non-unique normal route, mask not entered rn_delete: inconsistent annotation rn_delete: couldn't find our annotation rn_delete: couldn't find us %s %p at %p rn_delete: Orphaned Maskrn_init: radix functions require max_keylen be set rn_initrn_init 2raw_usrreqrtentplrtfreertfree: %p not freed (neg refs) rtfree 2ifafreertrequest deletertinit: wrong ifa (%p) was (%p) rttmrplrt_timer_queue_destroy: rtq_count reached 0 rt_timer_remove_all: rtq_count reached 0 rt_timer_add: rtq_count reached 0 rt_timer_timer: rtq_count reached 0 route_outputroutearp_rtrequest: bad gateway value arp_rtrequest: malloc failed arprequestarpresolve: can't allocate llinfo arpintrarp: attempt to add entry for %s on %s by %s on %s in_arpinputarp: attempt to overwrite entry for %s on %s by %s on %s arp info overwritten for %s by %s on %s arp: attempt to overwrite permanent entry for %s by %s on %s duplicate IP address %s sent from ethernet address %s arp: ether address is broadcast for IP address %s! arptfreearplookup: unable to enter address for %s revarprequestrevarp[NULL][ ifa_addr= ifa_dsta= ifa_mask= flags=0x%x, refcnt=%d, metric=%d la_rt=%p la_hold=%p, la_asked=0x%lx rtentry=%p flags=0x%x refcnt=%d use=%ld expire=%ld key= mask= gw= ifp=%p (%s) ifa=%p genmask= gwroute=%p llinfo=%p (NULL)Route tree for AF_INET (not initialized) in_controlinvalid argument to in_lifaddr_ioctlin_ifinitin_addmultiin_delmultiin_pcbinit: hashinit failedin_pcbinit: hashinit failed for lportinpcbplIPv6 pcb passed into in_pcbconnectinterneticmp_erroricmp lenicmp_reflecticmp_mtudisc_timeouticmp_mtudisc_timeout: bad route to timeouticmp_redirect_timeout: bad route to timeout%d.%d.%d.%dipqeplaeshmac-sha1deflateip_initip_outputip_setmoptionsrip_attachrip_detachrip_usrreqtcp_inputm_pulldown malfunctiontcp_pulloutofbandsynpltcp_outputtcp_output REXMTtcpcbpltcpqepltcp_inittcp_respondtcp_ctlinputtcp6_mtudisc_callbacktcp_timer_rexmttcp_usrreqtcp_identudp_inputudp6_ctlinputudp_usrreqipip_input: should never reach hereetherip_inputMD5Finalrpc denied, status=%d rpc denied, error=%d RPC timeout for server 0x%x krpc_call: sosend: %d bind failed nfsbioread: type %x unexpected nfsbioreadnfsvinvalnfs_doio: type %x unexpected Process killed due to text file modification nfs_boot: using network interface '%s' nfs_boot: socreate, error=%dnfs_boot: GIFFLAGS, error=%dnfs_boot: SIFFLAGS, error=%drevarp failed, error=%dnfs_boot: client_addr=%s nfs_boot: set if addr, error=%dnfs_boot: server_addr=%s hostname=%s nfs_boot_initnfs_boot: bootparam whoami, error=%dnfs_boot: no suitable interfacenfs_boot: bootparam get %s: %d nfs_boot: mountd %s, error=%d nfs_boot_getfhnfs_boot: portmap NFS/v2, error=%d nfs_boot: bootparam_whoami: bad reply nfs_boot: bootparam_getfile: bad reply nfs_hashlocknfsnodeplnfs_inactive: pushing activenfs_reclaim: pushing activenfskqlcknfskqpwnfskqdetnfskqpollnfsconnfscon sotypenfs send error %d for server %s nfsd send error %d receive error %d from nfs server %s Egad!! short receive (%d/%d) from nfs server %s %s (%d) from nfs server %s impossible packet lengthnfsreply nilnqnfstrynfs_requestis alive againnot respondingnfsndlcknfs sndunlocknfsrcvlknfs rcvunlockKerb nickname short Kerb nick verifier bad Bad kerb verifier Not fullname kerb verifier nfs server %s: %s build > MLENnfs S too bignfsreqplnqnfstimrcld kerbnfsd initnfsidlnfsionfsauth1nfsauth2nfs_mountroot: root/root on %s nfs_mountroot: getattr for rootswap on device 0x%x nfs_mountrootswap/swapswap on %s nfs_mountroot: getattr for swap WARNING: no swap nfs_mountroot: can't setup swap vpnfsnfs_mount_diskless: vfs_rootmountalloc failednfs_mountroot: mount %s failed: %dnfs_args: retrying connect nfs_mountnfsdismnfs: writerpc iovcnt > 1nfs_remove: no namenfs_remove: bad v_usecountnfs_rename: no namenfs readdirrpc bad uioEEK! readdirrpc resid > 0 nfs readdirplusrpc bad uioEEK! readdirplusrpc resid > 0 .nfsA%05x4.4nfs physio/asyncnfs_fsyncnfsfsyncnfs_fsync: not dirtytag VT_NFS, fileid %ld fsid 0x%lxbwrite: buffer is not busy???file system full %s: write failed, file system is full ffs_realloccg: bad blockno%s: optimization changed from SPACE to TIME dev = 0x%x, optim = %d, fs = %s ffs_realloccg: bad optim%s: optimization changed from TIME to SPACE dev = 0x%x, bsize = %d, bprev = %d, fs = %s ffs_realloccg: bad bprevfree inode %s/%d had %d blocks out of inodes %s: create/symlink failed, no inodes free mode = 0%o, inum = %d, fs = %s ffs_valloc: dup allocpos = %d, i = %d, fs = %s ffs_alloccgblk: can't find blk in cylffs_alloccgblk: cyl groups corruptedffs_clusteralloc: lost blockffs_nodealloccg: block not in mapcg = %d, irotor = %d, fs = %s ffs_nodealloccg: map corrupteddev = 0x%x, bsize = %d, size = %ld, fs = %s ffs_blkfree: bad sizebad block %d, ino %u bad blockdev = 0x%x, block = %d, fs = %s ffs_blkfree: freeing free fragffs_blkfree: freeing free blockdev = 0x%x, ino = %u, fs = %s ffs_freefile: range: dev = 0x%x, ino = %d, fs = %sffs_freefile: freeing free inodebno = %d, fs = %s ffs_alloccg: block not in mapstart = %d, len = %d, fs = %s ffs_alloccg: map corrupteduid %u on %s: %s ffs_balloc: blk too bigCould not unwind indirect block, error %dffs_update: bad link cntffs_truncate: newspaceffs_indirtrunc: bad buffer sizeffs_isblockffs_clrblockffs_setblockffs_isfreeblocksoftdep_flushfiles calledsoftdep_setup_inomapdep calledsoftdep_setup_blkmapdep calledsoftdep_setup_allocdirect calledsoftdep_setup_allocindir_page calledsoftdep_setup_allocindir_meta calledsoftdep_setup_freeblocks calledsoftdep_freefile calledsoftdep_setup_directory_add calledsoftdep_change_directoryentry_offset calledsoftdep_setup_remove calledsoftdep_setup_directory_change calledsoftdep_change_linkcnt calledsoftdep_load_inodeblock calledsoftdep_update_inodeblock calledsoftdep_slowdown calledffs_mountroot: can't setup bdevvp's ffsWARNING: %s was not properly unmounted WARNING: R/W mount of %s denied. Filesystem is not clean - run fsck WARNING: soft updates isn't compiled in ffs_reload: dirty2ffs_reload: dirty1no UFS2 support ffs_statfsupdate: rofs modffsino%s: typeffs_write%s: nonsync dir writeffs_fsyncffs_fsync: not dirtyffs_inactive: pushing activeufs_reclaim: pushing activei_ffs_size too smallmangled entry%s: bad dir ino %d at offset %d: %s bad dirFirst bad Second bad ufs_direnter: newblkufs_direnter: compact1ufs_direnter: compact2checkpath: .. not a directory chown: lost quotaufs_linkufs_renameufs_rename: lost to startdirrename: EXDEVufs_rename: same fileufs_rename: lost dir entryufs_rename: lost from startdirufs_mkdirufs_readdir: lost in spaceufs_strategy: spectag VT_UFS, ino %d, on dev %d, %d flags 0x%x, effnlink %d, nlink %d mode 0%o, owner %d, group %d, size %lldufs_makeinodemode = 0%o, nlinks %d, inum = %d, fs = %s ext2fs_valloc: dup allocext2fs_nodealloccg: block not in mapcg = %d, ipref = %d, fs = %s ext2fs_nodealloccg: map corruptedbad block %d, ino %d dev = 0x%x, ino = %d, fs = %s ifree: range: dev = 0x%x, ino = %d, fs = %sifree: freeing free inodeext2fs_mapsearch: block not in mapext2fs_alloccg: map corrupteduid %d on %s: %s ext2fs_inactive: pushing activeext2fs_indirtrunc: bad buffer sizeext2fs_readdiri_size too smallrec_len is smaller than minimalrec_len % 4 != 0reclen is too small for name_lendirectory entry across blocksinode out of boundsbad directory entry: %s offset=%d, inode=%lu, rec_len=%d, name_len=%d ext2fs_dirbadentryext2fs_direnter: newblkext2fs_direnterext2fs_direnter: frag sizecheckpathext2fs_writeext2fs_mountroot: can't setup bdevvp'sext2fs%s: file system not clean; please fsck(8) ext2fs_reload: dirty2ext2fs_reload: dirty1ext2fs_statfsExt2 fs: unsupported inode size Ext2 fs: unsupported optional feature ext2fs_rename: lost to startdirrename: linked directoryext2fs_rename: lost dir entryext2fs_rename: mangled dirext2fs_rename: lost from startdirext2fs_mkdir: blksizeext2fs_reclaim: pushing activeamap_lookup: offset out of rangeamap_lookups: offset out of rangeamap_add: offset out of rangeamap_add: replacing null anonamap_add: slot in useamap_unadd: offset out of rangeamap_unadd: nothing thereamapplamap_wipeout: corrupt amapcownowpagecownowamap_cow_now: non-resident wired page in anon %pamap_splitref: split at zero offsetamap_splitref: map size check failedamap_pp_adjref: overshot targetamap_pp_adjref: negative reference countuvm_anon_add: can not allocate %d anons uvm_anon_adduao_set_swslot: uobj = %p uao_set_swslot: attempt to set a slot on a NOSWAP objectuao_create: kernel object already allocateduao_create: hashinit swhash faileduao_create: malloc swslots faileduao_create: asked to enable swap on kernel objectuaoeltplaobjpluao_flush: strange, got an out of range flush (fixed) uao_flush: weird flagsuao_getuao_getpageudv_attachudv_detachudv_faultfltamapcopyanonget1anonget2flt_noram1flt_pmfail1flt_noram3flt_noram2flt_pmfail2flt_noram4flt_noram5fltagain2uvm_fault_unwire_locked: address not in mapuvm_fault_unwire_locked: unwiring non-wired memoryuvm_fork: uvm_fault_wire failed: %duvm_swapin: uvm_fault_wire failed: %dschedpwaitscheduleruvm_init: page size not setuvm_km_init: could not reserve space for kerneluvm_km_suballoc: unable to allocate space in parent mapuvm_km_suballoc: submap allocation faileduvm_km_suballoc: unable to create submapkm_getwait2km_allockm_alloc1wuvm_km_alloc1: non-released pagevallocwaitkmthreadkmallocvmmaplkuvm_mapent_alloc: out of static map entries, check MAX_KMAPENT (currently %d)# uvm_map() successful calls# uvm_map() back merges# uvm_map() missed forward# map lookup calls# map lookup hint hitsvmspplvmmpeplvmmpekpluvm_map_clean: weird flagsfork: encountered a submap during fork (illegal)fork: non-copy_on_write map entry marked needs_copy (illegal)MAP %p: [0x%lx->0x%lx] #ent=%d, sz=%u, ref=%d, version=%u, flags=0x%x pmap=%p(resident=%d) - %p: 0x%lx->0x%lx: obj=%p/0x%llx, amap=%p/%d submap=%c, cow=%c, nc=%c, prot(max)=%d/%d, inh=%d, wc=%d, adv=%d OBJECT %p: locked=%d, pgops=%p, npages=%d, refs= PAGES : <%p,0x%llx> refs=%d PAGE %p: %b flags=%s, pqflags=%s, vers=%d, wire_count=%d, pa=0x%lx uobject=%p, uanon=%p, offset=0x%llx loan_count=%d [page ownership tracking disabled] >>> ANON DOES NOT POINT HERE <<< (%p) checking pageq list >>> PAGE NOT FOUND ON PAGEQ LIST! <<< uvm_page_printit page found on pageq list anon backpointer is OK checking object list >>> PAGE NOT FOUND ON OBJECT LIST! <<< page found on object list uvm_page_bootstrap: no memory pre-allocateduvm_page_init: lost %ld page(s) in init uvm_page_inituvm_setpagesize: page size not a power of twouvm_pageboot_alloc: out of virtual spaceuvm_pageboot_alloc: out of memoryuvm_pageboot_alloc: pmap_growkernel() faileduvm_page_physget: called _after_ bootstrapuvm_page_physget: out of memory!uvm_page_physload: page size not set!uvm_page_physload: start >= enduvm_page_physload: tried to add RAM after vm_mem_inituvm_page_physload: unable to load physical memory segment %d segments allocated, ignoring 0x%llx -> 0x%llx increase VM_PHYSSEG_MAX uvm_page_physload: bad free list %duvm_page_physrehash: WARNING: could not grow page hash table rehash: physical memory config [segs=%d of %d]: 0x%llx->0x%llx [0x%llx->0x%llx] STRATEGY = BSEARCH number of buckets = %d uvm_pagealloc_strat: bad strat %demergvapager_mappagedaemon: deadlock detected! pgdaemon%s = %d Current UVM status: pagesize=%d (0x%x), pagemask=0x%x, pageshift=%d %d VM pages: %d active, %d inactive, %d wired, %d free min %d%% (%d) anon, %d%% (%d) vnode, %d%% (%d) vtext pages %d anon, %d vnode, %d vtext freemin=%d, free-target=%d, inactive-target=%d, wired-max=%d faults=%d, traps=%d, intrs=%d, ctxswitch=%d softint=%d, syscalls=%d, swapins=%d, swapouts=%d fault counts: noram=%d, noanon=%d, pgwait=%d, pgrele=%d ok relocks(total)=%d(%d), anget(retrys)=%d(%d), amapcopy=%d neighbor anon/obj pg=%d/%d, gets(lock/unlock)=%d/%d cases: anon=%d, anoncow=%d, obj=%d, prcopy=%d, przero=%d daemon and swap counts: woke=%d, revs=%d, scans=%d, obscans=%d, anscans=%d busy=%d, freed=%d, reactivate=%d, deactivate=%d pageouts=%d, pending=%d, nswget=%d nswapdev=%d, nanon=%d, nanonneeded=%d nfreeanon=%d swpages=%d, swpginuse=%d, swpgonly=%d paging=%d kernel pointers: objs(kern/kmem)=%p/%p swapsysuvm_swap_init: can't get vnode for swap deviceswapmapswp vnxswp vnduvm_swap_init: extent_create failedswapdrum_addsys_swapctlswapctl: copystrswapctl: miniroot copy failedswap0x%04xswap_on: miniroot larger than swap?Preserved %d pages of miniroot leaving %d pages of swap swap_on: unable to preserve minirootdisklabel regionswap_off: swapdev not in listswstrategy: vnode type 0x%xsw_reg_strategy: swap to sparse filewarning: resource shortage: %d pages of swap lost swapmount: no device swapmount: no device 2 swap_deviceswapmount: copystrsbrk: grow %ld failed, error = %d uvm_coredump: user process with submap?uvm_deallocate with null mapuvnsyncuvn_attach: blocked at %p flags 0x%x uvn_attachuvn_termuvm_vnp_terminate: io sync wanted bit setuvn_releasepg: kill flag set on referenced object!uvn_flush: obj=%p, offset=0x%llx. error during pageout. uvn_flush: WARNING: changes to page may be lost! uvn_flushuvn_cluster: offset out of rangeuvn_getuvn_getpageuvn_iosyncrd%d: fixed, %d blocks NULL pointer passed to ip_ecn_ingressNULL pointer passed to ip_ecn_egressNULL pointer passed to ip6_ecn_ingressNULL pointer passed to ip6_ecn_egressin6_pcbconnectin6_pcbnotifyin6_ifloop_requestADDDELETEin6_ifloop_request: %s operation failed for %s (errno=%d) in6_controlnd6_prelist_add succeeded but no prefix prefix ioctls are now invalidated. please use ifconfig. in6_update_ifain6_update_ifa: addmulti failed for %s on %s (errno=%d) in6_update_ifa: failed to remove a route to the old destination: %s in6_update_ifa: the prefix length of an existing (%s) address should not be changed in6_update_ifa: valid lifetime is 0 for %s in6_update_ifa: prefixlen should be 128 when dstaddr is specified in6_update_ifa: a destination can be specified for a p2p or a loopback IF only in6_purgeaddr: failed to remove a route to the p2p destination: %s on %s, errno=%d Couldn't unlink in6_ifaddr from in6_ifaddr in6_unlink_ifa: autoconf'ed address %p has no prefix invalid argument to in6_lifaddr_ioctlin6_savemkludge: no kludge spacein6_addmultiin6_delmultiin6_are_prefix_equal: invalid prefix length(%d) in6_prefixlen2mask: invalid prefix length(%d) in6_prefixlen2maskin6_ifawithscope: output interface is not specified get_rand_ifid%s: interface identifier generated by random number %s: ifid: %02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x %s: failed to get interface identifier %s: borrow interface identifier from %s %s: got interface identifier from %s %s: got interface identifier from itself in6_ifattach_linklocalin6_ifattach_linklocal: failed to configure a link-local address on %s (errno=%d) %s: no ifid available in6_ifattach_loopbackin6_ifattach_loopback: failed to configure the loopback address on %s (errno=%d) in6_nigroupin6_ifattach: %s has too small MTU, IPv6 not enabled in6_ifattachin6_ifattach: %s is not multicast capable, IPv6 not enabled in6_ifdetach%s: didn't unlink in6ifaddr from list in6_cksum: mbuf len (%d) < off+len (%d+%d)in6_cksum: out of datainternet6icmp6_mtudisc_callback_registerENOBUFS in icmp6_error %d icmp6_input: unknown type %d(src=%s, dst=%s, ifid=%d) ICMP6 checksum error(%d|%x) %s icmp6_notify_erroricmp6_notify_error: in6_embedscope failed icmp6_mtudisc_updateni6_inputicmp6_rip6_inputicmp6_reflecticmp6_reflect: source can't be determined: dst=%s, error=%d /usr/src/sys/netinet6/icmp6.csanity fail: off=%lx, sizeof(ip6)=%lx in %s:%d (src=%s dst=%s tgt=%s)icmp6_redirect_inputICMP6 redirect sent from %s rejected; must be from linklocal ICMP6 redirect sent from %s rejected; hlim=%d (must be 255) ICMP6 redirect rejected; no route with inet6 gateway found for redirect dst: %s ICMP6 redirect rejected; neither router case nor onlink case: %s icmp6_redirect_input: lladdrlen mismatch for %s (if %d, icmp6 packet %d): %s icmp6_redirect_input: invalid ND option, rejected: %s ICMP6 redirect rejected; redirect dst must be unicast: %s ICMP6 redirect rejected; not equal to gw-for-src=%s (must be same): %s ICMP6 redirect rejected; no route found for redirect dst: %s icmp6_redirect_outputicmp6_mtudisc_timeout: bad route to timeouticmp6_redirect_timeout: bad route to timeoutip6_initip6_input: packet to an unready address %s->%s ip6_savecontrolip6_nexthdrip6_nexthdr: m == NULLOpenBSD-currentcannot forward from %s to %s nxt %d received on %s cannot forward src %s, dst %s, nxt %d, rcvif %s, outif %s ip6_mrouter_doneadd_m6ifregister_mifdel_m6ifadd_m6fc: %s o %s g %s p %x dbx %p multiple kernel entriesdel_m6fcip6_mforward: ip6_mrouter socket queue full ip6_outputassumption failed: hdr not splitip6_setmoptionsip6_setpktoptionsip6_rthdr0nd6_init called more than once(ignored) nd6_setmtu0: new link MTU on %s (%lu) is too small for IPv6 ndopts == NULL in nd6_optionuninitialized ndopts in nd6_optionndopts == NULL in nd6_optionsduplicated ND6 option found (type=%d) too many loop in nd opt nd6_options: unsupported option %d - option ignored uninitialized ndopts in nd6_optionsln->ln_rt == NULLln->ln_rt->rt_ifp == NULLrt_llinfo(%p) is not equal to ln(%p)dst=0 in nd6_timer(ln=%p)nd6_lookupunspecnd6_lookup: failed to lookup %s (if = %s) nd6_freend6_rtrequestnd6_rtrequest: bad gateway value: %s %s: failed to join %s (errno=%d) nd6_rtrequest: malloc failed nd6_ioctla router(%s) advertises a prefix with non-link local address default router list contains a non-linklocal address(%s) ifp == NULL in nd6_cache_lladdrfrom == NULL in nd6_cache_lladdrnd6_output: can't allocate llinfo for %s (ln=%p, rt=%p) nd6_storelladdr: something odd happens nd6_storelladdr: sdl_alen == 0, dst=%s, if=%s scope error in prefix list (%s) nd6_ns_inputnd6_ns_input: src=%s nd6_ns_input: dst=%s nd6_ns_input: tgt=%s nd6_ns_input: invalid hlim (%d) from %s to %s on %s nd6_ns_input: bad DAD packet (wrong ip6 dst) nd6_ns_input: lladdrlen mismatch for %s (if %d, NS packet %d) nd6_ns_input: duplicate IP6 address %s nd6_ns_input: bad DAD packet (link-layer address option) nd6_ns_input: invalid ND option, ignored nd6_ns_input: bad NS target (multicast) nd6_ns_outputnd6_ns_output: source can't be determined: dst=%s, error=%d nd6_na_inputnd6_na_input: invalid hlim (%d) from %s to %s on %s nd6_na_input: duplicate IP6 address %s nd6_na_input: lladdrlen mismatch for %s (if %d, NA packet %d) nd6_na_input: invalid ND option, ignored nd6_na_input: a solicited adv is multicasted nd6_na_input: invalid target address %s nd6_na_outputnd6_na_output: source can't be determined: dst=%s, error=%d %s: starting DAD for %s nd6_dad_start: memory allocation failed for %s(%s) ???nd6_dad_start: called with non-tentative address %s(%s) nd6_dad_start: ifa->ifa_ifp == NULLnd6_dad_timer: called with null parameter %s: DAD complete for %s - no duplicates found %s: could not run DAD, driver problem? nd6_dad_timer: called with non-tentative address %s(%s) nd6_dad_timer: called with duplicated address %s(%s) nd6_dad_timer: DAD structure not found nd6_dad_duplicated: DAD structure not found %s: DAD detected duplicate IPv6 address %s: NS in/out=%d/%d, NA in=%d %s: DAD complete for %s - duplicate found %s: manual intervention required nd6_dad_ns_input: ignoring DAD NS packet for address %s(%s) ifa == NULL in nd6_dad_ns_inputifa == NULL in nd6_dad_na_inputnd6_rs_inputnd6_rs_input: invalid hlim (%d) from %s to %s on %s nd6_rs_input: lladdrlen mismatch for %s (if %d, RS packet %d) nd6_rs_input: invalid ND option, ignored nd6_ra_inputnd6_ra_input: invalid hlim (%d) from %s to %s on %s nd6_ra_input: src %s is not link-local nd6_ra_input: lladdrlen mismatch for %s (if %d, RA packet %d) nd6_ra_input: bogus mtu mtu=%lu sent from %s; exceeds maxmtu %lu, ignoring nd6_ra_input: bogus mtu option mtu=%lu sent from %s, ignoring nd6_ra_input: invalid option len %d for prefix information option, ignored nd6_ra_input: invalid prefix len %d for prefix information option, ignored nd6_ra_input: invalid prefixlen %d for rfc2374 prefix %s, ignored nd6_ra_input: invalid prefix %s, ignored nd6_ra_input: invalid ND option, ignored defrouter_addreqdefrouter_delreqdefrouter_select: called unexpectedly (forwarding=%d, accept_rtadv=%d) defrouter_select: more than one router is installed nd6_prelist_add: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_remove: failed to make %s/%d offlink on %s, errno=%d prelist_update: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_update: nd6_prelist_add failed for %s/%d on %s errno=%d, returnpr=%p pfxlist_onlink_check: failed to make %s/%d offlink, errno=%d nd6_prefix_onlinknd6_prefix_onlink: failed to add route for a prefix (%s/%d) on %s, gw=%s, mask=%s, flags=%lx errno = %d nd6_prefix_onlink: failed to find any ifaddr to add route for a prefix(%s/%d) on %s nd6_prefix_onlink: %s/%d is already on-link nd6_prefix_offlinknd6_prefix_offlink: failed to recover a prefix %s/%d from %s to %s (errno = %d) nd6_prefix_offlink: failed to delete route: %s/%d on %s (errno = %d) nd6_prefix_offlink: %s/%d is already off-link in6_ifaddin6_ifadd: failed to make ifaddr %s on %s (errno=%d) in6_ifadd: wrong prefixlen for %s (prefix=%d ifid=%d) in6_init_prefix_ltimes: preferred lifetime(%d) is greater than valid lifetime(%d) rip6_inputrip6_outputrip6_attachrip6_usrreqrip6_detachudp6_outputspsrr1r2r3r4r5r6r7r8r9r10r11r12usr_spusr_lrsvc_spsvc_lrpcund_spabt_spirq_spFaulted in DDB; continuing... address %p is invalid address 0x%08lx not a valid page framedb_fetch_reg: botchbranch_taken: botchscp=0x%08x rlv=0x%08x ( rsp=0x%08x rfp=0x%08xBad frame pointer: %p Bad user frame pointer: %p %sr%d=0x%08xtrace: pid %d not found swapped out at %p frame address = %08x frame address must be specified spsr=%08x r0 =%08x r1 =%08x r2 =%08x r3 =%08x r4 =%08x r5 =%08x r6 =%08x r7 =%08x r8 =%08x r9 =%08x r10=%08x r11=%08x r12=%08x r13=%08x r14=%08x r15=%08x slr=%08x mainbuscpufootbridgemainbus_bs_alloc(): Help!mainbus_bs_free(): Help!%s, #0x%03x-imbimbrangeswiblxblmulSnmsmlaSnmsdumullSdnmssmullumlalsmlalstrtdaWldrtstrbtldrbtstrldrstrbldrbstmYnWlldmXnWlldrsbldrhstrhldrshswpdmoswpbmrsdpmsrpFmpF2bxclzdmbkptSdn2eorsubrsbadcsbcrsctstDn2teqcmpcmnorrmovSd2bicmvnadfPRfghmufsufrsfdvfrdfpowrpwrmffmlfdvfrdpolfpbopmvfPRfhmnfrndsqtloglgnexpsincostanasnacsatnfpuopstfQLvldffltPRgdfixPRdhwfsrfswfcrfccmfPRghcnfcmfecnfemcr2#zmcrmrc2mrccdp2#ycdpldc2L#vldcstc2stcund%s %08x %s%s#0x%08xp%d_f%d#%s[r%d]cpsr[%c - unknown]%d, c%d, c%d, c%d, %dr%d, c%d, c%d, %d, rrx, %s r%d, %s #%d{r%d-r%d}^[r%d#0x%02xf%d, c%d, No support for this CPU type (%08x) in kernelcpu.cachecpu.nocachesa110.cachesa110.icachesa110.dcachecpu.writebufcpu.nowritebufsa110.writebufUndefined instruction in kernel Warning IRQ's disabled during boot() real mem = %u (%uK) cpu_startup: system table size inconsistencycpu_startup: cannot allocate UVM space for buffersavail mem = %lu (%uK) using %d buffers containing %u bytes (%uK) of memory cpu_startup: not enough memory for buffer cachecpu_startup: no room for system tables; %d bytes required_bus_dmamap_load_raw: not implemented_bus_dmamap_sync: mix PRE and POSTunknown buffer type %d _bus_dmamap_sync_bus_dmamap_sync: ARM32_BUFTYPE_INVALID_bus_dmamap_sync: ARM32_BUFTYPE_RAW_bus_dmamem_map: size botch%s: SA-110 with bugged STM^ instruction rev 0rev 1rev 2rev 3rev 4rev 5rev 6rev 7rev 8rev 9rev 10rev 11rev 12rev 13rev 14rev 15step Jstep Kstep Sstep Tstep Bstep Cstep Dstep Erev 10step Gstep A-0step B-0step B-1step B-2step B-3step B-4step B-5(IXP1200 step A)(IXP1200 step B)(IXP1200 step C)(IXP1200 step D)(IXP1240/1250 step A)(IXP1240 step B)(IXP1250 step B)step A-1step C-0step D-0step 0ARM600ARM610ARM620ARM700ARM710ARM7500ARM710aARM7500FEARM710TARM720TARM740T (8 KB cache)ARM740T (4 KB cache)ARM810ARM920TARM922TARM940TARM946E-SARM966E-STI ARM925TARM1020EARM1022E-SSA-110SA-1100SA-1110IXP1200i80200i80321 400MHzi80321 600MHzPXA250PXA210PXA27xIXP425 533MHzIXP425 400MHzIXP425 266MHzunknownCPU_ARM2ARM2asCPU_ARM250CPU_ARM3CPU_ARM6CPU_ARM7CPU_ARM7TDMICPU_ARM8ARM9TDMIARM9E-SARM10ECPU_ARM10SA-1CPU_SA110XScaleCPU_XSCALE_...wr-thruwr-back**unknown 3****unknown 4**wr-back-lockwr-back-lock-Awr-back-lock-B**unknown 8****unknown 9****unknown 10****unknown 11****unknown 12****unknown 13****unknown 14****unknown 15** IDC disabled IDC enabled WB disabled WB enabled LABT EABT%s: %dKB/%dB %d-way %s unified cache %s: %s does not fully support this CPU. %s: This kernel does not fully support this CPU. %s: Recompile with "options %s" to correct this. %s: %dKB(%db/l,%dway) I-cache, %dKB(%db/l,%dway) %s D-cache branch prediction enabled DC disabled DC enabled IC disabled IC enabledunknown CPU (ID = 0x%x)%s %s (%s core)Processor failed probe - no CPU ID Vector ExceptionAlignment Fault 1Terminal ExceptionAlignment Fault 3External Linefetch Abort (S)Translation Fault (S)External Linefetch Abort (P)Translation Fault (P)External Non-Linefetch Abort (S)Domain Fault (S)External Non-Linefetch Abort (P)Domain Fault (P)External Translation Abort (L1)Permission Fault (S)External Translation Abort (L2)Permission Fault (P) uvm_fault(%p, %lx, %x, 0) -> %x UVM: pid %d (%s), uid %d killed: out of swap Non-emulated page fault with intr_depth > 0 data_abort_fault: Misaligned Kernel-mode Program Counter kerneluserFatal %s mode data abort: '%s' trapframe: %p FSR=%08x, FAR=r0 =%08x, r1 =%08x, r2 =%08x, r3 =%08x r4 =%08x, r5 =%08x, r6 =%08x, r7 =%08x r8 =%08x, r9 =%08x, r10=%08x, r11=%08x r12=%08x, usp=%08x, ulr=%08xssp=%08x, slr=%08x, pc =%08x Fatal abortInvalid, Fatal %s mode prefetch abort at 0x%08x trapframe: %p, spsr=%08x badaddr: invalid size (%lu)mmrwpmap_enter: no pv entriespmap_enter: failed to allocate L2 bucketprefetch_abort: page is already mapped - pte=%p *pte=%08x prefetch_abort: pc=%08lx proc=%p process=%s prefetch_abort: far=%08x fs=%x pmap_init_l1: can't get PA of L1 at %ppmapplpvepll2dtblpll2ptpplpmap_bootstrap: WARNING! wrong cache mode for primary L1 @ 0x%lx pmap_bootstrap: WARNING! wrong cache mode for L2 pte @ %p pmap_bootstrap: No L2 for va 0x%x, pa 0x%lxpmap_bootstrap: out of static L2spmap_bootstrap: No L2 for L2 @ va %ppmap_alloc_specials: no l2b for 0x%lxCannot allocate L1 KVMCannot allocate L1 physical pagespmap_map_entry: no L2 table for VA 0x%08lxpmap_map_entry: can't find L2 table for VA 0x%08lxpmap_map_chunk: no L2 table for VA 0x%08lxpmap_map_chunk: can't find L2 table for VA0x%08lxpmap_map_chunk: no L1 table provideduser pmap (%p): pmap_kernel (%p): domain %d, l1 at %p %08lx: %c |0000 |8000 |10000 |18000 |20000 |28000 |30000 |38000 pa 0x%08lx: krw %d kro %d urw %d uro %d %c va 0x%08lx, flags 0x%x dumpconf: bad dumpdev=0x%x dumping to dev %u,%u offset %ld dump device bad aborted from console i/o error device not ready succeeded area improper area unavailable dump to dev %u,%u not possible pagemove: size=%08lxvmapbufvunmapbufisaisaattach: can't map `delay port' irq %d drq %d drq2 %d/%d iomem 0x%x port 0x%xisascan>>> probing for %s%d succeeded >>> probing for %s%d failed >>> probing for %s%d >>> probe for %s* clone into %s%d %s: iosize not repaired by driver >>> probing for %s* finished >>> probing for %s* nonepulsededge-triggeredlevel-triggeredisa_intr_typename: invalid type %dcom_isa_attach: mapping failedkbc selftest: %x pckbc_attach: couldn't map%s: unable to establish interrupt for %s slot %s: using irq %d for %s slot : can't map i/o space %s: overriding IRQ %d to %d %s: warning: can't establish shutdown hook : can't map mem space lemac_isa_probepci bus %d%s: Cannot map registers: DC21285 rev %d serrsdram_paritydata_paritymast_abttarg_abtparityfcom%s: Unrecognised IDfootbridge_intr: ctrl=%08x footbridge_intr: pcistat=%08x footbridge_alloc(): Help!footbridge_free(): Help!footbridge_pci_intr_map: out of range interruptpin %d line %d (%#x) pci_intr_map: no mapping for pin %c isairq %ldirq %ldfootbridge_pci_intr_string: bogus handle 0x%lxNo memoryfootbridge_intr_establish: IRQ %d out of rangestatclockhandler: Statclock overrun clock: hz %d stathz %d profhz %d clock%s: Cannot install timer 1 interrupt handlerstat%s: Cannot install timer 2 interrupt handler/usr/src/sys/arch/arm/arm/softintr.csoftnet_intrhand != NULLsoftintr_establish: unknown soft IPL %d: consoleserial_rx: can't establish soft interrupt%s: Cannot install rx interrupt handler%s: Cannot allocate rx buffer memoryfcomstartfcomcninit: mapping failedfcomcons_alloc(): Help!fcomcons_free(): Help!wd: <%s> %s: %d-sector PIO, LBA, %lluMB, %llu sectors %s: freeze lock command didn't complete wdattach%s: WARNING: unable to establish shutdown hook CHS, %lluMB, %d cyl, %d head, %d sec, %llu sectors LBA48, %lluMB, %llu sectors %s: IDENTIFY failed __wdstart: bad return code from wdc_ata_bio()wddone%s: soft error (corrected) , retrying device faultdevice timeoutST506/MFM/RLLESDI/IDE disk%s: %s wddumpwddump: try againwddump: device timed outwddump: unknown error typewddump: %swddump: drive faultwddump: DMA errorwddump: polled command has been queuedST506wd_get_params: bad return code from ata_get_params%s: flush cache command didn't complete %s: flush cache command: drive fault %s: flush cache command timeout wdc%s:%d:%d: not ready, st=0x%b, err=0x%02x BSYDRDYDWFDSCDRQCORRIDXERR%s:%d:%d: timeout waiting for DRQ, st=0x%b, err=0x%02x %s:%d:%d: bad state %d in _wdc_ata_bio_start _wdc_ata_bio_start: bad state%s:%d:%d: intr with DRQ (st=0x%b) %s:%d:%d: read intr before drq %s:%d:%d: device timeout, c_bcount=%d, c_skip%d %s:%d:%d: bad state %d in wdc_ata_bio_intr wdc_ata_bio_intr: bad statewdc_ata_ctrl_intr: state==RECALrecal%s:%d:%d: %s drive fault error (%x) %s:%d:%d: %s timed out piomodedmamodesetmultino media/write protectedinterface CRC erroraddress mark not foundtrack 0 not foundaborted commandmedia change requestedid not foundmedia changeduncorrectable data errorbad block detected%s %serror not notifiedtodclockClock has gained %d day%c %ld hours %ld minutes %ld secs %sCheck Condition (error %#x) on opcode 0x%x AT BLOCK #: %d (decimal) SENSE KEY: %s off INFO: 0x%x (VALID flag %s) SKSV: %s FRU CODE: 0x%x ASC/ASCQ: %s COMMAND INFO: 0x%x %c Incorrect Length Indicator Set%c EOM Detected%c Filemark Detectedscxsplgetxscannot allocate scsi xs only the first 4,294,967,295 sectors will be used. could not get size scsi_scsi_cmdscsi_execute_xs: invalid return codescbusyunknown error category (0x%x) from scsi driver probe%s(%s:%d:%d): No Additional SenseSoft ErrorNot ReadyMedia ErrorHardware ErrorIllegal RequestUnit AttentionWrite ProtectedBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare ErrorReservedNo Additional Sense InformationFilemark DetectedEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnCleaning RequestedErase Operation In ProgressLocate Operation In ProgressRewind Operation In ProgressSet Capacity Operation In ProgressVerify Operation In ProgressNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Not Ready, Rebuild In ProgressLogical Unit Not Ready, Recalculation In ProgressLogical Unit Not Ready, Operation In ProgressLogical Unit Not Ready, Long Write In ProgressLogical Unit Not Ready, Self-Test In ProgressLogical Unit Not Accessible, Asymmetric Access State TransitionLogical Unit Not Accessible, Target Port In Standby StateLogical Unit Not Accessible, Target Port In Unavailable StateLogical Unit Not Ready, Auxiliary Memory Not AccessibleLogical Unit Not Ready, Notify (Enable Spinup) RequiredLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorLogical Unit Communication CRC Error (ULTRA-DMA/32)Unreachable Copy TargetTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureHead Select FaultError Log OverflowWarningWarning - Specified Temperature ExceededWarning - Enclosure DegradedWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedWrite Error - Recommend ReassignmentCompression Check Miscompare ErrorData Expansion Occurred During CompressionBlock Not CompressibleWrite Error - Recovery NeededWrite Error - Recovery FailedWrite Error - Loss Of StreamingWrite Error - Padding Blocks AddedAuxiliary Memory Write ErrorWrite Error - Unexpected Unsolicited DataWrite Error - Not Enough Unsolicited DataError Detected By Third Party Temporary InitiatorThird Party Device FailureCopy Target Device Not ReachableIncorrect Copy Target Device TypeCopy Target Device Data UnderrunCopy Target Device Data OverrunInvalid Information UnitInformation Unit Too ShortInformation Unit Too LongID CRC Or ECC ErrorUnrecovered Read ErrorRead Retries ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block ReadNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite The DataDe-Compression CRC ErrorCannot Decompress Using Declared AlgorithmError Reading UPC/EAN NumberError Reading ISRC NumberRead Error - Loss Of StreamingAuxiliary Memory Read ErrorRead Error - Failed Retransmission RequestAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRecord Not Found - Recommend ReassignmentRecord Not Found - Data Auto-ReallocatedLocate Operation FailureRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorData Sync Error - Data RewrittenData Sync Error - Recommend RewriteData Sync Error - Data Auto-ReallocatedData Sync Error - Recommend ReassignmentRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data Without ECC - Data RewrittenRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With L-ECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteRecovered Data With ECC - Data RewrittenRecovered Data With LinkingDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationRecovered ID with ECCPartial Defect List TransferInvalid Command Operation CodeAccess Denied - Initiator Pending-EnrolledAccess Denied - No Access rightsAccess Denied - Invalid Mgmt ID KeyIllegal Command While In Write Capable StateObsoleteIllegal Command While In Explicit Address ModeIllegal Command While In Implicit Address ModeAccess Denied - Enrollment ConflictAccess Denied - Invalid LU IdentifierAccess Denied - Invalid Proxy TokenAccess Denied - ACL LUN ConflictLogical Block Address Out of RangeInvalid Element AddressInvalid Address For WriteIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBCDB Decryption ErrorSecurity Audit Value FrozenSecurity Working Key FrozenNonce Not UniqueNonce Timestamp Out Of RangeLogical Unit Not SupportedInvalid Field In Parameter ListParameter Not SupportedParameter Value InvalidThreshold Parameters Not SupportedInvalid Release Of Persistent ReservationData Decryption ErrorToo Many Target DescriptorsUnsupported Target Descriptor Type CodeToo Many Segment DescriptorsUnsupported Segment Descriptor Type CodeUnexpected Inexact SegmentInline Data Length ExceededInvalid Operation For Copy Source Or DestinationCopy Segment Granularity ViolationInvalid Parameter While Port Is EnabledHardware Write ProtectedLogical Unit Software Write ProtectedAssociated Write ProtectPersistent Write ProtectPermanent Write ProtectConditional Write ProtectNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedPower On, Reset, or Bus Device Reset OccurredPower On OccurredSCSI Bus Reset OccurredBus Device Reset Function OccurredDevice Internal ResetTransceiver Mode Changed to Single EndedTransceiver Mode Changed to LVDI_T Nexus Loss OccurredMode Parameters ChangedLog Parameters ChangedReservations PreemptedReservations ReleasedRegistrations PreemptedAsymmetric Access State ChangedImplicit Asymmetric Access State Transition FailedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedCurrent Program Area Is Not EmptyCurrent Program Area Is EmptyIllegal Power Condition RequestPersistent Prevent ConflictPrevious Busy StatusPrevious Task Set Full StatusPrevious Reservation Conflict StatusPartition Or Collection Contains User ObjectsOverwrite Error On Update In PlaceInsufficient Time For OperationCommands Cleared By Another InitiatorIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledCannot Write Medium - Unknown FormatCannot Write Medium - Incompatible FormatCannot Format Medium - Incompatible MediumCleaning FailureCannot Write - Application Code MismatchCurrent Session Not Fixated For AppendCleaning Request RejectedMedium Not FormattedMedium Format CorruptedFormat Command FailedNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorEnclosure FailureEnclosure Services FailureUnsupported Enclosure FunctionEnclosure Services UnavailableEnclosure Services Transfer FailureEnclosure Services Transfer RefusedRibbon, Ink, or Toner FailureRounded ParameterEvent Status NotificationESN - Power Management Class EventESN - Media Class EventESN - Device Busy Class EventSaving Parameters Not SupportedMedium Not PresentMedium Not Present - Tray ClosedMedium Not Present - Tray OpenMedium Not Present - LoadableMedium Not Present - Medium Auxiliary Memory AccessibleSequential Positioning ErrorTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyEnd Of Medium ReachedMedium Magazine Not AccessibleMedium Magazine RemovedMedium Magazine InsertedMedium Magazine LockedMedium Magazine UnlockedMechanical Positioning Or Changer ErrorInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetLogical Unit FailureTimeout On Logical UnitLogical Unit Failed Self-TestLogical Unit Unable To Update Self-Test LogTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has Changedcomponent Device AttachedDevice Identifier ChangedRedundancy Group Created Or ModifiedRedundancy Group DeletedSpare Created Or ModifiedSpare DeletedVolume Set Created Or ModifiedVolume Set DeletedVolume Set DeassignedVolume Set ReassignedReported LUNs Data Has ChangedEcho Buffer OverwrittenMedium LoadableMedium Auxiliary Memory AccessibleRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorData Phase CRC Error DetectedSCSI Parity Error Detected During ST Data PhaseInformation Unit iuCRC Error DetectedAsynchronous Information Protection Error DetectedProtocol Service CRC ErrorSome Commands Cleared By iSCSI Protocol EventInitiator Detected Error Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorInvalid Target Port Transfer Tag ReceivedToo Much Write DataACK/NAK TimeoutNAK ReceivedData Offset ErrorInitiator Response TimeoutLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureErase Failure - Incomplete Erase Operation DetectedCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedSCSI To Host System Interface FailureSystem Resource FailureSystem Buffer FullInsufficient Reservation ResourcesInsufficient ResourcesInsufficient Registration ResourcesInsufficient Access Control ResourcesAuxiliary Memory Out Of SpaceUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change InputOperator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedFailure Prediction Threshold ExceededMedia Failure Prediction Threshold ExceededLogical Unit Failure Prediction Threshold ExceededSpare Area Exhaustion Prediction Threshold ExceededHardware Impending Failure General Hard Drive FailureHardware Impending Failure Drive Error Rate Too HighHardware Impending Failure Data Error Rate Too HighHardware Impending Failure Seek Error Rate Too HighHardware Impending Failure Too Many Block ReassignsHardware Impending Failure Access Times Too HighHardware Impending Failure Start Unit Times Too HighHardware Impending Failure Channel ParametricsHardware Impending Failure Controller DetectedHardware Impending Failure Throughput PerformanceHardware Impending Failure Seek Time PerformanceHardware Impending Failure Spin-Up Retry CountHardware Impending Failure Drive Calibration Retry CountController Impending Failure General Hard Drive FailureController Impending Failure Drive Error Rate Too HighController Impending Failure Data Error Rate Too HighController Impending Failure Seek Error Rate Too HighController Impending Failure Too Many Block ReassignsController Impending Failure Access Times Too HighController Impending Failure Start Unit Times Too HighController Impending Failure Channel ParametricsController Impending Failure Controller DetectedController Impending Failure Throughput PerformanceController Impending Failure Seek Time PerformanceController Impending Failure Spin-Up Retry CountController Impending Failure Drive Calibration Retry CountData Channel Impending Failure General Hard Drive FailureData Channel Impending Failure Drive Error Rate Too HighData Channel Impending Failure Data Error Rate Too HighData Channel Impending Failure Seek Error Rate Too HighData Channel Impending Failure Too Many Block ReassignsData Channel Impending Failure Access Times Too HighData Channel Impending Failure Start Unit Times Too HighData Channel Impending Failure Channel ParametricsData Channel Impending Failure Controller DetectedData Channel Impending Failure Throughput PerformanceData Channel Impending Failure Seek Time PerformanceData Channel Impending Failure Spin-Up Retry CountData Channel Impending Failure Drive Calibration Retry CountServo Impending Failure General Hard Drive FailureServo Impending Failure Drive Error Rate Too HighServo Impending Failure Data Error Rate Too HighServo Impending Failure Seek Error Rate Too HighServo Impending Failure Too Many Block ReassignsServo Impending Failure Access Times Too HighServo Impending Failure Start Unit Times Too HighServo Impending Failure Channel ParametricsServo Impending Failure Controller DetectedServo Impending Failure Throughput PerformanceServo Impending Failure Seek Time PerformanceServo Impending Failure Spin-Up Retry CountServo Impending Failure Drive Calibration Retry CountSpindle Impending Failure General Hard Drive FailureSpindle Impending Failure Drive Error Rate Too HighSpindle Impending Failure Data Error Rate Too HighSpindle Impending Failure Seek Error Rate Too HighSpindle Impending Failure Too Many Block ReassignsSpindle Impending Failure Access Times Too HighSpindle Impending Failure Start Unit Times Too HighSpindle Impending Failure Channel ParametricsSpindle Impending Failure Controller DetectedSpindle Impending Failure Throughput PerformanceSpindle Impending Failure Seek Time PerformanceSpindle Impending Failure Spin-Up Retry CountSpindle Impending Failure Drive Calibration Retry CountFirmware Impending Failure General Hard Drive FailureFirmware Impending Failure Drive Error Rate Too HighFirmware Impending Failure Data Error Rate Too HighFirmware Impending Failure Seek Error Rate Too HighFirmware Impending Failure Too Many Block ReassignsFirmware Impending Failure Access Times Too HighFirmware Impending Failure Start Unit Times Too HighFirmware Impending Failure Channel ParametricsFirmware Impending Failure Controller DetectedFirmware Impending Failure Throughput PerformanceFirmware Impending Failure Seek Time PerformanceFirmware Impending Failure Spin-Up Retry CountFirmware Impending Failure Drive Calibration Retry CountFailure Prediction Threshold Exceeded (false)Low Power Condition OnIdle Condition Activated By TimerStandby Condition Activated By TimerIdle Condition Activated By CommandStandby Condition Activated By CommandPower State Change To ActivePower State Change To IdlePower State Change To StandbyPower State Change To SleepPower State Change To Device ControlLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackPacket Does Not Fit In Available SpaceIllegal Mode For This TrackInvalid Packet SizeVoltage FaultAutomatic Document Feeder Cover UpAutomatic Document Feeder Lift UpDocument Jam In Automatic Document FeederDocument Miss Feed Automatic In Document FeederConfiguration FailureConfiguration Of Incapable Logical Units FailedAdd Logical Unit FailedModification Of Logical Unit FailedExchange Of Logical Unit FailedRemove Of Logical Unit FailedAttachment Of Logical Unit FailedCreation Of Logical Unit FailedAssign Failure OccurredMultiply Assigned Logical UnitSet Target Port Groups Command FailedLogical Unit Not ConfiguredData Loss On Logical UnitMultiple Logical Unit FailuresParity/Data MismatchInformational, Refer To LogState Change Has OccurredRedundancy Level Got BetterRedundancy Level Got WorseRebuild Failure OccurredRecalculate Failure OccurredCommand To Logical Unit FailedCopy Protection Key Exchange Failure - Authentication FailureCopy Protection Key Exchange Failure - Key Not PresentCopy Protection Key Exchange Failure - Key Not EstablishedRead Of Scrambled Sector Without AuthenticationMedia Region Code Is Mismatched To Logical Unit RegionDrive Region Must Be Permanent/Region Reset Count ErrorDecompression Exception Long Algorithm IDSession Fixation ErrorSession Fixation Error Writing Lead-InSession Fixation Error Writing Lead-OutSession Fixation Error - Incomplete Track In SessionEmpty Or Partially Written Reserved TrackNo More Track Reservations AllowedCD Control ErrorPower Calibration Area Almost FullPower Calibration Area Is FullPower Calibration Area ErrorProgram Memory Area Update FailureProgram Memory Area Is FullRMA/PMA Is Almost FullDEFERRED CDBParametersError in %s, Offset %d, bit %dProgress Indicator: %dActual Retry Count: %dASC 0x%02x ASCQ 0x%02xDiagnostic Failure on Component 0x%02xDecompression Exception Short Algorithm ID OF 0x%02xTagged Overlapped Commands (0x%02x = TASK TAG)host adapter code inconsistency unknown error category (0x%x) from host adapter code User command with no ioctl User command with no buf scistrcmdlen too big physio split the request.. cannot proceed DEC RZ55 (C) DECEMULEX MD21/S2 ESDIA00IBMRAID 0662SIBM 0663HIBM0664H3171-S2KZ-CDFRSS2FQUANTUM ELS85S iomegajaz 1GBMICROP4421-07SEAGATEST150176LW0002HPC3725SDCASSONY SDT-5000 3.WangDAT Model 1300 02.4Model 2600 01.7Model 3200 02.2ALPS ELECTRIC CO.,LTD. DC544CSW03DCR-2801TE1.07CREATIVECD3630EAC101FX320Sq01GCD-R580B1.00MATSHITA CR-5741.021.06Memorex CRW-26421.0gNEC CD-ROM DRIVE:2734.21SANYO CRD-256PSANYO CRD-254PSANYO CRD-S54P1.08CD-ROM CDR-S11.70CD-ROM CDR-N161.25UJDCD87301.14scsibusscsibus at %s: %d targets scsibusattach: can't allocate target linksscsibusattach: can't allocate lun linksscsi_probe_busPLEXTORCD-ROM PX-40TS1.01MICROP 1588-15MBSUN0669vendor-uniqueremovablefixed targ %d lun %d: <%s, %s, %s> SCSI%d %d/%s %s%sscsibusprintdirectsequentialprinterprocessorwormcdromscanneropticalchangercommunicationenclosure servicessimplified directscsibusprint: impossible device type offlinescsibusprint: impossible qualifierNEC CD-ROM DRIVE:260cd%s: not queuedcdioctlATAPI CD-ROMSCSI CD-ROMdvd_authdvd_read_physicaldvd_read_copyrightdvd_read_bcasddrive offline%luMB, %lu cyl, %lu head, %lu sec, %lu bytes/sec, %lu sec total%s: not queued, error %d SCSI opticalSCSI disksdgetdisklabel%s: removable disk stopped - not restarting %s: respinning up disk %s: respin of disk failed - %d %s: ..is spinning up...waiting %s: WARNING: cache synchronization failed TDC 3800 ARCHIVE VIPER 2525 25462SANKYO CP525 ANRITSU DMT780 VIPER 150 21247VIPER 150 21531WANGTEK 5099ES SCSI5150ES SCSI5525ES SCSI REV7EXABYTE EXB-8200 263HHP T4000s TANDBERG TDC 3600 ????TEAC MT-2ST/N50 rogue, %s: %sdensity code 0x%x, drive empty or not ready %d-byteprotected blocks, write-%s variable%s: cannot set selected mode %s: bad request, must be multiple of %d %s: bad request, must be between %d and %d %s: not queued %s: block wrong size, %d blocks residual %s: bad residual %d out of %d %s: %d-byte record too big atapiscsiwdc_atapi_start: not ready, st = %02x wdc_atapi_intr_command%s:%d:%d: device timeout waiting to send SCSI packet unexpected data phasezero length transfer requested in data phasedata transfer direction disagreementdata phase where none expecteddata transfer direction disagreement during senseunexpectedly in command phasewdc_atapi_intr: warning: device requesting %d bytes, only %d left in buffer wdc_atapi_intr: warning: reading only %d of %d bytes atapiscsi: Shouldn't get here %s:%d:%d: device timeout, c_bcount=%d, c_skip=%d, status=0x%b, ireason=0x%x Device Reset WaitIdentifyPost-IdentifyPIOMODEunknown state%s:%d:%d: soft reset failed use one of: %s[a-p]parsediskboot_file: '%s' rootconf: device name too longboot device: %s. root device (default %s%c)swap device can't figure root, hope your kernel is right rootconfroot on %s%c boot device not knownboot device: lookup '%s' failed. rebooting... The operating system has halted. Please press any key to reboot. OpenBSD/cats booting ... Incompatible magic number passed in boot args(hd0)wd0diagcan't init serial console @%xinvalid geometrydos partition I/O errordisk label I/O errorno disk labeldisk label corruptedisa_alloc(): Help!isa_free(): Help!stray interrupt %d%s ; stopped loggingintr_alloc: bogus typeintr_establish: bogus irq or typeintr_establish: can't share %s with %sintr_disestablish: bogus irqisa_irqdispatch: %x dsrtc: cannot map I/O space : lithium cell is dead, RTC unreliablemii_attach: phyloc and offloc specifiedmii_activate: phyloc and offloc specifiedmii_activate: DVACT_ACTIVATE%s: config_activate(%d) failedmii_detach: phyloc and offloc specifiedOUI 0x%06x model 0x%04x rev %d at %s phy %dmii_phy_setmedia: MASTER on wrong mediamiiautnsphyDP83840 10/100 PHY: %s, rev. %d qsphyQS6612 10/100 PHYinphyi82555 10/100 PHYi82562EM 10/100 PHYi82562ET 10/100 PHYexphy: 3Com internal media interface %s: ignoring this PHY, non-zero instance exphy_service: can't isolate 3Com PHYukphy: Generic IEEE 802.3u media interface %s: OUI 0x%06x, model 0x%04x, rev. %d %s: no media present dev %d function %dpciprintpci_io_find: bad requestpci_mem_find: bad requestpci_mem_find: bad 64-bit requestmiscellaneousSCSIfloppyIPIethernettoken ringFDDIWorldFipPCMIG Multi ComputingXGAvideoaudiotelephonyflashhostMicroChannelNuBusRACEwaySemi-transparent PCIInfiniBandparallelmulti-port serialmodemGPIBsmartcard8237 DMA8254 timerRTCPCI Hot-Plugdigitizergame portgeneric386486PentiumAlphaPowerPCMIPSCo-processorFirewireACCESS.busSSAFiber ChannelIPMISERCOSCANbusIrDAConsumer IRRFbluetoothbroadband802.11a (5 GHz)802.11b (2.4 GHz)standardTVvoicedatanetwork/computingentertainmentDPIOTime and Frequencysynchronizationmanagementprehistoricmass storagenetworkdisplaymultimediacommunicationssystemdockserial buswirelessI2Osatellite commcryptoDASPundefinedOZ6832 CardBusOZ6836/OZ6860 CardBusOZ68[17]2 CardBusOZ6922 CardBusOZ6933 CardBusOZ69[17]2 CardBusOZ711Mx CardBusOZ711M1 CardBusOZ711E0 CardBus3c9853c9963CRDAG675 (Atheros AR5212)3CRPAG175 (Atheros AR5212)V.90 Modem3c9403c3393c3593c4503c555 100Base-TX3c5753CCFE575BT3CCFE575CT3c590 10Mbps3c595 100Base-TX3c595 100Base-T43c595 10Mbps-MII3CRSHPW796 802.11b3CRWE154G72 802.11g3c556 100Base-TX3c556B 100Base-TX3CCFEM6563CCFEM656B56k Modem3CCFEM656C56k Global Modem3cSOHO-TX3crwe777a AirConnectGig3c900 10Base-T3c900 10Mbps-Combo3c900B 10Mbps3c900B 10Mbps-Combo3c900B 10Mbps-TPC3c900B 10Mbps-FL3c905 100Base-TX3c905 100Base-T43c905B 100Base-TX3c905B 100Base-T43c905B 10/100Mbps-Combo3c905B 100Base-FX3c905C 100Base-TX3c9201 100Base-TX3c920B-EMB-WNM3cSOHO 100B-TX3c980 100Base-TX3c980C 100Base-TX3cr9903cr990-TX3cr990-TX-953cr990-TX-973c990b-TX-M3cr990-FX3cr990SVR953cr990SVR973c990BSVRVoodooVoodoo2BansheeVoodoo3Voodoo5300SX500TXDeltaPermedia500MXPermedia 2Oxygen GVX1Permedia 3Escalade IDE RAIDFE2500 10/100PCM200 10/100FE2000VX 10/100FE2500MX 10/100PC4800 WirelessPCI35x WLANPC4500 WirelessMPI-350 WirelessACCM 2188 VL-PCI2051 PCI2051 ISAATP850U/UFATP860ATP860-AATP865-AATP865-RAEC6710AEC6712UWAEC6712UAEC6712SAEC6710DAEC6715UWMPX 5030/5038EN2242EN1217rtl8139RhineIIAWA-100M1435 VL-PCIM1445 VL-PCIM1449 ISAM1451 PCIM1461 PCIM1489 PCIM1523 PCIM1523 ISAM1531 PCIM1533 ISAM1535 PCIM1543 ISAM1541 PCIM1621 PCIM1647 PCIM3309 MPEGM4803M5219 UDMA IDEM5229 UDMA IDEM5237 USBM5247 AGP/PCI-PCIM5243 AGP/PCI-PCIM5451 AudioM5457 ModemM7101 PowerAL981AN983AN985ADM8211 WLANAIC-7810AHA-2940AU/CNAHA-2930CUAIC-7850AIC-7855AIC-5900 ATMAIC-5905 ATMAPA-1480AIC-7860AHA-2940AUAIC-7870AHA-2940AHA-3940AHA-3985AHA-2944AIC-7880AHA-2940UAHA-3940UAHA-398XUAHA-2944UAHA-2940UWProAIC-6915AIC-7895AHA-2940U2 U2AHA-2930U2 U2AAA-131U2 U2AIC-7890/1 U2AIC-7892 U160AHA-29160 U160AHA-19160B U160AHA-3950U2B U2AHA-3950U2D U2AIC-7896/7 U2AHA-3960D U160AIC-7899BAIC-7899DAIC-7899FAIC-7899 U160AAC-2622ASR-2200SASR-2120SAAC-364AAC-3642Dell PERC 2/QCAIC-7901 U320AHA-29320A U320AHA-29320LP U320AIC-7901A U320AHA-29320 U320AHA-29320B U320AIC-7902 U320AIC-7902B U320AHA-39320 U320AHA-39320B U320AHA-39320A U320AHA-39320D U320AHA-39320DB U3201200A1200BABP-930/40UAABP-940UWASP-3940U2WASP-3940U3WWaikato Dag3.2Endace Dag3.5Endace Dag4.22GEEndace Dag4.23AT22AT24AcenicAcenic CopperBCM5700BCM5701AC1000AC1001AC9100AMD64 HyperTransportAMD64 Address MapAMD64 DRAM CfgAMD64 Misc Cfg79c970 PCnet-PCI79c978 PChome-PCI53c974 PCscsi-PCI79C974 PCnet-PCIElanSC520 PCI751 System751 PCI-PCI762 PCI762 PCI-PCI761 PCI761 PCI-PCI755 ISA755 IDE755 Power755 USB756 ISA756 IDE756 Power756 USB Host766 ISA766 IDE766 USB766 Power766 USB OpenHCI768 ISA768 IDE768 Power768 AC97768 Modem768 PCI-PCI768 USB8131 PCIX8131 PCIX IOAPIC8151 Sys Control8151 AGP8132 PCIX8132 PCIX IOAPIC8111 PCI-PCI8111 USBAMD8111 LPC8111 IDE8111 SMBus8111 ACPI8111 AC97MegaRAIDMegaRAID Series 428MegaRAID Series 434ADSP 21535 DSPAD1889 AudioSafeNet ADSP 2141TC9021BanditGCOHareHeathrowPaddingtonUni-N EthUni-NUni-N AGPGMACKeylargoPangeaPangea USBPangea AGPPangea PCIUni-N2 AGPUni-N2 HostPangea FireWireUniNorth FirewireUni-N ATAUniNorth AGPUniNorth PCIIntrepid ATAIntrepidIntrepid USBARS106SARS0303D1000PV2000PV2000MT2000MIAX88140A/88141Radeon Mobility X600Radeon 9600 ProRadeon 9600Radeon 9600 XTMach32Radeon 9600 Pro SecRadeon 9600 XT 2ndRadeon 8500 BBRadeon IGP 320MMobility M6IXP200 AC97SB200 PCI-PCISB200 USB2SB200 USBSB200 PCI-ISASB200 SMBusMach64 CTMach64 CXIXP300 AC97IXP400 AC97IXP400 PCIIXP400 SMBusIXP400 USB2IXP400 USBIXP400 ISAIXP400 SATAIXP200 IDEIXP300 IDEIXP400 IDEMach64 ETRage ProMach64 GDMach64 GIMach64 GLMach64 GMMach64 GNMach64 GOMach64 GPMach64 GQRage XLMach64 GSMach64 GTMach64 GUMach64 GVMach64 GWMach64 GXMach64 GYMach64 GZRadeon 9000Radeon 9000 SecMach64 LBMach64 LDRage128 LEMobility M3Mach64 LGMach64 LIMobility 1Mach64 LNMach64 LPMach64 LQRage P/MMach64 LSRadeon Mobility M7 LWRadeon Mobility M6 LYRadeon Mobility M6 LZRadeon Mobility M9 LfRage 128 Mobility MFRage 128 Mobility MLRadeon 9500/9700Radeon 9800 XTRadeon 9800 ProRadeon Mobility M10 NPRadeon 9500/9700 SecRadeon 9800 Pro SecRage 128 Pro PDRage FuryRage 128 PKAIW RadeonRadeon QERadeon QFRadeon QGRadeon 8500 QLRadeon 9100 QMRadeon 8500 QNRadeon 8500 QORadeon 7500 QWRadeon VE QYRadeon VE QZRadeon 8500 QlRage 128 GLRage MagnumRage 128 RGRage 128 RKRage 128 VRRage 128 SHRage 128 SKRage 128 SLRage 128 SMRage 128Rage 128 Pro TFRage 128 Pro TLRage 128 Pro TRMach64 VTMach64 VUMach64 VVRS300 HostRadeon IGP 9100 HostRadeon Mobility IGP 9100Radeon IGP 9100 AGPRadeon 9200 PRO 2ndRadeon 9200 2ndRS480 HostRadeon XPRESS 200Radeon XPRESS 200MRadeon 9200 PRORadeon 9200Radeon 9200 SE 2ndRS480 PCIERadeon X300Radeon X600FireGL V3100Radeon X300 SecRadeon X600 SecFireGL V3100 SecRadeon Mobility 9200Radeon Mobility 9200 (M9+)Radeon 9200 SERS100 PCIRS200 PCIRS100 AGPRS200 AGPS5933 PCI MatchmakerMyrinet LANaiAR5210AR5211AR5212AR5210 (Early)AR5212 (IBM MiniPCI)AR5210 (no eeprom)AR5212 (no eeprom)AR5211 (no eeprom)AR5212 (emulation board)AR5211RefIDE-2015PLVortex 1Vortex 2Vortex AdvantageAVL2301AVG2302ALG2301ALG2302ALS4000LP-PCI 4 SerialFritz ISDNFritz v2.0 ISDNBRI ISDNPRI T1 ISDNF5D6001F5D6020V3F5D6000VME 617VME 270655015601BCM5752BCM5752MBCM5702BCM5703BCM5704CBCM5704S_ALTBCM5702FEBCM5705BCM5705KBCM5720BCM5721BCM5705MBCM5705M_ALTBCM5714CBCM5780BCM5780SBCM5705FBCM5750BCM5751BCM5750MBCM5751MBCM5751FBCM5782BCM5788BCM5789BCM5702XBCM5703XBCM5704SBCM5702_ALTBCM5703_ALTBCM5781BCM5753BCM5753MBCM5753FBCM4401B0BCM5901BCM5901A2BCM4306BCM4322BCM4309BCM44015801580258055820582158225823BT848BT849BT878BT879BT878 AudioBT879 AudioBt8474 HDLCMultiMaster NCMultiMasterFlashPointGPPCINitrox XLCinemaster643106554565548655506555465555685546900069030CL-GD7548CL-GD5430CL-GD5434-4CL-GD5434-8CL-GD5436CL-GD5446CL-GD5480CL-GD5462CL-GD5464CL-GD5465CL-PD6729CL-PD6832 CardBusCL-PD6833 CardBusCL-GD7542CL-GD7543CL-GD7541CS4610 SoundFusionCS4615CS4280/46xx CrystalClearCS4281 CrystalClearPCI0640PCI0642PCI0643PCI0646PCI0647PCI0648PCI0649PCI0650AUSB0670USB0673PCI0680SiI3112 SATASiI3114 SATASiI3512 SATAAAR-1210SAGigaCardEX110TXTriflex PCIQVisionQVision 1280/pSmart Array 5300Smart Array 5iSmart Array 532Smart Array 5312Smart Array 641Smart Array 642Smart Array 6400Smart Array 6400 EMSmart Array 6422Smart Array 64xxNetelligent ASMCPCI HotplugUSB OpenHostSMART2P RAIDISAPnPNetelligent 10/100TXNetelligent IDENetelligent 10 TIntegrated NetFlex 3/PDP Netelligent 10/100TXProLiant Netelligent 10/100TXEmbedded Netelligent 10/100TXNetelligent 10 T/2 PCISmart Array 5300 rev.2Smart Array 5i/532 rev.2NetFlex 3/PNetFlex 3/PBCompexeRL100-ATX 10/100PMAC 9871356k WinmodemSoftK56 PCIHSF 56k HSFiMUSYCC CN8478MUSYCC CN8474MUSYCC CN8472MUSYCC CN847182C599 VLBCY82C693U ISAFEther CB-TXD 10/100FEther II CB-TXD 10/100CG-LAPCIGTC-Bus II-PCISoundBlaster LiveSoundBlaster AudigySoundBlaster Audigy LSPCI Gameport JoystickSoundBlaster Audigy DigitalEctiva 1938Cyclom-Y below 1MCyclom-YCyclom-4Y below 1MCyclom-4YCyclom-8Y below 1MCyclom-8YCyclom-Z below 1MCyclom-ZIQ80310GXm PCIGXm ISACx5530 SouthCx5530 SMI/ACPICx5530 IDECx5530 XpressAUDIOCx5530 VideoDM9100DM9102DM900921050 PCI-PCI2104021030Zephyr NV-RAMKZPSA21140TGA2DEFPA21041DGLPB (OPPO)ZLXP-L2 (Pixelvision)21142/3Farallon PN9000SX21052 PCI-PCI21150 PCI-PCI21150-BC PCI-PCI21152 PCI-PCI21153 PCI-PCI21154 PCI-PCICompaq SMART RAID 42xxSWXCR RAIDPERC 2/SiPERC 3/DiPERC 3/SiPERC 4/Di i960PERC 4/Di VerdePERC 4e/Di8139Viper/PCI550TX530TX+DFE-690TXDDWL-610DGE-550TDGE-528TDGE-560TDGE-560T_2DGE-530TSmartCache/RaidSmartRAID (I2O)SmartRAID 2005SMemory ControlPCI-SCIDMX3194UIS64PH ISDN155P-MF1 ATM (FPGA)155P-MF1 ATM (ASIC)25SS-3010 ATM (ASIC)SpeedStream 1023QuickStep 1000 ISDNLight Pulse FibreChannelLight Pulse 8000Endace Dag3.6DEndace Dag4.23GECB-1410 CardBusAudioPCI97AudioPCICT5880ES366H ModemMaestro IISOLO-1 AudioDriveMaestro 2EES1989ES1989 ModemMaestro 3ES1983 ModemMaestro 3 AudioES366H Fax/ModemES2838/2839 SuperLink ModemES2898 ModemRoadRunner HIPPIRoadRunner Gig-EFreedom GBusWL11000PATM PCA-200ATM PCA-200e801 SoundTMC-18C30 (36C70)GL24110P03GL24110PGL24110P02PR103WinTVPN672TX 10/100Visualize EGVisualize FX6Visualize FX4Visualize FX2Tach TL FibreChannelTach XL2 FibreChannelJ2585AJ2585BDiva Serial MultiportElroy Ropes-PCIVisualize FXeTopTools Communications PortNetRaid-4MNetServer SmartIRQ82557B 10/100 NICPluto MIOzx1 IOCMercury Ropes-PCIQuickSilver Ropes-PCISmart Array V100Smart Array P800Smart Array P600Smart Array E40077516500781179517814/7851/785480658165815479567955/7954MCACPU - Alta LiteCPU - Alta MPISA w/PnPCPUAuto LANStreamerGXT-150P82G267582351 PCI-PCIServeRAIDMiami/PCIOlympici82557B 10/100FireGL2PCIX-PCIX77201/77211 ATM (NICStAR)WDT 50x Watchdog TimerINIC-850 (A100UW)INIC-1060 (A100U2W)INIC-940INIC-941INIC-950IPN2120IPN22208849EES ISA2114580303 IOP80312 I/O CompanionPCIE-PCIEIOP331 Channel 0IOP331 Channel 141210 PCIE-PCIX82375EB EISA82424ZX Cache/DRAM82378IB ISA82426EX ISA82434LX/NX PCI/Cache/DRAMGDT RAIDi960 RP PCI-PCIi960 RM PCI-PCIi960 RN PCI-PCIPRO/1000 (82542)PRO/1000F (82543GC)PRO/1000T (82543GC)PRO/1000XT (82544EI)PRO/1000XF (82544EI)PRO/1000T (82544GC)PRO/1000XT (82544GC)PRO/1000MT (82540EM)PRO/1000MT (82545EM)PRO/1000MT (82546EB)PRO/1000MF (82545EM)PRO/1000MF (82546EB)PRO/1000MT (82541EI)PRO/1000MT (82540EP)PRO/1000MT Mobile (82541EI)PRO/1000CT (82547EI)PRO/1000CT Mobile (82547EI)PRO/1000MT QP (82546EB)PRO/1000MT (82545GM)PRO/1000MF (82545GM)PRO/1000MB (82545GM)PRO/10082559PRO/100 VEPRO/100 VM82562EH HomePNAV.92 ModemPRO/Wireless 2100PRO/10GbE LR (82597EX)PRO/100 MPRO/100 VE (82562EZ)PRO/100 VE (82801FBM)PRO/1000CT (82547GI)PRO/1000MT (82541GI)PRO/1000MT Mobile (82541GI)PRO/1000MT (82541ER)PRO/1000MT (82546GB)PRO/1000MF (82546GB)PRO/1000MB (82546GB)PRO/1000GT (82541GI)PRO/1000MT (82573E)PRO/1000MT QP (82546GB)82815 Hub82815 AGP82815 Graphics82806AA APIC82559ER82092AA IDESAA7116EE Pro 10 PCIEE Pro 100EE Pro 100 Smart8255782437FX82371FB ISA82371FB IDE82371 ISA and IDE82437 PCI/Cache/DRAM82441FX82380AB Mobile ISA82380FB Mobile PCI-PCI82439HX82806AA82870P2 PCI-PCI82870P2 IOxAPIC82870P2 Hot Plug80960RP ATU82840 Host82840 AGP82840 PCI82845 Host82845 AGPPRO/10GbE SR (82597EX)82801AA LPC82801AA IDE82801AA USB82801AA SMBus82801AA AC9782801AA Modem82801AA Hub-to-PCI82801AB LPC82801AB IDE82801AB USB82801AB SMBus82801AB AC9782801AB Modem82801AB Hub-to-PCI82801BA LPC82801BA USB82801BA SMBus82801BA AC9782801BA Modem82801BAM Hub-to-PCI8256282801BAM IDE82801BA IDE82801BAM LPC82801BA AGP82801E LAN82801CA LPC82801CA/CAM USB82801CA/CAM SMBus82801CA/CAM AC9782801CA/CAM Modem82801CAM IDE82801CA IDE82801CAM LPC82801DB LPC82801DB USB82801DB SMBus82801DB AC9782801DB Modem82801DBM IDE82801DB IDE82801DBM LPC82801EB/ER LPC82801EB SATA82801EB/ER USB82801EB/ER SMBus82801EB/ER AC9782801EB/ER Modem82801EB/ER IDE82801ER SATA82820 MCH82820 AGP82850 Host82860 Host82850/82860 AGP82860 PCI-PCIE7500 MCH HostE7500 DRAME7500 MCHE7501 MCH HostE7505 MCH HostE7505 MCH AGPE7505 MCH PCI-PCI82845G/GL82845G/GL/GV/GE/PE AGP82845G/GL Video82865G/PE/P CPU-I/0-182865G/PE/P CPU-AGP82865G Video82865G/PE/P CPU-CSA82865G/PE/P CPU-I/0-282875P Host82875P AGP82875P PCI-CSA915G/P/GV Host915G/P/GV PCIE915G/P/GV Video925X MCH Host925X PCIEE7221 MCH HostE7221 PCIEE7221 Video915GM/PM/GMS Host915PM/GM PCIE915GM/GMS Video6300ESB LPC6300ESB IDE6300ESB SATA6300ESB SMBus6300ESB AC976300ESB Modem6300ESB USB5300ESB USB6300ESB WDT6300ESB APIC6300ESB PCIX82801FB LPC82801FBM LPC82801FB SATA82801FR SATA82801FBM IDE82801FB USB82801FB PCIE82801FB HD Audio82801FB SMBus82801FB Modem82801FB AC9782801FB IDE82945GP82945GP PCIE82801GB LPC82801GB SATA82801GB AHCI SATA82801GB USB82801GB PCIE82801GB HD Audio82801GB SMBus82801GB LAN82801GB Modem82801GB AC9782801GB IDERCU32 I2O RAID31244 SATA82855PE Hub82855PE AGP82830MP CPU-I/O-182830MP CPU-AGP82830MP Integrated Video82830MP CPU-I/O-282852GM Hub-PCI82852/82855 AGP82852GM AGP82852GM Memory82852GM ConfigurationE7710 SMCHE7710 MCH ERRE7710 MCH DMAE7710 MCH PCIEE7710 WMCHPRO/Wireless 2200BGPRO/Wireless 2225BGPRO/Wireless 2915ABGi960 RD PCI-PCIPRO 100 Server82371SB ISA82371SB IDE82371SB USB82437VX82439TX System82371AB PIIX4 ISA82371AB IDE82371AB USB82371AB Power8281082810 Graphics82810-DC10082810-DC100 Graphics82810E82810E Graphics82443LX AGP82443BX AGP82443BX82440MX Host82440MX AC9782440MX Modem82440MX ISA82440MX IDE82440MX USB82440MX Power82440BX AGP82443GX82740 AGP82450KX/GX82450KX/GX Memory82451NX Mem & IO82454NX PXB82802AC Firmware Hub 8Mbit82802AB Firmware Hub 4MbitI2O RAID PCI-PCIRCU21 I2O RAIDRCUxx I2O RAIDRCU31 I2O RAIDRCU31L I2O RAIDS21152BB PCI-PCIS21154AE/BE PCI-PCIPowerstorm 4D50TIntense 3DExpert3D5526 FibreChannelPRISM3PRISM2.5Prism IndigoPrism Javelin/XbowPrism GT/DuetteAEONGV-BCTV3AGX016ITT3204 MPEG DecoderIT8212FIT8330GKTIHSSIDS3SSIDS1Appian LiteDual SerialQuad SerialParallelDual ParallelDual Parallel BS3 805Leadtek WinFast TV 2000LXT1001EG1032EG1064PCMPC200PCM200PNICPNIC-II8031K56flex DSVD LTMODEMLTMODEMVenus ModemUSB 2-portUSB QuadraBusFW322 1394LS242 DVD DecoderPMAC 98715PMAC 98727MX86250Smart 16/4 PCI RingnodeSmart 16/4 PCI Ringnode Mk2Smart 16/4 PCI Ringnode Mk3Smart 16/4 PCI Ringnode Mk116/4 CardbusPresto PCISmart 100/16/4 PCI-HS RingnodeSmart 100/16/4 PCI Ringnode16/4 CardBus Mk2Collage 25 ATMCollage 155 ATMi740 PCILibertas 88W8310SKv2YukonYukon 8035Yukon 8036Yukon 8052Yukon 8050Yukon 8053Belkin F5D5005MGA PX2085 (Atlas)MGA Millenium 2064W (Storm)MGA 1064SG 220MHzMGA Millennium II 2164WMGA Millennium II 2164WA-B AGPMGA G200 PCIMGA G200 AGPMGA G400/G450 AGPMGA ImpressionMGA G100 PCIMGA G100 AGPMGA 1064SGMGA G400 Twin HeadMGA G550 AGPMGA Millennium G200 SDMGA Produktiva G100 SDMGA Mystique G200 SDMGA Millennium G200 SGMGA Marvel G200 SDMN-120 10/100MN-130 10/100Powerstorm 4D30TGUI AccelMPC105 PCIMPC106 PCISM56Raven PCICP-114C104HCP-104ULC168HDMA4 serialDAC960P V2 RAIDDAC960P V3 RAIDDAC960P V4 RAIDDAC960P V5 RAIDAcceleRAIDeXtremeRAIDMyriNet LANai 9.2MTD800 10/100MTD803 10/100MTD891 10/100/1000MV1000NCP130NCP130 Rev A2DP83810 10/100PC87415 IDE87560 Legacy I/ODP83815 10/100DP83820 10/100/1000SCx200 ISASCx200 SMISCx200 IDESCx200 AUDIOSCx200 VIDEOSCx200 X-BUSSC1100 ISASC1100 SMI/ACPISC1100 X-BusNS87410PowerVR PCX2I/OVersa MaestroVersa Va26D MaestroMagicgraph NM2070Magicgraph 128VMagicgraph 128ZVMagicgraph NM2160Magicgraph NM2200Magicgraph NM2360MagicMedia 256AV+MagicMedia 256XL+MagicMedia 256AVMagicMedia 256ZXMA301GA620GA620T1P2S1P4SCMI8338A AudioCMI8338B AudioCMI8738/C3DX AudioCMI8738B AudioHSP56 AMRNSP2KNetVin 5000Universe VME53c81053c82053c82553c81553c810AP53c86053c1510D53c89653c89553c88553c87553c151053c895A53c1010-3353c1010-6653c103053c875JFC909FC909AFC929FC919MegaRAID 320MegaRAID 320-2EMegaRAID SATA 8xPacket Engines G-NICFNW-3603-TX 10/100FNW-3800-TX 10/100NX82C501 PCINDR4600 PCIBS21 10/100E-mobility WirelessImagine-128Imagine-128 IIImagine-128 T2RImagine-128 T2R4NV1DAC64Riva TNTRiva TNT2Riva TNT2 UltraVantaMCP04 LANnForce4 ISAnForce4 SMBusnForce4 IDEnForce4 SATA 1nForce4 SATA 2CK804 LANnForce4 AC97nForce4 USBnForce4 PCI-PCInForce4 PCIEnForce4 DDRnForce2 ISAnForce2 SMBusnForce2 IDEnForce2 LANnForce2 USBnForce2 AC97nForce2 AudionForce2 PCI-PCInForce2 FireWirenForce2 400 ISAnForce2 400 SMBusnForce2 400 IDEnForce3 LANnForce2 400 USBnForce2 400 USB2nForce2 400 AC97nForce2 400 PCI-PCInForce2 400 SATAAladdin TNT2nForce3 ISAnForce3 PCI HostnForce3 PCI-PCInForce3 SMBusnForce3 IDEnForce3 USBnForce3 AC97nForce3 250 ISAnForce3 250 PCI HostnForce3 250 AGPnForce3 250 SATAnForce3 250 SMBusnForce3 250 IDEnForce3 250 USBnForce3 250 USB2nForce3 250 AC97nForce3 250 PCI-PCIGeForce 6600 GT AGPQuadro FX 330GeForce256GeForce256 DDRQuadroGeForce2 MXGeForce2 MX 100GeForce2 GoQuadro2 MXRGeForce 6600 GTGeForce 6600GeForce2 GTSGeForce2 TiGeForce2 UltraQuadro2 ProGeForce4 MX 460GeForce4 MX 440GeForce4 MX 420GeForce4 440 GoGeForce4 420 GoGeForce4 420 Go 32MQuadro4 500XGLGeForce4 440 Go 64MQuadro4 200/400NVSQuadro4 550XGLQuadro4 GoGLGeForce4 MX 440 AGPGeForce4 MX 440SE AGPGeForce 4 MX 420 AGPGeForce4 MX 4000Quadro4 580 XGLQuadro4 NVSQuadro4 380 XGLGeForce2 Crush11nForce PCI HostnForce 220 DDRnForce 420 DDRnForce 220/420nForce APUnForce AC97nForce ISAnForce SMBusnForce AGPnForce PCI-PCInForce IDEnForce USBnForce LANnForce2 PCInForce2 AGPnForce2GeForce4 MX nForce GPUGeForce3GeForce3 Ti 200GeForce3 Ti 500Quadro DCCGeForce4 Ti 4600GeForce4 Ti 4400GeForce4 Ti 4200Quadro4 900 XGLQuadro4 750 XGLQuadro4 700 XGLGeForce4 Ti 4200 GoGeForce FX 5600GeForce FX 5200GeForce FX Go 5200GeForce FX 5500GeForce FX 5700LEGeForce FX Go 5700OTI107OC2183OC2325OC232682C092G82C557 Host82C558 ISA82C568 IDE82D568 IDE82C621 IDE82C70082C70182C82282C861010L100L110L200L210L400L800Lx10H100H200H200HV2400H/800H800H011HExsys EX-41098PMC/GNIC2RZ1000HSP MicroModem 56PCIHB5I/O BridgePCIHB7CNB20HE HostCNB20LE HostCIOB30CMIC_HE HostCMIC_LE HostCNB20-HECMIC_SL HostCIOBX2CIOB-EROSB4 SouthBridgeCSB5 SouthBridgeCSB6 PCIOSB4 IDECSB5 IDECSB6 IDEOSB4/CSB5 USBCSB6 USBCSB5 PCICSB6 LPCPCI/ISASAA7130PT80C826PT86C521PT86C523PC87550PT86C523_2PCC-ISESES1849I/O 9050I/O 9080DC5030PDC20246PDC20262PDC20263PDC20265PDC20267PDC20268PDC20268RPDC20269PDC20271PDC20275PDC20276PDC20277PDC20318PDC20319PDC20371PDC20375PDC20376PDC20377PDC20378PDC20379PDC20617PDC20618PDC20619PDC20620PDC20621ISP10160ISP1020ISP1022ISP1080ISP12160ISP1240ISP1280ISP2100ISP2200ISP2300ISP2312ISP631285008580RT2460ART25608029812981388169818081855C465 CardBus5C466 CardBus5C475 CardBus5C476 CardBus5C477 CardBus5C478 CardBus5C521 Firewire5C551 Firewire5C552 FirewireRS56/SP-PCI11P1 ModemViRGETrio32Trio32/64Aurora64V+Trio64UV+868ViRGE VX86C92886C864-086C864-186C864-286C864-386C964-086C964-186C964-286C964-386C968-086C968-186C968-286C968-3Trio64V2/DXPlatoTrio3D AGPViRGE DX/GXViRGE GX2Trio3 DX2Savage 3DSavage 3DMSavage 4ProSavage PM133ViRGE MXViRGE MXPSavage/MX-MVSavage/MXSavage/IX-MVSavage/IXSuperSavageTwisterTwister-KProSavage DDRSonicVibesSafeXcelMagicLAN SWL-2210P984x GESK-9821 v2.0SK-9D21SK-9SxxSK-9ExxTigonSTG 2000XSTG 1764Kyro-IISTG 1764X64GXDVDmagic-PRO86C201 AGP86C202 VGA648FX AGP86C20585C503 System5595 System85C503 ISA180 SATA181 SATA182 SATA5597/5598 VGA6215300/305/630 VGA85C50185C496SiS596530 PCI540 PCI550 PCI85C601 EIDE620 PCI630 PCI633 PCI635 PCI640 PCI645 PCI646 PCI648 PCI650 PCI651 PCI652 PCI655 PCI658 PCI661 PCI730 PCI733 PCI735 PCI740 PCI741 PCI745 PCI746 PCI748 PCI750 PCI751 PCI752 PCI755 PCI760 PCI900 10/100BaseTX961 PCI962 PCI963 PCI964 PCI965 PCI551155125513 EIDE5571 PCI558155825591 PCI55965597/5598 Host620462056300530 VGA650 VGA6326 VGA6330 VGA5597/5598 USB7002 USB7007 FireWire7012 AC977013 Modem7016 10/100BaseTX7018 AudioFDC 37C665FDC 37C92283C170 (EPIC/100)83C175 (EPIC/100)LynxEMLynxEM+Lynx3DMLynxELynxE+Lynx3D910Pirahna 2-portTulip, power, switch extenderFPGA I-Bus Tracer for MBDSZB6120CXD1947A FireWireCXD3222 FireWireMemory Stick SlotVelocity128PCIO Ebus2HMEPCIO Ebus2 (US III)ERI EtherGEMSimba PCI-PCICrypto 5821Crypto 1KPsycho PCImicroSPARC IIep PCIUltraSPARC IIi PCIUltraSPARC IIe PCICassini EtherST201ST1023ST202140XX4018ASurecom NE-344S2PSpectrum24 LA41X382C10182C10382C10582C565 ISATC9021 GigETC9021 GigE (alt ID)DC-290(M)DC-690CDC-3x5UTerratec TV+Terratec TValueTerratec TValue RadioTLAN3DLabs Permedia3DLabs Permedia 2TSB12LV21 FireWireTSB12LV22 FireWirePCI4450 FireWirePCI4410 FireWireTSB12LV23 FireWireTSB12LV26 FireWireTSB43AA22 FireWireTSB43AB22 FireWireTSB43AB23 FireWireTSB43AB21 FireWirePCI4451 FireWirePCI4510 FireWirePCI4520 FireWirePCI7(4-6)10 FireWirePCI7x20 FireWirePCI6515 CardBusPCI6515 CardBus (Smart Card mode)ACX100AACX100BACX111PCI1130 CardBusPCI1031 PCMCIAPCI1131 CardBusPCI1250 CardBusPCI1220 CardBusPCI1221 CardBusPCI1210 CardBusPCI1450 CardBusPCI1225 CardBusPCI1251 CardBusPCI1211 CardBusPCI1251B CardBusPCI2030 PCI-PCIPCI2031 PCI-PCIPCI2250 PCI-PCIPCI2050 PCI-PCIPCI4450 CardBusPCI4410 CardBusPCI4451 CardBusPCI4510 CardBusPCI4520 CardBusPCI7510 CardBusPCI7610 CardBusPCI7410 CardBusPCI7610 CardBus (Smart Card mode)PCI7[46]10 CardBus (SD/MMC mode)PCI7[46]10 CardBus (Memory stick mode)PCI1410 CardBusPCI1420 CardBusPCI1451 CardBusPCI1421 CardBusPCI1620 CardBusPCI1520 CardBusPCI1510 CardBusPCI1530 CardBusPCI1515 CardBusPCI2040 DSPPCI7420 CardBusPCI interface5634PCV SurfRiderR4x00TC35856F ATM (Meteor)R4x00 PCIToPIC95 CardBus-PCIToPIC95B CardBusToPIC97 CardBusToPIC100 CardBusFast Infrared Type OSD ControllerVirtual NorthbridgeMem1Mem24DWAVE DX4DWAVE NXCyberBlade i7CyberBlade i7 AGPCyberBlade i1CyberBlade i1 AGPCyberBlade Ai1CyberBlade Ai1 AGPCyberBlade XP/Ai1TGUI 9320TGUI 9350TGUI 9360TGUI 9388CYBER 9397CYBER 9397DVDTGUI 9420TGUI 9440CYBER 9525TGUI 9660TGUI 9680TGUI 96823DImage 97503DImage 9850Blade 3DCyberBlade XPHPT343/345 IDEHPT36x/37x IDEHPT372A IDEHPT302 IDEHPT371 IDEHPT374 IDEPyramid3D TR25202ET4000w32p rev AET4000w32p rev BET4000w32p rev CET4000w32p rev DET6000/ET6100ET6300UM82C881 486UM82C886 ISAUM8673F EIDEUM8881 HB4 486 PCIUM82C891UM886AUM8886BFUM8710UM8886UM8881F HostUM8886F ISAUM8886AUM8891AUM9017FUM8886NUM8891NUS2013CP5610USR997902V961PBC i960 PCIV292PBC AMD290x0 PCIV960PBC i960 PCIV96DPC i960 PCIK8HTB HostVT8363 HostVT8371 HostVT8501VT82C505VT82C561VT82C571 IDEVT82C576 3VVT82C585 ISAVT82C586 ISAVT82C595 PCIVT82C596A ISAVT82C597 PCIVT82C598 PCIVT8601 PCIVT8605 PCIVT82C686 ISAVT82C691 PCIVT82C693 PCIVT86C926 AmazonVT82C570M PCIVT82C570M ISAVT82C416 IDEVT82C1595 PCIVT83C572 USBVT82C586 PowerRhine/RhineIIVT6306 FireWireVT82C596 PowerVT82C596B PMVT6105M RhineIIIVT82C686 SMBusVT82C686 AC97VT8233 AC97RhineII-2VT82C686 ModemVT8366 ISAVT8633 PCIVT8366 PCIVT8653 PCIVT6202 USBVT6105 RhineIIIS3 Unichrome PRO IGPVT8361 PCIVT8375 PCIPM800 AGPPM800 ErrorsPM800 HostPM800 DRAMPM800 PMCPM800 PCIPM800 Unichrome S3VT612xCLE266VT8623 PCIVT8233 ISAVT8751 PCIVT8237 SATAVT8235 ISAVT8377 PCIVT8378 PCIVT8237 ISAVT8378 VGAVT8231 ISAVT8231 PMGVT8363 AGPVT8371 PCI-PCIVT8501 AGPVT82C597 AGPVT82C598 AGPVT82C601 AGPVT8605 AGPVT8633 AGPVT8366 AGPVT8361 AGPVT8235 AGPK8HTB AGPVT8377 PCI-PCIGDT6000/6020/6050GDT6000B/6010GDT6110/6510GDT6120/6520GDT6530GDT6550GDT6x17GDT6x27GDT6537GDT6557GDT6x15GDT6x25GDT6535GDT6555GDT6x17RPGDT6x27RPGDT6537RPGDT6557RPGDT6x11RPGDT6x21RPGDT6x17RP1GDT6x27RP1GDT6537RP1GDT6557RP1GDT6x11RP1GDT6x21RP1GDT6x18RDGDT6x28RDGDT6x38RDGDT6x58RDGDT6x17RP2GDT6x27RP2GDT6537RP2GDT6557RP2GDT6x11RP2GDT6x21RP2GDT6513RSGDT6523RSGDT6518RSGDT6x28RSGDT6x38RSGDT6x58RSGDT6x33RSGDT6x43RSGDT6x53RSGDT6x63RSGDT7x13RNGDT7x23RNGDT7x18RNGDT7x28RNGDT7x38RNGDT7x58RNGDT7x43RNGDT7x53RNGDT7x63RNGDT4x13RZGDT4x23RZGDT8x13RZGDT8x23RZGDT8x33RZGDT8x43RZGDT8x53RZGDT8x63RZGDT6x19RDGDT6x29RDGDT7x19RNGDT7x29RNGDT8x22RZICP82C592 CPU82C593 ISA82C594 Wildcat82C596/597 Wildcat ISA82C54182C54382C53282C53482C53582C14782C97582C925Virtual SVGAVirtual SVGA IIP9000P9100WD33C193AWD33C196AWD33C197AWD7193WD7197WD33C296AWD34C296WD9610W83769FW89C840F 10/100Linksys EtherPCI IIW83C553F ISAW83C553FW89C940FW6692 ISDNLinksys EtherPCIX3201-3X3201-3 (21143)CBEM56G Modem724734738737740740C724F7447541221PCI-ST32Genie TV/FMDVDMartin-MariettaHauppaugeDynalinkCompaqSymbios LogicATIULSI SystemsVLSIAvance LogicNSTseng LabsWeitekDECCirrus LogicWestern DigitalAMIAMDTridentAcerDellSiemens Nixdorf AGMatroxChips and TechnologiesToshibaNECFuture DomainSISHewlett-PackardPC TechnologyAsustekDPTOptiElsaSGS ThomsonBusLogicTexas InstrumentsSonyOak TechnologyWinbondMotorolaPromiseNumber 9UMCI. T. T.PicopowerMylexAppleYamahaNexGen MicrosystemsQLogicCyrixLeadTek ResearchInterphaseContaq MicrosystemsBit3OlicomSunIntergraphDiamond MultimediaCMD TechnologyQuantum DesignsBrooktreeSGIACC MicroelectronicsSymphony LabsSTB SystemsPLXMadge Networks3ComSMCAcer LabsMitsubishi ElectronicsSurecomNeomagicMentor ARCAdvansysMolexMacronixEvans & SutherlandNvidiaEmulexIntegrated Micro SolutionsTekram (1st ID)NewbridgeApplied Micro CircuitsRealtekNKKIO Data DeviceInitioCreative LabsHighPointSigma DesignsVIACogent DataSiemensAcctonVortexEfficent NetworksIDTFORE SystemsPhilipsZiatechCycloneAlliance SemiconductorSchneider & KochMutechXircomServerWorksRicohD-Link SystemsCorrollaryAcardZeinetOmega MicroMarvellLite-OnV3 SemiconductorPinnacle SystemsAT&T/LucentDolphinMesa Ridge (MAGMA)Analog DevicesZoranPijnenburgCompexCycladesEssential CommunicationsO2 Micro3DFX InteractiveATMLC-CubeAVMCoregaASIXIntersilNortel NetworksSilicon MotionEnsoniqTransmetaRockwellDavicomITExpressPlatformLuxSonorTriTech MicroelectronicsAlteonUS RoboticsNVidia/SGS-ThomsonAurealADMtekPacket EnginesForte MediaSIIGDTC TechPCTELCNetLAN MediaNetgearMoxaLevel 1Hifn3wareAbocomSundanceC-Media ElectronicsLavaSunixMicrosoftOxfordTamarackAskeyAvermediaAironetMyricomVScomAvlabInvertexBroadcomPlanexConexantMyson CenturyTopic/SmartLinkENEAralionTerraTecSymbolSybaBluesteelVMwareNational DatacommZoltrixEumitcomNetSecSamsungAtherosGlobal SunSafeNetLinksysNetoctaveAltimaAntares MicrosystemsCaviumBelkinHawking TechnologyINPROCOMMLanergyRalinkTekramHint3D LabsAddtronIndustrial Computer SourceNetVinGemtekc't MagazinIntelAdaptecAtronicsNetMosTigerJet NetworkEndaceBelkin ComponentsARC LogicINVALID VENDOR ID"%s %s"unknown class 0x%02x, subclass 0x%02xclass %s subclass %sclass %s unknown subclass 0x%02x, rev 0x%02x) rev 0x%02xvendor "%s", unknown product 0x%04x%svendor 0x%04x product 0x%04xunknown cy82c693_init: bus_space_map failed (%d)cy82c693_initcy82c693_readcy82c693_write%s: External SRAM, %s access%s, %dbytes/SCB %s: couldn't map interrupt %s: Using left over BIOS settings : couldn't establish interrupt%s: Enabling 39Bit Addressing : unable to map registers %s: unable to allocate bus-specific data fast, parity checking enabledslow%s: PCI error Interrupt at seqaddr = 0x%x %s: Latched PCIERR interrupt with no status bits set %s: Data Parity Error has been reported via PERR# %s: Signaled a Target Abort %s: Received a Target Abort %s: Received a Master Abort %s: Signal System Error Detected %s: Data Parity Error Detected during address or write data phase RAID functionality unsupported adapter at unexpected slot %d unable to map to a channel %s: unable to map device registers %s: couldn't map interrupt %s: couldn't establish interruptadv_pci_attach: adv_init failedAscInitFromEEPAscIsrQDone: completed scsiq with unknown statusAscIsrQDone: Attempting to free more queues than are activeAscIsrQDone: Corrupted SG list encounteredAscExeScsiQueue: Queue with QC_SG_HEAD set but %d segs.AscExeScsiQueue: Queue with too many segs.AscResetDeviceQUANTUM XP343011071NEC YAMAHACDR400CD-ROM DRIVE TDC 36HP : broken match/attach! : couldn't map interrupt : %s, using %dK of on-board RAM, can't map on-board RAM: unable to map device registers pciide %s: device disabled %s: couldn't map %s cmd regs %s: couldn't map %s ctl regs %s: couldn't map native-PCI interrupt unknown interrupt%s: using %s for native-PCI interrupt %s: unable to subregion %s ctl regs %s: couldn't establish native-PCI interrupt, (unsupported maptype 0x%x), unused (couldn't query registers), unused (registers at unsafe address %#lx), unused (couldn't map registers)%s:%d: unable to allocate table DMA for drive %d, error=%d %s:%d: unable to map table DMA fordrive %d, error=%d %s:%d: unable to create table DMA map for drive %d, error=%d %s:%d: unable to load table DMA map for drive %d, error=%d %s:%d: unable to create xfer DMA map for drive %d, error=%d %s:%d: unable to load xfer DMA map fordrive %d, error=%d %s:%d:%d: bus-master DMA error: missing interrupt, status=0x%x %s:%d:%d: bus-master DMA error: status=0x%x channel 0channel 1%s: %s cannot allocate memory for command queue%s: %s disabled (no drives) %s: no compatibility interrupt for use by %s configuredwiredcompatibilitynative-PCI, %s %s to %s: DMA%s:%d:%d: cannot allocate DMA maps, using PIO transfers %s:%d:%d: using DMA data transfers not responding; disabled or no drives?other hardware responding at addresses%s: %s ignored (%s) , (partial support) (unsupported): no DMA%s: %s ignored (disabled) %s:%d:%d: multi-word DMA disabled due to chip revision : ATA33: ATA66: ATA100: ATA133 %s: bus-master DMA support present%s: %s %s to %s mode %s %s: can't allocate memory for command queue: unable to map BA5 register space %s: port %d: device connected, but communication not established %s: port %d: unknown SStatus: 0x%08x %s: port %d: device present, speed: 3.0Gb/s, speed: 1.5Gb/s%s: port %d: PHY offline : can't subregion offset %lu size %luport 0port 1port 2port 3%s %s channel: can't allocate memory for command queue%s: couldn't subregion %s cmd base %s: couldn't subregion %s ctl base %s: couldn't subregion %s channel cmd regs : unexpected PCI function %d , %s %s to native-PCI compatibility : cannot allocate memory for command queue , (unable to map ctl registers)540620630630S633635645645DX651652655658661730733735741745746748755760962963: 5597/5598unknown SiS IDE type %d %s:%d: error intr %s:%d: bogus intr %s: unexpected PCI function %d %s: no known timing values %s:%d: bogus intr (reg 0x%x) : couldn't establish native-PCI interrupt: couldn't map bus-master DMA registers : couldn't map IDE registers : DMA %s: channel %d: can't allocate memory for command queue %s: couldn't map channel %d ctl regs %s: couldn't map channel %d cmd regs %s channel %d: can't subregion DMA registers ppb%s: not configured by system firmware pci at %svr%s: Using force reset command. : failed to enable I/O ports : failed to find i/o space : failed map i/o space %s: can't load dma map %s: can't create dma map %s: can't map dma buffers (%d bytes) %s: can't alloc list : could not establish interrupt%s: rx error (%02x): rx buffer error system bus error received runt packet received giant packet FIFO overflow frame alignment error crc error%s: rx shutdown error! %s: tx shutdown timeout %s: restarting %s: receive error (%04x) packet lost overflow no buffers%s: rx packet lost %s: initialization failed: no memory for tx buffers %s: chip is in D%d power mode -- setting to D0 i82558i82559i82559Si82550i82551, %s%s: Allocation of PCI resources failed %s: Unable to initialize the hardware %s: EEPROM read error while reading mac address %s: Invalid mac address , address: %s %s: Unable to allocate rx_desc memory %s: Unable to allocate tx_desc memory %s: watchdog timeout -- resetting %s: Could not setup transmit structures %s: Could not setup receive structures %s: Unsupported media type em_set_multi%s: Unknown MAC Type : mmba isn't memory: can't find io space : can't find mem space %s: The EEPROM Checksum Is Not Valid %s: Hardware Initialization Failed%s: EEPROM read error while reading part number %s: em_dma_malloc: bus_dmamap_load failed; error %u %s: em_dma_malloc: bus_dmammem_map failed; size %lu, error %d %s: em_dma_malloc: bus_dmammem_alloc failed; size %lu, error %d %s: em_dma_malloc: bus_dmamap_create failed; error %u %s: Unable to allocate tx_buffer memory %s: em_allocate_receive_structures: bus_dmamap_create failed; error %u %s: Unable to allocate rx_buffer memory %s: Adapter hardware address = %p %s:CTRL = 0x%x %s:RCTL = 0x%x PS=(0x8402) %s:tx_int_delay = %d, tx_abs_int_delay = %d %s:rx_int_delay = %d, rx_abs_int_delay = %d %s: fifo workaround = %lld, fifo_reset = %lld %s: hw tdh = %d, hw tdt = %d %s: Num Tx descriptors avail = %d %s: Tx Descriptors not avail1 = %ld %s: Tx Descriptors not avail2 = %ld %s: Std mbuf failed = %ld %s: Std mbuf cluster failed = %ld %s: Driver dropped packets = %ld %s: Excessive collisions = %lld %s: Symbol errors = %lld %s: Sequence errors = %lld %s: Defer count = %lld %s: Missed Packets = %lld %s: Receive No Buffers = %lld %s: Receive length errors = %lld %s: Receive errors = %lld %s: Crc errors = %lld %s: Alignment errors = %lld %s: Carrier extension errors = %lld %s: XON Rcvd = %lld %s: XON Xmtd = %lld %s: XOFF Rcvd = %lld %s: XOFF Xmtd = %lld %s: Good Packets Rcvd = %lld %s: Good Packets Xmtd = %lld : %s,: unknown device: %x:%x dc_pci_attach: can't find I/O base : can't map I/O space : can't subregion i/o space ne_pci_attach: impossible%s: init failed, error=%d vendor 0x%04x%s: unable to map registers pcscp%s: can't create dma maps %s: unable to allocate memory for the MDL, error = %d %s: unable to map the MDL memory, error = %d %s: unable to map_create for the MDL, error = %d %s: unable to load for the MDL, error = %d dmaintr: discarded %d bytes (tcl=%d, tcm=%d) dmaintr: tcl=%d, tcm=%d, tch=%d; trans=%d, resid=%d pcscp_dma_intr: empty esp FIFO of %d %s: dma_intr: DMA aborted. %s: error: DMA error detected; Aborting. pcscp dmaintr: DMA wasn't active%s: unable to load dmamap, error = %d pcib%s: %s (rev. 0x%02x) pcibattachisa at %s%s: %s channel interrupting at irq %d pre 1.02.0usb: USB revision %s, not supported usb_attach%s: root device is not a hub %s: root hub problem, error=%d usbtaskunable to create task thread usb_create_event_thread task%s: unable to create event thread for usb_create_event_threadusbevtusbtskusb at %susbreausbreadusbd_add_dev_eventusbd_add_drv_eventusb_add_eventusb_detachusbdet%s: event thread didn't die usbsynusbd_transfer: not doneusbd_start_next: error=%d usb_detach_wait: %s didn't detach HomeConnectBluetooth3C19250 Ethernet3CRSHEW696HomeConnect 3C460U.S.Robotics 56000HomeConnect 3C460BU.S. Robotics3Com OfficeConnect Analog Modem3Com U.S. Robotics Pro ISDN TA3Com HomeConnectAboCom SystemsXX1XX2URE450 EthernetUFE1000 Fast Ethernet1/10/100 ethernetXX4XX5XX6RTL8151XX7XX8XX9XX10BWU613Accton TechnologyUSB320-EC Ethernet2664WT-Sinus 111 WLANSpeedStream EthernetWarplinkAcer PeripheralsAcerscan C310UAcerscan 320UAcerscan 640UAcerscan 620UATA/ATAPIAWL300AWL400Actiontec ElectronicsPrism2.5 WLANPrism2.5 WLAN AROPEX FreeLan 802.11b802UAT1ACTiSYSACT-IR2000U FIRActiveWireI/O BoardI/O Board, rev. 1AWN-8020 WLANAddonics TechnologyAWU-120AN986A EthernetAN986 EthernetAN8511 EthernetAN8513 EthernetAN8515 EthernetADS TechnologiesUBS-10BT EthernetAEIAgate TechnologiesQ-DriveAGFA-GevaertSnapScan 1212USnapScan 1236USnapScan TouchSnapScan e40SnapScan e50SnapScan e20SnapScan e25SnapScan e26SnapScan e52AirprimeAirPrime CDMA Wireless EVDO cardAincommAWU2000BPheenetWM-168bAladdin Knowledge SystemsUSB-HASP 0.06Alcor MicroMacAlly Kbd HubAU9814 HubMicroConnectors/StrongManNEC Kbd HubAllied Telesyn InternationalAT-USB100Altec LansingADA70 SpeakersASC495 SpeakersAmbit MicrosystemsAmerican Power ConversionBack-UPS Pro 500Eagle IEagle IIEagle IICEagle IIIAnchor ChipsEZUSBEZLINKAOXApple ComputerOptical mouseSpeakersAraneus Information SystemsTrue Random Number GeneratorAsahi OpticalPENTAX Optio230AsanteAskey ComputerWLL013 (Intersil)WLL013Voyager 1010ASIX ElectronicsUSB 2.0 10/100 ethernet controllerAX88178ASUSRT2570ASUSTeK ComputerWL-140ATEN International10Mbps EthernetUC-110T EthernetUC210T EthernetDSB-650CUSB Cable 205AtmelUHB124 hubW-Buddie WN210DWL-900AP Wireless access pointAT76C503 (Intersil 3861 Radio)AT76C503 (Intersil 3863 Radio)AT76C503 (RFMD Radio)AT76C505 (RFMD Radio)AT76C505 (RFMD 2958 Radio)AT76C505A (RFMD 2958 Radio)AT76C505AS (RFMD 2958 Radio)Audio-TechnicaATC-HA4USB USB headphoneUSB Audio SpeakerAveratecAvision1200UB&B ElectronicsuLinks RS-422/485F5U002 ParallelF5D6050 802.11b Wireless adapterFBT003v2 BluetoothF5U103 SerialF5U109 SerialF5U409 SerialUSB to LAN ConverterF5U237 USB 2.0 7-Port HubF5U120-PC HubF5D7050 54g USB Network AdapterBillionton SystemsUSB100N 10/100 EthernetUSB100LPUSB100ELUSBE100USB2AR EthernetBCM2033BCM2033 (no fw)Brother IndustriesHL-1050 laser printerBehavior Tech. ComputerKeyboard/MouseCANOSCAN N656UCANOSCAN N670UPowerShot S10PowerShot S20PowerShot S100PowerShot G1PowerShot A20Computer Access TechnologyNetmate EthernetNetmate2 EthernetUSB Chief Bus & Protocol AnalyzerAndromeda hubCASIOQVBE-300 PDACASIO Nameland EZ-USBCCYU TechnologyEasyDisk PortableCherry MikroschalterMy3000 keyboardMy3000 hubChic TechnologyCypressChicony ElectronicsKB-8933 keyboardCH ProductsPro ThrottlePro PedalsFighterstickFlight Sim YokeCisco-LinksysiPAQ PocketPCA1500iPAQ WLANW100WLAN MultiPort W200Personal Jukebox PJB100SnapPort EthernetConceptronicC11UWL-210C54RU WLANConcord CameraEye Q 3xConnectixQuickCamEther USB-TFEther USB-TXWirelessLAN USB-11FEther USB-TXSWireless LAN Stick-11FEther USB2-TXULUSB-11 KeyWLAN USB Stick 11FEther USB-TXCNomad IINomad II MGNomadVoip BlasterCambridge Silicon RadioBlueCoreChuntexEx1300 hubCypress SemiconductorthermometerKeyboard/HubFM RadioUSB2 HubDaisy TechnologyPhotoClipDallas SemiconductorJ-6502 speakersUSB-FOB/iBUTTONTrueMobile 1180 WLANDiamondRio 500Dick Smith ElectronicsWL-200UCHUSB 611GWL-240UXH1153 802.11bDigi InternationalAccelePort 2AccelePort 4AccelePort 8Digital StreamPS/2 ActiveD-Link10/100 ethernetDWL-120 rev EDWL-122DWL-120 rev F10Mbps ethernetDMIStorage AdapterEasyDiskFlash DiskEicon NetworksDiva 852 ISDN TAEIZOhubmonitorELCON SystemtechnikGoldpfeil P-LANElecom29UOLD-USB/TXLD-USBL/TXUC-SGT SerialUC-SGT0 SerialELSAMicrolink USB2EthernetEntrega1S serial2S serial1S25 serial4S serialE45 EthernetCentronics1S9 serialEZ-USB2U4S serialSeiko EpsonUSB PrinterISD Smart Cable for MacISD Smart CablePerfection 636U / 636PhotoPerfection 610Perfection 1200U / 1200PhotoExpression 1600Perfection 1640SUPerfection 1240U / 1240PhotoPerfection 640UPerfection 1650GT-9700FPerfection 2400Perfection 1260Perfection 1660e-TEK LabsExtended SystemsXTNDAccess IrDAFalcom Wireless Communications GmbHFalcom Twist USBFreecomConnector for DVD driveFuture Technology Devices8U232AM Serial2232C SerialPS/2 Keyboard/MouseMatrix Orbital MX200 Series LCDMatrix Orbital LK202-24 LCDMatrix Orbital LK204-24 LCDCrystalfontz CFA-631 LCDCrystalfontz CFA-632 LCDCrystalfontz CFA-633 LCDCrystalfontz CFA-634 LCDSEMC DSS-20 SyncStationFuji Photo FilmMass StorageFujitsuAH-F401U Air H deviceGarmin InternationalIque 3600Genesys LogicGeneLink Host-Host BridgeGL650 HubGL641USB CompactFlashGIGABYTEGN-BR402WGN-WLBM101GN-WBKGGigasetGoHubsGoCOM232 Serial converterGood Way TechnologyGWUSB2EAdvanced Gravis ComputerGamePad ProGREENHOUSECF-writer/MP3 PlayerGriffin TechnologyiMate, ADB adapterGude ADSExpert mouseCLOCK USBGuillemotDA LeaderHWGUSB2-54 WLANHagiwara Sys-ComFlashGate SmartMediaFlashGate CompactFlashFlashGateHAL CorporationCrossam2+USB IR commanderHandspringHandspring VisorHandspring TreoHandspring Treo 600Hauppauge Computer WorksWinTV FMHawkingUF200 EthernetHitachiDVD-CAM DZ-MV100A CamcorderHewlett PackardDeskJet 895CScanjet 4100CPhotosmart S20DeskJet 880CScanJet 4200CCD-Writer PlusMultimedia Keyboard HubHN210WScanJet 6200CPhotoSmart S20DeskJet 815CScanJet 3300CCD-Writer Plus 8200eDeskJet 1220CDeskJet 810C/812CScanjet 4300CCD-Writer+ CD-4eOfficeJet G85xiLaserJet 1200Scanjet 5200CDeskJet 830CScanJet 3400cseDeskJet 885CScanjet 6300CDeskJet 840cScanJet 2200CScanjet 5300CDeskJet 816CDeskjet 970CseScanjet 5400CDeskjet 959CDeskJet 930cInkjet P-2000UDeskJet 640cPhotosmart P1100HN210E EthernetiPAQ 22xx/Jornada 548Jornada 568PhotoSmart C500OpticalCD-ROMIiyamaImationFlash Go!Inside Out NetworksEdgePort/4 RS232Hubport/7Rapidport/4Edgeport/4 RS232Edgeport/2 RS232Edgeport/4 RS422Edgeport/2 RS422/RS485Hubport/4Hand-built Edgeport/8MultiTech version of RP/4Edgeport/(4)21 ParallelEdgeport/421 Hub+RS232+ParallelEdgeport/21 RS232+Parallel1/2 Edgeport/8Edgeport/2 RS232/DINEdgeport/4 RS232/DIN1/2 Edgeport/16Edgeport CompatibleEdgeport/8 RS422OEM deviceIn-System DesignUSB2 StorageIDE ISD110IDE ISD105Portable USB Harddrive V2USB cableUSB Storage Adapter V2EasyPCAP310 AnyPoint IIWireless 2011B82930 test boardPrism2.x WLANValueCANNeoVI BlueI/O DataUSB-SSMRW SD-cardUSB-SDRW SD-cardUSB ETTUSB ETTXUSB WN-B11USB Airport WN-B11RSAQ1 SerialI-O DataUSB2.0-SCSI Bridge USB2-SCIomegaZip 100Zip 250CDRW 9602iRiveriFP-1xxiFP-3xxiFP-5xxJatonJenoptikJD 350Japan Radio CompanyAirH"PHONE AH-J3001V/J3002VJVCMP-XP7250 Builtin WLANMP-PRX1Kawasaki LSIKawatsu SemiconductorMiniHub 4000PKC-180 IrDAKeisokugikenHKS-0200 USBDAQKensingtonOrbit trackballTurboBallOrbit trackball for MacVideoCAM VGAKeyspanUSA-28 serialUSA-28X serialUSA-19 serialUSA-18 serialUSA-18X serialUSA-19W serialUSA-49W serialUSA-19QI serialUSA-19Q serialUSA-28X/XB serialUSA-28XB serialUSA-28XA serialUSA-18XA serialUSA-19WQ serialUIA-10 remote controlUIA-11 remote controlKingston TechnologyKNU101TX EthernetEastman KodakDigital Science DC220Digital Science DC260Digital Science DC265Digital Science DC290Digital Science DC240Digital Science DC280EasyShare DX4900KonicaKYE SystemsNiche mouseGenius NetScroll mouseFlight 2000 joystickColorPage Vivid-ProKyoceraAH-K3001VLaCieHard DiskCD R/WLexar MediajumpSHOT CompactFlash2662W-ARLexmark InternationalOptra S 2450Camedia MAUSB-2USB10TXUSB10T EthernetUSB100TX EthernetUSB100H1 Ethernet/HPNAUSB10TA EthernetWUSB11 802.11bWUSB11 802.11b v2.5WUSB12 802.11b v1.1WUSB11Network Everywhere NWU11BWUSB11 v2.8WUSB11 v3.0LogitechM2452 keyboardM4848 mousePageScanQuickCam WebQuickCam ProQuickCam ExpressQuickCam Pro 3000QuickCam Notebook ProQuickCam Pro 4000N43N48 mouseM-BA47 mouseWingMan Gaming MouseBD58 mouseiFeel MouseWingMan GamePad ExtremeWingMan RumblePadWingMan Force joystickWingMan Formula Force GP (GT-Force)iTouch KeyboardUSB-PS/2 TrackballTrackMan WheelCordless mouseCordless keyboardCordless Desktop OpticalLCS-8138TXLucentUSS-720 evaluation kitMacallyMCTD-Link DU-H3SP BAY HubRS232 InterfaceSitecom RS232ML-4500MelcoLUA-TX EthernetLUA2-TX EthernetLUA-KTX EthernetWLI-USB-S11MCR-SM2 SmartMediaUSB-IDE Bridge: DUB-PxxGWLI-USB-KS11G wlanLUA-U2-KTX EthernetWLI-USB-KB11 WLANWLI-U2-KG54-YB WLANWLI-U2-KG54 WLANWLI-U2-KG54-AI WLANMetricomRicochet GSMicro Star InternationalMicronet CommunicationsSP128AR EtherFastSideWinder Precision ProIntelliMouseNaturalDigital Sound System 80Sidewinder Precision Racing WheelTrackball ExplorerIntelliEye mouseInternet Keyboard ProMN510 WirelessMicrotechSCSI-DB25SCSI-HD50CameraMateFreecom IDEMicrotekPhantom 336CX - C3ScanMaker X6 - X6UPhantom C6ScanMaker V6USLScanMaker V6ULMidimanMidisport 2x2Minds At WorkDigital WalletMinoltaDimage S304Dimage XDimage 7iDimage A1MitsumiCD-R/RW DriveMouseFDDMobilityEasiDock EthernetMC141555 hub controllerT720cSB4100 Cable ModemMultiTechMT5634ZBA modemMustek Systems1200 CU600 CU1200 UB1200 Plus1200 CU PlusBearPaw 1200FMDC-800DV2000M-SystemsDiskOnKeyNational InstrumentsGPIB-USB-ANational SemiconductorBearPaw 1200BearPaw 2400RepeaterPicty760Picty900Picty920Picty800USB2.0 HubNeodio6-in-1 Flash Device ControllerMulti-format Flash ControllerNetChip TechnologyTurbo-ConnectClik! 40BayNETGEARUSB 2.0 Fast EthernetMA101MA101 Rev B802.11b802.11b V2NikonE990E880E885NHJOlympusC-1C-700 Ultra ZoomUSB TO EthernetOmniVisionOV511OV511+OnSpecMDCFE-B CFMemory Stick+CFDatafab-basedPNY/Datafab CF+SMSimple Tech/Datafab CF+SMCF + SM Combo (LC1)Datafab MD1-II PC-Card8In2OQOmodel 01 WiFi interfacemodel 01 Bluetooth interfacemodel 01 Ethernet interfaceOurs TechnologySolid state diskPalm ComputingUSB Serial AdaptorPalm m500Palm m505Palm m515Palm i705Palm Tungsten ZPalm m125Palm m130Palm Tungsten TPalm Zire 31Palm ZirePanasonic (Matsushita)LS-120MultiMediaCardPen Drive6 in 13 in 1Peracom NetworksSerial ConverterAt-Home EthernetWL-503IADSS 350 Digital Speaker SystemDSS XXX Digital Speaker SystemPCA645VCPCA646VCPCVC675K VestaPCVC680K Vesta ProPCVC690K Vesta Pro Scan CameraPCVC730K ToUCam FunPCVC740K ToUCam Pro PCPCVC750K ToUCam Pro ScanDSS 150 Digital Speaker SystemDIVA mp3 playerPhilips SemiconductorsP.I. EngineeringPS2 to MacXkeys Programmable KeyboardPilotechCRW-600 6-in-1Planex CommunicationsGW-US11H WLANGW-US11S WLANPlantronicsPlatronics DSP-400 Headsettest boardPortGearPortsmithExpress EthernetPQITravel Flash DrivePrimax ElectronicsG2-200G2E-300G2-300Colorado 9600Colorado 600uVisioneer 6200Colorado 19200Colorado 1200uG2-600ReadyScan 636iG2E-600ComfortMouse-in-a-BoxSony PCGA-UMS1Prolific TechnologyPL2301 Host-Host interfacePL2302 Host-Host interfacePL2303 SerialParallel printerATAPI-4 Bridge ControllerPL2501 Host-Host interfacePutercomUSB-1284 BRIDGEQtronixScorpion-980NQualcommCDMA MSM modemCDMA MSM phoneQuickshotUSB StrikePadRainbow Technologiesi-Key 2000Ralink TechnologyRATOC SystemsUSB serial REX-USB60RTL8150RTL8151 PNARTL8187RolandUA-100 Audio I/FUM-4 MIDI I/FSC-8850 MIDI SynthU-8 Audio I/FUM-2 MIDI I/FSC-8820 MIDI SynthPC-300 MIDI KeyboardUM-1 MIDI I/FSK-500 MIDI KeyboardSC-D70 MIDI SynthUM-880 MIDI I/FSD-90 MIDI SynthUM-550 MIDI I/FSD-20 MIDI SynthSD-80 MIDI SynthUA-700 Audio I/FRockfiregamepad 203USBSaitekCyborg 3D Gold JoystickSanDiskImageMate SDDR-05aImageMate SDDR-31ImageMate SDDR-05ImageMate SDDR-12ImageMate SDDR-09ImageMate SDDR-75Sanwa SupplyJY-DV9USB gamepadSanyo ElectricSanyo SCP-4900 PhoneSWL-2100UScanLogicSL11R-IDESealevel SystemUSB-Serial converterRoot HubSilicon GraphicsSN1 L1 System ControllerSharkPocket AdapterSharpSL5500A300SL5600C700C750Shuttle TechnologyE-USB BridgeeUSCSI BridgeImageMate SDDR09eUSB SmartMedia / CompactFlasheUSB MultiMediaCardSony HifdeUSB ATA/ATAPIeUSB CompactFlashCD-RW DeviceSCM MicroSpeedStreamSpeedStream 1022SigmatelDatum Networks SSF-7X Multi PlayersDigiFilm-ComboMULTICARDREADERSilicomU2EPsion Dacom Gold Port EthernetSilicon PortalsYAP Phone (no firmware)YAP PhoneSirius TechnologiesNetComm Roadster II 56SitecomLN029WL-022CN104SmartBridgesSmartLink EthernetsmartNIC 2 PnPStandard MicrosystemsEZ Connect EthernetEZ Connect 11MbpsEZ Connect 11Mbps v2SOHOwareNUB100 EthernetNUB110 EthernetSolid YearSony DSC CamerasMemorystick NW-MS7Harddrive V2Memorystick MSAC-US1HandycamSony MSC Memorystick SlotClie v3.5PlayStation2 keyboardPlayStation2 keyboard hubPlayStation2 mouseClie v4.0Clie v4.0 Memory Stick slotSony Clie s360Clie v4.1 Memory Stick slotClie v4.1Sony Clie nx60Sony Clie tj25SOURCENEXTKeikaiDenwa 8KeikaiDenwa 8 with chargerSphairon Access Systems GmbHUB801RSTMicroelectronicsCommunicatorSTSNInternet Access DeviceSun CommunicationsMobile AdaptorSUN CorporationU-Cable type D2U-Cable type P1Slipper UIr-TrinityU-Cable type A3U-Cable type A4Sun MicrosystemsType 6 KeyboardType 6 MouseSystem TalksSGC-X2ULDiamond (Supra)Supra Express 56KSupraMax 2890 56KRio 600Rio 800Nike psa[play 120Surecom TechnologyAcer Communications & MultimediaEP-1427X-2 EthernetSusteenEricsson DCU-10/11TangtopUSBPS2Taugagreining HFCameraMate (DPCM_USB)TDKUSB-PDC Adapter UPA9664USB-cdmaOne Adapter UCA1464USB-PHS Adapter UHA6400USB-PHS Adapter UPA6400TEACFD-05PUBTekram TechnologyALLNET 0193 WLANZyXEL ZyAIR B200 WLANU-300CTelex CommunicationsMicrophoneUT-USB41 hubTUSB2046 hubNex II DigitalThrustmasterFusion Digital GamepadTodos Data SystemArgos Mini SmartcardTrek TechnologyThumbDriveThumbDrive 8MBTripp-LiteU209 SerialTrumpion MicroelectronicsUSB/MP3 decoderXXX 1100TsunamiSM-2000Ultima1200 UB PlusUMAX Data SystemsAstra 1236UAstra 1220UAstra 2000UAstra 2100UAstra 2200UAstra 3400Universal AccessPanache Surf ISDNUSR1120 WLANUSR9000 SureConnect ADSLViewSonicG773 Monitor HubP815 Monitor HubG773 Monitor ControlVLSI VisionCPiA CameraVisioneerOneTouch 7600OneTouch 5300Scanport 3000OneTouch 6100OneTouch 6200OneTouch 8100OneTouch 8600VivitarDSC350VTechOptionVodafone Mobile Connect 3GGlobeTrotter 3G FUSIONGlobeTrotter 3G QUADWACOMCT-0405-U TabletGraphireIntuos A5XirlinkImaging DeviceIBM PC CameraY-E DataFlashbuster-UUX256 MIDI I/FUX96 MIDI I/FRP-U200NetVolante RTA54iNetVolante RTW65bNetVolante RTW65iNetVolante RTA55iYanoU640MO-03Z-ComM4Y-750XI-725/726XI-735ZinwellZoom Telephonics2986L Fax ModemZyXEL CommunicationOmni 56K PlusADI SystemsAdvanced Micro DevicesNANAOAlps ElectricAMPAmerican MegatrendsMethode Electronics Far EastMaxi SwitchLockheed Martin Energy ResearchToshiba AmericaMicro Macro TechnologiesLite-On TechnologyTatung Co. Of AmericaMyson TechnologyDigiITT CanonAnnabooksAztech SystemsAdvanced Connectek USAALTRAATI TechnologiesAsahi Kasei MicrosystemsBAFO/Quality Computer AccessoriesA-Trend TechnologyAdvanced Input DevicesBrainboxesAxiohm Transaction SolutionsSymbol TechnologiesFuji ElectricKeithley InstrumentsEIZO NanaoFFCAnko ElectronicAOC InternationalBarco Display SystemsBridge InformationBio-Rad LaboratoriesAct LabsAlarisApexAcer Semiconductor AmericaAiwaACARD TechnologyAlcatel TelecomAsia Microelectronic DevelopmentBizlink InternationalAashima TechnologyAlcatel MicroelectronicsBoston AcousticsAureal SemiconductorBrimaxAxis CommunicationsABL ElectronicsAlfadata ComputerNational Technical SystemsOnntoBeAPG Cash DrawerB.U.G.AVerMedia TechnologiesAptio ProductsArasan Chip SystemsAllied CableBroadLogicAction Star EnterpriseADESSO/Kbtek AmericaAPT TechnologiesBoca ResearchAndrea ElectronicsBurr-Brown Japan2WireAIPTEK InternationalAuthenTecAlation SystemsAmerican Biometric CompanyBlueWater SystemsAgilent TechnologiesAdirondack Wire & CableBeckhoffAltius SolutionsArris InteractiveACTIVCARDA-FOUR TECHAIMEXAddonics TechnologiesAKAI professional M.I.ARESCOMBay AssociatesAlteraBoca SystemsGeocast Network SystemsKurusugawa ElectronicsABCNORMAL_COMPLETIONIN_PROGRESSPENDING_REQUESTSNOT_STARTEDINVALNOMEMCANCELLEDBAD_ADDRESSIN_USENO_ADDRSET_ADDR_FAILEDNO_POWERTOO_DEEPIOERRORNOT_CONFIGUREDTIMEOUTSHORT_XFERSTALLEDINTERRUPTEDXXX%x.%02x, class %d/%d, rev , addr %dusbd_devinfousbdly0 lengthout of datausbd_fill_iface_data: bad descriptor(s): %s iface descusbd_set_config_index%s: device addr %d (config %d) exceeds power budget, %d mA > %d mA %s: port %d, set config at addr %d failed %s: No free USB addresses, new device ignored. usbd_new_device: cannot find HS portusbd_print%s, %s configuration %d interface %d port %d%s: at %s (addr %d) disconnected %s: %d port%s with %d removable, %s poweredmultiplesingle, %s transaction translator%s%s: bus powered hub connected to bus powered hub, ignored %s: no interface handle %s: no endpoint descriptor %s: bad interrupt endpoint %s: port %d power on failed, %s %s: cannot open interrupt pipe %s: no ports, hub ignored uhub%s: hub depth (%d) exceeded, hub ignored uhub_attach%s: port %d reset failed %s: device problem, disabling port %d %s: strange, connected port %d has no power %s: illegal enable change, port %d %s: port error, giving up port %d %s: port error, restarting port %d hid_start_parsedefault bType=%d Local bTag=%d Main bTag=%d Global bTag=%d BAD LENGTH %d uhidev%s: %s, iclass %d/%d %s: could not read endpoint descriptor %s: unexpected endpoint %s: no report descriptor %s: no memory %s: %d report ids uhid at %s reportid %duhidev_intr: bad repid %d uhidev_set_report_asyncukbd %s: attach failed, %s %s: was console keyboard This port is broken, it does not call cnpollc() before calling cngetc(). This should be fixed, but it will work anyway (for now). too many modifier keysbad modifier sizemultiple key code arrays key codes not on byte boundarytoo many key codeskey code size != 8umassCBIBulk-OnlyRBC%s: using %s over %s %s: bus attach failed %s: command protocol=0x%x not supported %s: isdata not configured %s: unable to get Max Lun: %s UFIISD-ATACBI with CCI%s: got polled xfer %p, but %p already pending %s: BBB bulk-%s stall clear failed, %s %s: Invalid CSW: sig 0x%08x should be 0x%08x %s: Invalid CSW: tag %d should be %d %s: Invalid CSW: status %d > %d %s: Phase Error, residue = %d %s: BBB reset failed, %s %s: BBB bulk-in clear stall failed, %s %s: BBB bulk-out clear stall failed, %s %s: transferred %d bytes instead of %d bytes%s: Unknown state %d%s: CBI bulk-in/out stall clear failed, %s %s: CBI intr-in stall clear failed, %s %s: CBI reset failed, %s %s: CBI bulk-in stall clear failed, %s %s: CBI bulk-out stall clear failed, %s %s: Get Max Lun failed: %s umass_cmd: large datalen, %d %s: Unknown status %d in umass_scsi_cbaue%s: EEPROM read timed out %s: MII read timed out %s: reset failed %s: setting config no failed auemii%s: getting interface handle failed %s: missing endpoint %s: couldn't get endpoint descriptor %d %s: %u usb errors on intr: %s %s: %u usb errors on rx: %s %s: usb error on tx: %s %s: aue_send error=%s %s: tx list init failed %s: rx list init failed %s: open intr pipe failed: %s %s: open tx pipe failed: %s %s: open rx pipe failed: %s %s: close intr pipe failed: %s %s: abort intr pipe failed: %s %s: close tx pipe failed: %s %s: abort tx pipe failed: %s %s: close rx pipe failed: %s %s: abort rx pipe failed: %s cue%s: read MAC address failed %s: couldn't get ep %d %s: cue_send error=%s kue%s: warm boot, no firmware download %s: cold boot, downloading firmware %s: failed to load trigger segment: %s %s: failed to load fixup segment: %s %s: failed to load code segment: %s %s: loading firmware failed %s: could not read Ethernet descriptor %s: no memory for multicast filter buffer %s: kue_send error=%s wsdisplay%s: screen %d-%d added (%s, %s emulation) %s: screen %d deleted wsdisplay at %s mux %d: console (%s, %s emulation), using %sdmuxwsdisplay_common_attach: no memorywsdisplaytty() on ctl devicewsdisplay_switch3: giving up wsdisplay_switch3: screen %d disappeared wsdisplay_switch3: not switching wsdisplay_switch3: invalid screen %dwsdisplay_switch2: giving up wsdisplay_switch2: screen %d disappeared wsdisplay_switch2: not switching wsdisplay_switch2: invalid screen %dwsdisplay_switch1: screen %d disappeared wsdisplay_switch1: not switching wsdisplay_switch1: invalid screen %dwswaitwsmoused_sleepwscons: copybuffer memory malloc failed wsemul_vt100_output_c0c1: ESC in kernel output ignored \[>24;20;0cP0!u%5\wsemul_vt100_handle_csi[?62;6c[%d;%dR[?13n[?21n[?27;1nP2$uwsemul_vt100_handle_dcs: bad type %d[11~[12~[13~[14~[15~[17~[18~[19~[20~[21~[23~[24~[25~[26~[28~[29~[31~[32~[33~[34~OPOQOROSOpOqOrOsOtOuOvOwOxOyOIOMOD[7~OBOCOA[8~[6~[3~[2~[5~[4~[1~OjOkOlOmOnOowsevent_readwskbdwskbd at %s%s: attach error=%d : console keyboardcannot load keymapwskdetwskbd_detach: %s didn't detach %s: event queue overflow %s: connecting to %s %s: disconnecting from %s wskbd_get_mapentry: %d(%d): bad entrywskbd_load_keymap: %d(%d): bad entrywskbd_load_keymap: %d: recursion too deepwsmux: attach out of memory wsmux_getmux: no memory for mux %d wsfont_unlock: font not lockedpckbdprobe: reset response 0x%x pckbd_enable: command error pckbd_disable: command error pckbd _cd'(r 4YYYYYYYYZZZZ ZZ(Z)8Z@ZHZPZ\ZdZhZ 4&'./$#! *+.-4)(% ,D]_\]_<$^_<^_a_a_<a_p<a_pXa_b_b_(b_@b_c_c_< d_d_ e_4e_<e_e_<|f_,f_Tf_lf_f_f_f_ g_ __t_0_D_\_p____ȇ___ _ _ _ _L!_d!(_!@_`!__!Đ_ܐ_!__!_!4_!\_t_!ܑ_(!_<! _$!$_!<_T_!__!_<&<_<&P_<_'_'_5L0_'7H_'7h_'\8|_'__7__:__@pZxZZ< 5 /|'ᅠ" <  !!!!!!!"-"/""")"H"a"d"e"## #!#%% %%%%%$%,%4%<%P%Q%R%S%T%U%V%W%X%Y%Z%[%\%]%^%_%`%a%b%c%d%e%f%g%h%i%j%k%l%%%%%%%%%%%%%%%%% %% :&;&<&@& B& `&c&e&f&j& k&-"*"U<"~# # # #)#<*#>-_ { }xYYvw E--   <<cr39AAAAEEEIIIIDOOOOUUUYaoybuiltin@ `P0p@h0[ $( ,h6677l87@_` ```$`,`4`<`D`P`\`h`p`x````` a@,a@aTa@ha |a`aaaa aabB b b (b 0b8b @bHbPb %Tb0+\b@2`bP8db`>hbpDlbTw33Lynn~~~~~~~~~~~)+-/13579;=?ACEGIKMOQSUWY[]_acegikmoqsuw ! ԏLUUt&`H@?@@`THIS is A memory TEST patternu%Kuuv𮭨@H4     tPT$48<p\dh! "##l!!H'@+d+P/8. @ @   )<@2  jahd?ī D̫Cx CԫC0 CܫC$D4DnTDGFFF G $G( C  m<1P TS 1 B @  \N [  (^  1 1L1 8 ,1 s Lps f } {U PY Z <; 1\1aT1 tl 1D pB(n R  pX  n B 111111nn1xx $z ({11 dpp u11s111b1 @dF1h   d j 111hZ ew4f1 1111 1 11dpz1 < <@p a \ 1,h 11}O otwxmk l b 1q 111111h; 1 11111ؓ 111118G 111L1111111o Tq 111111$1111111W  t< = L{@H 1\M p r (}} \~1111111  p  1 nd<11V |mHW hL 111HPX`lԗ؃0D++++, +  0 22(3,,,,,d@B R<P0-  ` l(4ep&x|p8dt`RRWZ_<`d,aatd$etde8fhffXhFxjjttyclsttyopnttybgttyinttyoutDkT̾lL9999̾99@9999̾99@9999̾99@9999̾99@9999̾99@9999̾99@ 00 xh400DHKDHII0KP+ffs+ext2fss"cd9660<(msdos)nfs d13$QQ,R<<=>NOOl  4!<@SXTT2lockf@`  3 4 :60/ |8/ 8 :89X981 3bH3w px { | D} xy } d34 <4 h4 4 4 4 5 D5 (p545@5 L5X 6 dL6tx666 7 07 h7 7 7 7 8 H8t8 88 $8 0$9 <P9H|9X9d9t:(:3:,:34D4p4444 5L5x5555(6T6666 7D7p7777$8P8|8889,9X99993 4 D4 p4 4 4 :4؉ 5؉ L5؉ x5 5P 5 (6ԇ 6 :6 7 D7 p7 7 7 7؉ $8؉ P8 |8 :8 :8 9,9| :܇ X9 39؉ 9؉ ,: :b:3 4 D4( p4( 4 4 4 5 L5 x5t 5L 5 :5 (6 T6@ 6X6 :6( 7( D7( p7( 7( 7( 7( $8( P8( |8d 8ܓ 89,9 :( X9l 39 9 ,: :b < d ė devopndeviodevwaitdevindevoutdeviocdevcls3 4| D44 p44 4 4 4, 5, L5, x5 58 5 :5 (6 T6X 6X6 64 74 D74 p74 74 74 74 $84 P84 |8 8 :89,9P : X9( 39h 9 ,:Tb=. .. 3 4| D4 p4 4 4 4 5 L5l x5 5 5 :5 (6 6 6d 7 D7 p7P 7D" 7# 7H# $8, P8\|8 8 8, 98, ,9l, :, X9. 3\, 9/ 9L/ 9, ,:T b? M O 20123456789abcdef^^3333t< 8 #$%&'()*+ʚ;,-.ʚ;/ʚ;0ʚ;1@BC =D$E =F$cde@B@B@KLاO[@T6nQ%l7Jpp@@@@j j j @ pBB L  < BB,2HE@ е HE d T HE,0 dd  w P l ^  HE l HEw l r 0 HE` l HE)` l HE* l p) d3 L5 HE l t ptCHE dX|EEEEE}E#(D<8Q @X,HFLFTF`F`CdChClCxFFDFF F$F(F,F0F8F4F?m=~#C I~#CF#~#C9 )~#C*u~#C ~#C HB !~#C/~#C/~#C/k H!~#CG0~#CG0~#CG0eIu!~#C50~#C50~#C50!~#Cb2~#Cb2~#Cb2i !~#C2~#C2~#C2쩩!~#C%3~#C%3~#C%3n!~#Cs4~#Cs4~#Cs4!~#C5~#C5~#C5MY2!~#C=6~#C=6~#C=6kUh!~#C6~#C6~#C6 !~#CC8~#CC8~#CC8]!~#Cٟ8~#Cٟ8~#Cٟ8:x!~#C9~#C9~#C9b"!~#Ci:~#Ci:~#Ci:/o!~#C3;~#C3;~#C3;7 2!~#C~#C~#C!~#C-1~#C-1~#C-1q!~#CZb~#CZb~#CZbl@!~#C~#C~#C "3c!~#C~#C~#C ӳC0!~#C~#C~#C !~#CJ]~#CJ]~#CJ] zC!~#Cw~#Cw~#Cw K!~#C'~#C'~#C' aQ!~#C~#C~#C j8!~#C~#C~#C  !~#Ch ~#Ch ~#Ch 8a!~#C ~#C ~#C G!~#C+S ~#C+S ~#C+S AD!~#C ~#C ~#C ]!~#C ~#C ~#C tU!~#C ~#C ~#C z!~#C~#C~#C!~#CI~#CI~#CID*!~#Cv~#Cv~#Cv[B!~#C I~#C I~#C I!~#C~#C~#C_4z!~#C~#C~#CQn!~#Cf~#Cf~#Cf;!~#C~#C~#CM3"!~#C*u~#C*u~#C*u!~#C ~#C ~#C 8!~#C>~#C>~#C>PTY!~#C~#C~#Cs !~#C~#C~#C&!~#CG~#CG~#CGɛ!~#C9~#C9~#C9Y!~#C k~#C k~#C k2R!~#C~#C~#C$!~#C4~#C4~#C4jO!~#Ce~#Ce~#Cen!~#Ce~#Ce~#Ce4!~#C(~#C(~#C(!~#C/ ~#C/ ~#C/ B!~#C`!~#C`!~#C`!8!~#C!~#C!~#C!p<!~#C"~#C"~#C"˗!~#CF#~#CF#~#CF#l!~#C[$~#C[$~#C[$%t^!~#C %~#C %~#C %̬!~#C%&~#C%&~#C%&[!~#CV'~#CV'~#CV'X\!~#Cc'~#Cc'~#Cc'P!~#C(~#C(~#C(,Y؁!~#C')~#C')~#C') M0!~#CQ*~#CQ*~#CQ* D-!~#C+~#C+~#C+!`!~#C,~#C,~#C,!N/!~#C,~#C,~#C,"i!~#CD-~#CD-~#CD-"#!~#C}.~#C}.~#C}.#J9!~#C/~#C/~#C/#!~#CG0~#CG0~#CG0$X !~#C50~#C50~#C50$*!~#Cb2~#Cb2~#Cb2% ޿!~#C2~#C2~#C2%ZA!~#C%3~#C%3~#C%3&9!~#Cs4~#Cs4~#Cs4&Z)j!~#C5~#C5~#C5'Y+!~#C=6~#C=6~#C=6'S!~#C6~#C6~#C6(,!~#CC8~#CC8~#CC8( e!~#Cٟ8~#Cٟ8~#Cٟ8)"0!~#C9~#C9~#C9)N3 !~#Ci:~#Ci:~#Ci:*́$6!~#C3;~#C3;~#C3;*>Dw!~#C~#C~#C+ }!~#C-1~#C-1~#C-1+!~#CZb~#CZb~#CZb,Yn!~#C~#C~#C,!~#C~#C~#C-Z!~#C~#C~#C-(,a!~#CJ]~#CJ]~#CJ].;\!~#Cw~#Cw~#Cw.!~#C'~#C'~#C'/<!~#C;X~#C;X~#C;X/d!~#C~#C~#C0;!~#Ch ~#Ch ~#Ch 0!~#C ~#C ~#C 1TOp!~#C+S ~#C+S ~#C+S 1 E!~#CX ~#CX ~#CX 2mY!~#C ~#C ~#C 2x+(!~#C ~#C ~#C 3E!6?!~#C~#C~#C3lIu!~#CI~#CI~#CI4b9R!~#Cv~#Cv~#Cv4}Ha!~#C I~#C I~#C I5!~#C9z~#C9z~#C9z5d!~#C~#C~#C6ɠ!~#Cf~#Cf~#Cf6%9-!~#C~#C~#C7T!~#C*u~#C*u~#C*u7#!~#CW~#CW~#CW8"\!~#C>~#C>~#C>8>!~#Cp~#Cp~#Cp9xW!~#C~#C~#C9>!~#CG~#CG~#CG:>v!~#Ct~#Ct~#Ct:P!~#C k~#C k~#C k;d.!~#C8~#C8~#C8;?<!~#C4~#C4~#C4<HĖ!~#Ce~#Ce~#Ce<).U]!~#C~#C~#C=!~#C(~#C(~#C(=-F$`!~#CU ~#CU ~#CU aϕ!~#C`!~#C`!~#C`!!~#C"~#C"~#C" yb!~#C*#~#C*#~#C*#\!~#C[$~#C[$~#C[$G8!~#Cs$~#Cs$~#Cs$fLa~#C %~#C %~#C!~#C6&~#C6&~#Cba~#CV'~#CV'~#C/[!~#C(~#C(~#C@ga~#C )~#C )~#Cd"!~#C')~#C')~#CdIMa~#CT*~#CT*~#C!!~#C+~#C+~#CQ섅a~#C,~#C,~#C!~#CL-~#CL-~#CHJa~#CD-~#CD-~#ClD!~#Cq/~#Cq/~#CpI4*a~#C/~#C/~#CD!~#C50~#C50~#C3a~#Cx1~#Cx1~#C2"!~#C2~#C2~#CXLa~#CB3~#CB3~#C`8!~#C%3~#C%3~#Ccua~#CR 5~#CR 5~#CQ!~#C5~#C5~#C a~#C6~#C6~#Cr(!~#Cn7~#Cn7~#CRLUa~#CC8~#CC8~#CQDv!~#Cp89~#Cp89~#C{va~#C9~#C9~#C,!~#C3;~#C3;~#Cia~#C~#C~#Cop!~#C-1~#C-1~#C'ګ^a~#C~#C~#C!~#C~#C~#CEa~#C~#C~#C y!~#C,~#C,~#C kia~#CJ]~#CJ]~#C 20!~#C~#C~#C xtca~#C'~#C'~#C |l!~#C~#C~#C Na~#C~#C~#C A!~#Ch ~#Ch ~#C d4 a~#C! ~#C! ~#C cjT!~#C+S ~#C+S ~#C `#a~#C ~#C ~#Cx0!~#C ~#C ~#CVa~#C ~#C ~#C9!~#CN~#CN~#C:Nѹa~#CI~#CI~#Cht!~#C~#C~#Cwpa~#C I~#C I~#CRi!~#C~#C~#Cwa~#C9z~#C9z~#CSd !~#Cf~#Cf~#Cw"a~#CC~#CC~#C(!~#C*u~#C*u~#Cw`&a~#C ~#C ~#CÒ@J!~#C>~#C>~#Cw a~#C~#C~#Coa!~#Cp~#Cp~#Cwya~#CG~#CG~#CӒ!~#C9~#C9~#Cw;a~#C k~#C k~#C,!~#C~#C~#Cwa~#C8~#C8~#Cy=8!~#Ce~#Ce~#Cwi1a~#Ce~#Ce~#C!~#C(~#C(~#Cw4$a~#C/ ~#C/ ~#C>!~#CU ~#CU ~#CwݡIa~#C!~#C!~#Cw!~#C"~#C"~#Cw C}a~#CF#~#CF#~#Cw6/~!~#C[$~#C[$~#CwFa~#C %~#C %~#Cw+!~#C%&~#C%&~#CwB>'a~#C6&~#C6&~#Cwg-!~#Cc'~#Cc'~#Cw\_a~#C(~#C(~#Cwz!~#C')~#C')~#Cw;y_a~#CQ*~#CQ*~#C c&!~#CT*~#CT*~#C r!Ǭa~#C,~#C,~#C!Q!~#C,~#C,~#C!q*Ca~#CD-~#CD-~#C",!~#C}.~#C}.~#C"٫Xa~#Cq/~#Cq/~#C#; !~#CG0~#CG0~#C# a~#C50~#C50~#C$!~#Cb2~#Cb2~#C$|a~#C2~#C2~#C%LrX!~#CB3~#CB3~#C%iata~#Cs4~#Cs4~#C&M{!~#CR 5~#CR 5~#C;X&b9a~#C=6~#C=6~#C'b!~#C6~#C6~#C;X'Da~#CC8~#CC8~#C('U(!~#Cٟ8~#Cٟ8~#C;X(xRa~#Cp89~#Cp89~#C)!~#Ci:~#Ci:~#C;X)4a~#C3;~#C3;~#C*jv!~#C~#C~#C;X*Y|a~#C-1~#C-1~#C+ļ!~#CZb~#CZb~#C;X+a~#C~#C~#C,s2>!~#C,~#C,~#C;X, a~#C~#C~#C-f!~#CJ]~#CJ]~#C;X-;a~#Cw~#Cw~#C.u5!~#C'~#C'~#C;X.pma~#C;X~#C;X~#C/Ti'!~#C~#C~#C;X/a~#Ch ~#Ch ~#Ch 0| a~#Cv~#Cv~#Ch 4 4!~#C I~#C I~#Ch 4!a~#C9z~#C9z~#Ch 5>!~#C~#C~#Ch 5Ϳa~#Cf~#Cf~#Ch 6-!~#C~#C~#Ch 6Ĥa~#C*u~#C*u~#Ch 7:J?!~#CW~#CW~#Ch 7ОRa~#C>~#C>~#Ch 8T!~#Cp~#Cp~#Ch 8gw"a~#C~#C~#Ch 9^52!~#CG~#CG~#Ch 9X:a~#Ct~#Ct~#Ch :!~#C k~#C k~#Ch :΀a~#C8~#C8~#Ch ;_i!~#C4~#C4~#Ch ;a~#Ce~#Ce~#Ch <?%K!~#C~#C~#Ch <KYja~#C(~#C(~#Ch =t !~#CU ~#CU ~#Ch =*a~#C`!~#C`!~#Ch >!~#C"~#C"~#Ch >Z! Aa~#C*#~#C*#~#Ch ?"!~#CF#~#CF#~#Ch ?PgNGa~#Cs$~#Cs$~#C+S @-!~#C %~#C %~#C+S @1z`a~#C6&~#C6&~#C+S A N6!~#CV'~#CV'~#C+S Aa~#C(~#C(~#C+S BPx!~#C )~#C )~#C+S Bj\Va~#C')~#C')~#C+S C!~#CT*~#CT*~#C+S Cc a~#C+~#C+~#C+S D 8!~#C,~#C,~#C+S D~-Ua~#CL-~#CL-~#C+S E5!~#CD-~#CD-~#C+S Eƙa~#Cq/~#Cq/~#C+S F`!~#C/~#C/~#C+S F)ua~#C50~#C50~#C+S G&!~#Cx1~#Cx1~#C+S Gha~#C2~#C2~#C+S HՌNv!~#CB3~#CB3~#C+S Ha~#C%3~#C%3~#C+S Ip!~#CR 5~#CR 5~#C+S I a~#C5~#C5~#C+S JJ!~#C6~#C6~#C+S Ja~#Cn7~#Cn7~#C+S K,3!~#CC8~#CC8~#C+S K~J]a~#Cp89~#Cp89~#C+S LB!~#C9~#C9~#C+S LtKu a~#C3;~#C3;~#C+S M;!~#C~#C~#C+S MkKa~#C~#C~#C+S N<!~#C~#C~#C+S N a~#CZb~#CZb~#C+S OX!~#C~#C~#C+S OCa~#C,~#C,~#CX !~#CJ]~#CJ]~#C z҈a~#C~#C~#CX o.-!~#Cw~#Cw~#C ܁a~#C~#C~#CX A!~#C;X~#C;X~#C  1a~#Ch ~#Ch ~#CX 6V}!~#C! ~#C! ~#C @ѭla~#C ~#C ~#CX  ,!~#C ~#C ~#C ma~#CX ~#CX ~#CX !~#C ~#C ~#C :a~#CN~#CN~#CX !!~#C~#C~#C -[a~#C~#C~#C =!~#Cv~#Cv~#C Za~#C~#C~#C n!~#C9z~#C9z~#C жea~#C~#C~#C {X!~#CC~#CC~#C ހIa~#C~#C~#C l~!~#C ~#C ~#C xHa~#CW~#CW~#C "!~#C~#C~#C 7va~#Cp~#Cp~#C '-.F!~#C~#C~#C #a~#C9~#C9~#C !~#Ct~#Ct~#C +a~#C~#C~#C @!~#C8~#C8~#C Lea~#C4~#C4~#C g !~#Ce~#Ce~#C (9a~#C~#C~#CNehC!~#C/ ~#C/ ~#CNa~#CU ~#CU ~#CN!~#C`!~#C`!~#CN3ja~#C"~#C"~#CN !~#C*#~#C*#~#CN,a~#C[$~#C[$~#CNH%!~#Cs$~#Cs$~#CT$a~#C %~#C %~#CN !~#C6&~#C6&~#Cma~#CV'~#CV'~#CNh]!~#C(~#C(~#Ca~#C )~#C )~#CNTЎv!~#C')~#C')~#C da~#CT*~#CT*~#CN!~#C+~#C+~#C 1a~#C,~#C,~#CNh!~#CL-~#CL-~#CLa~#C}.~#C}.~#CNՇ!~#Cq/~#Cq/~#Cpo8a~#C/~#C/~#CN(Q !~#C50~#C50~#CMA a~#Cx1~#Cx1~#CN#9g!~#C2~#C2~#Ce欽a~#CB3~#CB3~#CN[|!~#C%3~#C%3~#C|a~#CR 5~#CR 5~#CNp۰!~#C5~#C5~#CfOja~#C6~#C6~#CN` !~#Cn7~#Cn7~#C@ 2a~#CC8~#CC8~#CNs!~#Cp89~#Cp89~#C|?a~#C9~#C9~#C l!~#C3;~#C3;~#C a~#C~#C~#C!!~#C-1~#C-1~#C!1a~#C~#C~#C"CJ!~#CZb~#CZb~#C"-a~#C~#C~#C#+A!~#C,~#C,~#C#XgTa~#CJ]~#CJ]~#C$Δ!~#C~#C~#C$QPa~#C'~#C'~#C% 4 i!~#C~#C~#C%rDa~#C;X~#C;X~#C&b!~#Ch ~#Ch ~#C&a~#C! ~#C! ~#C'\!~#C+S ~#C+S ~#C'>a~#C ~#C ~#C(g|!~#C ~#C ~#C($ga~#C ~#C ~#C) Ӧ!~#CN~#CN~#C)!a~#CI~#CI~#C*g!~#C~#C~#C*Sr6a~#C I~#C I~#C+!~#C~#C~#C+n+a~#C~#C~#C,p!~#Cf~#Cf~#C,a~#CC~#CC~#C-ip2!~#C*u~#C*u~#C-$a~#C ~#C ~#C.סI!~#C>~#C>~#Cv.|ʿa~#C~#C~#C/~!~#C~#C~#Cv/Ia~#CG~#CG~#C0f%.!~#C9~#C9~#C0a~#C k~#C k~#C1x!~#C~#C~#C1_-Ea~#C4~#C4~#C2$!~#Ce~#Ce~#C2Aa~#Ce~#Ce~#C3;!~#C(~#C(~#C3~&Ma~#C/ ~#C/ ~#C4Yc!~#C`!~#C`!~#C4Ha~#C!~#C!~#C5 !~#C"~#C"~#C5La~#CF#~#CF#~#C6+!~#C[$~#C[$~#C6nλa~#C %~#C %~#C7XR!~#C%&~#C%&~#C7a~#CV'~#CV'~#C8 y!~#Cc'~#Cc'~#C8wa~#C(~#C(~#C93p!~#C')~#C')~#C9`a~#CQ*~#CQ*~#C:w!~#C+~#C+~#C:a~#C,~#C,~#C;!~#C,~#C,~#C;a~#CD-~#CD-~#C<!~#C}.~#C}.~#C<a~#C/~#C/~#C=D!~#CG0~#CG0~#C=|`a~#C50~#C50~#C>MH9!~#Cb2~#Cb2~#C>1>~a~#C2~#C2~#C?V!~#C%3~#C%3~#C?&a~#Cs4~#Cs4~#Cf@Gd!~#C5~#C5~#Cf@xa~#C=6~#C=6~#CfAڪ!~#C6~#C6~#CfAAJCa~#CC8~#CC8~#CfB^!~#Cٟ8~#Cٟ8~#CfB%,4a~#C9~#C9~#CfC1\!~#Ci:~#Ci:~#CfCGXPa~#C3;~#C3;~#CfD85!~#C~#C~#CfDa~#C-1~#C-1~#CfEv!~#CZb~#CZb~#CfEea~#C~#C~#CfFuu!~#C~#C~#CfFa~#C~#C~#CfG&!~#CJ]~#CJ]~#CfG a~#Cw~#Cw~#CfHjs!~#C'~#C'~#CfHa~#C;X~#C;X~#CfIJz!~#C~#C~#CfIyxa~#Ch ~#Ch ~#CfJL*!~#C ~#C ~#CfJE a~#C+S ~#C+S ~#CfK@o!~#CX ~#CX ~#CfKb{Ӎa~#C ~#C ~#CfLUP!~#C ~#C ~#CfL !a~#C~#C~#CfMC!~#CI~#CI~#CfM[f=a~#Cv~#Cv~#CfN;M!~#C I~#C I~#CfN xYa~#C~#C~#CfO2v!~#C~#C~#CfOw!~#Cf~#Cf~#C7ur!~#C~#C~#C{q7!~#C*u~#C*u~#CqVh{!~#CW~#CW~#CQ7!~#C>~#C>~#C90a~#C~#C~#C2!~#C~#C~#C%a~#CG~#CG~#Cl,!~#Ct~#Ct~#C$Ka~#C k~#C k~#C4=s!~#C~#C~#C1a~#C4~#C4~#C<!~#Ce~#Ce~#CԊ&a~#C~#C~#Cs)!~#C(~#C(~#CdRa~#CU ~#CU ~#C{O!~#C`!~#C`!~#Cb(a~#C"~#C"~#C!~#C*#~#C*#~#CEa~#CF#~#CF#~#CK=!~#Cs$~#Cs$~#CB"!~#C %~#C %~#C % -!~#C6&~#C6&~#C6&&>I!~#CV'~#CV'~#CV'YZ!~#C(~#C(~#C(C~#Cp~#C~#C`~#CG~#C%&~#C%&  PbBp)~#C(~#C )~#C )*}Zx~#C+~#C,~#C,1 ~#CL-~#CL-~#CL-/tmp/disktab.shadowwd9~#C}.~#C}.~#C}./tmp/fstab.shadowՂ~#CG0~#CG0~#CG0/tmp/resolv.conf.shadow+{ ~#Cx1~#Cx1~#Cx1/tmp/hosts ~#CB3~#C(~#C(bK҈~#C*#~#C6&~#Cph:d[~#C )~#C,~#C,fa5Y ~#Cq/~#C2~#C2p~#CR 5~#Cٟ8~#Cpx0~#C3;~#C~#Cp{ d\>q~#C! ~#C>~#C>  ( 0 8 @ ?9cgeNNcH"f^eC8Q[ZzB2st':>m_& }e!6-3MM"qN|=\kh7SINJ#Dħ"bH<(h L !en>(5t6Ѵ4AZ$)-l/EWMY/4mP۽i84l]q"]F\4Nʙ//Uy:dF}?ۺ{(m{ VЂaV ]<Ox80W4+ąŘj!b>7;kSU?2U,]\1i&'CN Rκ5D^jzJ7kpJ(4|.+myrAH_s)ve45hpI;TΐN_qNLta49E|}{]&lйDagY&z::i+ 6M&@gct{ƒ\V6;FPm##+ϺK[YRomkK lv)L+3 XǾ Jv8\q}\$#,_1Ф\9ՠB-9fݞrC)&' 0|b$PSY059.f A"cp+F/Qp[*͞D1BMU2Ll|W2=84hdgEJh`cj,Z8I@Fb$YuOI?Ay&܉hwircj*H+L'y dG9 E _3BQd%z6q;[;s1U?5+IbVb9}3ef֨9#N:NPotH 4Gfϳ8Õp$p-dh Zp:;!},k'PzI L;GFnj'M ?n2n~pXyNTQFxZ4}7Zbgtq=IFoҩ# &{ijv?uyƿ6~K٪^$TW3ڼCE<#+fyܖB=|Ev-w=4GpfWbGu)WY۴[TAOGF{ _wl-]J<mq(Caq3.3$[`r9Vpj>&"ͦ`_?BAO& EM&"Zȋ}WfOTE9O>v(ux1DɈs2E`@FE.@p]@(x_l3NЇM;eDyzzb6R8t-?%;{*~":8[\F rg3H~q$9I+(nM=2T,'OSEZ!$VG΋XZ4*cf%@Vahߓ{ . .. catchmodchgrp cp dd df edexpr-hostnameZ ksh sh ln lsmkdir mteject mv pax tarcpio- rmstty-sync-ip 0 IP icmp 1 ICMP tcp 6 TCP udp 17 UDP  . .. pppfirmware͈groupspwd.db protocolsservices disktab fstab resolv.confL hosts ... ... ... ... . .. bin dev etc mnt mnt2= sbin= tmp usrvarinstbin .profile  install.md upgradeinstall install.subftp-data 20/tcp ftp 21/tcp domain 53/tcp nameserver domain 53/udp nameserver www 80/tcp http shell 514/tcp cmd nfsd 2049/udp nfs nfsd 2049/tcp nfs ... . .. binmdec=sbin=share= . .. ftpgrep-fgrepegrepgzip-gunzipgzcatless-more-\sed . .. . .. . ..misc=keymaps . .. termcap ... . .. tmp db runempty= ... ... ... ... the disk(s) to allow the creation of separate filesystems for /, /tmp, /var, /usr, and /home. __EOT fi set -- $DKDEVS [[ $# -gt 1 ]] && _defdsk=done ask_which "disk" "is the root disk" "$DKDEVS" "$_defdsk" [[ $resp == done ]] && exit makedev $resp || exit ROOTDISK=$resp ROOTDEV=${ROOTDISK}a SWAPDEV=${ROOTDISK}b . ..chowndhclientZ disklabeldmesgfdiskfsck- fsck_ext2fsfsck_ffsZifconfigZinit- kbdmknodmount mount_cd9660e mount_ext2fse mount_ffs mount_msdos mount_nfsnewfs newfs_msdosping-ping6reboothalt-routertsolumount wicontrol dhclient-scripto0 usb0 usb1 usb2 usb3 usb4 usb5 ;; wsmux|wsmouse|wskbd) M wsmouse c 63 0 600 M wskbd c 63 1 600 ;; wsmouse*) M wsmouse$U c 62 $U 600 ;; wskbd*) M wskbd$U c 61 $U 600 ;; tty[C-F]*) U=${i##tty[C-F]} case $i in ttyC*) n=C m=0;; ttyD*) n=D m=256;; ttyE*) n=E m=512;; ttyF*) n=F m=768;; esac case $U in [0-9a-f]) M tty$n$U c 60 $((16#$U+$m)) 600;; cfg) M tty${n}cfg c 60 $((255+$m)) 600;; *) echo bad unit $U for $i; exit 1;; esac ;; wscons) R wsmouse0 wsmouse1 wsmouse2 wsmouse3 wskbd0 wskbd1 wskbd2 R wskbd3 wsmux ttyCcfg ttyC0 ttyC1 ttyC2 ttyC3 ttyC4 ttyC5 R ttyC6 ttyC7 ttyC8 ttyC9 ttyCa ttyCb ;; pty*) if [ $U -gt 15 ]; then echo bad unit for pty in: $i continue fi set -A letters p q r s t u v w x y z P Q R S T set -A suffixes 0 1 2 3 4 5 6 7 8 9 a b c d e f g h i j k l m n o p q \ r s t u v w x y z A B C D E F G H I J K L M N O P Q R S T U V W X \ Y Z name=${letters[$U]} n=0 while [ $n -lt 62 ] do nam=$name${suffixes[$n]} off=$(($U*62)) M tty$nam c 4 $(($off+$n)) M pty$nam c 5 $(($off+$n)) n=$(($n+1)) done ;; ptm) M ptm c 98 0 666 ;; tty[0-7][0-9a-f]) U=${i#tty*} o=$(h2d $U) M tty$U c 54 $o 660 dialer uucp M cua$U c 54 $(($o+128)) 660 dialer uucp ;; st*) n=$(($U*16)) for pre in " " n e en do M ${pre}st$U b 25 $n 660 operator M ${pre}rst$U c 25 $n 660 operator n=$(($n+1)) done ;; vnd*) dodisk vnd $U 19 19 $U 0 dodisk svnd $U 19 19 $U 2048 ;; rd*) dodisk2 rd $U 18 18 $U 0 ;; ch*) M ch$U c 27 $U 660 operator ;; cd*) dodisk2 cd $U 26 26 $U 0 ;; local) test -s $T.local && sh $T.local ;; ramdisk) R pty0 rd0 cd0 cd1 st0 st1 wd0 wd1 wd2 wd3 wd4 sd0 sd1 sd2 R sd3 sd4 bpf0 std ;; all) R ccd0 ccd1 ccd2 ccd3 vnd0 vnd1 vnd2 vnd3 sd0 sd1 sd2 sd3 sd4 R cd0 cd1 rd0 tun0 tun1 tun2 tun3 bpf0 bpf1 bpf2 bpf3 bpf4 R bpf5 bpf6 bpf7 bpf8 bpf9 pty0 xfs0 ss0 ss1 ch0 ptm local R wscons pci iop0 iop1 uall tuner0 radio0 speaker audio0 uk0 R random lkm tty00 tty01 tty02 tty03 crypto pf systrace wd0 R wd1 wd2 wd3 raid0 raid1 raid2 raid3 std st0 st1 fd ;; wd*|sd*|raid*|ccd*) case $i in wd*) dodisk wd $U 16 16 $U 0;; sd*) dodisk sd $U 24 24 $U 0;; raid*) dodisk raid $U 71 71 $U 0;; ccd*) dodisk ccd $U 21 21 $U 0;; esac ;; *) echo $i: unknown device ;; esac done } R "$@" list="$RMlist" for mode in $modes; do list="$list;${mklist[$mode]}" done for group in $groups; do list="$list;${grplist[$group]}" done list="$list;$MKlist" if [ "$eo" = "echo" ]; then $eo "$list" else echo "$list" | sh fi #!/bin/sh - PATH=/sbin:/usr/sbin:/bin:/usr/bin T=$0 [ "$eo" ] || eo= hex() { case $1 in [0-9]) echo -n $1;; 10) echo -n a;; 11) echo -n b;; 12) echo -n c;; 13) echo -n d;; 14) echo -n e;; 15) echo -n f;; esac } alph2d() { local t="$1" local p="0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ" local sub=${p%${t}*} echo ${#sub} } h2d() { local s="$1" local f=${s%*[0-9a-f]} n=${s#[0-9a-f]*} echo $(($(_h2d $f)*16+ $(_h2d $n) )) } _h2d() { case $1 in [0-9]) echo -n $1;; a) echo -n 10;; b) echo -n 11;; c) echo -n 12;; d) echo -n 13;; e) echo -n 14;; f) echo -n 15;; esac } unt() { arg="$1" tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" while [ "$tmp" != "$arg" ] do arg=$tmp tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" done echo $arg } dodisk() { [ "$DEBUG" ] && set -x n=$(($((${5}*${7:-16}))+${6})) count=0 RMlist="$RMlist $1$2? r$1$2?" [ 0$7 -ne 8 ] && l="i j k l m n o p" for d in a b c d e f g h $l do M $1$2$d b $3 $(($n+$count)) 640 M r$1$2$d c $4 $(($n+$count)) 640 let count=count+1 done MKlist="$MKlist;chown root:operator $1$2? r$1$2?" } dodisk2() { n=$(($(($5*${7:-16}))+$6)) M $1$2a b $3 $n 640 operator M r$1$2a c $4 $n 640 operator n=$(($n+2)) M $1$2c b $3 $n 640 operator M r$1$2c c $4 $n 640 operator } RMlist="rm -f" MKlist=":" mkl() { [ "${mklist[$1]}" ] && { mklist[$1]="${mklist[$1]};mknod -m $1 $2 $3 $4 $5" } || { mklist[$1]="mknod -m $1 $2 $3 $4 $5" modes="$modes $1" } } M() { RMlist="$RMlist $1" mkl ${5-666} $1 $2 $3 $4 mklist="$mklist $1" G=${6:-wheel} [ "$7" ] && { MKlist="$MKlist;chown $7:$G $1" } || { case $G in wheel)g=0;;kmem)g=2;;operator)g=5;;tty)g=4;;dialer)g=117;;_lkm)g=61;; esac [ "${grplist[$g]}" ] && { grplist[$g]="${grplist[$g]} $1" } || { groups="$groups $g" grplist[$g]="chgrp $G $1" } } return 0 } R() { [ "$DEBUG" ] && set -x for i in "$@" do U=`unt $i` [ "$U" ] || U=0 case $i in std) M console c 0 0 600 M tty c 1 0 M mem c 2 0 640 kmem M kmem c 2 1 640 kmem M null c 2 2 M zero c 2 12 M stdin c 7 0 M stdout c 7 1 M stderr c 7 2 M ksyms c 8 0 640 kmem M drum c 3 0 640 kmem M klog c 6 0 600 M xf86 c 2 4 600 M reload c 2 20 640 kmem ;; xfs*) M xfs$U c 51 $U 600 ;; uk*) M uk$U c 28 $U 640 operator ;; tuner*) M tuner$U c 75 $(($(($U*2))+16)) 644 ;; systrace) M systrace c 50 0 644 ;; ss*) M ss$U c 29 $(($U*16)) 640 operator M nss$U c 29 $(($(($U*16))+1)) 640 operator M enss$U c 29 $(($(($U*16))+3)) 640 operator RMlist="$RMlist scan$U" MKlist="$MKlist;umask 77;ln -s ss$U scan$U" ;; speaker) M speaker c 99 0 600 ;; tun*) M tun$U c 33 $U 600 ;; *random) n=0 for pre in " " s u p a do M ${pre}random c 40 $n 644 n=$(($n+1)) done ;; radio*) M radio$U c 97 $U MKlist="$MKlist;[ -e radio ] || ln -s radio$U radio" ;; pf*) M pf c 39 0 600 ;; pci) M pci c 71 0 600 ;; lkm) M lkm c 35 0 640 _lkm ;; iop*) M iop$U c 73 $U 660 ;; fd) RMlist="mkdir -p fd;$RMlist" n=0 while [ $n -lt 64 ];do M fd/$n c 7 $n;n=$(($n+1));done MKlist="$MKlist;chmod 555 fd" ;; crypto) M crypto c 47 0 ;; bpf*) M bpf$U c 22 $U 600 ;; bktr*) M bktr$U c 75 $U 644 ;; audio*) M sound$U c 36 $U M mixer$U c 36 $(($U+16)) M audio$U c 36 $(($U+128)) M audioctl$U c 36 $(($U+192)) MKlist="$MKlist;[ -e audio ] || ln -s audio$U audio" MKlist="$MKlist;[ -e mixer ] || ln -s mixer$U mixer" MKlist="$MKlist;[ -e sound ] || ln -s sound$U sound" MKlist="$MKlist;[ -e audioctl ] || ln -s audioctl$U audioctl" ;; uscanner*) M uscanner$U c 69 $U 660 ;; usb*) [ "$i" = "usb" ] && u= || u=$U M usb$u c 64 $U 660 ;; urio*) M urio$U c 67 $U 660 ;; ulpt*) M ulpt$U c 66 $U 660 ;; uhid*) M uhid$U c 65 $U 660 ;; ugen*) n=$(($U*16)) for j in 0{0,1,2,3,4,5,6,7,8,9} 1{0,1,2,3,4,5} do M ugen$U.$j c 70 $(($n+10#$j)) 660 done ;; ttyU[0-9a-zA-Z]) U=${i#ttyU*} o=$(alph2d $U) M ttyU$U c 68 $o 660 dialer uucp M cuaU$U c 68 $(($o+128)) 660 dialer uucp ;; uall) R ttyU0 ttyU1 ugen0 ugen1 ulpt0 ulpt1 uhid0 uhid1 uhid2 uhid3 R uscanner0 uri . ..MAKEDEVttyp0ptyp0ttyp1ptyp1ttyp2ptyp2 ttyp3!ptyp3"ttyp4#ptyp4$ttyp5%ptyp5&ttyp6'ptyp6(ttyp7)ptyp7*ttyp8+ptyp8,ttyp9-ptyp9.ttypa/ptypa0ttypb1ptypb2ttypc3ptypc4ttypd5ptypd6ttype7ptype8ttypf9ptypf:ttypg;ptypg<ttyph=ptyph>ttypi?ptypi@ttypjAptypjBttypkCptypkDttyplEptyplFttypmGptypmHttypnIptypnJttypoKptypoLttyppMptyppNttypqOptypqPttyprQptyprRttypsSptypsTttyptUptyptVttypuWptypuXttypvYptypvZttypw[ptypw\ttypx]ptypx^ttypy_ptypy`ttypzaptypzbttypAcptypAdttypBeptypBfttypCgptypChttypDiptypDjttypEkptypElttypFmptypFnttypGoptypGpttypHqptypHrttypIsptypItttypJuptypJvttypKwptypKxttypLyptypLzttypM{ptypM|ttypN}ptypN~ttypOptypOttypPptypPttypQptypQttypRptypRttypSptypSttypTptypTttypUptypUttypVptypVttypWptypWttypXptypXttypYptypYttypZptypZttynullMzeroMstdinstdoutstderrrd0aMrrd0ard0cMrrd0ccd0aMrcd0acd0cMrcd0ccd1aMrcd1acd1cMrcd1cwd0aMrwd0awd0bMrwd0bwd0cMrwd0cwd0dMrwd0dwd0eMrwd0ewd0fMrwd0fwd0gMrwd0gwd0hMrwd0hwd0iMrwd0iwd0jMrwd0jwd0kMrwd0kwd0lMrwd0lwd0mMrwd0mwd0nMrwd0nwd0oMrwd0owd0pMrwd0pwd1aMrwd1awd1bMrwd1bwd1cMrwd1cwd1dMrwd1dwd1eMrwd1ewd1fMrwd1fwd1gMrwd1gwd1hMrwd1hwd1iMrwd1iwd1jMrwd1jwd1kMrwd1kwd1lMrwd1lwd1mMrwd1mwd1nMrwd1nwd1oMrwd1owd1pMrwd1pwd2aMrwd2awd2bMrwd2bwd2cMrwd2cwd2dMrwd2dwd2eMrwd2ewd2fMrwd2fwd2gMrwd2gwd2hMrwd2hwd2iMrwd2iwd2jMrwd2jwd2kMrwd2kwd2lMrwd2lwd2mMrwd2mwd2nMrwd2nwd2oMrwd2owd2pMrwd2pwd3aM rwd3a wd3bM rwd3b wd3cM rwd3cwd3dMrwd3dwd3eMrwd3ewd3fMrwd3fwd3gMrwd3gwd3hMrwd3hwd3iMrwd3iwd3jMrwd3jwd3kMrwd3kwd3lMrwd3l wd3mM!rwd3m"wd3nM#rwd3n$wd3oM%rwd3o&wd3pM'rwd3p(wd4aM)rwd4a*wd4bM+rwd4b,wd4cM-rwd4c.wd4dM/rwd4d0wd4eM1rwd4e2wd4fM3rwd4f4wd4gM5rwd4g6wd4hM7rwd4h8wd4iM9rwd4i:wd4jM;rwd4j<wd4kM=rwd4k>wd4lM?rwd4l@wd4mMArwd4mBwd4nMCrwd4nDwd4oMErwd4oFwd4pMGrwd4pHsd0aMIrsd0aJsd0bMKrsd0bLsd0cMMrsd0cNsd0dMOrsd0dPsd0eMQrsd0eRsd0fMSrsd0fTsd0gMUrsd0gVsd0hMWrsd0hXsd0iMYrsd0iZsd0jM[rsd0j\sd0kM]rsd0k^sd0lM_rsd0l`sd0mMarsd0mbsd0nMcrsd0ndsd0oMersd0ofsd0pMgrsd0phsd1aMirsd1ajsd1bMkrsd1blsd1cMmrsd1cnsd1dMorsd1dpsd1eMqrsd1ersd1fMsrsd1ftsd1gMursd1gvsd1hMwrsd1hxsd1iMyrsd1izsd1jM{rsd1j|sd1kM}rsd1k~sd1lMrsd1lsd1mMrsd1msd1nMrsd1nsd1oMrsd1osd1pMrsd1psd2aMrsd2asd2bMrsd2bsd2cMrsd2csd2dMrsd2dsd2eMrsd2esd2fMrsd2fsd2gMrsd2gsd2hMrsd2hsd2iMrsd2isd2jMrsd2jsd2kMrsd2ksd2lMrsd2lsd2mMrsd2msd2nMrsd2nsd2oMrsd2osd2pMrsd2psd3aMrsd3asd3bMrsd3bsd3cMrsd3csd3dMrsd3dsd3eMrsd3esd3fMrsd3fsd3gMrsd3gsd3hMrsd3hsd3iMrsd3isd3jMrsd3jsd3kMrsd3ksd3lMrsd3lsd3mMrsd3msd3nMrsd3nsd3oMrsd3osd3pMrsd3psd4aMrsd4asd4bMrsd4bsd4cMrsd4csd4dMrsd4dsd4eMrsd4esd4fMrsd4fsd4gMrsd4gsd4hMrsd4hsd4iMrsd4isd4jMrsd4jsd4kMrsd4ksd4lMrsd4lsd4mMrsd4msd4nMrsd4nsd4oMrsd4osd4pMrsd4p memkmemMksymsdrumMreload st0rst0Mnst0Mnrst0est0Merst0enst0enrst0 st1rst1Mnst1Mnrst1est1Merst1enst1enrst1bpf0MconsoleklogMpxf86Mwheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root bin:*:7: news:*:8: wsrc:*:9: users:*:10: auth:*:11: games:*:13: staff:*:20:root smmsp:*:25: popa3d:*:26: sshd:*:27: _portmap:*:28: _identd:*:29: _rstatd:*:30: guest:*:31:root _rusersd:*:32: _fingerd:*:33: _sshagnt:*:34: _x11:*:35: utmp:*:45: _kdc:*:59: _kadmin:*:60: _lkm:*:61: _spamd:*:62: _radius:*:63: _token:*:64: _shadow:*:65: crontab:*:66: www:*:67: _isakmpd:*:68: network:*:69: named:*:70: proxy:*:71: authpf:*:72: _syslogd:*:73: _pflogd:*:74: _bgpd:*:75: _tcpdump:*:76: _dhcp:*:77: _mopd:*:78: _tftpd:*:79: _rbootd:*:80: _afs:*:81: _ppp:*:82: _ntp:*:83: _ftp:*:84: _ospfd:*:85: _hostapd:*:86: dialer:*:117: nogroup:*:32766: nobody:*:32767: dumb|80-column dumb tty:\ :am:\ :co#80:\ :bl=^G:cr=^M:do=^J:sf=^J: vt100|vt100-am|dec vt100 (w/advanced video):\ :am:bs:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :@8=\EOM:DO=\E[%dB:K1=\EOq:K2=\EOr:K3=\EOs:K4=\EOp:K5=\EOn:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=^O:as=^N:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:do=^J:\ :eA=\E(B\E)0:ho=\E[H:k0=\EOy:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k5=\EOt:k6=\EOu:k7=\EOv:k8=\EOl:k9=\EOw:k;=\EOx:\ :kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:\ :ku=\EOA:le=^H:mb=\E[5m:md=\E[1m:me=\E[m\017:mr=\E[7m:\ :nd=\E[C:rc=\E8:rs=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :..sa=\E[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t\016%e\017%;:\ :sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: vt220|vt200|DEC VT220 in vt100 emulation mode:\ :am:bs:mi:pt:xn:xo:\ :co#80:li#24:vt#3:\ :@7=\E[4~:RA=\E[?7l:SA=\E[?7h:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:ho=\E[H:\ :if=/usr/share/tabset/vt100:im=\E[4h:\ :is=\E[1;24r\E[24;1H:k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:\ :k5=\E[17~:k6=\E[18~:k7=\E[19~:k8=\E[20~:k9=\E[21~:\ :k;=\E[29~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=\177:\ :kd=\E[B:kh=\E[1~:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:nl=^J:rc=\E8:\ :rf=/usr/share/tabset/vt100:\ :rs=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :..sa=\E[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t\E(0%e\E(B%;:\ :sc=\E7:se=\E[27m:sf=20\ED:so=\E[7m:sr=14\EM:ta=^I:\ :ue=\E[24m:up=\E[A:us=\E[4m:ve=\E[?25h:vi=\E[?25l: export PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ umask 022 set -o emacs # emacs-style command line editing rootdisk=`dmesg|sed -n -e '/OpenBSD /h' -e '//!H' -e '${ g p }'|sed -n -e '/^root on \([0-9a-z]*\).*/{ s//\/dev\/\1/ p }'` if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES mount -u ${rootdisk:-/dev/rd0a} / echo 'erase ^?, werase ^W, kill ^U, intr ^C, status ^T' stty newcrt werase ^W intr ^C kill ^U erase ^? status ^T _forceloop="" while [ "X$_forceloop" = X"" ]; do echo -n '(I)nstall' [ -f upgrade ] && echo -n ', (U)pgrade' echo -n ' or (S)hell? ' read _forceloop case "$_forceloop" in i*|I*) /install ;; u*|U*) /upgrade ;; s*|S*) ;; *) _forceloop="" ;; esac done fi #!/bin/sh delete_old_address() { if [ -n "$old_ip_address" ]; then ifconfig $interface inet -alias $old_ip_address $medium route delete "$old_ip_address" 127.0.0.1 >/dev/null 2>&1 fi } add_new_address() { ifconfig $interface \ inet $new_ip_address \ netmask $new_subnet_mask \ broadcast $new_broadcast_address \ $medium route add $new_ip_address 127.0.0.1 >/dev/null 2>&1 } delete_old_alias() { if [ -n "$alias_ip_address" ]; then ifconfig $interface inet -alias $alias_ip_address > /dev/null 2>&1 route delete $alias_ip_address 127.0.0.1 > /dev/null 2>&1 fi } add_new_alias() { if [ -n "$alias_ip_address" ]; then ifconfig $interface inet alias $alias_ip_address netmask \ $alias_subnet_mask route add $alias_ip_address 127.0.0.1 fi } delete_old_routes() { route delete default >/dev/null 2>&1 if [ -n "$old_static_routes" ]; then set $old_static_routes while [ $# -gt 1 ]; do route delete "$1" "$2" shift; shift done fi arp -dan } add_new_routes() { route delete default >/dev/null 2>&1 for router in $new_routers; do if [ "$new_ip_address" = "$router" ]; then route add default -iface $router >/dev/null 2>&1 else route add default $router >/dev/null 2>&1 fi break done if [ -n "$new_static_routes" ]; then set $new_static_routes while [ $# -gt 1 ]; do route add $1 $2 shift; shift done fi } add_new_resolv_conf() { rm -f /etc/resolv.conf.std if [ -n "$new_domain_name" ]; then echo "search $new_domain_name" >>/etc/resolv.conf.std fi if [ -n "$new_domain_name_servers" ]; then for nameserver in $new_domain_name_servers; do echo "nameserver $nameserver" >>/etc/resolv.conf.std done fi if [ -f /etc/resolv.conf.std ]; then if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >>/etc/resolv.conf.std fi if [ -f /etc/resolv.conf ]; then cat /etc/resolv.conf > /etc/resolv.conf.save fi cat /etc/resolv.conf.std > /etc/resolv.conf rm -f /etc/resolv.conf.std chown -RL root:wheel /etc/resolv.conf chmod -RL 644 /etc/resolv.conf return 0 fi return 1 } if [ -n "$new_network_number" ]; then echo "New Network Number: $new_network_number" fi if [ -n "$new_broadcast_address" ]; then echo "New Broadcast Address: $new_broadcast_address" fi case $reason in MEDIUM) ifconfig $interface $medium sleep 1 ;; PREINIT) delete_old_alias ifconfig $interface up ;; ARPCHECK|ARPSEND) ;; BOUND|RENEW|REBIND|REBOOT) if [ -n "$old_ip_address" ]; then if [ "$old_ip_address" != "$alias_ip_address" ]; then delete_old_alias fi if [ "$old_ip_address" != "$new_ip_address" ]; then delete_old_address delete_old_routes fi fi if [ "$reason" = BOUND ] || \ [ "$reason" = REBOOT ] || \ [ -z "$old_ip_address" ] || \ [ "$old_ip_address" != "$new_ip_address" ]; then add_new_address add_new_routes fi if [ "$new_ip_address" != "$alias_ip_address" ]; then add_new_alias fi add_new_resolv_conf ;; EXPIRE|FAIL) delete_old_alias if [ -n "$old_ip_address" ]; then delete_old_address delete_old_routes fi add_new_alias if [ -f /etc/resolv.conf.save ]; then cat /etc/resolv.conf.save > /etc/resolv.conf fi ;; TIMEOUT) delete_old_alias add_new_address sleep 1 if [ -n "$new_routers" ]; then set "$new_routers" if ping -q -c 1 -w 1 "$1"; then if [ "$new_ip_address" != "$alias_ip_address" ]; then add_new_alias fi add_new_routes if add_new_resolv_conf; then exit 0 fi fi fi ifconfig $interface inet -alias $new_ip_address $medium delete_old_routes exit 1 ;; esac exit 0 MDFSTYPE=msdos MDXAPERTURE=2 ARCH=cats md_installboot() { } md_prep_disk() { local _disk=$1 _resp typeset -l _resp cat <<__EOT $_disk must be partitioned using an BSD or an MBR partition table. BSD partition table or MBR partition tables can be created by OpenBSD. It is more a question of firmware compatibility disk portability. (Once we can figure out what filesystems ABLE can boot) __EOT while :; do ask "Use BSD or MBR partition table?" BSD _resp=$resp case $_resp in m|mbr) export disklabeltype=MBR md_prep_MBR $_disk break ;; b|bsd) export disklabeltype=BSD md_prep_BSD $_disk break ;; esac done } md_prep_MBR() { local _disk=$1 if [[ -n $(disklabel -c $_disk 2>/dev/null | grep ' BSD ') ]]; then cat <<__EOT WARNING: putting an MBR partition table on $_disk will DESTROY the existing BSD partitions and BSD partition table. __EOT ask_yn "Are you *sure* you want an MBR partition table on $_disk?" [[ $resp == n ]] && exit fi ask_yn "Use *all* of $_disk for OpenBSD?" if [[ $resp == y ]]; then echo -n "Creating Master Boot Record (MBR)..." fdisk -e $_disk >/dev/null 2>&1 <<__EOT reinit update write quit __EOT echo "done." echo -n "Formatting 1MB MSDOS boot partition..." gunzip /dev/null 2>&1 echo "done." return fi cat <<__EOT **** NOTE **** XXX ************** Current partition information is: $(fdisk $_disk) __EOT fdisk -e $_disk cat <<__EOT Here is the MBR configuration you chose: $(fdisk $_disk) Please take note of the offsets and sizes of the DOS partition, the OpenBSD partition, and any other partitions you want to access from OpenBSD. You will need this information to fill in the OpenBSD disklabel. __EOT } md_prep_BSD() { local _disk=$1 cat <<__EOT No special setup should be required to label using BSD disklabel. however if the disk has previously been partitioned in another manner, it may be necessary to wipe existing partition tables before proceeding. dd if=/dev/zero of=/${_disk} bs=512 count=10 disklabel -c ${_disk} __EOT } md_prep_disklabel() { local _disk=$1 _q md_prep_disk $_disk case $disklabeltype in BSD) ;; MBR) cat <<__EOT You *MUST* setup the OpenBSD disklabel to include the MSDOS-formatted boot partition as the 'i' partition. If the 'i' partition is missing or not the MSDOS-formatted boot partition, then the kernel required to boot OpenBSD cannot be installed. __EOT ;; *) echo "Disk label type ('$disklabeltype') is not 'BSD' or 'MBR'." exit ;; esac disklabel -W $_disk >/dev/null 2>&1 disklabel -c -f /tmp/fstab.$_disk -E $_disk } md_congrats() { cat <<__EOT Once the machine has rebooted use OpenFirmware to boot into OpenBSD, as described in the INSTALL.$ARCH document. The command to boot OpenBSD will be something like 'boot (hd0)bsd'. __EOT } #!/bin/ksh MODE=upgrade . install.sub while :; do ask "Root filesystem?" "$ROOTDEV" resp=${resp##*/} [[ -b /dev/$resp ]] && break echo "Sorry, $resp is not a block device." done ROOTDEV=$resp echo -n "Checking root filesystem (fsck -fp /dev/${ROOTDEV}) ... " if ! fsck -fp /dev/$ROOTDEV >/dev/null 2>&1; then echo "FAILED.\nYou must fsck ${ROOTDEV} manually." exit fi echo "OK." echo -n "Mounting root filesystem..." if ! mount -o ro /dev/$ROOTDEV /mnt; then echo "ERROR: can't mount root filesystem!" exit fi echo "done." for _file in fstab hosts myname; do if [ ! -f /mnt/etc/$_file ]; then echo "ERROR: no /mnt/etc/${_file}!" exit fi cp /mnt/etc/$_file /tmp/$_file done hostname $( is found, and the fstype is not nfs. Non-ffs filesystems will be mounted read-only. You can edit the fstab now, before it is used, but the edited fstab will only be used during the upgrade. It will not be copied back to disk. __EOT edit_tmp_file fstab munge_fstab check_fs if ! umount /mnt; then echo "ERROR: can't unmount previously mounted root!" exit fi mount_fs install_sets finish_up t 127.0.0.1 localhost ::1 $(hostname -s) 127.0.0.1 $(hostname -s) __EOT ask_yn "Configure the network?" yes [[ $resp == y ]] && donetconfig _oifs=$IFS IFS= while :; do askpass "Password for root account? (will not echo)" _password=$resp askpass "Password for root account? (again)" [[ $resp == $_password ]] && break echo "Passwords do not match, try again." done IFS=$_oifs install_sets while read _dev _mp _fstype _opt _rest; do mount -u -o $_opt $_dev $_mp || exit done myname _dn=$(get_fqdn) while read _addr _hn _aliases; do if [[ -n $_aliases || $_hn != ${_hn%%.*} || -z $_dn ]]; then echo "$_addr $_hn $_aliases" else echo "$_addr $_hn.$_dn $_hn" fi done hosts.new mv hosts.new hosts save_comments hosts save_comments dhclient.conf for _f in fstab kbdtype my* *.conf *.tail host* ttys; do [[ -f $_f ]] && mv $_f /mnt/etc/. done ) _encr=`/mnt/usr/bin/encrypt -b 8 -- "$_password"` echo "1,s@^root::@root:${_encr}:@ w q" | /mnt/bin/ed /mnt/etc/master.passwd 2>/dev/null /mnt/usr/sbin/pwd_mkdb -p -d /mnt/etc /etc/master.passwd echo -n "done.\nGenerating initial host.random file..." ( cd /mnt/var/db /mnt/bin/dd if=/mnt/dev/urandom of=host.random bs=1024 count=64 >/dev/null 2>&1 chmod 600 host.random >/dev/null 2>&1 ) echo "done." set_timezone finish_up #!/bin/ksh FILESYSTEMS=/tmp/filesystems SWAPLIST=/tmp/swaplist MODE=install . install.sub if [ ! -f /etc/fstab ]; then [ -f /etc/disktab.shadow ] && cp /etc/disktab.shadow /tmp/disktab.shadow DISK= _DKDEVS=$DKDEVS while :; do _DKDEVS=`rmel "$DISK" $_DKDEVS` if isin $ROOTDISK $_DKDEVS; then resp=$ROOTDISK rm -f /tmp/fstab cat /dev/null >$FILESYSTEMS cat /dev/null >$SWAPLIST else ask_which "disk" "do you wish to initialize" "$_DKDEVS" done "No more disks to initialize" [[ $resp == done ]] && break fi DISK=$resp makedev $DISK || continue rm -f /tmp/*.$DISK md_prep_disklabel $DISK unset _partitions _psizes _mount_points _i=0 disklabel $DISK 2>&1 | sed -ne '/^ *[a-p]: /p' >/tmp/disklabel.$DISK while read _dev _size _offset _type _rest; do _pp=${DISK}${_dev%:} _ps=$_size if [[ $_pp == $ROOTDEV ]]; then echo "$ROOTDEV /" >$FILESYSTEMS continue elif [[ $_pp == $SWAPDEV || $_type == swap ]]; then echo "$_pp" >>$SWAPLIST continue elif [[ $_type != *BSD ]]; then continue fi _partitions[$_i]=$_pp _psizes[$_i]=$_ps if [[ -f /tmp/fstab.$DISK ]]; then while read _pp _mp _rest; do [[ $_pp == "/dev/${_partitions[$_i]}" ]] || continue [[ -n $(grep " $_mp\$" $FILESYSTEMS) ]] && break isin $_mp ${_mount_points[*]} && break [[ $_mp == '/' ]] && break _mount_points[$_i]=$_mp done >$FILESYSTEMS : $(( _i += 1 )) done done cat <<__EOT OpenBSD filesystems: $(<$FILESYSTEMS) The next step *DESTROYS* all existing data on these partitions! __EOT ask_yn "Are you really sure that you're ready to proceed?" [[ $resp == n ]] && { echo "Ok, try again later." ; exit ; } _i=0 unset _partitions _mount_points while read _pp _mp; do _OPT= [[ $_mp == / ]] && _OPT=$MDROOTFSOPT newfs -q $_OPT /dev/r$_pp _partitions[$_i]=$_pp _mount_points[$_i]=$_mp : $(( _i += 1 )) done <$FILESYSTEMS for _mp in `bsort ${_mount_points[*]}`; do _i=0 for _pp in ${_partitions[*]}; do if [ "$_mp" = "${_mount_points[$_i]}" ]; then echo -n "/dev/$_pp $_mp ffs rw" if [[ $_mp == / ]]; then echo " 1 1" else echo -n ",nodev" case $_mp in /sbin|/usr) ;; /usr/bin|/usr/sbin) ;; /usr/libexec|/usr/libexec/*) ;; /usr/local|/usr/local/*) ;; /usr/X11R6|/usr/X11R6/bin) ;; *) echo -n ",nosuid" ;; esac echo " 1 2" fi fi : $(( _i += 1 )) done done >>/tmp/fstab while read _dev; do [[ $_dev == $SWAPDEV ]] || \ echo "/dev/$_dev none swap sw 0 0" >>/tmp/fstab done <$SWAPLIST munge_fstab fi mount_fs "-o async" ask_until "\nSystem hostname? (short form, e.g. 'foo')" "$(hostname -s)" [[ ${resp%%.*} != $(hostname -s) ]] && hostname $resp ( cd /tmp; rm -f host* my* resolv.* dhclient.* ) cat >/tmp/hosts <<__EOT ::1 localhos (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x ELFa(t44 (dd$$|g 444OpenBSD -LTP@0! MP@ -0LM 0PS`@p0 xI/ P000`P`0 R ^ *0 0 Q P:00kk 0S SX 00-SL@  @1S@DQ@Dt @Dt0鴐 -LM$@0S0S꬐ -< L04S0 00 h+1괫} 0S00긫 -LM`pQ 0S5/ip@PPPQ P Q088 8TQ  鼫~~ p-PLM@@P` ph 0-@L -PP \*Z|I" 0OSP8  (00SPZ꼫~~T -鸢帒<LMP000圂S0: pP=xw (@T` 8KX0  \ , (Ÿ8 $ RŸ8  0 8 =0000S0A  10S000 B Y 1p0S0 Sl+ h10S X1X!0T!0SH!@1  !8 700011000S `R PpU=0p @0S 0S  0< @0S 0Sl = . \T`(Xl -LZ 00  -LO0\ -LG P00X -L<0 -0L0000 -0L00 0  -Lp0@ -Lh0 -L=밂 0-LMK Pp@81 0X  R@ 0b0CS$,,,,,,,,,,,,,,,,,,0D0E0J0AS00 0xS S *S 0S ", 0 $<0 <00ذȂ p-LM KP0B qr1 'X PY 0b0CS5t`P$K4`P%%K5 `P*%F:`P!%O1 VU00 0xS S *S`P0E" $ VU "<0 0 (B<0 =<p0ذȂ 0-x0LP h0   aAq 0A0q08@0P 0R0 : 0d 0 R0   - L <02 - L ;02 - L ;00 - L ;00 -LMd"\"TK.P00s D@00Cs0 00Cs0c(XX -8rLP,20  6%P ,10S0q QP1000 A0! 1%P0 1! %0P00 tWLQPa` \10S 0@P4 $A0P 0P 0PV0  Rp: P 0 0; S0`@%,"@0h0Q X/;Ph)gN 0\(8 0-LM@KDP tV0: S\L KPA!P0000 0e.pq0S00000m8@ 0-L1 R 1 0Su*Q  1Q   "4A P 0!0  tIV lԋ0 0".8Nj0 0 0 0  P0    00 00000 0000 @0  W00 \D L000 @0 0 00(00Xh0 ` -0LM 0RE0RQ0R_ x00 l@ R R*T bQ 300,00S h`T  -`1LMP``p@Q VP@  . $0S@ U0/T0V000 0T0 0 0 0S00U 0pd  t9P@0 fR `!* 00 0Rb10 00 P0hd -pLuM0d yK,0 e 1b1 P a!  B=9! = 1 Z. zP@S0 Ir/ p`LPno JP PoOK 0!dPP2A  R  x1 RtVOKd0`!2A m  R ,1,R@Kd0!2w?KAYv?K!00/C#b10 - "0 7됀K p`0d wKP\2뉁5 @v?K %00 ,0SD,.A?(̃ԃ܃MbD -LM)@N&@ -LG  - L0 P `0@%,"0h,p6q . 2`p0-  P 0 pWp@0P`l 0S0C0T8P00  Z 8 MT0L0 -L Mȡ00 `@%,"0,pbq`C 2[ 8c8d0 K00 , PQ4 `0pSI 0SF }PQ4"`0 K03K,` p  @0 pR' 0S$ 6U0`PP  lS@0 pR<0 0S@0p R 0S m0 -GMLM2 `@P d " dp?@E 0P8갞````F-K0 B BJ0 @bTQ7A~K pGpG@lP 4 04 04 =K 0C 0CD $ $d <PՄ0-S D7 8BS0$(=S(`lhT hp -L06 Z(밅 -LM`POP( @(K,pK 0  (0@SS -L M0@p00 0Sf PP 0S nSW =kP0`0@Q 3P QIQG  0V0P . 0' Y0  0000V 0`0 ,K, ?R0S@p @30"Sl 07Y000 LPH00D 0oSP 7(W4 -||LxM@P`pd#bpA P0@$S3th`p2`2`p22qx2 Rl2L2\"0QQ@c (2 R}`K1PpR0S'pW PU `@yUP@Tjo U P1 R  \W  j'0pS `K@TP40: S S' $@P0 R 0  DWP pjO0S  D QQCPPLQ}<655P5555lT \0̆ -LMp K0@T` P !P@ Tj_ 00T 0-x0L0PS0@Q  }P 0S(0 R00 R0 P-L` 0S5nS 0@ ,P@l0PP@p` ,Pp@0oS` Q -蠟L0S 0 R0 R / X @ Pp`0DS 0 PUjOvP D0\j/T0 r)joj#?55 p-L M `K P@E0s  呅p鏅p ( -LM, pPo5G"%$,0O"#!,0 0o -LMP, 0 b2  B 0R00 0`p @T To+ \+4 Tv Ttd+ Q+Te TcY+0V+,4  0- Q ZP@E0 Z/  pl1 R/ @pTg' cZ`P]T0  vP@0  PTo ? ;`P@0x /P@X*0 * * 4 { 5Y@A058H5T(pa -0LMPpP`)0 R @;$0 A 0 @嚄0 R W@ $0@Tj_\冄 K$K,@@@$00 55ht5Ї؇ -1L4M`, P!10 00 @,0P 1PUTBp< AH0`JZ/ 0@K 0@`T9 T7 [* H*T) T' P*M*T T E*B* 0@K,0<T00 Zj .*0 (* #* 0TP@P0  k0PKY@5L -`L@ PP pJ0S p:Pp億0 -LM`@P0p& QP@ i0S T F 0 $$ Xp -0L  `밫 -qLMʠ`0 P6 \P0d .40( 8%P<(@dl ?@ed, 0C0  $H0QZ T* Z *D  T -HL M, 0 [PnP #1RL0S @D@030(,)Pp g@$)B`@)v#,Pc P 00 0b0  0 0$ D0QZ T*,Z *D 1S -AML ML6 DDf@Pp, 0&V^pq ?0@8Szꔶص$<D5 WPp0S HP4 R>:P42Ptp4 8$ 0@bT<4 Q T Z\ P`+ P  PP 0SP(0  P7P<4 08$ <4 P<$0R08$R0S =P 8DDPP B.K B B(历P@ 4Pp~0S !MBK@@,P 8$RP@0DP@Tj_0T,2 R  08 $P8P1 RbBKHHP\ yP4 ,P0 + 0  jP mP`t 04D000$ 04| 04T  00TP` 1P` ;P 4P |/P P`x0 l{L(l5ȉh$X5T Љԉ܉p= <Hh -PLMP P` @ pK e80S@@ 00S00(W 0-P@ 0LSP  0S0S0 ( -LM Mß'}KpG` pG , P@Pq #T@U 3h`P 0S 㞾PP @KA <0A؉  3) 0QqA9  婀9@X L P  P< P  ,< = =XLP d x=,LHP < \=,<|-<< << ; ;; ; ;;,; ;;,;;,;;,p;l; \; T;vP; ~@;<; w,; $;e#;,k;o; d:h:+]:a: `b0FSQ :M>KQ0C0C p+p   InK`F`F3P@ $`=EY0S 4: S < `EMKHHș@ ( "Pv9؉9^@h9 9T D PQ R$ U9 P^ T Q R U(0  ܤ0J   H/Z 80380S5 0S  8 R 8 R8 R  % R\8 h8 R`8 R 5 Se  88 Rk i U Up80l2) X00R00S7 P 0@ P 10135:3P x X7 R 0B$ 70S4 \7 R R0$ 70S4 7 R 7 R\$ 60S4 60S4 6 0 S4 0$ Sa4%S04 RPؔ6Y> A) Д0AP,  6X@JP dV000TU 3 5#:,P( 0V00X@6h1h ? 6``U 0#5 %* % U UU 4S X0 4  \ P  @ؔ  YRJ^   $X T \% P ؔ PY0 <U U%1 ATE Uc ccXe 00S.K05 \pt \ IC6<0S@#/Q 0SKoP\0@  TS050P5 P  P㬄 X#%*X4dPP<5 4< 05 0@RQx' <%!q0`J  0  5 SP L S3 p0# U Ugg Ug gg )X 0H,଄  <Ja ` 0 %P@V`!X:5 S S V X X42 v \b 2\b`$"#00C4 ;C4R 00UV `Pw4S\004 e$ V04 0S03$ 54 5 X4 (4 $ u<Qp ,0 S ,!(lH6AA5BH\h55z5555ԑ5ܐ5556556t5{6{6T 0<dȓؒ0\ГDt4$̏LTX\dhltx 65gfff555|4lАNK@RNK4@@4 6 P  4$S440 $ 5    ^ % Ue0Vf*0U U00R00SU $0R eVU:PU L U0#03RQ $$刖p ܤ P%0W^  Pd \0#03\030"S3  `QP,<"(PK0d1P ^ U * X  PQ ܤ #Cp 4P  5$ UP2Q 4( Td0 25P%$P ܤ0 0 P B24P%40P$(3R ^3  X4LS \ R 0\J>Kܤ0C@R0 00aAU0!|rP!d0B!U0PBBBB@B`BBpB0BPBBBB|4(KM.KP B4`( Kp$(0K4(K4(K-K0 B$@5 (K 4D% 0K.KH5 4 B#4 `5 4L% $D PT"$`lK``V! ` pK @X K DP,Ġ KHQ. ,KL R$D @5%(PK(`K@d! \!4 $ X! $0@ P \ 5 )0R`06P$(6R0/ D!b0 $v> 0Xp6BNKx6Q%̠%4%(@D@D0 P5&a !0S66TQ$0 N0o00  e T AܤU0 U 0A AH7(KJ.KP BX7(K`'(0K$"$d% $$PT0!l |! D! `0 @ p lKd`V,Ġ@ `000 q%4$:]$ 0P> 40Q`@V>d8U U Uʠ 5$ V:%V#t@U8'L40S@.ccT5l P0!01S030S345-*Q$H9U! $UT  h9Q eVPR 9U  T 9R UP9R R/5 sPBNK@D@D*5| P  p$ e (.Pa4: S ܤEnK`F `F @P0   %<$`\d4S: 8j\d4S0\ T([44 嬄 D D ~gF -LM@(KP`5  Ppp0W0* R00S 0rS`Fv (P@ P@Z`F (00T P P (0vj?(0 Z?(0 T0#(0 -PL`p@PDP @T:T @2 #ԴD -LPgM/, `fxPBp  Q q00  R P\ 8Ÿ q00  RP 0`SpSapCP 0S.S  a#00Y00S ,0S 0S 0S $0S5MK  pI w8pW0SH00Y00S(0 0(0,0S0,00S' 0S $0S ?P $0 ?c02 $00 ,0S ,0 {$, u (l oX iP@ <4t0(`edAAԑ{Ȕؔ -LMp.sQ5Q/%sQ& s,Q0S h?4 0ss`8|@|PPshs<Q@rLrDr<r4r,8Pd*lpx Q-0L $ Q*  }"뜕 -LM`@po $K8P{o0S0S 0 _"$0 UR#U p-LM`PU@ T<OPP UTUpT̕- 0\ \8 0000ӑS^ 0 ^0  Br0 BS 0r0 -ALM3 0 08 0 0 0 0t 0d 0T 0D 04 0$ 0 0 0 0{ 0v 0q 0l 0g 0b 0] 0tX0l S,h̖ܖ,H`tėؗ$ -LM00`Kq@ 00 pYPPS 00@TH 0uS> <S2  0BS^Q 0( 0 0 0 ?R(0  -R   4K P@ 40 R0 0(@< <QP0 0( dGP 0L<< 0pPPx80\ P-L   봠Р 0-LMt@ 0Pd>qQ n@ 80h1q0(0 ,q 0S8, -LM0:(0 P0( 0S(0 0 (K  pPP) 0S& =P`u 00,pK O0cSb iSI lS> oS& A0S 0S 0S(0SP0AS, [0 0S0 OP,00 0oSP O,0(0P,0 0 0|P,00 0iSrP0 TnO,0$0XeP,00 00.(0pL488@HPX`L -LM `P0p-S000P(K 0(P P@  0S 0 Q (;w;r , D0h0S $ "-,0 0$  -LM@00$0 C 0+ 0 -00 $0 0 0+ -0 D0- -L M0KS0@0,0  K 0 0 0`t -LM@m0 00S 0 $: 00 $ 00 $: 0S00  <<  00 0 -LM@=m0 0 -LM0@S  h; 0 << 0 -LM@p00$08  0 0(0-K 00 $ 0g@+$po -Lhfo` -LM K00"DP:t - L6Py:nt  - L(Pk:ot  -A0 LR`P pPJ RDA R pP3 RA R pP R@ R pP 0S 0   0 p  0$  $ 0 p $ 0   0 p  0  0 p PĚh̞ -LMl \, P`p 0LSD ( nWl@ZT 1 nW%X  @zW $8W8zW $8qWh8hW H8_W $(8VW00 NW $7EW@ $7<W  73W  7*/W00SW $ T7W 47W 7 W 6W  6W $ 6@W  6W $l6W@ $L6W ,6W  $ 6W 5W  $5W 5W 5W00 lWP5W $05W $5wW 4n@YW00cW4ZW $4QW@ $l4HW L4?W  ,46W$ 4-W 3$@W 3< S S 3$ W  |3W $\3W  <3W  $3W $2W $ 2W: b0S Q KdeW " @ ^ 0K0 P" XK 0SXL1 ,0S ,;K jK j jKja0S @K00!da 0Sn}i S  Selhd`oI 9 @}l4xl( tl(l|,$\lȤL\lĥ\l|ģ L,<ԥ4$TdP`pآ@8ȦЦئ(40,< $0 0-0P@0LS 0@0800 6$6 0-|PL0@S d0dl00 0HS@k4k$k0000 6$6ذ@0 -0L0CSQ tM00-  Q^00?  Q^00@  ,00 0 6p= -LTM\ X3XSp`| , xp p <R|0,i |0@F0T #|%Gpa@ P p0| `Kx| Pxt KkPJ4K|x bP}W   |0S0t  | l h 0S |`KxPKP& |0 | Ql0Sh0S,0 S ,Ʈx )Pk x%Pld6[PP|0 |(1  0P @hh0l0  XP|0|0`6.t  k~pA|@Px :p7 P6H(P T DLt@Tht@4$gt`lxl0 -0L B㘬밫 -rLtM@P`!;FpF@; -P4`1`1`00P @a 0T Q $T 1@KP`  50: SP  0`SD T 86,6(606T k L#460 -GML M1嘁\$ `@pL x1x!t1Q0T*IKAP4: S 81 R CkP1P j$0 S $xf0S(PP BNK@D0 P P`1:f?00 tjIKAuPP0 R4: Sf0086(06X> (6460,6 -0L 0,カ밫 -(LMP` 0 %$Ep ?0@8S񟗄T ,4t|0S#00, d 0S 3 [ 0S T 0S#00J t#000d#0S < D3<#0C40P 0 R * 0000 t""! n"0S  "0S0Pa0Ua ژ2 R t2t 0 R @prpŸQ @0P@ S00CSt8U sP n ឪU fP  0M U [PP 1\   00h*0ESH D@P0P P  g 3 0 R, KkP0ESU , Pe/2  Pw Yr 0 RmmL3xXx\|\l|p|t\ZT |\lZ\0mdx p-LM@P`^0Se/ 0U $000 0 phw4p  -2LMpP` Az3w3t3r3100 1 RT 0S? 1 R20S 0 S(  \( KPH]  Q$ K@@"P Q40P EA>0@P 0g Ptd0S pd0Sx H0 R\ PHZ\TWEV||Zmdxfdgd -LM@Ed00CS"("("("("("("("("("("("(""(" "("("("8"0h2$ &h(P0 -2LM `RpY 1 RJ0 b QQ* P1 p2"1lR' 2!|a0yM,@0U0x `1R `VD20S8S, es20S8S PL@P 0Pf0 R0 R ` P |t`| Ph2`PT|Z\|0WEVZ 4Dx\|\ZrdApedAsd  -LM( R,@:( 0e/eT *0 SR:N -LM0pS`B0S0%  R2!( , 0 4 8 |< l4S X("PB4S  <0B4Sl4ScP0SZT0SRP@\0 S@PFUں(PU@0S PU@ 1i a  0@0p 0 X 0S S@!18 0 0S S (   0 ~| w r@ lt@ f\@0 _M0 lZEdlt (08DPX`hp -LM@Tp`U( XP@H0 'B0JP@ S7h)l)***)*** **$*X0 #8@pT`P0  `Pt l \ XT ( P@ p`A>P?> -L,MB0 80 0P, 4  ~딠p`0 w0S= / ἜP80BUa ,P 0lP 0S 0ڕX څ!,L, D 00Sv Sj ,$$"4Q 80!R,00CS0, 0  ,0, o1,k0 8Q   ,`008 P,,00* C R +, 000 08@ $ @,A0 08 P,,00* C R , 000R,_10R,Y1 ,x L,T80a ,<g $8 -LMZ0, #00 00pӑ Y33`   Rx3x!t0d 0P Y ( <, 00 $8 4 <  m+. P@ᷛPtB Z 0 Y  0 Y&. P@ᣛP[B Z 0x $hY (XP2LL"{8@ToX0, 8@T$e$a$]P YT U 08@ \0 BS@TZ@TP@\ x?PU@ =/T0 D1 4,0( X0 00CS00  ä0P L0L 00 X00 X0 |LXd`lx(4HP(0<HP -LM@0p8(0 pP P@| 0 0!0|PD P@\ o_Ke/& +P P`D e/\ PP3 DA@cX`Dl00CS0X0ӤX0 PpP A00CS00Ӥ0 PpNUnU(d(0 S (iTdp0`4dT c <c(\\h\l <D0 -LM0pK040 1PPPJ눁@F@@|P`L 0\!^ (`  P@E_ 0#SAcᔠ040 40S ၠ4PK fbp 4 0BS } _0S _0 S4c$>a뀩T\\*h -LM@_0S@ -LM@@^000S 00_0S -lL M@p` \ |0 0  Rp P00 0  `` -AML ; MBK@$ I:I8 , 00 8$P  P00 PP :P`` R 00L`P1V4k ,F(;P` KK0C 0C00 ,fP4V4 P 0S44X0PH`T0S440044 PV 0SE0S440 =0S  440@40@4 ,,P+VpPh 0Se BNK@D@D 0*04S\  4 44!\0PpPL W00R00SB,B~KpG pG ?P 8V`P _-*PPBNK@D@D0 044 S;;S(  04R,@40@4 PBNK@D@D0 044 S,  07,@@ PBNK@D@D0 044 S8  0\,@$ @$ LP BNK@D@D0 044 S0vP BNK@D@D0 {044 S4dP BNK@D@D0 i044 S<RP BNK@D@D0 &W044 Sptv8?P BNK@D@D0%D044 Spt~,P BNK@D@D0p%1044 SptP BNK@D@D0$%044 Spt=`P BNK@D@D0 044 SPFP a0BS0S8a AR:R `0A8BV< B.K B BD$ PD4` 044 SV P D4`044 S<$V<4 `- DPT` *0S XP #@T:q30  00S044 i04S44S +044 0< 0<$ @T6 TV* tP `D4<$P V ePD4` u<$4 <4V TL"D4f<$P**V ?PD4` O<4P~ V 0D4 B<$4 n<4P m D454 <$0aC1 0 *@@ ]*@$ @$ k,0 @qS t,尢 d*@40@4 /8*@40@4 }*)$ BNK@D@D0 044 STI440CSpבxʑc*@ @ ((T\dt,hp<{Pdt{ 8\l -LM(0S`d ,0S 00SH 40S Q| 80S0 ,0<08S804 <Ph (PaPY (PR8SIPU@0a Sp>P7<P-00S$0S0S8PU@U2 \aP 0 )PU)))< ) )8))x)l)`)T)w)<H| <P -L3Mp0moKPe/OK 0 e/ KK?KH2 01 2e/$1 (  0S t( -d1L(M\@@K @ Dq04Q@K`@@ 07< 02C 0-2 0(H 0#2 00.  - ) %c ! 5 0pB 0`XX e(PHx,\(`82P *0P ": -MLM N~KpG ) e/9 , $Q   P PX P 4) KA  BA .K B B)   EP@j(K0PS44S tZ(K0S0( K0@4@44 @@ @\4p*S:\4 X4(KS:X4 0mKS(K008 UZe/뎎KH:  V *㍼P 00CS00  ä0e)(K00qP@ P 0@pSAKUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUXNUUUUlNUUUUUUUUNUUUUUUUUUUOUUUUUUUUOpPPPXQUQXNUUUUQ(RUtRRS TUTU$UxSUUU% _OKe/e/  5P Ll]e/E 0 @8 ^PP 0S WK@ p YP@ 6 0DZ- \Ɵ6 R@@R@\ OKe/e/Z  } z 0) e/P Z  P e e/OKe/e/ e/POKe/e/~ jOKe/te/pZ  . + 0) nOKe/]e/YVOKe/Pe/L(8P"OKe/@e/<Z    0) {Z      .v7 3]UH0| @P3 RLZ )9 e/P< tCtt#tPP  R0000ӑ yS0 R000ӑnSU P#00ӑyP p2 ,0S ,厞  P@ c&e/PX HXU ၼP@  0e0[ $$FPP0S e/PZ q POKe/e/}e/yV Z 4 |81 RPZ  )9j e/XP   kPM %Ke/Je/F ,.'*(.llA rdA<DTLd:||x\(<d -ML M R, p0 @ S a`BV00?V p ,0 S ,夝0S 0S8V08ǡ8סPV08ǡ00000  UV4 00 0 ; 0 Q P@` 80Sg  @1^:0^0n005:0 S0S  0q P<0S9 P@ aY440~ P @0 P1 R 0S 00b01@ Q  Pm j P 00b P P 0SO` 0V0R00S`V@ P@; a`B0S 0S|V>p dVp0( KBNKa@D\0 (K@D . 0<(<x::<h p-RLM0@`+ a@ R\0"(\` ph ^0S  0 SS S0d0T!\ ph (<<fP0, 0 phP<4$ -SLMp 8Ka`N‡PV(VT` PG 0S0Sy  PK 0 SSZ, [RW R08 0R 0 @T0 4J 0 S?0S< 0S U408   P`1 R 0SS 0J(U ` V P)01  0S0S" U <1 Q *(1 Q :0S S R000 00000 0J ((PU2UP 0S S R000(U @@1P000 h<::$ -LM&KPpT b[P1^PD1@0!P * U:U: Q:Q"P^^@(1 Q:00Q$^T 0`S 0!@l0Q` PS 0S`l0S@0:: -RLM0`pl a@QgJ(T` iR 唀R 0+W  0l!00`1 \ p; p0 3 P 0S S" P0bS0c00 Ri7 P ig*0 `0T< 0Sh. 80i=T (@@AP0< ,x:$ p-LMKP@ [PTPT`0 R*0R*0@  [PᲔp::0 P0:00 -a0L0p@TP  V P P0 S R @000?S T S 0?S h`+ SX0 ` BR X0  äX0 "<60l -AML M4 8 , 4- MK 3(K 8 BnK`Fs< `F V 㶵 RpS3(@K @T 0 0S S@D00(K0?S (K0*S 3(K RTD   0SQ"0000ӑcS &S %S 0@-S+S@84 0D RBK0A0AP@R0"S 04 Rf<4SZ0 9MK 6d8+\ 8-Q `@  00* <\' ZP@/48`V%0 (U/ ;P V  @0aS@ lZ  ~U ,0 S ,  P@<l0 R000@D0ᒃ MK4h <0gbSe4@D( b<$ 00]??A(<Hlp=lY@0@D0d( O -K0P kS gS844()< @DmS/4$(4( 4480<4 0(K RO TR( K0?S X0  BR X0`  äX0l (! -LAM MhB>K0C0C4 , p@2(K0PS`V2(K \ @   0@R1(K T1(K `\Ē1 ,0S ,(y 0g g0C B#b"Baa  X8 < TLL!LTH 090 03Y ᖒBKJJX@8<$wT;K  ,C P 0(K;K, S QQa B RR24  l4 mL00CS0X0  äX0  (tHPl -$LkM0Ke/ ,0 4d(T0!PP 墲P@ ᜲP' @T`t\TX 0l@@T T8@ 4T00CS00  ä0 QT`@ UPP  ( P,#3P P@t x3x t,,@0\#\3P P}@t 3  t0@8 # 3P Pg@t 2 t8@4"2P PQ@t p2pk t4@<@T44T" L2@ 5p@S pb <PRR0SS T * R 0 dR0b00S@<@P!1P P @t T1T$ tDh!h1P P@t 0 tTD0 ,0S ,塖0 | e/0 a00eP h0hk@ H0c(|lPpP:{xdP p:${`$ -8@TLPp60S S 0 (S"H\T& ᜐP`$ 8@T0S S 0R8#H\T@<0 P @Ade. -LXM|`K@X pIPP 0rSP'O |0@Sb00C8SOOgRa嘁@aR T@ p1GT0\0CS0<0  0DD PP 0ɰP* @ðP" @T7R 0@.R T@ 0 T00CS0 }@00T sPx0K @1Sꐩx4LlP:T`Pp -LMp<P@ 0P@ @p <P*`f ax x0P@ @p <0 fP0 0`mg((0 m::$ -LM"KP< @0S0 @ 0耟  2[ 8#Rp`#P1 0 QS*10@  P 00!10 ᐏP!H0@ 0R!705@20  0 :<::0 < 0 ::A-p刀0 P0b0`Q0S S ^ @ 0S0T0%0n 0%!Q:: -0LD0C6S[||||||||||||||||||||||||||||| |(|0|8|@||H||||||P|X||{`|h|p||x|||||D}HhHN@<840,($  $N"N NNNNNNNNNN N NNNNNNMMMP pTt`0Dx ,P8\<d -L`pPAT 1SPUzA@@ᗎP  . p-LM`P@PQ@TpP Q P pQ -LIM MJ~KpGpGP @ , 1JnKS`F1A@TP,0 S ,卓 SP0rSJ /{TP@ PrU B>K0C0C4 000 !P@0@@ !8 pPP 4S JnKⴀ`F10 "\a0@|$:Tʄ1SBKAA  0p(t(\| -2LMp`@0P0 $ \0 K~ 0 ~ x 0p ^\ :` 0X ^< :, Hx::X$ -LM`pP@0 0 08!0 01QQ p: p 02 X P 0 0S P V 0 SS Px0`000< 0S40H. i8 0cx:8$ -2LMpP0 0|0`` `@t P0P t9T @(%L  -zxD$ -2LMPQ  0  @ e@t 0& t A0T:`pW; 0 \l< X0 "@ ,0 0pzx $ -2LM`px \p0@PP@ @| <0< | `dx$ -2LMP 0 Rp`0 0` `@t 0 t| 0 @ 0rxpx!txP` @ᆬP @T<M 0 0T @x$40 Q-Lp`( P% P# P! P !@R @PP P@T! 0 /\ #PP ɋP ċA4 $0 NltD$.P0S  0 S b -LpMpK`P0sep @T X `0S@ 0@0UPrdAedA. -LP\p@` 0B0C3SO`ЋЋЋЋЋЋЋЋЋЋЋЋЋЋЋЋЋЋЋЋЋЋЋЋЋЋЋЋЋ`ЋЋЋЋЋЋЋЋЋЋЋЋЋЋЋЋЋT <0( ,0P<0( ,048  1hjW <0( ,0P( 0]V ( ,0P<0W<0( ,048 ( (0R, ,0R0 00R4 40R8 80R< <0R@2 44 4:P$ o(\ '$0 P 0Z<0 0Q#2 -L8M0U@p 55 u  % 5PꨍlHT$4@  $Pp 4Q 0SDP PpdP(D0: S  S  S0 0lp{ 00 R000Sg RĎ?;#003 <0S c#?;0P@ ?sLD T@ ;00S  ?+83 0S,3@T c ?V2"@@ 0S H2 AR;;S" ":00S 0S 2Ql2l"d2T"H2D2qH0S0||\ K1Ps1 S@ 00 ~rH!0!q@ 00 ocH0!c@g0*YH0d!Y@T P!P00p 0Q  >H0!>@0 0T P(H0 (@0P 0<0  H0d}| }||H\}`}X}| h}||}m8@P -LMc0Ss0S 3 R S0S3 Rt3 R hCPHTP,K K0S 3 R| 0 0R  R B 0 S "000 R2 R0S㼂 00CS00  ä0N00`V xx20 0hPM/@2`DBHP(@ 0S 0+0 3a000+~P !1aA0 @@AP|  C@ 0X$1 v@e0APR0: SN8 @TI0K@D0 R㬀 00CS00  ä00 ( 808 $0}|}||d}}}}\@t}XL|\} -?MLMt0t` R   0S P 垍Dp0S?KK@D0P@D?+iP( p- LMP|Ut`0   p @0T PࠡF > -\0L RL H0 @R0,0, 0X>0U> }$ h}} 0-QLP) 0S-ЙЙЙ,Й0  BiP@ڸ0 T ;;S0@0T@|0 t>0AF\ 0T @>00  iP@0 0h}| }d   -b0LP@@xr PP PX"000SQꠚ888ԛUڅ;;SNU8U0011 U00R@@T U 1 Q 1P=E!0|!=l1 h=\=,E0S E0S E0ES U0P0 0 R0Q/PUE0 S E0S E0S E0S00PX_=00 000|   d < t  -1LM R*ʔa0S& !00CSYxx0Sp1  0SK|0S0 0  0S==[0ȌlȠ@$ K$ @ _P@0 HP U0S \p0 y@0T@_0 0@TP 0hQ00000||||  m|  -P@LM0 U 5ࠟP.0 R  06p`W 80 S80S*0S@0QD@ <000P|4  -L M䁟P@P!0S꜠H\UTg<0000U$ha 0 RQ R 0QqD!r< 1 R bD T:P0U$`0 [0 njlȠ( f`0P@( Kd$@ jP8D$0H 8<<Td    h}m 4  -?ML M804S?KK (@D, r@Dz r"(K0?[K<(PE0 PE00 -PAb0 0#PV?KK(@D@D?+fP`G?+fP;@@ HP+X@ P0020 P ,0 S ,C0 ;;C ;C Cp  C` C ?+tfP}(md p 4      -LMdNK@D0 @Dp (0 Pw P0\ 6+P9x+Pꀿ}}}}d}}}} -bML$M 0,0 @bmK(`FP$`F T T 06 ,0S ,m0DP0 P!0SZx1 ZQt!0SCb}b]pP0S(P ,!0S,Z -PP0(P@+~P 0S @0S| 0 00,P\0` X@0 ;-P+P(8}}}}@ -bML$Mx0x@ R  +P P L0 Db=K0C$0CP3 0S Є}(P -%ML,M%K0(J⒍K JE(H,0 (H %b}K(pG P`$pG; S/R P58,0 S 4,埄 KH%0R/S /00H5 0H5` %,K( B:KBP`:KP fL%$(K0: S 4 S*PsP5.P|4 R ,PsP00'P@40S(40S- :KL5*KP/QH KLP T5*KP:KH5P@0S 30S #a=(K0Q|3|#׸*P#P* $P$C0S3 R *KPQP0S 2 R{ "a=(K0Q2հ"mڰR0Sa2  Q V dP|20 S SQ$ 0CS+P0Sh 4B0Sd ("00CS00  ä000V (*A a%K(JPJuP@ "   {<0P!4t,11 0Qڍ0S0  (Ka=  '-0QBa=l (KX00SX0X <0l 4(} p}}}H}}}d}}}} -LM⬡0P,P @1`pD3P P00SP` PUD1 R 4'4P 1@  40$P$ 0S U0 R 4P  @0| ,0K8P P.0ST 000 08Pꀿ}|0T|d} -!LM0S|@ a1@11 WpQPpA\PX@T PZ\A1 R 33@0S`P111P 1 110@1SZX0 R Hl3HX,@\ӯ m\h @P}| 0-@0PQ00L ? Q ?;#ʁ P!~ Q ~<Üʘ0 0P 0x 0t0p0 0P03 8<|}}(\\}h} }}t} -0LM @0R0 0P 0 0 0 P`0 R ? RL?;ʂ;;S 4<2|}\}h}}}}|}0 0? }h}  -02LM R"0S "00A0008P_䡟 A00b@_ß 0 dp#4'YX`pPB`V pWC`QP0 H S0 @ *$!%P-0 0S0A:00cP@0 000  0S @ @0P0 pA2V8@ 0, 00002}|}h} }}}}t}|@t -q@0LS" 1 R8 P-`PP0S@T ʺP @P0 @1pd0/X0@P00 $1|} }}} 00b0} -Lp` M0 0@K  !夡0 0bO TS0`V p00P1@_0 U0 d0 Kp#4'P50 K`Vp Y*ڴ@ 00b`W  W V 0X0Y0XVt`WX}}h}} 0-H0H@L 3Tq -LM\q0`SN H!3#c1c0cAT R$0S8 Q0S. T P T $`P 00T 0$`00  XPl0(&PC3dAdv@d@000XRP$Tq -LpPP 0S ,0SP!%0aV 0S P0S$0 0@0S# V qP00 0$ 0 T %P(@u`PYP0000(= -LpcPP 0S ,0SP %0aV 0S {P0S$0 0@0S# V NP00 0$ 0  R%P(@Yu`PtP0000, -LM@(8aMP@ 0S T -1LM 0 bM@ ^0 - ! ^  ^ a0 :#:900 P \0  ^  ^ ^  ^    0-LbM(MPbMK@D$@D0p 0 d0 KX0P  0 @0 0 0S kz0(\T ` 0A0- SPL@ 0]0S8  R0SZ+ 0U+l -a- `L0Q!0p@[ P20P d 0p QL -+4 $$+ PP 0 KS- L˸0P 0  -PL@LPgb=0  <|1  5d1  .Lq0 '41  1$  1*  00   0A0a-  bam` ; P0@09P0: S `0  ,h 0S HP (,$0H8 W! -LTMr0 $0 @"P2b- 0LS`P2`  0L`pPKS񟗞a=0A 0WPP2 HD 0 P,2 0 P 2  @*$0 S $'y1  0 P1 0 P1 0 P1 0 Pp1$ 0 P$1* 0 Pa=0 0 P; 0| PLPP00S S S S  Pd0 )@0l A 0O Pv A(0(qP (,$0 mS- Lg0P 00 mS- LX0P 00 ]} -2LM pR@ nPb0   2  l"0 T2  <2.  $262a-  am` & 1>  P F $04 4!N0 y P Vt $04 4`!f0 h L1^  a P@:0@0P3n000cBP) 0: S `@0 0S@P0 ` `,o 0S P `@0 0S@ Pn#R} (,H8$0 |0 } -H$L|M0 ,0 < P $00CS 4   4圐K R 0  & P3=6K 0 P7#00CS   a=0p`P@00S@b-P ``06 u P03 ($3 0 P3 0 P 2 ](2 ,0S ,Cw2 0 P2 0 Pa=. 0 P`2& 0 PDR>0 0 PF 88# 0 PQN0 0 PV 88# 0 P^ 0 Pp nP/P*Pn000cP@P00S S S S  P<00cPy0 'sq0b= 0P@60 0C PL [b=0P@06\  03 P (0}q  <(,$HtqQ-H0 4S Q 0 S  q} -LMPpPb@03 R 0#400"400"40 0"40  0"40  0"400"40 a͠$ 0 `48 0`  !H8 0Da=$"$2T:0D0P300cPP*!0: S `@0 0S@P1 ` `,o!00 P `@0 0S@ %P0 400 400 40 0 40  0 40  0 400 40 a͠$ 0 `48 0`  !H8 0y} (,$08H P& -%L0M0 (0 H P4H@ AR4  0AS, ,,HPa`%<%8.K-0K.[- [%<$,0KP0K+K(,0[+[pPPČ%H8 0P`KPH0`P@P`b- 0^ H3 A&S(0 S ('u0LS#H@4B0KAKB [A0[4Pq 80D KC0K 83H@@ 4#H0 4@0K?K@ [?0[4P#H@ 4>0K=K> [=0[4P" 4<0K;K< [;0[4P" 4:0K9K: [90[4P" 480K7K8 [70[4P8"@460K5K6 [50[4Pa=@,@8@4 K30K2K1K4[3 [2[10[ $4(PpPE400K/PK0 [/0[4UDKP2P-000cP@P#D1H`0S S S S\H  ePH<00cPLH0 %EC0HP H 0 @@,@8. K-0K,K+K, [.[-[+0[ 4H0P@b- P0@/HP b=0+ K. K- K, K#(0 (,$$ -0` LK$KP P0`P| PQ-d 0QpL0L {P0, C% }(,H 0-QLM@P&0 R00P0 R0S 0;0 R0 R0 R a= 0P0-\ 00h$40 |000 0 }} 8\(, p-LKtM @`KPP   \L0  Fp$p,0 00$- 0P ) -LpM`@KPP X0PpWH0P 0R ,0 ^a$P} -LtMpPK@P1 R* 0R5 0: S, 0PP `, 0Q` P X 0x @O$XC,0L C$P 0R $}}$8 -MLP4M H4p , t * $00C S0p8L`ppp3P3 RIKII a4S+P) +#0@P \ `3 RT3T P00##3 ,0S ,r3P 2 Ro 2 BQ R0P0 R0Sx"0;0 RQQ B0S|2 R p2a  02L嫿P zP0SBB0S1 R  IKAAP!0S$\1  `+4t!`#11  WBnKP`F`FU!B4: S>hp@ Pp2+ 00#00 ,  Q%x "B  X (}X}}(,\t}}8\0 p-LtM`KPP 0@T0: S c/Pp*L 0"pCPVp* p}$8 -LtM0@/SP @//㰾`@pKT/ `0S0S ĵx0\0S0S! *x } -@LpMS` Pp0S 0 R KyP0Sl00d0 Rd00HPW*00 W"P* 0P"@X -LtMp@W0 P`0S 0 R KP0Sp00d0 Rh00HP*00 "* 0"PX -LM@0Sl`0P )0S )04 !$0 RPT}} -LM@ 0Sl`0P )0S )04 !$0 RPT}} -LM@r0Sl`0徽P )0S )04 !$0 RPT}} -LM!@6P) 0h~! -*0LM"*@+=Pi) 0hh! -LMRp, `1 0S00000SPP0e0 peR  V@*0S@T*0S T00- x@ x@@T P`W,0c ) 0  !pW4jP  0p\ x/0\Q`( 0 l~}  p-RLM`0 Pp=@0T<  P( 0ph ( `T 0-0@SLPB 4 0R0a 0h2}8 -ML4M!0QP,0 pG`1 KK`(@D@D V k#  wKP p R0 RPa- 0S0S 0 Q 0 ,0S ,7oK(A4A /P a=(K0Q p0| 0QX0PR(4 0@ Q J( 0$ (`l -0 0R00000L R0000 R0@00x0 Rl=ih0P PP0 RP$} }}}h $}} p-PLM@` 0Sp iPP ;@P0/S00H 0 S8 @`0 0 PPPPp hld0 R00T0T QH0  \80 R,0 P0 p}},}td 0-0P LRl0@T 0S @T00SU0 ((IP^}h@l -QLP=aq R1 0S  0S0! @0S00 0  P 0lP 0PL' 0` KC'P DP*00dh$}p }}p -$#L M0PS sWP 30C S8@@@@@((@@2 R 0, K@00KXP0,0 0y0 \ 0D"00" 0"bMb=0@`l `0 @p 1封 * RY 7 R$00  +P0 `ç 0p!尺 P;041 P1& 04!  Ra- 00 R0 0 R  R00 R0 00S  0a @0@00PE00P<,}dt}  8 -P1LMP`U; pP@5*(P00CS00Ӥ0(p  T:0P0D@00CS00Ӥ0 P p 銽T pPH P  P@P0  P } , -2LtMxŸ@0pŸT S, Pp$T ⢯0 CR 00s2 ,0S ,l0R Y @KF1 R@(08&B`P0 \*L-S0!^ *\ ^ *\^0305 -$$q0LS`P P: 0-S00 00 0S&0@T0  ᩷:TP 0 0:S l R1 0 LP0Y?0C0 hZ0}l4}T  p-LM0@P/=+|P00l0勷0SP`ph8<倷0Sph00ph}X\T -LTMptp % p 00@JS񟗈&'''''''''''''''''&'t''''''''('' (('''$(<(''T(`(l(''''''&x((('(''('(('() )'* *$*0*<*H*P*'*p(4qDTA0S`0@0w,0S 3wCPv  4 u4Po\j43S Pvd43u,3u$33t 2 Pt2 Ps2s2r2rBp2P: \2p2pH2p 2|2 pt2@p}l2pzd2|w2|qP1@ 0S `Pa0CS"))))))))))))))))1` 0S{1P1P1P1P1  &t1p1{1[PzqT1z-L1y*D1y'xP0a,AH0pK @p <1P@x  0P@ P⹫UH@ 05 0' }ll}H p }l }}T}}}}|} }}\}}}}}}} }}}L>  (,`}n9lT }! 0 |BXL0@0t0 X X0 t0SI0S| |0 0S`,`,,,- 0S@0cP0 0S0w 0S @0yP 0$!0S0<1 _P1 RH!d1 p6QM Q ! R 1R B Q @A1A0t0 001A0t0 01A0t0 02B0t0 0 - 0PDDLM@, 0 4 8 0(Bp 00@JS񟗾//\1\1//\1//\1\1\1\1\1\1\1\1\18.0\1\1\1\10$0\1\10\1\100\1\1\1\1\1\1\10\10\1\1\1\1\1\1\1/0\100\10\1\1\1\11\1 1,1@1t1H1d1t1111\11vfP040 606666|6T6t&h640Y8  6 86   w4 8bP8  fe6 0 f5b5%5 \0X5 | 0-S 0 , 0S,  5000 Bx5x%=l55P6W44 0$0,0%000( 55 %, 5R Q@b $4 00CSTY  0S2244YpP. Yi 80I`0< 80 VL h,P\D;P< Pp$P(4 RYPW Ø3 , RPC0S 0S SP 0S,30 tᬄP@\ L߳P R2P 2Pp̳P `P x2`0P<0 20H CQ0"Q0v <2PlYPN YY 8 I`0 @0 8 V; @Q P1ᘳP B CP wPtሳP1 RY0  8`p3P@x )P`dP P0 OBPP;PP `P`P@  ,P).P# \0S \}8!l|} `!l!x!!!!X}}!}}x``}|}}}}},T l8}!!!"" " -LpM`@pK@ 00RPPAP0: SU/00 0D 00S%P  +0 -4L$LM4$䄟P4 $4p $`p 60@DSp9D:D:D:D:D:D:D:D:D:D:999D:9;D:d:;D:D:;D:D:;D:D:D:X8D:D:D:D:D:D:@;D:D:D:D:D:D:9X8L;T;D:`;D:D:h;D:X8p;x;D:;;D:;X8;;;D:D:D:;3x3x#000d3+ X3c~H3@c@ P@ P 93 R ) #b尒ŸH0pK  p 2P@l  2` @ pp`ⵧVH@ L2PH2b 0-S 0!0S "22!0291100!101|1!0&H!1r!!0QS<<L<L<< R|PP R0S,1 $\P 0 R _ R 0 PPK }}}\}|}}0"}|}l8}!!L>T"l"(}x``}}}x}l},T "}! p-0LM` |@P%!d0 P0R4BDL S00CS00  0p ph}"x"1 P00ᘽ -L0L R0 R  车꘽"" P-L 0S鐅P1 0PS$ p,ӰPp`=ͰP@ ]P  ppP0VPPS0  U  0S( ^ #!# p-LM KP qd R0\4P0 0b0CS#@AAAAAAAAtAAAAAAAAAAAAA`P$K4 V U  0xS S *S p`P0E" $ VUp`P%%K5`P*%F:`P!%O1Q0r 0-LMKPᴀP @"#  0 S R A]PP   B#0 0 C 0 0 8} -L 0㫿a0#m -L0,㞿 a% -p@LM@ 0\吿4 0L勿E 0<冿B 0,偿0$= |`&& 'h'' -MLML0P`(0  0S ,(0 S (zb @Rpx 0\S@ S  R wR \PP`  PI000S  \R 0R 0S \P 00@0@0S PS" GS0000S 00P 00PPP\0 0gS pS00BNK@D@D ;D 0\z(v ('((tx0(X(( -@TpL 0S 7\`PUP P@@0`S 0 p`PPP P((lp 0-\0P@LT 0 @T0U$ 壤Pl)l -LM0PS x@T l1P0000 <1`V0S`" 1 R @T 0T @T 0TT 00[ 0 p<Pp  R/00`o @0/S`0 0@4R R/00pl}},)H) p-!0LM0PP@ 0 R 0 R pp0 " 0/S @T|0 RpПPT @`H0@PpUP00l}} p-0LM`0@P?P6 *P *P 0S p*P P Q  P Qp*P Q P0 R /QPpQ @PQ}@-0 !S@@T0]P P 0-S P]P ^ \ ]\ P Q0 -PRp0LS@ 0/Sk 0S 0/S6 2 R2 RPp10SS S !Z 0(Pp10SS S +0  \Pp@!00CSk `,1 R.000S S 0/S 00CS00 0+ $<0C<`0S.000SlS 0/S 000  00C0ꌿ t} h) -ML M\\1 `P$ ^KPE840,0S/ 0Sү0 S0 K0S( .S @ Wp Ԭ P;0W$0 S x$_d0 K@TTfHb(}))*,* 8*\*|* *** p-LM@P` 0P D0 L\ 0 pPࠣ -P`L/Q@@e Tp Q@:0Q Q0@*0CQ:0QQ0@*00 01* -LcMZK MpKK K(@DKK( @DN*K", 8:KWLK KPH0`K: bK(J,J 0P'02(K  UT1*00UT1:T3 0 PPi1!(K(K0@cTP 0S 0Y pWp,0 S l,^T *0S 0TP*0S0T0* K\ 0 1(K R K(刡0(K RK*K:K(庫ZKX:KZK(8o0S  KP KZK(8TxKQ :K(0nt( T\++,+8+\+ -LMpXP, @ *0S &S  \S 0T*0Sh /R9R,00`BVP"0S 0S0 `bV0dV @\S R0P -LMp㮳1PU|堾PP 0S`QP@ 0 S/R< AX4aP2 T,/00 1  bPP 0SVVVVV00 R,0 h@T0 0S/S @ ,}x++}}|}`}+++X0X P -88L(0 R[}}+$,} p-L,M(@KP P P Pt <8828Ÿ@@4`K@PK$Ÿ0 0 ,0 4 PV PF P6 P& }P0  40 uP oPpVX!Wp@0S ]P@0S SP@0S IP@0S ?P@P 6P 0K   0K  w 0K  k 0K  _@,P}}WH, -x0LM @R`0 R P0 RP PaPꜿ p-PLM@3 R0 (a0S= 0#S4 \S. PP$ I0"C12d1@cP 0S PVP P0! 0pxu  `o 0#S@ I~P,P  ꜿ/>3h,,=,X0X P#3!"c1 0c!R 0S R(/>3 p-PLM@3 R0 (a0S= 0#S4 \S. PP$ e0"C12d1@cP 0S PTVP P0! 0px  ` 0#S@ }P,坸P  ꠿/>3,-=,-X0X P#3!"c1 0c!R 0S R,/>3 -PpL`@ 0Sd /PPp0 S 00C S0u 0SUP@j U 0SE00W0S1W 0S !0 0P!10@ @@P000 RH 0h U, a U\ P 00000 0S MS CS000 0S 07 cS mS00dv,QW0p0@ .QT@}  ( `-x----.4.`.@-0\ @a 0S)  S   0R  0R \\  0 S0S 0 S0S  0R ꔿH -LMPت0pS@ q 20  00S| 0S(T`q @ỪP_0 1 !.B=R pGV0G SRddddXddddddc 0!0!>C111v>C 0C0 !0!>CP00 1 !.BR00 R0S P&0B00 1 !.BR00R0S P0 1 !.BR P 0 1 !.B;R (p010!.CDR Pk?C@.PT @} 0-LPL@DT  0ܶ0S0 ! ꤿ . -LM⬁PPe 1 R 1 R|1|!11a11acAT pP0 S @T0 0RT 00S0hS0餿$qv -dpL0S ` AT@0`V01P@PSSUꤿ p-LMP@T0 p0Sx`t 0 h0h]ѹX0P0H00 H 0 ꨿G}.}. / -ML0M (R04 ,0  2 ,0S ,X4! /!8 0AT ~KpGR0pG8 @T'SP@, Q0 Z0Q  P D! TFS4a=  8,1008 A  +0`PS 0S040S  MPT 4a=0 S0ń8  $ ꨿(0/G30 -1L M@\, `p? ̡1 0, @R@\`0 PPI P 0S: Pda00S0@P! 00S00S QP 00 0 0   )&0, PhPP 0p p00  ` WPP 0X0@ LQP 00  갿Ŀ01 0-LPL@DT  0雳0S0  괿=81 p-LML`0S P0AT  0r@TPOUp鴿 -LM䀟pPP, / 0"c12f1`cAT 0S @TPP@ lxP pP ,000! 0AQ(o0ST 鴿/>3p1 0-LPP 0A"#12b1 cAT 0S @T00 ST 00 00PP0鴿/>3 0-TPL@ T0 04 @00P0S0070긿<}1 -LMP0@SȠp  0S P@w0BS` x0 (00 徐 L 000oP`V$ 0`00긿<}1 -`L0S$ PPUJp0"S@0S w 0RH Q zQPPUZMP000鸿} p-@Q0@LM@C!1`@P  KP*0P0:0 R@U K0P0,*0P0:0@p  -P 0S\ \P00S0 BSxxx`x00L\:0000L \*P\:000L\*00L  L 0 00L 0@- 0P@CRyyyy00L\ :1!P@00L \*0\:000L\*00L  L 0 00L P-  *0 R: R$0 R:  Q0-LP0 S\  0S 3@T0   0 T} -LMP@ PpP \ 00CSP0 @ ($ 022|P}$2L2|2 -LMP, P, 4#, ,(3(cpp0K0CS d, B, l0  , ,2  t , ,2|   a,  ,l2a-d2bb0  00 02R(0 ` >0R 2 "00<(@ /R }   @<0S@P `1`) (@0/S  00C0Xl1 @1) @1  5R K0BS` 0@Q KP0  @P00 9p 0 0 :0 d@0, @m, 0PT , @b, B$ (,H8  }~ -3LCM |3 B, R`@LpXdpp83 R  3 ,0S ,SBP0SPdU <"K d2K0b S Sy 0CSV+2 Kd1KK 0P>KdP2 0P >Kl,20 P  2 X>Kt10 Pa=.K0 PK&K 0P|KP RP@!0S Sa]P K@ 0K@P `p@< 0S@P``0  _+0 Kd2.K@/K N@KPt0h0x\0pP0hBS$  #0 $ 0<2S (@'(PKdA (KPYoK P0 `A \A XA TA PA LA HA DA @A PdC000 (3>K kPVXCX_K#^?K@|A 庤PHx!1RS@$0KP0;CS040@4Q0S|  `]dўlΞA Ȟ!r 10C1 =At0\ T0 02FP@iT00< KcK0 ! 寲`VKe/K:1 S < K eKK R x0S:!F A I 0S t5  1 刡  00Ì bK 0`Pʱ 0<~D$&9r464\&=K@婬PpOd&Y?KP0C P囬P Y?KP0C P卬Pw SF]?K x0(PK0@00  O? K ^ 300 0p1  000+]?KR W ]?KH 7 ]?K> ~P@ 00 OOK, @@H 0-LP:㻝0^  x0\*@P0\@ PL0@ D@P@4㜝 H -LM@@ -MLMXXb0PpH,0 pp03*0* 201 0 2 1  Q P1@ԡ`0 810 @@凢0P0?P P$JKx!(@D@D0h!`P~X -0P ,0 Q  ,&J `8#8P#$0$ @JK(@D @D1K<:(<2: !<(K0<:(<2:(LL!<  04(ؿDпXԿ 88ݿ8D -L4MD 0K`D 0P@K0 Z L7  X  ,D h0S '0S0 0R0; 6"  ) R000 0p 6F 0 B0p0 \Ɵ0 ` {DX@0S #S $0 0c@BHX@000CS00  ä08 S7 S@PHUp|0 ă ā Ă< 4 <( "4\,<PEU, pH'W 00CS00  ä0XPHpWp!pW T0W6 'W00,P|0 ă ā Ă< 4 <( "4\,<xpW0 PH 'U00CS00  ä0` pD 0T Phß0I0p@gU0#DHLS$H 0 \6DP20S.W)4S4#0pW@ *0 @S0pW:0pW@ *0Sp 0W:P@K0/הPKP@0/=0 \ 8K⭨48 < ( 4" <( "4, ! 0,< `Rc@0 , =9 A0 0 0 =,0 2a, 3c#0OPK< LH0`KqPK@ P K`KPKH 0@PK\,!L@0SPK! !H0Sh0L@Sd*PK`T0 A 0010Z1P7  v p 9DпXܿ09lD9L9X9l9~p9~x9999Կؿ9@999 :MQڲ0AQQ00  8#8LȃLȌ 00Ѝ -ML$4Mx4Q (K @, \ 0 CR 004|K(IITK(JJT$0 tӬ * ᴊ0# ʬ* ᫊#0S`V* XN|VP@H|X0 P - aP@:|V0 n8#0 嘬 *y *uQ 2 R c  8,0 S ,8G2@2@P0 ናŸp`0 胓6@PK0L X0/0s)K@ B0/ؔ0/P@@c0/P@@Ȕ0/S0/P@ @帔K0LP@0/@B)K0 BP@0/@妔KP@P!<0 @ * 螀i 蚀W 薀P@M  f   *܉3K (JJ0  *Ή 0RK(II l*Y@A(l :<:T:UDh::::; -L0 K M00, 000K 0 ƒ p/? 0@ @ _` Q @0 RQ   -LM@8T (0P0PD -LM@Qsꄵ LTȷ`hQ DLT\dlt|ht0S #!Q ĶpAV`X9PLHDh.840#$(,"(h!0S S0Swusqo0("#;;0;T;t;;;;;<<(<8<`<<<<<=$=4=H=X=t======><>\>>>>> ?,?Pe 0Qi$0Sƚ LPo0@0  Po0 45@"%$0& P; MP P (` 9PD>0S 0S5>z 0@ e٣PpH0 0QO$ 0eA,.A -LMp 64 J, p" PP0S40UX0SP `4V ,"0 0S@̥P1 ,40X+0S*kP8 #! Pᶥ`S/0 P\ P8 L 4,  00X00,00 0S0S,0 2PP0S 4, 0t 00PPPPX,00@0& 0 0 0$0&0PO}t0SqmA - qPFL` I0 Q00\0S@`.Q,*\ L0S `00S  0 Q0/S0S:0 R P /P R܌  -MLMp0P@AnK 0 `F\`F 0 0U0 U00S0 U; 0S l RB@F0S D 08: S0 " (rB܌ BB B( -L@!x1hFSP/ 0Q0 0 : SFH` d0S T0S 10g1hhP  PP 0hT B($B̌4BLBXB`BxB -LMa0P, 0 (@tt1L pKR `0 T! 00C SG A?K K0 0Q0 00nS 0 S A0nIK00 K pKA/00, ̡       (4B p-LM(`P,@劑P ,0P p  L0S$ `0! 00C S0 0p00000004 -LCM MD$E~KpGpG 0,           `$ \$ ` 3* R@ R  ȣd$ 0SP' 0Sj3 3(K |3P\4 4 XT 8@T40 @TL S0@: S< ,(P,0 S ,@2 2@PP 2 P2R( K"\$ XD @An04"T2 R0S <vBNK@D@DG P@1 qd4 S00C0 zy !1@01j 000lIy \0S l@3<$x060S bP^ 0 pPV 0 UP@ x0SJ GP @0S? ;<3I 0S t( B(B̌BT\BBBBC08,CPChC|CUCCCC -T0L8M<0 0  8 @ 4 0K0 , ( $   Y@K2 -MLM⼑0P0 P00S,  1Q  0P1#\Q:,0 S P,?E.K B B0h$ !1`$ (@K  d 8 X \ @&?; hBNK@D@D 0 P h F0D_0 Îp` "o(܌CL -L Mr`9PPy i&" P(0S\ }P, (0, ( ,0OƗ@0 /c0,00 0 0S3&j,0 0S(&_0 00,0 0S0 00 M 0 R 0 @@P0, P( ,P6  c Ɨ@0 S/0,0C0:0 (0庛(=ČD D. -0L)MA1 L0 B0Q 0`!0 `0000L0 S  `0 00 `P(yp@W  Ԟ0001V' @ 00CS00 0S 1P01rXQ0P 000,0 QP080 -@LMT 10C1Jh@-p0\ ` L00n^@` 4K0C4 01PßPoAJD  \ $  0 B00S00Y X 6#1@% "X`P$R`1 ,0S X,= 0@82P @" Q 70$ :  0_PPd 0hƑ(0CC1/|x0Pw00S  n Q<;P9(DDDDP -MLM0tC\d#, 4 <(  P@\43{4 #A6T8 4 ` #140\F" $p`B6# AV#1%Y X @0 0 ˋ p2Re L 8(LH0PS@*KAAD R& 48 S <8(000 @XT:8H000,0 S ,H< 4 0 |00S00YX   D0TPDHGPH @7 Q L 1HH@8H0006#!P*8H0L Q@T *BKAA@ 0 S@@T:08(|04 @P0088  <  +(EDDDPEȌ -0LM PU@p$`T` #T*U0 R / 0喃" l(`▂#0U<0 R 0 0喃" L8ELEhEE -0P0 P00LMS0 P%܀ R0 P.:p$60PP5`@2:(P`@,F0B$|P0 R0`@00&$F00$ʝ@0 p܌E   -!LM0\00 \pG\(:`(P``ᮝ,F0B$妝0 ƚ \ᔝPt0t0l h d@d0 :0(0000dlt܌ExXp\h`ԅ - 6 8`0(@ 0L 0SĠP`]묀ppGP3@00 00`PS P@0Ss0S5P,Rtl dphx\`XE -LM@P00!5` -LM@&B ?̉ Pa(4PUp* 0А0 T00P00@ 000p@0 (($`嘚d0 dS D 0 Q004P Ѕ4؅̅ąF -P0LM@ᱜ<0 P 0S P 4̅(F p-LM``0S TPT 01@CT*44000p40T*̅؅Ѕ 0    -LM`P@aUpᰀ 0SP 0S 00C0$d \0 iD80  \0   >̌*@FԌ88HF B( 0-(0@ LRP 0 ,, 00 0-(0P@LT ,P  T00T0S 0 T @0܌ -LM@0T0 T00S0 T@ἺQ||tp0 Rg T0K0 g 8 (TF܌\FrdFhF̌tFF05 -0LM@ 0h C\ 00CS Xhxtt 00 00  F8F -PLM@ @1 Q (P0P*0ES;PU:0U z W/ , Ẁ0 0Y`P( 00@$Kw$ @0 0 /&`$ 000H0G  W00 R8܌Ԍ4 0- L8M00 H0 <0 80 40 00 ,0 (0 $0 0 0 D PK@ HK@4 ֘$0$  00C0088Ԍ -LM@Pr0 `0"xpM b0@SB,,,,,,,,,$,,,,,,,,41 b 0`ip1 h \!000`01@ m0U>0(!S 10`00!0`00 0@TQ P  0 R T@DX  0;T@DlzX T0 R G6,،ЌFlPČFF̌T (ADA G| p-L@M P`KW0S 0S  { p G -LM`t`ğ QS, @ DdZ 0S 0S~ p P0S 3 ,0S ,7 0ṢģL0S@ Pi먓0S 0S_ 0\CS 0S ?0S 0S , @C 1 D@! T 6`Vh!h1h!X0 d1@L@@0,@ \@ ,0KT@ P@ L@ H@ D@ @@ <@ 8@ 4@ 0@ 6`TP (0@T*0U U@\K (0PT*0U6`V 2&ꀠ?>1 L!\  @YP ?>1 A! @TڑRڎ@Ԍ -L M0 _0Z0 Z00S70E 0S 1St5  d50S`P<5&0O @0 V"U 5 RD G 0 0|P 0  㘕Wd D0S Y X`4&B ?ፄPPp` Y YP Y  Y! U@1(@Q0 T PEU@ #6#aᯗPP@T1X@QcTP #0001 01S@  YD3  , \3)&T3 0@L#0<$ 64$0 R  "0S  M0@$00 Pq p2l2    4/P x2 d` P~ 2 RA @(>1 R,9 Qh;Pe@0 ! PPZ @@TP|6#1@DT PM\1 R 0  | P+ h1 !0/l (K0 b@0 ,J0S /0Sq P 00P(< ㄐP0S "XZ P D z9F tt8DI@F8ǏԌ04$(I(Jxȅ8JTJ`JxJJJJ`Jl -LM@P1Ppe`VWY!?> DR.000 0. $0`F0V$0@X L0 S00*/.P (@ R00  0R 0S R0R0S P 0 R yP` _X0 S00Dō<<8@dN($0JTJǨ(K@l$4Kl -La8M0&0Q 0  p 0KL P H D @ < 8 4 0 , ( $ @0(0PU *0T0 T00SP (0@U:6pW<0P 40H@ PK0S  0, 8 -LM`VPڴp崀N@PT 0S  0T @T R 0S `FVP 0  0P 00,$dN -ML M0,0   BRPx0@xxt P d$PTDT$E>K0C4  L44 $0ß 3 R( K#d `$ *B>KMK0CL0C L4 p0 R X:p# X*pCp\  X:[$3 ,0S <,2 0S 0 S s S # P"   00C0 "{ P  000 00C0  PR0S-@<2Vϔ@U P  嬗2(KZKK@$ (@i0\4  X$ nHQ& B0O0  0lp 6`X!0SV Eo0 H5@"%$1 R0 P P& Pd P ?0:90|o(8KKЅ؅H0KKKKLD,ĽXBLBlLKlKBTJKK -MLM$p\0,0 (`; R 0S L0 S8(K 4  `0 A?(K  A?(K D KK~0((K0Q 0@^^>KMK ᣑz P$ $\ 0S  R0.S $0'$00Q0Q0 Q00SpG h'dT X (,0 S <,,100 00CS񟗳h      $0S&&L0S6 `03  00C SK             0S 00C S'@            00&_ P%00C00000000      |0S $\NK @D@D0, S^K PE0 0%5 R g$\00 PO$0SL0 R$ 4 RO$\ P; 0: S0   4$009$\R  0.S  00l PS L0S|3(K4!  `0A?( K A?(K KK k}$\0 0 Q0hNK0ᴀ$00$03  0`0C0 ᎕@@Q @T; Q 0S+ 0 SP $00$0P "00C0"p>KMK - PH"`D000.S "T nP00L Rm `0j 0Sg 8\@P^>KMK @d$00$0@1  0`0C0 崀=@}?P|P( s50.SR 00Ph L0S# `0 0S 0<0P$0 (XLK܌8dLtL|LL4L0LĽLLLMMK(MTMMMMNN4N ((0c -!0L1pCW:@`V QЀ Ȁ0 R 0pGW*0 R PQ 0 R x0 UP`@H000<0 00C000Ѕ؅84T0 0-L8M`Q QT!00 @D H0 @0 <0 80 40 00 ,0 (0 $0 0 0 K0DS0@T0@@ 00CS.x$D` 0QP 0S P0  00?)dHK HKpHK4 00  BD80ȅxBTN`N4N -`LVP)P>1 1ER# @T 0S @T.!0EX00C0`FVP 0  @00(T@0 -LuM؆0,0 ( p! (1PW1 1 1  6 \ᄦP  (` ,6&2Pv !,6"! 0&&& ና&ᆓ rKん f?K^4 Z(@1^*P P ?> P  RN+ 0`F<0^:6^  ^<ş 0P<,5% \?>1/1L.QAN 0 40\1嬤 01 0S  1, 0 S  0\` K_K<$1ڒ,6 1R rK P0S#1ƒ& ẉPh0SR1#᷒&᫉P86 P90S 0S % T1 0S 8rKH Pß,0 S ,I-C1! 0 000S  ReK& P !&m001&]P hTeK P & L!00! &<Pu 1{ vi,6KQ01,&K `,6|AQ000P0SH1 SDH0S%1 S!.0\!5 2! 5:? >PN0ׇ? >0N0CS$(((101 ,6 0q ,6!j tX@0 H;(@hNNNNOLOpOxOOOO8xO -PULp`:4@$@TPZ U:OO 0 00 --L [ * p-PLM@P`l0l R ᅍT D0 Rp80 B 0  s*05O --L  --L  -LM@> o h0@ --L D* p-LtM/P@TK P0: S p0`rS{  0-/L@PU+D0 00x/00(+n+n000P -LUMpPKPP@lK80S-0: S  SU P U@P P@0 R000K@P h1: S@ c$^=+P$P4P P-L %P DP -QLM@ &P T %TP -LMP dP -kMLM7 6@, @6K0A䆟 A 6 P@P6: S 1PK 㾀&P0S| |6 Rq 0 S i\|0Sa L6L&@HfHv@@ @@@@C%0 0?%0S P5P(0%<00PC0S0S X5 ,0S ,*L%e.K B BP \P @0@T H6<4"D0# sP@0@Tşş%5@0T06 v4 RД3S (0 త4 @@TZ0Q $R |P0S (4 R &6$P, ,4@ &PT6&  S0"",3 0P@ Uh 6T#00/>10@3PL x3PTChG T3P= ܆P03$- 6SR ,@!0@T00 "2 㺆B00㴆0"S P yx2`ulPP\Hd,(PPO@^T J/ cu1  LPP>, c&R0S%"0!S$ 㮲pu=PL~l ,l 뚙?A(܅,ȌtPTJԅ̌،PHTP<ČPPP Q,QPQtQQQQ܌LQR@,R8PR40tR4ąЅ؅̅RRxRS$SHSpSxSSSSSl -L M, Zß ?~u3弃 ;WP c+ Q#x3R,p / pW,P  0bW@ᆋ0EOa.6 0@Ɔ& 6F@Vt3 ( &$6mr 0(& 0Ds00 nB 0+00 0S02PU D2 00  0 0 00 ,0,0 00000 330330 33033 @0L@0 D0PD00 550550 55d00d0d0d 0 d  ` d0 1 R,d0\ +㔄P 0 R,w6!P@kU*0 Q@tPU:aA ,0 Č<ԅSSS܅STHTTT@-@0 0   0 0 0$  (@$, (@0@, 0000 D@0HD LH0L 330## 330## 330%%  -PLM@ 00 R$hkČT05 -LMp@t`@v^ Pa0@S pd1P  0PUK T q,10  00S 2W~Cp pG R R0! lc.`fP%UP 0FOa.U&pn  0 6 & p@b0PV6@ $8P<T\U -0LM@H HyP0T tVj! 0edA@UTU-L0(&S  d0 P0S\P P1 Pa S\Q 60Q -L: S  S  S H0 R4p S S  S S긌U -1L `R_*tP@@ Td1 RLX1 RHL1 RT ,1 R $;QXp4ᐆ00CS0X0@ӤX0& T 00CS00 R0 0  yTYT nTNT 㨯YT00yTP 2w PXG.w@4([̌TJ،ȌЌUUUU -0 @LM̀@@0 ` @@``PUPTp p @ P00TQ  p0WD0@@W뀍( U 0-PL@T 0&"0S @T@T# 0 @TT  d 000X 0000 0 @P@0V p-l0LM@Ɠ0\S` @088 000 0 `PpȌԅ p-LM0@S` PU 0 \0U P 0 PPt0T p 6 Ul`P6@ S6& "," Z 6T <pU|UȌ 0-L0P LR @  (X$P 0鈮 ̌0VTJDV -LM8pP(2G 2 R b  ? @_qTo 1 RP a@T T rPUp@ U QW!0Z00 lQ3L1 R% P ZD1 R 1Зo͗ 1 !@P᫇0 @C@0PP  ?Iq@0@ 0P PPUgHȌԅ܅<̌ (XVtVVVV -L$M0 !0P@`_ᖄ@K &" $"40 D @K0, >Qd4 ,4 P[ 0@0K,0-QM@4 8@ H 4P8pT54 , R0,# @K@_@K0   0`Q 00Vs# @0P 88 x 4@0pW j8@0@80 0<VVW$W,W -PLM, 00 ]@_l!@K0/a,@@K,< 貃QG 0 0PP< ,@`K 0㡃Q.0pZ o @ 0R  @@K0 `@0PK_tp ~ ᇆ,\a0 Z<,S00 ,K<4W!@\1 00CPp010  pL@ -L8M 0@K0 ,0  -RSL4M@ Ppl h\\1  BRH pT 0, P \0 , K X T L H D @ < 8 4 0 `HH\KP@ 0 P0 X T0 PP 0p  0U0?00f fᕃns`` ፃ/00f V:TPU L0L X0 0 TP  U \K+8`i\ -L u! - L0  hvhW| -L(vhv -LM0@S ALBDBLB00S lh0 R \P0008a0̌WWW -L`P\]똡嘁q@!̺pb@1 P$CHCHC0CHCHCHCHCHCHCHCHC@CHCHCHCHCdClCtCC@@1@@@0 e 00=@0 0QQ0 R|0 R 0 R|0 RP0 R XrP LH0JWWlT  -0`P0@LpP |oPlP 00Ur0S8M@PP$q 0 N0 -sL` P00CS00@Ӥ0tE U T T 3 R^ T0M CR `o000- CR 8^00@t$3 0 0 0S= 0^ CR /000T C@?R 00p P0@0@|2|t"0`000R P, 0Rp0 CR 0@0R P0RȪp0Rp1 R 0^ CR X000I CR 0000R0Rp1 R 0$ CR 000Rp0 R T 0 R2 0T0Q0S* Dl 3d0@" eX`q@0ܨl0W -0p`0P@LP bnP@ 000T0S vP@ 40 N0 -LpM` 0Rp䠟%  p@ PP  ɩPP p @TwPl0ld0 KᵖPL, P 3P$l0 -PLM@, 1KP@0 -SU0`SpJ 0A0C,S<LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL0,0  ` 44  ` p0SV PEU@ jmP PEU@ڜc0S qmPPE@ $0S\3X3 P3 Z U30 0 Y U  ,  /mU"0p0t0 ڼ:mPCPUUڄ+mPdPUUXb0S mP 0S0S20S p ` 0pGS0SًW R0S) 4Q P  PE@1QP Q d㴋PE@< 000PEU@ 00S1Q 00S  l0 qP 01S00S00S @ l|0 qPpX cP\đbX@c\ctcDcc 0-TPL0@S s<0ב  0P@0000 p-1LM0`@PP cqP1UP  YqP'P)p MqPx0l DqP`P0X00 D8qP< 000p(i zi ci c~i < -L,MD0P`K@p,0 ($ $ k qp 0S 0S 0S%@PS{P<   pp2<@TU  @00PEU00Sp<,0 S,g(i$ccc -L M@,K0 >pP` T .@P` en0 Srd200000S0yp,P Uy V 0 Sr200000S skP c \P^0 r1000PT  Dk 00SAA. x 4k  :~ 00S P2  p,Z  4kP% 0 00RSY 0@T 0R @0S 0 0S$0S 0p0SPU,?VEW44 `cc`P\c -Lp0 ,j(0( op> 鰑zi d -4L ,j(0( op( 鰑yi d p-L M$@K DQ;8 op$ $P`  $0 0 ` op 0$ PS 0@UU0  CR 0 R00_h 0PU@H00CS00  ä0 Kp霑xi 0dLdtdl0 -L0LM@@0@<0^ ,0  阑 -0L0 阑 -0L0 阑 -<0<L00, ;o0Sh 霑i d -L 0000 0餑 -0LM0@S/ h00S00S P00  |,0T, @00 0 0 0锑_d -$$ 0L00  锑 -L(Mp0@PK` @ 0 4, n0S i3[x DT 0 T KnP@ 0S, E(i ci dd Qd0d0A00d0đpbxb -L M Kp0,` E$P@\  05Zt0p00dS X)Qi0SHD p@h Fi$ P0t@l0@Bdxbeđpb p-0LM0`0S P xP!KH<P|@T 00S iP 0S 00S` @TV8ׇ0=p阑e$ecHe -PLM`@Kp| `$h1 @`@0 DP 00 ,(0m0Si pee -PLM`@Kp| `$h1 @`@0 DP 00 ,{(0m0Si ee p-L,M`0@PK@$ 0 尀 lh0S Mk P0r00000Sp  ,KVhPX P?H0{mp8 0S( p(ei$eef p-L,M`0@PK@$ 0 k 'h0S k P0r00000Sp  ,KhPX PH06mp8{ 0S(p(fi$Hflf|f -LM@0Pp`P  R0@r1000xSY@Qg W gPY r10000D0S  rt10000D0SX0UYDDTY 0- qP100000S00B R00000ӑW0C q000000S00B R00000ӑW0C0@00W0\R00S ggP@00 `hV f`fff p-QLM@P` 00S R00000ӑxS T0S r000000S r000@000STT T00P0SPP  ph_8@\T$@VTpftf(@ 0-L0MP@0K; K @ h@0S`  @0[<0KfH0H <0K0lP0 0S 0(i ff 0-L MP0Q 0 @!K  ~0Sp h Ky0@KL f@0@ kp0 0S s0(fig g -LMԡ0``K@8 PpK(0 ~@ ~0tP0 L0 P` M Q4P P0L` 2PUh: 0@KT fH0H RK0kp4 0S$p(\gipgg -L Mp08@Kx` Pl 0 ed k0sPP  (P kp8 0S$ (igigg -L,MȀ0K4 MK|"W{x0SxZ@I?K2lK1ppK01@T` Kip`xZ`tPP@1@SPTUpPl r 200000S 0:SP Pl 2PPU t@T0, CR 0 R00vp0K1@S\?ZU@ T 0 CR 0R00W8!R0S<1S0P [ 00CS00  ä0 X800S"0 ,0Sp,(i i8iiiilgghhh$h,g8hMLDM1唑0 , | T >KK(@DD@D \@|X cH 'iP`:>{KL@K(pG>[ $pG,| (| 8P 4p c  iP@P <0So <0TP+ 0 0CS00ä0<0@T|PPZXU ,0S8,t騑(ci i|`hthxl|hh 0-x0LP! @ T @3| 0 CR 0R00z@x0 C{$>{R d0SB0S 0B 0 CR 0R00K505P d 0 CR 0R004x070 0h0glhhhhhhh i 0-0L0MP0@@K( 0 W{ c|0| =hP 0SX~0 P0 H00<$  0S(0鐑(6i(@iTPidi 0-t0tP0Lh@h  \0\00 00b@08 gP$D0鐑T\5i xi p-LM@`00X`PD 8㛁@P$NP^Pp鐑Tiii -Lqd0d0`pT0@#nPp@@Np0 o 0鐑T j4j -LM@KD004 (V 00鐑LjxjT -LM@-D004 (8 00鐑jjT\ -L M0p$0  @pp`0h\$KP`@y$0@@S 鐑Tj(kPk40S 0S0S\o-L0S 00  S\0S]o 0-@PL0 Np0 0]o 0-@PL0 9p0 㫀0o -LpZ6PP`@l"d0p0`@0 @㌀8k@T( c p(W_ p-LM0@S`P 00  SA/Pp@0Sp -QLMPp W@cX0$  A0S 0 0 SP @0S@0S$ 00 S0P QWl`||Xth Hd H00p@0S% 4iWr(p0p_(W0 CR 0R00pphUpTs\sl -@L x`A 0S> 0CW31 V ,0 CR 0R001 ` R"R000ӑ0 CR 0P R  U 00 R0 S0 S0Sl p-L$M08@K`  Q>t4 <0K 0 [P sb 0z<0S  lzn0S 00S Q0S 1#$0$ <'p8ذ4s -LMK,p0 Q`r 0@S zW0000T00TQP  s sT@D0T0T0 d20Ds@-^@ 0S\\  P2  RR P2 R\ 0S\ -LM@  Qj ds -L(M@q0D@K$ ,a 0 s$ ?[ j`p80S3 40S/ 4P%jP0   R`p㖕0@`TU/[PPE Vt`U hR@00U00SV  0S,  (i$ xx(xr x - @LM0 r鬍Tq 0-Lr@TlPll 0h{Z 00Z404 _0S 0h04xi TxDDZD0DZ0@-@@@((0P\ P, ,0PRP0@00@-@@@((0P\P, ,0PRP00@0@-@@@ 0P\ P$ $0PRP0@00@-@@@ 0P\P$ $0PRP00@0@-@@@000P\ P4 40PRP0@00@-@@@000P\P4 40PRP00@|@-@@< <0@R8 80R < <0@R8 80R@`@-@@< <0@R8 80R < <0@R8 80R@H -LM`ppl P8 %00XP5帕 P@ %< 媤p< 10@GS񟗤|М؜$,,4<Tt̝ԝD4T$P@@H4@@$4P($4@ $P@@@ 4333 3#P@3#3330ă80 ;0u3h#@t3P@@`#`3P@#@@x3,#PP@d3`3\3X#PWP3#00Q 3#< e<J2"P2@@@#0Sq`a%2 R2 R 2 R2 Rh"0S0S\2 R42 R0SX2 R 80S(Y 0/;40 "0S9 !0S3 %S" !0S! 1 R!0S!t1 R!!1V   y1 1 S41 R!1 Rt!t!p! 0S ST!S0 R0083S 0 R Dx匒MD0 SDT傒P0 0S0H딒TX`Hxxdxذx -LM H 0R,0 0 0 0 $5 R5 R 5 R @@ ` 0KV㼐 嬐 娐 夐 堐 尐 崐 帐  @  QQ \  D0.S (0^1Q o @p0 D0S@@@P 80 @T@1Y1Q@ 80S @K 3 R E 3@T PPK0 #\@KXo0 #SoP @ +ZP(Zl QR P   OP@ 0 0&W0 0 0W0: S S 00R0 d@ `Vw R 0@S |@ p2KL"0 ST2  `V L`V2 ,0S , D@K"0 nYx !0t p nY! 0l nY1h R0d0  ` `!0nYd  000 V0-S L m 0R@@@ {Y P [| G| ?0 R0 0p Q0 R [LD `\0 ](h*@HxTqlxdXذ -LP# \ \ P  \  Ph P 3S40 RP \ 0XD, 0-@LTP 0S@T0  , 0 0CS00ä0l -L,M , 3S 2 R2 R 2@Gkt2pQ[ @K 0ST T2@` R42 Rs j,@ 0  $   1 RY0: S SK 0SC (080c!01 R 1 R0(D1 R&t1 R# : S : S L00CS00  ä0 pW ,0S ,M {80(T "88 #$ X@ 0B ?T@0 `{  Pr(h yyxTplxxxxy 0-0P R 0L0x0 R00d0 RX0 R H0 @Tjj00餒hp -LM,K0 P| lR0 0 Q{00P4 U 0S 004!4  R0 P,@4Oj8 41jP80080 3S 1 R1 R 01@%j80 R< ;al` g0STR `Q0SK R pG~`A< 0(y~@l8\0 D  -L(Mlq0@PKda @ 0 H ~PPD3[1 ,,!0vP"P  0 S  00 0 x 0x 3KAPP@8T 0@8 0( i yhĀi  -LPM∡0H@Kp|P `(0 HP DP @P 01 0 R 000 ^0 0-@0P0LSR0S 0' ; 0PP 0x 00P 00>8H 0>$ dzDP<,܁X~ -!LWM0,0  pᤄPUaKJ/ #ad HT NP=WoK0PS @W 0]KS  @P U00R00S>n0 ,0S ,| \\ K.0 ]0 S \ ꚴ|>D0D @ꑴs> 0$ 7(Ji(pz<X~ -LdM☑@q, KⲠP0K0`0 ` p@ 0K K` `0P` 0 R  )000 PPPP0  0S 0 0 .0\ K\l`K@ mZ0 0p P ,0S X, TZ@>0 (zX<p~ -RML 7 M(% 4%  ǟ7 ȟx,  ,  0 8 < @  t' 尒p. H0@/ShxPPPPPPPPPPlPPPPPPPPPHPTPPPP<PXd0:;;@00S lVA0C2SE$T0TTT<TTTTHTTTTTT\TTTTTTTTTTTTTT0TTT<TTTTHTTTTTT\0<00S|090;0:0;0:080gş80:( 8 071fFKL L4EG.Kx t :  B0p l P 0 *Z5 I09M@ f0:;8  TNKA @ 0S 0 R 4%RQ #NKA sD4P|ß0 R 4 R Xh 0@0qP00<0β,0, "NKA E2\3 R 4 R0 S  "NKA'l2`P0S2 4 R.". gP"Z1@,.0 63y/ G3M1T 2P00(10 \~qP Q<T uqPp!NKA P L0 R 4 Rk (`rPX@@ a080 00 V00NKA 1Pڠ0 R 4 R Pø;d0 0:;7/0<0:;:?.A(`Hl܃l4Tl''L6܄$T @(TpȅT X <Tp|txx`Ć$'u0P\hȇ0XP,Pĺ7Tp 1 bZ bZW0% 1PGFKL@ L@@@@@@laG~K@pGx t : 0p l P0 R11 P0Q5  ~X1)@P50 ,%R0 KL@ L@@@@@N>K@0C, @:0C D P$0S \0 0 )VYP`"0  NNKL2@D@DP)` 0T `?YPD2) 0`4YPlppЀ4 0S Q0S22x 0 .0% >5 P$  #0 5@T @@T \DTH$0 00000000@Y@TP@0D @E@0 4 R1 @\ O>K)0C* Xps $KNK@D0$% R44:0  4 4: 0 XPPX0 8EP00 0 s0% 0% 05S8%R 454 00) 0l0   ,0S  < 4 (%R f<5P(%`6 0s 400) 0   0Q4 ZQʘ&0) %R @0SX&\KPEd&@0@>XP6&0@3XP&ONK@DP) 0 P%XP6) 0PXP(@ @;- 5' 50C5 儰| @ qII (0@ ,x00MKBKK DhDKL@AI L@ A 0IH D L @TcPU\0SV(0 NH@0 5 @n]P> Hx804 =KL0Cˠ 4 $5 4 HD5 D 4 zP L%$Ed  R 0S9LPڔ0   嵲m0S mDWd0S t P@, I:0=KEK0CL0C 0 0WL: Ri g` ?K0Cɠ@ 0Ch* @>W }05 ~PP:`@ +0V@0 )0 WPL%\PhO.K B0 BnhPeh4HP4  `J@TO^KPEPE 04 P@540SHP$zT4HP~ Ln2IT`<Phd p04 -|<@O>K0C)0C D VP [KNK@D Z<)O>K0C Vp F-N>K0C 0C( V8 <-00 tT  }$"`=` KPp % 1 PP JGHP 0 H,%00a-PQP0  P$ 000P tx -LM8P |0 R 0 l00 .L /,P 00 @4 @ @ @ G K PV@@p<<00    0 ᠺP -3L$M R 0SS@@@@@@@@@pp3  W\\!00j0Kvg_3 3 .$(," \"(!̠0!0 `.2 p22@80K8P  0 0@ ,@ 4p u0P0?@ P`2 X0İ0P 8 4},w@K[<@@<4 Ġ̌(<"4!Č ̌$yl -LMP`p@'V 0` S$HHHTHHH<HHHT%RpWQpPp%QpATX@ 0gT  @TV p`5TDL0 -LM4 4 8 71 40 p  0*8 W<*408 `g:0F S4*2PU*0K @ O0 < 4 >t؋=; 0H`x`iP:Ќ،$Ԃ0DP\l -L@MP0q DH0`LR!R 0 垥8,#44$<@PČ! @P@KP5 .0[MP. | p( .0NMPL.  r 0S , \tZt(`i̍ԍ -D0 ML@( <@@XI0 R 頺H`i0` 'S0-LP@v(@0dSK<Qh@!!!!!!|!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!墧001@T0d*Sʜ0h 0$0h錧 0`\X偧0H <80hu0,q܍#8@d@,4 -LxM0`S qP10  0D0SJ 0S TKPKLKHKDK @K@T^>P@.K B B;Pݡ `FR0 |Kpx P+`M[ WZV <Hń+ ,0S8,(4WĐ$ -LM`0X"XB00P0H0PPE 0S00(2(5 rP000 Hb22 .0S 9,7,5,3,P u@50SPE #,U 0+S-S0S.P-P .U@PE P_U`@PE0SlPfP wPr P ~00S 00SQ1 &)i<;HPBPcj_H`ԒdL0 p-LM@7P `4p -LMvD@T00.0,0 S S0 S S0@-S@  TAN Ra0NS\ 0RAC\ 0^0 S -d0LMP@@L0 ;<00S 000S?/;lL -L0MԂԢ 0Pp(0 PTPK 2bG0S @@_HPH nP6 2P- PD2[KP) XP/ P) RP, KP- M P< 1P/ KP) CP, K P- > P3 K P- 8 P0 1P0 21 .1 +|1 (p1 %d1 "X1 L1 @1 41 (1 1 1 1 0 0 0 0 0A[?[0HP @@[0G @0H P 40K9K3K6Kd<@T K]op (0S4( (l$l|| p-LMP`0,@KHP 0 3 )G 0Syp( -LM@P  00R0R  00Shr'阿 -LM@P h00ShP'阿 0-LP@P $00S0hT' 0阿 -L M K8P@![A[R0 ʐP x0td P00TT0@LP k400 PP00ht@xx -LM p-LM`\P 0SL0   \ 0S @Tp -L p@P`D0S0000080S 01P 008 -T0L0L SH0D0% <0, 0S00 0% 0 <x -LM\@0S P0P 0SH0D0q% <0, 0S00 0h% 00x< 0 Y%D0 0Q%Hx 0 I%L - 0 LN$ h:%P 00 0S 0.%ꀿx*00S0 0%Tx 0 %X(0( 0S00 %\X -Ll000CSBBBCB h:h(ThBnh\ - 0 L$0 ` - 0 L$0 d - 0 L$0 h - 0 L$0 l - 0 L$0 p - 0 L$0 t - 0 L~$0 x - 0 Lo$0 | 0 c$ꄿ -RLM@  pP+p0 s P T*U P pT PPEUTt`wl`P PP PPUZ)T  ip i+ 8NOT -L M0D040 4? 0`0V 4 AR0C  0R$$0R:F`00V0 R 0 s0s tC0S 0 4 X3 R@304SP00 0` 0  0 0 0A> 000000000000 0000 `0`圢0A> 06 pIpq QcPa 4S4S 4?0 @pP@uq*`0A>@t 0 001 0*l (pP|P*?T A.0O0P000B>0,10S 4PU/0K000 o* B040 00S 00S" 00 0000000`0` 0 0 0 0000000 0000 `0`0 $4SY*0頿,h(t0h -pLM@ 00s)0@(@-`@? 0"00\ 0S0S000\蠿 -LMZIp q  Z0Y0:H!O 4  6y†04 S4 S* P%0 4 S4 S0 4 S4 S*p 00 0 4 S4 S:T0O YA. P ` `6& 0I6Y$頿h -x0LM@ 4 BN@Ap@0t hz 00Np頿h 0-LgP" 0P0Q  0R 0R Q(00A> 000 $$0頿(00S00B>0@-(0A> 0$Đ6I 蠿 -LM@$0AR 0  0R0$$R 005:| L0$$R0$4 A  0@0 0$4 頿 0-PL $4S0C! 4S4S 4 A> 0@0P0 A 0@d0 $4T0$0AR 0  0R$$0R* 000hc꠿5=?0/9P6 0S000, p- LM 4B>0 pQ 0P@00QP`@BN@0 A>0A> 00$d0(@K B>R0  40 40 0>pqph(p頿 -LM;Px 404@0  0000 0 00 0 0 00  0?\00꠿ -LMX@ 0S 00 0/ @0S0 04h꠿ -LM@0 >pq @ -LM̀p`P@TC@!3;A>B.A 0 0$D4 dD P  40 40 4sto 0-tP@0L 4@ 4@P 40 04T0@0h0頿00 ᠿpD0 00000Sp00000S p0 000  -p000L00 0S0  Pt t)CP@ qL0 0000 0S8 0(0$ C (0 $ 00 0  -L 00 0 p-LMP%-$`$@000-000p-ꬿ -`Lp00S 0P@-x 0 0S %-0 0 00(`S@0S0S 0-L@LP 0LR0 0CS00 00 00 -鐠p0 刀0b? |`PUL@0S 2M-0 P0b?U0S( 0f0@m -錀p0 儠0b? x`@TLP U u!-0 @0b?TU,0@ 00c0m^ -PL0`0pS @, 0 R , 0 0CR00S 000$,000 p-LM|` x0RR@,`0`P0 0R00C0,00`00S c0Sp 0-p@LP,`0P0,D P:00@P*0P0鬿 0-t@tP0LS 0S 0S0800 P0S00 - 0L00S W 0-xPx@0LS 0S S0S0S S 0S 0S S 0S0S S0 -LML@00 S00 S S 00 SS -H0LM0@S ,0@$ 0@]00鬿 00< 0-L@dPLaTa```$`ada` a\alaaaaaaataaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa0h0hlA00S S y00S Sc2P-0K0K /0@KPKPN0D;SJ|iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii|iiiiiiiiiiiiiiiiiiiiiii@x 00#0U T TpP 0#0CScPp(08<|, 0-L8#P` 0s0s   0h(0(P0S @00?@0T 0-1L R 0R:a"0 0R 00S 00S 0 P/ 0 P @T&P@:  h00S 0S(H0(0P<5 ;$0 0@DL( -0LMK0 !( - LP x0P0@0P00P "P @00S SS g h,@( 0-H@0PS80L0 ,0,R:Z!0P00@(0 0-LPD(@@T:TT*0 -LMPB@`0p   P0p<0@ T* P0P0i/   Pp U  !W i,D - >LM0.0?.00e=@]@0 S=@= +=0S?0SeXC`0SeX@e dM0S P P 0S#0K$`K$K P P 0(K(0 F@(P]T0DcS&r$rtv\q zh|z -L M@000 p`P00T,0  300CW 30SW200CW 9B2 R 200CWUV S0S x20S \+UVP h: R R F20S~ pWWJZZ`P#p`Pv0X,0 p@q>P ,PL1AP-00Y000 # 1 00S0uv   00S00S0   00S6 00S 00S-pWZ00S0   ,0S 00p 000 00SYk 0 o} x dXh -LM@`PpTW 000CT0 @T Jp`PvY Z?@TZXZ!o6 x -01L M0pS` 10S P; i8pP@+u)V 0AP 00S PP@ 0pP@u l0 000 0x -LMp`pP@uV iE 0S<00S,00S 0 0S00C'xHt P000P$ -P0Q0L00 00 000$L - L00 00C0L p-LMP`(+@0  000p P0-L@P@ 0TS0hP00PP$0PP$ -LM@0S00L p-DPLM@`T Pp@Tp$ 0-LP@P000P0000000000   -pLMP@u) 10S1!00`Q0 "P*ip@ VP@< P00 P8p0t T >  P 0`V00S;00 P``V%0P@` P@@P%@Ex00S00 S 0 P@ P pDP@Xh, -pL MXrPp20S200QPW0 P@P u20S @ T T10: P@ P p1@0`PP` x!0$ P@ p`PP,  0,0 @6Pp@ 0000  %0 P` P l @0Q P 0Px00Sl00 @,@ @0PU`XW,w  Xh, p-pLM`Pv dP<p P P@0P`40`/@0P`p P P0`p  -L0SH hp0 s 0 0  Bhꌗx -LMp`pP@u P |00Sh0 tW V P@(0 f K!$̗ -L M@Kp O p-LM`pP@uxFpP@uPph UT0 ph p-LM`P@P  P ptP@$00S/ ph$ -L M`P, , RP,0@cT A dxvP@ Ho0pw0x00XW0A ,0@T)y z  V0 U0 1 ,0c@0;p`Pv ,0@T{ ,1 ,0@d@ 0@ܠ,@00CT Tp`Pv XW  000S o10@0CT@ D0@@X 0 0@@$x$ -hL7` 0S 0 0S<0040   0+0 HxuPTX -LM⠀0圐p댠`P00V@@TP PV  b,  b,`PpXPTL0 0DS@0 80 40 00 ,0 00 0 dTX\`lh -L M@@0 S( P@p`p`20S, 2Ÿ  00 r0s 0SR !0S0S1 01 00p 0 00 0S/@@K 0 $1P a,1UP0!c0@P+P 0 0P00 0 0  0Rph0 00d0 0000 S 0 (0S8(m(PT TXXPyd\ p-LM0`SQP@0SPE P P@P0SUfp0SQ 0S0ASQ 00S0 0S  -qaQL 0@ l0T@lT@S   0^ࠡ0nP 0 000 h0 00000nP0<0 0n d0 XdT0PT@P ꔶ$0 000@P $0 000p p-0LM0@S 0S PpP pp`P R`000SP PT R ,0000SS Pp0TT -@LM80 00 B0 @00`0TPTX -T0LM0@SJ@000S P @TZTP -0LkPx -QPp1MLP0 0``P!A0P000SPh0S `1@HT1@0@T @1@a0 0CRP  UR1000S S 00@0TS P0ø 0D Rڴ000SP W00P00S U PT P00C0LL0 0p<0 0P000h4XXTPT -0LM00@0T0p` Pcڴ10U 010`@'P`  TJ1U RZT010Pe0 DPPE0 0U00Xd\T -p@LP`P 05P  T0P0@` "l@h 0RX0X 0 ?R D0@0 000c lpHXPT P-L@p`5PU U nU"0 Pa50Sa uꈥ\ |0L 0R 0SPUQL0   RRyxw0 P50000050Sp 0S 0S0STQڨ0   RRPO0 P0 00& 0SI 4Q!0S 40S0ST0   RR(0 `P000 3 0S R0S300PSU T P0 :P000 ßS0 0S_T2QW T g 0 P_T$0S 0S a 000S|2Q00  C\2LB 0 P 0 P000=_S0S 0S  0S  0S 1 T "0  P  T  0 P000 P D10SLSS G >PC <P2 10S ST0 )0P0 @@0@0@0TP 0 PX 000P 0 yP  000HT\0PT44X 0-@1@LP T00 P0S1b Q 1 Rb\0 00R 00S 00S00S 0 000 00000 00 p00S d00S *00 00T000lpX4TPThP00S 00<0< 80Q0(000000`hUTP0 0 ` p-pLM@0`t nPPEp@ p0.@0t T T000CUP800@(P@0 V000pXP -@0LMTpP/P $@0ꌀ0P0PE* P@ p U `[P @0<0Pf%(0PE0@W0000XP@-p@T* R  :P0b0D 6@0@@0@0 |< @-P 0S 00Q | -L``P@ T 0S0S*0 S0SB @ T 0S0S:p R000 0  `0St0 @ R0 0S0S@@0 S$0 0 0 | -L^ 0 l -LMH@0S dR 00 000P00 -2LM0pS px} XW"Z 0S 0S *Z 0S0S:0S0S0$2Z 2 00`PQ PU`R?Q=PP;1 `XW f1`P0 00pv  0x@0XW4  0 V;U9@04P 0 `VU a0`P0 00pv  09@0VU80   |h -LMZP,"PU 0 S 0 S *PU 0 S0 S:0 S0 S01U 00 p ` Q `VpR+Q)Pp6P(0`ZGYE $1p0 00px  0@0P`Z,Y)p P ` V U x0p0 00px  0@0P` V U0 |h -LM P@p` P@t0u00X00S T00XtuP@tTU@0x -L M0-S gGEC`,  1`P LPp% 0S" 0SKPP` )@&@@JP 0`;$ቹU0S'Pm6}1 Q  1Y L b40 , oHU5̰@ 400S Aa0@S<0 -A @L2$0R20 -'PLM! $P .P ^P@0 00 bP|@000C 0`@`000T@P@ 0s0s(x< -LP 0-LM@ PKT 00000 -L M@K0,sώ0s 00@3 -L M^@K |0^0s 0s\0000 H00 0400 S P < -LZP ,0, 0S @-, (02 S@04R 0-PLMP0K K@XP# 0S00R0S$ 00  0ܘ P-L0 h+ 0-PLM@Y P 0P[0=0C:SGxphlPhPdP`P\PXP@8P޷040K 0(10 e0\`dhlp0PPP0PPP= -@LMTd ThL0 !@<840,h,lؙ -LMЁ0P@$0 * TTbA`A 00B S10 0C00B S0hQQ@`.0,SVVE1C B(1`$1 <qK 0S#T`VPK K @ 0@1` !0`V@K 0@  `!PK @ P0@`0P !KHP  $0S4$(`\ (Wp=$04 -PLM! P P( R0 0 0S 0S l|T0T Q0000K (0,0 K0K00K0K0 e89<` -l0LM@QT T@ hN$0  hl0 R008x -PLM$ \ R 00S S  P$K ?0000@0pS $0@ D$0 0RV   D $ 0+SppW0$0 q1 +P0 (K$( $ 0+S0(0 1[aX$0z@0C$0 6a0DPS``-P@<0K0P 0(0 000CS4@h W'P000"W $00Se S$0 $ 0 S 0$ (K8$ $00SR $K 00S($00SHT -LMP( `P@p@@P0U 0@ 0$K$0 1U0  0 0S SU(00SPPU`  000CSWT,UF U IU F 0 0 S008U4 U 7U 4v1 0000vp1 0 00X0ESDU U U (K, K,0S 0 000S U(U 0 W000CS  <$<<<<0010$K0$0 U 0  0  鰚Ț,Q PP -LML@0 LP -LP0 0S00 -LP  0   0PT -LM0K0 =T -0L0hT -`LPp@`0PSE 0$S T; !P80 0C$S'00@f B 000S -L Mp`P0-S@@000C S U 00V(KX(`  00B S10 0C00B SU0@0X`p -LM@ R |00S dR 00X0 0P0 0H00 R 000 $ Rd(4\0S R 0 R000000ӑS$0S A0@Sa @0R0-P00 p-LM@P` 8X0@0P SP000000STAr0Sp, -LMK -LMp,r` @ @@. 0P`#ذ -L  M0KA 1@ _P1$a0d P@00KT0d  U0K 0   -L`P@M\0K0 0鐆P@ !) 0 K4\0d 0\ 0 K00PKF" $0K p-D1LM00@`1 (1 p0S! 0DS T\dpl00CS @T U 7`KPP0DS  (40 0@phX p-LMD`DP0@S 00P AP0  Pp0X 0-@ L08PS@00) 0R+0@00T0W -LM@P P -Lp`$M姯Z, H0  `vp0.0K.K0 0 P@0@@hp`0Z-00hH  ,0 S ,(L -Lp`$M姯Z, H0  `vp0.0K.K0 ]0 P@0@@hp`0Z-00hH  ,0 S ,y(T p-LMP0ϰ0 0@` 0K K\0/cC!b10@00R0a\-00a  0SQp(gfff` 0-LM@P0$@K 0 O] 0S 80(h 0-L M@P0@K 0 }7E 0S  0(t -`LPPp% %P0 `p`0nS dS sS@P pPpP -LMt qP@h T T Tt h -0p L \ `P@ 00S 0@0 S @ \00ShLD000@000T(0 hPL4 0-L@Psj 0 0HT p-LM`0PS@ t00SX 0@S  @00ScJ(0 0S0 >pLpT00C p p000C 000C?001xd0@-H 0\8001000\0 010xd0@-<00 CR,0010 BR0 000xd0@-8 0R (0P@0100 R0xd p-L MP` 0@R$K0S ]僰0 100$0s 0s 0 01$ KpxXd0@-P 0S0S0X@0^! 00S 0SN00^0dx 0AxP<00 r0s  Pd@-p@0\`0 0r0s 00000\0 xd 0P PPB@x -LM\X@TLD@0 840 ,(04\hhplp p-LM@Z@`P8 0S BPl   =0  p$$ -0LMK0K00K 0-L M8P0@K 0 . 0S  0( 0-L M8P0@K 0 N 0S 0( 0-LM8P0(@K 0 n 0S ݴ0(`i -LM@u q0r00T00S 800T@qr x -LMB@6P񟗓@|p|||||||p|||||||||||||||||||$0dDL|||||d|||@||||dt1 p1RDT10SD1@18B01$1@0S, wpq' P0mp@q cQP@@ V0 SPO@@Hp q  (0]P$\h p-LMB@6PHP@pP@u2HP@UʰP2 R B@0`PP`VUP@UʒPL2  B?@0%2z2S P@@r@0`PP`VhUfP@U`P^ph\0P@t0 u SR?P@09 gp0 s2  0 _0 S*P(Rph=Qp0 s ph| |0S0S S00CS00S S p@,0SP phph-px$\M 0:S S@.S ?S  \SR R 0-0LP0CP@ Sf0B0C2S=0 00 0 PE000 -<<LM0pSP0:S %S .S) ?S \S / `V $K00!c(PPDP`VPE $K@@!O(P (0S PW00P:g$\0h -D0L<080`00 ,0b A0 \h(0$0 0b0c0A}p -0LSPp`@7  r000000S R000@00ӑ0 T00R00S@D 0S 0S uP0S000S&10T00S 0T S@D00\00SH00S800SSS00S<H40S r0000000S0S000  $00S00SD -0LM0@SԀTpW.0000Sp頠`00CVP@tu 0 0S 0`0CVp(tx -$LM0s0s@ !1 P@R00os00SoP`00CV)pP@u XWp q   Q0 P0  Z$`00CVt x -LU0S, ,h0S000hV( -PlpL† @:0SX 1L0SPD@0S%0PD -LM@P9D0  p-LMP `@ (0K l0 0"T\4cPP (0 00 pD 0-DPLP @ԪT000  00t4,@-p`P@Q|0s 0S 0S tu' 0S$\!:00SP00S0Q 0S 0S tu 0S0S*Q (t@-0S  0S 0R0S ^ 00S0S:@T 0S 0S 0R 0R@8@ -LP@ M`, K00 p`PWY Z 0S0 S` M Z  0 S0 Sp`A , 0S? 0 S, @0 P`R @0P`, P,0S, 0S @0P,`00 ,  0S0S , @0 QP`R0QSW -LM\S\p`@0 :< P @0Ra@00hï @ 00 0hï @ 0<K%0SP0PS @K 0P<K 0O<\ 0 <0 <\t00S0 0 T@< -LM@K=0s0s n0 c -Lr 0 0S0 h( -LM@P  pP@uoP@0pX W``0P@,0`(WP@  hpP@u|0`0VpP@u p u `VJpP@u @x -L,M@@K `Pr@K` ph200 <q8 r 08@ T<\  Q R`( 0@0C 0, K  `P @0 8 ` P @0puv R@0KD10S D@0dS0c S0 P @,0K4 K0,m@K,#0"0P00S`0P00S Q   H  4  , 00@z00CS0uH00So4, 00  @~@THh -QLM@P` 0S!-P 1,0<R A0S* 0S!0S001 &뀁p0S  PP1Wp 0S  01A 0S 1 0S{  0K(0s$@tm K>0 ` PP` h P00 R00SH0  0K 0P 頤DФ(@< -L4MP@pß00K @KP  R0S `  D `VD r0s tu h20S R0S0S *tu $200@_0 K0tu 0S0S*100@_10!0S0S00 ?SRp00pWÏ0K D1t u  y0z 0 U T P @t u  U0T0 " 0 @0K@  Pl q0s  ,0S00S0K@0K0 K0@ K 0,4Xp@-`^@P  \\ 0S 0\ 0SP@Up^p 000h 000h 000h -@LMTP oDl< gdah]`x -81LMXH @@ K ~C@e:pV0  @`Pp'0S0S 0 0?00`0  X 0S L0DS$0   ihxxP -LM0$ KK 0 0 P$ - L) P005l -LML0K Ap@T0[S00KT[l -FML M7GNK, t7t@D @D0`PXX D'@Cp 20@FS@"" ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( (  ( ( ( (h" ( (  ( ( (  (" (#(# ( ( ( ( ( ( ( ( ( ( (8#### ( ( ( (# ( (# ( (# ( (%L&X& ( (&'6 R5 5 R0%<0uKA $P00Q0S Q0(8luKA ~$P00Q0S 4; 5p$5 k5 gtKA `$?Q0S 08:$000N000;0@008`4 R$ = KJ p pGJ HL$ 0 Ps /P* P P $0004SP0;000@P P3 R3 aP3  080@0 P8  Pd3    P43    P3 R0"< P P070$H P P060$T 060$P 070$L 0 70T H L 008rKA $P00Q0S  n0$000qKA $P00Q0S U0,0|qKA $P00Q0S l?0 0$qKA l$P00Q0S )0001 `bVQ$B~KpGpG`JgP  2P $0}P b0-S x #1(',@Ԧl4LdȧT p0 -L4M0 4 00[ ,0 ZP@K0@pP@P 0L0P 84 R 0@ D0  @ D t0H0 0D S ;0 oR04  0S00@ 18#8L0 T3 M 00CS0|S0 00P@7`@ 000< 0SC0S #0P b000 0!L< C444 00 0hBD@0pxj0d2 R  4@ 0SZ ,K00D pPPJ =D080 ` 1B< @K0 00!P@$ P 1 xW0q@ R xdM0`1 RH@4@0pc@; P32(322(322(3(3(3(3(3(3(3(3(3 3(303 +0@SH%#:u04 0@Sg0@>Sp $ 1 @bTQ04  0QInK`F`F04 LPDDT0 sT 7pP, MK@D@D 0070 )NK @t娄pY ,0 S ,f0  p 3MK@Dc@D0.,r㠠P XZ W\ p녤(l$T 4$0L` -LMp0R@ 0 P`# _TP l"^K@0  0 S ,  _(  -OMLM|B tUdr  , u 6 ?K@KA K%0 B% 0UK 0 P_OKH H Q *3b1(K R qP0`S @P0 @PXa 0PS@TPP01PQ? % 5P P P 00P@00P0S P B_ 0, BQp0  ,_|1_K@ ?K4a0(44Tl(`id -GML M!0p,0  KJ`J*K@_ ?K0 K@_0dpa  0SS?A pV`P$ZWy0 ,0S ,( P-L@ p0 Sp p `P P P4  0@Sp0!R4 -LlMȀ0@K pd$0 `0S" 0`C^P|]0@` @n-P^Pd f- $0S $喤((؟ -LtMpp, `PKY 0<< 0 @@`W `!dP; 0W0@ 0[?S. Y  KP 0@ S @RT00T0ST00T0S\0 ,0S X,;L`@`@F T(0DXhp؟ p-@LM`X`D00CS0X0ӤX0 PpP x@00CS00Ӥ0 Pppu YUyUp l؟0!400   00!$!Ƞ ! -AML Mp , @@ @4$ <BnK84`F(K $t8 `F<$  )` ¿ RS3(K @T40 0S S@D00(K0?S (K0*S p3(K RTR " 0SQL#0000ӑb0CSPBP@d@d@d@`Bd@d@d@xBd@Bd@d@d@d@d@XB@$@D<$ 000P-S+SP84 0T \BK0A0A`P\0"S 04 R[<QO0 2`84+S  8-\ `   00( <P% Z`P)@0 *g/ =@PQ  0lS @aZ d~_ D1 ,0S H,F/ `P<$b0 \000<4 @D~@D00< z@D< t@D< p0(K R ?\( K0?S 5X0 T BR X0`  äX0 8+?A(<Hll 0-LpM 0P)p@K 0s |0: S S0 7*0; p-LgM`0@0 Pu ˜@T.K 0st |10! 10t!  0S 4Up_@)(edA -PLp@@W` pT P 0 0S 0 R   -L Mp" 0 @T`P # 0 aP@0  P@\q^ TR 0h^0[`PA@40 ?0@- |&>t0@Y.@P?/@@B@DRPN`,0 @`VP$@Z -@L MX &>opn003X$`pZ p-LM&> @`@] ~NP PwU$@pD -LĠ[D 0Pp`0 W ,R} P00 -LĠ[D 0Pp` W, *0 S xsd -GMLM 0`p,0 ]MK@D@D 0Pr0 )K hVU -`q00 L 0p0S2 @ PP#Uw 11>p X11>.QQ$ DX<)V pX0X`x 0-LM 2P R|@|K  0S@ jpX VV@0TD  <V寖 0<DTx p-MLM`@0 0 Pᦻp* AK@@+0`P! T*AKAA 0r00000S  r\00000S 0S@\:!0 Sϛp(4-Q* rh000000S  r@00000S0S QQ: p-PLMU`x x0d X' 0@0BPP0P0p8 p-LM 0@Px 0`0X0S 00 0 0r@P @ p08 -0 SL0S S h0 hrd -0LS S hX hP -0LS S hظ h= -0LS S hT h* -0L G밫 -QLM,  10S 1 0 RA000u,  00S Sp1I0S; `10S7T1,@<T@@@@ ! 0Pp`SL1 0p^UPP$X U`00Q` e Xp, hP PP `phP`0`@H0 , ,0 0!0 0 000l Q p-LM`uP@P 0 SP UT0  ]K P00@  !p0 -9L M 000`fS eS gS )))000P@00GS񟗳hhhhhhhhhh@l@l@l@l@l@l@l4i4ii@l jj8j\jl@l@ldj@l@l@lxj@ljj@ljj@l@l@l@l@l@l@l@l@l@lljj@ljk@l,k@k@l@l`k@lkk@lkjk@lDlkkk@k@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@l@lk@lDl0lT u$6 0 00 R6 5 5R95 ! 0 B 5E ,K0, R( P00R0S p AWp5 pEPX%00T%6 ,KŸ0, R P00R0Sp54u44  44 4 G$4 4=$$000k0 0 0( l4]hh 0T4SP4QDNF30000E3 4<3   83 33/3)3 3$3"3 3338CPD3pP XP D<3 c,3P0@S@# 3 e0pp5X2P2U0`c ڒTPV20S= "0SW`F@1x0@S$"000T23<2 82  "0T13 0 d1R0S000  00CP X1 o!P !<xp!X!0@0T410SPRV00S0  VSP0P p `Fvp A`FvpW 밫X Tl,x`Dp|dhXXȒhT lt0l -LM@P0pK" { p P0Sʄ0   T p`p  00 0  -LM@D  hݑ@- 0@R:T 0 S* 0R S R  :0 0b0000@0c00 00 0DH -@L0P00  H T00 0D S0<PP4 0 0PS0hDHLT8 4R00C0 R0 DLH -LM@T- -LP0L p-0LM0Q 0R0SP  6P`Q3S S S 08 P6P@pذ -PLM`bPP20StS P X20SL<<"0@S@00K 0` <@ @@ ,0K@  0@@pK0 K\ , * 1@ <0R0 0S B S@ < lP@t1 Z00R00S H000 810S,10S 10SFq0S 00S0R ~RP0SXO@X00 R00SOX 0S0S0SL 0Y0 R00S <00SDSR 0TP|ll -x2LM< P \20S``JH"`0P=020p R8K  01@P10pK0P@ 0 0dHP10S 8PK(0S0 00S,0S P` Pq0僐Z410S V``V < 0R0! R00S8A RV3 00S/00S+V# p0SR 0 00R00SR O0 0R00Xh0 : -00C0dlh|TPX -@L`(P1T T0q4T0S` 0U  R00000ӑ00Q000 Q0 Q0a !00S  R@000ӑ0!0a00Q  -LM@Ppt ttt00S$S 0,p 0 0`^S0p0C0$3t0 S 3 0S00 B B0 0 S PP0@ FP00C0044   0RI r@200000S r2P000PU0_S ,S ^S $S =S -S :S /S 10S  R10000ӑ0.S 0`?QXZ, 괎P0Q010S$10S p, R X00b0CS0X40h0j`C f0Q0Q a01 p00S  Rh000ӑ0!0a0 Q4S  -LM@0p@R`,@ *$R 4Sf 4S P`PR S Y7Kp20O00O4S  0 0 Sr400000S00S_S   P0S r4400000S0_S 0 S 0R r300000S0_S0 Sr300000S00S_S4SPk P bpW00cO0O4S @0 0 Sr200000S>00S_S:   P0S r200000S(0_S% 0S! 0R rH200000S0_S0 Sr 200000Sl00S_Sh  Us 0b00S10PcUj~pZ0O00O4SL @0 0 SrT100000SA00S_S=   P0S r000000S+0_S( 0S$ 0R  r000000S0_S0 Srh000000S00S_S@,@  0 S 0 b10PU, -L⿌P  -LP  }0@-@TP* ^ \00S.^ H0 0S \4000 ӑ^ 0@T:0 -\0Q 0\ a p-1LM0`S@PP10S U t0 CR 0R0 S 0@00-,wNP$10S U 0 CR 0R0 S 0@00YNPU 0 CR 0R0 S 0@0TL@0 00CS0 ph0  0plp= -LM@PJ`p!)pF@K 0PDLDXhx` 1p1' 0`0 R0Y00 @b0Q T00S J0 R 0 R V @PG0P@S@0$HltT  p-LMKP @P`J011QhTZ P@Tj_EZpD]P TP`+ -LKM MCNK@D0@D,0 pNKKPPPM.KAAlP@4: S  S \H,0 S <,巐mK`F`F P@ PP  nP@h 2 R_2 R BPO WP4S 0G0@$<@ 8@ ;0K4@ 0@ CK08K KKNN( 0<K @7P`! $04 1D MNK !0P 0 0,x{M{p L@dP p @XD@0 0Pd :QP $$  pX:0P 0 2P T]] (P@T Ph5mK`F`F P8(ؑ 0 -LMp(KzPP3 @T `W@ W Tjo(T PZ ( D (00(PZ ( D (00TL 0-x0L0PS0@Q  PP 0S(0 R00 R0t P-L` 0SnS 0@ ,P@⯉l0PP@p` ,{Pp@0oS` t p-PLM@ PPp,P .TP 00 P @Q T`P. ?P 00 P 0Sp -L 0KM#+ -L 0<4Lx -OML Mh3PJK@@| ,  NK 0C%P^GP P| UG70$\<-PPL 0<1 V(l<T TxL̎d -LM@lP T  Q q0@0  R\ =l -LM@ P T  Q q0@0  R\  0-LM0P00CSK @ 0$ ϓ0 R  00@Ul -L0H kً -LM`P`P( @(K,pK 0  (0@S -L M0@p00 0Sf IPP 0S nSW =|P0`0@Q DP QIQG  0V0P . 0' Y0  0000V 0`0 ,K֬, ?R0S@p @DF0"Sl 0,Y000 LPH00D 0oSP (W4 -LM<@KpPdP@  % P40KP\XXXCXXc -0,0K * K<#$pd ?0L:S^ꌜ D$D8`D0000S Υ1000,K +K&0Sb @ 00y!0pWQF pGw x PP`   0upGw )P@ `tP oP jP ;P@@0S  @`P0\ p0p ^9I140K'Pl0T (hЉh@X -LM0@S\ %PH  P8PP hЉ -ML M$ß0`@( ,0 @2P`d088 B~KpGpGP"04 0X 048"qP0 T  QPP KA >KA B0Cm048P480   ,2X("@  0G08@Tk } p@^ P+ UX@ 1 ,0S ,PKAA GP<8C4P 4  XLrH08QNK@D0@D(!`i4F[D0S Y XH0SOD0S bY  IHEHAH>HU Ꮕ48tvG08@TGeTn (|lذȊ 0-`0L@PT  P @T(0 R00 R0 0-D0L@PT  {P @T 00 p-LM:`PP 0h 0@T  \P @T0 ph  Jpt -`LPp@0   0@ -PLM  0SlnS `0 @KTF0S@ @ 0oS0  (W -PLMP` 0S pUX鵄?@<@@N 0p`V긌 -L M0 40 (KP`* iF2pP@0H U0S -Sl01=P APAP@0P0$`P00`40(W -0L 밫 0 00 --L f p-PLM@P`l0l R T D0 Rp80F  0   Fۇ05O --L  --L  -LM@B h0@ --L 㬇 p-LtM/POJ@TK neP0: S p0`rS_ Y 0-/L@0JPU+D0 00d/00(+M+I00P -LUMpPKP1eP@lK8*e0S-0: S  SU P U@P P@0 R000K@eP h1: S@ [Ec$^B+P$P4P P-L P oDP -QLM@ mP T ^>TP -L↪P PdP -LM40 $40  08 Pp  _P@=  PP a`.W X X0SV  0m _8  8 0SV  04 P8 W ` DW X00S($00 0 R 2X0 `,Kpx "@T 0S @TT ,  PB4ppW^^J R0000 0W 8 00$28 8  0"PP00  B 0S00C0V 00R0R`V` 0S 0S4P  0S 4P [YW  0(<Pp  0 3D, 8 R" 0PU 0S  0U  0PPU884P0` XMc;LLV'l P:U0@` -LP}@P : q00  R.@P*j`p@T  P0 R @Tl@0 0 000< @0@000eP`*  0-T0LPU @C @T ,C@T PU0r -LPp @`T ?P @T@96 300 00 @@m p-LM @`P 0PP ,0 R p 000p -`LMP@41010Pp`!0s ?S mS 0Pp, G0 PbQ VU UW V  h뻄 0 pR0`0PEslT  -LM0@0cSZ bSZ4 `K 1 0pR R [ # 0 P `V | $40"WĂ,(0 ("4S @ P  (D`0 p-LM@PP`p#P$0S`'C0 -PLM808 4 $@,  #밫m - !L$M0` ,0 pp@ PLK2  L@ H@ D@ @@ <@ 8@ 4@ 0@  < p`>0$SPUlB>0S >0S I40 ,0S (,内3 у(:i ( -L(Mp0@PK@`  0 @@ <@ 8@ 4@ 0@ ,@ (@ $@  0` Rp@T L 0s  0S L (9i (-0 R 0R1!\ 0S \\0 0A0@ 0C^!\ 0S \  -LA^K@M PETMPEp` | z0 S\0 K`00A>K 0C  ᳔l  -LB^KMMPE@p`D J80τ KBK p᎔G -MLM`p tANK @D@DP8 &,0 KpA.K B0P0& R0-P@L4 \ 0 0h 0 @0 SA@Qa0@7 @SW @  -LM0P0S  00XSxS`pzW` *0@B@@p갠 -LBnKM`F`FMP@! ,$0K +. dB>K0C\p % 0$K0, P00S 7 P Z ʖd0X $K0\#0$ K0@(0XSxSP$L -pL`0@TP) 0R q0 0 @ R T^ hL@0@TTF@pW`4=@0@T4@T(@ -LM0S!Ƞ R 0 S  Rl l0 QAQ 0H @ 0,@R 4 0-PLH?0@0CT]0h 0?0@0CT 0S?PX p-LMPp?0@00CT`Pph?D? :00CT@00CTO  T(@ -00LS  S ?h?`t -AML Mp0   p4 0}8 ß3( KBNK0@D#̠(0K@D1p B^KPE`PV00(K8083( KV0 9$#0(0K0h3V2( K0̠0(0K pi V2 0Sp>g <"(K00hWXP! 00 x9?p6? @ 0 TP@,?D)?<&?0 ,c ?V] 1SCV& @0 S; S6 7S1 nS, _ ? ?60S @ 0 0@00 R  >20 S|G<4!(K0p0hWP08$44 >1 !<>>1>10@ A`> 048 % &@@@?81` @  (\|( -LB>KM0CM0CpT"PB`v(0K BK'I"ᰠg (0K+ !尀0S$ @P!T, 1 (K N>00CS~ @ 0SX) @!0S% $P!)<0 (K $>0@0CSt|R P 0S,(0K 0R000'G 0  0-LANKM@DM@DP !1̠ K, == =============x=p=h=`=X=0\ ,Lp0Pl -MLM!0LPK@ K,0 L@ H@ D@ @@ <@ 8@ 4@ 0@ (H尀H X0K<0 P X@ T S p\R T 6PKX@1P8!8 C=X0pT0 2@P`L L0`/= r n j (""( 00CS00 ä0X0pW G80 ,0S d,兀 =H.(p(i D0l@lth -0L \~밫 - 3L MP, 0 8 4 < @0  0-S 2@  4 ", Fp@g TP r0S `T> TP` 2SiT/ LT8  8  T oT00000  lT<00<0 vTzqP0S 䡟@ ǟ2S P2S 0" 0 4 R㌡@ pTx 2 TT 0@0C0D0q810  00S !P0S @2 PR@-2S8 R$<0S8 R000 R00S <0S 0 R00S 80< 0 }@@<@@}+T hl p-L$M`<@K0P  0 <0 80 40 00 ,0 (0 $0 @ p 0[S np (i c -L(Mp0@PK@`  0 0@ @@ K<@ 8@ 4@ ,@ (@ $@ @ p 0S  A (i d -LMR@!x 0S   ;@] |Q<0 CR P000S% 0CW3? X 0, CR 1000 \ `0 CR 000 \0S@0> CR 000Ri0 Rd \ 0R0 S0 S0RTs\sl -LM@Ὑ0S 鴙0Shd ꬙0SP 0S@ < P0  $4oX CR 000Rh=0 R \40R \ +0 S0 S 0-,@LP0S 9P@0( 0-LBMQ0 0C @S 4P=P 60x 0S ds0A L  4F/K<F (l , -0`PL@ p 00B S0B a0BSWBA0BS7BR@P8T4`Hpp` `Q:0e0b``` -L@LM "00P 0;0i\< -LP$M@KDK`@  0@ < 8P 4` 0@ ,P PPPp-DP tmPP$ 0  ppPD0ph,U U@ *VL0 0S 0@T:m} L\ -QL$M@DT6 T- T$ T0 T0  @ 0@E/0 R0 R000 R"x0 R"ddd@ `D0\@!/ D @0/t|,4@-@T<0 1  0B0R \ -L@Mq0P 0 L@ 0`S os \ K\@TT9 0S0N 0XS0@  $H .(AQ   .$0  B LR 000K.00CS00  ä0 0S r dF0R PD>P0 R0080 R0"0(\<DlPX`h0@ S)<0S88J.,0(0$000tx 0-L\P@ "10Q0S aT0 R 0h.0 0h.0h.Q R R  00S "48<#800000Sx,r p-L,M` 0@@KR0 P !KT*00 R ^:00- 0S Kqp ( p-L$MPŸPb0 S @0x Rp 0S$  l                       r0 S qp"R 0tt!Hd` 8T 8PK0  0 80 40 00 ,0 (0 $0 -0 S08 K70K o0 [R R/0[0S Q"[-K"48<#8 0 .K/0[0St,`dP03P 00|.P ,r`(, 0-PLM @ @T T ,|̽t0%d0 RK 9PP .㰽P@  ̽P@, -T0 ML\@4 <@=P , ! p-<4(LM<Q"4 L0`,$,!$#\@!P0T0Q00SA1T`U W-!P`V ,cpU(UU $Ġ$ $< PY$Ƞ$$< @|| P@ PK$Ƞ $<X HPA$<< (P:hP`, -p2LKM@PHK ,@ `Upp 0@CT@#V@PK^I \`D PP@PK00PW @0S <0S80S40Sx V$l1ROK RH[  <rP0,(!p1 ,0S ,o \0 S- ʀS S `V0 00S SpppS SpS Spppp(, -LM0@0CSThhhhhhhhhhhhhhh`hhhhhh0 Vh!h#00@-d Q00XB.P@0L#"\ 00  P0S:00A0< -L(M 0K("[["48<0#Q02K4 2[S2[S X Z4 0,,,! ,@K P qZA <4(<"4(< p@*4@8 <#8   Pp p+[*[)@[(P['`[,0[p P@ P`00S W*00SW:<,2@jH^LXd<h` -0LS00S4  0S hJh`0 |-, p-PLMP@a@A 8A00!S 0 90!S0 :P0 ) 0 p@0S wP 0S0Sx0  R 0S l:`6P 4; @0 <0 p2tD77l -pP0@P@TL`% 00000S 0T 0S0S\hTH 0S 8,P@`'t 7 00VX 00N 00F - 0 L勰0 2 07 - 0 L{0 2pT7 - 0 Lk0 2"x7 -PL0M $ 0 0p0 0pS`! K$K3P 0S@! K$Kz3P 0S$0 1;$0P5P0 $ Q 0S$00aSP 0 0QPPW 00S  $000S $0C $0$0QR  0&$0Tg27 +1 -CML M% P` , \ EK@A@%3P`4 5ӯ5 T`4 |5 t5 ÿd dX`50S y R<5 t 050Sp `44Pj 50S0 0R r40000S 0S0BKAAS0 0r40000S R0t4000ӑ00S0BKLLH40S  040S 4$4Q T30Sc0 0S30S S0@03P0@00` 2P@~d743@\4XT30SD30S `43P 20S`4 `4 20S M 2@`4"2Q\20S@Xb0 &0Svh20Sr TR0@P0LS3P0@00eENK@D, d`4 0OPX4S`4MHTUH 0SE 10S< `4(3P6 p10S d T10S <14!41Q ^@10S@p0 0S00S `0@02P0@00P 0SEK@\4XLdz@0  ,0 Sh,zk(27 $+"117+1 `1,4,0 D- 0 @ 0^ 08D -AML0CMP00 , 04 4 0P004@@S`BK@ A@"]1P 04SBK@ A@"Q1P 04S44 2442PX2 4TpJ <20S2 0 R r20000S \!BK0LLS0  0 r1000 0S R01000ӑ00S044T d10S 44h 44D10S 44 44V 44BKAAFV P44'"/K0 P 442p 4SP44  RQ  0|@9h0 Xe0 ,0S@,}j(H277+1p8| -L6@00CS00  ä0 60S t00S h@h0hP`0Xp01P@`p`p0$0Լ2"1`++1 -AML M" P4 , 0 BK@ A@T"K0P 44D @282 44( $2 2 8 哼d R1 _ 10S[ 44S1PU 10S  BK@R@ r100000S0 R0l1000ӑ0 RBKA00A<10S j $10S  Q10 S`0 pp^0S00S @Pp1P0P0004 0P@8㊼<0@ ,0 S\,i(27 $+"17+1`|110 S -LMHCD\ <<3|8#0 ,S X30S1$0S 2 @E"$2r20 \0)2 "ŸŸ"22x2`l2P`2@ L0<242@ 0 2 21@{ 010S !1۫10S !1Ϋӫ1`X1@T10 |庫p1pqHh 岫\1AT1T \|00<奫0S(娫0@T Q 喫0@TP0 +2"1 108d\p"p D7+` + 77$+D6 `1p2''+1+1 4 7 p-PLM@P`0S00P xHP00 \@P L0 D.pV 0 "p2@X -0L 0`+7 - 0L0 0 l71 -0L 0h7 0-PLM@ !0S000)P0 P P0 K 㕇P00S0 |0 ª |0 0T0 HPH@IX 峪0S40 80岪 '217l -0L D 07 -0L 8 0+7 -0L , 0(+7 -0L 08`7 0-PLM@P\1 T_ NP@!0S000!P YP  TP0 T*0P @,w0@0 @0S 00S 0Sh0,00`0@0 P\04@0 00 02L 41|087 -0L 07 -0L 0 7 0-PLM1@ "P0   ځP K 㐆P00S 0 忩0 00 0S000hPt 0@S000008,0 D0ᠩ0( S00002'7+  -PL M   KK,P 0S0 0y0 0P|@0}S t00S\0hn0\P H0R@0 P,0  <P27lt&1 -MLMp0P 0 00P0P 0 3`.P0 Pg# ANK @D@D$P X0 \PT# 80 V` 0S(  f(p27p -PLMd   KK!,P 0@S 8080 (0 027 -PL M0 , ,K0K0!+P 00  11 00 1 0 寸4 D$ R0  0S 00-0S 0S0@0S 0P0,P0P000 +P0`@4{@27 $+"11`  -PLM   KKʗ+P 0| SKKʎ+P 0\S T0T0 ND0 0|0S$0v  (207P -P0LM0P01@0P1 $zp 0\``pP ,P0 PbP 00|S ,P _,Pp0  X0,0P_U h}_2X7 -PL$M0 , ,K0K!+P ,0S ,K0K!*P00 1弧, 001 4  4@ P 400|S 4Kz,P 4\,PP1 00@ <1 41 吷< $%1p0S. ,00CW*Ww0a050K00`!50K4-0pS0@0S 0P000+P0P00h00S ,00CW<V4@0 P,0 ^27 $+"11` -ML Mq0$0 3`/PP@P@@T!|PP 0S`Q/%P@Lq@BnK-0 K@`F4!0G ]P+0 K0 10S A X00  &!0  4bBK@PжͶ`Pt00P!@ $0S<$c(̰'2+P07 -L`M|q Px t `tKxK\!)t0x 0CSD1 <嚦81@0P+t0Sx0t00t0 x0Pt0SP兦p@K] Oᙳ`@x0 @t00t0 x0 `P \0|j Vt0Sx0T  P0 0S< Vc(27$,8@LT+t 0-L@0LDP0lP 0000}S$06`P0d7h2 0-LMMlPANK@D0@D0 !P DD @0 P  0S$0  c0(27 -PLM   KK#)P 0S |0|0 l0 0PH00}S <0<0S 0إ0$27  -PLM   KK(P 0S |0|0 媥l0 0PH00}S <0<0S 00$(270\ -PLMX   KK ʱ(P<800 u(0  'd|27 -PLMX   KK ʏ(P<800 S(0  |27 -LMM0BNK@D0@D`+,0 tV+VpPP00U00S BNKB.K@D BQ@D BQ 00Q+a R6PP00U00SBKA0A@-0K4PP ,0S,a(0 -PLM   KK(P 0d SKK (P 0DS <0<0 ͤ,0 00 \ Dx1sxPQt1St~Q|Q!,0 S,V -LM$@ #ؙ屶l2Td7 -LM$@#ƙ埶Z2ld7 -ML M60H ,0 0L P$ D4 ;P@ 60S*D4㔩 㑩x?PX  0SX T5P\  0 S \$ D4H`D SpD4L$:筣Pi D4LT Vx P `   qP   qP5\P$   zqP @gX$R P$ p/+@/x:Pt@ppPW3 W1*P0#03U0S* TD @@]`@ XPVV*4 T4S 0S Y 0SD4L$ttT.T +T :4/`0VP P`3V U  R0305`1:` :PT 0S U ppU 0S /PpP30S t3tT$ 0PP 30SG@3 0V@4 10S 1U! 0IV BNK@D@D0!刺x1 @4 < 8  \ACKX1APA@4 PP4CKSAA4$ 84 1!0?2cS D40`4 OD4`$0RD4 D4HSD0`$0Sr` ,0 S,U(0+4('2$H1(P`7Q< P-L`7 .OP@ 0pSP' +Q 00 %Q r00000D0S  r\00000D0S PP0pS@00g,p000000S00@ p0 00000S70@W0@ 20rP000000S00@r$000000S70@W0@ -LMl @o0SX  zo0S<  so0S$ 0P 0T -$LYM0@,0 4p@` [Kt嫹 ᧹`4Kl  0h d `A VpP$" L@KjP eP#LK 0[P#LK P0EL0[S LK 0VPU u  ᪧ x3 p1Q,,TLpA@#@3T J p10S S_K <奱P,2 帖P`Ȣ& ᳺPP 0S U 0S S_K <zPP,ҠDN8`@TV 1 p lcQ ³0pt1 @l]/KpA 2PJ0S x ^?K 廴P፤xA00pᇤ0dQS PP. H10S 08 0=PP㊣P | _?K,冴P00Sfp0\0 0 ,0S,S(1:\TXp=`hذ78"2(T0d8\9?',8 -LMd@4 0 0CS00ä0彲((0 0 S q2048 --p1pq0LS00`& TATÕH ㈑P8 4 】P展 /00CS00  ä0 {P@Tw0  !ㆥ @/劕c0 |ҟP0PSTh'02  ? 78  8 -LAM M8B>K0C0C0 +, ɷ %@$ A p< 8 4 BK J4`J U0@S񟗾  00DP 0tDPp 0Pu04S440S (D($ U; #0SS5V4X24UV 4V00V00S30S#30S X X0Sp3|3 ֔X30 CR 0R0 S 0P0Xu3 00000S "01000C0W2 0BSpRdppW00X00S u2 00000SpW)0U0 U00S@$p0 @<2QP4@ 5dW(UpX-U848S1  8 V-0K`ZP4A# PP210SS5V4Vڐ10StA0 CR 0R0 S 0P0,4$RB>K 0C c R+#$}8Q 00 S Y44044 1V 0  <% 0 YR 00S <$`0RR0F<,0 S x,Q< 0 (` 7?< 2D <7l"_9; 0  -LM800 (@(0 ð~02" 9 -JML M͟@͟KK` ͟VSp=͟N_N<,p 0P@004 <P@0< 0 $ 4  Q 0-S<$TU< |<@T $_ \< X<RHK0C 0C)00P 4S 4 S9T t9Pt rP`I 0SA +P &P7,90S 0CS  go4,90RP  4S8P@80<HP 4TSd8P- 84 $R P& ㅢア4DS7@$P tq4TS7P i4S 4  4S ] Vd7 0S k0CShppS7/4 APp``@VH70S> 60S 60S6&4S.ʸ4S 4S'4x6# 0C\0\00IK.K 6 B B Ɵ0O4Sʸ4S 4S5ܮBNK4@D@D++P`60S7 50S |50S/hşP*0S'450/P0S*,5#0 CR 0R004 00CS00ä04啮V W0 S |4 VOh4#0 CR 0R00(4oK.K3 B B0Od40S 30S 30S #4Sʸ4S4 S440@3 0 CR 0R00<3P@ 0 CR 0R0 S 0`0v2P@ p` 30S2 20S 20S*x"4Sʸ4S4 S4P2#0 CR 0R00A2 00CS00ä061ޭ40@ 9 40@ /0 S0 1 4$St1 4.}ҠϠ4S2  ɠ.Š 4DS0@ 10S$1 "@Pq004SM4 S0  4S4T 0S0Sg ,0 S,M1(+ +++2  1l9 ,ܸ0xp  78 D*'   -LM00 (@(0 ^702" : -LMϟ@`0 _X0K, 0` 4` <` 0>Ο0Οp0 >Ο0p0 P` PH H0S > 0RS ,0S X,00-S \>, T Q@>D 8>0S H0S ,  .0 80 R@0  D0 H0 S  L }P! =0S =0SNP00@0S@͟<0S<ȟ,= p ,=p.L㾟D0@0 幟< X, PS ,00|SO ,ٸP@/, @0S 0 S , @㕟<㒟= T00,0T|  T,p 㲸T/0p0WP<0S 0 S,gP<0S 0 S ;0S ,p , ,0S HQ;0S o ; ;RgM@;PL ٞPH0S \ 0S H lP 0S  ( c _P@ 4 40S pW%,sP:00 l:p) ,00|S D ,=0 00S,|  *0S:d: ,j0 00SD:, 1 O80 00KP0S;0 Z0 SiPpF4FP0@0  @.0: S )0S009 H9@T 0DS0 0S 000FQppY90  p@0 S pWPdUQLȟ80OP< 80S 80S4(T0S,T0S X0S%X07# 0C\0\00|7XK |ǟ0OT0ST0S X0ST7.4077 g'P`PpÙʈ70S7 60S 60S/ƟP*0S'60/P0S*6#0 CR 0R00I`6 00CS00ä0>46V?0 S@5 W W,`V 0S 0 jPPU 0p P@0S@0 }jP,80pS,5p05 080 VP00P0  V[5#0 CR 0R004努4XK 0O 50S l40S p40S X$T0ST0SX0 SX0$ğ@04 3 P`L0S 000@20 0 CR 0R00V v V 00 CR 0R0 S 0`0<3P@ 4p`P0S CP 8|>d30S2 20S 20S*"T0ST0SX0 SX02#0 CR 0R00EP2 00CS00ä0:$2400@ 90 Sp:1 000@ ,/80 S1p 1p080@֜<ӜD0SD Μ4#r@ RH0S R0S10S 8 d1Rp ㌈00 0,K0 .p{K0v> 0$, 圌D0S`0d0D ㊜l00S70 @ 倜<}1+X ++ +|2  17: (ܸp++l8 *0lx 8<'d l |   ,7+P4 0@P@@80S 00S08040S4l 0S0S@)<& -LM0 S 01 `0, 1 a 0 S00SS  |0S$ `͟lP HP < ;>崻00= =0 >K @P $0S S0 L<0S$ L0S la < X凕P(:$:a?B1cSQ8 PUQ  U@ 'jKiKKgK qK mKo/K=KnOK@c PW1S_1S\1SY 8 w!1 (,10$10 < ȟ4<K^ 4"<  0jKiKKgK fKeKKcKbK aK$K(_K,^K0]K4K8[KK ğpL0DS  p㓹 P1S00 0Sd >KP@0S S >K  P >K ) PLC P030 >K PxXC0r/K1 ?P@S㑩PQ ZOK3(`K0S S 220S3 20S/H3(KKoK\0P1 \ S_K <@@P#P 0nP R `2 0S82  <2D4 QA Q^ ^ 8 0@X@G)0@0 0  $         $ ( , 04<8@@D  ! 1S0s`0a 0 \^$1  0S >K  #P X@~0P00  ,0 S,Ed8( d:,(+4 1L 7gfff2T '|   "  `   T 0 p   }~ :T+  4 7\X ` p    -0L,MP؀0p0U$0 D @KD K `喩@T00?[\H0K @H 婦P<{ $0S $FEd(d8,   -LMr4 0S@0Se@+ -Lk 0000 -|@0Lp0 T\" 0S0LbLr0 0S 0b(r@(2(R  Q ,/BΆDQAφA@E0<1 <10@! @10D!D1t00lH1 H1`0L! L1P0P! P1@0T! T10X! X10\!\10   ۑ ֑0+11b0͑b+ɑ +đ+忑 y0S00 001@+":d89?l  ++76 12' -LM`@00CS00  ä0 -, 0$0000ߖ2980" -DL$M0D ,0 H 00 @ 儑P4@ 3#3Q040 3@T 30S 30S@@S0S&@P 3t30S \3dT3 0S44!P(}PP7ߖc0@H ,0 P@ ,Җ00000 4D P`B000c_,㴖82`D H0P宆㧖4"0@0P 20S @P10S {Q0S 0@T4D PK Q0S1Pb0S0@T 4TD P T0S. +0A0S1PC0S 00<K0  <0 KVP00S0  =00S" 0,0S@0  ,|+l 7 2 +$7<` 8D*4D1 9'9 0-h0LM0 0PK!K0   @T0D(0 T097 -/L`PPU1 1U U/0p0W 0م@+ .0PW0PdZ 9X0l000Pp 0X0U.S100E 00EPEW +p2\P -LBMAq0 S P u10S1  RAnK `F`F0X!PƧ0 0fP0, oQ10U B>K 0C0$  0 K(4 0BK @@ _Pʰ00S0  FU 0K0 +ePP@00S 0S8 5B?(97< 9' -BMLM(7$'$70 '7 H , 廢 'P  0 S606+ 6PP6@P6vP6fP6Ȇ@6@@PP6 6@6@叢P@ 0S 3PP l,P T%PP @PPP,(6(P5  c &P 0S50U0S 50@T@LPP@ 0S P P PPtEBl5P5  X5X 7P UJ P c40NBS񟗓 PPPPPPPPPPP PPPPPPPPPPPPPPPPPPP@PPPPPPPPPP8PP@TPdPlPPPxPP,P8  3I#00#0F3;0 0 0 ;4303 3 <3033 _P#h3% '2 2\3 2L30 rH300000S 3TZ 3 3  l2 0"Hp_2202 2l0 2H H P ZP BNK@D@D+T2@ D壓04SBH4>P 10H P4'P@ >㇓ ㄓH@1 0@$ D4 < 8 4D 0CKdAA A0QS R  1h1 q儡0S 1 (P@@T S P@(T 7`"dX1`d " +71tXp |1ؓ12,+'lh<T 17+ p0+T -LW 娒0 p-LM@P0`I 0S @0S *C00@P 妲00000S T@0S '00$0 $ 00`p+?,<7 p-PLM 200CS00  ä0 10S A宂凟AQ [P ᾏP^ @0 SP00U1P`1t参0X!0CS00Ӥ0/ PB p?0a0S Q00Np@ P 0S 00S0d0  00S 0S d00 CR 0R00t \0R T1L ph-21"+7x+++`Pp@-& @`QP 0R0S  0R 0S 0`S`PQ^ppp p-d d0LM\` X0X PPP0@T000p"+7 ,+?p@-AaP0$S!S0S S001  00 h!h1!Qp0 S S8  S0S00 S0000 S S S "S \S0S 0 0S "S P00P p4 0S00 S000p+ ?+H -PLMp(M1@ 1QQ! aA0p2V*Q 0S 0S H0`2V: iYP@U@p`0` l P \<0< PEU12$c8T -,0ML  0E<밫` -MLM , % 5 剞P@ " 0S  P:? |B^KPEPE0d% T[P5P0S4<RNK@D@D*WP,KR5( K·.ڊP褟 P P  QC Pd XP TXP .㻊P@ XP  `XP00c0S .㦊P@ tXP@i  XP0S0@S񟗻d$P %P4_5"塊P P t嘊P L3YK0AA;P5?P %0S_52YK0AA#P5?P{ 0Sw^r20S} P Plpp00 P  RqXr0So Lb11@P@U pP ` 2000 pX 0 P0 1pO PpK 0S1 0 0D!!00!!00 00da11 @`QT $1fp+ 0 S0TS 00@T1TGP PP6@Ps0܌0a_<0ʌ0 ,0St,u<(,P0T"<1 "Hd@20d p-LM a00` p 0@ PS,P ppP"P@@\P0 p "P\P0 p P P P,P00Ppp8@0S cP 0S pPT -LM Z6@TP 0000Q6P 0-0 L0C@R P6P 0 Q000 P0-L@ 0S Q 0PU*0T60PU:N60hK60 -L MS( 0$ S 33 P$K(K"$ 0BS (0 2~2 B0S22R(00S(0 2P 0Sp奧7P 0S (0PP@20S 202 _~@ @噈2 @哈2 @午1 @凈1 〈1P0S1@1P(0 z1d0S0`0_PV  ZP@pl SP@ 0T.S@DpP0@4!~Tp,, yP 10S11  V  `0 } R00 V   yP0} `+2("T7  71pp" +M"1?7+D7Xl'8;;17   -LM,Qp" ,   /K?KKP2  2S 2S&20S" *NK"__K, ۫P ҲPx202 S2X"ŸL2WB 2  @22 2S&P`ǻP`V   0\}1X}|@KP!O|PKtVuP@|0[S@TB yP@2S偱 |mP@ 2SXt P`@TXQ $VP W00S&p0P  J0 0y` 0@P0 POP@P 0T,0 St,9(7,!<pTt2$8XL1"7++  -`LMpP0@T0|0 | 00@dP UP ̉@T0P S00@@0 800P00"2+7 -AML83M4ß@0T,0 p0 3 0S 3@ SP É@0S 0S 00@T@0SP@ 0SBu00SP/S  0 S R?f|D%iBnK`F`F+w00S/S/00P+emPkP1X0Q  \ 00 1P0S 00pSh1h!0?2cS XL100$R 1PBNK0@D@DV000SX000{ |P TP@@ P0@0x0 ,0Sh,8"( x++'1h7Q;<2d -MLMpp0 S( P`L Tq0SHHA0 @{fBK@@$!TP9 1$K R01000ӑa0CS'lt0t0U{ 0 \0E{K{(0 S4(A8`(+2 0-0L0M0@PKS@,  0 ㊰0S\@0S 00YP  04 -LMp0 SԀ0@0"P`P P (K◩(0`P R rp000000S`P T 0S8@,z ǿ';2 -LTMa0qS!0PPPA[ 0r10000S@ Pr1000PU@p \vP \1\z000 00200`KdKhK\0KX K T@KlK , l0X T0 h0\P0 d0v.BL0 `0A BH0 0D @ 40 JhpP X0S 0h Lz00P X 0SH@8Hz @u0'7; 2$d 0-LMH@0Psُ0 K㋉p 0SPP0wt@ -LML@P00sA@+ -LMH H0q,0 F6&6K60S |&Qp6\Ɵ  d@ ( A@ _P$ &@T@dTd@K0 %50PCUڔ5 ra҆@ φş@ş`g0%p `P`Pp%5VF%T5UWPT  ᩆ@ ᦆ5@` \ B0%@P辛0 04bQ c<" =9 B =<" $8 82 0 S0S*<#NK\<8" 0 T< 4020bS aD"  BD" @2 =9 =D@2 kP@@k/ Qq0  p%KHP;%.K3n3/C0ur I@ F@`0#d =@ :@`t#Y%KnT3OK0ua2g 2crB&0@" #? 2cc#aw0S0S%NK/ )PڄŸ0 S 0S* @ @" <2S @ @d"`N !Pǁ1P@%K p0 p%K om1Po0uv ʅ@ Dž@`0! ᾅ@ ễ@`x!ښd1OK0uf2g2crEଅ0@ਅ8!?` 2cc,! GOKᙅQ 0lH~dHP 00CS00  ä0 6(,0 S,R5.A(  8 +++@7Qųt2t -x3LMp 0@@,0 KGH3H0b0P a  B=9 = 0 iP@i/ p0 nK KP@/ )P @K p2QP0吠KS0SLŸ HŸH2@K00 րY~/ ~/ n"ŸP@Y00 d!p\P 0SL0SI@K]/ (PBڜ R>1 P@@PR50S1:PP@ ᖀK o0 @Ko onl 1@o0ef2f2c BDP ᙄ0Ϡ#PE0l 2lADd`0 @宙@Kᇄ0 S00W<@,0 Sh,X4.A>P?( +D+X0+8ų`2x -LM0`V *0P0`YV@: H1 ŖPUP@᭖`VA0S,0 :p0AT0w 0S :000CS00  ä0# -  P@| 0 @0 C\0\00 T,0p0S,0 `V@72 -L MD00 K4@.p( P0 1[SP00@2ht@@7 -0L M@K 0 K  / -$4L 0Zi %S 0 v>  0EiS 0 v>  0`0iT6ii?N((()),)@)X)h)|)))) p- LM0Qq`P$0  /v$ 0 0 *v$0000 u K@ $K $ Rv(K0 (0 y( u 0pN -p`0LH@d0&PR60 0Sx6  pG6 6T0S &00 << U $(  hN) *"" -ML M P, ß  < 0BS8@<Kԅ<0@pK@0 @G 00T`K0T0 S" Dw 1 S@KHK0hPK0h0 S X\ ( R $ R pzl` Pg '@H &PR 40S0@P 18SK9 9,998@4DH0 &0@冡< 40!1ZsNK@D0 @D]4 H08 6 64 1d1Z`P1\!rsNK@D @D8B'H04 &0!80 04 R8@Z ZK'P  0  '7` 0V' P7 {NK@D @D0h    T,0 S@,$(ND*P*`*Nt****p=** -LM( 0R@40 ,0 00  t, $P t0 X t4 , K 04 (pK0!=0 ( $0  `40`V0 ZRc0  P  ,K (, 0K $0 4K 4 `4 84 `V@Z0N4N -LMc0 @ 0$0 @ tp$`KP 0 0 $0 $4QV 0( SR (K(NN** -LMb0p 0H0 &f@ p $@ 庍PP0(p  (K⧄P00P@@TP @(@ $K N ([NN  ++$+ -1L M0H`s6p0@S 6  bP610=S 6p1S&P A0AW2P]P@3FFFV6 1 Vs@ s0@s@@61S @0@$S `Ss0T` : s@ s0@s6@@ 0 塈N<+d+++ 0-T0P0LH@60S 6&016P1S060N-00S ^0 0-S_0 000S0 0 p-0LM0 S@PTl`d0P@奼pTG 0s 儼偼引00pN+ -LMAP4 8 0 4 8`@UFDFFDFDFDFDFDFDFDFDFDFpFFFpFDFFFFFFFFFFFFDFFFFFFFFFFFFpFDFDFFDFDFFFDFFFFFFDFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF]@TdGpW 08 ;40 ++, -LMP@T. p, .T`% .V00.R0SV t0000PtX0000P-T_T _TW$pV @8, 0-LM@P@ .R r0\00000S0S0 S0 S K:PP 0 -PLMpQi@0T1* Rr000000S  0RQ 0 wP`F0'S"S $S `S \S`F\000`F0@0T:V00?|,,Xp p-L M`Pp P ,50@Hrol姓ᥓ PK0  ` 1Kp@0<ST 0 p,N,, -1L M0t!H0 F, <00 0< D1< ,00(1   00 1  1K/ P 0`P p̌0\|0 00 00`0`0h0>P@ ,PK 0s > p@0PN  $O -LMp@ de>P@ Kv r 40R ,Bp, -LMc0PH0 pK FS  @@IP񟗫OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOpNO(OP@ (k( iU00@@,P00Z00SP;P  80T0- -LMȀ0 0$ H0` v8@K0S PU 0l@00<K0P,P ;P @  $0S $$(Nx0,-00 p-LMPK;P `V( 0@T hP 0S 050@0 {D0S @Th  hD@`VD0S8| id,0 =p004Lc0 Կ -2LM@pT @pTzP`T @TP 1 0R 00 !00@0c|!S0"c1QP@T Q  D1RT0S000000@T^  p 0#S 0SY Y@T P0  0Q0  d0RT0SL00S@PT,0 N0NNп Lc1@1Կ -AMLMPzK @(pGK0C 0C1 BS 1S5@T0 ,0S,(5$6P0-H0@0 80840400,0 N|@O@?N+@NN -0 0CS00LӤ0e ^00# P 0 000t0 00p PPQ8 00C 0000@?N@N+@|@ p-LM@T1PL1`P p001 0000S#Q"Q0P0`pQ q0 00000S-Q0P0`pQqt0 00000S T0PL0`p408 P,0`(0 00p@|@NN?@ 0-PL0@S| p0 h0R`0 X0 T00040 ,0 T(0 000@N@@NNN@ -LM℠0SxpxxPx`0 0 Z@^L0 D0 @Y(000@NN@@NN@ -LM@p P p-LM@`Pppe UP\PP "P H0D0@T80T0Q@D0   0p06@H6@ -pL`P@xP000PP px0000D0SuX0 L0@T<0T4@D0  0@@t6@ -pLPBo@P -P_P p0 00000S<0 pt0 000D\0Q`T0@TH0T@@D0  , 0h@@ |6@ p-LM @R`pRx90000ӑa0CSTꨃTȄ<(؆0ćTȈ@$\`|@-Pp-Pp|-Ppu-Ppn-Ppg-P|p@t_-P p\X-PLpHQ-P8p4J-P$p@B-P p;-Pp4-Pp--PpP%-Pp-PNp 4-P 0S|pt -PFp` "-P 0S@p @8,Pp ,Pp@,Pp,PCp,PMp@,Pp,Pp,Pqp@,Plph,PXpT,P[Dp@<,P p$,Pp,PERp@,Pp,P6p,P/pP|,Pp ,P@n,Pxptg,POp@X_,PHpDX,P4p0Q,P pJ,P p@B,PAp;,Pp@3,Pp,,Pp@$,Pp,Pp|,PKpd,PTpP,P@p<,P,p(+Pp+Pp@+PQp+Pp+PEp+Pp+PGp+Pxpt+Pdp`+PPpL+P<p8+Pp +PPp@+Pp+Pp+P:IpP +P@+Ppy+PJpr+PSphk+PXpTd+PDp<]+P0ppV+Ppp6O(F660=6?6M6T77696"7 77*(7I87C@7D7:=L7\7l7!|7i7HP77Kf%7'7|7A71ԍ77h;"7B78#`N* 8& 8G܅X.(8+0888.@82H83P8>xJX8 `8h8x888/)88E8 ;-8ȥ988 959 --LM @0| Nxp !20S \_T 㤘H 㠘<20S ,,R$zo tJtF0U41$9 --Ll i0T TNLD 1D080S _$ p ltJtF0U --Ll C0T TdNLD 1D080S u_$ J FtJtF0U --Ll 0T T>NLD 1D080S O_$ $ tJtF0U -L`@PS pR %R0mS,R0L Mtp` PD"@`PT@D ń R000 --L@ 0C<0 ]/P@XGVP@`<?T#0@@0 J/P@4C P@-Tv#0D0 8P@"Tk#0H0 -:P@'P@T[#0L0 :P@ hP@ L;TTB#`0P0 0` 4` ;P@ <@E0L!!!?!C!c,B^ B^DHL@PP 010000012c12c1 C @00012c12c1 C @IJl(JTJlJJJJJ- 0-LPLfP@4 0S0 P0K p-RLMP@` 0S(0 i000p(K p-LM`@ 0 cIPP0Phu 0 0bU *Hww0#S s0S uk ph4KXKtK -Lp`P ?P@HU tT<Q;t P0S L0#S hDKKK -MLM$0KA ,0 `hQR Q Q d8 S%KAA ld8 S:qXlPP ePP0 l(KA Al K+B 0d(0Rp8:spP@ zeP@ p(<:>K0C0C`#8 nd8! SD5;<#iKA Act(d8!M@S:rtP CeP t( JKA Exd(0@R:q|xP %ePT x( ,KA A&|(d8@S:r|Pp ePpv |(PゎKd8H@ HS( h;KA A01(81(Rd8@ST:rRd0P1(I (PUڈ< 8 V  P(1S>K0CPU!d8PS& 0 ( hX d8 WP@t KA gKA A aw4 0 ,0S ,(K034KKL 1 P-L@' 1a 0Qc 1 N'PVP Qxh!0 PTP R@ 0O  q0 Q@L005P 0@0CS0@0 0WR 00CS0p@0 0AR< 0ROO$O O|x$L.P hDPM Q-L@Pp`  a&d@@0 0#0@T` 0P@ 0h`td@0 0#0@T` 0P@ c 4P,P(M -LMp 0( PP`30K c 0P$@0 0#0@T@ c-p@ (0 S \(q`VDT8PP,K(,P4M@M(MdMM -LMQ0@ T< T: JP1 0S0@0`0PVpqP`@ 0 \0 p0S00 S 0PVPBc|PPpPPM -PL M@0 P2KPPR1P@ "댂PvZdBP0S P & P 0 RP0 P BXP, 1 0R S0`00\Hd \Z \L ,KPP= q, Qᐑ bPtal0 Q@L00RP 0@0CS0(A0,/0rM00CS0@000OPUlxP0<OPc ,P,KRPPX|PURRlP0,.MMM -Q00SLp0 q00`Ԡ0L00P 0@0CS0@0 w0Lda00CS0D@0`0HPTPXP.PA- @0^p`P 1S \0 A\ ^@p P01 0 0CR  HPLPXP@-tt@ R `0!R 00S01S 0P 00PPHPXP -P0 @ | |`@@t0t @L@0\p0CS@00h#0LPPPXPHPTP -0L!SPp+ EzP@! /P`0!S QP t0 l0PhhGD`0 g9LL0L,hNRMN -L M@xp"Phh"0 `TS, @2@"0 p(2@ P`<B2  P PWP 00CS0A0T0 Pp00CS0`A0|80X00 S 0 ,0RS 00S Y 000 ] 0S 0 0)R00SX`00PY0H H, S00 (0 00cwP`PPR\P$N8N -LM`0S00CS00@Ӥ0t TG "PUʜŸ0  @2 ꀂtŸ0 Up|00 P <2 Bp42R ,r0 0)K00CS0A001 Q( Tx0 @ 0@Z P1 0 0T1  00(! 00S $1 RZ J JKp0 QP\00P 0 BP0R P0 ~:0JX$00CS00`Y oP@R#dP\PP.`PLN -LMP!\@`- P@#  /Pp0!S OP t0tp0P dBV0fxJD)oJ$ ⧹NdNN -L@p`0PS;T00T00S 0S00c`^ 0 T 0 0 `P @00T00SP,0 R 0 RmPP`P -PBuL`@ Xp0S PPEuI]N -L MS , 0 0 S@`T,x3@AP , 00L3TDդ _00 @D S 00B @DPPx 00 S R"pWЂ W`l000oPp 0"0C`"S0b0_Z ^UAfP 00 @G S 00B  Q 00, pQ Q@L0002P 0!0C@!S0A0 0RIX00CS08A0004I00CS0p夐0 T`l00P 0l0CS`0E``0? <0I,j00CS0|PpllP.M -$LM` ,` 00CS00@Ӥ0xtV 聟 0R,0 !0@1   T`0 00 00qp0 RP\00P 0<0CSP04Q0 b0H00CS0@0K0 @,0` Vp0 ,` Vdl 0P00\yHX08`0 0  (N@PlPPR|P.NN -PL`@pPEuȂ `V 2p W\0P0 @^R00S$ 0t CR 00PEu@0@0CS00  ä0 e0R P]0\ CR ^00 pQ=0"#CQ0!-000 80 B1R0 \00 0 B0R0 ,00p0R P 0R P0Q P긠 JP  0 jC0Q| 000Q P0RH ,0Yp_0 Cf0pIlNNN I'H -L|M, 0 A]50 LP@00  0RrS5E,%0剔p sP5   pP5   NxPL4d5\0 !0 ,00a,0 , R 00 -Q ,0 S5 00000 ,  B, \TP@ [P9O6O3ONPP 4 Yt`U<4P P@PLd0S 4 Rc (4 PP WPP 3 4PPu5 0u C0 X0S3 3P3>0S l3 d3P`4X3>0D#S4,#>ubB0 X0S2 2PR0 X0S 2 x2Ptl2> E0P`00@iL2 0R Sy 84"P0`00[ B>c[[0ST !w>O,0 S1  00 Q,0S< h1 xJX00 Q 01 R.c+p009P 00P 00 !Q 00 ~H0 R2NK7qP0: S  0Z 00G00 <>p, RR|OlT " #QOOhPPROROHlNlPMlN$ -p@ `P0L0 %P00 00 ,S;S;S 0S0S0 0S 00pRtPpPP|P -LMtD`ğ0 q00  R 0  R3 P 0EUS\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\0<000 q00  R 0  R10q10  00S u1  00S^U-U`F`u pP ^U-U```\kP 0  P`P 0.U001``P  pP`P  0 ;U0 0 0  `0S Vl0 RP /UP` 0U00R|PO|LPtPP -`OLMp0 q00  R 0  R?0P E0pRLLLLLLLLLLLLLLLLLLLLLLDLLLLLLLLLLLLLLLLLLLLLLLLLLLHLLLLLLLL@LLLLLLLLLLL@xLLLLLLLLL8Lpx@`HLh<@xL\͟ 0nS` lS0 P 0 R0= R =y P W`0pS`0= = P@=  P<= R8ʚPp̟0 0nS` #lS0 P 0 R0W0L Bp< R 吲L⋲ `0pS`0X ˟ 0nS` lS0 P 0 R0;T R;;{ `0pS`0; Ro0q:0  00S` PpʟX 0nS` KlS0E P 0 R09: P1e*P+P&\!\\: R \t P Md:)9@ {  XE k`0pS`0 ] Y9 R ɟ, 0nS` lS0 P 0 R0 (00cS0 (0S : .`0pS`0"8 R0ȟ* 0nS` lS0 P 0 R0 (0S070S700L`0pS`0 XIPTǟ1 0nS` $lS0 P 0 R0d7 R 7`'A PPaT`0pS`0(W PdƟ7 0nS` *lS0$ P 0 R0t6 R 6p& P T&00SPALy`0pS`05 R 5 R5 RH0q(50  00S9 Pp3 0!Sğ* 0nS` lS0 P 0 R0 0S E D*`0pS`0p4 Rß 0nS` lS0 P 0 R0 D`0pS`0s0STß+ 0nS` lS0 P 0 R0 d3 R @Pgl`0pS`083PtŸ/ 0nS` "lS0 P 0 R02 R 2"P. P+M|`0pS`0r0 PR0& 0nS` lS0 P 0 R0T^ PS`0pS`0@G1P* 0nS` lS0 P 0 R0 1  P``0pS`0|PxPH`HlRlOOMOO|LPP PPPhhPP3VU00GUX $ 0nS` lS0 P 0 R0 ,000gPc `0pS`0  qX QX} 0qD=0  00Sn _Pph L= R|QP=- PT 0nS` ElS0? P 0 R03N0S!\  I?\0S \>TTTWU 0d HP0P > R > RqXG ?;`0pS`0+? `|? R$! 0nS` lS0 P 0 R0u|?`0pS`0? ? NPD010CS0 0nS` !lS0 P 0 R000  Q0 P|`0pS`0< pP0000  |PPPlPO -`0` LRTLL0<SS,0 0Qڄ0tPpPP|LP -LMܠPp@* W* 0 0S@@T0TbW`CPP l0 R   0ѣP 0#T 0EE@RPPP -LLM0 R8Ÿ" 0 q00  R 0  R1 A0 Sd KP& 0!S] 0SWʬaQQڌ 0  Q @0 0 0 S 0  {P,q$Q0L00EP 0@0CS0@0 $0g;00CS0@0 0`00P @@0@$|PN.PxP -6LM PR,P l,K6\@Pp P,0 Q@i0! ( P0 S 0 !R %R  Qd 00P0\ST 0 R Rʤ5 BP5 P %Q00!Q`uTş0 R`l00P 0 0CS`0e0 |80:"00CS0D0e!0 0 Pdt Q`l000`P 0$0C`$S0d0 =|00S? h@?3 , Q@p,  0 0,0P0Cs,0 0 00@b\s Q`l000P 0#0C` #S0 c0,0T5 2`V0 0 P-ꈂ Vp|000P 0@"0Cp8"S08r0 0 :l00CS0HPI 0SF q0 Qʠ0 0@T*0 0P T:0@00Pa Q@L000P 0!0C@!S0A0 x40900CS0u`匐0 QP\00nP 0T0CSP0PP0z Lw0P|PRxPP. 0 Px@P :PGOK 7H -0 $e(PP RP -80L R (@ 0! <=Q p-L M@udP0@D`P K`<P 2[![SC$0BR0\`pht@ -`0LM @R 0D!S a70S/$^57PP -L P> P4 000 S/ S- @PP pP `0S 8P@` @@ LsP|0p p0P\@4Tz},@P0$ |PpH'.PM -LMq@P0S S  [Rb \RZ 0S  S0匡Pc Q| I `1 @ RD1 0o(0 Q`l00$P 0`0CS0`0 0F400CS0@000 SH@P@(|PxtP. Q$Q ^R ]R 0]S S [S  0]S S]R.Q =Q:Q R]R 0 S 0R]S -PLMPP0`@p T/ 7P* 0 S0 S00 10BS gR  00 p00 PP 0P0 P |PO$R -SLM p 0%S 0 R ࢟ Qx0  P0 pg \PG 0 R Q0"plR Q@L0005P 0,"0C@$"S0B0 0U300CS0A000 R0 pt1 RlA8P X1 0R S 0`00P 0S0BpG0` Q@L000P 0 B0R@ q@0k ho02lY00CS0@8h0SL(@00Pi0F|PR,R$R.PlPO -2L M0r0l^L@4 , 0 000 00,qP`0 0bZ4 @R  P8(PnP!0@00`T@T# U T00CS0@0 4 @ 4 0 zPP00CS0D@0 0pPPRP R -LM " P2 P@" " q ğ0S   ?K PW"R 20R2 84bPU$0S4 \G"0S \ 2 1    ?KܙP 3 `d 0Q,V,K 0S 2Pß0SH# )G030 "G\ 0 0%rŸ0 QP\00zP 0"0CP"S0R0 W01P00CS00B0 B0 0o࡟0 Up|00<P 0!0Cp!S0Uq0O L0\1X00CS0$b"P U" 0S  F0 K9P0x 0uꬠ0 Up|000P 0d 0Cp\ S0Xp0 0" 0MP(R RU@Q. -L MH0 @\, P40 p( 0&S \S~ 4@TM0 P0p 0cS3 Q 00c Q@L000P 0t#0C@d#S0\C0 n*00(00CS0C0W0Ȃ T`l000XP 0"0C`"S0xb0 30v0<00CS0 00S|9Sz400CSv02 @`1 d Q Tq, 0@TPgꔡ Q000 P 0\!0CL!S0D0 0+000CS0x0 `@0 dQ T2, 0@TP(꘠ Q000P 0` 0CP S0H0 e0 $R,R R(R. -LMؐԀdP`01 ^, p@PP@ @q0@0 A0@0,A0 00/(N@@. -LM"0 s8 < 0s BВ0S2  @0T00@D ڄ0r 0S;P=|=|=00 00 0 T0@D0#0 N @0?T@Dڄ0qa4PK0 d 1 0C 0 d 1 0C @D /\ `Fʀ1 R!PX D0 80!0C,!,<S0(A0000 00 0@D0 00 00 00  00 00 N0GRPhPP\Q -`L0 0Cs0 p001 R 0p 0Cs0d0d 00T T00@PT P0@HTRP -LM@`/먃0#sP 1 0#{pP H0@*SHD@@@@T@@@@d@@x@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  0 1 "P00Pp2C00X2PH2D2 @bTaz("0S "0S n ! 0 g!0S ZY g[1 vx1@DrxQq+K0 PP*-30S0E= 0 0!K"pp-70S?T%w  rC!0S 0S  BK1: S 0S 0S BK[p0: S.  0 0 `N^ HN <hjDR@RLRlQXRTRT xQHRPRQQ0 -LM/@ᛣP 0SP :0/S P:0/S @P:0/S@P:0/S  -0L|MD$ ܁P  00 ߂PP 3S S 0S4 3S0S$   ` /P$ $  0 pi/S @ 0T/S/0000a`0 SHDj0 Z`KJp 3S @0 Sr 0: S 0: S  0: S> ( S  S QP00x2 R QP Q02 R Q S  S S-$ igQ\1 R1 R 0S 0: SQ 00t\!liPYEPDLi Av 0S i@ 00 0: S, -'0: S#0 R0S @0uj@PM3S0@0g tWiA S00 ꩚0S<ipHR,R@RذTR0`RRXRxx0# R00R\R0  QQQRQ -LpM@ 6p` T@B0S2 R! BpD"$00CS00Ӥ0 PpP PB00CS00Ӥ0s PpyUYUi  6pPpZ (@ T ip00T0S %pT>W6 1 R,0  !0S SSPH4 pKVP  0R1 !ᯭP p PcSaSp|۝USQS@1=1x@E0Sa  (D,$DRLRR0R0XRHRPR -LMMpA^K PE0PE` @ 0 Ap 0T0 PxphGP\0P 0 S @ F@(}(RRXRRR -QLM@l 0S\THSx0S@4 40 0Rh.R0RRXR -QLM@p 0S`X H70S@4 40 0Rh*0RRXR p-LM0AP: #:0$ h?`L3c0(  ,0D?B3c 0~BP@BV;  P 0S @0<0V$ ᥬP @0V0 L᝙P ֘0-S xl՜@pL0S LDB4uh P 徜@0RMbSSS -L 8nDP饘0 R  (S 0-,@,PL $Q" M"밫4StS -BMLM;;BK@(L; L , @0gS0*K`h[K⼐帐 p00P0D<y,P(0 00;  0uS0nS0 0 0BMK(@D @D^,P Y,P[K@ @Z5,0(K 0?BMK(@D @DP B}K0(pG(KpGd 0]6P@ ?hB]KBK0T(PE(L( PEL #%-*01G6P@0C0B-K( B BS1`@ 10DES񟗾SSSSSSSSSUUUUUUUUUUUUUUUUUUUUTUUUUAAQAAq 0S 000  b0 QŒ00 , P080!Q,000STxR -0L0SxR p-QLMP@`p00SV@+00$0!0$D"0$0!0$D"0$0!0$D"0$0!0$D"0$0!0$D"0$0!0$D"0$0!0$D"0$01`FV$D#V 0 0$01`V$D#pxRQ  0 " p-LM`P@@Tp -`PLCM p4 7 0 (1 0JK1 R0ڨKKK 0SK p ?@`PK  R p ?@`P4!' P@-P $ RS΂@ 0p`809 PL0  (,08<lPP- $P Q <01 Q0C 80<<ࠓ80 p-RLM@` @0S01RPPU pPp(0 PS00P(0,0S00,0| (PpVF20`f$00FPS0,0$0p040$`phTh0%0 0X00L0 0T00P0T\ -$@L40pS` $P0 (P4(Q$ 02(0,00( `cV:4bb4(0,0000004PcUP!f S4`V 4f L4(00` 00( 0S00,00`S*0,0 -PL,M4 8 ] $`VZ 0SW 0S0SQ0 S 00440@  < 8 0JpWh: 0 Q7h威pG:hQ D*00 0Rh S.0L T0l pl0T/ PP0L 0Lh 94 094 000`0  h0S*T0 #L B ,K 2+[0SZ0Jp[PW*Z 0JpW:+0[h pc8 VP0W*Z  0JpW:h +0[Rpc8 00P(pG*P0W*Z  0JpW:+0[8pc0P⨁pG0W*Z  0JpW:+0[8pc0 P⨃pGh` 0S|PEu PE0u h ` h0Sw:0S+ S 0l@LT0l` T/^p0PPL Gl0`P00X0d 0XpPP0L 0 64  03T 02L0C0,@K 2+0[SZ0Jp/,0[S ,000 /[0 [0 20C"[0L3  1/ [+0[0SZ0Jppb82[+ [@0,0[pbS80  0@54 00H000HQ W*Z 0JpW:01@ 0C0 @ pa800X 02P0C0,@K 1+0[SZ0Jp,0[,000 /[0 [0 20C"[0P3  1/ [+0[0SZ0Jppb8,0[+ [@pb8&2[ D0,0[ 0H0HQ W*Z 0JpW:01D 0C0 D pa8H,0@D 00lR0034 0f@Qt H D0PaS<@P c 0 PeU(0@Pb40e0eU P@@0UP!0ee@0@ 0<PU0< @0S @ RK @0< B0< @ 030S4 WZ< 0JpW4H@ l0@H 0Q00 < H0c 48(4<,(<4 <@SH  14 000p00 L 0L0 <4@(08SR :%<,0RP0 e0e 0L P0l0W0e0l0 $0 4#%/4p$`0% -L|Mp t x0 p0pLK W R *t0  0 Z00: LK00SP Y!Q | x ,@K0P00@0,0K0 2K+PK.x0 00.P|00SP| |pY100pcQWWQڀ p0R0P0SKKplK 0p Wj0K Z*t 00S 0 000峠 Z:p\ \   T#T3̠ 0 @@  9x0 p [S\!`0|p  0 0 l0 Q0+K,0KK `0,0KպKځ 0,0K0 "K0 | BPPd06 ,K ?.U G0B @T0DLK `0`0C`0 W< 00t 0p W0^ \ l0 R|00  *00cQ0 R:p [QR! C x0  00 0bC10@0 V,0K+K"K# \ 0S x  p +K06  ,K - G0B @T0D```Vx010 Z([h]]8b 0`] -L -L4MP`' 0oS000 0gR   L0 0mS000 0fR  p\ X T0 H0 &(ep@H0@ 0SB(ppp4ppp@pLpppppxpppppppppppppXxdppppppxppxxxxpxxpp pH  L 0T0 0SD Lş1 -R5 0PcUa.H QP T0S4WppZPp P @T 0 000CS00,K 0@߅0S0 ,0 R0 l @ 4@ `P kPP `lP@ 30C STtH RK 0S 0S @ R4 @4 L00L0@8 L00L0@ Lm/P X呉`0S @0SD 4UP LQ 0S0ST R X\ 31P L0SX\ t=@0<5 m; x`S0S/ H`S0S}T 0!R0;0Sv S4K8 K0K/P0 #80@ 080 WPU+ P000CS,K@ P@0S ,0 R0D@ @0 ; \ 7L {S"005P< @@ )0S :@PpP b\ 5X .P@ *pX pL\ o0S0S0@0e0@7VVVVbT b0ذxbc 0-LM0@SP oKP 0K Yp 0 R U 00U S y700SK  .p 0 R  R S70Tc -t0LPd0 R X0XP PP00L c@0( 4P000(VVtlcVcac p-LM` `P0@0@\  0S 0S 0S p] -LM"00Qp,0 w$Ps_`0@0 P`O 4d[$K4!04  PN \P4 T勏K` *0S0 0 (P  !0S0 R0 0  0@ f* 000'P0S d0 ,0S \,e0S 0QO(p]$]0]`iA -l2LM 40pF ;;S0SQR0SJ R, 0,0  0++PR- 0\ )0S(dP! ?;?00clcQ/\ 0 8&,0 X0000000S0S0.P@0S0 & 0 X@0@@@080   0 0S}zp]A0@-@ 0!?;?0c\<`?* Q< R:8\0P0S000 0SP P Q!0/S0S*U 00SS 0 S /S R0S00l]$]  -MLMp0P@AnK 0 `F`F ZR 0w%U0 U 0S l -@p!0S D 08: S0  (rBl] BB B( -L@!x^0hFSP7 !0Q0 0 : SWFH` djQ0 R TQ 0S 00g0hxA!P h如 QXP 4h] B($B8]4B\XBLB`BxB -LCM0`,$0 (@A/ K0 0R00P00 P0eS&0eJ/K0P 0 0p 0S0  0A? K   , (U 0SD0 R0 0  $0 S $h($]\0]B 0-(P, L@ $P  $0 0 S0 000$]\ -LCM Ml$E~KpGpG 0,           `$ \$ ` 4* R@ R  d$ 0S3 R 0 P, 0S ށ뤃0SZ3 (K 3P\4 4 XT @T40 @TP C0@: S< 0,N P,0 S ,3 2@.PP 2 Pw2R( K"\$ XD @A08"X2 R0S @UBNK@D@D~ P@6 qd4 S00C0 {y !0@00e 000p(y ` 0000S tP0 ,,s 0SPY 0 PQ 0 QP@ d0SE B< @0S: CP7PD ( B(B8]\C]BBBBC]t],CPChC|CUCCCB -T0L8M<0 0  8 @ 4 0K0 , ( $   H@KL -CML M☡0PP,0  1Q  0P1#\Q:,0 S @,EKI I0 0`$ @( K@X d 8 \ `0@0 BNK@D@D 0"P  @00@$;D+t(l]C -0#LM0$,0 P`P 0 7 Pp@(0S  0 2 ,0S ,T8!P4 42((0,00h0O0 82 008"Č Rh  0P1OP5~:\z:00/0SIOK,d&040#0PS<,X& 00L0TO:0082 S0,  0P1OP57:\3:000PS 1&01 R @@IP0, P( ,P0h0QO 400Lh08!i 85@0 L0P %0 0L T: 85@0 L0~(p]hiC8]D D 0)-Lg1!1Q@@ px`0(40PS % 04L0T;:0000eW+ A 00CS00 0S 0`00D`0` 000`0 ``< |%0 4L T:$]p]]] -@LMT x00C0h@-p0\ ` L00n^@` 4K0CB4  0D0 04 01@DpPÏPoD \ 0 ?00S00X W 0t/1E $$pWR`P1 ,0S ,Q 0 P  `0S@~P1)O  0g Ppz@0 `( B0B!O}0pt00 S 0l X 08  [D@ 0(@_R:0S:P h0S(p]DDDD] -MLM0lC\\#, 4 @(  P@[,4(0 B04(  3<  400T` t00\F" $p`"0t/AV#1%Y X @0 0  \2R_ Q01 D@!T  `,0V04 @@ T Q?>1 D@!T 0 T0 0̀0P( X (0KP L H D @ < 8 4 0 , pC뜠0 0P,0`U0@T UP@XKP 0 T `,0V00op]](]`]V -LM0 0,0 0p:40  6 6< 00`<0 @0R)0S&6 RtF p 0d 0PP 46 ,0S <,ڻ0 ,   Kx4 0S R1 < 8 0 B ? `PP@404 S S` Q V@1(@Q0 T `FV@ 0%0tP;P`@T1X@QzTP $0000 00SW4 Q4  A 4 4" 4  R 0s 0 p00t 00pPd4d$00i4 00$4040$0h Rf   #0S u 0p$0h0fPR <0 00x3t3   |P 3 l hP3 R! Hw2 R4 3 R <0 R 0SR;Sh0S)|0<(œ R:0S:\4h0S1<  0@#? S`& @CT`0t0@DT `4"80d a( Ÿ.NP^1 R  p (h0<0 0<  0 0Pw,1 R 0twlP  0p4< <0/410r($0 P X P0S 0S  hP P0  } D K G (p]]]]I@Fj\I8]`]]\0]VVI(Jxx\8JTJ`JxJ ]\jJJ\\Jj0 -LM@P.Ppe`VWY!?> DR.000 0. $0`F0V$0@\ P0 S00*NP ,@ R0 0  0R 0S R0R0S ;P  0 R sPd ]\0 S00Hō<<( ](]dNV]\JTJK8](K@lV4K0 -80LM, ,0  @Pp]Vk -1L8M1q1!00( T (0KX P L H D @ < 8 4 0 , ,0@Q 0PU `TP@  @0U ,0X00P @0P@ XK0S S \Vp]lV] -LM`VPڴp崀.@PT 0S  0T @T R 0S `FVP 0  0P 00V]dN -LM$$ @0 @0PVV,k -LM88 00 @0ShVVHk -MLMTTE0,0   BR$hxl !P % P80  4EKI I4d]0ğğ q`$aA4( Kpp$p4pğV`$ 0d *MKJ J0P000Ss`V:ğ $`0V0 *D0P00\'`V:ß0 q`S00*PP V:MP,0 S |,A0S 0 P00S 0 S s S $#P # 2  00C0 "~P  000 00C0  SV;;S nT"9(K00MKA@AKK@ $@(0 \4  X$ iBNK @D@D01 R" 0̠ ~ A0S0?0?00 R&P0 @`q0̠ L8d 8I   0I PP; PP 0:0 ) g(]KK\^|VV<]KKKKD\hkB8]XBLBkL0LKlKBTJKK -ML08M (8Rp, (`  Q 8 Q753 575$\C0S {P W0 41 R77 (K(K  (K0AO0KKl,I0S`7(K (K ( K(K0 00RP^^x>KMK 5[P$ $\0S#  R0.S $0&$00\ &"F 00CS񟗍$``$0SX ,0 S ,,并00  & Y5 R E0 S %G 00P%00C0 @0S$ $\NK @D@D0@S^K PE0$0%+5 R =pP $\00$0S0 R$ 4 R4 R$ hP 0: S0   4$00^$\OR$ 0.SH00P[S0 41 R33 (K(K  (K0AO0KK,@0S<3(K (K ( K(K0$00\P000 Q0hNK0ᴀ$00$02  0`0C0 R@@\+0SP $00$0P l"00C0x"f>KMK P8"V4_00@P \ P !?G0l!00S 0S ,0D0 P>KMK Pe$00$0 1  0`0C0 崀t$v@P_ l0S 0x0 P\0 R\ 0SY <00M0 0](l]\XL$]KdL]|LLtLL]LL8]kL\LMMK(MTMMMMNN4N $$0c -LM$$ @0 @HP^Vk -`!LMX0P!1pCH1W0:<000@`V Q 0 R 0pGW* 000 R PQ 0 R 0 UPy`@uPl000`0  00C0`0 0@0  ^\V]4^]] -LM$$ @0 @P]Vk -L4Mtq lPhh!0$0 @P T0 L0 H0 D0 @0 <0 80 40 00 ,0 (0 $K# a Q @L@ 00CS6ll( 0QP 0S P0@T000  00ϮxTK /TK% 0STK@ <0 ,]ptV]]x\xBTN`N4N -`LVP)P>1 1ER# @T 0S @T.!0EX00C0`FVP 0  @00oT]\(] -LM$$ @0 @PVVk -MLM0,0 K0 HK0?(@DD@K8K @$K ,? _R@X\$UU?(K1 U5U3HKKQ, P0@@?|\ ``N A$e @?AV@0p`/110Sr(K($ULqO QKPTPK XP58K1\@@?NA`@ 0|0l(K0?K!d $5dKS@B@h@$5A@l@0` | ?KAd@KK\ d0Tb 8KKP,=aHK0(K( B@B8KA z<K(@0@ SHKAX4 ZK(@ @K!HK1  0 K $08 00C bpX L?>1 H!X ,;+;HK ,0PK4KKT K!(K0 0(K 18K@T;@0 0 0! d HK @`˟0 S 3 S (K EHK@K0 $K00HKP 0,0@0CP(KTK_ (K 8K1e$5S8 HKApKK  $  (0,KS0@0^ TKHK(0 , A0000@K  0RP04080<0@0D0H0L0KKT08K !L5KsHKɟAÄpX3D Ϡ0.0CS      K000KHKA 0 I0CQ(K!HK 0A\00> 00c@# XpK\ K(0SK.!0\0@0> 00c# K 0X0C 0KUB8p WG?>1 AR!?> p W ^# ^"KG$0KQ0$0HKA`0.!008 > b0Q0cP8K! 08HK@ Z $5S,Kl p@h0PX`P ^ $%^ࠡ1(K01!p@0SX^ $%^ࠡ101v(0Kf(KHKA쥟8K$P @(0K 8K1HKA (K(K0(K0(0K HKKAP3P B ` P5 R9 K8K [DEK,0QK^$PPL5Ks8K0@P5 ; P|,0 S ,(K P K0PP0K(K8K  PHKATğ0 S(K!KT0K0$SHK@TT08K  P HKAh P3 R KXK8K1 SQKHK\0A00RKHK\0@00?0p00S @@THKAK XHK@X(RRKK`000QpKK`000?000S @@@THKAK X@BQKK\0 2RKHK\0@8K { P' HKA4# P K0S(K K\00SHKA\08K <RKK0?\04000S4(K08K0 RKK0?\0000S4g(K08K0 \K8K1 `K8K1 (\ l Dl0]]VV|i]pO,l\Dl`ll<]lp]U llp]8]l md]$mOK8K(K HK@T0\ S(K KT00TSHKA(KT08K @(K| P0@@gK@000| !(K!p0!SKKT000T  000| @P0 0` PE(K!0 SHKA2X0000000$%R8(K!?l>1 @  KK 0h2RK`00 ?> 00c# 8dW"K0K"0#>PK1(KTHK 0AO K0@ P54C0SPXP 0S 8KpP0@@?|`N A@u?$%ARP `Ah?AP=L0@Po4D P  RTJ$5SDD0S Pf0S`P Kt4 $ X\60  0 00 --L ≋Ȭ p-PLM@P`l0l R T D0 Rp80j p7 0  j㡬05O --L  --L  -LM@lgN h0@ --L r p-LtM/Po@TK 4P0: S p0`rS%  0-/L@nPU+D0 00*/00(++00VP -LUMpPKPP@lK80S-0: S  SU P U@P P@0 R000K@̉P h1: S@ !jc$^kg+P$P4P P-L P 55DP -QLM@ 3P T $5TP -LLP 5dP -^MLM= =@, @= _K A=A`PoP^5: S  PP PDx-0S< l= R0 X 0S4= &D i40S 0-@,=@(-(@@@ @@o0 0k0S P ,P(0,<00iPIl0Sd<@T 4,0 S h ,(,-K B BP 8 HPd5Tt5x%0%#,0106Pd5@T˟˟+; 7id5T `m; R0  V$+0S 0h$ p , L+0 t'#Po70Cɯ5@"%$pWZ0S[0<cQM0ZQڨ0Qڼ /0@L@0S >f0*0S2 P. 0$J QQ\  000S 0 #f)0S P  00H0cQ  000cH0t)0S f\0S P  40L0cQ  400cL00S ` e(0SX P X,5S05S. S ( 0S>0S e(0SbP 0(<Q  <0(5<(0S e$0SKP{  hH080@_Qn d H0S.0O 0S e'0SV+PR  gL0@0@_QE p L0-0O@'0S |e(0S. P* 7 W0S0,%R0S0L%r 0S 6 R @EP `P3S x 0pVPT085"d@00PgS0$PP Ve 00 pWD&00/>10@\6PPF 6E46P(@ 6P6 P5& 0%@U5 @E000%S P 4|5    d~g L``P` `$h / (4Lwa(0S? $0 00L 0P5?T5 V>X5pP0@@?|PN A@a ?$%AR㰠 `AT ?A=`L 0D#D3 P 0S U0 00,%0S><0(5 H0S.0O "L00O\P p"000D5SL000<5S,2  2 }000a45 SJ]H0S0O L0-0O021  1 *1  1 |000h1@@4P  0<0|P 00t!0S0f[ 3t0Pvf.c dnf&c Hff <<`(\4]]tPTJ\8]h]P]]^p]P] ],]PPP QHmPQtQQQQ]]l]hmmSmmKmn4n`nn$]\nR],R]PR\]n ^4^^\|\\oR(od]To|o0]ooo$SHSpSpSSSS0 -LM PUŸ ?P1q :P@V:` 0P\%1R x,Qaڴ RєڒS0ARph0 S\8Ad04 00 @T 1 , 0 B0 0!Ph 0SP 0 R,b@Ph00`T*0 QPd@T:aAe<,]]\p]TSp$p1 1FR#  800g\0 8 a@T^ 0/.!1CQT^@P0 0 ! 0!S 3S 0^P @ ?>1 A!  ?Q>`0 0 ?> 00c#^ \0008 W0$00C0g0$0^<]p]]]U i(] -L8M0@K00 ,  -RSL4MP @`t pq\d1  BRP  T 00c0Q3@T TX0X  0S  R1 018Ġg0r -LM   K 0KK p@YDr -LM @ \K0   KpYf0 lr -L -LM@@0S  hC -LM@9p$ pQrr -LMM B~KpGnK0pG`F+`F(0 6+2rPÏ˰ PP"KAA NK@D,X  4h 0X ,YO[|,`4 0X G[`L$BpDa008 @\P6KAA 7\p@X0S' T 880S@YT 0S 0@T8800 |  SplBT(0 SH((r sDspssP ssM t p-L$M' P`*4@K P 0` ,` 4P  *10AS1 0K(0 $@ ` (KhZd\ {p H<0! [PF8K [p@ _X0S  gpRT80[S [@:YT80SS S 0 0R0<0 <KI`A40LLL Dp t,tHtdtM t^ tXdW 0-LMP0@S P XP 0@+PW 00H^tu -l0LM@ 0K $0  K$ K 0P W0 H^4u -X0L M00 0@0 K P W H^Du -\0LM K"@ 0$ KK@  P (K0$(0H^ 0-L@s⨘<PP@ P@0q -LM@ɘ0S ŘØ0S  彘h麘 -LM 0`p@ 0S 0S,l, P0 0@)@`\ \0CP@W0(00$p$pP(P鴸(@^ p-LMP`P rp@@@-0 qP@ U@p0S PL嘿P@LpTP@ (8@pp*Tutuu p-LM`@PT 0SR(0@MT00P <pYP@0PS Pp@^M \\ -LM@' r`RK !P0 X 0 uuu -LM@ 0`p`(KIpj pPP V $(K FyP( 0[ 1S00 0V% (!pPGV0S CV0S ?V0S$ %$) $%$ W0`S|10S p0 ,K,0 IX0  $v8XHv|v p-LM`0S+ JP@'  # 0P00 $0( S ( ( R$0$0phfUp, ,0 ppphp@^0] @ P&\ @\ @\ @\ @\ @\ @\ @\ @\ @\ @\ @\ @\ @\ $\ @\ @\ 8\ @\ @\ @\ @\ @\ @\ @\ @\ @\ @\ @\ 0\ (0$000000] 0a _ ^ p-LM`00P 0@T PU 0sp00 0(@T8@0S Xph0S 0p@^0] -LM`@pT? 00 0(@T8@pT`/ bP `(@T$T" 0 0R 0 0Ep 0 0S 00 0P 3 00 0V aPP80@T 0  U (@T @^vTu\\ (0 R 00 0( R@^\\ 0 D^ -1LM@pT 000 0U(@T3!p4 Qp`0 P#(@K P $` ` (P  ,R$K - !1`HV 0$,K W,0C40 Sp@0UpT0S P0 0 Wp0ST0 S|T0 S @T@4@^X'vqD^vM 0-LY30 R 00 0( R -@0 U@>U @b 00cSkNK@D9P m0SXi PP>]0S  /ZKP  = R K| t]0S 8NP 3KPxx:KKAxzPi?: S ]0S[ KP  P`PK`0P p<  0P *Kx ZK:KPtqt<0  00SKtjK2t`W~Cp pG0S 0 S 0S00 S0S P-0SZKtP4S0>0Lm0SKt00S00SKt,0S00 0SKt(0S0`,0sZKtP40L,0SjKt`4S000[0S0S0ڴk0S 0 QڄK0Sx@P+0S010; RʴK0S ; rq + 0sKt[4K00 q *Kt 400t`80P )0 8 )*\ 0S0^K#10iPE \  &ʟ@<0*<00$Y00lj00 @*ɟ0 S0RS80X0S AK(AotP X8(`K 8(K0 K|(0(K K .:*K0KZKjK|0x K$hP P0 S 0 G0S *KWx 0Sz p@{ PG ~KpGpG'0JnK`F A]K0(PESPE,I0STZ 0SD  dTp P)A4 - *PjK`V) XxNK@D@D0|&(u s q `QT0 t $8 0(8 (( 0 ,H  >K0C0C G PP| KA P0SkK|? gKK t | SZSRP0S \\ƟLV0  4Ɵl5, @P`0 4( + ?0001 S90^Kt(0 S;30Ml/`!T:K0 < 0K  xc SHP*  @P"  ~IjKPt Ktp *KP|:A}K(pGpGP`) H  P `VIJP @0Sr0@00S P  T Y0`Vj?0Z(O  LO  dDh"X2dKTArp @84"2$ PNK@D@De/ K>K| jK0C^!t@P(`K1( K,@0) 9 !1 ɠ$ (PKp , +^KPEPEd!0BNKK@D@DP@!@1KQ!1*KQ t P갫( __wPwT lw$d`www_dw+`w8xdxxxxxyDyhyذ(0yy$` yyy`_y,dy z`_ z8z`Tzzzz`zz_{{4{_hIX{{ `{_{`{|l_(|@|`|p|>K0C0C``1L0 K00``41P@F0P!`h1Pt`1P`1Pڰ!000,a1PPaۮ1PtaҮ2Pչaɮ,2P8հaH2PTէa差d2Pp՞b宮2P(b奮2PըՌLb圮2PcPo|b吮2Pw0S 2#CYbjP#000M<_PD3D#D PA(ced3Ppet34TcZ3PՐAxcQ3Pլ834PP c?3P&c63P d*4P(,W 0D P 00- L@PpP`0 `R\ 000GP@< 0-Q(L^edA,d `Ȕ p-d0LM0`S@P p84 0SQph `gd|| -0-LPP@>㦒$0 ˶ ɶ갫 0-PL0@S00  2 xl0 R 0TST 0S S 0S o_$, -LMPp`p@? P. $PK` yPp $0 P  0$0 $C40S$0 ld U rPDAOP$ uذDP0 -LtMK@oPx0  P P P Y Xh -LMБ 1, ! 1 ! 1!p1 !  p `PP6 KZ C/KjU@! WT ,0S H,s sP 0 PP P]P PꈀKZ2@Kl p0 ` @P@ W  ?P 0\ DoPP (gP(T̀ -LkMl0`d$0 PP@ 0S@AsK P $A1" P 6^KEP@ #P1*$0 S $  P*0 S/R ` d P*P< o,(x++؀+ 0< -LMp0PK 0 Kt0t `h ,@0X @ K` 0S  剒(dddXt -LM X` , p88 P  /?P %>P >P NK*0S p_.0AU4ʨ> ~>p#  { l> h>Rd.`p (0 ,50(5P , 1> @, M^00 00 Rڨ R= =$ $RӠտڰ$RӐպڌ000 0400 Bd40AP LL0Q 4 R(:R8îR0H0400cL0 H0S.0O L00O PP00Z4\ʠ ZP00P0 0T 4Zʠ ZT00T0˟ T00S1800`0 8Zڠʠ Z`00`0ʀ P80Sp; P%00#1t0 003x0@P+4|0d0 |Z;ʠ Zd00d0JX;\` 4@8@帊@ԛ0P4@8@@00" 8 000P|0@8@@000 夠Zɟʠ Z000 0B00000S010CO 00pǏ| tSΌ/1`G P$p`Z`Z 00 0` |02X3 X3嬠S  ʠX30X38 X3S H܈P0`x@ @ⴐ ]00)1 @@ a` TBP X0|00  0  X@I @D 0 H 0S S0$5P㸀 0P @@ ?|`N A @!?$%ARp0R`A?A@T0 S< R7`P0@@?|pN A@00$/>AQ@0P`?P?T0 0 00S000ʠ $FP 剐X3 0X3@ 0 腟 80080`00`0 80Sڴş4 00RR 80080 `00C`040040 |00|0l0 0 E0 PKOP?E UpxP开 0Eo0 950 0ЄH5P0`x@!@@o^Y l 80 Si  Vg  \Tb[0$4L<4@ ɐ00 000@80080 `00C`0C0 PP0@ @?|`N A @/?$%ARp0Q` A!?A@TLßPp @ PK0?PxP0Eo0 500 0000000 x@83!R@@ऀX ʸP B0KKP帀PP2 @B 0 P @3 RRR0S K聟 @ @0 R0hŸ  Hp@ PK0?P`xxP0Eo0 W5P0P10`x@!@@@Tڴ00i 0p@PK 0?P4P0 @?|pN A @i?$%AR㰀G` A\?A@Ti0 Se` Raڣ?/0 0 (dd<#0dd__``dd|`_́(P|؂`VUUU(Ddȃ`$_`XxԄ__$d,Xd̅_` `d$W__T_(Xd`d0l dpt(`P0@@?|pN A@00$/>AQ@0P`?P0@ @ 0P0i0p圁PK0 P?jxP0Eo0 b50D@ 0|0@ `|zP06 T DHR0S T0T p" 0@TOJ0KJ0S0p P0@@?|PN A@V?$%AR㰀 `AI?A=`L0`d 0S2$0@$ |02P| $ Q0°0Pè Ű RD3 3  3 0L5 @5LV>00h0Ph0 S:h0PŤ0S0X36 Xc0PE`0|pTV V> T5T50X5 ^ @`=LP0OOT0p$$0 $I4 0X3@,@P,00,0@`0xQ0000, B` PZ0 "@p0`S$0bZ/0A P+U 8@P  fI0|  _I ,00C,0`@^@`@P 0|p$ d$0t&10XFP0SPPU p0Sj `00 ,@5L20000# jl 0Zp0ڴʠ Zp00p00V]&PA 7P'\50\'@0h'<l7P0X0'\@/0"b7D 0 0 0 0 0000@0S 0S 8P ,0, Z`(\H;0pKS(d d ,0X0Sy 8 R P  0 Pf(0X 0 8\łI  "(9\5 0Z8( P,0X \00@ d0|  ,0X) I9 P0 0 ,400 80 0 + 0Q  ,ҋ 0 T@0d jZ Q  00 Zl Z00@`T#d0>PcUcP#u  R  H sYIP@ ;9 ^E6+$0| < G@$AP4>>. g0,0p`0P4-/ V 0 Gx긓pß0 d|P  B H0lcG80|00$a8P@@d G0"Gv S|0` 2Q@500h0 X3X#B P5PBL%00r/ P5T%  lŸPP0P%PH X3X0 I80Jp|0P d@Pz0 Z0` VPElL5` sT5Z20P000s, `A\ L5sX500VL5sP5T%2 0 / 00n0L5sP5T%2 0  80ZZf0 L5sX500V. 00V0?T5 V>X53TTX>̆_Dp؇ ,P`hdD0 0Q 0\\F0d40 S$||F FF0S nWP T?/0 0 W0 G0 ,5<0 0LC0 004 Ϡ΃`/ -LM, ,P@, 0p0Q"0$ `,0 V` e0e\0 40 40@44 ; :,0Œ8 Mʟ0p:0 , ,00CPʟ+0! * 0`e<` ;pʟ1 <0P0 `$5S@8Lp 0T0T0 1X0 PX00\0 0\0/>`$5SYڴ 0|(/`010Ch0 h000h0h0$%10l0 @0`| /l01d0 )d 0R<ʸ 0,0\ 0,p8.!Q0σ\00>00c 8p W 00C 0pd(@`0xQW%00PUDh% *l 1 D, '&0000| u66 ƟRT000T000@|0嬠  EP`[0 ;0p 7PeM<@6Pp Ri  C00050 80 Y0 (00(0%540( 0l ( 048@Pp- | `!40040\%4800` \@4 45.!Q0σ`004>00c 4  P $00$044 80<0 SlP 8@4 R`0 \0$%R L$?>l 1 D, 4$0000| ß3 RT000T000@|0嬠  P`0 0p |PePT3Pp R  000 3< 800 S<Y#0i14  4 "2.!Q0σ`00>0 0c x2 <$0 Y0$0L0$%R0<0 plp h@\P@" \ !0$%\ 10 10S1p p0W\ 0$%\ 10 1tt!0 00T1T0$ <08!00 001 0008,0 0 0@ dP0oU X@@@V X@@@ 0|/`01d0@]%EdddU 0d  -LA^ p t00 000 R6Pp04WP㌠(p`͇L|0P` 0O;h0d4 ND400 pt_4d`D41 D,  00C0 00C0"00C0 000000|2 0000| D2<2 RT000T00C0@|0 4 40 P`0 0p PeP1 pRU 0400C0@, 00R> 4@P180 0` @80 0` 80$ 0` $ 800`4  4 08 P ?Q>`0 0?>0 0c0@8 T0 d 04<X@@@ h?ddU @Xd -LMpQl0A d  al1 RO 00C 0@0S\0000 10 d0 l 00C000C0P`,0W**0 0 0$@x`0d C0XKB$PE 0x m00 6) J FddU d؉ -0LM`pQ  X0X07!hF<0@ L 0P@P " __`d -0LM`\0p l0 P X0XN0P+P ,0007 h  $u ___d` -8L0@S%4 \ p 0S0 #Q00 L0 R0S  < -8L0@S! $ d @ d d d 000 10B0  2 R0  00 QT -8L0@S!м ,  , , , ļ 000 10B0  2 R0  00 p -L M@H K0s4 A[TP s@TP@ht@x -LMP@勾p1儑儡`px!pP@4 "P-긾 ؾ ؾ ؾ ؾ ؾ ؾ ؾ ؾ ؾ ؾ ؾ ؾ ؾ ؾ ؾ ؾ ؾ ؾ ؾ ؾ ؾ ̾ ؾ ؾ ؾ ؾ ؾ ؾ ؾ ؾ 0`0``p0 PbUA20Sh0`X0W 0 ReddddT dd -$bp0LS2 R2 pRpW "PPq С#P@c #0B SPh h h h L h h } 0l0S@ bP $ 0S P a   0S R R 0 R P @P 0Sb@[<0S0S@ "P #WE<0S  ddddذd0x -LpMP@T `K8P 0 R !<0S  @0S@: S! p0S : S 0 R !P }@P 0Sd P (0 R dd0dd -LM쁟0Q@(0 Pp`i 0: S (0 S (参 0S f  /p` K!p 1 S!3 |PpE 8@ IP B P ?0  |0  ,P % P0  P  P| MKwP   (0d -LM@`P  Vp@0V U@0 @ PPU`VUU -1L$M℁PUp$ `Sd1 R 0: S P$0 S $$ρ4K@+[ Q003 Kp@`D00CS00Ӥ0 PpP @00CS00Ӥ0 PpYU00yU?< ,d(d  p-LMP`P @@P0/S+ /eBP0.S P0S@p0S .S0S`V d 00 Q P0S0P,!   @@P0/S d, -0L '}밫L -LHM0`@/BH#P0000gP S0p0 p fP2p tP "0Sa@a T@DpTW :Pz0S2Cb 0|"S00QS 5PP?0S. 6[8c8Ph0 0d0 hK0S [kPn0S 8 lK qd 0hKPl0 R 0S 0i\@Kt PI90S0S`0=`0K 0 Al0 P0 Sl  l?P@@:p0p0 Pwok0DShtPphPhp(D0 TLdxHlT  mm8@0ȋ!܋`!ذ 0-LM0@P R/ AR@ < 0 ,00CS00  ä0 $@ 0d@<4@0( ,0D@<0 $. $A0hv<0l4Tt -RLM@p 0S   [<Tc W@` 0S] |Q<0 CR P00 R%  B02? X 0, CR 100  \ `0 CR 00  \ R@0> CR 000Ri0 Rd \0R R R0RTs\sl -40L R(0$0$   \}d 0-LPv@y8P P  @00d d - LԌ -L\Ԍ -LMhq0S \\ÛPPL gx@!PD 4a@HP!@0P P00FP@ @3 0 0@@Pp@K;0$!  P 0CP 0;C 0 0d@d @7ˠ$0K $ @/8#}ldd -0LS \|0H0  00S_\-\0S , p-LCM``GOK0PL  80 Y 0S ~p(DL -LM$@0 S A00T 0-D0L R 4410P@@7T00Xh 0-LBMdP0FOK\0 P 04 0S 9~0(\dl p-LM`@K,0 PCUphd p-BMLM`0<@KP0 B<0[ES FS AS ' R0r S00x;K_0 S X}pCNK@D@D 0<0[FS 0  (xذ -$0LM K YP [d p-QLMP`@00H@ph0PE S U@00p鸍 -LM`P0ဋᨋh!pXq mP pP P@(@ Hx!0AT3 T`7 @P0/S Z  1P0S@!`P X:Ep`:  @@P0/S Q@  l{lT 0 -LpM`@pK.7@W6 00RPPAYP0: S/0U0 0 XE60S U P :60S  9:+ذ0 -0L >{밫 -\@LM80(0( 0{{{{{ -LM` 2P( S l  Q Qq00  R( \ 0S#S 0P00 `  (0pPpp(Ȉ0S 0H00S (S 0S(0 t0W0 S񟗮 @ < 0 l d D , (0\(   Q Qq00  R( 0000((0\(   Q Qq00  R( 0;S`( \ oSf  ,da(0\(   Q Qq00  R( 0\S  G(\(   Q Qq00  R( 0S: * D((0\(   Q Qq00  R( (0`S0Z00 0Px(0\( h  Q Qq00  R( 0S 0(0;Sp  ( Kw (0\(   Q Qq00  R(  ( K\ 0S (0\( D  Q Qq00  R( , 8k(0\(   Q( Qq00  R( 0S  3 @T00u#(pnj4L( 0phe`d(( ( 0\SS. (~P(  L( ( 2P(   Q Qq00  R( 0;S /.(|)(0 ( P(   Q Qq00  R( 0;S S ( pIQD>(*(YP( p4  Q Qq00  R( 0,S00\(   Q Qq00  R( w(%P( pd  Q Qq00  R( Z l0i`lp܎ p(4D{ ذPdď(< 0-LM P@U W \UXQ UM  0S 0[S: \S1 0\S \R 0S 0 0 0S000 00\S  0S  0\S0nS 00  0[S KP@ ($0\$Q@-@000^S00]S00 R ]R0 0[S \S 0 R ]R00]S 0nS 00.^ =^:^00 ]P P 0]S0PP -LMMpNK @D0@D` 0 BPU 0 K0S0 t U P T0S5 0S 0 iy ({ -L M@X, 02 ,0 p1 100 ,0 0;P0S4P  \S  RE ZQ@D0S4 0bp00 g R AP\0 00 CP \00, 0 S0`B 0V, 0S`:\Q&Q\00 S SP+ 4  0bp@, 0{1qА ( -LMr ` 0 ( P0 (PpŸ  Q Qq00  R( 0gS} 09S,1SUK A A dpP@P@(S S (0(8 0 S  x;SpSF wSP( <  Q Qq00  R( 0NK @D@DS  S ( 0(0S0R0 20PU ( p {1] 0tydu00U0P0h((T|ԑ{ ذ -MLMh P( 0\SSN ~KpGpGPP(A jK$`FP@ `FPP5 0Q Qq0  00SP@T 000S0S   0S(0 S H(w8,( ,X -ML MD!D0 ,0 낮KJp`J  P@Q ' Q Qq00  R ^ \R 0 R0hQ` 0f Sʉ kp00w@0 ,0S <,gw 0S S( 0-LM0@9SP$0S$S /S  0P@  00Dt 000 K! \S@В R-`L@ ( 0pS S ;S p0 0 0 S S ;SR 0gPV@ @3 \20pS S 8p0 0 0 S S00  p-PLM@P& `0a0CS $                  $       h 000@Tp 0S0 C0S40 2q {  - P LR` 2P R 01@pT 0S @Tm0@00` 00 P 4y8 p-LM PR` 2P RT0 AT 0S @Tp0 P0 0p4y -\pL`AT 0S<P pU@`V0 `4yP - rLMP@`!p?@H /P< d p 1`1`^ 0t00 0AQ0S 0S|0jpP.P n@l{{{T {l -錂LpP0xSM @:S=d0SX20 #R. @U<ŸPE$ R R 0 0  00 0 0 0 0Q00 00 00 00nS1  paP X1 0S7 S Ha LP@  00t@ 0Q 0#S0nS0@0 RP0 @0  | 9d0P@ 0X 00h(. 0 0%8{8{`{{4{<{{ذ -LMb0S!lRhPdr 0SX2X0{ 00CS0r2  p0 :0S 00,Ka0@ @C,  02!刁000 00CS0 0Ӥ0,pXqHQ$Ԁ0S P R" 0pW ` 0@ ,0 S0 ,pT)0S3 PI)PJK(@DP@D *04\ 40 B0{({l{Ĕ -LMr0@s `PR |R0VQPq`20  00SG \PD 0, CR 600`0S0$ CR "0000CS00  ä00@(0S ( \0R0R P(0\ CR #00夼P 0 C0 b\ 00`0\ P+`0Rt$)`vdP fL$ KP2[S<00ZDlԔxht@ -PLM؀`pP@) T 0 S R@D @00U00  0 !P P #D <0S1{{{ -LMP, Up & &U0 \Ud 0SDb p9  0r1 P`0@0S*,0   000PU@0S*00K@ 0@ @K @ 00s0s\U @0S*P000K@ 0@ 0&S\SPq(00  00S00@{ -LM@P P`p W00 k 0 0  N P0-L@P 0wS! sS @T0 p P 0 0^'@0 d[{Sp P00E'' 0Cذa00 0-PLP @hT000 0-LPChP@0 0R0 @@0G  0-SL@p  P`hP@4 U@@V@G h P @\0000Q00;h -L,MS @D ||#kp LP ?PPP4#0SA $G冈H 僈L Q 0S 0S"0S P0 "PPe偽2p D y2`b`" @ 82@ $2$ ; 00 , G00 080 4 5G`0 000+Y008 8 00U0 10S@ 1 020 0X ,(xP@! 0 40S Ql+Y Q 0 A= 0 e@=ll@40S`l+Y Q 0 A= 0 eP@O=el8,l@̡|h08 -pDaL MP44!dp dP ?P aPtP`` 0PX(PKxxP@ 0 00 q01w wP@p 0L 000S W0@L̡| p-LM0@SP P `K 0o5PP 0 RPPSpw?P -PL@`p dp nP ?P lP`pP` zPPPP 0P cFPp \F0PpS@` -L@pPPP0S.?` c?P 0P D0 SU0S D ꐦh@` -tLPMB^p`L  0@ P @$l0 @ PH -LM@pTP 0-S c@#cp lP ?PsPwPpP>`W00S!0(R00S k>Xd R $@K`P $0ASA2 A$ R20S`#?1S2 R hBxR` R PdBd`VZX ? ?0D,0  P5?BQc U`, (` ,pKPB0 R,0 PPV`U ,@0!@dʹWpp@R 0%S# $K2`P $p`P`AT嬧 >>CP  0p00  00S& @ wPp6 P`7d寱P`2 @@``Hlhdhgfff7 ذ H 0-@0PTL 0Qlb@@0( -XRLMP"@gb?P 0A`V PU / 0S ݃0S =1 LPl 0S0@  $0 S  1SqQ0S 10Sl{= @P@$b?0P0P00S` 0+0 0K@KKV0?0 0K00K?V00~0@ ;0 QR~ K60P@@ RV  0# @, 00c=(@`8P(l -PL@p` ap lP ?PmPp`t 0P0 PPP =㓰0P0 B0PPS@Ȧ0fP p-0LM` P@a?P 0AT K02\0 S0 1 !0l p$<p<@`\p -LM0@P,0 #Jap ?P SPP,0 S ,b3 AT #0 P 00LS!00LS0B \L 8k<2p0\ p]  Qf` XIP@PR  Q8 P3 0X0C SC B B B B B B B B B B B B B B C B B B B B B B C B B C B B C B C C PI PQP'SP0-V +V ,Q@ 姯P \ \ =V1h0l唯P 0a0CSD D D D D D D D D D D D D D D D D D D D D Ispmk@hpU @@K`Pp 0 0=00 b200P B\,0000D<<<3(@Htl p-(QLM !@;`?P< 0aV< 0 0K.P( 0Q0 R 00 0 S   0S  0!XPp PV;P< (L;p֤p@`ذ8 0-PLM @_?P 0PPKPKZ@P 0S@0 SR R 0@` -PL4M0p @P0 TP XP $ _p, rP' ?P pPLK<PX L:sP uP`PX  L K$<PX L <:0T0 0P0 0!R40*X{;$Xc?@fP` 00XPT0Sc 0 00 , 0 00R080 4 x 4`u U 0S C0 P0ŵU u 0  $0S"tP0;0 T0S H00c RHKrZpP800c R8KhZ`Y U u P2 P$ R X P qOX2 KRP0\U00Su US 0"0  40VG 0S 00{0`71 R,4 !}P# 0S>dT0S Xu XuX;\00 000D7D<d  0~d U0S4V  V 00S`FV 0V0 R ePF\`0  @0 < Y@0p0H0 D 4X:@%Hħ0 0-lPLh @k^0?S L01M0< 1 00S(0( 0hW0@`D p-ALM!PE^?P4 0P@ P 0SPU @Zp: _:rP``V 0-S PprP@P s0S,^9p0S`@`HԧD p-ALM P]?P`p0AT K=[P 0 ! 0 rR @0S W`W?P00`h0 R 00C8S` RV 0  8@`p p-@AL M8!P]?P`E 0AT00  K[P: Q40 R 08SS#  R 08SQ 0S 000 0 at80bPV L08pQ 0`008p@` 4s p-LM 0S@`)p KYP'0S !0P@PB VX0S0eC10C0@0S0$0 R0ppD -LM`p ]p fP ?PvPpp 0AT W yP0 [ Q@~@T 58_)P@ħ -LM\` PW  u`ONFd`@@ePX OD%BddW_N( FVe $P @)e hH -LPM@lPK`ᄀdK 0hp 0 0 0U -LM`SK@P VlKK0S@ #3````0SS?KS?K0C0C0`"S?K0C`VK@4KbQK_m 0h  l0R=9B\! =C ` \1 `! 0` d 0Rd! =9B@Kh ZK KP T1XbL1Pc=9 A =X T X! T1 PVK0 A0@.U A 0@#U A 0@lSahX 0 P< 0  40  =Ch! d1 h0  cl0Rc=9 =\! \1  A0` `! \10`! S \1 =9C`! =C `! \1 Ũ `0 cd0Rcd! =9 Ah =h! < d1 d1h!0 SKZKh! d1 w=9C p|?BU0@8@HT\ -LMRU@1 14 1簡P11P @T<080  4`(y -LR  ì/` P 00U0S0  'P "P `P =P :P PEU0\\S @T0 'P "P `P =P :P \P0 @0S0XE Q  p00  RAQpP P U0/S QQpppePH< -LMp`@(K 0 {0P(0 U(0Sl,0K  P X(00,00 0 (0Sw dy Q-L`p90  Lp0PS@   \R% [Q*Q ?Q $Q 0(S /Rp RQ0~S  *00W 4删P  0S@D p-PLM`P@^TQ 0RQ@Tpp -@TLP`@p8p@PTh]Z -QLM@% T! AP0Q/S P /S @P0/S0S1d0/S@P0/S 0 -L M0K` d d 0pS  NP P0hU`5*00L@ @dDA A0@P0 -L$M@ @D 2  000 , H 00T0`80 4 V :4@废Ppc W 80  cRP8KK@V*0 R 0PU0:/00H0 80 cR8KK@H D墲@B4 \ 0BDACTP`0<0 < KLP@ 1 1 P@T10 R` W4,|Q  J<0S 0l@p -@LPpm+n`T@X00V00S,0S &P 0SD@P`d@@VLP -L2LM@"<2<4"42@,@ 2"2pb p2",K@@00@/C,P1 `!1eNp1!aP@C^ 1!T10n 0cCP@00pQ2 P7`1 R p|@!0@ 4@,01 06S 1 !pp 0`1` P P P0@P L <0cL8d=I ||||||x<|@|(|H|}}L|} |0|$|,|D|P|И4|8| 0-PLM P@0 K Br0K  PKH00Cs00 4| -LD0S 00 P P }T| -|p|0L@ R``P* `  0 0 0  | || -`嬠L@PpP0 @ @ 0 pS030#00W 00P0Uu0U|$|<|| | -L -T0T LM0 Q<@ P` >@ ||4| -D0D L0\0 P ( ||4| P-L`N \ RT LR0S0f0QE$@F0t0f0Pp F@Dtp 䀟 ` N00H0 0 c@BTT@@DtP @Dtu@ @Dt00X0 0PPu0UH||| |(|,|<| -L -L -LZ 00| -LNy - 1 LP@8 `00Cs0䠟p- P P r0 0  R0_S $S@@PP P  q00 0  R_S $S@@00Cs0SW||4| -1L @\7 `00Cs0ࠟp- \  r0 0  R0_S $S@P\ q00 0 R_S $S@00Cs0 ||4| p-0LM@P: 00P:p0@ph`P0`P* 0B0R0T:pp00U0T|0|| -LM@@t @Dt 0-@PPL 0PS0 P0 p(0  0 P00 -hP@L`f P Lp0T*0V  0S 0T*0V $|| - PLM@ pH 0 0  R ^wT@?hrhh -D0D 0L0Q0 P`0TY||4| -D0D 0L0S0 P0<A||4| -p0 @L `P00Cs0 U0 T  @R 00Cs0(0}P@||4|| 0-0PL@00Cs0 tϠ Qd0AQ 00S 0S0@0Cs00|4||| - L 0   | -$0L; 鼟 -0L?逡 -0L6 - 0L0@*4|@| - 0L04|@| -D0L R80000 ,00@8|4| -0P LU:0` pUhh0P0@  `Ϛ l0 尝\ \0 0Rh?h"ꀡ||@| ||<||-000 0 0 bL1C 00O갡@|D|000 0Q 0 R M||8| -LCM`0JK $0 @ PTJ P/,1 P0' )S S1 S (0KU*0T0`pP@ g0^S@ (@T$0 S `$MU 00eU@  (P||\l -pQL@@0 @dT` :%PP 0@DT*d0 XD0@@0@^S@D~ @|| 0- L^RP@ \P00d0Ŝ mP0 -p0xP @L@b\`00=D0 <0 40,0 !||||<||H| -0L-| -0L$| -L -p0LMqP 0  0Ra a1 0@0b!0C01R0 RሑF PU"x 0@S0P0cPcT<0 0CR& 0R 0R>P*Pt @DtP@0T 00t0T 0R P

R0@D?R0 00p\0 T 00 0S< ^00,P@0 ?00 00{{ P0-L@P T j$|0 0h S`0 ! XT0hX$H0<R$40 K$꤮P|ИT|lL0H -LM∢pQ, S d,@01Q 0H 0@:T!$Pj a ,dP00S SYT 0S@ WG@01 R;0@:T;T 01  lX#00 RPq 00@ ,0T1 ?> 1 @  ?>1 @ p 0P P B@, < ,Pd00@TTPUX~WT$ #P|ИlT|X||̮ p-LM<_8!00( k$A 0 PP Ġ00 PPUP` 0P4GU  D@PĠ 0PPU㱃P@ DqP80  p,hP|D|P|T|c@-?>,1@LQ 00X|P| -LM@Q  Q Q Q Q$ h0 |H| p-LMP` R @0@0R@PcPbsS@ptH|| -L0Qh0 YH|| - LM0 0 p` P0@@cP0 PPᛘt 00p 0>L0L H0@ @0@p`E⅘ T T| |||| -Ls -Lk -Lc -L[ -LS -LK -LC p-0L$M` 0K K$K a0a(@K @@PP 0@ 0K @T$0$0P 0S@@TPph|||| d -h1L M`` 0(K n0n4@K0K,K @P@P? X04 ^00,0KpCfP00T0S`T XU U 04 fP00  0R/S \P(0K+00( e PF|||d| -\0\X0X T0L0 L08\000 5 h((|$|0||||<|0P -T L0LS00P0 S  0S0P} p- P PP0PLM`0 0@R 0 R R00CRphp0DS 4 4 4 00C000,|(| | p-LM@,`PP 0S 0U p$| 0-L@Pp0p0  0!0S 00@C_ 0 00000t0 @P8|4| -LMPp0` ` K"`8@T 0 0@0@ ET چ`|| ||| p-1LM `Vr 1 RPC0S S S "S 'SP0S0C00 R R R "R 'RP0S S S "S 'S00S0C0`@0S S S "S 'SP00@y@p^P@U0Օ 0  R R "R 'RPEU  R R "R 'R0u0 S S "S 'S OP8|4|ULC -,2,B L^P r00Cs0e b^  q00 0  R_S $S0^ LUT  r0 0  R Qp!B00X0^2  r0 0  R0_S $S#UU r0 0  R Q 00000 r0 0  R Q 00Cs0R000 r0 0  R Q D||4|  -LMtQlh0h @ PT *Tp0Q`iTP*0U@00<||||0| -tt`0@0LpO2@@PP}+ P4pz0mM4 -LM0@S`p) P$ ( +*(0  (0 P (PK x0S( 0Q *00 $0 `(0 $ @`DA A@ @ $ ( ` $ (  p-L Ml`0P0@0 $K 0 $0 9$ K 0B #1P Pp` p-L M`0@0P 0$K0 $ $ K 0B C1<@ S@  @ p` -PL`M@ ` `   /0S 0S0S @0  00 , |00p(0p 80 4 P@ Lp p p p  `K 800c R8K=PW񟗩괼 H D H ` V񟗜 8 H d 0 X l x X P l | `X 00 "" " V  R X V X 08.0004, `8@[0T. @0T* @(0V0 0 0  00 , 004 080 PL=@` DA A0@0@0@0T * 00   < @`DA A0@0@+ 40 0c0 0C Vm Q 0 R00S 0S,0[W 剐Q   l!0F]Sh< h h h h h h h h h  < h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h < h < h h h h h h h h h h h h h h h h h h h h h h h h h h h h h  h  @   0   0 00S 0  0 0 0 `0S0000 > S<   0 0  00 @ {V @ 0000W(  0 8K KP ^P 0 UPuX p=40UdP  @0T*  0@8@` DA A0@0@hr0`0  `   $00(   0 S 8  b R8K <P00 0S )00 HKPp 壏  000  $00(   0S 8  b R8K;P00 0S )006 0 | dK@K 0g000 I^0@S 8  b R8Kڨ;0P00S00  00@0 @ KHK 0KPp~ WX  PJ ([ 3[0cഠ00@ 0 R00#0C S-                           00 ?00A `@0  (CXUl4p:Z C0  0A 0  00#0CSO 00)  000p 40Pw]  H R000 0p 40Pk"@U 0 ]R]0p00 0 40@U K e  X 0 ` t0|`0 r)` np H0`VH0 f R 3[SD0 RD0 H p00C0 1`VQ 3[S ` RD 3[S0p0 >QA ` :D  0SC' D 0`0V V    0Svv  D C3[SpL0D\F `A 6F`pN 40 U B GH0`VH0 `Pク ,] ꈡH ذtD@D@ Y@P08 @WPL -L MPpQs 0#S  `P@@:T 0ş00 `@ 0`S VPT`0@@T*TQ%XJ K#XG (5  0S8  @T000@ ğ0 @" 0 R +X 4 R 4R 00 @T+X li@-X=X ?X @4R44@T0@@Z0=X[P 0@S*S0]S =X Z[@00  #0HS                          2 0,0 0 4 DbZP 0/Z40 0`CA 2020@S@@^,0\ *000 4  @0@S000MŸ  10,0 0 4 4,0\* @ 4 |[0 @` DA A@,@ 4 0 0 T`V T0S@`@@T 0`SFP[hP 0@S*S0]S( @T*T0 @ T00Q00S V 00 W80k80Z#[l0`P`&@aZL0 0`S`Z Z H`@ -d1LM`p+DQ``@NP`@ 0S $K $!A@CP P  ) |2V200@0 R0PU 0S 00S 00`@P@P,0 UXtx -L@P᲋@%Tp? #T U@` ):P`T`T TU@ :P@T0e  m7P@:p`p 9P`DT*P@: 9P@DT* p-LM 0CP`CA)P @0T *00: TpX0 @`DA 3A0@@0@`Adph;  -0LMpH`C V,004 80 R ,0T80 80 +V,004 80 R,0 v,0,0P , ,0S ,0 R,0 8 80 R ,0 , ,0S ,0 R 80  @T -5P80080 8 0S,00"4 004ʋ@T@ 4  uPsTn040 ,0$, 0 S00P0#S ,004 ,0 Rz ,0 P,0,0  00,00,0,^,0Y,0 @EY8 L1,0, 8 s?0S,8IEd Kp㯕P#0aP@Q<#0S 0SHSX0 @Y0 @S``K`P-BP\0P0P .dK yx2 0000 000 ,0e`0\ 0 00 0\ P  `[dK N040 4 1V 0S0  Q@@ 0@ 1, @@p1,,  AE8 00 4 1# R 80 R 80 Rc 80k`][SmTP  ?8 1S p880!1P00>8 @1Sx;,8KyK/gI{ Pܡ 4 \d`D@0dhذ -L,MH, \00 p4 L H  0S 0@S \ |<mV kT,0`S ,0 R V 0S ,0S ,0   D 8@ RD00D0  1S4 `0 7# RP Tq 0ǟ0 ^7 0o>0 0 R^ D 0`#VL@Q D0@ 0J 0!RPU7 ,0S 6 R /㻄P0H, , 00CS ,  |   | ,4 0044 |6 ./, 0@3,0 R,0 R @ ,0vz00 ~040 0,0 0-PNH P 0, , 0 @@ ,0  00x5 p0S 0@SLUD0 ,0  ağ#080 , ,0#20#0 ,< ,0<0 00kP@> @48|$,,#0< <00, 0< S 0DS d d t t 44 4 c. 0\.a,0 , 00, 000,,0 3P,00 3@  00 0@(_y, 0T F,0  ,0 R  : ,0y.B\ 00 2,  0 p00 0S B @JJ <$T,0 R X0T9PQbR$ =PV ,0S ,0 R ], 00D L0 W ,0 0H0 1RB ,0! Q5 ,0! Q7@R4||!W4pP@ p*TH  0 R H 01` Q H0, ,0S ,0 R 0` n0S00p000 PU  , ,0S,P |6눡L@dh@Dȡ0(<4l}0pZ Y 4& @d p-LMP`PQP@ 0ST 0S`@0 0@x0 $ 0 0@Ȱ԰ 0-L@F 0FPP$ 0h : -0LMp@`T P FP L 0V0R00S@R F 0 0  -LPp`EF  @0;` 000W FM0  0S;0FV0 0N p-LM@`P0=S\ *SZ +SZ@F F 0 ` p -LM`pE2/PP` @0T00SK 0 H PTF 0S 0 U @' TL2L2@ 0P ,2U( .0 00 OP2P 0 PQ000Y @ @ Q0000 !F0P9U&10T00S 0 PU10T00SPPU00S U EPP 0 だP 00000 0 PP 0`DOVPX0P 0 c0 E@Rꈡ<<}|4` p-L M PK`pEFP@  V 0 /R 0(00 0Kp| -LpMPK`@PpP@U WV 0Sp : S  S pp@Ip -SLM0@< /0P < P  ׃H1  000 , 00PT080 4 4 :4@ӀpW7 `eW 80 0c S8K-@ @Г/0080  cR8KP-@  <4 zP 0SPU4,4`, 酃p -x0tp00lL @`0PP50D01 @600000ġ@ -LM0X pP `ᐣ $ Q jP+i$n x.dnL $"2 RpGp W00W030"Ssn Y "Y  0S  S0 0 R00ꈡ@Ȳt}0lL8Ppг -`LVP |p 9xP@  0S@00T 0P0DP@!@t}l -QLM@< @0 W zD <z\1  000 , ߼00p0@80 4 ui`g0PP 0*8K @\0S 800c S4$@D0 @p< @Z0z80`P cR8K$@P Њ4, `௼r0#Գ p-LMPK`@&P* P1 000c0 P*U OppPU )pVP pp0dP?SX0 b@@0@ P 0pt} -H0H 0 SL4:QSC  -,0,  LQ p-h0LM`@ XPRT`: 0DRC 0/00C0 p逡t}T|0d}0h}@-T0T @0aC P  /4 00 $ $0@h}d} -LMЀpPQ@Pl`yEQT00? @AT, :0TZ,  ]hP 0 AT:0T00cC/hP ꀡ -X0LMP 0 cBAB P0 P @ P   P-Lx@0lpPh 0af0lCQT a8 j1@0[P | p-0LM @R! 0S`0PSpphpٛX0XPPaH08 <0 B PP`vPpp}l}\}t}`}| -LM8@04S} $0}/ 0 @ ꀡ| 0 -LP@;" `vP000 RTpP@01Q*`P010CQ*00 010CQ:|\}  -1L M R!001CD밁P !-@~Pa) 0`QPG : 0鵇p@ 0S c"0SQ(pA60 P SPI0 h B: 0҇pP o{ꈡp}t}$l}| \}`} Aq  Rh- - - - - - 0S Aq 0S     -GML M,q,1IKL 0 $ 4 @HPP" P 쀟BnK`F0 .-}P@ 1P$Ͱ4P ኚ$0 S h$'\0IKA⾝P$r( $l}08\}@-@@ P0S @ P0S P ^ @ P0l0c0 -RPpLM@` PER 0 ,0 0 0 0 0 0S  U@PE0S0 0Q : 0FS   ` e0 l0 h0 d0 `p p-d0LM\@00cC1@QP 0`Qa0(S{ pg| -LMl`4 㰊0 㡆DP@P+ n0 8 p`8p`  0䠟S8   400C0X000 `Я@F̠F00K FD00K/K.K-@K,`Ků4v 4 ⾯ 0V@00Z\}`}t} -LM@Ng00\} - L 囯PX --LMT0T @0S4.*Po }- s,@ --,@L^ l- b,*@ --LM0 @0 S)0 |0 R   h0  0L0L 4R$ 8- .,,@ġ005 --L@<<, ,-$ ,)TD@ P0-L@ 0P PP |0x-S ,T T@Q  R 0<S08, 000PBsP 갡ȡ@05X --,0L \,y)x}@ --00L R   ,d -LpM|K⺛Pt0: S  -H@LM '0 '0@D ' 0 x} 0-LPP@00 S U| p- PLM` @P pޒPPV(0 S | P0-@L@P UT  0h 0(@ -LM@SyP0뜴 -LM@h p-LMPq 1@ 0 00S  R pP0S T00ppho0`@pP 0%0P00S %10P00S00P00S T 4 P0000ppT0ܴ 0     d -LM,@0SP }00d -LM4@ P0SR i00d -LM$@0SP Y00d$0 0PQ 00d  P0-Lp@ h@0S 0SP6000,PP.00P(00d -0LM`0V`P{t@@gpP,@d  0Pp+P &$0  00鴡08$ -1QL@P` @ހ0Ǡ) n8Vpp 0S00 i&0 S 0S `P@†0 0 0N8@TZ0S40 Rh=hi}\ȦDX }Hd -\1LM@`THQHqH 8Q8q8 0R @TV 0R 0S00i;@Q06Є 0S S0 0S 0S0R`P 0SP }$\h -LMRQ$ 0"Sxrxb@ hrhb@ 7@TZ 0S i= 0# @TZ73=0QS 1 R R @qa@ 7@TZ0S aA0S 㳼PpP `1 00P P8i0Y;f 0 O1f 00{0P0S  L7@刄 R0R ,ft l00"fP b00ꈡ}dHhh}\lܵ< -L Mp4 0  x, Kro` LDP @$0``0($00 :PbP@ 0#SUP3 RTPPU @0S @Q 0@0 3 RT  40S '30030 4$U3C ,K     8 000  0S  )0`V (`V +(%" K,K ~0S  @b@R@ k6@TZ0S@ @2!@@@ @@G<50,T 0S C6 ?6_wP@  NᡔVL1f݆81 K(1 ` A 0,  0(  00008 P0P 0`` |m,K Y~h\}|}h}d@\ddHt}|h$xĶ -LM@K @3~8 R +~000"\} 0-LMPK ~x0p\ 0d 0 P  ~}0 @}0\}ܶ -L M$`K@  }pTpP, (KP 0PS  @ }T0d0 } }( R p0!h`0\ @0 0S \ 0S\\$Pذ} -L M$pK` P}(KP@$  R 0S (P |}c hNUU  b}(0! 8\ذP -L M, KDM}0K PPP 0S X0@ pT `0ŸS0``pS" @T$W0 0qX 0SB0S  z0S pB hPW00H0 U00 0S X 2 R0">0,K | ㏁PkX`A00 R  0S AQZP ,K |3c X H*c 0,1!G0  ,K|0c0 h 0 } /0< )}9K,K |lc,K |T00 !H\$`h}h}(}4PlxPذ 0-0@ LR# P0\$ 0S 0S0Q RT p0phTd  0X00\ 0S@ 0S@}$HPX` 0-LMPK@ |80@0S 0@S |0\} -L M,K`PD p|V`pUF 0KP@3 X XT ,40#00 V  @  00CS0<0U@T@T 0 t@T  { {000!(@\}Pذ -LM pK` {@T P0S 0@  00CS0<0@T@T 0 H@T0k" {{}\@ķ -LM@K 8h{00 \000^{ 0\}} -LMQ@P 0= S< 06 @`쀟40 0Qp@Q Q 0  T  0R@QT t3 0R0   0S 8)@,i$$}}}}}̷Է00 000S  0S$4 0S000c}$ -LMP00좟000 SQr`j0 SV Q  Q  00. 00 R} `2 Ry 0Sv QDbj @B5PY 0SN P 0S? "1 0S0;004 S 0S# ( 1 1`@ 0S Q !|f! Q 0S V PP 412  00S0  } 0  <w}`0 `P0h;0l`0P@j 0`00@0000@00Za Q_Mꈡء}h}l|p@H  -LM0` V 2 0S{ `VpKᤲ뼠K  PPhڸpKᘲ`V 0@T 0S @T`VH q}V (0\Q=9A =C 0(l0c (( Q=9 =p 0( 0b @(( Q  =9A =C0d0  ch  Q=9b @ =  0H /}00 0S0 0SS0000000 }$?B} p-LM P 00S QT 0PS4 0S 0 S0000 00CS A0Sa 8 R 0RS  @ a 0S0 * 0SD 0S$ 00S D1 R 0S 0S RA & C 0 0S 00S p 0S 0 U  ,00 000ppphP00CS000$phd}ķ}}4@ -L`\MD0V ,0 x 0 #@003# Q Yt +0 0Y 0-0p0 0PU5 0@S] _ _ $` lK@ ;iV 00Ul t "Va VR tŸTp"p Q0l KPx "U 0S UxQ1 ,0S ,"0 SVt  V  PU 0S0 S t\h10i"x 0P@LDT^"l0[S (!T100l Kx` Q" L" p0F"V 0SlK~ lK@ C"{0l0Kx @VT0 SS 02f 0lK2a R4P x X"(}dpx0`hdĸ̸ԸH` -8#0L` %^0?Sab b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b b 0b b b Pb Pb Pb Pb Pb Pb Pb Pb Pb Pb b b b b b c 2P Z0010S P C41 @T 0S @Tjp1@PT 0 YPX@TX Z 001@T 0PU pVYP XPU@TZ 00Q003p @T 40S 0S @T@T 0S S @TZ0H} -p LP00 X R 0S R 0SRl`}}| -L,,0@ S00 N }|0SS 0SSS  000Q  0Q0 0  ` 0ST 00C0H0H < P000P00}}$}}}}- RR  RRR00Q00Q <R 0S  R 0S } p-LM0@`TP 0S@TpPP -/LM0尟,0  ?@ 0@ t2 |" 0K/KH" 2 x pB 岫|20 2 ϟ? @p@嚯K`!200`d"  `` P\P ,ϟ 0S  X X #X  0 0 0.0S 2   hb  P\P Ο0S00 X V V0D.020c RKp Vi lk r $y py y y { { | @} } P~ = R 010!X00Sx P\P ͟0S0P0 PUf U00 UPM!UH u ,00 P -U u ,00 PF u,00 @KQ PK P\P ̟ 0PS  U PU U U  U  P-0KT:"0R0 KGP; AT 0 !R 0$000 8 H [X @X*X~ ?X+X{ !Xy 'Xe P"X? \X \X$X   - P\P D˟0S00  (X {XJ [000@* 00X  " b RKp P\P ʟ 0S  00   00X    20c RKp00X  @00 00$0000K p P\P ɟ0S00 :X %X#Xf 2 Z 0`0 K W 2 Z 0 K    P\P ȟ0S00 i  P\P ȟ0S00 Y (X & 2 Z 0 00 0`d K 2 Z  0 2`0c 0{ Kv `X2 Z 00p7 ` R< R 0S BR RB B+R ' KK  P\P ǟ0S00 $X "X 20c RKpX  \0000\X `X00" Z@ `@ K \X P\P (Ɵ0S00 X 005 2ş Z  0 K  P\P ş0S0P0 P(U 00 ` n2 Z 0 K "`X 00 7Pc)KP 0@S " b RKdp  00 R<4q0$20 00 8  K0  @ )X (X0000S0C P\P ß0S0P0  P)U0020c RKp/KZ V`>X<XBVPW U V00W00SZ x徨)X O&X+  X"t2 ,0S x,a(XT2 R P\P lŸ0S0P0 P(U  P\P Ÿ0S0P0 PU |X&UF ;X |X 1&XK;X |X0x"`?|q0FSGLAb@T *Xl (Q d~{X0A0EA0US2 " / AE'2`A2&  ]'P@ 0 0S 0S 80S 0$ @ 0, 80 `(D H}}(AE 'P@  P0R }R\  300T*X 0S0 0 0▧U0`00C >X000 P\P 0S0P0 PX< <X>U&P 000 0x姧l1E` P\P 0S0P0 P-U0 0 0&U >X00  |U00S @0<X00>X'X2 JZ H ` 00C0 K"X|2 JZ `00 K}X`2 JZ `0 K0S z z z z z (X( "X 'X @TV2 JZ `@ K p 00000)X \X  00C000"X \X0 0C'X0000C`X  " \X P\P H0S00 $X "X X\0520S\X `X2 JZ `# KZ(X000 )X00CS0 P\P (0S0P0 P)U b@P axx000( `p 2 JZ `  K\X 'X "X 0 0m2 Z   &`000 K"X \X P\P x0S00 $X "X X  \00\X `X 00` )X |X (XO 00  2 Z 00` K 0 00T}X |X (X3 00  '000 P\P  0S  CX X'00C0D p-LM0P0`0@V:`p0T:  -LM 0, !B0001 < 40 0 嚥408 0<0 @ 80,` pcP\P 1 R0P0 PUR W U p0U <00c R<K @P`S UU( P\P 0P 0R0 P U<K U$ <  b Rڼ @P<00c Rڳ @P8 0 08 @@0 `K0 00C00,}}( --hLM 00CS08 00CS0$@@ T밡`@ p-LM@<`0DSl0P B    8 $`4 ( , 0 p<004`ޤ00,(` p-LM,`,T- X 1 R$ R 00S  RXij  0S 00S 0S 00 (1  sX0001( dP  0R@ S ,0@(0c aR( (@@D0S #   $0S R;T 00S $<0 0 raꈡ4Hpܡ -0@L MTP@ T R,d-0M,_- 0, 000 < c0SH0@ , G 0 04HL -!MLM ʟ` ,  PT( X8 \ d @ 0 S\ @0S - !KLLl Yh O \ SL p\P` !P@0 XH XQ ` R$ 0 B 0d(  h8S`` 0S XQ T(8R ,0`S ,f@!P@ 8!mK `F0`F(0 w`XPXQd( h8S` ((XePh` @Q 7 R!0AVS񟗆T Ѝ T Ѝ Ѝ Ѝ Ѝ Ѝ Ѝ Ѝ Ѝ Ѝ Ѝ Ѝ Ѝ Ѝ Ѝ Ѝ Ѝ Ѝ Ѝ Ѝ T Ѝ Ѝ x Ѝ Ѝ Ѝ H Ѝ Ѝ Ѝ Ѝ Ѝ Ѝ Ѝ Ѝ Ѝ Ѝ Ѝ d Ѝ Ѝ Ѝ Ѝ ̏ Ѝ Ѝ Ѝ  Ѝ Ѝ 4 X Ѝ Ѝ p Ѝ Ѝ Ȑ Ѝ  Ѝ Ѝ Ѝ H l B^KPEpPE0K K,0L+ AD``XP@p06B^K PE0PE0&Xup6B^K PER$0#0pPE00AS00@SB^KPEPE%0 0 B^K1PEaPE0%2uplNlo<B^KPEPE`%0:4lNlb<B^KPEPE0%`}] P00{RPPU B^KPEPE0$u~KpGpG+\}\PPlNl7<B^KPEPE0 4}\@p{B^KPEPE)lqNl<B^KPEPE$$B^KPEPE+\u*+?rB^KPEPEB^KPE0KpPEd8 ,LPB^KPEpPE\0EB^K PE;KpPEd( ,C@l=Nl;B^KPEPE`#yB^KPEpPE0,B^KPEPE(.\P0p0#4B^KPEPE0*DxP qP@ B^KPEPEB^KPEpPE B^KPE pPE 0` K,0A+K0+0BB^KPE` pPE 0H2B^KPElMl;B^KPEPE"&B^KPEPE w 4\P  /\P B^KPE@PE+.\ "\Pp)+@)*_`3\P h)*+\P B^KPE~0K+KpPE,0A+B )* MP0/S)*B^KPE0PE 0B^KPEPE0 s0 S Sh`  p S \S0p)h8 d8S`00`8 (@Pp=`\`tddpȡh,+| 0X 0T -LM䡟䁟p@`P\P 1 R0P0 PV(t ȕ ܕ #U` 00``` 00c R@P000  V[U(K8P/ P(0PS  b Rڠ0@00S(x0[P\P L0 R0P0 P0 `밡H} -1LM  0((0 $ (0p000 , P`P\P 0 R0@0 Q@000c R0KKP[T@` ]T`FTV T00,$ `ݟV00} p- LM0`S0C0Px0U  Q@@T0 AQ 0p$ P@ 080}` p-0LM R 0 0P 00pphP0S`  0 0R@0 \T 0 0R0 P 00p@(0  0P 00p}} 0-8 P0@0L ? @=00 -LM0@=C0 0 a] -LtMK 0S00cS0P@$ T P0 0@TKPx0: SH K 0S 0X S `0S X ,'P 0@@}}}}0} 0-LpMP0@S|0lS`0 TK  P|0: S\0 0 00}| -LMp@:``PP :Y`PP%YP@ 0T\S T 00U0L0 R T?Y@\ D|p}| P0-L@ P@(T 唞T0叞| p-LtM@PHK08`KVP0: S`0 0 0p| 0-L@D' P(,0P-0h+Ll -LM0S ( " 0QOK0G/sq00 K'g@9&>&   @ 0@S P@1PSlg@0S P@1PS4g47 0|P& -(000[0@XPv&00  6 ! P PP @0 @*0SppƟp@P0PP T@)H(Dy&`'0@/SP< P 60S,6T  'zn@`&7(\& '0US Ue%5Q00H&0@ 0S 0PP P5P` `PP"0S"P@T $@@)4p0S d jPKP2: St 0`@S@` 00DSg#02 e0L0  娦$P0``P 0SK 0S8@T 0/%& R$P PUY00 0SH3  6p-00`%&zP  00 0@TJ 0ꮲ 0S iP@} p-PLM`0P V@᧘@P S0p 0Q0-@PL0 00h~0 p-LM0`S0 00@ 0PᒘPf0P00p p-LM<`P@1S@$TpSPp鰞 0-LM@4P,,P$ 0 0鈡 -PLNMP! Rp0PH1 `AT P$UHR?K k1VQ?K-KAQH1`PH T0P@<`0S 1<SP$U(" ꬽ Ƚh 0-L0M|P0@@Ktt0  R 0S $Q@000* 0S 0(н - qLMPP0` 5 PP* P( 0S0P00S R 0V0U00S00 U 0HSx0x 0Q$`}`@劎}}{|V 0000`QR ꈡ$` -L,MS0L0 0H S pP T W㸓 DK   pPO 40AU00#`B $?U sU00WP0P0 <#@0U @$T %T  0  koU<PP@ 2 V 21   R<V<0  L0 T 4D1S +R-R0S-RG D H R T0 SD1S  H0 T R L 0S $0S LP0S D1@S @1S``!T RDD L!Tr'D1 S 1 SD  0S0#0@0-S /P 0-S 0唐 @6@( QTl@0* PQTLT@0@S 00$T000}~ܽP  0-LM@P K%$0 S  P00 Q0 Sp 0 0-L@PP 0p -LDM耟0QP`@$0 P$0 S $0MT0pITUP!P0dP@UdpK  VhQP40p 0e( -PpLM`@*0S @T:X00 S WP*U> ?U< [U) ]U" |U )UX IyWpGY00X00S |PP X pX Y X R0!S@ R0]S@ꐯ -RPL MP@p`R *0U5#SP QT:U0S d?S^ *S 0TQ T PE0 P0PS:< S P, 1 0TPES% ,0 S Z0@00  00\ , 0Z,0XP , 0P,Q vP@QSSڿ0CS P, 0TPES,   U0@00  00U\ , 0Z,0XQE\  D0x U ;P r, 03Pk sP, PEU0  g 0@ P ,0X , 0PGZp@-@^P`D R6 R0 ^ R 00 Q00S @^0]STp0-S0S \ Rp0 \0]S[Qp0  R   R( !^` P-L@Pp`*0S @T: `)\ 0W0|\00S V  fOP``Fvꐯ1 -LM, ,0 i?B10Q , ` P@BpU<:T P @DU 00 00 P  00 U 00 6HpG@ , 0hC1 iBS, ,`   P 060  PO 0 0     -LM@`Q 1 PU$ 0Q-P0 Q -P 000#0+P0SPU00 -P  0  0 0:U?U0r ,U00;UppWj#Uh NPc :P. ;P, ,P# #P 1\ !000p01S 0!0 00! 001 p 10 R 00%1S00! ;Pp :P 0 00 P 0?00P000:S00P 0T HD0L0-SX^U0 00 H `< 0-LP0 S@5 0  0S0h0S 0\@ 'Se U 0S C  0  00SU0<0hPP0H0L -LMh4 4  , 00 @夒4q8 1cPPP@*cTX` U`V`P40ccp0S0W<0 ^ ~,@\8   00@T pNWP8o韒, 4 0, T < 0x` -QLM@ m`Pp `PP*PU e*0S \`0S0@e P8dUp:0h0 -L`p &PPZ ;0#S70@P0@ -LM @UmP 00 ImP00 p-@LMTP` ᐾTP pU OP0  P000[‘` -`<LVM`0 0 /Q40 8 , P80 0D .Qq 00pW8p  8 R 0 S:S0 0S:S0S0g0 080YS 0/S , R 0S38 0RY 0c0 0 @ cRP @ _ 0 SP/R/00040 pO @0 bRP _8 R00 4ZO0 cR@P ,o_,  P0 S/R/000.S0S/S  8 `0@-S`G /SppW @/P/R7 ^/ .^ QP R/R0 00S/S /^^  .^0/SSQ000 QP@ Q AQ0/SQ.00 /R P-Lp@` NP0 Ulp ^T X0T L0hP͐0P@@8|` -LM@N|0     噐00 K 0  P 0P/0000 ` -MLM0ܑ0c0SpP, @ PT? 0/Sb S: /KP`dU VO V> 0/ c 0 0c RPBNK ` P@Dy^@D` _P0`(K P/R P PP X@,0 S ,L0S 0.S0.S U0u/S U0.SN`0/S (  -LM@p|0`00 0,0< (p0P SP@20 P00S 0`` S`` og "kpppW@, -PLM`lp@82 T& V`0 0,0$ (` p ` P jꘀ[⇏x0\00@0P3 jP PP PPPP0 -pPLM`l@*$ T P (0S0W< 00$  `  j\ jP P PPpPPPPp -L^M\pP`@)T0㠀 0WB , 0 E 00p(Ppp PPP $0BRU@Pkplێ@ 0- 0PSL@]P toPP0 , 0, 0- 0PSL@ BP Yo 0P 0 P0 0-0L@P  0S0 0  00 0,f 0- 0PSL@ P0 , 0,娎 0- L @ 0  0 0S[ :Q0a0 /[0 P0    0h o$0 0 ꨾ -@L P 0 Sw p   0:0@ #  = S , (@0  d0d@0 0 90   0p``V  ՄPp``V@ 90 000S@ ;0 0W$ 0  _000@$00o@꼾 -LM @   0S9 / &:0  uP 0S0 0S0:00;0嫴0 00$ 0:p  间$00" о -L @\`PpK C :  W  0 0 :0  0ZQj0 ;0$ V ?SR0 e00  0Bu ? S Rp <$0070 -LMP `p* V# @T T@ '[0 `d d0V0 pX f0;-p @T  -P Lp7 WpG2 @T p) @T!  ZP @0a@T@` ZpW00 V dP  X@D  -LM @T 0S  0C 0 P 0S $  0-L@P8 50u  0 Q)  Q000  0QS 0*A0 0 00: A0 PA 00 00p  0S 8 p-LM @`A v" + 0`KS" PK  P P+0S   ;0"0 $0p  $0 0\  R 0 B `0p   Pd P0-L@P I 0h0 -LMP `pZ XS@T 0PI T@ Y0 0 d0 `dpV&]p" VQ@ \@`T`d  pPp@`TV  Y 0 0f0 露0S 0 ;0哲 00$ 0X | --LM 2 -p-PQ LP@4MH`KH 0 0  @p꨿ --L4M@@K0B  u -L`M0VPD ,0 < @  @T %T  R 0 B @0D  D @T0D |8 ,0S l,@T 0DLS L L L L L L L L $ L  , L 8 L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L D L L L @TYT A0DS 0@%0DSSk t t t p t t 0 <0<00 <0 d0D,pK< S/ p p p p  p p p p p < p p p p  p p < Q a@ @ 1!10A00R0guT @P-0+0 0(K0gC Y @Ѫ30#0 P0S X i @ = ShC @ @0@X+YD D I0S C  0  0YpIXDD 0S C0 @0 HXʨ}D00hD0 h0S C0 @0 Xj-P+P/ P- 0P 0@0S# 0C0 00 DIYpD 0xS0S 0C0 00 D p ID 960S 0C0 00 DpID $0gX0000gQ 00SN 00!10 ! g@ \pGX0x00<0倠 8pK0<0 8 K:<0p (1Wp< !G08@K8pK,}<00@0 <0@0<0 t@Xqhnlꀠi@fd0 b 0@D@@ @0  @10@00C @0 0@`FQ@ @E C(ȿؿH 0-0@ LP0 SlPl0  R0S RR 010000 밡H~<~L~ -L!PP@`p 0S 0|R0P 0 T  0e@aP00|PH~L~ -LPP`p 0S0@0 p0T d0T 0P <T2Pr@XH~L~ -LMp, PP0@07 T`( U FT&T &T 0PX W  0pV000 ;T`,0S U(0P @H~L~ p-LM@0S( 0 ER p`0P0 Q@@Q$T00 0h 00`S000 L0RP4 5*p000EPH~L~ 0 -LML0@S 80  Q 0PH~L~ -LM$`Kp@H P 0b -(L@H000 P@ 00 oN00C0Pw;P 00 0000CS 0 0P0 000CS0Q; p-LM0P0`P@ 0T S0 0 R@0P@fDA 01p  -LMaQ @ Q1!0 dT Q  0  褀T@tPa4p0 @0 P@`|hT@tPa4p L @< oH0\T~ \~(h0 ) H p-LM⩦D`0@TP PpNP 00@ Np -LM0!0Pp@ `0P W IP a=P`V @Z XP5P~:P G=PT +Po: KP PP0HH p-0LMR@>`\0 @ P0  0S800 0S'`pHܡء0 R(4 0S 0 0 R CZHT 0S R 0S 0  R Q CZH p- LM@`T P0@0@ x0 P0S V 0 0SPU @Zp0 0 LpܡHء  - p WL` 0S XX P< 0@E XX@0  p 00<~0  @ 0 묠| p-p0LMd `0`@` P0` 0S 0SPU @ZpܡءH 0-8@L P0#0 @ PUZ0bH 0-@ LPP.c0U< 0 0R0 00Q00S` 0h7 <0 R 00Q00 0000$~|  0-\@P0L  0 S 0P 0 0S  -LM@p PPP0 "  ` 0 R$V` p0ppS 0p(K (p $0 0 N`( K0N(0 S  00 0ꈡ P~ 0- @ PLt 0 0 S x ` | 0  000 000000  < -LMp`XP 8C80C S?L! " " " # # 8# L# # @$ \$ <% $ $ <% % % & ,& \& h& p& 0SU @0S %o0S0SB @0S $a0S PU0 @ T&@PT 0P0S 0S@Z m0S ! 0$0 '@T 0#"#0#0#t0##P 0 p#\#T# @0S4#1(# @1S R 0S0"""@0S"d"0S0""0 0\"PU @"@0S \)|"0S0 !PU!i! P10!!0!0!yd!0S\  P 0}0DS ' 0( P( X( h( p( T \ 0  0  0i 0S|  @t t ` X X T L L 30#0P \r `0-0L@P^$$@0hS^$? -LP`p@ T) ) ) ) ,* * * * * + + ,+ W@ `T"T $T \$(P 0S)P$((P 0S)"p"p${P @T }@T}P(|) -- L 0 -- LP4M@@K B 0 0 -P LR`p %R k R ;0B:S- + + + + + + + + + + + + + + + + + + - + + + - - - + + + + + + + + + + + + + + , . + + + + + + + + + + + + + + - + . p0  ;R   Z @T @D Tʜ @DT  pa@p  p@P 0Sx ?dRX`-X@-00dpPg 0S` -PLM`G y p 0 S P !00P @0S`y@PP200P @0S`y@PP00 P0 00000SP p-LM`P@eyy phG p-LM@`P0 S0 0 0 0 0 X0 X0 0 0 0 1 1 0S Tdp@P0SVU@ PEP0TVU S 0-L0MDPK@ B 0 P1 1 1 1 1 L1 L1 H2 2 2 2 1 w0$(P 0S)$((P 0S)${P P P}P(| -Lp@PUjx0@S Px`00 R 0S0S1SP01  p-PLM`P5 P0P 0@S xPxP 0@S x0Sx P phxxp p-LM`@PT P 0S 0Syx0S@psxqxox -LMLapPX00,Q, p;P@, uSPP nSP XWiXE/) oX00#)x c@@(T YEPpEP@ iLhh5l H -LM@0SvX00h p-LM`Pw0 0Pw0@0S000 L000 D@H@ 0 L 0Pp -pL `L0P0A@TJ0S 0 @TZ 0 (Hlwhwj  \( p-LMd`dd n0PSpAW ,P1 S0 0~| -LM@pP` 0[S 0S@┐ 00  @ʟP\w g ~0p,K Ⴔ,0 S*0Iw] -L MB0( K!KP` 00Po![P`r00000  0   !0 0B0\0;00  710 R 1! L0R'; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; 1 P 0?00 00<0 0@ PpL0PS !0[pS 000P0<0(p!0[S(嫽H~  -LM@0, K%K@p`@00  Q ! 000 TP 0@L@T " P  0 00  0000%0[S 000P0<0,:P\H~ -LMp B a8    0`3 0 @ 0O#ODP0`U0 PFF00fQFP@ U 0 UBa1#  f0E  f00f 0S-00f C`r`~gfff -LMK @p p p-LM@,50 R00SP`@B : 0Q(*u0 V0   0 00 0p0 00`_3 0V0 H 0 0㽲P  㪼T p兼8\` 0-@0pPL  0 000h@80/   ~0~ -0L @P`iM    RG  0 l!@Up0 00SB Q/ 8Q8-Qp% #Q, 0 % q0 0  R0Aq00  RWAq00  R7AQ00?$QW@d@T00S$T@` R XRxR00`_0`H 0-0LM @K{pPh  0 R  R0P  00 t0 -L M`@r20P  0S082Stp   ` P P q00  R@PdU0n@P 0!0!!0eP@ 0S pL10  00S Q8!0000ӑ0Q 0S p00  00S Q 0000ӑ00S q00  R@ 0P  0L @00S  AHp|` 0 -LM0p 1` 10P00s@ A@=  0 0c0 AZ os -LMP, 00 AP` 0[S =S `@3 R  % 0U p[0  , RV0 xᱺV h3s,  Q 0X40 @L , 4 @ )80 <   0T0 V0 S   v ,0   k 0 00 008 0 R00S@0    0T0V0S  <0S0  Y%@T4 R} V 0   h0S0 ?S 0S ) R MP 4  00 00400Z  s s NND-P -PI-P ,0h  `@P  @QL@00  Q 0 չ눡\`D̰H - L`p%60W00S PU 0@PrU 00WD0<0 0h> r r ! -PLM@ 0T0   R0 0Q [R P@H-0S00 0\00 Q\0[S 0S0 [S ]SQH -LM@P0 0S00 -LM@P  0S 0=S   -1L M q< ,0 0 4 Y ap`VJPU 0 0 S" `VZLY4,0Q *00010 0 `40 q0@` DA qA@,@ 0 4  L@T   P000L@T0 4,0Q* 004 0X0@` DA qA@,@ 0 4 s0<0  0 R\Bl -LM@R $P 0 ~ -LM@> P h ~ -LM@@P:Q Q HR HR HR Q 0R HR HR HR HR HR HR HR LR 0<00<00 b0 <00 <00S A>A0T <00< <040 0<0~(l ~ p-LtMPy@P S PS tS S S S S T 0T LT \T lT T T T T `U BPt00なpXpp@ 42 p0<0j@ "@`@0<0p0<0?zpp0<00<0~A!0<0w'psćp<\0 ! P 0Ӫ0p p0  0 S0`PO0@/SXJPKMP0: S`}pLhp000<0D0 b< @0<0kꈠ|t~lx~ -LM@@P-8V xV V V V V V V V V V V V V V V V @P0800h鵩t pld0 hh,<@P  p00hꈠ<|ht -LM` p-0W:00pPU 0SPU 0SU 0S  o@  *0 A?U0@0 pP0@ 0 P]P [P P]P Ra -LM[@*0Sd 0  h -LMpPH0`KW1S~ @1S勶\ -LM Q#p`a0S  @T 0 S 뷅@t 1 R Q 0T2 0T/ 0T! :P… … 뼅t @ XQ A 0  0 0  R X0 Q\@X뗅 T㿅뀗| -|XL0@ S$[ ^ p^ ^ @_ `[ `[ `[ h_ _ Lc 8h0Sr P0^@0[P\ XpR 0ǟS7 S 00BS7 0GSWW0 iP0\ [ @\ |[ p7 R cQsQ CQ  P  700BP0\ \ @\ H\ 6 R6  00P0S P 6  B P00 P``V10@<&SL00@``0  6p@p P 0 Sx @ @0 @,,   5/T ` `  P{ p%0 0  R8% 01000C0E0 %0@00};10@S0 D0 0$0@0T0 $00v 0rp$0 0  R$LQl4h4   PY 0 $000 w($0  #0 00 B3  7 P00 PppWP  0P``V @T 3 DTS @ 0 0b 0  00 m@0P 0PV 3'QP  2H 2 RD 0 0S: 0M  0 0-0 @0 TT 0 0S 0^  0(" 0@$ 0 0 0 00  0R 0 @ꠡ괁1`V P q0@0  R`Fp1XV P q0@0  R`F PPEU q@L 0PE0`U 0 ` 0 0` 0? 0@T 0 R`@0 p0 l( 0'00_|h~8<~(~+`i~,~@ p-|0LM@`@P᪰\\0P P0D D0< <0@#ph|(p$xtlh P0 0 .PP ᠡ p-xLM P00PPPU@C H4 R < P ,ğ0S0C00@0 00C 00  c 6> 3 ppß0 Q #0S0C000C0  0P0 0 ӷ0C 0 p0P 0P 4#0SP(3PT-f f f f f f f f f f f f f f f f f f f f f f f f g f f g pp2 S p2! RHR0 0CR0$b 82Q@  0 @00 R 1 0 S0 00  c= 00 0 0St1 `P`1   \\!0a00cSsS CS41@ ph`0 RA 0@  l m=0 0d c 00dR0c00P@$h@0S\0PpH0P0  cI=0  A P꼟h( $ 8< -LMPP`0  @P0 04? R 0LyS{$m 0l k k l k k k k u k u k k k k k k k l k k Hl k k k k k k k Tl k k k k k k l u k u k l k k k k k k k k k k k k k $m k 8m Xm |n k n n k k 8o k o k k k k v k o k @p lp k p k k p dq k k 0l k k s k `u k lq lq k k u k r u u k k v k $v k v (w k tw w k Tx lq k k k k x -0S= R 0R0B00\=! R  04=" M  P 000k ,000,0 P 0?PPPlNS|P%< OP@,00X @< T \,0S000@L0% , 0PPS 0 ؋P 8%P 0S  0R (@Q0 0cc i  p/800@Q@@@pp` 88 j @;+;@@@;  :@G: +:*@@ *@8J0 0 @0S0C0)UP d:P*00ePc(j@ErP00 *, :ɟ9@@: @P9)i9@ HPPEU@T 9 0S0C0U X9<9<)0)0xY 4@0 Z9(8(XP HP0 0H0Sڈ8x(l8UPe0e, 00e0Th0 RV 0   QPc\' 00^P@0@%SP@c\Uy\ 0Pc\q7l'h7H7g0WSwS0 q@70  00S0GN q00  RcRP 0 @ P۬PGЬUFN @P t r0 0  R= P; Q @P6L%5 0R00 Q q00  R PP ?P  0S0C03PPU0 Q q00  R ^^$ PUD! R r0 0  R PQ q0 0  R PP PUP @84$4$ 0#S0 00Ue3P_CcP  00 {CceP  eh#t3弣\#T3 0dcS000P PPEU eX 0Sg 2"2\ 0 0SXP0  Pֵ 000C] -2 R@ \2H"D2@@ 0Qp"`05X  ' U 1 R1! 0b0P0U1! 1P8@%0 0P 0000uA 0S 01 !1 0QP`!0T00 R U@`p开P0 |0  0  R4 0P0Q 00 00CQ00P000ꠡh,xl@pt|00d0 8<q00  R 0P0QP HX@ 000 8  0 0 0 00P8 Pb 0P0 P00S@K -LP0Lp`tS񟗀 } } } } } } } } } } } } } } } } } } } } } } }  } } } } 0} } } } } } } } } } } } } } } } } } } } } } } } } } } } } d~ } } ~ } } } } } } } } } } } } } } } ~ } } } } } }  } } } | } } \ }  } } }  } } } } } } } } } $ } } } } T R3 Q PP3 P@0P 0U0P`P 0U V P 0U0 P@ pHXWVPPUZP P FP00fP``aP@@P2,R@$0 PPWT R2 Q CR!0 0SgWP 1 PR!0 0SdlP 0CUx0 q00  RPlR !0 0SeRࠟؠ0 RZ 0PSTZR㬠0  RK QE 0PUP@hh0 sRD 0 0S3-0 PPPUPE%4 p-PLM@@lPl` R  XP0@D S<0 0S0C000pp`(h -n$0 Q 0:700[P(P)P{P]P}P 0-4@4P0L 70 0 0, ,000 0 6 p-\`LM@dPd 30 0 p| 0-@P L2 0 00h 0- P@Ld0hd| -LtQM0l!d1d `1`@$K@` ```@ `` ( 0 Q C$0 P0b!0 !0lq00 c`R 00CR@ 0@0C 0d0 d 7 7 0 0bd 0C0\0T0T P0px| p-QLM@PpR `0 Q 0Q 0  -6 000ppD`  0S0 c6 00 0 p-LM@`@P 0S d 6 0 e0b 0pp@-P @Q` L| T  0P 0 QL|VT @pppPZE-@A`0 P.`Fv+ Qp0 0  00  0P0 q00  R 0 PP0`Fvq00  R0 0 q00  R0 PH@- AP0P+PEu( p@P$0 r0 0  RP 00 ` PJ 00 PPEuPJ0 0 |0 0 Q HG-$P0 P1PEu. p`BP 0 r0 0  R 0LP0@ 0  P0 0@PPEu P0 0 q00  R HA-@P0 P)PEu`p# r0 0  R0 P0T q00  R 0 PPPEu0@-@0P%@Dt" PP J0 r0 0  RTP 0 r00 Q@ P@Dt0E-Ԁ@ 00CP-@Dt* p`P 0 r0 0  R 0APXP P 0 q00  R @P@Dt Q-LP@,0 Q()0P>5`V Ttp@'  0P0C 0 4 ,0P廩tp -PLM @`; 00CQU5 0U@@A^S`00 PpX`P@ 0P0C 0 3 00TU (Pt -l0LM` `0@  5T 2404 00 Qx Ox꬗ 0-PT0P0L@@P8P 00` r00c00%괗 0-pPL0 0S0R@@0 P0 0B0@ T -LM̠0@ `T,@ Ppᨐ0 g?R,`,@ 0p0@ PT0 h?R0` 0 0 `?R` -0LM P@0 s0 -L M0, p^P"0p @7 0^40U0 ^00S00,0 0 P 0W PPĄ^00 pW@0 0Ĵp02 0^U Ÿ000C,0 0W 0!^0  ^!00,0 0W000   0pW 00PPEu`p @ 0 PER` \0 S S Ew000u@p 0 00S  R+@S<@P0S 0 1$w@000,0S o"0Q @>@h0 Ru M00 pW-00Ĵp k  0pWurꜗ p-LM`@PT# 0dR 0@P0@pv0S0C0 vt 0S00v0S00<0 P bPv0S00ꌗ -PLMpA0S_ PWa$K@0 (K,K @zPPB H1($01 $0T00 (0@cT  R 0000 0 0@@,0,0 r{0S @TYP p300(Q 0pp~thl<x d -PL$M@`P㼒 r0S㨒 T0S PV0 ,K0K4K8@K @wyPs Ve `FVV80S940qO`@M,03,0!0{P00SP 1T0 S/R  P4y|1|!x1l1l!@@4@Py1UpU 4@y08P PU48 v4y540P``pyx0 @ x00qQk D0@@ P[  00 dthlx< -L$MK0 K @KK @xP@ Wv_y6 0 RPPሡ -T0LM @R 8 TT^h/u.u@@$:u@ꈡ0P00 нꔗ -Luhu -LM,@0(S^0000ꀗ| -GML M<2 88@Pp`, $"%dp fPp` iPp` 1 @bTQo+1IKaAA$Pp4: S TcIiBKHH+( P: L80Y/S/00@Tt p/ьP`` 0SP :0/S$ V:0/S `FV:0/S`0 SS0@T4 P  /P40`FV:0/S (xT  -LjM M(kKH0 H`p,0 CP;2Q 7P2 R2 RVsP,0 S ,f靄0S  |囈6: S" KA ACP L6: S P $჈6: S V .MK@D @DPSuK APKrPR>7P KA A1P]NK@D @DLB D= P@=1( K ! Q@10 ` P00CS00Ӥ0 Pp @00CS00Ӥ0 PpyZYZf`~{6PRL 8 (0 4MR -0L$M@  H0 < U H@PPD@ <_@-K Pp iPbᇗ0Sp h ᤦ@T xSP 4@幇@0P/=-=@嬇a$=D0SF[P=00LYP)$, 1ϠA/ 0(@@lN#b8K@80 4 0@ , ,P<P @@}<P$<t@oh0-S @gL0S @_XH@@ 0 R@Q@M0;0<`H0P0[Pr<5H D a@2}0PMb\l| -LM0 4 ӃP; ,K Vp# ,0.C4 P ,K Cp ,0 C4 QQlxl@ll 00}\[8,$@4,4 00l080< 0-,@,PL $}  y 밫Dd -LM@P 0Q 0-@LPU @0SQ000 -LM0@S hp@-0PS00p-\@@T \ P`r00 P 0 R0ATap -LM0@SK P  00 0-0@SL UPP  08.0(0Pp= 0-0PSL@0S00 RP0P 0S 0- L0@T  0P0Q 0S =S Qh0 `0 00S<Q  !Q >Q  PP e갨 -L4 0-XPL0S S 0@ S0 00봨 -LOM\0X,0 0P S ,0 S ,,eOKKK`VT QP W?K+%{PW?K \!QH1SD1 L1@[0P S Tb818S <+/ F4(0 -Lp`@T TT#6P0S! P T0  0S T x*@T TT * 4괨 -Lp`PU U @0S P U0 0 00b0bPU U 3봨 -L MP`p@T T T TT T$KPKP@ (KFP; 0D S$ <         T h $ (0Rpp`$ (0Rpp$ (0Rpp$ (0pRp$ (0Rpp$ (0RppGE0D S (         < T p (Pppý(Ppp((pPp(PppӤ(p鴨 p-LM^`P0S p.T@0S 0S uP0S 괨 p-LM``@0S pP0S {@0S t괨 -LM@`LX0@@D0@ R0S$-~` -@L8Mp` M\l2` N\X2@ L"^p5&LKTpK`H P K0T L` !*P@P00P0 PP2 P +0H P0 T @@*P |N<K &P800 pS080 80W@:0T@Z >\)<\00S#\! D`K 0  \9C0[SD[0 CR 0R P 00xGOl吂0 pW@X D00CS00  ä0 0Ol 4l0 -0L <밫H p-0LAM @P` ]p sP` /0 @bTQ!P PpGOK2PP V.PP[M(DT lx -0L 밫 -LMnQ@0,T  h~00000 0 000  -LM0p (0 P@/UoKK/wPKU  S?K\ 0SKK,L1 H1 D1 @1 <1 81 41 01 *,KL0$ ,N7(0 S ()( -LaMb>K0C 0Cp( @5Pv$6: Sg  S*PW(0 S (LBnK`F`F|!|13* 0S @aDPP$[NK@D@D  AP72W>C R0 RW Wz7}0S @^PPW dBnK`F`F+hM0)0KW (y(edA0 -LM@X 0s ]]]T0+7at -SL Mp@P}00!1/P`!  Vx }0S@ 0P) P* W@p}?00 \@a` X0Pj) P* W@V}?00$(  -LM@ K K 0K @@'P -LM8 < @ P`pm 4KP@h 4 0R SB :P`Z 4 $40@#P0PS ,KL ?PP 0 P@ U10 % *PP 00S0 K_P 0 R ;;S PP 8P PP 0< @0T PPV ,h(8@T -ML M0$ , p P`:|?000!1 ,0S ,SAP@ 4LP 0 4P x|0S08p|0S !0BKHH Fj#0@CPP- ᵃ0@S" i0S c0S+ 00L/ \ 0$ 0:8|?000, 0dᾂ$(X,dtx -L,MQP, p0K0 `ß Q Qq00  Rp0+S-S-S +S 0+S-S QN QLq\30  00S.^A0.S7 Z0PC Z48 "O1@K 00K @0KH@L P P K 00K`V 10(O @/{ "00Z { 000S 8OSl,4`( &"0K`PP, P0 Q!000ӑP PUw{"00 P pl1  0PX1@@K1`M% <0 ,,< {p4@0 KX0 8 Wm0K J80K5 B"4@Z$$ `JPU *0 K0 VP00KU:@ K00K ,@ {0@T0 {'0 0R00 { 0j -L,MR4 @00 K@PK@ ,0K?Op#$pWXO(ß$@  4Be!5P[ 00Sz "00 /";0@@De#%P[0SY<8@K !10.O@ oP P`O$  !5;B S<0 8 N 0,E @,P00Q 8 0,Pu!@@PK0 4K !0& 0d|8^,Q@00 KL!@@,P0048! {&@0<P0@cT4 _Q,0S @00 K@PK@0@00Y 1@0  @ K0K ^ 0KYm @@K V @PKf@0@PK*z 0E -LMЀ0P` p (0 P@qK 60UKS   3 (0S h(I SKI,KKI,K K/IKP c?K@( -LM@ K K 0K @@B$PRAQ:0S A Q:0S -L(ßSM 0080 0 4 p< W@ 0,K000%PP. ,\X 0P@ *0S @ 0T: 0\S 0 S RL, 8 \R 0 S@C80Rr 0Y0\``VS @ R00Z00SB Y@ X P; 0 @S P1 0S , S  0S $ SQ  R R08 R0  R0 R 80R R P@  0S00 < 4  R<00<  ◺P@ <0,  <,0< ` a 2P,,0@ C, (P,deY00\00@0 , ^ -ML M"0嘒p,0 yJKHPHP` V 0/S T; Ph BNK@D@D+ @0S :S SU00 0S S:SE 0S0V0 0S /S tPJK@P@ T ^t0W0P00S@PW40 P t(1 ,0S ,F׹+x :7P` 0SPR 0UPE"*0SP 0SBNK@D@DBNK@Dt@D0l W$ P:BNK@D@D|BNK@D@D,v(`e(,$< -$0LM KwP鸬 -0L: sP鸬 p-l0L M0@ KP K0KK@KvP`+  0 000p鸬 -@PLp|cP p3 R %R XV 4 * R00cPE: UcU pP/꼬DlldgfffQ p-PLM@`PC ph10  00S H100PC r0 0  R1.\P' *\\ 0SU 0B8 S('08C?P- PPڌ@PEUp pT00  0<0S000PC r0 0  RlHl -LMp`#0P@ r \P T\0 P@h -"P@2L MR0@K0 p` UsLz\Ō\pG   a 0a>Ìp4G6pGƃ??p`F R bЮ?Ф@A P 00Q00S Q b`.^L2a?@ C_`0 ᾰPx 0 ῰P0x0Ńƌz(p , 0 KV10U0 0 P@0 0 0 e? -L Mp`@P@a<K4K0H0S񟗦 < ` p ( P  P  P , P  0 H  T  < ` p ( P  P  P , P  0 H  T 8D3#cX Q0@ 0 KD0  DK5P0S u!000PKp Du!00CP3L#cX Q0@ 0 KD0  DKP0S t!00 Dt!002cX" 00D0 ?0PKQ@  DKP0S t!00h ~Dt!00ŸH2D"cX 0QD0 @ 0 KH0S DKPt"00t"0020K00!1cX! 0QD0 @ >0PKA0S DKPp~t"00lzt"00ht10 KdQ814!cX 0QD0 @ 0 K(0S DK|PLZt"00HVt"00D00K000 0cX @ 0Q@D0 00K DK\P,:t"00(6t"00$Gldlt4 4 hHL@@0D cX 0QD0 @ <O0 KX@0S DKPx0 R s!00 Cs!000Ů00KP0 cX 0QD0 @ O0 KA0S DKP01 R s!00l Cs!00x1藮00KQ1!cX 0QD0 @ kO0 KA0S DKP1 R s!00 RCs!0002i00KDR\2`"cX 0QD0 @ O0 KB0S DKPb2 R ls!00Z $Ccs!00Q2;00KR2#cX 0QD0 @ O0 K8C0S DKdP4X3 R >s!00, B5s!00#3 00KS3#cX 0QD0 @ 0 K`C0S DK6P@3 R s!00 Bs!002߭00KR2"cX 0QD0 @ 0 K0S DKPr"00r"00d20K00T"2cX" 0QD0 @ ?0PKB0S DKP1 R r!00 vBr!0010 KQt1p!cX 0QD0 @ 0 KdA0S DKPD1 R r!00 IBr"00v0`00KP0 cX 0QD0 @ 0 K@0S DKPY0 R cr!00QL BZr!00HD0200K4PX`tx h?G?P B3#3cX QO0@ 0 KD0  DKqPAOq"00=Kq"0093#3cX 0QD0 @ O00K0C0S DKRP"3 R ,q!00H @#q!0030 KS3 #cX 0QD0 @ 0 KDß0S DK$P$3 R p!00 @p!00?0PKh2d"cX 0QD0 @ / ឫPځ?0KtB0S DKPp"00p"00o?Ÿg/ 0~P0 K0ᓫP@Q1!cX 0QD0 @ K0 K0S DKP1 R p!00 N@p!00{S?0PK,0 cX 0QD0 @ 0KP0S DKPa0 R kp!00Yp #@bp!00P 0@K G$HPX`h| ( <DLPTh$@h0l cX Q4O0@ 0 KD0  DK?P0S p!00 ?p!00@0 cX QO0@ 0 KD0  DKP0S o!00H ?o!00 >8o"00&D4$cX Q0@ 0 KD0  DKCP0S o"00 @ >  >o"004C3"cX Q0@ 0 KD0  DKP0S n"00@ > >n"00Bl2h"cX Q 0@ 0 KD0  DKP0S n"00@ > >n"00A1!cX Qi0@ 0 KD0  DKP0S n"00@ a>L ]>n"00`AD1@!cX QB0@ 0 KD0  DKPw0S n"00p@ :> 6>un"00c0 0cX 0QD0 @ @00K0@0S DK|PLZn"00HVn"00DD00 KTdhlpHLt| hG?$P80< cX 0QD0 @ DO0 K`0S DKBP0 R n!00  =n!0000K000 0cX qQ00KD0 @  O 0@K DKPm!00p-`P@0!@`Pp -P@E:::LCLM/\p, J\!h1S   00 \ 8AS, 0110 p0 F0 W10 46@ d,0 "&`'@0@p 0%0 6`P@0,!O3\ \0 L03  1S@Rp@- b@0`P \02l`1^1b\@0pRp@- b@0`P \02loQ^Qb\@0pQP:  -P@Lh \ p`T<  0 p`@A 0-L LP@ἧ\4 00A 0-H LP@ἧ0S0hp0 -LP@,M⌥0KQ0 @ ,@ WSO@S`8 RPRI*R4%0 0 0 s 8 0b038 b&x@(8!8HT*@@*TI2@0@bP8@8#8XU*P@*U@2 ȀP 0& @-O@d4xB 02d @-M0Ѝ@4=> 0  @6 -L MQ@0K00#  0 0T0P00S00#0 -LM K K! P -LM K K! P -L 0KM#V% -L@0\M0 0 L0  <0 ,00S00 K$ K<P$ll -LM`Rp @t%  P`F @pT`P0AS Q)0 0  00    p-LM @0`SPR0 S ^   0100p 0S Q0 S  0S0 .R@- P@0@ .\Q00Q0S@@ 0S0 .R𠁢Q00á? P  ( 0 8 @ H P X ` h p x  plhd`\XTPLHD@<80X(H 0- LM@P K0  0p0*Q@-@Q*\?\ [\#\ q 30  00S+.10#0 \00S#10#0 \00S.20#0 \00S  \  0LS00S qX2  00S \\ 00@M \ J 0 @ P  ` p `! \00n  0000D0\  S00000\00a \00b \00t \00v \00f \00r  R   ?\*\ #\[\ 0 \ #3 00000 00@\00M0 0qL00  0 0S-00 ^0\0?0@0\00s  p-LM@QP`0 f0p0  Q -LMP4 Q @pB8 | Pz*QP*Q?Q [Q#Q p10  00S+'10#0 Q00S#10#0 Q00S'20#0 Q00S : Q  0AS00Sp1  00S( \Q PQ T:`4P00 V Q 0K0  jQ@80c@ T4:@D`0K0  j` VPE  @` -@TL P`p T0g0 0l 0 e@DT  * -ML M<$08,0  ,]PP^ P@cBnK`F`F sP 0#S   P< nP  hP33p 0PP( BNK@D @D 44S ?R0Sp  iPP  44S ?R0SpO/2 ,0S ,թBnK`F`F B`rP 0#S \ 7L 28 -P  $PP' BNK@D @D e44S ?R0Sp  PP  O44S ?R0Sp BNK@D@D +< PP A0S  PP0SU|0S  0S  0Sp 0ST P@008  @( dh|lh(WЉh -40L R4P P00  0-LP$P P$@ YP00  0-LPP P$@ DP00  -LtM@0SK *0P H K 0S x0L: S< bO00b0P0` -LM@0S00 -h0L,M80 \0 00 T0@4 , (0 $@ 00 8K 0  x`U (P0@-@P  0S ^ 0S^0 @0S SS00@00P0* -QLM@,0 pR ᧢P4 i 000 h 0p` V Vᘦ%j:$,0P  0\0 p` V000S00 YB080 4 0\08 0\0I` Vp Vᘦ%.:"0\0p` V?`Wpᘦ%$ 4,0P 0\04 0\0Y4t @,0PP`@,0PP`a0 0* --L]M qPM?KC/`KK \1 4Q 0Q )  =K0K00S cK|1 1  x 嫄p@ 1P|KP 0S L 凧|1S00` 000|1 (B|#y0* -4LMQ<@ 8#8Q8:0Q 4 %*0 0K Ġ̌.Č#̌ !m Q *v* -LMP -LMt"  2 ,  " !H `Ca0P2 8PP 0SX?P P 0S  $481!`)!e_0`X0 `0ᕯKS/K ڜ1S9 > @T  0(KQ QMK0SMK^P"3@(K0SS SQ  . .OK @D. P-?(K R!  0S .?(K R2S "RGlK bdKZ7^0 4  MK0iPMK P+ 1cMK P^ nb ^0S ^ L`* 41`A^yLD N. h^0#S ^i A R@\K 0@,q"|@@"2@@P 0S"2P(l*$p=0X, -L,Mp`@ KD0K< 8 @ 4 0 , ( $ 匧PDP@  0`4PP @TD@D<8 -LMp@P `p08K8 (P , 4` p7K0 8K (0S (寤( -MLM Z,   4 `a V $ 0P@Q X1X1 - $Pp' B^KPEPE0$! <@嘀`ᒀV INK@D@DP 4: S  R 0 0 ,0S ,PJPt $R 0R\ 4 L 8J`(ll0X -LMh@pP` 04K4 $@ ( 0P `3K, 4pK $0S $ (l -LEM@pKK, 4! K081 P@  #R 00T-* R+ R) R' r0 0  R r0 0  R0 Qh#0000ӑ000\*0 S S S0\*0 S S 3000 \ *0 S S\*0 S S  \* 0 S S S R r0 0  R> \*00 S S SP\P 0S ``Pz0+Sd -S D 4zP0+S0 -S PPUb ?? UP[|,0 S t,I0S @S P K?K*`0S @S K?Kv*0SP @S  4.P`8~ 81S  K?K^* 4t8 0SP @S 8~ 81S  K?KF* 4\8 (| -LM8KKPp <, PP `P@ ,0 S ,ϢP/K%>KH D LB @B KH L @B 0S GN"0 0V:`aP@ `<$0=80` 0) 8 a0AS"w (x (x (x (x (x x (x (x (x (x (x (x (x x (x (x (x (x (x 0| 80>080 8 C. 8 800p+WP -W=W80@ =W  0 S RA(  #vP0e(0 (P@} ( t(0PPԲP@ P0 S S0 S S ŲP0P0,K Ѳ,0S ?R0Sp0PB U 0@S  R00 RZ@ T 0S 000 ! BX @儲P@ ꋍPP 000  bK0@NK0@00P0ŰP 0Vl0l -L>0Slx\R*;O* -LM,4C8̓ <.K #h, ?KKK@D3 0# p @ l -p`LFPP /P @P 'P 0S0S l 0-@P@0LS00$ 0000M$l -LM(@0S0 =00$l -LM0St (K 坭Q@`Tg ( 0 S RL0L(  S *(0#` @Rq PU`@0S0T`ÅbPP `0 S S0 S S SP@00TP@ 0U ` 0S  R00 R@@TP U 0S |00x0V:\&PP 00PP@Ņ,,P$(,<@-Mp` @0\@X\x\@ Q $Qq0 0  R#0C'  Q .Q0V42:ЍQ q00  00S 0gC R17 1RTq00 D R q0 0   Ra0LA0L** -PLM`p +H000@,K0K 0 , ( @@p0 WV0000.PP0  0 @@sp  TG0@NG0@s* 0-! L0TTW!P@GT @@ T 0G0 0 -PLMU㤀0` 3@pT A0S0h0 @ǥ\00VD @:,0"0G0| -LM@(@T0 @| -LM, ,D0 ` v00  R-V`<  +V< `YY0V Y0V <Q +. 0@K  0O@K 0 K@@K 0KP@@K p<00 KSP T@0PiPepv$B 00Q0`Fv  00Q[ v 00Q7 FW F` VM\< R& 40S 8@T80 W V00S NG"00`D@ 1B"@$$pSƏ4X004 X 80W8@<0W V00S pD@ 0B"@$$pƏ4 X000Q \,0 J00 K\0XSxS`I   B00! RA R0000000000000000Z* * ?0-1pQ LR@` 0S P @@ ZZ0@< [0000S@* ?0-1pQ LR@` 0S P @@ &Z0@< '0 000S@ * 0-LM 0xvr.0l@hpPTkX0 RP 0 PP@ Z0H@ D p-LM@hP`I\ 0 @4?Tp`0@ R@X 0-@LP 00(,@r.0 " 0hH@  -rSLM"0@P` :Ep 0P E0pE p-LM@hP`M \0 @4Tp`0@ Rm@X 0-@LP 00,@r.0  0hH@  -rSLM"0@P` :DEp 0P 9E0p4E p-LM\@0PSP`PP 6@0PPPpuPpD`\ 0-LP(xP0@P @q0@X p-LMDP0@S8`p$0P@@@@D`\ -@LMKhH@ -LTMF\` \ , d h g l 2%0S U@T %0S :Sd P0@T @T@KG\d QR dPPGDGPP XK OX0S p00R0Sd@\T00Q00S ` PT0PS l  R T@0,S SS S UP0T0 UP004D,0 S 0,UT@PPh@T /P@K0h LK@BPh啅 Uh  L叅pLP ῚL刅yh00fs`V tCDK0\HK P@KLK @PoULD0LP 0H3LK2 P@K@P`ᰦP: h0S@- Ih@ )R ˦P  T P@ 00CS0 0Ӥ0 P p A0+S:P P P _P TKF\ d0@RSA00Xh PFP \QP!00 DQ0SG d0S7 |,0d LKP@K@PPP LLބP0T@KPT FFFPP d@T XK'X 0SpR`@@K` `0d>H0  P(\d`hD*]*l*$* -LMğ !  \ ,    !4@R@ `h4@K K 0 ' K# K,K  K K K K  KV0 \0 x X0 T0 P0 H0 D0 @0 <0 80 40 00 L 0 0 |0 t0 p0 l0 h0 d0 `0 \  !@0pCⅠK  ePP.0[  R) R' T*00K[p20  00S  Q"0000ӑ0K[ Q"0000ӑ0K[00BL0@X XKK, PGK K K K K K K K K }V0S )x!QCl0S3 0CS/VBu@41 ,0S 4, KOp>B0S   WKP7KXKL00L0 60[S0X K60K#:B00Hp`B 0(  U5 0l0 -L0Mp0P 0 `@ LKL@KD00D0 Q Q A00 0 S 8 又, Q(lt,t,t, -LM^8K- 7<K@ K0 <0 _Bp` P" YPUDK@ D `@K HEvD@K  @K0 8Kk: Sb0 d Sc0 ] Sp0?0 0r0-00w0-00!=@SL CS-0> X! r0-0 0w0-0R00 &R-0! !r0-0 0w0-0R0 R-0 00 0 R 0Rt0T0x00 R 0Rs0S0x00 S ! Ss0S0x0 Sd0 Sl0  S-0 Ss0d{*Kx*u*%r*on* j*R0S 0S0S0  R00T* -MLM00@ <PC 04D @0h184 8$P# 0.S0 @T'*0S0T!* <$P <@D@ D 00p 9P4 0@ 4D 4 0.S0SBNK@D@D +sP >P 0 (4 -LM`001\L `PP@ Q  R0RQJ 0S %ZP 0S0 h@00~Pp  -P 00 q 0@0A   00S*W00=0@~0P ~P ~ p-QLM@`P * 01RF $1R 0ST:0SppT  PPpp0R\ 0Q^0 Q@ p0Q RX0 Q@P R0 S#@Pp?*[!]- p-LM`P P0PEuA PEP@uy~00pu~ p-MLM`ANK@D\P@D+ x 0@  0S DpCANK@D@D+_P ( -LMM|pANK @D0@D`P+ 0 HP 0@ $ 0S  參($ -LMM|pANK @D0@D`P+ 0 P 0@ ( 0S  g_(,0PP0 Br 0 B\0 r 0-0@SL 0}PU ,0 S00P0}  0-@0L@PT oP @T00 p-LM0`PU }}TP00p p-LM4R0b0BP`(` 0St 00P 0S\ 000 0  0 1P0 0S8 00P 0S  00 P 0S  0 0$0D!$0<1p0`  v0 ` 0`  i0``0`  Z0``0`  K0``0`  <0``~T<P -L M0`S$ p  :S0 $0 0pS PK%t>l>\>P@ (K 4(0S p00R0S >P@  (0S p00R  R W1 $ 0 0 z>|v>lr>d Q T1 R 0S0<00  00  0 R 0 R0 0 0S 0I>E>P@  㗡(0S p00R0SP X.>P@  〡(0S p00R0SP$|P -4L  0PP `@T T 0T,S 0S P ss  0PU  0PP  0PPPd p-LMP0 S0 `@0 P P0Ss0X S0L@0Sp00s s sT -L MpȀ@0`SP(@ &\0  WP 10$ KvP(KӔP  (,D0  $ds|TlL@-0S@ @ 0 0 0  -LM`Q ^( @`p$ 4 0PB ( K10"P; (P6V00T00S(0V0T00SW YP P0 $&@6$ 02P $ 03r$KCTl --LM -L@`px1`0 XXP1T  8BU8 $0H  vv밫05l --L 0-<0@ PL,,T U 0h갫05 0-0L@P 0SP0 CR 0P0 00R P1 0 0 -PL4MPL p` 0 S@P X 0 S @P L0@KP\!H0KQ, < 8 4 0 p4@HP D `` @0)Sn6 0  ./ }+0U# >E0CS <0pCaH0S  j H N a 0H0 L0U 0R*0 0\){} 0-@PL0\*ql0  0!0S T000@CT00^00S 0 u -LP0SPp:qP`\&*0^S00p\*0]S -S \0* ]R S*-R P0]S-Rx \*0]S :0SS 0 0@SJ0  t0`2  00SH@TZ 0S?W"  0SJ 0 @@000l 0\0Z 0  00 0 B 0SP  h hb  P  000  00 -00-0 -  Pz00 -00-0 -  h00 ]00]0 ] h 9P & P0S1*8  ,P+ 8000 -@PP050#-SL [S0 :Sa =S1  pR*0-S `WW  0 00 \  X\*0]S -P0`0 `0S0%*00-S]S P*0S*0=S .0]S00$P*0S0"*00-S]S 'P *0S*0:S 0]SP*0S05l:o h -LM @$Ap\ *P q00  R@ `ePi TP0S PP PP  000   PP0S 0PS -LM@=>0 00  0- LR@%*0S*0[S 0 0.Q00PQ*0S*0.S [00]S00Q R* -PL@  R)* P*0PS 0]Sp`ePV , ṮP0 R 0S<px0   0 R PX 00p , 00  RP   p-LM0K KP` 0 ]0@K0K KhP`p -0L `@8pP Put00  00S P h ]0S04  4  p-LM0K KP` 0 ^00K K]0 @0K K$P`p -LMP`@p0SGT1 T00W0 W00Si   pppppDpppppp` f 00   f  f5"  A,  i f0   f  f"  A    @`pG f 0  f  @D @D`q0 S X -LM P p0 0@W` 1R Vi@0S P0 h0S 0S @`P  R Ϡ>1*!">00c # Ϡ j @ $iP@ 0^?>1  ^0h0@iP@ 0@0hp@-0`@  ^R *0 00  n^ :0E\  00C 0p -L M, p0 0 S@"* 00T0R00S P*`P0 00 R0#S P: P @ T:`@ T*,,0p-0 R*0 R:@-0@P*0  \: -LM@`pڽ0 00R0 hPU@  P g i޺ 0S  Pi/hQh- 00/>\ 0S0\ 0@- 00>Q\@ 0R0\00 -0LS8p`0S PU`P 40PU040@0 S @TP -`RL@PpR 0!i000 p-LM0@S`P 0\ 0  !p/ p-LM`\P p@  A 0S0 0H0SHP Z  e! B 0A0S 1>3 01 0-0@SLP0 g0S @ 00h 0-0P0@L qg0S 0 0 00 0- LR@00>#R0 (R" R @0Q@PR@P0fP< @Q >3SAQ 00@0QLR RRL>31>#R R "RR R(00(000S0 0>3S S S\(00(0 P L -LM 0R  @T p0R000PP P<PhfffffeE -LuMp0 (, 1 cfP`` ^fPPR 0@x1 0$P}K@{K 0 oK. ́ ȑ q ѲuK k(P? 1 p0fP@ oK 0 ,0S ,k0 10SJfHf H0 @;f 0(xm<  -LbM⸠0JK(0 p @)@KpZ_K`$P TjKjK11 P 0S(0 S (fk( -$0L!00  -LMpZ a|# 0 0  R4 УP ɴ@j Tr#1PU%0\ \|t3  00SXH3 /\00\0SP.\ \|3  00S 0 0/\P- \ W u0i U ډ>i1!X H U (00 0S PSPSPPP0i!UPQQ20  00S W䡟`P L@j T! 1\P \|1  0 R\ Uڶ][i0XSxSNQKq(10  0D0SB X0P` 0\7 \5|00  0D0S, |  0 0  R \ 00ӑ@ @dT0P0U0 XHm 00P02 a( UHEDPx0 -LM0  呩 -L M@ 0@偩RA*Z>* -QLM  0K  0  # 0-LP@#p P͸p U T 0\ pP U+ -LKC/JK X1 0Q ,Q _?K A xA 尴D0 bKd1 t DQ 0S dp($;P -LM0P\04#   R,0 p 1S01 8# `<# @# @T1 t(>0  00S 0S0q=  0 0S 0 0C`0 P %T 0S 0S0 0C` 8\= ,0S P ,%dP 8P@pxT.h?@J@J@J@J@J@J@J@J@J@J@J@J@J@J@J@J@J@J@J@J@J@J@J@J@J@J@J@J@J@J@J@J@J@J@J@J<@J@J@J@Jp?@J@J@J@J@J|?|?|?|?|?|?|?|?|?|?@J@J@J@J@J@J@J@J@J@J?lI@JlI@J@J@J@J I@J@J,I@J@J@J@J@J@J@J@JpJ@J@JDI@J@J@J@J@J@J@J`I?lIlIlItII@J@JI@JI0IJ J@J(J@J0J@J@JpJk| 100Cw:@3 @ < 0SU@0q:  0 0S 0`0CS0 >P MT<@@$BKXXU'DzP 【<$00<3 <l$00S<3 ʮ<3 S  3K0X <# 4JZ!3KL @+0D:SFHGHHGGGGGGGGGGGGGGGGGGGGGGHGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGH@00CS0000@Z   0@xeTET'& 3NK0dF3K+L MK43 4  43 MK 4 8# 8# 43@婙44 &@x3.KXx&3>KXP 【  <  S<P dA@C @KKS@p@@@@!@0@# <3 lP 43 @4C `4343  04 43 ` "@# @0@]d @ 0t<0  00@P@C J$@@C (X l d @-^R  \R n-\ @\00]\0S  R\ A]\{\*Y* -LM@`p(ZPP: 0@0@@@@@@@@@0$` $0 P oP@0 hP' 03`P,YZ#| WP ` 03$0  < P$00$0eZZZ  `S0S $ )@TD0 003$  3S03Y`` 0SV,0`@,@ ,@ B00|;0 0 -LM( Dp$ `  / PP P P@ (@00 00 0S p-LMP`P 3@S0S0@TZ3SOZP(P#GZ$0 #10#0V@@T:Z0p5Z0`P`Q$0`$Z -@LT` $0* 0QP3 Q# R 0PU@G Z3S3 3S S  $00 S/0/R@0( D u P 3S 03$0` P3ա 03šv0 #0$0@P$0 :.$0PY3s7 0$ @Q$0@ 0 S003aP $0 :P3 $0p RP 4 0@/@$0 @2 u{Y  @@_Q $@ 0 0R 3 P0 3L00 P  *PP$0   30P0K0 8P3 03 PU 0  PU:$000# 0B8S 3S  $0H ,P3ԡ 03ġ0 #0  R-#L 0 0 :Q0-Q@@TLP`=p@$0 3C T TP+ U$0P:$03PS0 /R $0@  h ԳPp nP6K00 -L,M , 4 `PV , R0H0  $ 0S0H0 L ? ,0H S@@PRP < <0@0 4 $$00 S/RA  0T0 /00TT 4P #0 ph0 D 8 Z YPP $0 0.S  P@y Qc*D #  00S$0H:<0S HQ 0 03#40000Q08 8@ @0@ 8@ H R L0S P P $0 0D00$0D00 H Rں#0B8RSH00CH0 0( 0 DT{W0{ "40$0:$0?00puP  W $0 P T 0phpTPW0S 4 03$0:$0aP 0S[ 040. ScU P0SA$0 0YXT0AT T 0@0S ,YQ4 3S#$0 Y 0SY00 0 ,0S4 # 7P 4 #$0:$040 0`0' 40VP @   4 <3@ 0300 <0 @400420#4 0 BH  L ,0S V4 #400ꀀ -LpM$0@0PK@P0J 8P10: S S 0  S00D00.S, 040  3S,0Q  3S000P0 E0S D040. S00`Pp` p 0 0pP w00 -0LRP@` V P  0 @T` 0@T000(00VPpPppV -LM$0HPPp`OVP@ 0 h$ 0I00D @0(`#0 -PLM@ @gVT 0-00L@ :0S00?0 00NV0oVPP 0S P>V R D0P00c00 R3 SD0Q00c000S0 3S 0-@PPL0雫0UP1S -LpM$`@P R KaPp 0 0R, 0R p00V@@p  PP -L4Mp, &$W, Q< , R0, & BX 0BX0 嗃#(R@40 T P?4 P0`Y 00  Y 0AQ0 X`P&TP @0P UR PUJ P"0Y<0 00  Y 0L\0 `g@g' 0L\0 Y 00  Y 0L\0 P@g< ' 0L\0 < RV 0 b0hP,0P㗃#40 Y0`; 0@P0 4@d0fgP!P Y0` 0L\0 ^ T4 , d/  0  0L\0  0@P0 ʿ,0T`P0 0V*@T%Pg PY 00  Y 0AQ0 @' 0AQ0 P`0V: 0Y<0 00 0 0  0 P Y0 0L\0 0' 0L\0 ' 0AQ0 4 4P4 P4 40P01@80  8P@ Ph PZ 800cD0 @ 8PP? P10@4 ` aH 84 HPa P4 P4 k4H H 4P4 PH4 40H P D D0P0 PD D0P0 P   P P  `0VL *@T%Pg PY 00  Y 0AQ0 @' 0AQ0 L`0V: -LLM` d d@` @d@ h0 \`K$ h0 PpW:` <Q U@ * 0dR @T`05<5:T 0 00` 0 0Pp$0(0,0 0LPP d0S`@H0SW 0 P0P00 d\ Q D0^ "0D0^`H0S0 t `0L R0Sf R0S]  0_P@ E U 0 CPU 0; HP@ d\ 0hc/0cOdP^*hP@pD0^ 0  d0^p@P:PPRRTPP\R {R`@L  0%0DkRPc`H0S[RR`@0\ 8PPp -L M@0TP 1>3S S 0P>3S ? S S 0@U S SS S 0P` 0 P Fp, @E  0@ PP, P , 0@S8 S !S 0P` 0 P Fp@E  0@P 0 S S 0>" 0c O 0 > 0c" 0P` 0 P Fp 1>30@C0  @P @p1>3@!>#"R@D 1>3PLSJ1>3P!># RA -L$M@ ,@ 0 p RP`A>3S S  S PU00^ PE0A>3S aSV 4S1>  0 0r% 0 @Q00dS0  0dV0  P   1S P1S 0sS ,1V >3,@0ca0 0@P@D ,@  ,00C ,0 ,01 , `{S@ S > 0  0cO0K ,@00 VP000 KS>30@C 0,0 @>P0!@># R 1>3@!>#"R@D 0a @ K> B000 K@K ,00Ps000,00 P>30 z V  VR  0R MS S  V`EV V@*0 S=090 0V V0V5:-0 SX S&S- S V$ V*  R rlA 00  R _Q 0VV r, 00  R_Q00  V V*0V S VV r@ 00  R_P V5:00 PA >3PA>3 S>3 2 V  0| -LM0Q, `Q0 AϠ lp 0 4 00XP40`l ^0p U40 @  U V  Vs T e42W  U' u "0 0Q_U  V v 00QF_VD  U u!0 0Q%_U# A?G0CS >2,0X  R 00  @P4  0  @0W  V v 00Q_V pp0  @@DTʎ0 00\@\ d0Wpp~ 0w0r ,@pn 0g -LM, 0 0Q0 `Q0AϠ l040 0PX`lp U@  U V  Vr T d02W  U' uŸ 00Q_U  V v!0 0QE_VC  U u 00Q$_U" A?G0CS4 ><,00  X^4 00  @P40  @E0W  V v 0 0Q_V pp0  @(@DTʏ0 00\@\ d0Wpp 0x0s ,@po 0hG-Q0`A $ P !>3Sy < S7 S S S Q@3"Zp0   S S0ZS S S0>#0S S S S "S>0!># R0p !>3 S >3 !>3 S&S S\0X0>0400 S2 aB0L~ -LTMd h h@d @h@ l0 ``K$ l0 PpW:d <Q U@ * 0dR @Td05<5:T d @@PprMP$ 0 0( 0 0, 00 000  4 y 0SPP h0Sd@H0SX 0 +P0P00 h\ Q D0^ "0D0^dH0S0 y d0L R0Sk R0S`  0fP@ E U 0 FPU 0> NP@ h\ 0lc/0cOhP^*lP@pD0^ 0  h0^p@P:PP$LLLTPPYL$L Ld@L  0'0DLP^dH0SVLL$Ld@0\ dPP?p -L M@0TP 1>3S S 0P>3S ? S S 0@U S SS S 0P'` 0 P Fp, @E  0@ PP, P , 0@S8 S !S 0P` 0 P Fp@E  0@P 0 S S 0>" 0c O 0 > 0c" 0P` 0 P Fp 1>30@C0  @P @p1>3@!>#"R@D 1>3PLSJ1>3P!># RA -L$M@ ,@ 0 p RP`A>3S S  S PU00^ PE0A>3S aSV 4S1>  0 0r% 0 @Q00dS0  0dV0  9P   1S P1S 0sS ,1V >3,@0ca0 0@P@D ,@  ,00C ,0 ,01 , `{S@ S > 0  0cO0K ,@00 VP000 KS>30@C 0,0 @>P0!@># R 1>3@!>#"R@D 0a @ K> B000 K@K ,00Ps000,00 P>30 z V  VR  0R MS S  V`EV V@*0 S=090 0V V0V5:-0 SX S&S- S V$ V*  R rlA 00  R _Q 0VV r, 00  R_Q00  V V*0V S VV r@ 00  R_P V5:00 PA >3PA>3 S>3 2 V  0| -LMp, 00 Q,(P4 0 8 0 Y 0000AϠ0 P0P 4¯ < 0Y04 `<0P 0 V<0 @  V X  X T sp2Z  V' v\ 00Q_V  X x$"0 0QT_XR  V v 00Q3_V1 A?J0CS$0, Y00R0S0 8e0 4`0 80P1P<  0P00 P P0Z  X x 0 0Q_X 긠00 P@DTP0y 00\@\ d0Zo 0h0c ,@_ 0X -LMp, 00 Q4(P4 0 8 0 Y!00 000AϠ PP< 0`Y V @  V X  X T 00 P@DTP82Z  V' v$"0 0Q_V  X x 00QU_XS  V v!0 0Q4_V2 A?J0CS$  0<S 4< {P ,Y 0 8x0 4s0 80PDP< 00 P8P0Z  X x 00Q_X |0wX0X `0Z@n0h0c,@`0YG-QM@p(,P >3 S C S> #S S S P@Ѝ3"Y0   S S0 YS S S0>#00 000S S S +S "S 0>00 1>3 S 0   0S0 `>3 S >3` >3 S 0&S Sy`0\00 >00`0 S00h0S0`@Cca@-M ^@ P`pX\ Ѝ(@ \@Ѝ@@Ѝ@eE1ᄅ* -<5L|MHK0 @K0PuAe/e@ L L R *0S0L  L 0|S :S 00$@$@@L KPڄLPX00 LP`: @PX0L0P K@X0pP0<T K(@(0T0X K@00X0\ K@,0\0@L K40PL d K@p00, d0h K@80yp408 h0l K@<0op6[>lp K@4gp7[0Pt K@4_p7[04x K@4Wp7[0| K@4Op|00 K@P0Gp00 K@T0?p0: K@07p0,K: 0r 0Kn 4KjDDa^KHPEPE0! P@*|1 R H ?PD %X(L  P 0Pp KAA CXPX D0吙`@CPP  0媩P@( @<8PFPy`` CP  ≩00`HH L (  -LM@p$ M$`K ,PK 0 p P , 0S0$ 0C0 00 R  \ 0 S @0:SS|S0:S|S S  0-L@P0h -LM<@0S00( (0$00$  -ML8 M00ß0c S0, S8  sP "0S0@04 KAAkfP@R 08 0 C0P  |20  00S p0 S\R000:S #S <Ÿ ^0 S\R00~KpGpGP0 S 0:S  \S 0S0g d;cR0( *ᤨ08ZP KAAfP@ 080CP 0@81@\ 1 ,0S $,=HeBNK@D@D0 08 r0KA80 A@/0S@2Pn 0@a @00P `fPK08fP>$(  -Lp= P@ d@BP`$ d0:SS ^S \S $ @^ 0:SS00f^@A`}BP`VRBPfdqBP `d P00:P\00BS1P0C@ 0 0/S7SB0@@2S?Xdlt|Xdlt|00:00 0 0 00T 00S:S00ov -Lp= P@/ dAPP! 0d:SS 0`e\d@ 0:SS00e\@APAPPUAAPd P  0-LP# P 0R @ 00B SaBQABW0B\70BS>. 0 XRxR @@00 :S0-LP 0:S0@0&@0- 0 Sn@Sl -LM K"#vtOu*$r* -LM0`=S`pPƖ,KP@; U麖 P:0P00@S=S 0S=Sg! P,@@P 0 ,0RA 0=S 0S0 0=S=000P0 @0S 0S` `00cC Q AP@ 0 0S 0 @0@, 0k( p-L@`M@PKᢦP 0! 0S0 pk 0-L M@CH0P (0 $ 00K K(0@  0  ,P P 0Ulʢ* BƢ*A`*#ᄁ*@-@0S  S 0Sd@﫢*(異*Q0 a 0a$h*$%* -LM< 08 rSwS@T 00  @, ,0SZ 4K™PTpPH P < 0rS <0֖@4^,0@, P,00,  4Ė@00@T 0E@T< 0rS 0<4P 80M.4,0@4(T 40,?,?,P -LM☀@`T 0S `@TT $pK pPr0S V0000?u$, -0-LMP0 S@   R1 00 cQ  R!,0 k 0S D0(k -0-LMP0 S@   R1 00 cQ  R! 6 0S D0( -0-LMP0 S@   R1 00 cQ  R! 0S D0( -0L k -BMLMh#0P,0 0L4  0S 00,3 ,0S ,gD/㔑PL$H$ K2P@@v00 cBK J JH 兑MK@DPpP 0Sr\`0CK0A S A P2D4 H2@ K0C0C0  A  zF00C=S񟗗ꤼ0 S  1S!00 c0S p!C0L4 dϓPnL$R 060S3/(rk@-@^  0 S SS00N0 --L  l 0-LM@Pᓑ0S 080S 10S  +\ 0 @@P -LM@`P/P pWƥW0S `U @YT :0S =000@0PTP:@T TW[=PP  t 0֟ -PLUp`@: PP@ U:` `       --L p-LM@P\0X T`夅T < 000 たễ ph钅갫05lP 0000ӑ  p-LM(0`S/ r   P00 00 @T_Q <0@T_ p R 00c@_ 0(pP@ u0 0 -L * -2MLM#0@,0 s0/S  P BKAA G+ \p Y W3*WY 0P/S00@83 ,0S $, B/ 8P<P"P@aTnK`F`F ;0Z0pd   0 S/R  Rm/0 0 x2(K RW\)P L$P@ Y 0C/0h@+!PBKAAP@L<: S< S0< ?nK`F`F! PP|1@(K /R@ Y!Z 0 S/R 0 S*>K0C0C/  +㪄 Pp* +㴎p?00^ 0@C/j0@h>00SZ I, D\+㏎>00S8 B>K0C0C+< 倎!(0 -PLM Q    0@+ @C;PAp .0@0K=+P@ `00  K @ KUP@  Q00RPPU<0S :   ;Pn 0g`0p00 .000PP_ KݶPZ/000S| lPUl 0.S`   KP Z 000S0 S0 @c0Q00TQ8  ];0P a 0 0@b 0 峤@ Q /00b  00b0 ˠQ00 0rQ ;XC ;"00 0S 040. S0SZ 00PP 0 S/00a0 a f: }0 0;0 :P   + p-LMP `V p 0@ H::Բ`زp 0-P@L\Pe0 -LtM㬕p@  KP`0: S ᩲ'0 0 Np ::PP ;#;S + .:Pp  P`  Z: { p-LM@:^<0  00S 0S0q=  0 0S 0 0C`0}P %T 0S 0S0 0C` 8\= ,0S P ,>_P 8P@pxT.(`lpH`hpk| 100Cw:@3 @ < 0SU@0q:  0 0S 0`0CS0 ʮP MT|,d|Z @ T *000啎P d X2 `0 j 0 0 43 0P4#83 04# `83 Z KK @0S 0 0CZ @ S0 RT `XP T4#0KK@Q4C @ 0Z0C0   0S 0 R@X 0088 .P XZ@&43 @4# 0q 8  00S 0Z0C0   0SP 0d`83083 00\0q7  0 0S0Z0C @0 SP P7JZ!3Kg @+0DMSa8<8<<HHHHHHH``<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<P <#  @00CS0000;Z 0@XXTxT'  3K0``3K<#@C  43 @4C 8C@8C  43 @4C 43 43 H3>KXX7P 【<$00<3 <l$00S<3 ʮ<3 S  3K0X <# 4JZ!3KL @+0D:SF(44@00CS0000@Z   0@xeTET'@ 3NK0dF3K& MK43 4  43 MK 4 8# 8# 43@t44 @x3.KXx3>KXP 【  <  S<mP dA@C @KKS@p@@@@!@0@# <3 lP 43 @4C `4343  04 43 ` "@# @0@]d @ 0t<0  00@P@C J$@@C (<  d @-^R  \R n-\ @\00]\0S  R\ A]\ -LMP pR0 0V@ :000忋P`dp@V * 0 f0 0  fm -LM0 @0pP `冀5PP @ 00@P0  5PP 00_0 ;0P`0@  `VZP p0-LP@H l1 RV 00S  R 1S010 :000P0S  0S 0B0PB0000P 00 0R0 P0PS 0@ <08 0B0 0BP00 @0 0>P0000B9p 0-P@LT a DA0DSR0D@TP0 \(YP.T.Q0x -EMLM@H$ 0r/, 废'H4 YL h Pl4 Y t7 ,0S p,9!4 $Tǟ8(<,"(S\$ D ` 0 l YMPpDP 6 0YY`  \4`$ P T  S\4`$0Cd$ \4 V:l6 D 0 l %MPpXD(PR `V)*N` VX !*N`V H*N`V x*X4S TJ `\4CS\ d$R00V0#02S`4S T PY? L ""`$00R00S Y! 0S L0  CKA A$HkD4p cWH}D4 0D$ YYX^ X$ YR X Q T@ Tp XTp0% H$[ Y\ YY d^`` DTPD3 WX^/ `P" D4 0b3 RD :dd nl3TP:hQh ecT4  T4 H`D40D4 D40D40D4 <K <0S80S40s?2 D4%+[8YDlSP%D4|H$D 0 l $LPpDcPdd ``QD4!0 2P^D45p#04P 5wy D孈pCNK@D@D 0KPp:Pd40d4 ᔈD4` cpWw᥅D0l D4 D1PP*CNK@D0@D 0KPpPd$ d$ D4P0P eD4`p0D4 ^D4p cWdd ŲmD$H0D4 DKD$p0D4 0H$ VY(Tup||pH}Hx 0-0L@r/t崝P9M0s 0  0S 00Tup -L Mr/0P勝Mp X X0c. 0P  q30   00S 0@T tX3  00S.Q q0 3  0D0S}:\D ,pKn fG,0[S6 `S@ 0fS+ "bS @TV0S 1P Ƞ 0CP 0S` 2ySX`{ 㙄,0[q0@T t1  0 D0S:R .R 0P.S  gQP,sh!hh1H @0 p@@81  :TPz0P.Sl  ?QPp,J < 00 @p@0 0x@v+h0K ^7DPP'\0 */00c0[TupH|Hp -BMLM3@0r/, v8 Kp XY0S XY0S R0s R S 0S S X X0 SBKAAX@ Xt BnK8`F `Fn XF2(K Rb 0pS@ 0fSU LbS @TW0ST2 ,0S L,o60P< Ƞ@ <4$BPP&@$< 09Pp Q<0  F!0X0P 1 8$0  0 0 <0ySX p  b0 ]@tP. K`g0 , !ZP@p PPUZ.0K gCpA00 0  0 @ 9\-/00L00SS (  h(TupHpHT 0-8P@0LS((S0@0T   0-,PLP 0@T 0@   -L M0r/O븢4 0S ,K YSP@ ,0 S R@0@,  S*h ͕,0`` @#R #㱂P`,'UPP r` OP], 0 S S 0SN ,S!0p0 0 S S0 S S 1pP0`TPP 00U 0S  R00 R@@TP U 0S @@4 0 0@+0K 0 0VP4TPP @, 6OPn4 0 ,  P H0 DDSP WTup |Hpx -pL` 3P@ 0SOP PP OP 0S t0 -pL `P P@ 0S 0S 0P -鬁L0M 0嘡0 0` px1Z>*p8TP@P7 P N0 S S0 S S #TP`@ 0 SP P`+U`T 0S  R00 RPPU@ T 0S PX000 R X0W@4SP@ PᏁP $0W`4H@hx -L(Mp젟0 S( POP 0@`8PK P@UP00*XΞ    t@@0p!lL0\S@0 !$ 0^A(   HG-@M`@<T8 40 ğ0,`0#0c0, `0cC 7?04 #/(00 ( ~- 0 ~ " #~5 ~ !~7   ~9 / 00, ,: "#:0:"&!*  1 !00H,x P `@p` Ph%%),%\P0!ē @ 1 )Wh _)| 0* 0 ` 0+p0 `08000 @`@1p0lPz0p[0ˌ0 00400@ЍHKkx; -LM`0(K\p@P.  ($ 8 ( #"., K00K, `0@,<4 Ġ̌(<"4!Č <.̌ (0 $ t  -LM0`$S@ 3 R (PK0000e@SP0m _Rl zP `P;@ ZP@P5@9P-P.@0zS `S;0C ZS@S50C9S-S.0C0p 0@SX, K00KUPP2,pŸ * =? 0 7?0  ?0 4 [,  9?0 &?  3?0 ? 000  6?0 #? ?00P 0zS `S;0C ZS@S50C9S-S.0C0 Rp 0zS `S;0C ZS@S50C9S-S.0C0 Rq0S  0P0S 0 e0#R0L@0SP0SH@ {~@a 01S   @-!P.*@0 S0ԧ S ԧ RQ 00C210P*0SԧQ <0 C120P *0 S ԧ R 030P: p-@L$MaP2 ` 0( zX%X@ phH -LMp0@P 0 0`K 08#HT UPUP#08  0 S  .Z( P -BMLMr0D`K@P ,0 602S0$S aS@ t,0 S d,-@0$S>G KR K0Y@} P TKB}AK`Z0(H K:K4H  K@TK 0i TN:B]KAKx1 (PE(I(K @PE6I @T@ @?T@BKCK!"41"",!1AK1@TPZ$ @20@0  @*K0 ૒TK } rK @TK  T:k(` | H(0@-"Q*|@P0#!0\ "0'*0#" \ ! *0##? 0 \0:00000E-0``&&&C&̠O 1t@X 00#0P 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 0 0#0 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1@x 0 0#0 0#`&&&C&̠O 1@x 0$0#0 0#P%%%C%̠O 1@x 0(0#0 0#`&&&C&̠O 1@x 0,0#0 0#P%%%C%̠O 1@x 000#0 0#`&&&C&̠O 1@x 040#0 0#P%%%C%̠O 1@x 080#0 0#`&&&C&̠O 1@x 0<0#0 0#P%%%C%̠O 1t@ ̐0@@0#D 00#P%`&P`E-D0``&&&C&̠O 1t@X 0@0#0P 0#P%%%C%̠O 1@x 0<0#0 0#`&&&C&̠O 1@x 080#0 0#P%%%C%̠O 1@x 040#0 0#`&&&C&̠O 1@x 000#0 0#P%%%C%̠O 1@x 0,0#0 0#`&&&C&̠O 1@x 0(0#0 0#P%%%C%̠O 1@x 0$0#0 0#`&&&C&̠O 1@x 0 0#0 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1@x 0 0#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1t@ ̐0@0# 00#P%`&P` H0@-@P!0\#0 0(S"Ƞ0 -L0M($@KP"h0dp 0 8#x "W 0@2K,0 00 p,K0K  H,0 0("x00W0p@d  608 0#H,0T108#xW -L M((KⴠPp@"hh   0 8# "Y 02K00 40  z000# 00 s40 0#0K4 K40 00 0("04 Y @  X000# 00 Q40 0#0K4 K40 08 4#H00T108#Y p-LMH`P*$H ph? (-"xPUL`@: 08#XU@: (-"xPUL`@: 08#XU@: -pL MW`,*0K0 8 Ƞ<̌ Č40 ,K ,0 0 a,00 ,@[0P[p#Ġ"#" #8"(W0@ P`: -pL MW`,*0K0 8 Ƞ<̌ Č40 ,K ,0 0 d,00 ,@[0P[p#Ġ"#" #8"(W0@ P`: -pL MW`5*0K0 0#0P0 8 Ƞ<̌ Č40 ,K ,0 0 ,00 ,@[0P[p##Ġ"" #8"(W0@ P`: -`CL0V Mp@CPC,K0K6,K0K08 <40,0   Ƞ0̌Č  0 )0[0"[ ,0#40, [ -0[0"[ 00#400 [ 0 0#0Q`FVPE@D08 <40,0   Ƞ0̌Č  0 )0[0"[ ,0#40, [ -0[0"[ 00#400 [ 0 0#0QR-D?0 \ !Z  -LM@t@ğ0 8`, ~x &gP 00 0S$S 00R5:0PK c ax [x K Nx  Dx 'D\@ @'(`@ ?0(LX\ @c@@ '<@<@ (H<@ [H@ @D@ - K(DH [P@ @L@ . K8DP [X@ \/ KX [@@30K`0T@ 0 KP@ L40K, 1K2PK 84K ,0(S(h ,&T ( 0-PL@U !", 1#80!"$ 11PX 0h0 -LDM@@ hKԆ p0(h0 0'00 * 霠 d0  (  ly 0)pgz p`00* 00H '臠\  )  $0( jX 0 0'00 * 霠 T0  (  x 0)pgz pP00* 00จ '臠LP  )  0( jH0 0'00p * 霠 D0  (  Lx 0)pgz p@`00*00)COH臠 0'<00) 00 ( j8  '  ܗ0* 霠 40 0(00w )pgz p0  *  0'臠,00)00pd  j0*00(00LP 靠 0)00*00(w< p{ p 0'0 0)00hh0(0 0'00টT  j0*00(00༖X 靠 0)00*00vD p{ p 0'0 0)00th0(0 0'00T\ j0*00(000H  靠 0)00*00 vp{ p 0'0 0)00셟4h0(0 0'00ȥ`  j0*00(00कT 靠 0)00*00uH p{ p 0'0 0)00\h0(0 0' 00< j0*0#00 < i 0)0#00ud pz p 0' 0#00Xh0( 0#00 ꤠ0*0#00औ4  i 0)0#00thpz p 0' 0#00dh0( 0#00H ꤠ0*0#00,\  i 0)0#00 tPpz p 0' 0#00샟D h0( 0#00̣` ꤠ0*0#00ଓ i 0)0# 00spz p 0' 0#00t h0( 0#00T ꤠh0  (  0 0 i *s pg{ p00)00舠T0  '  ̢0 ꥠ( ଒\ i 00* 00r pg{ p  )  l 舠d 'H0 ꥠH00( 00$ i   *  r pg{ pP ) 0舠400' 00༡ ꥠX0  (   i <* tq 0pg{ p`00)00P 舠D  '  (  0ꥠ    xjVp $ν|*ƇGF0FؘiD\"kqCy!Ib%@@QZ^&Ƕ]/SD!7Ç ZEogL*B9q"am 8D꾤K`Kp~('09|eVD")*C#9Y[e }]O~o,CN~S5:*ӆ*#** -LM0p@ LP D00 00B S0`Ba0B\W`BA0B0S7`B R Q\S P Q'd???????t?????d?0U0P:0`d00c0CV0`ąrppp0d0C0pp -LM 0@Q`pPT*.X0 R0""00 0PT:400 30 SP:00,   -LM0@S 08000 -WMLM0@P=KC/NK, h5 @A (K  2@2  0IZS)0El`l`TEl`l`l`l`l`l`hExFl`FFl` H H H H H H H H H Hl`l`l`l`l`l`l`l`l`l`PH`[l``[l`l`l`l`@Wl`l`PWl`l`l`l`l`Xl`l`Yl`l`l`l`l`l`l`l`l`l`[\H`[`[`[]\Hl`l`]l`]\WL__l`_P`Xl`l```l``.(K0S 0(K0  00A SPڅ 10 A0 R0PC$^ 2S12 20 2 2"S 0c" 2 i eb\ R \ 202 b K).K?K + >(K *Y 00I SP100PC0 I R$Y 0U@@22R SK).K?K   00A SPڅ 10 A0 R0PC$^ 2S12 2P  0U@@" B\ R \ 2PB K).K?K G202 P100PC0 I R$YR   } 2S"12 2`202 VgTB   00\0S㬀K& Q; ':Q <Tq`>(K VR  "202 @"PaUU&0 "2 0RPEK2 " pUʄ6( "2 0R2 " p>(K R ?K 0C0 20Q2  pʀTp PfUUhE00@ "2 0RPEK2 " pSU0 "2 0R2 " p@ʬ" n` "2 0R2 " p\ʬ" "2PcUUş00 "2 0RPEK2 " p=U! "2 0R2 " +ʰ2"R2 S0K 2 K7P P ?KP m02 0@,0 S ,h KP PK KPKeYU K/ (PQ3@ "2 0R2 " p>ʘ"2R @ "2 0R2 " p$ʜ2PCUoU C00@ "2 0RPEK2 " pU0 "2 0PPK BKPKKP{K"Rڜ2RS20 "2 0R2 " p>ʘ2P`UU6A00@ "2 0RPEK2 " p!U0 "2 0R2 " pʬ2 p1 0 2Q02  KhP0KcPK )AKZP"K20 "2 0R2 " p!ʴ0 0 20Q2  p K 0C0K@ "2 0K*PKK#PK(  ̿8  0@ "2 0R2 " pL@" "2 0R2 " p9ʘ2PcUU1ڔ@00@ "2 0RPEK2 " pU0 "2 0R2 " p 20 2"0Q_KPKPK \AKPKKP~K2Sgڤ1. (K K0 "2 0R2 " pN Kz/O P 20C0 2"00CQ2  p ʆ?K0 "2 R0 KzPBK2PCUUڤB00@ "2 0RPEK2 " p U0 "2 0R2 " TPK $CKKPK00 " 2R0K8PK3PK C P`UU'C00@ "2 0RPEK2 " pU0 "2 0R2 " pkڠKPKdPK lDKPKTQ K00$0(0K0 "2 0R2 " ?KPK'PK % >&B`Ph( K0h`C1!`P0h" 00S00 0hV0 n0h0 @m`PV P00 U- >(K Pu`   2S12 2 2Po02 u@ 2"S 1" 2 2P0o2 e2S 12 2  Po V "  2S 12 2`   >(K ="" "  2S 12 2  P`"@ 2S 1 2 2P`2S"12 2 202 P`    2S"12 2`202    2S12 2 2P`02 @ 2"S 1" 2 2P0`2 2S 12 2  P` t)"   2S12 2`  " 000S" " Z2" "  2S 12 2 P`  "@ 2S 1 2 2P`2S"12 2 202 P` 2SK 12 2`  "  >(K ht@ GYgYT@y 2 -KS12 2202 -KP K/ ăP- >(K `< -KP㘃2KL -K<KK 2 GYgY|\ggYEeeY"fY \  ``y?(K R- >(K \0l``\`T ` 0`L K 2 S``2 2 KS12 2  @l\"  20" o  2S"12 22 /202 - 2S12 2  2 @ 2 KS P12 2 202    2S"1 2 202 2 2S 12pS1x2 2  P`" 0" 2  8ؿ2S12 2"80X T "  {P `hV`k`?02 VY K >(K`2S0 2 KP "+DKPK0Sn"i 00 -LM$p㴐K @4KP  , 0 4pK3pK2pK1pK0pK/pK.pK-pK刀8K  0Pڸ0@%SP@D @ 0AZSdiidiiiiiidcdid,diddddddddddiiiiiiiiii egigiiiiLfiiXfiiiiiXfiihiiiiiiiiiif$egggTg$eii`gi|g\f|hhihh\fiihiTj 00B S`ԅ100C0 A R$Q 0Z0 W pKK0̠ P0 @ W p ̠pKK*Q 00A Sh00A Sc 00B S`ԅ100C0 A R$Q0Р P0 @ W p РBKKc <100C0 A R$Q 2/  0Z 0 W p KKC .  0Z KK6 0Z KK+@ 0Z0 W pKK0Z KK0Z KK    0Z KK@ 0Z KK0Z KK0Z KK 0Z KK0Z }KK @ lR   0Z hKK 0Z ]KK@ 0Z RKK  0Z GKK  0Z <KK0Z 3KK}0Z *KKt 0Z KKi A  O \ 0Z KKWQW;P!0Q0S j j j j j j j j j jii jii j j j j j j jPP^ 4 K^ 000 p,0 S d,PȀ40 "xĐ (  -LM`PQp0 @ 0 w @|审@  b+~pw l( -LM @`PfT40 p ETeTpG/  P090 ,K0K0RtgTGTp400  fT@ I P0@ 0 R*00SC 00 0:0 g 00S 0@8 a P0h0b -0`P -LNMp0Q 0 P-0 +0a0ŵ0ť \00 K0 ` l@,/C!bL0 Rn000n^*0^0: 0eR  (gfff0 0-L@!0RP0L1 0 000Q 0t P 10t  -`Lp@P8#8S"!"81 ("((^ XU 0V1`P` !@ xp -Lp B/ bR@P`0ڃ0Rʙ V0P0 P @@ 0 BPU@UPe 0 BPU98 88S00000P0   0"108#8S2 "$"""!    -LM@;00@ -LMp`PW, `pP 00 R"0 0!@0 < 0@ , R40 @*004 T:aPX8` 4P @9*0h&hV 4@ p(8#8"(2, !#, T x:p0#h 4@ pP %82! 8"(#8P2! T, x:80X:0 @0R<  0>S000CS00 0>S 00, 0, -LMPp&EQ @T` P 0`S @c0`\0p0J@`0 1p q  -LM0b 0PUp@ڂ Ul R0  R00@ d 040 Q2 :RP 0E0e0Q0: P!0 <01R\3# -L@PP`9 @P``!p0@P `a(8#8"(0b! aL8U0CȠ: T * 8#8 "(L8 T0CȠ:0>S0>pGS p00`@-@0!"** B\0l Cʠ\7SL l0\20 -0pQ`5L@B 0` P0U 5 \ lU2><``6> U ` 6> 2.0 -L MP@4Q6%z00 600 T`,@ ' ,KP0 ,0 `100 ,02 0 000S  @0 W 0C>C5 `0C0 C>@0C!0B@`@0K00 0 @ -L MP$K`@0(Kp{ 0$KP N0bŒ\0 :CWP -L\M8 4 ] 04ޏxCPLP PP T T0  q0 0  RT  T 0-S +ST T 0 S/ 0Sw T0`/RX0 p9R 10W0C10W0`CT@p /RT@ 9RRHp  @EReR@@ 8L04T  T @04  +RT0  -R 00B S4T #0R 10BST0B0 /RT0 9R T@10 0C/RT@ 9RT@!0aPS^@ ` @ W @@ @lH@@ \W  H D IZD0 SD@00 HLNpIVP@ 0 bNWl aD@@0dPU 0 vNPV MU-ڮ"00p0lP dwhupslqto8QT  P0 SrN< ||@??ER$ U@ L`@P 0 4NU`ʄ5I1 0 (Na&j0jV0Vἐ5XH 0`l l l0h  ! Qt , K00K^d @@p T@,`l0L! 0P`PCP`P`^CN@6@lpP`U࠱ࠡ^ࠡ^pn`nPnQpdp @dd@ VdGd Zh h Uh;h Wp5p hdt 0< 0pcP tpM/O P@P).O MP@<p`Pp`zP/O cMp`*3 Z] Z/O pP3.O MM{KPH<p`\p` x0 cM 0 8Ma&jjZ dhhfpdtb<TK)H0 3MP@<PX46S / FP/ 0P - 7P`K5I /0 M 0 L1#:x":S5h2\ R `@t<\ O0p`qX46S X N0ndY*l"0y\0zi/ P . LP@F[O0<0S, 4`!6S \ <@T 0 LJ/ P@PH  0 L>x1#::646SX1#::C (< R%X#46Stpt 4P5?55?5???|<AMPe ,  xMP@ ERUlU@ p`@P 0 MLU`ʨ 1 K 0 @L`K O P`` K@K0 L0 ,L.O P@P5 P@P Pg@0QtA 0 @ n@ L0 @AL 0 @qt@  L M}/O KP@[/O KBL  40T0 T 0RT T@ T@ TW T 20R) 10BS0BT PX QP U EW !p₠1W`^W 1p⃠W1Ѓ`PT0 T0 00B STP 0RT 0B Q@L@ T0 0ST S}0T@P T@ q -LM, 0 0 S0 J 1P,  4 ptP8P - ` 8#8!"(!82$8!#80a("(40 (bA(U $Bh0SpG W 0SpG WJ0S , 0,P1`8P 8#8!( 8 H!#80a("(40,(bA(U $Bh 1 pRpG W 0SpG WJ0S ,  -LlM4 \80 p`@W00qdz01#:H":S !. P  002Q0 0000K, K0':ც᪪Zp T K J%00ƂJ0 KZ/ l J. JW/ JP@ ER/ J0 JH P PP QX 0 PP00CP0 X 0j@SP0S@dB C`@ U< U<@ E` ES`@ d0 ` 4 ^ࠃ^4 N4 40P\ PS%ꌌ,T4\?aCoc?`(?yPD?8p l <S񟗹ꀪ4H44444444444Ȫ4Ъ44444ت444444444444 44444$44444,4L000@ 0S`VLB0S<2  02 P@0Gh2p' 2. 2Ύ 000 0 00S 00 6 0pPPl1 ,0S ,|8 0000T1LQ:0@1 14101,1(10p0p0000000Pp7Pt p~lpK? jP@`&yV0@  Pqp1i@n(    P D < H 8 HTt  l | p  tm -"LM>@0> 0T@ ` 0Sk*@T0Z`c Sd2 R  mZ&fQ *6 p<K5(2<  R 2Pj@0T1 *jP<0@ 0< PT1:0S jP<0 0< P11 0F0 Q 0@0S P!0S@ @ mmP  < R000@@ 0f00  hj R<  0#P R<  0#PR 0#P L0 0 0 <0 `T t < H @  x   0@S P-L @ <0!RF 0q PRQ @`@` 0 R0!0  B8# 010 g!0`BQc R0liiP`VP@@`@PFPP   p-1LM `R@7 0P5 T00Q00SJ` t!* T|P0 RU 0 RUU00S p lDnPB 00c8 h |    -H3L M R0 ,3@T$f 3 R :##:S )f @ T[2 T,K2,P UP2 2pMi\I \E000C@; *"*2`21 2!-0\"00 ! RSR00Z0S $2 R 00 cl0OP@ 0 ZR Z 10 % f s :#:S `hP PU,P h @$ET P, UU` !@h1ShpWPU,P  h @$ETP,p U0 00 SR0 :JR|0 R0P@  nf bh 8 | L < @ H 0p  Ld p-PLMP8 0 R 0 R/0 R *0"*RPb%6 ` V#0 VэpK0@ T@t0 p0@ah!Rhpp 屍,8 h | L < @ H  -X L0PS HH 00CQ0 00l00>4 0  p-LM`0PS@'00 S0I0 0CR@0l T00\Q00Sp뵾 00kpk @  x p-LMl`0hPS@0X0T S0 ph?0 0CR0pphkk P  -pL0@S`.P0 0S0"T 20 0CR@0x T00Q00SLzS 00mkLdk \  x -LM` Pp\ :36021V 0RP!*PPq Ve0`0@0@0001300p jPK@\ " @0d!ST 21 @!T 0U '6 p(K0(@ T@0 0@)gQ 10 QX@ڤ21 Ln!@X @pn*02&60 ` p`< @ H P  -0LMR@0 0 40 p R d:#:SP,K0M,<(8 800f010 pPfP,`,0`V,`  f @$ET @`,` 00PVP" 'f1 S01l7@fPp,`,0`V,`  f @$ET `,p 7 F RǟW0 0d aQ0  0 6 vf01 @0D0 6 R6 RvP 08& 0Q@0 X600HP0@ 0 8FS46  0 4 0bQ@QcଌP`400a0 5"& ,6 0<0 D 0 2f0S 0#P` `V,`  0#Y`V,`   0#Y V8  0#YZ VD0SK 0SPC 4R4 9 ,0Sd00 AS 0 S0 0 4 P 008 Rh4   8 0#% R5052"080 B20 5#0@,0 e1SJ 0J#600S00  0BB#600<0Z@l @e1S 01,  00C 04#@ eP&,` 0;#;S`,` 80S8  R00,` R00,``,` ,`Vm " |e @$ET<0Z,`V^ 0;#;SW8Q 8  R00,` R00,``,` 彋,`B P0 S%*0S P40040  0 S*0SU@  @ 04 Q @ 4 D0P P0  0P00 0 S D0P Q0 P00P붻0040l4 08  4 ^ l4  0S@ 0P00Pt  hk  zb  gBlH   x  t  T <  @  L  p-LM0<P0C*"*2pB!0`36h1 Rb \] 0\& t!0d1 R1 0R p R 0S 00K  1@ T@0 0  id@01 R @T g R \ 0S * R 0S  0S: Pp3gIp0 P < @ H L -LM`t0p Rd0`V @@TJQ 0PES@TZ`ᆊVAU4x -``LMPp !0@ `0`VQ0@JDX a0P00SC/f`VX@E_Z  0-0L R, P0SJ R 0SX@ZP P P000     D 0 PH  C/f0!p -LM:L@0cP0S @0cP0SPaM -PLM\\`p@P0SpC/0pffPUX`EOZ_0 ,p -L0M0 @00 R/Xt|(4@P\lx0 (0 $ (K, K00KRdp, ܹ0 0K%ePd 0 K0 (0 $ (K, K00K-dp ,0S  0 0 0 0 0 0 0 0 0$0 (0 0 0(0 0 0 0 0 0 0 0 0 0 0 00! 0(0 $ 0= (0 $ z - LM0S!P0,0 % 0( 00 ,K0pK` @ 0``ep@ PUU00 0`0`( p-0LTMP`XK <@KhK0 0h0 \0XK< Kc"@0 dK`0 \0 d0 #cdS( M-L@M@ 0p`P{ 0 p`dPPk 0`0`KX0ԗ0S   0G R 4 40  1@ 0 (@\`$@TpPa`8@ X0pX L H T` Pp lFXKEP* <0 0PS` 00E0 @d@ U PG 0d KQ@@ 00勸00UX0 D0D$\ ,0$@(\ 00r00H~fm M0-LM00 0 PS0`" -LM,ş `,  (q 0  0  5 $0 K0 0 0 8K 匠K┐K80P800X0K00 P  0P   P 00 0 X 0WP0S0S 3`0K KP L ۖ 32a/@#b! eP pj `@HX KK⌔ ZhT(|P pp -L`M0(0 `0 \0 X0 T0 P0 L0 H0 |0 x0 t0 p0 l0 h0 d0 D0 @0 <0 80 40 00 ,0 @DpKP@`X 9PPP 0SG <S hf0| KT0 ` p h X P@ L t lP `KPH\ T0P W `P 0S`0S<:(dx p0PS0X0  8T L0 P@  8T L0 X 0 p -LM(@0$S  h` -LM@0SG00` -ML4M00Ÿ 0, K*KSTX{ K(JJ hPpb 0#S P@ PPP@ PT 0S  R00 RPPU`d@ T 0S X@T:KTPPPKXK(N$NJK(@D`$@D(`F (K@0 @P@T *KX K00X @TT0 ,0S P,0P ?,,P}`( p-L$M00 `P80 40 00 ,0 (0 $0 0 8@K2PP T P@ 0S4p -LpHMP`Dp @p  PTupp -pP@L`r/0W@e T@@)0@"p0V`@ h0 2 `@\0@#$0$ ("("4 400g@ITup -(!XL"x H` P S hSU H -LaS!!Q#7011A!1 ȠOS0!90IS0A0 !0xp00 cd1(0000 c( )S0! (a c0#7%c!c1c X@0CS08 #HT 0 @00ӈ 0  S0 900T| ?A7c%c!c1cW XEنH*:*8*<*@*y>*&$B*dL*fD* -@pLᜈ 0R 0SZ`0 P@0E.>? B7c011N0 d 0!T 0 L0L " L*d/uD*8*>*@*<*EنB*:*f! !ST0x0|P 0-0PLr/8U4@0, ,UB@0S0TupphpH -0PL4r/U0`Sp- S  0@W0 0 R@ 0T0\ 0S 0S0S0S LPp 0@W0 0 R@ 0TP 0PTup -AMLM,48 <#h0V,0 4  P`F&B~KpGpG 00PSP@ ZH00$H T00S4P 0S`F00 ,0S $,uv P(, -AMLM,$p(. , "h  V, 4  P 0 ,0S ,JP`F%BKHH 040PSP=@:H $H( 0"(lP0P`F S(@ -LMH L p r/0, TH` 9p 0 1d" L"0 R0t2 0<Sh2 l |2 p2 0^x xD R" P P |x0,X0S @㒟KoK%KAK  0@P񟗢H)TP tQ$ Dȟ 0 Sp" ,0 S XD"0S 0@SD2 wPҧ00D"UPOK?K@DH2L42  p70 S TV*00, bZ00`F@T@Q*@$?#<-"-0 0c`0, bP *0S  P*0SPlR Pp4 0 0  RP 00ӑ -RL M00 , *,p `PU 0 S0? 4` PU0S 00X: iPUJ0.S \S@TpPUZPU0S .U 0@- .R .R .^ABa0B" Q00.Q^APBa@BABa0B UT00B SQ 00\S0@B-R T0\S0B ^0*S 0.S S0S !0B]S.R000Q\R R.R0S !0C]S0S0 0   < 00 , 0 ( Ġ P 0000ӑ -OMLM@ 0r/ , iP05 - 0aPTE E E E U0 )1S|)\= K AAD !p7 !4oS- I>K0C 0C000S000@S0005\ =000@Q JY/0`00n0`A ` 7P@ d hwPpd  P7L< (K OKAPPI  < @REnK`F`F J4@@ ;P@(K R  (P&+(K0 S S %R0P S S \ \ \00\``V`@,K74 P`e  (P1+(@K0 S S+Pn/Y 0 SS S S ,S PPP 0bSyS fS P 0bSyS fS|zD (PW *(PK0 S SQ\k0P S S \ \ \00\@@TY`, 6 6P@`0DS PH` \ V!* \00 \PYP\ V: P P P 0S S S  <(Px((@K0 S SrUUo 0 P S S \ \ PP P 0T r0 0  R  0SMKL LL@K '50  rNN.K B0 B0C P0S  R4EYI4 R2% % P kAIT ,pN 'P&(@K0 S S U UP 1115  \ \ \ \ 0 SSz ;S`w 0 SL 5P ;Q Qq6  0P NKJ J  FPE %4!@% h1 5P`3  Q;Q Qq00  RP 00  PE4 l1 00 %h1 % 05l!$05  $  \@hl\@K P00 ώhO`  Q;Q Qq00  RP &Y  ! /P P PP0`30E R@ %5E $0$@ % 5 E  APt &P`#(K0 S SHY?P  E " H8`0S= UU`0` HPD SEH`P 0.\@SPpVP *T.@D 5PPV:00P0:0 000,0 S <,0fHPP ENK@D@D+P.4P ,`4LHP= `p,4`0e SDpPH` \V!* R R00 R0SY P\ V: P P P P 0S S S S000 4S1o/S0S .&$0 (Tupphph H| 0=h   * d x     -0LMP0r/L0pSD Y@ S S@0TP S S  %P`3$K P$Q |H1  00P0S0 ^00 0 0 00T R R R @0TP R R R0S %P  %P0:0t %P0; X %P0; < %P01Tup ac   <4<("4 <1QS0 W 0-L@PP@ T0 0-LM@ P K 0K  P @@Jp0 -LMKPA-M `p |20  00S3 0\ Pt A\ |0  0  R#0CU\|0  0 D R |0  0   Ra NA N.\ 0V54:Ѝ\ \| 10  00S 0hC10S <55556^*0S쎑W <4<("4.<0^* R0S8<^P0S R8<4X\x\PP P-L \hB/00h -LMP@`T,`K,pK 2P 010jP VX`@TX ,K E0V0.T00S` X   -"L$M0Z @ " P0` 00PUoS <0PUoK  0p  0S 0aPo 0  p`P v ꝙ 0^pK0-@_0 0-\ @0S  S0S\ -L M, ,P0 `@ t00  R-T@ +T@VV0Tg V0T ``YqqBBYp XfphX t0 0Q0@Dt0 0Q2 t0 0Q7 DW D@T%^Y \ 00T00S  d "00@\00T00SL, 00S ^,00E 0XSxS@`P p-LM`K$P PP@ 0S 0S @TxU p̘00,P 0Pp -LDM@@KD`KH @  0P < 0 8 4 , CP PpL T DPP P0 CPD@0U*0S 0 @T:L 0 0S 1gAL  Pp  DD\p 0pU 0` \`T0 @*0S 0 @T:\ `FV0#0%H0% %:H00\0 S2 S00T0  `T  0T0  \`B? `00p ` T ` 4?T0S00pp0pP` p D &? D `DpT R 0ST0S 0 P 00   X  `62` V`06` V  D `0S0V V p QX DXp > pVp p 0SV X H@@0 S S#00T0  T0 S000T TL000pDL0 T R 0S7T0S   X p`6 ` V`6 ` V0S V PX0 0S V X : p-LMP7.@nP`0  Q>0p -L M, ,P0 `@ t00  R-T0@40  +T4 @VV0TP V0T ``u@a@p$t0 0Q0@Dt0 0Q t0 0Q7 DW D@T\ W00 T00SG' p"00@40S\00pgS \,00E0XSxS@`P --LM 0 0 -- L 0 -MLM@P, `T< p 4Q& #$0K$K0 S2|4 ,0S t,M鄖X 0H$@W KHH 0($}B$4PP4 `W \ Q\ #0S0 0 #aBP PJ `0S ZJZ:00 00J žKIIR PK %R| T @D R@T<@  0P PJ >K 0CPcT RL K0 A ,P@)t W~ { 0  x2P`K> @)>K 0C1Kc@@2AlA H D< L @L =5jO07S K A 0P@ԕ07S  0\KclA18 A 4< 0 < 5mQ T00%Q00S  `@Dvr `W!X< APPD@`PeX } 0ZA 0 AP PJ `81 K@@ 0| P PJ ` 1 K@@#@ (08 U  -LM0@s N0000 -LtMp0|@ $0 " 0jP`KS  $0S $pAth KPK叀K*) BpPNPdp GI|(4D -PLM@R  ?  000 -LM@tN 0 0 0P0 -LM3 -LMp@`P0T@$K P,0 P00g Z@갪 -L\M `\, l Pt 0%S U 000S,0 S ,b@zTLb ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` `Tb ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` `|bbbbP`cdc$c ` ` `Tc `P` ` ``chctc|cdccdd ` ` ` ` ` `Ldfhddd `df `gg(g@gPg `Xg `xgggggghPhlh`FmƟtl 0RPgl0S\&1|T l0 S010l$ 0  tl 0l 0l5 Ϡl0BP lll@ N 0C`l R 0L0b0 B`l $ l0 0l(Pl 0S 4 l0S䟕1`|t 0lt 0PR l l Xl (t0Ϡp0 x 09x3a#`!1!1"I2Gq#1/2b11Q3b11Qdßp嬣` !,0/C!b ?@1c!bb1cA 0c0cs0 0^I^"XpGx3l#a1!1!2I"G 22`11R3`11R[[0a Ba4P P 0VS$ gS  _t 00  0 l0 S5l0S p4Ÿl  P1l l0cl1 l l0 S|ըŤldK8@KdKt !0 >hl\PPl@ 0h hKlhP\th 0\t0l 0l 0S$@T @dJPϠ0Bl4? 2cc1D1A(@P`ilH|*T$I\Qnm`Uhp=t -LMTp,@KP` 0  T>  0S (Q *0S0 Q*0S0 -aLA@_OReBd @Ap`@@qGTçPDdp@DW00ä?dpG@Q ?T00S L U'@(0 0Q|0 S0 R -LMP LL1R00 mm@ `  0@T1@0pT mmP ` 0@11 T!@ 0T p`P%P_00 0@T0@Tlpk0@Ps(0SHp0T%P00*L1H -#ML M$0PP,0 ` FP 0:S /S .V%P PU  0:S0/S TtW 6(@3(@@ T*BNK@D@D+B% +-+)..%PP DP-p@ #\K(PE PE#JP741 0-$0)(0% 2R,p\ \^3^P2P ZZ0Y0 YQ001001 0 e b 0RQ @Xp@X L0 0 QsX Xp@pL0SP7d0T7 @S^ XX 0X0 1QuM@p0Xp@ X ZX 0SX7. X X  Y\ 0S\70X 00CX 1 RXl0 ,0S t, XPU/?$P8P0(|+rL0S0 C,S R-S+S0SS0SSP@-@  00L S 100C^00L S^ 0-LMPK@ 0P 02c2c20 :R 0 ;0P 0 2c! 0:S<0 P0 00 0-0P-SL@P +SP  U0 0c00 -LM0@JS: MS 00C S00 0P 0/S00    00  0qP 0.S 0fP 0.S 0 0 00 m E-P@p "22a11\3a11\p0Sl S  W02c2cZ@]E ;RPS J^P WXa  102c2c^S,! 1?0c0AZ1`L ` !Ϡl  B 111F/N!b  !@!A! B 0C`aR0B S B^ W 00T` 010S^ 02c2cS002c2cSQ*gfff$I -RLDMP\ ` /\0<S \0@0cd0 0S TKP@ IP00 `R <R `@ ~`@a0S,S ;S XKP@s 0V0R00S D ;Q,Qh Qd@Q` 0011P'RL7`c \\%0011P'R\\ds01u.00\'RT0 0f  P'L7R`c\T0X d0c bL7`'0 Td7 PhY 00 0 0 SmM @ \="d Y0@ `2"@<KnP@ 0,SPKeP@ ^d TX0]~h al0 0`p LP7`Tdh 0< KhX0@hP KT0@000@000 L1`"`!!X1X1 !h0 "b"b3h0 0XTڄT0>CX0 &@>`@ 0@>S``@ T00c  L7PTdg\ >0@>S\ @ bd  s$<0\@ R !`0@d T0 Q -@LM$0S h -@ 0LS0 00PhHi* -@LM9h9Pi 0-L4P@8 P0Sh!P. 1$PP!\ 0m ,TǃPǃLǃ 6!0hP 0:S H HP 0 ,!00hHiHh* -@LM9h|9Pi -LM`\p  0P"P7 S@ u RA @0S@AL0 Kp ] P` T70m= 01(0 R0P R0  A* p-0``0^80 ``V0u 8 ^N 0 0R 0 0R80L080 A 0V?HE.²QScQ$Ių -Lhu -L,M@<Kj0 Q 0 Q  -@p0T`LP 40c0h4 -@p0T`LP30c0h3 0R 0R 0R 0R 0R 0c -LtM0 00TK0SPPK?L@K< PhHK Pb@P儀KDK P PY}PTH^DńPڜ4^$ڔ4\  “Ϡ2l1Q`3l1R1R`@4!bH XP/H4^DńPDP$O2d1ap3d1U1UpW 00# 0A0d^ \D H0 0D0 )PH d!PT0;Q@0 v>8# 0ST Ŝ ŏP@@TPZ@ကK?0/0S0 P S@ ňK   P0SÈ0S S UP@P0CS0 @0S0 PʷTKP4\>`0 S; (("(Y 0@S1P1P}R pRJ0 S @TpG4UZ 0`S1PQPJP7  S K`VPE4UZLǕ0 00n0  0STK P` 40R00 ? \0#S gK    P00:TKwPT;0 T0 f QuPLDP0\  “2a1H`3a1R1R@0!^H PPKTK< YP 'lnQ~*lI -LMp@P`\ 0 ~ -MLM 04( S0 0ł>K0C0Cp0 D8 ,(RJ 00S1 P1!88 8( 80QBKL !80Q8(0@ SJBKL@8( 1SA0@(K@1 @( QZ@0S<8 <8.K B8(  0 P1H P'R <(@8 R<( @8XH8( 0>K0C!88!aPǖ\04(D8@X PLLGdUPP P`,8SL'L 0 `bS00 0~lI* 0-4PL@4  Z@40Pi~0 0 L8 0 0F8@0  R J1u  0Q R@Z* -LM@K$0c -L M@K$0@K 0 `RA 0 `RS  0 `RS AR b-  \ 1<20 0 \ ?\"00 0QS@-@0c  \1<0   \ ?\0 @0 @\ PT0 0 -RLM@8"x8S,0 `0hȠ,Ƞ*H&$!PQ # 3(!( '#P020cY ! C2R `0 !8,0S&hh0` 0 Q 2RhF0P13P1 <2 -(0(   1P ;;( ;S0 0P0 -LM`PP0@ KpD0 K04 4K00M00Ѝ -LM@Pp`EUW 00-_u@T0-`P\9p T0 R @  S$0 -LM`PpP%J6 K`P`,K0 0K00CM-00!OO$P`0"&pЍ -LM`Pp, H0P`pY ,0 p-LM`P@@@`@p -1LM0S``V$ P@pSS PpR SN $8?S @ U=|:JUT!0000à@T  RP;?$ $  u00Q0SpJe\0 \03  0<$0 00P@ $0P0?45WCpSpp p-LM`P@l@P@` ph -LMPP@`pW P `034 `RE0E0BUPU0H @0`043P 0 00` -LMdß@TXp, 00 ` T W 0^0T3("S*2V ,P0;,P02S|5P3 T T00W00ST00W\ /O0`PP#>`P`P`0O/ <`PP`V%^!000P 0\P2 000 ,P 00 0O/O0`*0`@0@ P` 0``!v00Q0 S  P (1U:  |0#03  ,K0f0K "Y` ^X,P0W T ,P0^,P0T^,P0{0^0TD -RL@M@p $0 0 $ ` `AG P@U0e $ e0(0 21%$ `e( $0 K(K$K$P0 P O4  b p-PL Mp_@@` P0Q S0 U UJA>`o0OoPJ0P` P 0 `p0`S  0 S43"?S04# 0 0 p-;PLMDUEoJP V 0T0U00S pp~UPD 000p5 D" 0a4000V`p -;L,M\< 8 * \PoO 0^8K< K`P80C8 <=PoOoPJ  0P` P`PD @ `Po4KO0^`P,0P`$+`P -;L`p45gSM 3^@$P 0 )V! W2 0 KN0^0 ^0n03  1>0$0 2 A$0 AB B0Q0UzW V2$0 n$Q0 Q03  01$0 0P0S;V V ?"0!P -;LˠP` 45fMà3^@p $0 $U V1$0 N$^0 ^0n03  1>$0 0$0 cAH0Q0\U UP` S:\: 0S00 lp'V U Kn<Q0 Q 03  010$0 1$0 0P0S ";Ϡ\  Ϡ\  y -;@T;LM/UT`ᠯ", (@ 4P 0 H X9 T^(K, KV0X4P 0K4 KM0,4sL'h$H X!1"4 R0#038"8(!,6.(0\ ! 2\ 0C QCR ,p 5U`; i^0U0X00S; -;PD;LM0/EU"4 0P ,@ (0 h Sb ST P ?45(K, K0PU4P0K4 K0P,0454( S b4 ࠑ}~ ,0 4 p?0S`,Ƞ,Ƞ(XB[ 4!Q0#038!8 5"40P 20bP  CR`P`  0P0!02S `FT ^S ;T -;0LMS@ ;0S P  00 45S P{P c45S;0 S-L# ;0S ?S S 00 P *S S 45S 345S;0 S-L# ;0S ?S S0 0000P *S S 45S 45S -!:**@LAB14LM\?@(0R\0l0&03  T`PT P TQx 000T`0R@L0R000 000 l>"0   -p`':@ナ7DL⨊ MXO<0KP  @KX@0H1@0 A@ 0?48@K5 0 ( -LP@K4MH)JJp,jP@ 冪 #T # 3(l0 $(h0.%pH(N.l # R2^P2t 3#S#3t@p#8$0 (, PP@2`3`#\ # 3(t0,( Ƞ##!@ Q020S ! 24`h@^ ! 2ldxY00RKAH D L0 *L`H0DK HKLK0D @T0 0` 0O/ l0T Y 00` 0O` -LP@KlM`K PP<,JXJ@ ,Jᄪ@|40 X%X "| t #[,Hs[2,.\0#03^#38,8 Ƞ&.x 8 "# V2R02 3#h00c bVQ0C2Y0C2S`h0 fh  00|00|0 H0 DK|D 0HKLK>L`dD H0h`Pxt@030# 3# h \|L| h|H ph0l@ 3 #030#0SPLh P DP t ` 0/O PP@Z ` 0O/A?O`PP` -p(  LMP`P' &:::S@ W @0 O00X64460 PP 20460@ -p(  LMP`P3 &:::S@$ ?S@ S@0 O00W VUS S X64460 0460@ -p(  LMP`P3 &:::S@$ ?S@ S @0 O00W VUS S X64460 0460@Q0 0aQ03000100P0R b0@- @P 1<\0 0 ?\4 00-b1R"  @-Sc@#0 401  00S20@-  3#@3@# 0  0bQ@2c0 0@-Pc0 @R#3 e d \@2 n0Q@20p@-X h%X ! $ T#3 Ƞ$ȌH.@!Q2pG-(!X  "(!& ' V#3W#3 Ƞ&Ȍh$a*'x%p,Z@2\P2 3 #P$ PG-ȠM!h,Ƞ !#8() X#3 Ƞ"( X(ȌPA*% ᑌ,Z@#@3H*H F' ᙡ&,QP2 Vp2` P@3@#\#3P, Ƞ%".p RP2 3#^#3@ .,$<0\@2@PTP28 40@0 PЍQPP  :Q00SP  :Q0#02SQP -P`LV@cp0S  SP@D RCA 0\R#R! B -L M@KFYPT `0 -L"ɠ2l3c13@"c1MP 1K0  & C -L^M⸠p`OKPC/MK@( h < 8 `&Vat0V$KOK`?cKpG 0@FfKq q A A 1 (0S (( -PLKTP(K@0CP@ 0C4 d B P@o 3( K!$(,"( R`*R^ 2Kp2 0 IF>K0C"P pt0,^0S 0t t h wdh$`0 K@P@ @$"(0K!48<#8 S*S 0H T H0L P J I@  Lh@hA Hp\ 0p4Slgp PBNK@D@DhL!L1#p@) "pPw0#SEKEKALK 0 LAIP4 \ X T #X4P$0P 1hP00p$RhPV0(0w 0<(@x -LM` @0 0\ `0V -pp`@LTP S P `@T` 0V0000h逸0w -LM$@0 S 90i -LMPp`P@b ,K0,px!0#p  P @\T`E,0S dddHHd d dddddddd( 0"00,(0 $" "p P@T` (pP0P (0L 0 "(0 ذ U0l<cd -Lh\P0l -L  hBl -LM`TPpP 0 S S 0d q" 0 0 @0$ `"@5m -LhP0 --LM  -LM@$  0$0KQ \  0  K 1S01 -@LM ui 0-LBP|@ 0S L| 0SPeT 0S \00LS `000 0 -LDM@ d P dP`} 0Sh 0S0J0@ @@`KTLpP dP00 H XP L T@ fXKP0SVX !/P0P0H0STTA 0@81H  8EP ;#P0@ 00ou00p0d  N X%4 40ᵶᳶ  `0X@\ 00Nu00 00(@, 00Bu00mh -LTM` `\ h0 0Qd 0p KLP0|0 pK0 0Rx0  x 00$0L< 4 00h[  % 0-LP@P0  P 0S S-P 0h'0 0-L@PP 0S S 00h0S 0h 0-LM@P0S0P  \0C 0 0-0 0 0LS@P 00S 0S 0S  0S 0hPpLx000 0 0 0 0 0 0P0 P 0 0 00 0-0LS@P S 00  0S S 000  0 S 000 000 P0-  @ , @-0@SC @<4(<"4!<0  -0S C   <4(<"4!<0   0-LM@0 SKCP0  <4(<"4!<0  -LM0@SK C < 4 P 1!0 1!( 0P1D!D, W00  ,0i- -L`p@ᬤPP  j dڤP -0LM@ ,0( P00 0-@LPP P \ 031 1! \!00Ic0@'Dc0@p@-0P0 @ 0`0  00  00  00 0 0 0 0 00  00  00  00  00  00  00  00  00  #0 0" ! !0"0 # '0$0& % %0&0$ ' +0(0* ) )0*0( + /0,0. - -0.0, / 30002 1 10200 3 70406 5 50604 7 ;080: 9 90:08 ; ?0<0> = =0>0< ? C0@0B A A0B0@ C 1 G0DFEEFDG ` 0V0pG-M0 咀 0P0呀 @P`pL吠叀 @P`p0P0 0 L0 0 0 兀H儀0D僀@@傀P`p0 <偀8 0 @P`pH0$0D @00<8000tw|04vx 0u0 ~}|{@zPy`xp,t( 0 @!P"`#p40$00%,0&0((0'p00 ,04h jl0r s0pon@mPl`kpdq$i hgf) *(0+,-@.P/`0p$0< 10 @2030405080\ \`0be0a`@Xd c_P^`]p[ ZYX9:;@607 8p0T@?0 @0A0B0C0D0^T0 0TD E0FG崌⾉0 0 ZЍ -LM@p4 00 , 08 40L0 Ƞ< S,ȠL 0X0C8#Ƞ3 X0 08\<#X5 0<0e8#h < _ X0` 0n0C 00,`0 0X00 00C8#Ƞ Pp@00 0E8X#X4  R 0("X0e8#h 8 0`0l0C0 , ` 8040 ePp80 4 4P㌠!\/ X0 08#X\< " 0<0e8#h<  `Ie00e0 `0@040\ 00C8#ȠQ00X @ -LMP @p`0B8S`RE 00Q 00lU@PT3 V  0S 0Q S0ò000 B0 00C0C0 0 00T00 YUU800C80N0 R -LMP`  a("H T p 0 ʲ0S T0 fP  `ZQ0 Ppd`P 0 0b8#H Tʲ0S  0- LP@0S 0\P 0Q 0S 0S 0S00 -LM@ PQpl 0 RX 00 P) @Y 00d0 0S 0S 0P  0(1 P$1 0$1  $1 0(! @0 d Ƞ Q`ἠ,kP   04p  0 S  1 0_0 00 0S0GP 张@`0 0S07P 0S @ -LMP`  Q@ n, $ 0 0S0P  0Pp 0, S 0 ?  W_0 0  pP!kP Y 0(10S$1 0 ! 0S 0P  0P$1 0$1ꄠ 0-LMP @p 1 00 -L M`@ A nQP, p'P"P 0 P 0, S 0   ^0 0 60 0S0|P  0Pp -LMP<0 80K0 Kp `P@Q0, 30 <KRp8#80CY 0@00PP08#X ("X 0 P L 00< 0@00Q<Y0A  P00< PP< 0P -RL M`Pp 0 @T 0S @RT ͅ0! A0@ &P@ V00  P V, 0 10 731 B,0  1@01S -L MQ 1pU, 0 1S{@`x 1Uu 0  \0D 0S0SZ 0 0<3Q B K  1F 0 10S% @ ` 0 Y \ಐ\% 0 Q10  @0 @00, S00 0 P 01-0Q0 P0 P 00 ` P@ 㜞PP  唞P@  1S0C100! Q0PQX 0 AQ=Q10 -LMPpPmP@ R0 X 0W@ P  0~AT \ t0_ P @-0@0 @0!00  RCA 0\R! BQ'  0R!8???t?h?\?P?D? 2 2 2 2 2 2 2 2Q 0S !0S: 0-LMPK 00%0 @( 0ST 0S @S 0ST 0S`]Q  V] 00 4x10*2 l 0-P@TUL P :ᄝP@  0[\ 0 0 p-LM@ P$K, ,0K $0 (` ` P `p -LM`V (  0SP@ p`@ V`pV@  V 1+#,PP 0p0`S0`` 0 @00, eV`pV@ B<B S=  P UP! 0 0e P0 0p0eS0`e0PVPV: ,PP 0 P0f  000]P P*0P` 0PU:'P 0 0c  0P0 V,` `pV@ ,0S? 0Y 1! P Q00P00S$ Q ,PPkY 0p0eS0`e^ P], P j0 0e 0  `000P E  IP0g0,0 B[ 0 03 0-0L @R5 P-  0P @0P 0P $00 0 00 QB< S  0  0 0c0 00000Ġp p-L M0K K@C 00p!` PUhC 0 SP P000pRP` 0 0 p p-LtM@PP`KP0@  P  Q 0 L P  p( 40R p; 0p0+ 0 pK -LM`p@}PP6T 0 0S)0 p@ 0S 0000 0E#10 0@S000!0 p0 P P 4x -LM`p@6PPT 0S @S 0ST  P pkT0 +p@ 0E#1  0@S4x 0-LTPM@KT 0K  0  @@mpj -LM`@ 0pP` -LM@|PP/0:0 p-LMP `@0 : 0ph}) -LM@pP  0:0q0:0$ -LMp` \0 P@ P@  0-L0MpP0 @0 0SDK@ 0S ,100@@(<* t,@ P-L 0 hPY 00h*M p-LM`0p@T 0Pd@00U0  ,PP`@Up0@00pp -dpLMW` P@PUJ0SX@PUZpW`R @0S R@- Mp-LM0`0 @`p Mp-LM0`0 @`pP@-@p `0S0S=S 0S=S PdP U 0S  0R^ 0S ^0=S P00cC10k -LMK -LM0K *P - LMK0P -LM 0@P@ -LM 0@P@ -QRLtMp` 0@S 0S@b@DT*@X00 0P0XR00S @ZJJJJJJJJJJJJJJJJJJ }J xJ sJ nJ iJ dJ _J ZJ UJ PJKJFJAJ=Q:Q:Q:Q:Q:Q:Q}:Qx:Qs:Qn:Qi:Qd:Q_:QZ:QU:QP:QK:QF: QA: Q<: Q7: Q2: Q-: Q(: Q#: Q: Q: Q:Q:Q :Q:QA ? QA ? QA > QA > QA = QA = QA < QA < QA ; QA ; QA : QA : QA 9 QA 9 QA 8 QA 8 QA 7 QA 7 QA 6 QA 6 QA 5 QA 5 QA 4 QA 4 QA 3 QA 3 QA 2 QA 2 QA 1 QA 1 QA 0 QA 0 \aBC`B0QA 0  -LM@YhV -LM@\Pp` h^\QU0SD R 0S=W00  00CS]X]]]]]]]]]]]]]]]]]]0 0RU00 1 0 0 ;00 0 0 R 0;S< W  4 &U 00!U 0, r@-Q:@- R (2 R R -PPPP RrPP B PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R@- RP1P P1P RrP1P  B P1P B@  R010 1  B R0q0`0q0`0q0`\0q0`0q0`0q0` R 0\6 R B0@-81, Ġ%̌T$\D#L0P  R0@ Ġ01#̌  R R B0@-81, Ƞ%ȌX$XH#H0P  R0@ Ƞ01#Ȍ  R R B0@-81, ̠%Č\$TL#D0P  R0@ ̠01#Č  R -- L`^M@pTA0TPC/M_K 0 KKM?KPE@`1 4a 0a d0K?aK@D 0KQ |A Q A w1` 0S  劚(P+-R0 0c BSR48 R p-@P`x BRpR0 BRRR2***x *J* -LM, ,`\0 4 P u00  R-UP8  +U8 P4 RR0Uv 4@T0U 4 4@0K/0 h@K @@K< pu 00Q0PEu P!0 0Q4 u,A 00Q7 EW EP4U%\ X  W W0 < U00S Sp"00PD@ <B"D@p$$ŏ X008Q\pw0 R \,00F0XSxS0P40 `b* -p@L00l8#hP 08#x `0 0c8#h08#x 0b0C`p`0 -LM@P 0S p7U0R G0`8U#h 0  bu Rʂ0 S00@0@@0@Rڰ 0000G000A8  B8 000o -L4M@ 0< 开@ PD p <0Px D0@ 00  0 ZH P L *P0<S`R0000 l , @0g\0KH8 K8' 0080 0 c4 CP08#8P0 0ZpPP0n0 a B 00ഀD   000#8ᲀL  L 08# aL0 00`0ᲀPD  0<@ D   000 -LLMT X PpP 0L8#hL \\P ` h [00C8S 0@TL s \d `E0S@@KHKd0@ @ b 00H0 0L c@d@ P P3 0S 0 00S L Pp   00008#h\0 0S\`0S L'\0S 0 00S\  TLPT \ \  hT 000 0a0C0 h 0b0C 0X L0PX L` X0@QPh  L X` eX 8K TP X0LPFP4PT 8pW\ 0 RL0X P X -LM@p0Qs P`0 R=V0e S0 0RS 00P U*V0 00Q *^ 0kP@  0Y008 8(40Po P0 00S"P@ 0S 0 00S 0P  Q p-LM40@SP`$ 000`!H 0 Pp0000000 0 B@ 0p00S40040 -L M`pxQ  0 0C0ppSa <0R@W  P@0P$p  P P>Y 0S00C0pp  ,1R Y 0C\0K 1 00  0 !0  00[\002K)0[* [0 0\ʌ0 0"K+ [,[ \OO0 0@0@0<  JPPBJ@ @00@ -L MPx`p@ `  1R TI 0CP0K100  0!0  00[P0Z" <0W@  P@0Pp  P qOO0 0@0@0< J PpBJ@ @00@0Tʀ0 0"K) [*[ Pڸ5P  -LM` T0H20APP p0 101e  d` 020 0  崜8Q0 00P -L M  !4 0pD $0@SQ!P40 BU00 ,P 18aV U 0, 1 CU@  T pb @ TPU00ZD0 $0@0@@c TD ZF !4 0@  A@ D@ 010CY ?=2!I !U08#X&ʊU0 aP`40@ D0 T0D0Z 1@@ AU@ D 1 CN001 :zNd@?=2D  $0!E!P@T$ U D0T P U D0TU1@ \0@bT5У 0$10C@/-"@dP`S\+ -0p8#(=1@0@A0C$0^^ 18a!$ BVLP ?=2!E.!h}` -LAMp0P 0 NANK0AnK @D `FS@D `F) \0 0 AK A0A $4 fi0s1 aR  V 0 pS $ 嘔<(x+0++ -L MⰀ0ሐ` 0cV8#Ƞ, F0@p P0 00 0c8#Ƞ 0 밀,000 0Pc PEP00@ -LM1@QPap 奎0 Rp8! ,5P8q8ʎpR0-P@ 0bR03 B0 -Lᴃ%s: %s not compiled in instbinUsage: %s ..., where is one of: mount_cd9660dfmountmount_ext2fssyncnewfs_msdossttylndisklabelpaxtarcpiofsck_ext2fscatifconfigrtsolping6kbdlessmoremount_nfsfdiskgrepfgrepegrepumountmount_msdosfsckmknodwicontrolreboothaltmount_ffsdhclientcpgzipgunzipgzcatchmodchgrpchownfsck_ffsnewfsrmmtejectmkdirksh-shmvexprdmesghostnameP`d  l8@@tXx|Љ #@@cbsconvfilesibsifobsofskipno value specified for %sunknown operand %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationscbs cannot be zerobuffer sizes cannot be zeroseek offsets cannot be larger than %qdconv option disabled%s: illegal numeric valuefiles is not supported for non-tape devicesstdoutinput bufferoutput buffercase conv and -DNO_CONV%s: end of device%s: short write on character device%s: short write on tape device%u+%u records in %u+%u records out blockblocks%u odd length swab %s %u truncated %s %qd bytes transferred in %ld.%03ld secs (%0.0f bytes/sec) summaryskip reached end of inputh (4<@HPXuserquotagroupquotarwautoaccesstimeatimedevexecsuidrdonlyupdateegjo:Rcd9660%s: Filesystem not supported by kernelrealpath %s%s on %susage: mount_cd9660 [-egjR] [-o options] special node %s: illegal value '%s'needsdoes not need-o %s: option %s a value-o %s: option not supportedhiklnPt:retrieving information on mounted file systems%s mounted as a %s file system%s is not a local file system-i is incompatible with -Ponly one -t option may be specified.empty type list %lld %7s%-*.*s %*u %9u %9d %5.0f%% %7u %7u %5.0f%% 1K-blocks%-*.*s %s Used Avail CapacityFilesystem Mounted on iused ifree %%iused Size%-*.*s %s Used Avail Capacity1024-blocks 512-blocks%-*.*s %s Used Available Capacity Mounted on %-*.*s %*d %10ld %11d %5.0f%% %s df: %qd: %s usage: %s [-hiklnP] [-t type] [[file | file_system] ...] ffsext2fskerberos uid mappingNFS exportedanon uid mappingexported read-onlynoatimenoaccesstimenodevnoexecnosuidwith quotasread-onlyroot file systemsynchronoussoftdepasynchronousasyncexported to the worldAadfo:rwt:uvforcerqnoauto/var/run/mountd.pidsignal mountdgetmntinfo:@nfsunknown special file or file system %s.root_devicecan't find fstab entry for %s.%s has unknown file system type./usr/sbinexec: mount_%smountfsstatfs %s%s/mount_%sexec %s for %sno mount helper program found for %sforkalready mounted%s on %s type %.*s: %s %s on %s type %.*s (%sunknown flag%s %#xv2v3udptcpsoftintrnoconn%s%s=%dwsizersizerdirsizetimeoretransmaxgrouplistreadaheadacregminacregmax, %s=%dacdirminacdirmaxprmounthardmfs%s%s=%lu %sadosfs%s%s=%u, %s=%u%s%s=0%omsdosshortnowin95gemdirexecnorripgensextattprocfslinuxversion %d, ctime=%s%s,%s-o[-Aadfruvw] [-t ffs | external_type][-dfruvw] special | nodeusage: mount %s %s mount %s mount %s [-dfruvw] [-o options] [-t ffs | external_type]special nodeufs%s: fstab type %s != disklabel type %s%s: fstab uses outdated type 'ufs' -- fix pleaseh (4<@HPXmount table fullspecified device does not match mounted device%s on %s: %sfilesystem not supported by kernelusage: mount_ext2fs [-o options] special node $FreeBSD: src/sbin/newfs_msdos/newfs_msdos.c,v 1.9 1999/08/28 00:13:52 peter Exp $%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) %s: can't read sector %u%s: can't write sector %uNO NAMEFAT%uBSD 4.4%u clusters too few clusters for FAT%u, need %uwarning: sectors/FAT limits file system to %u clusterstoo few reserved sectorsno room for backup sectorbackup sector would overwrite info sectorno room for info sector/boot/%s%s: inappropriate file type or format160180320360720120014402880%s: bad FAT typevolume ID%s: bad volume label%s: bad OEM stringbytes/sectorsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorswarning: %s is not a character devicebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %u-%c is not a legal FAT%s optionblock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: FAT type limits file system to %u sectors/dev/%s is mounted on %s%s: unknown standard format%s: can't figure out partition info%s: partition is unavailablegetdiskinfo%s: unknown disk typeioctl (GDINFO)%s: can't read disk label; disk type must be specifiedbps=%u spc=%u res=%u nft=%u mid=%#x spt=%u hds=%u hid=%u bspf=%u rdcl=%u infs=%#x bkbs= bsec=%u spf=%u sec=%u rde=%u%s: no default %s%s: illegal %s%s: bad %s"*+,./:;<=>?[\]|usage: newfs_msdos [ -options ] special [disktype] where the options are: -N don't create file system: just print out parameters -B get bootstrap from file -F FAT type (12, 16, or 32) -I volume ID -L volume label -O OEM string -S bytes/sector -a sectors/FAT -b block size -c sectors/cluster -e root directory entries -f standard format -h drive heads -i file system info sector -k backup boot sector -m media descriptor -n number of FATs -o hidden sectors -r reserved sectors -s file system size (sectors) -u sectors/track ȟП ؟lܟ<x    hI (:(,048@HPX`h p x#3#3233#@@P@Ȣ@Тآ $,4<DLT \ d@l@t|<ģ̣ԣܣ  $,8DLT\dlt|@Ȥ@Ԥ@ܤ@    $,4<D@L@T\d l C$tC|C$Cĥ̥ԥܥ  $,@4@<DLT\ddiscarddsuspeofeol2lnextminquitreprintstartstatusstopsuspflushrprntoption requires a numeric argument -- %smaximum option value is %d -- %sundefoption requires an argument -- %sillegal gfmt1 option -- %sillegal gfmt1 optiongfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:ispeed=%d:ospeed=%d %s=%x:%lxoflagospeedlflagiflagispeedcflagcbreakcolscolumnscookeddecekeverythingextproclcasenewoldostartostoprawrowssanespeedttyillegal option -- -%s%d %d TIOCSETDTIOCSTARTTIOCSTOPcs5cs6cs7cs8cstopb-cstopbcread-creadparenb-parenbparodd-paroddparity-parityevenp-evenpoddp-oddppass8-pass8hupcl-hupcl-hupclocal-clocalcrtscts-crtsctsmdmbuf-mdmbufignbrk-ignbrkbrkint-brkintignpar-ignparparmrk-parmrkinpck-inpckistrip-istripinlcr-inlcrigncr-igncricrnl-icrnliuclc-iuclcixon-ixon-flowixoff-ixofftandem-tandemixany-ixanydecctlq-decctlqimaxbel-imaxbel-echoechoe-echoecrterase-crterasecrtbs-crtbsechok-echokechoke-echokecrtkill-crtkillaltwerase-altweraseiexten-iextenechonl-echonlechoctl-echoctlctlecho-ctlechoechoprt-echoprtprterase-prteraseisig-isigicanon-icanonnoflsh-noflshtostop-tostopflusho-flushopendin-pendin-crtnewcrt-newcrtnokerninfo-nokerninfokerninfo-kerninfoxcase-xcaseopost-opostlitout-litoutocrnl-ocrnlolcuc-olcuconlcr-onlcronlret-onlretonocr-onocrtabs-tabsoxtabs-oxtabsonoeot-onoeottablet disc; ispeed %d baud; ospeed %d baud;lflags-extprociflagsoflagscflags%-8scchars%s = %s; %d rows; %d columns;speed %d baud;#%d disc; slip disc; ppp disc; strip disc; -aefgaef:gTIOCGETDTIOCSWINSZtcsetattrgfmt1illegal option -- %sTIOCGWINSZnot a terminalusage: %s [-a|-e|-g] [-f file] [operands] @(#) Copyright (c) 1987, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: ln.c,v 1.12 2005/04/15 00:51:57 uwe Exp $Ffhnslinkit%s/%susage: %s [-fhns] file1 file2 %s [-fs] file ... directory @(#) Copyright (c) 1987, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: disklabel.c,v 1.95 2005/04/30 07:09:37 deraadt Exp $P xxdd $(,(\{sƑOJ˻vqKIc%*d'`wB,c.ו[t9{~q?߽x7'yt?{\5e͠ۼSm^e-y]ivZdEz~3dO]vo˯:k3s__g%'l&;eYc0uκL?uV7H'D_'цTʪ6-j䟘]M%_g-Ƴ}}5H^3v@jEK5>//&[!9SWZЯ/5>(1<;A9`I;?~8 PMhumn;^^mMy۶4>dN>`6bh,{sQ'2;~Apm3( 䫶ߪU;||ب^La5þP<9!@Ut ,s;.|<`u].X抷v4ܲ1`0- fjO/i޺-XYZ šR7C<듣pH^U[ApH1UvUl+0SLDU5lV.w?%|K;3.LÞQuE_2g,0ru$ t٪~X#rMƒ~S^T p x|4 K /K [X)Uo5z8U0^[fJAeч+x&0ڇ;__|mE@SAݙTF#R=;3 kc7RvMD0ZAoٰDޚAKFBÔ*KB)0)Ǟk0|8cjz0*CΊ "u#B%N<;Wpkr#\5! ]CQֆM)V3튠I74=ix\  xӅoc9^,Ni(nI "2vgsΙ%|Ξ:'C@O]gr}eCܑ3$E QaiJ#d"T{jZgPI0Z5' rV}1|blNP(_(D2)=b.ȃ8Fys)n}@Z'>ňo2J`'>IG@/=dۂ7ԈL@CSkk .y!2,ף1-&!)j5- h[(PU`}p+˵foAjbk.円)=C^A8.uUl)meu~x8VHQlRh#>Dw6uټnv 0 ᙜzCQ%dA=O!޴G/qG·G@bGi&Ix -V#؈m)ˤz;${X+'•4FѺ VW^Xw1oED/U.N|\~01b+1w۱!/- ;`[ͺ]xW֋U X&Y;ejʡvAie~SKG!7{r#ݺ gWoF`⿌A&PGx `3oBO.i6 8'neL̙c j8+@57w~/>=au :F6,HC8 s'?-sA?h9U_!6)wjb^9C$ ϟ?aA zKS5sǸiA΍;8Yѵ6$svl9"lzВ=*Lqļ^;$Zp챾Nn,-!UFO5\yt2p9蒱K NrY8 ]<?f)5&u%W)>9(I%]@P{yaT_PRp 8ߡ0GY$J뎬 up ϧ}OO|F(r/۲m_krlXvڐsSHvuvq]^gW$(ˑ ^{AX>L'zǒa&[e0߀>XOVX |uz#Qؾ$650E!bV2d26IQ-4z.\NA'- U\w =}~ 4Z%'UK)P^)ECb`;_CpIUpIǤuISADדu؜&^U"?7dO\'ejF+d/aGsܵqP+Ƥ ;~L[]E T%#Ԥo t&*iF1;Q1P 7! nڱ.w}wUsȜIc8Q/- k^lg|6$߀݅f;VxtHfbD_uJd;c6FUlguٞfqTcVPH.u1\Fc4UƂPq(' if@gL/5vaD`| ;@X{} w}&&x[ pElP0Ǵ&台;}= jH? KVh'y8,iZs޹4&)C^s'S'iq'5㕩\T} %֨H%G߭~@C"YRhP,ǂ!qI5ŝ=q{cSZ$cҩcB7O,n*EݮV3qQŃđwL(S 'gLFȤPYp,§c钎*uBhdUށj]EqYҸ͢Fk>\k"7Cgԝ_gh&Vz؂@iAKrc.tr`zMI>4 iKiVpm *4 TQݵI=й.p {gZR6]m )|;YZe{f|"W(MzzuM-KТ\}ьܬsf8(7on.=.C.)q7S9R]z,)]a\:u_&܊ CU) XetGHjMsV rL4zZCB4?(gD ؠjHO(6HFocHj^ZI9 $9ɊLG- _@6X)ҝ"c{PxmH?:Cevص9/' P|R|ԮJ)35GM!;3<Ħc7qBMC QەE~W'=ɹVqO"ky(}"2H/xT Tdȹ};T! b%:/بYlpuWtߙf3yz-=1ns8RL $s0o:ُz`-Ope_Ln|ʡkJګ8= :9Sp|J J3 `c֝W0rK1kS;kqA=EI4ݤI~}{]|}7AS=O|:VJc'O&4|3KqnK]}^o3l|C gBXOZ|Ѯ D[*mthwgiD>G77_ :&ޚl{L0 _3K !7-Ÿ7Ƀ 8}=yWVƼޣY>1hݍf挒;6(]7{ MO,jrso\2=n?X$o)I>ڒ }Gnsd60YmT-7k5؋&z:5Gk b֋ Qt@澌 ejڱ5.L"ޡy4 ҪŔuNCsPqGt< /ch8]!OHx`\@,;>8jPF< ;4FiS{FGr7;,UxX<`T:wJySHvW'*Rk1s_ΒÄީ`?{b]c ߍdI3ۇk[:A:Km/!Џ0̶(W8`? O}eķ$<ɑ)ؐucQVRgyh++`Q*w`nOqA3"(I!\:<  ؄(! q}璣 v0U|ֺܿtS꺌Îʘa*5U)%: bsB, tZKXB+X#t0fQK=C ϰ xx@Z@1dH_,2\WĬ#N}=P7GAJ[9MIVOPul?>1108%G% A$CۜX~9X~cV\KI«Ȁ"٣2qFаؾ %C8Uf;RW".W-(]칢V:%.ˑa=;n[q3^9{D?='awa9X&YD&XvL1MHN ^~Wu >;Kpl߶QM.e.Ai؍Euvt[nƪ1tRQ;zkc$Az_*y@L<[c-W?_ԶEI7۳qYA| rf⹄%d| 7Rbs[叾>vԌPbadosudfunknownSMDMSCPold DECSCSIESDIST506HP-IBHP-FLtype 9floppyccdvndATAPIRAIDunusedswapVersion6Version7SystemV4.1BSDEighth-Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSHFSADFSNTFSUDFBEf:NRWb:cdenp:rs:tvwbckmgioctl DIOCWLABELunknown disk type: %sDANGER! The disklabel was not found at the correct location!To repair this situation, use `disklabel %s > file' tosave it, then use `disklabel -R %s file' to replace it.A new disklabel is not being installed now.writelseekwriting label to block %lld (0x%qx) ioctl DIOCSDINFOioctl DIOCWDINFO%s: No disk label on disk; use "disklabel -r" to install initial label%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of disk%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)no disklabel found. scanning.no disk labeldisk label corruptedfound at 0x%lxreading label from block %lld, offset %lld ioctl DIOCGPDINFOioctl DIOCGDINFOioctl DIOCRLDINFOBootstrap doesn't leave room for disk label\ :Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:nc#%u:sc#%u:su#%u:%srm#%hu:%sil#%hu:d%d#%up%c#%u:o%c#%u:t%c=%s:t%c=unknown%d:b%c#%u:f%c#%u:%sts#%u:%shs#%u:%scs#%hu:%ssk#%hu:%.*s| %c: %12.*f%c %12.*f%c %7.7s%7d%19.19s# %s# Cyl %5u-%6u %5u %5u %4hu %5u %5u %4.4s %c: %13u %13u device: %s # %s: type: %s type: %d disk: %.*s label: %.*s bytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total bytes: %.*f%c free bytes: %.*f%c rpm: %hu %hu partitions: offset# %13.13s %13.13s fstype [fsize bsize cpg] interleave: %hu trackskew: %hu cylinderskew: %hu headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %d free sectors: %u total sectors: %u badsect ecc removable # Notes: # Up to 16 partitions are valid, named from 'a' to 'p'. Partition 'a' is # your root filesystem, 'b' is your swap, and 'c' should cover your whole # disk. Any other partition is free for any use. 'size' and 'offset' are # in 512-byte blocks. fstype should be '4.2BSD', 'swap', or 'none' or some # other values. fsize/bsize/cpg should typically be '2048 16384 16' for a # 4.2BSD filesystem (or '512 4096 16' except on alpha, sun4, ...) re-edit the label? [y]: editNo changes.-cEDITOR/usr/bin/vifailed to start editor/bin/sh # line %d: syntax errorIDEline %d: warning, unknown disk type: %sremovableeccbadsectline %d: bad flag: %sdrivedataline %d: bad drivedata %s%d partitionsline %d: bad %s: %ssectors/cylindertracks/cylindercylinderstotal sectorsrpmtrackskewcylinderskewheadswitchtrack-to-track seekline %d: bad partition name: %sline %d: warning, unknown filesystem type: %sline %d: too few fieldsline %d: bad partition offset: %sgetasciilabelline %d: bad partition size: %sline %d: unknown field: %sline %d: bad # of partitionssector size %dtracks/cylinder %dwarning, unused partition %c: size %d offset %dpartition %c: block size < fragment sizepartition %c: partition extends past end of unitpartition %c: offset past end of unitwarning, partition %c: size 0, but offset %dwarning, number of partitions (%d) > MAXPARTITIONS (%d)warning, super block size %% sector-size != 0super block size %dwarning, boot block size %% sector-size != 0boot block size %dwarning, revolutions/minute %dcylinders/unit %dsectors/track %dcmplabel usage: disklabel [-c | -d | -r | -t] [-v] [-p unit] disk (read) disklabel -w [-c | -d | -r] [-nv] disk disktype [packid] (write) disklabel -e [-c | -d | -r] [-nv] disk (edit) disklabel -E [-c | -d | -r] [-nv] [-f tempfile] disk (simple editor) disklabel -R [-nrv] disk protofile (restore) disklabel -N | -W [-nv] disk (protect) disklabel -B [-nv]%s disk [disktype] (boot) disklabel -Bw [-nv]%s disk disktype [packid] (write) disklabel -BR [-nv]%s disk protofile [disktype] (restore) `disk' may be of the form: sd0 or /dev/rsd0%c. `disktype' is an entry from %s, see disktab(5) for more info. /etc/disktab`packid' is an identification string for the device. `protofile' is the output from the read cmd form; -R is powerful. For procedures specific to this architecture see: %s fdisk(8)You need to specify a type for this disk.No 'c' partition found, adding one that spans the disk. Initial label editor (enter '?' for help at any prompt) unable to get default partition tablePAGER/usr/bin/lessgunzip -qc|%sunable to execute %sEnteringExiting%s expert mode This option is not valid when run without the -f flag. Write the modified label to disk?Write new label?unable to write labelNo label changes.In no change mode, not writing label.Recalculated free space.cannot open %sFilenameName of the file to save label into.Nothing to undo!Last change undone.Unknown option: %c ('?' for help) can't run when there is partition overlap.Partition must be between 'a' and '%c' (excluding 'c'). editor_add Please re-enter an offset and size for partition %c. Partition '%c' exists. Delete it first. The letter of the new partition, a - p.partitionPartition '%c' already exists. Partition must be between 'a' and '%c'. No space left, you need to shrink a partition Partition '%c' is not in use. You cannot name a filesystem of type %s. partition to nameThe letter of the partition to name, a - p.Command aborted Please re-enter an offset and sizeWarning, need %u sectors but there are only %u free. Setting size to %u. partition to modifyThe letter of the partition to modify, a - p.You may not delete the 'c' partition. The 'c' partition must exist and should span the entire disk. By default it is of type 'unused' and so does not take up any space. partition to deleteThe letter of the partition to delete, a - p, or '*'.Partition %c is currently %u sectors in size (%u free). new sizeSize of the partition. You may also say +/- amount for a relative change.Invalid entry Only %u sectors free, you asked for %u 'c' partition may not be larger than the disk partition to change sizeThe letter of the partition to change size, a - p.%s: [%s] %s: [%u] Rounding to nearest cylinder: %u getuinthas_overlap Error, partitions %c and %c overlap: Disable which one? (^D to abort) [%c %c] Changing device parameters for %s: What kind of disk is this? Usually SCSI, ESDI, ST506, or floppy (use ESDI for IDE)."%s" is not a valid disk type. Valid types are: "%s"label name15 char string that describes this label, usually the disk name.The Numer of sectors per track.The number of tracks per cylinder.The number of sectors per cylinder (Usually sectors/track * tracks/cylinder).number of cylindersThe total number of cylinders on the disk.The total number of sectors on the disk.Not enough free space to shrink by %u sectors (only %u sectors left) The rotational speed of the disk in revolutions per minute.The physical sector interleave, set when formatting. Almost always 1.edit_parmsYou may want to increase the size of the 'c' partition.failed to sort partition tablesdrzFLOPPYxdhdCCDVNDsvndPossible values are:"IDE", Disk typeWhat kind of disk is this? Usually SCSI, IDE, ESDI, CCD, ST506, or floppy.Starting sectorThe start of the OpenBSD portion of the disk.Size ('*' for entire disk)The size of the OpenBSD portion of the disk ('*' for the entire disk).The 'p' command prints the current disk label. By default, it prints the size and offset in sectors (a sector is usually 512 bytes). The 'p' command takes an optional units argument. Possible values are 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, and 'g' for gigabytes. The 'D' command will set the disk label to the default values as reported by the disk itself. This similates the case where there is no disk label. The 'M' command pipes the entire OpenBSD manual page for disk label through the pager specified by the PAGER environment variable or 'less' if PAGER is not set. It is especially useful during install when the normal system manual is not available. The 'X' command toggles disklabel in to/out of 'expert mode'. By default, some settings are reserved for experts only (such as the block and fragment size on ffs partitions). The 'a' command adds new partitions to the disk. It takes as an optional argument the partition letter to add. If you do not specify a partition letter, you will be prompted for it; the next available letter will be the default answer The 'b' command is used to change the boundaries of the OpenBSD portion of the disk. This is only useful on disks with an fdisk partition. By default, on a disk with an fdisk partition, the boundaries are set to be the first and last sectors of the OpenBSD fdisk partition. You should only change these if your fdisk partition table is incorrect or you have a disk larger than 8gig, since 8gig is the maximum size an fdisk partition can be. You may enter '*' at the 'Size' prompt to indicate the entire size of the disk (minus the starting sector). Use this option with care; if you extend the boundaries such that they overlap with another operating system you will corrupt the other operating system's data. The 'c' command is used to change the size of an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. You may add a '+' or '-' prefix to the new size to increase or decrease the existing value instead of entering an absolute value. You may also use a suffix to indicate the units the values is in terms of. Possible suffixes are 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, 'g' for gigabytes or no suffix for sectors (usually 512 bytes). You may also enter '*' to change the size to be the total number of free sectors remaining. The 'd' command is used to delete an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. You may not delete the ``c'' partition as 'c' must always exist and by default is marked as 'unused' (so it does not take up any space). The 'e' command is used to edit the disk drive parameters. These include the number of sectors/track, tracks/cylinder, sectors/cylinder, number of cylinders on the disk , total sectors on the disk, rpm, interleave, disk type, and a descriptive label string. You should not change these unless you know what you are doing The 'g' command is used select which disk geometry to use, the disk, BIOS, or user geometry. It takes as an optional argument ``d'', ``b'', or ``u''. If you do not specify the type as an argument, you will be prompted for it. The 'm' command is used to modify an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. This option allows the user to change the filesystem type, starting offset, partition size, block fragment size, block size, and cylinders per group for the specified partition (not all parameters are configurable for non-BSD partitions). The 'n' command is used to set the mount point for a partition (ie: name it). It takes as an optional argument the partition letter to name. If you do not specify a partition letter, you will be prompted for one. This option is only valid if disklabel was invoked with the -F flag. The 'q' command quits the label editor. If any changes have been made you will be asked whether or not to save the changes to the on-disk label. The 'r' command is used to recalculate the free space available. This option should really not be necessary under normal circumstances but can be useful if disklabel gets confused. The 's' command is used to save a copy of the label to a file in ascii format (suitable for loading via disklabel's [-R] option). It takes as an optional argument the filename to save the label to. If you do not specify a filename, you will be prompted for one. The 'u' command will undo (or redo) the last change. Entering 'u' once will undo your last change. Entering it again will restore the change. The 'w' command will write the current label to disk. This option will commit any changes to the on-disk label. The 'x' command exits the label editor without saving any changes to the on-disk label. Available commands: ? [cmnd] - this message or command specific help. a [part] - add new partition. b - set OpenBSD disk boundaries. c [part] - change partition size. D - set label to default. d [part] - delete partition. e - edit drive parameters. g [b|d|u] - use [b]ios, [d]isk or [u]ser geometry. M - show entire OpenBSD man page for disklabel. m [part] - modify existing partition. n [part] - set the mount point for a partition. p [unit] - print label. q - quit and save changes. r - recalculate free space. s [path] - save label to file. u - undo last change. w - write label to disk. X - toggle expert mode. x - exit without saving changes. z - zero out partition table.Numeric parameters may use suffixes to indicate units: 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, 'g' for gigabytes or no suffix for sectors (usually 512 bytes). '%' for percent of total disk size, '&' for percent of free space. Non-sector units will be rounded to the nearest cylinder. Entering '?' at most prompts will give you (simple) context sensitive help.The 'z' command zeroes out the existing partition table, leaving only the 'c' partition. The drive parameters are not changed. mpsave%s%c %s %s rw 1 %d Starting sector for this partition.The OpenBSD portion of the disk starts at sector %u, you tried to add a partition at %u. You can use the 'b' command to change the size of the OpenBSD portion. The OpenBSD portion of the disk ends at sector %u, you tried to add a partition at %u. You can use the 'b' command to change the size of the OpenBSD portion. Size of the partition.Sorry, there are only %u sectors left The OpenBSD portion of the disk ends at sector %u, you tried to add a partition ending at sector %u. You can use the 'b' command to change the size of the OpenBSD portion. Size may not be larger than %u sectors Size of fs block fragments. Usually 2048 or 512.Zero fragment size implies zero block sizeSize of filesystem blocks. Usually 16384 or 4096.Error: block size must be a multiple of the fragment size. Error: block size must be at least as big as fragment size. Error: block size must be at least as big as page size (%d). cpgNumber of filesystem cylinders per group. Usually 16 or 8.FS type (decimal)Filesystem type as a decimal number; usually 7 (4.2BSD) or 1 (swap).FS typeFilesystem type (usually 4.2BSD or swap)Unrecognized filesystem type '%s', treating as 'unknown' noneWhere to mount this filesystem (ie: / /var /usr)Mount points must start with '/' Can't stat deviceBIOS geometry not defined. You must enter either 'd', 'b', or 'u'. Note: user geometry is the same as disk geometry. Enter 'd' to use the geometry based on what the disk itself thinks it is, 'b' to use what the BIOS says,or 'u' to use the geometry that was found on in the label.[d]isk, [b]ios, or [u]ser geometry$OpenBSD: ar_io.c,v 1.37 2005/08/04 10:02:44 mpf Exp $$OpenBSD: ar_subs.c,v 1.28 2004/04/16 22:50:23 deraadt Exp $$OpenBSD: buf_subs.c,v 1.20 2004/04/16 22:50:23 deraadt Exp $$OpenBSD: cache.c,v 1.17 2004/03/16 03:28:34 tedu Exp $$OpenBSD: cpio.c,v 1.17 2004/04/16 22:50:23 deraadt Exp $$OpenBSD: file_subs.c,v 1.29 2005/04/25 19:39:52 otto Exp $$OpenBSD: ftree.c,v 1.26 2005/04/21 21:47:18 beck Exp $$OpenBSD: gen_subs.c,v 1.18 2005/04/28 06:58:07 otto Exp $$OpenBSD: getoldopt.c,v 1.8 2003/07/02 21:19:33 deraadt Exp $$OpenBSD: options.c,v 1.63 2005/06/02 19:11:06 jaredy Exp $$OpenBSD: pat_rep.c,v 1.30 2005/08/05 08:30:10 djm Exp $@(#) Copyright (c) 1992, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: pax.c,v 1.28 2005/08/04 10:02:44 mpf Exp $$OpenBSD: sel_subs.c,v 1.18 2004/04/16 22:50:23 deraadt Exp $$OpenBSD: tables.c,v 1.23 2005/04/21 21:47:18 beck Exp $$OpenBSD: tar.c,v 1.39 2005/06/13 19:20:05 otto Exp $$OpenBSD: tty_subs.c,v 1.12 2003/06/02 23:32:09 millert Exp $Cannot write an archive on top of a directory %sFailed stat on %sFailed chdir to %sFailed open to read on %sFailed open to write on %sFailed open to read/write on %s%s: unknown format, %qu bytes skipped. %qu blocks %s: %s vol %d, %lu files, %qu bytes read, %qu bytes written. done. %s: Waiting for tape drive close to complete...ar_drainUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specEnd of archive volume %d reachedFailed read on archive volume %dWARNING: partial archive write. Archive IS FLAWEDWARNING: partial archive write. Archive MAY BE FLAWEDFailed write to archive volume: %dUnable to append, trailer re-write failed. Quitting.Write failed, archive is write protected.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Cannot allow updates to an archive with flaws.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to seek archive backwardsReverse position on previous volume.Unable to obtain current archive byte offsetUnable to backspace tape %d blocks.Tape drive unable to backspace requested amountget_physUnable to backspace tape over %d pad blocksUnable to backspace over tape filemark.Unable to locate tape filemark.Cannot determine archive tape blocksize.Unable to backspace over last tape block.ar_next ATTENTION! %s archive volume change required. %s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot open %s, try again Cannot save archive name.Quitting %s! %s ready for archive tape volume: %d Load the NEXT TAPE on the tape driveReady for archive volume: %d Unable to restore signal maskUnable to set signal maskcould not pipecould not forkcould not exec-dcCan't fchdir to starting directoryCannot chdir to %sextractUnable to open %s to readCannot mix current archive format %s with %sappend%s: Reading archive to position at the end...directory name is too long %scopyDestination is not a directory %sDestination pathname too long %sCannot access destination directory %sArchive I/O error. Trying to recover.Archive I/O error, cannot continuePremature end of file on archive readInvalid header, starting valid header search.Unable to append, archive header flawCannot identify format. Searching...Sorry, unable to determine archive format.Write block size of %d too large, maximium is: %dWrite block size of %d larger than POSIX max %d, archive may not be portableWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximium is: %dWrite block size %d is not a %d byte multipleUnable to rewrite archive trailer, cannot append.Cannot append to an archive that may have flaws.Archive read error limit (%d) reachedUnable to append when there are archive read errors.File changed size during read %sFile %s was modified during copy to archiveRead fault on %sActual crc does not match expected crc %sUnable to obtain block size for file %sFile %s changed size during copy to %sFile %s was modified during copy to %sFailed stat of %sFailed write during copy of %s to %sUser specified archive volume byte limit reached.Unable to allocate memory for user id cache tableUnable to allocate memory for group id cache tableUnable to allocate memory for user name cache tableUnable to allocate memory for group name cache tableTRAILER!!!cpio_endwrCpio file name in header is corruptedCpio file name length %d is out of rangeCpio link name is corruptCpio link name read errorCpio link name length is invalid: %qu070707File is too large for cpio format %sCpio header field is too small to store file %scpio_wrUnable to write cpio link name for %sUnable to write cpio header for %s070701070702File is too large for sv4cpio format %sSv4cpio header field is too small for file %svcpio_wrCould not write sv4cpio link name for %sCould not write sv4cpio header for %sFile is too large for bcpio format %sbcpio_wrBcpio header field is too small for file %sCould not write bcpio link name for %sCould not write bcpio header for %sUnable to create %sUnable to close file descriptor on %sA hard link to the directory %s is not allowedUnable to link to %s from %sUnable to copy %s, file would overwrite itselfCould not link to %s from %sUnable to remove %sUnable to link file %s to itselfCould not create: %snode_creatCould not access %s (stat)cannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCould not unlink %sUnable to remove directory %sAccess/modification time set failed on: %sUnable to obtain file stats %sUnable to set file uid/gid of %sCould not set permissions on %sFailed write to file %sOut of memoryFile seek on %sWARNING! Major Internal Error! GNU hack Failing!Failed seek on file %sFile changed size %sset_crcFile %s was modified during readFile rewind failed on: %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:Can't chdir to %sFile system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %sIgnoring too-long pathname: %sIgnoring unterminated pathname at EOFls_list%b %e %H:%M%b %e %Y%s%2u %-*.*s %-*.*s %4lu,%4lu == => %9qu %s%s %s ls_tty%s: unknown option %c %s: %c argument missing bcpiosv4cpiosv4crcustarab:cdf:iklno:p:rs:tuvwx:zB:DE:G:HLOPT:U:XYZ0Write limit is not a %d byte multipleInvalid write limit %sError count value must be positiveInvalid block size %sInvalid -p string: %cUnknown -x format: %spax: Known -x formats are:Destination directory was not suppliedb:cef:hmopqruts:vwxzBC:HI:LOPXZ014578/dev/rst0/dev/rst1/dev/rst4/dev/rst5/dev/rst7/dev/rst8Unable to allocate space for option listTAPEProblem with file '%s'Unable to open file '%s' for read-C-Iwrite_opt=nodirabcdfiklmoprstuvzABC:E:F:H:I:LO:SZ6Unknown -H format: %scpio: Known -H formats are:Problem while reading stdin%s: Invalid combination of options: -%cThese format options are not supported %s = %s Invalid option nameInvalid options formatusage: pax [-0cdOnvz] [-E limit] [-f archive] [-G group] [-s replstr] [-T [from_date][,to_date][/[c][m]]] [-U user] [pattern ...] pax -r [-0cDdikOnuvzYZz] [-E limit] [-f archive] [-G group] [-o options] [-p string] [-s replstr] [-T [from_date][,to_date]] [-U user] [pattern ...] pax -w [-0adHiLOPtuvXz] [-B bytes] [-b blocksize] [-f archive] [-G group] [-o options] [-s replstr] [-T [from_date][,to_date][/[c][m]]] [-U user] [-x format] [file ...] pax -r -w [-0DdHikLlnOPtuvXYZ] [-G group] [-p string] [-s replstr] [-T [from_date][,to_date][/[c][m]]] [-U user] [file ...] directory usage: tar {crtux}[014578befHhLmOoPpqsvwXZz] [blocking-factor | archive | replstr] [-C directory] [-I file] [file ...] tar {-crtux} [-014578eHhLmOoPpqvwXZz] [-b blocking-factor] [-C directory] [-f archive] [-I file] [-s replstr] [file ...] usage: cpio -o [-aABcLvVzZ] [-C bytes] [-H format] [-O archive] [-F archive] < name-list [> archive] cpio -i [-bBcdfmnrsStuvVzZ6] [-C bytes] [-E file] [-H format] [-I archive] [-F archive] [pattern...] [< archive] cpio -p [-adlLmuvV] destination-directory < name-list Empty replacement stringrep_addInvalid replacement string %sInvalid replacement string option %s%s while compiling regular expression %sUnable to allocate memory for replacement stringEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern list inconsistentPattern select out of memoryRemoving leading / from absolute path names in the archive ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Processing continues, name changed to: %s tty_renameProcessing continues, name unchanged. Skipping file. File name %s/%s, too longrep_name%s >> %s >> %s Replacement name too long %s >> %sReplacement name error %sTMPDIR/tmp/Cannot allocate memory for temp file name.Can't open current working directory.can not gzip while appendingCpu time limit reached, cleaning up.Signal caught, cleaning up.LC_TIMEUnable to set up signal handlerUser selection table out of memoryUnable to find uid for user: %sUnable to allocate memory for user selection tableGroup selection table out of memoryCannot determine gid for group name: %sUnable to allocate memory fo group selection tableEmpty time range stringUpper %s and lower %s time overlapIllegal upper time range %sTime range format is: [[[[[cc]yy]mm]dd]HH]MM[.SS][/[c][m]]Illegal lower time range %sBad option %c with time range %sUnable to allocate memory for time rangeImproperly specified time range: %sCannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %schk_ftimeFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryFailed ftime table readFailed ftime table seekCannot allocate memory for interactive rename tableNo interactive rename table, links may failInteractive rename table out of memoryCannot update rename tableCannot allocate memory for device mapping tableDevice map table out of memoryUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryUnable to allocate memory for directory timesUnable to store mode and times for created directory: %swrite_optnodir%s=%s is only supported when writing.Unknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format optiontar_wrFile name too long for tar %sTar header field is too small for %sFile is too large for tar %sTar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for ustar %sUstar header field is too small for uid %lu, using nobodyUstar header field is too small for gid %lu, using nobodyUstar header field is too small for %sustar_wrnobodyFile is too long for ustar %sLink name too long for ustar %sUstar cannot archive a socket %s/dev/ttyFatal error, cannot open %s%s: @(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: ping.c,v 1.72 2005/09/01 17:59:13 otto Exp $DI:LRS:c:dfi:jl:np:qrs:T:t:vw:number of packets to transmit is %s: %sbad interface address: %stos value is %s: %s%s: only root may use interval < 1sbad timing interval: %spreload value is %s: %spacket size is %s: %sttl value is %s: %smaxwait value is %s: %s-f and -i options are incompatiblebind-R option and -D or -T, or -t to unicast destinations are incompatiblesetsockopt IP_MULTICAST_IFgetsockoptCannot set the receive buffer sizePING %s: %d data bytes ping: recvfromPING %s (%s): %d data bytes Could only allocate a receive buffer of %i bytes (default %i)setsockoptsetsockopt IP_MULTICAST_TTLsetsockopt IP_MULTICAST_LOOPping: record routerecord route not valid to multicast destinationsunknown host: %sping: wrote %s %d chars, ret=%d pingerping: sendtopacket too short (%d bytes) from %s unknown option %x LSRR: 0.0.0.0 (truncated route) %s RR: (same route) NOP%d bytes from %s: icmp_seq=%u ttl=%d wrong data byte #%d should be 0x%x but was 0x%x%x (DUP!) time=%d.%03d ms%d bytes from %s: %ld packets transmitted, %ld packets received, %.1f%% packet lossround-trip min/avg/max/std-dev = %d.%03d/%d.%03d/%d.%03d/%d.%03d ms -- somebody's duplicating packets!%ld duplicates, --- %s ping statistics --- Echo ReplyDestination Net UnreachableDest Unreachable, Unknown Code: %d Destination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF setfrag needed and DF set (MTU %d) Source Route FailedNetwork UnknownHost UnknownSource IsolatedDest. Net Administratively ProhibitedDest. Host Administratively ProhibitedDestination Net Unreachable for TOSDesination Host Unreachable for TOSRoute administratively prohibitedHost Precedence ViolationPrecedence CutoffSource QuenchRedirect Network(New addr: %s) Redirect, Unknown Code: %dRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostUnknown ICMP type: %d Echo RequestRouter Discovery Advertisement(%d entries, lifetime %d seconds) Router Discovery SolicitationTime exceeded, Unknown Code: %d Frag reassembly time exceededTime to live exceededParameter problem, required option absent: pointer = 0x%02x Parameter problem: pointer = 0x%02x TimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask Reply (Mask 0x%08x) Vr HL TOS Len ID Flg off TTL Pro cks Src Dst Data %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %s %02x%s (%s)TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xpatterns must be specified as hex digitsusage: ping [-DdfjLnqRrv] [-c count] [-I ifaddr] [-i wait] [-l preload] [-p pattern] [-s packetsize] [-T tos] [-t ttl] [-w maxwait] host $OpenBSD: fsutil.c,v 1.13 2003/09/25 04:15:29 deraadt Exp $lost+foundwrong type to dirscan %d DIRECTORY CORRUPTEDNAME=%s fileerror%s=%s DIRLINK COUNT %s COUNT %d SHOULD BE %d (ADJUSTED)ADJUSTLINK COUNT INCREASINGUNREFmkentryUNREF %s RECONNECTSORRY. CANNOT CREATE lost+found DIRECTORYlost+found IS NOT A DIRECTORYREALLOCATElinkupSORRY. CANNOT CREATE lost+found DIRECTORY SORRY. NO lost+found DIRECTORY DIR I=%u CONNECTED. PARENT WAS I=%u SORRY. NO SPACE IN lost+found DIRECTORYNO lost+found DIRECTORYCREATE (CREATED) (RECONNECTED)makeentryNO SPACE LEFT IN %s (EXPANDED)EXPANDLARGE FILES UNSUPPORTED ON REVISION 0 FILESYSTEMSSETTING LARGE FILE INDICATOR SET LARGE FILE INDICATORTRYING TO SET FILESIZE TO %llu ON MODE %x FILE ckinodeDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDSiblockPARTIALLY TRUNCATED INODE I=%ublk %d < cgdmin %d; blk + cnt %d > cgsbase %d blk %d >= cgdmin %d; blk + cnt %d > cgdmax %d bad inode number %d to ginode bad inode number %d to nextinode Cannot allocate space for inode buffer cannot increase directory list cannot find inode %d CLEAR (CLEARED) I=%u OWNER=%u MODE=%o SIZE=%llu MTIME=%12.12s %4.4s %d %s I=%uBAD STATE %d TO BLKERR b:dfm:npyAlternate super block location: %d ** lost+found creation mode %o bad mode to -m: %o -%c flag requires a %s checkfilesysCAN'T CHECK FILE SYSTEM.** Phase 1 - Check Blocks and Sizes** Phase 1b - Rescan For More DUPS%d files, %d used, %d free ***** REBOOT NOW ***** ***** PLEASE RERUN FSCK ***** ***** FILE SYSTEM WAS MODIFIED *****The following zero link count inodes remain: %u,The following duplicate blocks remain: %d,%d blocks missing %d files missing ** Phase 5 - Check Cyl groups** Phase 4 - Check Reference Counts** Phase 3 - Check Connectivity** Phase 2 - Check PathnamesINTERNAL ERROR: dups with -p** Root file system** Last Mounted on %s starting usage: %s [-dfnpy] [-b block#] [-m mode] filesystem ... UNKNOWN FILE TYPE I=%ubad size %llu:INCORRECT BLOCK COUNT I=%u (%d should be %d) (CORRECTED)LINK COUNT TABLE OVERFLOWCONTINUEbad indirect addr: %d bad direct addr: %d bad size %llu ndb %d:HOLD BAD BLOCKINODE I=%u HAS DTIME=%12.12s %4.4sPARTIALLY ALLOCATED INODE I=%uDUP TABLE OVERFLOW.EXCESSIVE DUP BLKS I=%u (SKIPPING)EXCESSIVE BAD BLKS I=%uBAD STATE %d FOR ROOT INODE DUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYCANNOT ALLOCATE ROOT INODE ROOT INODE UNALLOCATEDALLOCATEpass2MISSING '..'FIXBAD INODE NUMBER FOR '..'DIRECTORY TOO SHORTDIRECTORY %s: LENGTH %lu NOT MULTIPLE OF %dMISSING '.'I OUT OF RANGEREMOVEpass2checkUNALLOCATEDBAD TYPE VALUEIS AN EXTRANEOUS HARD LINK TO DIRECTORY%s %s %s (IGNORED)DUP/BADZERO LENGTH DIRECTORYEXTRA '.' ENTRYEXTRA '..' ENTRYCANNOT FIX, INSUFFICIENT SPACE TO ADD '..' CANNOT FIX, SECOND ENTRY IN DIRECTORY CONTAINS %s BAD TYPE VALUE FOR '..'CANNOT FIX, INSUFFICIENT SPACE TO ADD '.' CANNOT FIX, FIRST ENTRY IN DIRECTORY CONTAINS %s BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'BAD STATE %d FOR INODE I=%d ZERO LENGTHBAD/DUPsummary info for cg %d is %d, %d, %d,should be %d, %d, %d SUMMARY INFORMATIONS WRONG FOR CG #%dBLK(S) MISSING IN BIT MAPS #%dINODE(S) MISSING IN BIT MAPS #%dsummary info bad in superblock: %d, %d should be %d, %d SUPERBLK SUMMARY INFORMATION BADpass5ino_bitmap:ibmap:blk_bitmap:bbmap:BAD STATE %d FOR INODE I=%ld %u: %2x %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. /r%s is not a character device Can't stat %s Can't stat rootmalloc failedrealloc failedstrdup failed%s is not a character device (NO WRITE)cannot allocate space for superblock setupLOOK FOR ALTERNATE SUPERBLOCKSLOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ext2fs(8).SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO FSCK_FFS TO SPECIFY THE%s %s %s %s %s %s USING ALTERNATE SUPERBLOCK AT %d WRONG FPG=%d (BPG=%d) IN SUPERBLOCKBAD SUMMARY INFORMATIONcannot alloc %u bytes for blockmap cannot alloc %u bytes for statemap cannot alloc %u bytes for lncntp cannot alloc %u bytes for inphead cannot alloc %u bytes for typemap IMPOSSIBLE RESERVED BLOCK COUNT=%d IN SUPERBLOCKSET TO DEFAULT** File system is already clean %sile system is clean; not checking ** Fstate = %d NO WRITE ACCESS** %sCan't open %s: %s Can't stat %s: %s MAGIC NUMBER WRONGBAD LOG_BSIZEINCOMPATIBLE FEATURE BITS IN SUPER BLOCKcompat 0x%08x, incompat 0x%08x, compat_ro 0x%08x VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEsuperblock mismatchesoffset %ld, original %ld, alternate %ld BAD SUPER BLOCK: %s %s: NOT LABELED AS A EXT2 FILE SYSTEM (%s) %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION ioctl (GCINFO): %s %s: can't read disk label PARTIALLY WRITING %sZERO'ED BLOCK %d TO DISK bad file type 0%o %s? yes %s? [yn] %s? no INTERNAL ERROR: GOT TO reply()cannot allocate buffer pool deadlocked buffer pool CANNOT %s: BLK %dProgram terminated MARKING FILE SYSTEM CLEAN cache missed %ld of %ld (%d%%) MARK FILE SYSTEM CLEANUPDATE STANDARD SUPERBLOCKSPanic: lost %d buffers READTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %ld (%ld), %ld,SEEKWRITETHE FOLLOWING SECTORS COULD NOT BE WRITTEN:returning to single-user after filesystem checkSALVAGE (SALVAGED)UNKNOWN INODESC FIX MODE %d benstuvusage: %s [-benstuv] [-] [file ...] %6d c['[ha[ta[a[a[a[a[,sZaZaZa`aaaZaT_a `afaXgaXga(ha(ha %d:powersave on (%dms sleep) (auto) SIOCG80211ALLNODES nonerestoreieee80211_listnodeslladdr %s %udB powersave %uMESSIBSSPOLLABLEPOLLREQPRIVACYSHORT_PREAMBLEPBCCCHNL_AGILITY SHORT_SLOTTIME RSNDSSSOFDMCACHEBSSAUTHASSOCCOLLECTSGIOCGIFMEDIA%s: no link type?init_current_mediaSIOCSIFMEDIAonly one `media' command may be issuedmay not issue `media' after `mode' commandsmay not issue `media' after `mediaopt' commandsonly one `mode' command may be issuedinvalid media mode: %sonly one `mediaopt' command may be issuedmay not issue `mediaopt' after `instance'only one `-mediaopt' command may be issuedmay not issue both `media' and `-mediaopt'only one `instance' command may be issuedmust specify `media' before `instance'media instance %s: %sEthernetetherTokenRingtokenFDDIIEEE802.11TDMCARPautoselectmanual10baseT10baseT/UTP10UTP10base210base2/BNC10BNC10base510base5/AUI10AUI100baseTX100TX100baseFX100FX100baseT4100T4100baseVG100VG100baseT2100T21000baseSX1000SX10baseSTPSTP10STP10baseFLFL10FL1000baseLX1000LX1000baseCX1000CX1000baseT1000T1000baseTX1000TXHomePNA1HPNA1DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDIFH1FH2DS2DS5DS11DS1DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72t1t1-amie1-g.704e1-amie1-ami-g.704t3t3-m13e3e3-g.751e3-g.832e1-g.704-crc411a11b11gfhmasterfull-duplexfdxhalf-duplexhdxflag0flag1flag2loopbackhw-loopbackloopEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapibssibss-mastermonitorturbohdlc-crc16pppframerelay-ansiframerelay-ciscoframerelay-ituunknown %s media subtype: %sunknown %s media mode: %sunknown %s media option: %smedia mode %smediaopt instance %d physical address inet%s %s --> %s phys_statusno carrieractiveno ringinsertedno networkbackupUPBROADCASTDEBUGLOOPBACKPOINTOPOINTNOTRAILERSRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST metric %lu mtu %lu lladdr %s description: %s %s: no media types?SIOCGIFMEDIA media: status: supported media: inet %s SIOCGIFNETMASKSIOCGIFDSTADDR--> %s netmask 0x%x SIOCGIFBRDADDRbroadcast %sin_status inet6 %sSIOCGIFDSTADDR_IN6 -> %sSIOCGIFNETMASK_IN6 prefixlen %dSIOCGIFAFLAG_IN6 anycast tentative duplicated detached deprecated scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime in6_alias%s: bad valueprefix %s: %s%s=%o%s=%xusage: ifconfig [interface] [address_family] [address [dest_address]] [[-]alias] [[-]arp] [broadcast addr] [[-]debug] [delete] [up] [down] [ipdst addr] [tunnel src_address dest_address] [deletetunnel] [description value] [[-]group group-name] [[-]link0] [[-]link1] [[-]link2] [lladdr etheraddr] [media type] [[-]mediaopt opts] [mode mode] [instance minst] [mtu value] [metric nhops] [netmask mask] [prefixlen n] [nwid id] [nwkey key] [nwkey persist[:key]] [-nwkey] [bssid bssid] [-bssid] [chan n] [-chan] [txpower dBm] [-txpower] [[-]powersave] [powersavesleep duration] [[-]anycast] [eui64] [pltime n] [vltime n] [[-]tentative] [vlan vlan_tag vlandev parent_iface] [-vlandev] [vhid n] [trunkproto proto] [[-]trunkport child-iface] [advbase n] [advskew n] [maxupd n] [pass passphrase] [state init | backup | master] [syncdev iface] [-syncdev] [syncpeer peer_address] [-syncpeer] [phase n] [range netrange] [timeslot timeslot_range] [802.2] [802.2tr] [802.3] [snap] [EtherII] [pppoeac access-concentrator] [-pppoeac] [pppoesvc service] [-pppoesvc] ifconfig [-AaCMm] [interface] [address_family] ifconfig interface create ifconfig interface destroy getifgroupsSIOCGIFGROUP groups: malformed link-level addressSIOCSIFLLADDR1ACFLRSTacdfghiklmnopqrstuxCOLUMNS%s: %s: %s: directory causes a cyclefts_readdisplay%qu%*s%*qd printlong%3d, %3d %-*s %*qd %*u total %lu %s %*u %-*s %-*s -> printlink ls: %s: %s %*s usage: %s [-1AaCcdFfghikLlmnopqRrSsTtuWx] [file ...] mainifconfigmake_packetrtsol_check_timerrtsol_timer_updatesockopensendpacketrtsol_inputinterface_upinterface_statuslladdropt_fill)get_llflagprobe_initdefrouter_probesendprobeadDFfailed to open a socketfailed to initialize interfacesselect: %sfailed to setup for probing routersfailed to initialize %skernel is configured as a router, not a hostkernel is configured not to accept RAsadDfFm1memory allocation failedinterface %s was already configuredfailed to get link layer information for %slink-layer address option has null length on %s. Treat as not included.memory allocation failed for %sNew timer is %ld:%08ldthere is no timer%s status is changed from %d to %dNo answer after sending %d RSstimer expiration on %s, state = %dset timer for %s to %d:%dstop timer for %sillegal interface state(%d) on %susage: rtsol [-dDF] interfaces... usage: rtsol [-dDF] -a usage: rtsold [-adDfFm1] interfaces... usage: rtsold [-dDfFm1] -a <%s> %swarnmsgprobing %sreallocmultiple interfaces foundff02::2inet_pton failed for %ssetsockopt(ICMP6_FILTER): %sIPV6_HOPLIMIT: %sIPV6_PKTINFO: %ssocket: %smalloc for send msghdr failedmalloc for receive msghdr failedsend RS on %s, whose state is %dsendmsg on %s: %ssendpacketfailed to get receiving interfacertsol_inputinvalid icmp type(%d) from %s on %sinvalid RA with hop limit(%d) from %s on %sinvalid RA with non link-local source from %s on %sreceived RA from %s on %s, state is %dreceived RA from %s on an unexpeced IF(%s)invalid icmp code(%d) from %s on %spacket size(%d) is too shortfailed to get receiving hop limitrecvmsg: %schecking if %s is ready...interface_up%s is duplicated%s is tentative%s is readyget_llflag() failed, anyway I'll tryioctl(SIOCSIFFLAGS): %sioctl(SIOCGIFFLAGS): %sinterface_statusioctl(SIOCGIFMEDIA) on %s: %sioctl(SIOCGIFFLAGS) on %s: %sunsupported link type(%d)get_llflagioctl(SIOCGIFAFLAG_IN6): %sgetifaddrs: %ssocket(SOCK_DGRAM): %sshutdown: %slo0defrouter_probedefault router list contains a non-link-local address(%s)ioctl(SIOCGDRLST_IN6): %sprobe a router %s on %ssendprobeTTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftinvalid namelen:%d/%luno nameunknown qtyperefused???unknown, type 0x%xrefused, type 0x%x%d bytes from %s, icmp_seq=%u hlim=%d(DUP!) time=%g ms dst=%sfailed to get receiving packet informationa:b:c:dfHg:h:I:i:l:mnNp:qRS:s:tvwW-R is not supported in this configurationinvalid source address: %sinvalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit -- %sillegal hoplimit %stoo small interval, raised to 0.01illegal timing interval %sillegal preload value -- %sMust be superuser to preloaddatalen value too large, maximum is %dillegal datalen value -- %sgetaddrinfo failedsetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_HOPOPTS)setsockopt(IPV6_DSTOPTS)-f and -i incompatible optionsUnable to allocate packetsetsockopt(IPV6_USE_MIN_MTU)setsockopt(ICMP6_FILTER)%s: invalid interface namesetsockopt(SO_SNDBUF)PING6(%lu=40+8+%lu bytes) %s --> new path MTU (%d) is notified recvmsgpollsetsockopt(IPV6_HOPLIMIT)setsockopt(IPV6_PKTINFO)setsockopt(SO_RCVBUF)you need -b to increase socket buffer sizeUDP socketUDP setsockopt(IPV6_PKTOPTIONS)UDP connectgetsocknamecan't initialize rthdrbad addr family of an intermediate addrcan't add an intermediate nodecan't set the last flagcan't allocate enough memorysetsockopt(IPV6_RTHDR)IPV6_MULTICAST_HOPSgateway resolves to multiple addressestoo many intermediate hopsgetaddrinfo for the gateway %s: %sping6: wrote %s %d chars, ret=%d sendmsg\%03odnsdecodeinvalid peernamepr_packunknown code 0x%x, type 0x%xNodeInfo NOOP HbH Options: Routing: Dst Options: -%uNodeInfo Supported Qtypes, compressed bitmap, raw bitmap %s(TTL=%u)pr_nodeaddr(TTL=infty) no address truncated --- %s ping6 statistics --- round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms %.1lf%% packet loss+%ld duplicates, IPv6 addressDNS labelIPv4 addressSuccessRefusedNo Route to Destinationpr_icmphDestination Unreachable, Bad Code: %d Destination Administratively UnreachableDestination Unreachable Beyond ScopePacket too big mtu = %d Time exceeded, Bad Code: %d Parameter problem: Bad code(%d) pointer = 0x%02x Erroneous Header Unrecognized Option Unknown Nextheader Listener QueryListener ReportListener DoneRouter SolicitationRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sBad ICMP type: %dNode Information QueryNOOP, invalid, oldfqdn, subject=%s(%s), no subject, subject=%s(invalid)Supported qtypesDNS namenodeaddrIPv4 nodeaddrNode Information Reply, %sVr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->pr_iphHBH RTHDR FRAG ESPICMP6: type = %d, code = %d Unknown Header(%d) DSTOPT IP6ff02::2:0000:0000nigroupusage: ping6 [-dfHmnNqtvwW] [-a [aAclsg]] [-b sockbufsiz] [-c count] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-h hoplimit] [-g gateway] [hops...] host usage: %s -l or %s [-q] name lqpc-xt/pc-atusbadblk201sunsun5hilgscdkfrukjpsvnohuberuuasgsflabrplsicfnodeaddeclklk401swapctrlcapsdvorakmetaesciopenermachdepappletables available for %s keyboard: encoding /dev/wskbd%dWSKBDIO_GTYPEUnknown encoding or variant. kbd(8) needs to be rebuilt.kbd_listunknown encoding %sunknown variant %s%s: unsupported encoding %s on %s WSKBDIO_SETENCODING: %skbd: keyboard mapping set to %s kbd_set?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for dataLESSSECURELESS-E-G-L-mMOREWARNING: terminal is not fully functionalCannot allocate memoryticdcmsomdmbvbbc|^srget_termraw_modeLESS_TERMCAP_ltget_envLINESlicokrklkukdkPkNkh@7kDTERMhcxndadbpcNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketseek errorread errorch_ungetchar overrunseek error to 0ESC^%c*s<%X>Non-match First-file EOF-ignore Keep-pos Regex-off (P)+ [Press space to continue, 'q' to quit.]less %sungetcc overflowPattern not found help(N-th) No %snext fileNo %sprevious fileNo such filemark: goto mark: Command not availableBrackets: [Press 'h' for instructions.]Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableeditchar"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)LESSMETAESCAPE\LESSMETACHARS; *? '"()<>|&^`#\%c%s%c%s%s%sHOMEbin_file%s %s %sLESSOPENLESSCLOSE...skipping... Cannot find help fileCannot seek to end of fileCannot seek to beginning of fileCannot seek to line number %nDetermining length of fileDon't know length of fileCannot seek to that file positionLESSANSIENDCHARSplinenum~ Calculating line numbers (press RETURN)Invalid mark letterMark not setMark not in current fileLine number is required after -lless Copyright (C) 2002 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less Tab stops and then every %d spacesopt_x-" must be followed by 1 or 2 charsquotes %sUse "h" for helpThere is no %s option ("less --help" for help)There is no %s optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric option-%sValue is required after %sNumber is required after %sfakeSearch includes displayed screenSearch skips displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by clearing each lineRepaint by painting from top of screenAssume intelligent terminalAssume dumb terminalDon't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesAllow help commandDon't allow help commandCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: Position target at screen line %dDon't display a status columnDisplay a status columnDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numbersprompt: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directlyDisplay control characters directly, processing ANSI sequencesDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linesDisplay underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: Horizontal shift %d positionsUse keypad modeDon't use keypad modeBe less helpful in promptsBe helpful in promptspostoalinenumtoainttoaiprint_intiprint_linenumap_posap_linenumap_intNo previous regular expressionInvalid patternPlease re-enter search patternNothing to searchLine numbers turned offh (4<@HPȉX x @pl Ȧ@Ц؋bgdumbtimernfsv3rdirplusmntudpresvportnfsv2ac23a:bcdD:g:I:iL:lo:PR:r:sTt:w:x:U-2 and -3 are mutually exclusiveillegal -I value -- %sillegal -R value -- %sillegal -a value -- %sconflicting version optionsillegal -r value -- %sillegal -t value -- %sillegal -w value -- %sillegal -x value -- %sNFS Portmapcan't access %s: %sbad MNT RPCCannot MNT PRCcan't resolve address for host %sno : or @ spechostname too longusage: %s [-23bcdilsTU] [-a maxreadahead] [-g maxgroups] [-I readdirsize] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-w writesize] [-x retrans] rhost:path node XtB@unused DOS FAT-12 XENIX / XENIX /usr DOS FAT-16 Extended DOSDOS > 32MB HPFS/QNX/AUXAIX fs AIX/Coherent OS/2 Bootmgr Win95 FAT-32 Win95 FAT32LDOS FAT-16 Extended LBAOPUS OS/2 hidden Compaq Diag.OS/2 hidden OS/2 hidden OS/2 hidden AST swap Willowtech Thinkpad Rec Willowsoft $NEC DOS 8Theos 9Plan 9 @VENIX 286 ALin/Minux DRBLinuxSwap DRCLinux DR MQNX 4.2 Pri NQNX 4.2 Sec OQNX 4.2 Ter PDM QDM RCP/M or SysVSDM TOntrack UEZ-Drive VGolden Bow \Priam aSpeedStor cISC, HURD, *dNetWare 2.xxeNetWare 3.xxfNetWare 386 gNovell hNovell iNovell pDiskSecure uPCIX Minix (old) Minix (new) Linux swap Linux files*OS/2 hidden Linux ext. NT FAT VS NTFS VS Amoeba FS Amoeba BBT Mylex BSDI NotebookSaveFreeBSD OpenBSD NEXTSTEP MacOS X NetBSD MacOS X bootBSDI filesy*BSDI swap Solaris CTOS DRDOSs FAT12DRDOSs < 32MDRDOSs >=32MHPFS DisbledCPM/C.DOS/C*Dell Maint SpeedStor SpeedStor SpeedStor BeOS/i386 SpeedStor DOS 3.3+ SecSpeedStor Xenix BBT Z[s8~eWjbO6p;x7NĞݳ5!8H.Aq~&9ڗU"@ї|u}}>*}{{%nuFr7U2~o|>]x7;?[yȋb/֞~ıyE(2RqZTy =8n>{~wIvJy|zXx{^x‹^𢅧^ ߓo&nkCkv-icU檃+  8w@4h$rD3RpGl۷=+.eXBioio^0#ڦGFxee)TBFF7$ ĪȶqKa+)(* =,'l1q*G-nng0XG⻬JwX;[?: TZAkI.F[8-Q~+9= 1x V1#W^_SFN닠8,:XUĊ)+\ӵ kupNG<XNZiU 76^z$VY_||{!Uv&t.∾\&#;~4= cɇ`c߀~R0iu:2, '3< !q0u9~;W-rt9Rԉe9pti2B&lRX cp4&㛷G0q.s-ܭ9simU& CPz(W-J\J*}n~j'ٴWϴfo.,_= , /&c e,{S&7hU`F,'IQ3sL*NLܠv]ׂD[? Sa \(:ғ¦HC(SN% v6~!مRtQZE t}࿷6OזLNe_N&(œErxK #d[2;7;paɆCx[z'k;%q dLO »[xٙ: X"DoLP3lͿ@릗nţL*XS$"U0pd-Q/-xSV a7ì(ybV=3P,"KiTP;*I,%״Q%wlV@URsQ,ik%%vzh}\*JC)YaKq1KXs]?N4tp 2l]LW8:-B[hxw{umoD ջp}wqzq`xl2tTHЧH }ke!C29.Z sQ7ih^Sog>-9ﮩd/%σzNչQ(M+qXd&6UJ w0;L$KI{Mx^j󱀒a]fmOyցJxl2ja%!'C2Js0h8ǒ ?$klbxCN=\~,=Й^h0Ce-$h`}Yu$hEg)g]މ@uYSVi0yp8Mټo6?BZ"zgiPXΆ(1<} A/^--ae877!V^c١ה_0PKt&Doyz tpǖMfÙ?$c :ڞZ>La`6-2$>jXi(@!_sἁ!ũ@d@g2R9`ȭ8P3;zfxBᾩ8-.|iʆ_|[7ߨoL|0FEgf+q Ӫnv5,o+g2/?lZwi[dʲ ;THo>+ 8`Ume (oqr)ee'.X>iʊ57?Զ& l)v/tP$`$ijؙ KV~JRkiU$NUrl ~ZiK]n3 lf4 "sUlRSS+ydž IA%C[Bx,Ȣ~!Rl,| ADf\]3-&N36[[;&$+qJ F0 .#[>-[nA(U*Xo".͞jwxOܥJݾL] ikOH:&Ȅº{⊞ۍ:褻u3`[ڱY*L6P42N{?jK,‚=(mz#^k (աש6j\ coU+Gt!b챀wNxڨ)7goloߑ\8AD{"=d~Bj6 Ѵ`W`ZU %"ua9b\ v bDwNB- jq :꒵1vOw.ÐWFִu\z7 ~. +9n`Y$MCK2 頝ZTd&f5$πHݚ4!Y*C:R*ݴO̖sog]oL[9bsj:uRqu HڅV}Tn aUP 5 ]t uVaVUI{64֜ABT|WE&͔ $a KjXF0kGFZ&3 qvS٬֧Xёب$g}Lb oV߰*͔sLgmz',#G%;sϩy쩒Zgtk#MjFGPA;%hk$~ţ,FwMōc ^ͫJm@;R %ՋnmcfB3.KPN/w'Q%{݁ +9-~{6c5o\C#V }J>&$Zo1.e|:x^pzړ5ĂTA(ZnԒ$Ȩ{ﯽG!Mm[zs#{UJdy8927O6PMa3ļTww _ZRBh;9Fp@3m4ٝnNG+wl6`]{H8— `WՕ`~0䮙YɼH0j3'q!}L$sd.}JPbC} ,usage: %s [-ieu] [-c cylinders -h heads -s sectors] [-f mbrfile] device -i: initialize disk with virgin MBR -u: update MBR code, preserve partition table -e: edit MBRs on disk interactively -f: specify non-standard MBR template -chs: specify disk geometry `disk' may be of the forms: sd0 or /dev/rsd0c. /usr/mdec/mbrieuf:c:h:s:Cylinder argument out of range [1..262144].Head argument out of range [1..256].Sector argument out of range [1..63].using builtin MBRCan't get disk geometry, please use [-chs] to specify.Please specify a full geometry with [-chs].Command help listShow entire OpenBSD man page for fdiskreinitRe-initialize loaded MBR (to defaults)setpidSet the identifier of a given table entryEdit current drive statsEdit given table entryflagFlag given table entry as bootableUpdate machine code in loaded MBRSelect extended partition table entry MBRSwap two partition entriesPrint loaded MBR partition tableWrite loaded MBR to diskexitExit edit of current MBR, without saving changesQuit edit of current MBR, saving current changesabortAbort program without saving current changes ----------------------------------------------------- ------ ATTENTION - UPDATING MASTER BOOT RECORD ------ ----------------------------------------------------- Do you wish to write new MBR? Do you wish to write new MBR and partition table?USER_initMBR is unchangedEnter 'help' for informationfdisk:%c%d> Aborting changes to current MBR.USER_modifyWriting current MBR to disk.Invalid command '%s'. Try 'help'. Offset: %d USER_print_diskBytesSectorsKilobytesMegabytesGigabytesask_cmd%s [%X - %X]: [%X] %s [%d - %d]: [%d] (? for help) ask_num'%d' is out of range. '%s' is not a valid number. %s [n] %s is not a character device or a regular fileDIOCGDINFODISK_getlabelmetricsDisk: %s geometry: %d/%d/%d [%.0f %s] geometry: Signature: 0x%X MBR_pcopyChoose from the following Partition id values:%02X %s %02X %s %02X %s %02X %s Warning CHS values out of bounds only saving LBA values Starting Ending LBA Info:%c%1d: %.2X %4u %3u %2u - %4u %3u %2u [%12u:%12.0f%s] %s #: id C H S - C H S [ start: size ]------------------------------------------------------------------------Start of partition #%d after end!In memory copy is initialized to:Use 'write' to update disk.XreinitChange disk geometry?BIOS CylindersBIOS HeadsBIOS SectorsInvalid argument: %s Invalid partition number %d. Swap with what paritition?%d same partition as %d, doing nothing. Invalid argument: %s Invalid partition number.Partition id ('0' to disable) Partition %d is disabled. Do you wish to edit in CHS mode?BIOS Starting cylinderBIOS Starting headBIOS Starting sectorBIOS Ending cylinderBIOS Ending headBIOS Ending sectorLoop to offset 0! Not selected.Selected extended partition %d New MBR at offset %d. Partition %d is not an extended partition. Writing MBR at offset %d. Xwrite %s %s Machine code updated.Partition %d flag value set to 0x%x. Partition %d marked active. Invalid argument: %s [value] (standard input)(fd %d)invalid file type^\((%s[[:<:]]%s%.*s%s[[:>:]]%susage: %s [-abcEFGHhIiLlnoPqRSsUVvwx] [-A num] [-B num] [-C[num]] [-e pattern] [-f file] [--binary-files=value] [--context[=num]] [--line-buffered] [pattern] [file ...] 0123456789A:B:CEFGHILPSRUVabce:f:hilnoqrsuvwxybinary-filesmmapline-bufferedafter-contextbefore-contextextended-regexpfixed-stringsbasic-regexpbinaryversionbyte-offsetregexpno-filenameignore-casefiles-without-matchfiles-with-matchesline-numberquietsilentrecursiveno-messagesrevert-matchword-regexpline-regexpunix-byte-offsetscontext out of rangegrep version %u.%u without-matchUnknown binary-files optionBinary file %s matches [[:<:]][[:>:]]%lldaFfh:t:v%s: not a directory or special deviceumountfsBad MNT RPC%s: unmount from %s %s: not currently mountedusage: %s %s umount [-fv] [-t fstypelist] special | nodeumount -a[fv] [-h host] [-t fstypelist]h (4<@HPXGsl9xu:g:m:o:not an MSDOS filesystemstat %sunknown group id: %sunknown user id: %sinvalid file mode: %susage: mount_msdos [-o options] [-u user] [-g group] [-m mask] bdev dir $OpenBSD: fsck.c,v 1.19 2005/02/03 05:03:50 jaredy Exp $$OpenBSD: fsutil.c,v 1.13 2003/09/25 04:15:29 deraadt Exp $$OpenBSD: preen.c,v 1.14 2003/06/26 08:01:54 tedu Exp $start %s %swait %scheckfs%s/fsck_%sexec %sCan't get resource limit for data sizeCan't get resource limit to max data sizedvpfnyl:t:T:%s: unknown special file or file system.fsck_%sInvalid option stringusage: %s [-dfnpvy] [-l maxparallel] [-T fstype:fsoptions] [-t fstype] [special | node ...] UNEXPECTED INCONSISTENCY:THE FOLLOWING FILE SYSTEM%s HAD AN %s %s: %s (%s)%sCan't open checklist file: %s/etc/fstabBAD DISK NAME %s pass %d, name %s Unknown pid %ld%s: %s (%s): EXITED WITH SIGNAL %d done %s: %s (%s) = %x disk %s: %s in fstab more than once!mkfifom:invalid file mode.non-numeric major number.non-numeric minor number.major or minor number too largenode must be type 'b' or 'c'.usage: %s [-m mode] fifoname ... usage: %s [-m mode] name [b | c] major minor usage: %s [-m mode] name p @(#) Copyright (c) 1997, 1998, 1999 Bill Paul. All rights reserved.@(#) $OpenBSD: wicontrol.c,v 1.58 2005/05/25 07:40:49 reyk Exp $$<Tl     0000PPPP!d"d#d$d&|%d station%s: %02x:%02x:%02x:%02x:%02x:%02x asid=%04x, flagsAUTHASSOCPERM, caps, rates1M2M5.5M11M, sig=%d/%dwi_dumpstationsSIOCHOSTAP_GETALLLucent WaveLAN/IEEESony WaveLAN/IEEELucent Embedded WaveLAN/IEEEPRISM2 HFA3841(EVB2)PRISM2 HWB3763 rev.BPRISM2 HWB3163 rev.APRISM2 HWB3163 rev.BPRISM2 HFA3842(EVB3)PRISM1 HWB1153PRISM2 HWB3163 SST-flashPRISM2 HWB3163(EVB2) SST-flashPRISM2 HFA3842(EVAL)PRISM2.5 ISL3873PRISM2.5 ISL3874A(Mini-PCI)PRISM2.5 ISL3874A(PCI-bridge)PRISM3 ISL37300PPRISM3 ISL37300P(PCI)PRISM3 (USB)SIOCGWAVELAN (0x%x)wi_getvalwi_setvalSIOCSWAVELAN[ %s ]must specify stringstring too longmust specify addressbadly formatted addressno WEP option available on this cardencryption key must be no more than 13 characters longonly 4 encryption keys availableencryption key must be no more than 26 hex digits long[ 0xUnknown Lucent chipUnknown PRISM chip[ %s, Firmware %d.%02d variant %d ][ %s, Firmware %d.%d.%d ][ On ][ Off ][ Firmware WEP ][ Software WEP ][ Unknown ]AP Informationap[%d]: netname (SSID): [ %s ] BSSID: [ %02x:%02x:%02x:%02x:%02x:%02x ] Channel: [ %d ] Beacon Interval: [ %d ] Quality/Signal/Noise [signal]: [ %d / %d / %d ] DataRate [Mbps]: [ %2.1f ] AvailableRates [Mbps]: [ %d.%d Capinfo: [ PRIV IBSS ESS [dBm]: [ %d / %d / %d ] NIC serial number: Station name: SSID for IBSS creation: Current netname (SSID): Desired netname (SSID): Current BSSID: Channel list: IBSS channel: Current channel: Comms quality/signal/noise: Promiscuous mode: Process 802.11b Frame: Port type (1=BSS, 3=ad-hoc, 6=Host AP): MAC address: TX rate (selection): TX rate (actual speed): Maximum data length: RTS/CTS handshake threshold: Create IBSS: Antenna diversity (0=auto,1=pri,2=aux): Microwave oven robustness: Roaming mode(1=firm,3=disable): Access point density: Power Management: Max sleep time: Enhanced Security mode: Intersil Prism2-based card: Card info: Encryption: Encryption algorithm: Authentication type (1=OpenSys, 2=Shared Key): TX encryption key: Encryption keys: Transmitted unicast frames: %u Transmitted multicast frames: %u Transmitted fragments: %u Transmitted unicast octets: %u Transmitted multicast octets: %u Single transmit retries: %u Multiple transmit retries: %u Transmit retry limit exceeded: %u Transmit discards: %u Transmit discards due to wrong SA: %u Received unicast frames: %u Received multicast frames: %u Received fragments: %u Received unicast octets: %u Received multicast octets: %u Receive FCS errors: %u Receive discards due to no buffer: %u Can't decrypt WEP frame: %u Received message fragments: %u Received message bad fragments: %u usage: %s [interface] [-olL] [-t tx rate] [-n network name] [-s station name] [-e 0|1] [-k key [-v 1|2|3|4]] [-T 1|2|3|4] [-x 0|1] [-F 0|1] [-c 0|1] [-q SSID] [-p port type] [-a access point density] [-m MAC address] [-d max data length] [-r RTS threshold] [-f frequency] [-M 0|1] [-P 0|1] [-S max sleep duration] [-A 1|2|3] [-D 0|1|2] [-R 1|3] [-E 0|1|2|3] wi0a:c:d:e:f:hi:k:lm:n:op:q:r:s:t:v:x:A:D:E:F:LM:S:P:R:T:get_if_flagsset_if_flagsbssad-hocunknown port type %sUGHRBD M@dmCXLS1@2 3cJ0123456789abcdefold usage of trailing 0assuming route to if entry in usenot in tablerouting table overflow: gateway %s (%s)netmask missingold usage of trailing digit, assuming route via gatewayblackholechangecloningdstexpiregatewaygenmaskhopcountifaifpipxjumbolinkllinfolockrestmpathnojumbonostaticproto1proto2recvpiperejectrttrttvarsasendpipeshowssthreshstaticxresolvebotched keyword: %susage: %s [-dnqtv] command [[modifiers] args] commands: add, change, delete, flush, get, monitor, show dnqtv/dev/nullroute-sysctl-estimate%-20.20s donewrite to routing socketgot only %d for rlen Examining routing table from sysctl(address family %s) actual retrieval of routing tablemust be root to alter routing tableking bula sez: set_metric with invalid keyinet6_makenetandmask128%s: resolved to multiple values%s: bad address%s: not a network%d: bad address familyinternal errorprefixlen is not supported with af %dactual retrieval of interface tablegot message of size %d on %sread from routing socketwriting to routing socketso_labelso_ifaso_ifpso_genmaskso_maskso_gateso_dstRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics or flagsRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_RESOLVE: Route created by cloningRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_IFINFO: iface status changeRTM_IFANNOUNCE: iface arrival/departurerouting message version %d not understoodprint_rtmsg%s: len %d, if# %d, link: %s, flags:name: %s, pid: %ld, seq %d, errno %d, flags:metric %d, flags:if# %d, name %s, what: departurearrival route to: %s destination: %s mask: %s interface: %.*s if address: %s flags: label: %s recvpipe sendpipe ssthresh rtt,msec rttvar hopcount mtu expire%8lu%c %8ld%c sockaddrs: gateway: %s RTM_GET: %s (errno %d)message length mismatch, in packet %d, returned %d locks: inits: sockaddrs: %s: link %s; sodump%s: inet %s; %s: ipx %s; %s: inet6 %s; label too longRouting tablessysctl of routing tableGatewayFlagsRefsUseMtuInterface%-*.*s %-*.*s %-6.6s %6.6s %8.8s %6.6s %s PortProtoSA(Address/Proto/Type/Direction)Source%-18s %-5s %-18s %-5s %-5s %-22s %-*.*s Address%-6.6s %6d %8ld %6ld %6s %.16sp_rtentryInternet Protocol Family %d: AppleTalkIPXInternet6Encapp_flagsroutename(%d) %s%u.%u.%u/%d%u.%u.%u.%u/%d%u.%u/%d%u/%d%s/%dnetname6illegal prefixlenaf %d: %s*.**.0x%XHany%XH.%s%s.%XH%02X%02X%02X%02X%02X%02XHlink#%d KMGTPasciiimageebcdictenexusage: %s [ | Using %s mode to transfer files. %s: unknown mode. TYPE %s %sTYPE %sinternal error: unknown type %d.We only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. local-fileremote-fileusage: %s local-file [ remote-file ] APPESTORSTOUlocal-filesusage: %s local-files Continue withmput%s: not foundr+wusage: %s remote-file [ local-file ] local: %sRETRgetitremote-filesusage: %s remote-files mgetand logged inConnected %sto %s. Not connected. Connected for proxy commands to %s. No proxy connection. (none)Gate ftp: %s, server %s, port %s. Passive mode: %s. Mode: %s; Type: %s; Form: %s; Structure: %s. Verbose: %s; Bell: %s; Prompting: %s; Globbing: %s. Store unique: %s; Receive unique: %s. Preserve modification times: %s. Case: %s; CR stripping: %s. Ntrans: (in) %s (out) %s Ntrans: off. Nmap: (in) %s (out) %s Nmap: off. Hash mark printing: %s; Mark count: %d; Progress bar: %s. Use of PORT/LPRT cmds: %s. (disabled for this connection)Use of EPSV/EPRT cmds for IPv4: %s%s. Macros: usage: %s [ on | off ] %s %s. Bell modeEPSV/EPRT on IPv4Packet tracingusage: %s [ on | off | bytecount ] %s: bad bytecount value. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeusage: %s [ on | off | gateserver [ port ] ] Disabling gate-ftp mode - no gate-ftp server defined. GlobbingPreserve modification timesusage: %s [ on | off | debuglevel ] %s: bad debugging value. Debugging %s (debug=%d). remote-directoryusage: %s remote-directory CWD %sCWD command not recognized, trying XCWD. XCWD %susage: %s local-directory Local directory now %s getcwd: %slcdDELE %susage: %s remote-file mdeletefrom-nameto-nameRNFR %susage: %s from-name to-name RNTO %susage: %s remote-directory local-file nlistLISTNLSToutput to local-file:usage: %s remote-files local-file Try again latershellusernameusage: %s username [password] [account] USER %sPassword: PASS %sAccount: ACCT %sLogin failed. PWDPWD command not recognized, trying XPWD. XPWDLocal directory %s getcwdlpwddirectory-nameMKD %susage: %s directory-name MKD command not recognized, trying XMKD. XMKD %sRMD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendusage: %s line-to-send arguments to SITE commandSITEquote1SITE CHMOD %s %susage: %s mode file-name SITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITusage: %s [password] Account:usage: %s command ?Ambiguous command. ?Invalid command. ?Invalid proxy command. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutusage: %s [mapin mapout] nmap: unbalanced brackets. Passive modeStore uniqueReceive uniqueCDUPCDUP command not recognized, trying XCUP. XCUPrestart: offset not specified. restart: invalid offset. Restarting at %lld. Execute get, put or append to initiate transfer SYSTLimit of 16 macros have already been defined. macro nameusage: %s macro_name Enter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4K buffer exceeded. usage: %s filename %s %lld %s %sSTAT %sSTATLocal file "%s" is newer than remote file "%s". |%sCan't allocate memory for $PAGERaccountbellbyecasecdupclosedisconnectepsv4formgateglobhashidlemacdefmdirmlsmodtimemsendnewernmapntranspassivepreserveprogresspromptpwdquoterecvregetresetrestartrhelprmdirrstatusruniquesendportsitestructsuniquetraceumaskverbose'%s' macro not found. domacroRetrieving %s/%s auto_fetchExtra `@' characters in usernames and passwords should be encoded as %%40Can't allocate memory to parse URLhttp://ftp://url_get: Invalid URL '%s'Invalid URL (no `/' after host): %sInvalid URL (no file after host): %sInvalid URL (no file after directory): %sCan't allocate memory for proxy URL.Malformed proxy URL: %sCan't open file %sReading from filehost %s, port %s, path %s, save as %s. (unknown)Trying %s... r+Requesting %s (via %s) GET %s HTTP/1.0 %s User-Agent: OpenBSD ftpGET /%s HTTP/1.0 Host: Can't allocate memory.[%s]:%s %s Writing HTTP requestreceived '%s' 301302Too many redirections requested200Error retrieving file: %sContent-Length: Location: Redirected to %s Can't open %sCan't allocate memory for transfer bufferReading from socketRead short file. Successfully retrieved file. Auto-login using ftp URLs isn't supported when using $ftp_proxyReceiving HTTP replyWriting %sImproper response from %surl_get http fetch aborted. file fetch aborted. ftp_proxyhttp_proxyCan't allocate memory for auto-fetch.Invalid URL: %suser %s:%s host %s port %s dir %s file %s Can't connect or login to host `%s'*?[]{}Can't allocate memory for URL decoding:/ftpgatehttp%s: bad port number `%s'connect to address %ssetsockopt TOS (ignored)fdopen failed.Connected to %s. hookup---> PASS PASS XXXXACCT ACCT XXXXNo control connection for command. %c%c%c421 Service not available, remote server has closed connection. getreply send aborted waiting for remote to finish abort. sentlocal: %s remote: %s %s: not a plain file. REST %ldnetoutsendrequest receive aborted waiting for remote to finish abort. receivednetin%s: short writeWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %suse of scoped address can be troublesomesetsockopt (ignored)EPSVwrong server: return code must be 229 disabling epsv4 for this connection PASVLPSVPassive mode refused. wrong server: return code must be 227 %u,%u,%u,%u,%u,%uwrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode AF mismatch. Shouldn't happen! %c%c%c%d%cparse error! setsockopt (reuse address)setsockopt IP_PORTRANGE (ignored)setsockopt IPV6_PORTRANGE (ignored)listenEPRT |%d|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dinitconnacceptdataconnproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s runique: can't find unique file name. Lost control connection for abort.%cABOR abort_remoteNeither $FTPSERVER nor $GATE_SERVER is defined; disabling gate-ftpdumbemacssu-r requires numeric argument46Aadegimno:pP:r:tvVRetrying... FTPSERVERPORTFTPMODEunknown FTPMODE: %s. Using defaultsgate-ftpFTPSERVERftp> sorry, input line too long. Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous help command %s ?Invalid help command %s %-*s %s usage: %s [-46AadegimnptVv] [-P port] [-r seconds] [host [port]] %s [-o output] ftp://[user:password@]host[:port]/file[/] %s [-o output] http://host[:port]/file %s [-o output] host:[/path/]file[/] anonymous4K macro buffer exceeded. Unknown .netrc keyword %sError: .netrc file is readable by others.Remove account or make file unreadable by others.Missing macdef name argument. Macro definition missing null line terminator. Remove password or make file unreadable by others.ruserpasspasswordpasswdmachine%s/.netrc: %s%s/.netrcstringlist|%.*s%*s| %5lld %c%c %2d:%02d:%02d --:-- ETA - stalled -%02d:%02d ETAprogressmeterAlready connected to %s, use close first. usage: %s host-name [port] gateserver not defined (shouldn't happen)PASSERVE %sConnected via pass-through server %s non-printstreamRemote system type is %s. 215 UNIX Type: L8215 TOPS20Remember to set tenex mode when transferring binary files from this machine. %s@Name (%s): Name (%s:%s): Password:Login failed.$initftp_loginsorry, arguments too long. (%s) unable to create temporary file: %sftpXXXXXXXXXXunable to create temporary file %scan't find list of remote files, oops.can't find list of remote files, oops. remglob%s %s? n, y, p, a, are the only acceptable commands! Interactive mode: off. Prompting off for duration of %s. confirmSIZE %sMDTM %s191Y2K warning! Fixed incorrect time-val received from server. %*s %04d%02d%02d%02d%02d%02dCan't convert %s to a time. %3d%% *************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************%lld byte%s %s in %.2f seconds (%.2f %sB/s) ETA: %02d:%02d:%02d ptransfer/etc/rcWARNING: some process(es) wouldn't die(can't restart init): SIGTERM processes/dev/consolesetsidrevokeSIGTSTP inithalted (with powerdown) by %shalted by %srebooted by %sdlnpq~usage: %s [-dn%sq] h (4<@HP@(XHȉreloadfilesystem must be mounted read-only; you may need to run fsckusage: mount_ffs [-o options] special node PHl:x:z:::::::::::::::::;H ;,;H8;HD;P;H\;Hl;|;;;;;;$ ;<<<,<@<X<h<|<<;<<$ <<<$ =,=H8=:D=:P= >4>L>h>l>H|>>$ >$ >H>client callocifi->client->config callocInterface name too long%s.%s/var/db/dhclient.leasesasprintf%s: no link ... giving up got link cannot open %s: %m_dhcpno such user: _dhcp, falling back to "nobody"no such user: nobodycan't open and lock %s: %mPREINITAF_ROUTE/var/empty/chrootchdir("/")can't drop privileges: %musage: %s [-dqu] [-c conffile] [-l leasefile] interface ARPCHECKcheck_DHCPACK from %spacket_to_lease failed.BOUNDRENEWREBINDREBOOTold_new_bound to %s -- renewal in %d seconds.BOOTREPLY from %s rejected.DHCPOFFERDHCPNACKDHCPACK%s from %s rejected.BOOTREPLY%s from %s%s isn't satisfactory.%s already seen.ARPSENDdhcpoffer: no memory to record lease.dhcpoffer: no memory for server name.Bogus server name %sdhcpoffer: no memory for filename.dhcpoffer: no memory for option %dInvalid lease option - ignoring offerDHCPNAK from %sDHCPNAK with no active lease. Trying medium "%s" %dMEDIUMDHCPDISCOVER on %s to %s port %d interval %dNo DHCPOFFERS received.Trying recorded lease %sTIMEOUTbound: renewal in %d seconds.bound: immediate renewal.No working leases in persistent database - sleeping. EXPIREDHCPREQUEST on %s to %s port %dsend_requestDHCPDECLINE on %s to %s port %doptions do not fit in DHCPDISCOVER packet.options do not fit in DHCPREQUEST packet.options do not fit in DHCPDECLINE packet.can't create %s: %mlease { bootp; interface "%s"; fixed-address %s; filename "%s"; server-name "%s"; medium "%s"; option %s %s; renew %d %d/%d/%d %02d:%02d:%02d; rebind %d %d/%d/%d %02d:%02d:%02d; expire %d %d/%d/%d %02d:%02d:%02d; } script_init: no memory for environmentPATH=/usr/bin:/usr/sbin:/bin:/sbinip_addressnetwork_numberbroadcast_addressserver_nameprepend optionappend optionno space to %s %sexpirypriv_script_write_paramsunexpected msg type %ureceived corrupted messagefork: %mwait: %mexecve (%s, ...): %mscript_set_env: no memory for variablescript_set_env: no memory for variable assignmentillegal character (%c) in value '%s'%s%s=%sdaemonInvalid IP address in option: %sBogus Host Name option %d: %s (%s)unknown dhcp option value 0x%xwarning: hostname %s contains an underscore which violates RFC 952option_as_string: bad code %ddhcp option too largecannot fork%s [priv]poll errorCorrupt lease file - possible data loss!expecting a statement.semicolon expected.expecting string or hexadecimal datastring constant too long.expecting hexadecimal constant.hexadecimal constant too long.expected option name.expecting semicolon.%s: unexpected option name.%s: too many options.expecting interface name (in quotes).expecting left brace.unterminated interface declaration.no memory for lease.unterminated lease declaration.wrong interface name. Expecting '%s'.expecting lease declaration.expecting identifier after option keyword.no option named %sexpecting number.expecting identifier.truefalseexpecting boolean.Bad format %c in parse_option_param.expecting string.option data buffer %soption data buffer overflowout of memory allocating option data.parse_option_declExpecting media options.no memory for string list entry.no memory for reject list!parse_reject_statementexpecting IP address.getifaddrs failedno space to remember ifpCan't allocate poll structures.No live interfaces to poll on - exiting.poll: %mreceive_packet failed on %s: %sInterface %s no longer appears valid.got_oneioctl(SIOCGIFFLAGS) on %s: %mioctl(SIOCGIFMEDIA) on %s: %mCan't allocate timeout structure!can't allocate protocol struct for %sCan't create socketinterface_link_status/dev/bpf%dCan't find free bpf: %mCan't attach interface %s to bpf device %s: %mif_register_bpfCan't get BPF version: %mKernel BPF version out of range - recompile dhcpd!Can't set immediate mode on bpf device: %mCan't get bpf buffer length: %mCan't allocate %lu bytes for bpf input buffer.Can't install packet filter program: %mCan't install write filter program: %mCannot lock bpfsend_packet: %msend_packetcSclarger than bufferoption %s (%d) %s.Many bogus options seen in offers. Taking this offer in spite of bogus options - hope for the best!rejecting bogus offer.Can't allocate storage for option %s.Can't expand storage for option %s.pretty_print_option: bad code %d%s: Excess information in format string: %s%s: garbage in format string: %s%s: expecting at least %d bytes; got %d%s: %d extra bytes%s: %d extra bytes at end of arrayUnexpected format code %cpretty_print_optionDiscarding packet with invalid hlen.do_packeteof in string constantstring constant larger than internal buffernumeric token larger than internal bufferlways-reply-rfc1048llowbandoneduthoritativeackoff-cutoffootingoot-unknown-clientslassiaddrlient-identifierlient-hostnameomainenyefaultynamic-bootp-lease-cutoff-lease-lengththernetxpireixed-addressddiet-lease-hostnamesardwarenitial-intervalnterfaceax-lease-timeediameserveretmaskext-serverne-lease-per-clientrependequestequireetryenewebindeboottartsubnethared-networkerver-nameerver-identifierelect-timeoutcriptupersedeimestampoken-ring-host-decl-names-lease-addr-for-default-routenknown-clientsendor-classexiting. %s line %d: %s%s^subnet_numberbroadcast_addraddr_eqpiaddr%d bad IP checksums seen in %d packetsip length %d disagrees with bytes received %d.%d udp packets in %d too long - droppedaccepting packet with data after udp payload.%d bad udp checksums in %d packetssubnet-masktime-offsetIAtime-serversien116-name-serversdomain-name-serverslog-serverscookie-serverslpr-serversimpress-serversresource-location-servershost-nameboot-sizemerit-dumpdomain-nameswap-serverroot-pathextensions-pathip-forwardingnon-local-source-routingpolicy-filterIIAmax-dgram-reassemblydefault-ip-ttlpath-mtu-aging-timeoutpath-mtu-plateau-tableSAinterface-mtuall-subnets-localbroadcast-addressperform-mask-discoverymask-supplierrouter-discoveryrouter-solicitation-addressstatic-routestrailer-encapsulationarp-cache-timeoutieee802-3-encapsulationdefault-tcp-ttltcp-keepalive-intervaltcp-keepalive-garbagenis-domainnis-serversntp-serversvendor-encapsulated-optionsnetbios-name-serversnetbios-dd-servernetbios-node-typenetbios-scopefont-serversx-display-managerdhcp-requested-addressdhcp-lease-timedhcp-option-overloaddhcp-message-typedhcp-server-identifierdhcp-parameter-request-listBAdhcp-messagedhcp-max-message-sizedhcp-renewal-timedhcp-rebinding-timedhcp-class-identifierdhcp-client-identifieroption-62option-63nisplus-domainnisplus-serverstftp-server-namebootfile-namemobile-ip-home-agentsmtp-serverpop-servernntp-serverwww-serverfinger-serverirc-serverstreettalk-serverstreettalk-directory-assistance-serveruser-classoption-78option-79option-80option-81option-82option-83option-84nds-serversnds-tree-namends-contextoption-88option-89option-90option-91option-92option-93option-94option-95option-96option-97option-98option-99option-100option-101option-102option-103option-104option-105option-106option-107option-108option-109option-110option-111option-112option-113option-114option-115option-116option-117option-118option-119option-120option-121option-122option-123option-124option-125option-126option-127option-128option-129option-130option-131option-132option-133option-134option-135option-136option-137option-138option-139option-140option-141option-142option-143option-144option-145option-146option-147option-148option-149option-150option-151option-152option-153option-154option-155option-156option-157option-158option-159option-160option-161option-162option-163option-164option-165option-166option-167option-168option-169option-170option-171option-172option-173option-174option-175option-176option-177option-178option-179option-180option-181option-182option-183option-184option-185option-186option-187option-188option-189option-190option-191option-192option-193option-194option-195option-196option-197option-198option-199option-200option-201option-202option-203option-204option-205option-206option-207option-208option-209option-210option-211option-212option-213option-214option-215option-216option-217option-218option-219option-220option-221option-222option-223option-224option-225option-226option-227option-228option-229option-230option-231option-232option-233option-234option-235option-236option-237option-238option-239option-240option-241option-242option-243option-244option-245option-246option-247option-248option-249option-250option-251option-252option-253option-254option-endpadvalue %s%o exceeds max (%d) for precision.value %s%x exceeds max (%d) for precision.value %s%u exceeds max (%d) for precision.Unexpected integer size: %dfilename must be a stringno memory for string %s.expecting a network hardware typeExpecting numeric lease timeno space for numeric aggregatenumeric aggregate too short.Bogus number: %s: digit %d not in base %dBogus number: %s.numeric day of week expected.numeric year expected.expected slash separating year from month.numeric month expected.expected slash separating month from day.numeric day of month expected.numeric hour expected.expected colon separating hour from minute.numeric minute expected.buf_open: %mbuf_add: %mbuf_close (connection closed): %mbuf_close (short write): %mbuf_close: %mbuf_read (connection closed): %mbuf_read (short read): %mbuf_read: %mcorrupted message receivedreceived unknown message, code %ddispatch_imsgcannot read temp filecannot seek temp fileline too longcannot write temp fileinvalid address/tmp/ed.XXXXXXXXXXw+cannot open temp filecannot close temp fileEnter key: get_keywordbad hex digit in keybad binary digit in keydes_setkeydes_ciphercbc_decodedecryption failed (block corrupted)decryption failed (incomplete block)cannot read fileinvalid pattern delimiter& no previous commandunexpected end-of-filecannot close input filecannot open input file%lu newline inserted newline appended cannot read input filecannot close output filecannot open output filecannot write filecannot read stdin \abfnrtv\\ warning: file modifiedinvalid filename@(#) Copyright (c) 1993 Andrew Moore, Talke Studio. All rights reserved. usage: %s [-] [-sx] [-p string] [name] p:sx ? interrupt? script, line %d: %s number out of rangeinvalid redirectioninvalid destinationno previous substitutiondestination expectedcannot nest global commandsno current filenameunexpected command suffixinvalid command suffixunexpected addressno matchfilename too longshell access restrictedinvalid mark charactered.hup/ed.hupno previous patterntrailing backslash (\)unbalanced brackets ([])infinite substitution loopnothing to undoHLPRfiprthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s%s: name too long (not copied)cannot overwrite directory %s with non-directory %s%s is a directory (not copied).%s and %s are identical (not copied).overwrite %s? readlink: %sunlink: %scopy_linksymlink: %smkfifo: %smknod: %schown: %schflags: %sutimes: %slchown: %susage: %s [-fip] [-R [-H | -L | -P]] source_file target_file %s [-fip] [-R [-H | -L | -P]] source_file ... target_directory ^^^j`qs\l `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @      inflate 1.2.3 Copyright 1995-2005 Mark Adler  #+3;CScs !1Aa  0@`@@bbLbXbhbtbbb%s not a regular file%s%s already has %s suffix -- unchanged/dev/stdout%s: unknown suffix: ignored%s%s: name too long%s: input: %soutput: %sdeflate.gzzcatzipunknown program nameGZIPGZIP is too longoption -a is ignored on this systemillegal bit count -- %s-o argument is too long123456789ab:cdfghlLnNOo:qrS:tvV/dev/stdin-o option may only be used with a single input filemay not mix -o, -c, or -t options%s is a directory: ignored: unchangedcompression not supported%s: won't read compressed data from terminal%s: unrecognized file formatcrc errordodecompressfchown: %sfchmod: %sfchflags: %sfutimes: %sZgzztgztaz.-_method crc date time compressed uncompressed ratio uncompressed_name%-7.7s %08x %s %10lld %10lld %4.1f%% %s %10lld %10lld %4.1f%% (totals) OK %4.1f%% -- replaced with %s %lld bytes in, %lld bytes out usage: %s [-123456789cdfghLlNnOqrtVv] [-b bits] [-o filename] [-S suffix] [file ...] 1.2.3put_headerfile errorstream errordata errorinsufficient memorybuffer errorincompatible versionneed dictionarystream endHLPRXfghorstuwxinvalid flags: %sinvalid flag: %sthe -R and -h options may not be specified together.%s: invalid user name%s: invalid group nameusage: %s [-R [-H | -L | -P]] %s file ... [owner][:group]usage: %s [-R [-H | -L | -P]] [-f] [-h] %s file ... $OpenBSD: dir.c,v 1.17 2004/07/05 02:31:54 pvalchev Exp $$OpenBSD: inode.c,v 1.26 2003/10/11 01:43:45 tedu Exp $@(#) Copyright (c) 1980, 1986, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: main.c,v 1.26 2005/02/03 05:03:50 jaredy Exp $$OpenBSD: pass1.c,v 1.17 2005/04/16 18:15:41 millert Exp $$OpenBSD: pass1b.c,v 1.11 2005/04/16 18:15:41 millert Exp $$OpenBSD: pass2.c,v 1.22 2005/06/16 14:51:37 millert Exp $$OpenBSD: pass3.c,v 1.10 2005/04/16 18:15:41 millert Exp $$OpenBSD: pass4.c,v 1.12 2005/04/16 18:15:41 millert Exp $$OpenBSD: pass5.c,v 1.20 2005/06/16 14:51:37 millert Exp $$OpenBSD: fsutil.c,v 1.13 2003/09/25 04:15:29 deraadt Exp $$OpenBSD: setup.c,v 1.21 2003/09/25 04:19:39 deraadt Exp $$OpenBSD: utilities.c,v 1.20 2003/08/25 23:28:15 tedu Exp $?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@dirscanexpanddir blk + cnt %d > sblock.fs_fpg %d cannot allocate memory for inode cache cannot increase directory listCG %d: BAD MAGIC NUMBER dfpnNyYb:c:l:m:conversion levelusage: %s [-fnpy] [-b block#] [-c level] [-m mode] filesystem ... %d files, %d used, %d free (%d frags, %d blocks, %d.%d%% fragmentation) phase 1, inode %d/%dcheckinodeconvert symlink %d(%s) of size %llu cannot read symlink phase 1b, inode %d/%dphase 2, directory %d/%dphase 2, parent directory %d/%d%s %s: LENGTH %ld NOT MULTIPLE of %d%s %s: LENGTH %ld NOT MULTIPLE OF %d (REMOVED)phase 3, directory %d/%ldphase 4, inode %d/%dphase 5, cg %d/%dCREATCANNOT %s CLUSTER MAPS SUMMARY INFORMATION BADBLK(S) MISSING IN BIT MAPSALLOCATED FRAG %ld MARKED FREE ALLOCATED INODE %ld MARKED FREE FREE BLK COUNT(S) WRONG IN SUPERBLKCREATE CLUSTER MAPS%sING CLUSTER MAPS DELETING CLUSTERING MAPS DELETE CLUSTERING MAPSUNKNOWN ROTATIONAL TABLE FORMAT %d INFORMATION; SEE fsck_ffs(8).IMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED)IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=%x IN SUPERBLOCKINCORRECT FMASK=%x IN SUPERBLOCKINCORRECT MAXFILESIZE=%llu IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%lx IN SUPERBLOCKINCORRECT QFMASK=%lx IN SUPERBLOCKcannot alloc %u bytes for cylinder group summary area cannot alloc %lu bytes for lncntp cannot alloc %lu bytes for inphead CONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATIMPOSSIBLE MINFREE=%d IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKclean = %d CPG OUT OF RANGENCYL LESS THAN NCG*CPGSIZE PREPOSTEROUSLY LARGEoffset %d, original %ld, alternate %ld NCG OUT OF RANGE%s: NOT LABELED AS A BSD FILE SYSTEM (%s) UPDATE STANDARD SUPERBLOCKreturning to single-user after filesystem check catchquitcatchinfoffs_isblockffs_clrblockffs_setblockffs_isfreeblock   init: %s init: already running initial setsid() failed: %mrootsetlogin() failed: %munrecognized flag '-%c'ignoring excess argumentsfatal signal: %scannot get kernel security level: %scannot change kernel security level from %d to %d: %scan't open %s: %mcan't get %s for controlling terminal: %m/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bincan't exec %s for single user: %mcan't fork single-user shell, trying againwait for single-user shell failed: %m; restartinginit: shell stopped, restarting single user shell terminated, restartingsingle user shell terminated.single_userautobootcan't exec %s for %s: %mcan't fork for %s on %s: %mwait for %s on %s failed: %m; going to single user modeinit: %s on %s stopped, restarting %s on %s terminated abnormally, going to single user modesession database close: %ssession database open: %sinsert %d: %sdelete %d: %scan't parse getty for port %scan't allocate windowcan't parse window for port %scan't fork for window system on port %s: %msetsid failed (window) %mcan't exec window system '%s' for port %s: %mcan't fork for getty on port %s: %mgetty repeating too quickly on port %s, sleepingcan't exec getty '%s' for port %s: %mport %s changed utmp index from %d to %dcan't exec %s for %s %s: %msome processes would not die; ps axl advisedNOS:T:a:b:c:d:e:f:g:h:i:k:l:m:n:o:p:qr:s:t:u:x:z:P:T:a:b:c:d:e:f:i:m:o:s:%s: can't figure out file system partitiondisagrees with disk label%s (%d) %s (%lu) Warning: calculated sectors per cylindermfs:%dNumber of cylinders restricts cylinders per group to %d. Warning: changing optimization to space because minfree is less than %d%% %s: no default sector size%s: no default #sectors/track%s: no default #tracks%s: maximum file system size on the `%c' partition is %d%s: `%c' partition overlaps boot program%s: `%c' partition is unavailable%s: %s: not a character-special device %s: getmntinfo: %s%sr%snewfs_%s%s/newfs_%s%s not found%s: bad sector size%s: bad maximum contiguous blocks %s: bad block size%s: bad cylinders/group%s: bad rotational delay %s: bad blocks per file in a cylinder group %s: bad fragment size%s: bad average file size%s: bad average files per dir%s: bad bytes per inode %s: bad track skew%s: bad interleave%s: bad free space %% %s: bad rotational layout count %s: unknown optimization preference: use `space' or `time'.%s: bad spare sectors per track%s: bad revolutions/minute %s: bad file system size%s: bad sectors/track%s: bad spare sectors per cylinder%s: bad total tracksinsane maxpartitions value %d%s: mount: %sabnormal terminationioctl (WDINFO)%s: can't rewrite disk label-N do not create file system, just print out parameters-O create a 4.3BSD format filesystem-P src populate mfs filesystem-S sector size-T disktype-a maximum contiguous blocks-b block size-c cylinders/group-d rotational delay between contiguous blocks-e maximum blocks per file in a cylinder group-f frag size-g average file size-h average files per directory-i number of bytes per inode-k sector 0 skew, per track-l hardware sector interleave-m minimum free space %%-n number of distinguished rotational positions-o optimization preference (`space' or `time')-p spare sectors per track-r revolutions/minute-s file system size (sectors)-t file system type-u sectors/track-x spare sectors per cylinder-z tracks/cylinderusage: %s [ -fsoptions ] special-device mount-point usage: %s [ -fsoptions ] special-device where fsoptions are: %s: exitedchdircannot stat %s%s: not a dir or a block device-rw-pe/bin/paxcopy %s to %s failedunmount %srmdir %smount %s %s/mnttmp mountpoint %s busygettmpmnttmp mountpoint %s too longmntXXXXXXXXXXmkdtemp %stmp mount point too long%s: initializing cg %ld/%d siginfopreposterous size %u, max is %upreposterous ntrak %dpreposterous nsect %dillegal expected average file size %dillegal expected number of files per directory %dblock size must be a power of 2, not %dfragment size must be a power of 2, not %dfragment size %d is too small, minimum is %dblock size %d is too small, minimum is %dblock size %d is too large, maximum is %dno block size to support this diskminimum bytes per inode isWith a block size of %d %s %ld With %d sectors per cylinder, minimum cylinders per group is %ld CylinderWarning: cylinder%s groups must have a multiple of %ld cylinders panic (fs_cpg * fs_spc) %% NSPF != 0cylinder groups must have at least %ld cylinders!mapcramped && !inodecrampedBlock size and bytes per inode restrictBlock size restrictsBytes per inode restrict cylinders per group to %d. file systems must have at least one cylinder (not %d) File system performance may be impaired. and ntrakrotational layout tables with nsect%s %s %d %s %d.%sWarning: insufficient space in super block for Warning: inode blocks/cyl group (%ld) >= data blocks (%ld) in last cylinder group. This implies %ld sector(s) cannot be allocated. mkfsfsinit failedsuper-block backups (for fsck -b #) at:%s: %d sectors in %d %s of %d tracks, %d sectors %.1fMB in %d cyl groups (%d c/g, %.2fMB/g, %d i/g) cg summaryWarning: %d sector(s) in last cylinder unallocated filesystem must have at least %d sectorsinode blocks/cyl group (%ld) >= data blocks (%d) number of cylinders per cylinder group (%d) %s. must be increased%s to be changed from %d to %d This requires the block size %s to be changed from %d to %d and the fragment sizeWith %d bytes per inode, Minimum bytes per inode is %ld block size (%d) cannot be smaller than fragment size (%d)fragment size %d is too small, minimum with block size %d is %dpanic: cylinder group too bigcg 0: bad magic numberinternal error: can't find block in cyl 0first cylinder group ran out of spacecg 0: bad magic number (0x%06x != 0x%06x)fsinit: inode value %d out of rangerdfs: read error on block %dwtfs: write error on block %disblock bad fs_frag %d clrblock bad fs_frag %d setblock bad fs_frag %d dfiPRr%s: is a directoryrm_overwrite%s (inode %u): not overwritten due to multiple links%s: malloccheckoverride %s%s%s/%s for %s? remove %s? "." and ".." may not be removedusage: %s [-dfiPRr] file ... bsfbsrdensityeomfsffsrofflinerewindrewofflretensionweof%s: illegal count%s: unknown commandf:ioctl MTIOCGETWriteProtectMounted76543210%s tape drive, residual=%d erblocksize: %d (%d, %d, %d, %d) density: %d (%d, %d, %d, %d) %d: unknown tape drive type usage: %s [-t] device usage: %s [-f device] command [count] Lost connection to remote host.shell/tcp: unknown service/etc/rmtwho are you?invalid user name: %sO%s %d rmtopenC S I%d %d ioctlrmtioctlProtocol to remote tape server botched (code "%s").rmtreplyProtocol to remote tape server botched.(rmtgets got "%s").m:pusage: %s [-p] [-m mode] dirname ... $OpenBSD: compile.c,v 1.21 2005/04/11 07:11:44 deraadt Exp $0123456789/\$invalid command code %cextra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandunexpected }branchempty labelread commandw commandfilename expectedunterminated substitute patternsubstitute pattern can not be delimited by newline or backslashextra text at the end of a transform commandcommand %c expects up to %d address(es), found %dcommand expectedunexpected EOF (pending }'s)\ can not be used as a string delimiternewline can not be used as a string delimitercompile_reRE error: %sunterminated substitute in regular expression123456789\%c not defined in the REunescaped newline inside substitute patternnumber in substitute flags out of rangemore than one number or 'g' in substitute flagsbad flag in substitute command: '%c'compile_flagsno wfile specifiedunterminated transform source stringcompile_trtransform strings are not the same lengthunterminated transform target stringtransform pattern can not be delimited by newline or backslashcompile_textexpected context addressunterminated regular expressionwhitespace after %sundefined label '%s'duplicate label '%s'unused label '%s'$OpenBSD: main.c,v 1.9 2003/06/10 22:20:50 deraadt Exp $ae:f:nusage: sed script [-an] [file ...] sed [-an] [-e script] ... [-f script_file] ... [file ...] stdout: %s ..."$OpenBSD: misc.c,v 1.6 2004/07/20 03:50:26 deraadt Exp $sed: %lu: %s: $OpenBSD: process.c,v 1.12 2003/11/07 02:58:23 tedu Exp $\%d not defined in the REflush_appends\ \abfnrtv%03ofirst RE may not be emptyܤ̦. Ԧ4 ئ4& ` 8&  = @6 8 5 ` , 8& 8& ,H4 8" @7 D7 7? E @ xZ O pZ ĨO ШM بY N @ N \Q @ 4T M G $G ,xZ 4@ <j DxA L`R -a-b-c-d -e-f-G-g-h -H -k-L -n-O-o-p -r-s-S -t-u-w-x-z===!=<>-eq-ne-gt-ge-lt -le!-ef"-nt#-ot$Ht(f8cLd\sllmnp  d| |    ī ܫ` X L   hܬ !L ( l` 8 H@ X d p |  ԟ   < ( ̬   0 | p $ 4t H< P \ lȔ    ȭ Э ܭx `, ( < \   0 @ LIJ Thb fd'(! ! %"#)< >g  0y7#-1 1= ?2*?* /&.&_606162636465666768695U5u4L4l3C3c[O%A"BCD%++--==!== *= /= %= += -= <<= >>= &= ^= |= <<>><=>=<>&& || */%+-&^|? , ~!():`xIFS= ${PS2=> } ${PS3=#? } ${PS4=+ }D̰ac̼ܼeiLklXXomC8nf$,ķb4u<HPprNs\hv<hp|xletxT\dl p  k x 4hI{}H ||&&!() ŠȠ]]<>`x Lhpx+$  T  @(#)PD KSH v5.2.14 99/07/13.2 AAA  Q AA A QBunable to allocate memoryLPrestricted shell - can't cdOLDPWDdon't know current directoryCDPATH%s: bad directorytoo many argumentsno OLDPWDno home directory (HOME not set)can't get current directory - %sRnprsu,-p: %s-u: %s: %spvVpv is a reserved word special is a%s shell builtin is a function undefined (autoload from %s) tracedn exported%s is *GOK*exported is an %salias for alias %s= is a tracked %salias for not foundL#R#UZ#fi#lprtuxfunction %s %T %s() %T %s: not identifierexportreadonly%s[%d]typeset -U -u -l -Z -R%d -L%d -t -r -x -i only -t, -u and -x options may be used with -funalias-tadprtUxalias: -r flag can only be used with -t and without arguments alias %s alias not found adtno argumentslpnzjob control not enabled%%%*d %*s %s%*d %*d %sls:bad signal `%s'Usage: kill [ -s signame | -signum | -signame ] {pid|job}... kill -l [exit_status] %s: arguments must be jobs or process IDsmissing name argument%s: is not an identifierarguments changed since last callOPTARGc_getopts: no argvmissing options argumentlm+alias+cd+command*=export+fc+getopts+jobs+killlet*=readonly=typeset+unaliaswhence+bg+fg%s%*ldm%ld.%02lds%snothing to shift%s: bad numberc_umask=+-rwxugoXsbad maskaugo%#3.3o ugorwxprsu,%s is read onlytrap -- bad signal %s%s: can only %s %d level(s)%s: cannot %sfv%s%*ld.%02ld%sreal user sys system user real :ptime: -%s requires an argumenttime: -%s unknown option*=.*=:[*=break=builtin*=continue*=eval*=exec*=exit+false*=return*=set*=shift=times*=trap+=wait+readtest+trueulimit+umask*=unset-tmissing ]internal error: unknown opunexpected operator/operandmissing closing parenmissing argumentmissing expression operatormissing second argumentexpression expected-atime(cpu-seconds)file(blocks)coredump(blocks)data(kbytes)stack(kbytes)lockedmem(kbytes)memory(kbytes)nofiles(descriptors)ulimit: %cunlimited%-20s unlimited bad limit: %sexceeds allowable limitinvalid limit: %sx_modefileglob: substitute errorFPATH;|&()`*+?@!IFS\$(){}*&;#|<>"'`beginning-of-historycomplete-commandcomplete-filecompletedelete-char-backwarddelete-word-backwarddelete-char-forwarddelete-word-forwardkill-lineredrawend-of-historyeot-or-deletegoto-historymacro-stringauto-insertkill-to-eolkill-regionlist-commandlist-fileprefix-1prefix-2yank-popbackward-charbeginning-of-linebackward-wordend-of-lineforward-charforward-wordnewlinedown-historynewline-and-nextno-opup-historyprev-hist-wordsearch-character-forwardsearch-character-backwardsearch-historyset-mark-commandstuffstuff-resettranspose-charsexchange-point-and-markcomplete-listexpand-filecapitalize-worddowncase-wordupcase-wordset-argcommentx_search_hist I-search: nothing to yank yank something first%s = '%s' %s: no such functioncannot bind, not a ttyPOSIXparameter null or not setexpand(NULL)%S%s: bad substitutionsubstitute%s: parameter not set%s: cannot open $() input%Rfunny $() command: %s*+?@! coprocess already existsPS4%s: can't find function definition file%s: can't find function definition file - %s%s: function not defined by %sCFUNC %d%s: can't open function definition file %s - %s%s: cannot execute - %s%s: restrictedcommand -p: restrictedbuiltin: %s: not a builtinEXECSHELL%s: %s: %sshcomexec: %scould not finish (dup) redirection %s: %sdupcannot %s %s: %s%s%s herein: yylexerror writing %s: %scan't %s temporary file %s: %shere document missing-rPS3%*d) %sdbteste_isadbteste_error: %s (offset %d)%s: unexpected `%s'end of expression%s: bad number `%s'%s: expression recurses on parameter `%s'%s: %s requires lvalue%s: %s applied to read only variablemissing )missing :zero divisorhistory functions not availablee:glnrs0,1,2,3,4,5,6,7,8,9,-%c%scan't use -e, -l, -n, -r with -s (-e -)can't use -l, -n with -e%.*s ${FCEDIT:-/bin/ed} $_error reading temp file %s - %scannot open temp file %serror writing temporary file - %scannot create temp file %s - %s-16substitution failed%s: not in history%s: invalid rangeno history (yet)HISTFILE%s.%dhist_shrinkinternal error: %s[%d]: shl_stdout not validtoo many files open in shellcan't create pipe - try againillegal file descriptor namefd not open for readingfd not open for writingbad file descriptorno coprocess/tmp%s/shXXXXXXXXstoppedrunning and You have %s%s%s jobs no such jobambiguousargument must be %job or process idwarning: won't have full job controlj_init: tcsetpgrp() failed: %sj_init: setpgid() failed: %sj_init: tcgetpgrp() failed: %sj_init: getpgrp() failed: %s[%d]jw:last procchildexchild: execute() returnedexchild: XPIPEI and no last_job - pid %dcannot fork - try againwaitlast: no last jobjw:waitlastwaitlast: not startedjw:waitfor| jw:resumecannot continue job %s: %sfg: 2nd tcsetpgrp(%d, %d) failed: %s1st tcsetpgrp(%d, %d) failed: %s[%d] job not job-controlledjobsnotifyzombiej_async: bad nzombie (%d)j_async: job not startedj_waitj: tcsetpgrp(%d, %d) failed: %scheckjobcheck_job: job started (flags 0x%x) Running (core dumped)%-20s %s%s%sj_print%s%5d %-20s %s%s %s%s%s%s %5d [%d] %c DoneDone (%d)remove_job: job not found (%s)no closing quote here document `%s' unclosed PS1PS2dopprompt\%c%r%l:%M:%S%a %b %d~/%smissing ] MAILyou have mail in $_typesetKSH_VERSION-xPPIDOPTIND=1evaltypeset -i RANDOM MAILCHECK="${MAILCHECK-600}" SECONDS="${SECONDS-0}" TMOUT="${TMOUT-0}"hash=alias -ttype=whence -vstop=kill -STOPsuspend=kill -STOP $$autoload=typeset -fufunctions=typeset -fhistory=fc -linteger=typeset -inohup=nohup local=typesetr=fc -e -login=exec login-tUccdatemailmakeprviwhoENVSH_VERSION$ /etc/suid_profile/etc/profile$HOME/.profileCannot determine current working directory-c requires an argumentUSERinclude: %dUse `exit' to leave ksh shell: %dalloc: %s%s%s-`%c' requires argument%s%s-%c: unknown option |&;<>()*@#!$-? =-+?#% "#$&'()*;<>?[\`|0123456789ABCDEFallexportbraceexpandbgnicecsh-historyemacs-usemetaerrexitgmacsignoreeofinteractivemarkdirsnoclobbernoglobnohupnolognounsetphysicalposixprivilegedtrackallvirawvi-show8vi-tabcompletevi-esccompletextrace%-*s %sCurrent option settings -o %sgetoptionsparse_args: `%c'%s: bad optionA:o;sgmatch'\'%-*s%*sdo_phys_pathshf_fdopen: missing read/writeshf_reopen: bad shf/buf/bsizeshf_reopen: missing read/writeshf_sopen: flags 0x%xshf_flush: no fdshf_emptybuf: no fdshf_fillbuf: no fdshf_read: bsize %dshf_read: flags %xshf_getse: flags %xshf_getchar: flags %xshf_ungetc: flags %xshf_putchar: no fdshf_putchar: flags %xshf_write: nbytes %dshf_write: flags %xshf_snprintf: buf %lx, bsize %dshf_vfprintf0123456789abcdef(null %s)too many <<'s for%s: bad identifier too many redirections %s: invalid function name thenelseeliffiesacwhileuntildo{}[[&&||;;((|&unexpectedunmatchedsyntax error: `%s' %s ?%dsyntax error: unexpected EOF ERRError handlerEXITSIGtimed out waiting for inputsetexecsig: unset signal %d(%s)%S #no-args# #no-vars# ( %T) %T| %T%;%T%s %T ]] %Sdo%N%T%;done in %;for %s select %s case %S in%N(%S%c%;%T%N;;%Nesac %s %T%;doif %Telif %Telse%;%T%;fi then%N%T{%;%T%;} %T& function %s %T%s() %Ttime %T%T|& < >| <> <<- << >> <&>&wdscan: unknown char 0x%x (carrying on)j_ttyinit: can't set close-on-exec flag: %sj_ttyinit: dup of tty fd failed: %sNo controlling tty (open /dev/tty: %s)Can't find tty file descriptorOPTINDPOSIXLY_CORRECTHISTSIZEVISUALMAILCHECKMAILPATHRANDOMSECONDSTMOUTLINENO%s: subscript out of range0123456789abcdefghijklmnopqrstuvwxyz0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZsetstr: %s=%s: assigning to self%s: is read only%0*s%.*s%*s%.*sy$%s %dfc -e ${VISUAL:-${EDITOR:-vi}} --grabhist: bad history arrayM-%s: destination pathname too longdo_moverename %s to %scan't remove %scannot resolve %scannot rename a mount point%s: remove%s: set times%s: set flags%s: set mode%s: set owner/group%s: set owner/group; not setting setuid/setgid%s: waitpid/bin/cp%s: terminated with %d (non-zero) status%s: did not terminate normally/bin/rm-rf-PRpusage: %s [-fi] source target %s [-fi] source ... directory |&=<>+-*/%:()syntax erroreval5division by zeronon-numeric argument_msgbufpM:N:sysctl: KERN_MSGBUFSIZEcouldn't allocate space for buffer datasysctl: KERN_MSGBUFusage: %s [-M core] [-N system] sethostnamegethostnameusage: %s [-s] [name-of-host] /var/run/utmplogout%s: not a device nodereadlabelfs%s: bad filesystem type in label%s: couldn't read disklabel%s%s%s%c/etc/fbtab(null)%s: bad entry: %s%o%s: %s: %mlogin_protect/*%s: chown(%s): %m%s: chmod(%s): %m%s: opendir(%s): %m%lld.%1lld%c%lld%c0B/var/log/wtmplogwtmp\\#TERMPATHtgetent.termcap /usr/share/misc/termcap/usr/share/misc/termcapTERMCAPOOPS?Ynacosacosfacos: DOMAIN error asinasinfasin: DOMAIN error atan2atan2fatan2: DOMAIN error hypothypotfcoshcoshfexpfy0y0fy0: DOMAIN error y1y1fy1: DOMAIN error yn: DOMAIN error ynynflgammalgammaflgamma: SING error loglogflog: SING error log: DOMAIN error log10: SING error log10log10flog10: DOMAIN error pow(0,0): DOMAIN error powfpowpow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sinhsinhfsqrtsqrtfsqrt: DOMAIN error fmodfmodffmod: DOMAIN error remainderremainderfremainder: DOMAIN error acoshacoshfacosh: DOMAIN error atanh: DOMAIN error atanhatanhfatanh: SING error scalbscalbfj0j0f: TLOSS error j1j1fjnjnfgammagammafgamma: SING error 0C0longjmp botch. no errorunknown/invalid errorresolved protocol is unknowninvalid value for hintsmemory allocation failureaddress family for name not supportedservice not supported for ai_socktypeai_socktype not supportedai_family not supportedno address associated with namenon-recoverable failure in name resolutiontemporary failure in name resolutionname or service is not knowninvalid value for ai_flagsxxswfstabscanfstab: rcmd: socket: %s rcmd: socket: All ports in use RSH%s: %s rcmd_afconnect to address %s: rcmd: %s: %s socket: protocol failure in circuit setup. rcmd: accept: %s rcmd: select (setting up stderr): %s select: protocol failure in circuit setup rcmd: write (setting up stderr): %s iruserok%s/.rhosts.rhosts lstat failed.rhosts not regular fileiruserok_sa.rhosts fstat failedbad .rhosts owner.rhosts writable by other than owner/etc/hosts.equiv__ivaliduser__ivaliduser_sa__icheckhostrcmd: address %s not listed for host %s__gethostloopgetnameinfoip6_parsenumeric/usr/bin/rshlocalhostrcmdsh: socketpairrcmdsh: dup2 failedrcmdsh: fork to lose parent failedrcmdsh: execvp %s failed: %s -lrcmdshrcmdsh: setuid(%u): %s rcmdsh: fork failedrcmdsh: unknown user: %s 4D`xResolver Error 0 (no error)Unknown hostHost name lookup failureUnknown server errorNo address associated with nameResolver internal errorUnknown resolver errorrresvport_af%u.%u.%u.%u%u.%u.%u.%uinet_ntop4inet_ntop6%8xH.%02x:%02x:%02x:%02x:%02x:%02x.%u8ؓ  $,48@HPX`hSignal 0HUPINTILLTRAPABRTEMTFPEKILLBUSSEGVSYSPIPEALRMURGTSTPCONTCHLDTTINTTOUIOXCPUXFSZVTALRMPROFWINCHUSR1USR2$08DLXhtnosappndnosappendnoarchnoarchivednoschgnoschangenosimmutablenouappndnouappendnouchgnouchangenouimmutablenodumpnoopaque ,","too small%ld%s-blocks%s: unknown blocksize%s: minimum blocksize is 512maximum blocksize is %dGBLOCKSIZE%02x:%02x:%02x:%02x:%02x:%02x%x:%x:%x:%x:%x:%x/etc/ethers+ ethers.byaddrether_ntohostethers.bynameether_hostton*** unknown regexp error code ***REG_NOMATCHregexec() failed to matchREG_BADPATinvalid regular expressionREG_ECOLLATEinvalid collating elementREG_ECTYPEinvalid character classREG_EESCAPEREG_ESUBREGinvalid backreference numberREG_EBRACKbrackets ([ ]) not balancedREG_EPARENparentheses not balancedREG_EBRACEbraces not balancedREG_BADBRinvalid repetition count(s)REG_ERANGEinvalid character rangeREG_ESPACEREG_BADRPTrepetition-operator operand invalidREG_EMPTYempty (sub)expressionREG_ASSERT"can't happen" -- you found a bugREG_INVARGinvalid argument to regex routineregerrorREG_0x%xsecurertsctssoftcarwindow/etc/ttys/var/run/dev.db__ttyname_r_basic/etc/protocolsgetnetanswerIN-ADDR.ARPAgetnetbyaddr0.0.0.%u.in-addr.arpa%u.%u.%u.%u.in-addr.arpa0.%u.%u.%u.in-addr.arpa0.0.%u.%u.in-addr.arpagetnetbyname/etc/networks/etc/groupgrscangroup.bynamegroup.bygidreadpassphrasePglob3g_opendirg_lstatg_statmaster.passwd.bynamepasswd.byname__YP!__has_yppwgetpwnamgetpwuidmaster.passwd.byuidpasswd.byuid/etc/spwd.db/etc/pwd.db*netgroup: %m(%s,%s,%s)netgroup.byusernetgroupnetgroup.byhostnetgroup: db getnetgroup: Syntax error `%s'netgroup: Cycle in group `%s' ,/etc/netgroup.dbyp_first: clnt_callalphaABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzblankcntrl digitgraphABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~lowerabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ punct!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ upperABCDEFGHIJKLMNOPQRSTUVWXYZxdigit0123456789ABCDEFabcdefalnumABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789NULSOHSTXETXEOTENQBELalertBSbackspaceHTtabLFVTvertical-tabFFform-feedCRcarriage-returnSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBIS4IS3GSIS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfivesixseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDEL[:<:]][:>:]]authunix_createauthunix_create: out of memory authunix_create_defaultauth_none.c - Fatal marshalling problem\dpx ,DXdp0D\\dpx ,DXdp0D\HangupInterruptQuitIllegal instructionTrace/BPT trapAbort trapEMT trapFloating point exceptionKilledBus errorSegmentation faultBad system callBroken pipeAlarm clockTerminatedUrgent I/O conditionSuspended (signal)SuspendedContinuedChild exitedStopped (tty input)Stopped (tty output)I/O possibleCputime limit exceededFilesize limit exceededVirtual timer expiredProfiling timer expiredWindow size changesInformation requestUser defined signal 1User defined signal 2option requires an argument -- %coption requires an argument -- %sambiguous option -- %.*soption doesn't take an argument -- %.*sunknown option -- %cunknown option -- %s0123456789abcdef0123456789/usr/src/lib/libc/net/inet_net_pton.cn >= 0 && n <= 9n >= 0 && n <= 15assertion "%s" failed: file "%s", line %d assertion "%s" failed: file "%s", line %d, function "%s" ipx_addr%d-%d-%d-%d-%d%x.%x.%x.%x.%x.%x%x,%x,%x%3x%3o%3dsscanfvfscanfb0b1ncdtscilcshssbpxbxfxoxtxdxsimulatedgetenttc%s.dbcgetnext|:execlexecleexeclpexecvpexecvp: : path too long xdr_array: out of memory   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~realpath__svfscanfgethostby*.getanswer: asked for "%s", got "%s"-_/getanswergethostby*.getanswer: asked for "%s %s %s", got type "%s"gethostbyaddr%x.%x.ip6.arpa/etc/hostshosts.byaddr_yp_gethtbyaddrhosts.byname:2*" <4,$ >6.&@80( 91)! ;3+# =5-% ?7/'91)! :2*" ;3+# <4,$?7/'>6.&=5-%      )4%/7(3-!0,1'8"5.*2$                                                                                                                                  @ @ @ @ @ ./ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz01234567896789:;<=>?  !"#$%&'()*+,-./012345%2.2u$bcrypt_gensaltOrpheanBeholderScryDoubtbcrypt 1Ѭߘr/Ḗ~&jE|,G$l iciNWqX~=t XrX͋qJT{YZ90`*#`(yA8۸y:`l>w'K1/x`\`U%U攫UbHW@cj9U*4\̴ATr|*oc]ũ+1t>\3֯\$lS2zw(H;Kkē!(f a!`|H2]]]u#&܈e>#Ŭom9BD . Ji^Bh!la gӫҠQjh/T(3Ql n;zP;*~ev9>YfCoEå}^;uos D@jVbNw?6r=B$7H ۛIrS{y%P;LylO`@ž\^c$johSl>9oR;Qm,0DE ^J3(fK.WtE9_ ӹyU 2`yr,@%g̣饎"2u<kaP/R=2`#H{1S>W\o.ViB~(2gsUO'[iXʻ]=!lJ[-ySeEIҐK3~ˤAb Lw6~д+MەqՓkю%ǯ/[{AI~-%^q h"W6d$ cUYCxSZ٢[} Źv&ϕbhAJsN-GJ{RQ)S?Wƛv`+t恵oWk *!ec.4dV]-SGjnpzKD). u#&İn}ߧI`fqilRdVឱ¥6)L u@Y>:䚘T?eB[k?ҡ08-M]% L&pc^?kh >\D}W7: P tAu8/;21>8TNmO Bo ,y|$ryVw.?rU$qk.P̈́GXzt}K:zfC cdG27;C$CMQe*P:qUN1w_V5kǣ;< $Y,n<pEㆱo ^*>Zw=Ne)։>%fRxL.jxS<- N=+6&9`y#RnfE{7(2åZl!Xeh;/ۭ}*/n[(!pa)uGa0a4c\s9pL ު˼,b`\ndi#PZe2Zh@*<1! T_~}=b7w-_h)5ǡޖXxWcr"ÃF T0.SHُ(1mX4a(s<|J]d]B> EꫪOlOBBǵj;Oe!AyMjGKPb=bF&[$ti GV[ Htb#*BXU >ap?#r3A~_;"lY7|`t˧@n2w΄PU5ai Z .zD4Egɞs͈Uy_g@Cge48>q(= m!>J=+hZ=@&L4)i Av.khq$j 3ԷCaP.9FE$tO!@MpE/f m1'A9UG%ښ ʫ%xP()Sچ, mbhiHפh'?Oz|Ϊ_7әxB*k@5 ٫9N;VmK1f&tn:2C[Ah xN جV@E'H::SU kKмgUXc)3VJ*%1?~^|1)p/'\,(H"m?H܆AyG@n]Q_2Տd5A4x{%`*`lc´2Of#k>3b $;" r(-Exb}doITH}'>AcG t.no:7`L knU{7,gm;e' )̒9 i{f} ϑ^و/$[Qy{;v.97yY̗&-1.Bh;+jLu.x7BjQ满PcKkؽ%=YBD n *Ngd_ڈ鿾dW{x`M``FѰ8Ew63kBqA_^;Z4ٷ,Q+:Ֆ}}>(-}|%rZLZq)GW;()f(.y_xU`uD^mm%adâW<'*:m?!cf&(3uU4V<wQ( gQ̫_QM08bX7 z{>d!Q2Ow~㶨F=)iSHd$m-if! FEdlX [@X̻k~jEY:D 5>ʹrdfGof,ҏ"W##v215VbuZ6ns҈bIPLVq z2E{Sb%ҽ5iq"|˶+v>S@`8G% 8vFšw``u N˅؍芰z~L\HjiԐ\-% ?2aN[wߏWr:j?$.Dsp"8 1).lN!(Ew8fTl 4)P|ɵՄ? Gy$1$%s%.*s$md5cryptMD5Pad__sbprintfbug in vfprintf: bad baseInfNaN__find_argumentsexponent?$@Y@@@@j@.AcAחAeA _BvH7BmB@0BļB4&k C7yAC؅W4vCNgmC=`XC@xDPKDMD7yACnF?O8M20HwZ?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~/&/etc/resolv.conf;#lookupsearchnameserversortlist_res_initRES_OPTIONSenvLOCALDOMAINndots:insecure1insecure2edns001234567890123456789abcdef0123456789ABCDEFinet_pton6  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~Li8,08< PT `h pt  Ȓ04@H<X`hxLgM\ 8@!`d"xde<@fX\#t|INCHAOSHSHESIODANYname serverMDmail destination (deprecated)MFmail forwarder (deprecated)CNAMEcanonical nameSOAstart of authorityMBmailboxMGmail group memberMRmail renameNULLnullWKSwell-known service (deprecated)PTRdomain name pointerHINFOhost informationMINFOmailbox informationMXmail exchangerTXTRPresponsible personAFSDBDCE or AFS serverX25X25 addressISDNISDN addressrouterNSAPnsap addressNSAP_PTRsignaturePXmapping informationGPOSgeographical position (withdrawn)AAAALOClocationNXTnext valid name (unimplemented)EIDendpoint identifier (unimplemented)NIMLOCNIMROD locator (unimplemented)SRVserver selectionATMAATM address (unimplemented)IXFRincremental zone transferAXFRMAILBmailbox-related data (deprecated)MAILAmail agent (deprecated)UINFOuser information (nonstandard)UIDuser ID (nonstandard)GIDgroup ID (nonstandard)NAPTRURN Naming Authority"any"/etc/services,/syslog_r: unknown facility/priority: %xvsyslog_r<%d>Error %d[%ld]%h %e %T syslog: unknown facility/priority: %xconnectlog_r/dev/log  $(,08DLT\dlx $(JanFebMarAprMayJunJulAugSepOctNovDecJanuaryFebruaryMarchAprilJuneJulyAugustSeptemberOctoberNovemberDecemberSunMonTueWedThuFriSatSundayMondayTuesdayWednesdayThursdayFridaySaturday%H:%M:%S%m/%d/%y%a %b %e %T %YAMPM%a %b %e %H:%M:%S %Z %Y_fmt%Y-%m-%d%H:%M%2d%03d%I:%M:%S %p%e-%b-%Y%04d_conv-0GMTmnabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789 :+-._Local time zone must be set--see zic manual page/usr/share/zoneinfotzload/etc/localtimeposixrules,M4.1.0,M10.5.0TZvsnprintfyp_match: clnt_callyp_next: clnt_call/var/run/ypbind.lock_yp_dobindclntudp_createfcntl: F_SETFDYP server for domain %s not responding, still trying clnttcp_create%s/%s.%d/var/yp/binding4Pl4T4L; errno = %s ; s1 = %u, s2 = %u ; why = (unknown authentication error - %d) ; low version = %u, high version = %u RPC: SuccessRPC: Can't encode argumentsRPC: Can't decode resultRPC: Unable to sendRPC: Unable to receiveRPC: Timed outRPC: Incompatible versions of RPCRPC: Authentication errorRPC: Program unavailableRPC: Program/version mismatchRPC: Procedure unavailableRPC: Server can't decode argumentsRPC: Remote system errorRPC: Unknown hostRPC: Port mapper failureRPC: Program not registeredRPC: Failed (unspecified error)RPC: Unknown protocolRPC: (unknown error code)%s: %s - %s Authentication OKInvalid client credentialServer rejected credentialInvalid client verifierServer rejected verifierClient credential too weakInvalid server verifierFailed (unspecified error)clnttcp_create: out of memory bindresvport_saxdrrec_create: out of memory perrorlibcUnknown error: Unknown signal: _catopen/usr/share/nls/%L/%N.cat:/usr/share/nls/%N/%LLANGNLSPATH!!!!!!"("@"T"h"|",""""""" #0#@#T#t#######$$<$P$t$$$$$%$%<%T%p%%%%%& &8&\&&&&&&'4'H'\''''''''((@(T(h(|((((())0)L)`)Undefined error: 0Operation not permittedNo such file or directoryNo such processInterrupted system callInput/output errorDevice not configuredArgument list too longExec format errorBad file descriptorNo child processesResource deadlock avoidedPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkOperation not supported by deviceNot a directoryIs a directoryInvalid argumentToo many open files in systemToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksNumerical argument out of domainResult too largeResource temporarily unavailableOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not availableProtocol not supportedSocket type not supportedOperation not supportedProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceOperation timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downNo route to hostDirectory not emptyToo many processesToo many usersDisk quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticatorIPsec processing failureAttribute not foundIllegal byte sequence\dpx ,DXdp0D\xdr_bytes: out of memory xdr_string: out of memory %$sniglet^&isatty ((((( AAAAAABBBBBB arc4_stirsnprintfHASH: Out of overflow pages. Increase page size %s/_hash.XXXXXXopen_temp~p @( 0(<tDHTX\tvdptBtPKԗĻ%++t 1]]],8<DT|880Ȯ($?,P4P<PDLT\LG h\LD|t> n@D|t> n|D|t>X(yBT{wBwwD|z (PwhwwD|t>8X.? ɚ;A ...@(#) Copyright (c) 1980, 1986, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: main.c,v 1.14 2005/02/03 05:03:50 jaredy Exp $\dhpx \(0$t8@DLTThPX@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: cat.c,v 1.17 2005/04/05 01:18:53 jaredy Exp $k pntnxn|nn$܎̎Dԑ $OpenBSD: cmp.c,v 1.5 2003/06/11 23:42:12 deraadt Exp $@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: ls.c,v 1.24 2005/06/15 17:47:17 millert Exp $P.$OpenBSD: print.c,v 1.24 2005/06/15 17:47:17 millert Exp $$OpenBSD: util.c,v 1.12 2005/03/24 22:53:15 jmc Exp $@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. @(#)ping.c 8.1 (Berkeley) 6/5/93.dA\lx<@LPT\`hl0=t > P30123456789=:f/?/*?*n+n,N-N.m'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !+ Hh VqQ:q:QZZ    l h b  w  i x X      0  $  k  j  is a directory is not a regular file (use -f to see it)$$a@b@؛B@cldA0e0Df d|Fĝg4hhHAi,؞j8HJ!llHdL ğmܟn" 4pHP4Tq`r"4Ƞs!PhS!,u"HԡVHw"$,`x(XA<آyz84L"l~!x?#DУ.AX (press RETURN)... (interrupt to abort)p381@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. $NetBSD: mount_nfs.c,v 1.12.4.1 1996/05/25 22:48:05 fvdl Exp $ $OpenBSD: getmntopts.c,v 1.9 2004/07/05 18:33:38 otto Exp $Ȏмظ11"t €u6Uu|agPtPS[X!Using drive X, partition YMBR on floppy or old BIOS Read error No O/S No active partition OxUxZk\Q0W8hXRd<T[XL[kX@SY04ZTpZxZZxABh@CD(E8FHGXU`VȒahbcteMf|hiLlnqqrsvw xu@(#) Copyright (c) 1980, 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: umount.c,v 1.16 2003/07/29 18:38:36 deraadt Exp $$OpenBSD: mount_msdos.c,v 1.19 2005/04/08 20:09:37 jaredy Exp $$OpenBSD: getmntopts.c,v 1.9 2004/07/05 18:33:38 otto Exp $@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mknod.c,v 1.13 2003/06/02 20:06:15 millert Exp $ A0LBh|C71 8LDd%-< X pC81  *0HkaԺcԺdԺeԺ fԺmXnpԺqrԺstԺxԺAԺ*DԺEԺCMԺ%PԺ RԺ-SԺ TԺFԺ71 (a   P <{  Pccp Xoa7a !$"#$$%0&8'<(D)H*T+\,h-p. Lt(Xx pksentrttvarrttssthreshsendpiperecvpipeexpirehopcountmtuUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CLONING XRESOLVE LLINFO STATIC BLACKHOLEPROTO3PROTO2PROTO1CLONEDUPBROADCASTDEBUGLOOPBACKPTPNOTRAILERSRUNNINGNOARP PPROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD LABEL+LiX$ 7TH<[lH8,,L-X GTKHx3$TDFGpKa2a5,"8G|-pGTPd 01 -x`G 4Z,A8XU h6$T:%A,T:l0XZ,8@Y8HDMPKtZXS`1l/x/H/`i`SH@(#) Copyright (c) 1985, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. ,p| @(#) Copyright (c) 1980, 1986, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: reboot.c,v 1.26 2004/07/09 18:49:57 deraadt Exp $@(#) Copyright (c) 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount_ffs.c,v 1.18 2005/04/08 20:09:37 jaredy Exp $$OpenBSD: getmntopts.c,v 1.9 2004/07/05 18:33:38 otto Exp $"/sbin/dhclient-script( 0(EHC P E(  0(EHDHC ;Zx0N$OpenBSD: buf.c,v 1.16 2003/10/18 19:15:43 jmc Exp $O$OpenBSD: cbc.c,v 1.13 2004/05/08 07:05:19 deraadt Exp $@ $OpenBSD: glbl.c,v 1.10 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: io.c,v 1.11 2003/06/11 23:42:12 deraadt Exp $O$OpenBSD: main.c,v 1.28 2003/06/11 23:42:12 deraadt Exp $<TOH$OpenBSD: re.c,v 1.10 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: sub.c,v 1.10 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: undo.c,v 1.8 2003/06/11 23:42:12 deraadt Exp $@(#) Copyright (c) 1988, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: cp.c,v 1.29 2004/12/13 20:25:34 otto Exp $$OpenBSD: utils.c,v 1.26 2004/12/10 10:23:30 jmc Exp $`````@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: chmod.c,v 1.18 2004/07/01 18:25:47 otto Exp $A ... ...\dhpx \(0$t8@DLTThPX`i`g`g`g`h@(#) Copyright (c) 1991, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: init.c,v 1.36 2005/03/13 13:53:23 markus Exp $M $OpenBSD: dkcksum.c,v 1.7 2004/09/28 17:57:46 otto Exp $$OpenBSD: getmntopts.c,v 1.9 2004/07/05 18:33:38 otto Exp $@(#) Copyright (c) 1983, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: newfs.c,v 1.50 2004/08/12 07:53:50 otto Exp $h (4<@HP@X@@ @%s: can't read disk label; disk type must be specified||}8}H}T}t}}}}}~ ~@~`~|~~~~4Ll$OpenBSD: mkfs.c,v 1.48 2005/08/08 20:27:22 otto Exp $......@(#) Copyright (c) 1990, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: rm.c,v 1.19 2005/08/30 21:00:05 jmc Exp $@(#) Copyright (c) 1980, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mt.c,v 1.25 2005/05/01 18:56:36 deraadt Exp $lpt؟| < x@(#) Copyright (c) 1983, 1992, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mkdir.c,v 1.17 2004/07/01 18:25:47 otto Exp $ {}abcdDgGhHilnNpPqrs tw xy !:#=@(#) Copyright (c) 1992, 1993 The Regents of the University of California. All rights reserved. d`{d{l / P̰,ԺĹԺ̹ع,s<L\lĺغ,spD( (08p<@ _@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mv.c,v 1.32 2005/06/30 15:13:24 millert Exp $@(#) Copyright (c) 1988, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: hostname.c,v 1.7 2003/06/02 23:32:08 millert Exp $\dhpx \(0$t8@DLTThPXBKMGTPE@5MS7) xxxxxxxxH.xx:xx:xx:xx:xx:xx.uuuuuTxx:xx:xx:xx:xx:xx@Lht Q$@L ht   . 4@dpt|x(08T\%         $ 48<@DHLPTX\`dh$lptx| !"#$%&'()*+(,0-8-H.P.//011\2`3h4p5x6|789:;<=>?@[\\ ]8^D^X_d_p`{{|}}~H L  (!0"?  \dhpx \(0$t8@DLTThPX.  ./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz:./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789abcdef 0000000000000000}` $L$KKpKml$L$KKpKn $L$KKpKoTx`  04t hLtht<D|8U>C*($NetBSD: ffs.S,v 1.5 2003/04/05 23:08:52 bjh21 Exp $$NetBSD: memcmp.S,v 1.2 2003/04/05 23:08:52 bjh21 Exp $.shstrtab.init.text.fini.rodata.data.eh_frame.gotpad0.got.ctors.dtors.gotpad1.bss.stack.arm.atpcs.note.openbsd.ident PP$tt }$~%d+5>C JQZ|g _fq44~m)a  ln}of!NI u p + & d _afs*QQafs Daemon/var/empty/sbin/nologin2_syslogd*IISyslog Daemon/var/empty/sbin/nologin2_kdc*;;Kerberos Server/var/empty/sbin/nologin2popa3d*POP3 Server/var/empty/sbin/nologin2_ospfd*UUOSPF Daemon/var/empty/sbin/nologin3U_dhcp*MMDHCP programs/var/empty/sbin/nologin3M_identd*identd/var/empty/sbin/nologin3_ppp*RRPPP utilities/var/empty/sbin/nologin1_ppp_mopd*NNMOP Daemon/var/empty/sbin/nologin1_mopd_rusersd* rpc.rusersd/var/empty/sbin/nologin1_rusersd_identd*identd/var/empty/sbin/nologin1_identdpopa3d*POP3 Server/var/empty/sbin/nologin1popa3dLGhc" ? : X " X _ppp*RRPPP utilities/var/empty/sbin/nologin2_pflogd*JJpflogd privsep/var/empty/sbin/nologin2_kadmin*<<Kerberos Admin Server/var/empty/sbin/nologin2sshd*sshd privsep/var/empty/sbin/nologin2nobody*Unprivileged user/nonexistent/sbin/nologin3_hostapd*VVHostAP Daemon/var/empty/sbin/nologin3V_mopd*NNMOP Daemon/var/empty/sbin/nologin3Nnamed*FFBIND Name Service Daemon/var/named/sbin/nologin3F_spamd*>>Spam Daemon/var/empty/sbin/nologin3>_rstatd*rpc.rstatd/var/empty/sbin/nologin3_isakmpd*DDisakmpd privsep/var/empty/sbin/nologin1_isakmpdsmmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin1smmspfa#A< r m & ! P K  _ntp*SSNTP Daemon/var/empty/sbin/nologin2 _bgpd*KKBGP Daemon/var/empty/sbin/nologin2_spamd*>>Spam Daemon/var/empty/sbin/nologin2_portmap*portmap/var/empty/sbin/nologin2_tftpd*OOTFTP Daemon/var/empty/sbin/nologin3Oproxy*GGProxy Services/nonexistent/sbin/nologin3G_ftp*TTFTP Daemon/var/empty/sbin/nologin1_ftp_ntp*SSNTP Daemon/var/empty/sbin/nologin1_ntp_afs*QQafs Daemon/var/empty/sbin/nologin1_afs_rbootd*PPrbootd Daemon/var/empty/sbin/nologin1_rbootd_tftpd*OOTFTP Daemon/var/empty/sbin/nologin1_tftpd_kdc*;;Kerberos Server/var/empty/sbin/nologin1_kdc_x11*##X Server/var/empty/sbin/nologin1_x11_rstatd*rpc.rstatd/var/empty/sbin/nologin1_rstatdbin*Binaries Commands and Source,,,//sbin/nologin1binoi"ID { v   P _ftp*TTFTP Daemon/var/empty/sbin/nologin2!_tcpdump*LLtcpdump privsep/var/empty/sbin/nologin2uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2_identd*identd/var/empty/sbin/nologin2 rootdaemonCharlie &/root/bin/ksh2_rbootd*PPrbootd Daemon/var/empty/sbin/nologin3P_rusersd* rpc.rusersd/var/empty/sbin/nologin3 rootdaemonCharlie &/root/bin/ksh3_hostapd*VVHostAP Daemon/var/empty/sbin/nologin1_hostapdproxy*GGProxy Services/nonexistent/sbin/nologin1proxy_portmap*portmap/var/empty/sbin/nologin1_portmapsshd*sshd privsep/var/empty/sbin/nologin1sshd[T vq ~ > 9 j e !  _ospfd*UUOSPF Daemon/var/empty/sbin/nologin2"_dhcp*MMDHCP programs/var/empty/sbin/nologin2www*CCHTTP Server/var/www/sbin/nologin2_rstatd*rpc.rstatd/var/empty/sbin/nologin2 daemon*The devil himself/root/sbin/nologin2_afs*QQafs Daemon/var/empty/sbin/nologin3Q_syslogd*IISyslog Daemon/var/empty/sbin/nologin3I_fingerd*!!fingerd/var/empty/sbin/nologin3!smmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin3daemon*The devil himself/root/sbin/nologin3nobody*Unprivileged user/nonexistent/sbin/nologin1nobody_ospfd*UUOSPF Daemon/var/empty/sbin/nologin1_ospfd_pflogd*JJpflogd privsep/var/empty/sbin/nologin1_pflogd_kadmin*<<Kerberos Admin Server/var/empty/sbin/nologin1_kadmin"vm,%KB k f  u p / * Q L   _hostapd*VVHostAP Daemon/var/empty/sbin/nologin2#_mopd*NNMOP Daemon/var/empty/sbin/nologin2_isakmpd*DDisakmpd privsep/var/empty/sbin/nologin2_rusersd* rpc.rusersd/var/empty/sbin/nologin2 operator*System &/operator/sbin/nologin2_ppp*RRPPP utilities/var/empty/sbin/nologin3R_pflogd*JJpflogd privsep/var/empty/sbin/nologin3Juucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Bpopa3d*POP3 Server/var/empty/sbin/nologin3operator*System &/operator/sbin/nologin3_tcpdump*LLtcpdump privsep/var/empty/sbin/nologin1_tcpdump_bgpd*KKBGP Daemon/var/empty/sbin/nologin1_bgpd_syslogd*IISyslog Daemon/var/empty/sbin/nologin1_syslogd_spamd*>>Spam Daemon/var/empty/sbin/nologin1_spamdoperator*System &/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonrootdaemonCharlie &/root/bin/ksh1root\Vpk-( Z U    z + & Q nobody*Unprivileged user/nonexistent/sbin/nologin2$_tftpd*OOTFTP Daemon/var/empty/sbin/nologin2named*FFBIND Name Service Daemon/var/named/sbin/nologin2_fingerd*!!fingerd/var/empty/sbin/nologin2 bin*Binaries Commands and Source,,,//sbin/nologin2_ntp*SSNTP Daemon/var/empty/sbin/nologin3S_bgpd*KKBGP Daemon/var/empty/sbin/nologin3Kwww*CCHTTP Server/var/www/sbin/nologin3C_kdc*;;Kerberos Server/var/empty/sbin/nologin3;_x11*##X Server/var/empty/sbin/nologin3#sshd*sshd privsep/var/empty/sbin/nologin3bin*Binaries Commands and Source,,,//sbin/nologin3named*FFBIND Name Service Daemon/var/named/sbin/nologin1namedwww*CCHTTP Server/var/www/sbin/nologin1wwwuucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucplg&!72 N I  _rbootd*PPrbootd Daemon/var/empty/sbin/nologin2proxy*GGProxy Services/nonexistent/sbin/nologin2_x11*##X Server/var/empty/sbin/nologin2 smmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin2_ftp*TTFTP Daemon/var/empty/sbin/nologin3T_tcpdump*LLtcpdump privsep/var/empty/sbin/nologin3L_isakmpd*DDisakmpd privsep/var/empty/sbin/nologin3D_kadmin*<<Kerberos Admin Server/var/empty/sbin/nologin3<_portmap*portmap/var/empty/sbin/nologin3_dhcp*MMDHCP programs/var/empty/sbin/nologin1_dhcp_fingerd*!!fingerd/var/empty/sbin/nologin1_fingerd . install.md set_term() { local _tables [[ -n $TERM ]] && return ask "Terminal type?" ${MDTERM:-vt220} TERM=$resp export TERM [[ -x /sbin/kbd ]] || return _tables=$(bsort $(kbd -l | egrep -v "^(user|tables|encoding)")) while :; do ask "kbd(8) mapping? ('?' for list)" "none" case $resp in none) return ;; "?") echo "Major tables: $_tables" ;; *) kbd $resp && { echo $resp >/tmp/kbdtype ; return ; } ;; esac done } welcome() { local _q cat <<__EOT Welcome to the $OBSD $MODE program. This program will help you $MODE OpenBSD in a simple and rational way. At any prompt except password prompts you can run a shell command by typing '!foo', or escape to a shell by typing '!'. Default answers are shown in []'s and are selected by pressing RETURN. At any time you can exit this program by pressing Control-C and then RETURN, but quitting during an $MODE can leave your system in an inconsistent state. __EOT set_term cat <<__EOT IS YOUR DATA BACKED UP? As with anything that modifies disk contents, this program can cause SIGNIFICANT data loss. __EOT case $MODE in upgrade) cat <<__EOT NOTE: once your system has been upgraded, you must manually merge any changes to files in the 'etc' set into the files already on your system. __EOT _q="Proceed with upgrade?" ;; install) cat <<__EOT It is often helpful to have the installation notes handy. For complex disk configurations, relevant disk hardware manuals and a calculator are useful. __EOT if [ -f /etc/fstab ]; then cat <<__EOT You seem to be trying to restart an interrupted installation! You can skip the disk preparation steps and continue, or you can reboot and start over. __EOT _q="Skip disk initialization?" else _q="Proceed with install?" fi ;; esac ask_yn "$_q" if [[ $resp == n ]]; then cat <<__EOT Enter 'halt' at the prompt to gracefully exit OpenBSD. You can then power cycle the machine and boot your original OS. __EOT exit fi echo "Cool! Let's get to it." } scan_dmesg() { bsort $(sed -ne "$1" /var/run/dmesg.boot) } get_ifdevs() { ifconfig -a \ | egrep -v '^[[:space:]]|(bridge|enc|gif|gre|lo|pflog|pfsync|ppp|sl|tun|vlan)[[:digit:]]+:' \ | sed -ne 's/^\(.*\):.*/\1/p' } get_serialdev() { local _d _bd _td [[ -n $MDSERIAL ]] || exit set -- $MDSERIAL _d=$1 _bd=$2 _td=$3 set -- $(scan_dmesg "/^${_d}\([0-9]\) .*/s//\1/p") echo "$_bd$1 $_td$1" } get_drive() { ask_which "$1" "contains the $MODE media" "$2" [[ $resp == done ]] && return 1 makedev $resp || return 1 return 0 } get_partition() { local _drive=$1 _fstypes=$2 _part _fst disklabel $_drive 2>/dev/null \ | grep '^ [a-p]: ' \ | egrep -v "swap|unused" \ | sed -e 's/^ \(.\): *[^ ]* *[^ ]* *\([^ ]*\) .*/\1 \2/' \ >/tmp/parts.$_drive disklabel $_drive 2>/dev/null | grep '^ .:' ask_which "$_drive partition" "has the $MODE sets" \ "$(sed -e 's/^\(.\).*/\1/' /tmp/parts.$_drive)" [[ $resp == done ]] && return 1 _part=$resp _fst=$(sed -ne "/^$_part /s///p" /tmp/parts.$_drive) ask_which "filesystem type" "should be used to mount $_drive$_part" "$_fst $_fstypes ffs" case $resp in done) return 1 ;; $_fst) resp="$_part" ;; *) resp="$_part $resp" ;; esac return 0 } askpass() { set -o noglob stty -echo read resp?"$1 " stty echo set +o noglob echo } ask() { local _question=$1 _default=$2 set -o noglob while :; do echo -n "$_question " [[ -z $_default ]] || echo -n "[$_default] " read resp case $resp in !) echo "Type 'exit' to return to install." sh ;; !*) eval ${resp#?} ;; *) : ${resp:=$_default} break ;; esac done set +o noglob } ask_until() { resp= while [[ -z $resp ]] ; do ask "$1" "$2" done } ask_yn() { local _q=$1 _a=${2:-no} _resp typeset -l _resp while :; do ask "$_q" "$_a" _resp=$resp case $_resp in y|yes) resp=y ; return ;; n|no) resp=n ; return ;; esac done } ask_which() { local _name=$1 _query=$2 _list=$3 _def=$4 _err=$5 set -- $_list if (( $# < 1 )); then echo "${_err:=No ${_name}s found}." resp=done return fi : ${_def:=$1} _list="$*" while :; do ask "Available ${_name}s are: $_list.\nWhich one $_query? (or 'done')" "$_def" isin "$resp" $_list done && break echo "'$resp' is not a valid choice." done } isin() { local _a=$1 _b shift for _b; do [[ $_a == $_b ]] && return 0 done return 1 } addel() { local _a=$1 shift echo -n "$*" isin "$_a" $* || echo -n " $_a" } rmel() { local _a=$1 _b shift for _b; do [[ $_a != $_b ]] && echo -n "$_b " done } bsort() { local _l _a=$1 _b [[ $# -gt 0 ]] || return shift for _b; do if [[ $_a != $_b ]] ; then if [[ $_a > $_b ]] ; then _l="$_a $_l"; _a=$_b else _l="$_b $_l" fi fi done echo -n "$_a " bsort $_l } save_comments() { local _file=$1 if [[ -f /mnt/etc/$_file ]]; then grep "^#" /mnt/etc/$_file >/tmp/$_file.new [[ -f /tmp/$_file ]] && cat /tmp/$_file >>/tmp/$_file.new mv /tmp/$_file.new /tmp/$_file fi } edit_tmp_file() { local _file=$1 ask_yn "Edit $_file with $EDITOR?" [[ $resp == y ]] && $EDITOR /tmp/$_file } manual_net_cfg() { ask_yn "Do you want to do any manual network configuration?" [[ $resp == y ]] && { echo "Type 'exit' to return to $MODE." ; sh ; } } ftp_list_files() { ftp ${_ftp_active} -V -n "$1" <<__EOT user "$2" "$3" cd "$4" ls quit __EOT } makedev() { local _dev=$1 if [[ ! -r /dev/MAKEDEV ]] ; then echo "MAKEDEV not found. Can't create device nodes." return 1 fi cd /dev ; sh MAKEDEV $_dev || return 1 ; cd - >/dev/null } addhostent() { local _addr=$1 _name=$2 _delim="." [[ $_addr == *:* ]] && _delim=":" sed "/^[0-9a-fA-F]*[$_delim].* $_name\$/d" /tmp/hosts >/tmp/hosts.new mv /tmp/hosts.new /tmp/hosts echo "$_addr $_name" >>/tmp/hosts } select_sets() { local _avail=$1 _selected=$2 _next _f _action cat <<__EOT Select sets by entering a set name, a file name pattern or 'all'. De-select sets by prepending a '-' to the set name, file name pattern or 'all'. Selected sets are labelled '[x]'. __EOT while :; do _action= _next= echo for _f in $_avail; do if isin $_f $_selected; then echo " [X] $_f" else echo " [ ] $_f" : ${_next:=$_f} fi done : ${_next:=done} ask "Set name? (or 'done')" "$_next" case $resp in done) break ;; -*) _action=rmel ;; esac : ${_action:=addel} resp=${resp#+|-} case $resp in "") continue ;; all) resp=* ;; esac for _f in $_avail; do eval "case $_f in @($resp)) _selected=\`$_action $_f \$_selected\` ;; esac" done done resp=$_selected } configure_ifs() { local _IFDEVS=$IFDEVS _ifs _name _media _hn while :; do ask_which "interface" "do you wish to initialize" "$_IFDEVS" \ "" "No more interfaces to initialize" [[ $resp == done ]] && break _ifs=$resp _hn=/tmp/hostname.$_ifs ask "Symbolic (host) name for $_ifs?" "$(hostname -s)" _name=$resp _media=$(ifconfig -m $_ifs | grep "media ") if [[ -n $_media ]]; then cat <<__EOT The media options for $_ifs are currently $(ifconfig -m $_ifs | sed -n '/supported/D;/media:/p') __EOT ask_yn "Do you want to change the media options?" case $resp in y) cat <<__EOT Supported media options for $_ifs are: $_media __EOT ask "Media options for $_ifs?" _media=$resp ifconfig $_ifs $_media || return 1 ;; n) _media= ;; esac fi rm -f $_hn v4_config "$_ifs" "$_media" "$_name" "$_hn" v6_config "$_ifs" "$_media" "$_name" "$_hn" [[ -f $_hn ]] && _IFDEVS=$(rmel "$_ifs" $_IFDEVS) done } v4_info() { ifconfig $1 inet | sed -n ' 1s/.*/etc/resolv.conf.tail if [[ -n $_hn ]]; then _hn="send host-name \"$_hn\";" echo "Issuing hostname-associated DHCP request for $_ifs." else echo "Issuing free-roaming DHCP request for $_ifs." fi cat >/etc/dhclient.conf <<__EOT initial-interval 1; $_hn request subnet-mask, broadcast-address, routers, domain-name, domain-name-servers, host-name; __EOT ifconfig $_ifs group dhcp >/dev/null 2>&1 dhclient $_ifs set -- $(v4_info $_ifs) if [[ $1 == UP && -n $2 ]]; then mv /etc/dhclient.conf /tmp/dhclient.conf mv /etc/resolv.conf.tail /tmp/resolv.conf.tail return 0 fi ifconfig $_ifs delete down rm /etc/dhclient.conf /etc/resolv.conf.tail return 1 } v4_config() { local _ifs=$1 _media=$2 _name=$3 _hn=$4 _prompt _addr _mask if ifconfig $_ifs | grep 'groups:.* dhcp' >/dev/null 2>&1; then _addr=dhcp else set -- $(v4_info $_ifs) if [[ -n $2 ]]; then _addr=$2; _mask=$3 ifconfig $_ifs inet $_addr delete fi fi [[ -x /sbin/dhclient ]] && _prompt=" or 'dhcp'" _prompt="IPv4 address for $_ifs? (or 'none'$_prompt)" ask_until "$_prompt" "$_addr" case $resp in none) ;; dhcp) if [[ ! -x /sbin/dhclient ]]; then echo "DHCP not possible - no /sbin/dhclient." elif dhcp_request $_ifs "$_name" || dhcp_request $_ifs ; then addhostent "127.0.0.1" "$_name" echo "dhcp NONE NONE NONE $_media" >>$_hn fi ;; *) _addr=$resp ask_until "Netmask?" "${_mask:=255.255.255.0}" ifconfig $_ifs -group dhcp >/dev/null 2>&1 if ifconfig $_ifs inet $_addr netmask $resp up ; then addhostent "$_addr" "$_name" echo "inet $_addr $resp NONE $_media" >$_hn fi ;; esac } v6_config() { local _ifs=$1 _media=$2 _name=$3 _hn=$4 _addr _prefixlen _prompt ifconfig lo0 inet6 >/dev/null 2>&1 || return set -- $(v6_info $_ifs) [[ -n $2 ]] && { _addr=$2; _prefixlen=$3; } [[ -x /sbin/rtsol ]] && _prompt="or 'rtsol' " _prompt="IPv6 address for $_ifs? (${_prompt}or 'none')" ask_until "$_prompt" "${_addr:-none}" case $resp in none) return ;; rtsol) [[ ! -x /sbin/rtsol ]] && { echo "No /sbin/rtsol." ; return ; } ifconfig $_ifs up rtsol -F $_ifs addhostent "::1" "$_name" echo "up\nrtsol $media" >>$_hn return ;; esac _addr=$resp ask_until "IPv6 prefix length for $_ifs?" "${_prefixlen:=64}" ifconfig $_ifs inet6 $_addr prefixlen $resp up || return echo "inet6 $_addr $resp $media" >>$_hn addhostent "$_addr" "$_name" v6_defroute $_ifs [[ $resp == none ]] && return route -n add -inet6 -host default "$resp" || return echo "!route -qn add -host -inet6 default $resp" >>$_hn } v4_defroute() { local _dr _prompt=" or 'none'" [[ -x /sbin/dhclient ]] && _prompt=", 'dhcp'$_prompt" _prompt="Default IPv4 route? (IPv4 address$_prompt)" _dr=$(route -n show -inet | sed -ne '/^default */{s///; s/ .*//; p;}') [[ -f /tmp/dhclient.conf ]] && _dr=dhcp while :; do ask_until "$_prompt" "$_dr" [[ $resp == @(none|dhcp) ]] && break route delete -inet default >/dev/null 2>&1 route -n add -inet -host default "$resp" && { echo "$resp" >/tmp/mygate ; break ; } route -n add -inet -host default $_dr >/dev/null 2>&1 done } v6_defroute() { local _if=$1 _routers _oifs if [[ -z $(route -n show -inet6 | sed -ne '/^default */{s///; s/ .*//; p;}') ]]; then resp=none return fi if [[ -x /sbin/ping6 ]]; then _routers=$(ping6 -n -c 2 ff02::2%$_if 2>&1 | sed -n \ -e '/bytes from/{s/^.*from //;s/,.*$//;p;}') fi _oifs=$IFS IFS= PS3="IPv6 default router? (list #, IPv6 address or 'none'): " select i in $_routers; do case $i in "") resp=$REPLY [[ -n $resp ]] && break ;; *) resp=$i break ;; esac done IFS=$_oifs } enable_network() { local _netfile for _netfile in hosts dhclient.conf resolv.conf resolv.conf.tail protocols services; do if [ -f /mnt/etc/${_netfile} ]; then cp /mnt/etc/${_netfile} /etc/${_netfile} fi done ifconfig lo0 inet 127.0.0.1 for hn in /mnt/etc/hostname.*; do if=${hn#/mnt/etc/hostname.} ifconfig $if >/dev/null 2>&1 || continue while :; do if [ "$cmd2" ]; then set -- $cmd2 af=$1 name=$2 mask=$3 bcaddr=$4 ext1=$5 cmd2= i=1; while [ i -lt 6 -a -n "$1" ]; do shift; let i=i+1; done ext2="$@" else read af name mask bcaddr ext1 ext2 || break fi case $af in "#"*|"!"*|"bridge"|"") continue ;; "dhcp") [ "$name" = "NONE" ] && name= [ "$mask" = "NONE" ] && mask= [ "$bcaddr" = "NONE" ] && bcaddr= ifconfig $if $name $mask $bcaddr $ext1 $ext2 down cmd="dhclient $if" ;; "rtsol") ifconfig $if $name $mask $bcaddr $ext1 $ext2 up rtsif="$rtsif $if" cmd= ;; "up") cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 up" ;; *) read dt dtaddr if [ "$name" = "alias" ]; then alias=$name name=$mask mask=$bcaddr bcaddr=$ext1 ext1=$ext2 ext2= else alias= fi cmd="ifconfig $if $af $alias $name " case $dt in dest) cmd="$cmd $dtaddr" ;; [a-z!]*) cmd2="$dt $dtaddr" ;; esac if [ ! -n "$name" ]; then echo "/mnt/etc/hostname.$if: invalid network configuration file" return fi case $af in inet) [ "$mask" ] && cmd="$cmd netmask $mask" if [ "$bcaddr" -a "$bcaddr" != "NONE" ]; then cmd="$cmd broadcast $bcaddr" fi [ "$alias" ] && rtcmd="; route -qn add -host $name 127.0.0.1" ;; inet6) [ "$mask" ] && cmd="$cmd prefixlen $mask" cmd="$cmd $bcaddr" ;; *) cmd="$cmd $mask $bcaddr" esac cmd="$cmd $ext1 $ext2$rtcmd" rtcmd= ;; esac eval "$cmd" done /dev/null 2>&1 route -qn add -host default $(/dev/null route -qn add -net 127 127.0.0.1 -reject >/dev/null echo "Network interface configuration:" ifconfig -am route -n show if [ -f /etc/resolv.conf ]; then echo "\nResolver enabled." else echo "\nResolver not enabled." fi } install_files() { local _src=$1 _files=$2 _f _sets _get_sets for _f in $THESETS; do isin $_f $_files || continue; _sets=$(addel $_f $_sets) isin $_f $DEFAULTSETS && _get_sets=$(addel $_f $_get_sets) done if [[ -z $_sets ]]; then cat <<__EOT No $OBSD sets were found at $(echo $_src | sed -e 's/\(^ftp:\/\/[^/]*\)\(:[^/]*\)\(@.*\)/\1\3/') Set names are: $THESETS __EOT return fi select_sets "$_sets" "$_get_sets" [[ -n $resp ]] || return _get_sets=$resp ask_yn "Ready to $MODE sets?" yes [[ $resp = n ]] && return for _f in $THESETS ; do isin $_f $_get_sets || continue echo "Getting $_f ..." case $_f in *.tgz) ftp $_ftp_active -o - -V -m "$_src/$_f" | tar zxphf - -C /mnt ;; *) ftp $_ftp_active -o "/mnt/$_f" -V -m "$_src/$_f" ;; esac if [ $? -ne 0 ]; then echo "'$_f' did not install correctly." else DEFAULTSETS=$(rmel $_f $DEFAULTSETS) fi done } encode_for_url() { echo "$1" | sed -e " s/%/%25/g s/ /%20/g s/!/%21/g s/\"/%22/g s/#/%23/g s/\\\$/%24/g s/&/%26/g s/'/%27/g s/(/%28/g s/)/%29/g s/\*/%2a/g s/+/%2b/g s/,/%2c/g s/-/%2d/g s/\./%2e/g s/\//%2f/g s/:/%3a/g s/;/%3b/g s//%3e/g s/?/%3f/g s/@/%40/g s/\[/%5b/g s/\\\\/%5c/g s/]/%5d/g s/\^/%5e/g s/_/%5f/g s/\`/%60/g s/{/%7b/g s/|/%7c/g s/}/%7d/g s/~/%7e/g " } ftp_error() { if [[ -n $(echo "$2" | grep "$1") ]]; then echo $1 return 0 fi return 1 } install_url() { local _url_type=$1 _file_list _url_base _oifs _prompt _passwd ask "HTTP/FTP proxy URL? (e.g. 'http://proxy:8080', or 'none')" \ "${ftp_proxy:-none}" unset ftp_proxy http_proxy [[ $resp == none ]] || export ftp_proxy=$resp http_proxy=$resp rm -f $SERVERLIST ask_yn "Display the list of known $_url_type servers?" "${_get_server_list:-yes}" _get_server_list=$resp if [[ $_get_server_list == y ]]; then echo -n "Getting the list from 129.128.5.191 (ftp.openbsd.org)..." ftp $_ftp_active -V -a -o - \ ftp://129.128.5.191/$FTPDIR/ftplist 2>/tmp/ftplisterr \ | sed -ne "/^${_url_type}:\/\//s///p" >$SERVERLIST if [[ -s $SERVERLIST ]]; then echo "done." _prompt="Server? (IP address, hostname, list#, 'done' or '?')" cat -n $SERVERLIST | less -XE else echo "FAILED." cat /tmp/ftplisterr fi fi : ${_prompt:="Server? (IP address, hostname or 'done')"} while :; do eval resp=\$_${_url_type}_server_ip ask_until "$_prompt" "$resp" case $resp in done) return ;; "?") [[ -s $SERVERLIST ]] || continue cat -n $SERVERLIST | less -XE ;; +([0-9])) [[ -s $SERVERLIST ]] || continue set -- $(sed -ne "${resp}p" $SERVERLIST) [[ $# -lt 1 ]] && { echo "There is no line $resp." ; continue ; } echo "Using $*" eval _${_url_type}_server_ip=${1%%/*} eval _${_url_type}_server_dir=${1#*/}/$SETDIR ;; *) eval _${_url_type}_server_ip=$resp break ;; esac done if [[ $_url_type == ftp && -z $ftp_proxy ]]; then case $_ftp_active in -A) resp=no ;; *) resp=yes ;; esac unset _ftp_active ask_yn "Does the server support passive mode ftp?" $resp [[ $resp == n ]] && _ftp_active=-A fi eval resp=\$_${_url_type}_server_dir ask_until "Server directory?" "${resp:-pub/OpenBSD/$SETDIR}" eval _${_url_type}_server_dir=$resp if [[ $_url_type == ftp ]]; then _oifs=$IFS IFS= ask_until "Login?" "${_ftp_server_login:=anonymous}" _ftp_server_login=$resp _passwd=root@`hostname` if [[ $_ftp_server_login != anonymous ]]; then resp= while [[ -z $resp ]] ; do askpass "Password? (will not echo)" done _passwd=$resp fi IFS=$_oifs fi _url_base=$_url_type:// if [[ $_url_type == ftp && $_ftp_server_login != anonymous ]]; then _url_base=$_url_base$(encode_for_url "$_ftp_server_login"):$(encode_for_url "$_passwd")@ fi eval _url_base=$_url_base\$_${_url_type}_server_ip/\$_${_url_type}_server_dir ifconfig lo0 127.0.0.1 if [[ $_url_type == ftp && -z $ftp_proxy ]] ; then _file_list=$(ftp_list_files "$_ftp_server_ip" "$_ftp_server_login" "$_passwd" "$_ftp_server_dir") ftp_error "Login failed." "$_file_list" && return ftp_error "No such file or directory." "$_file_list" && return else _file_list=$(ftp -o - -V "$_url_base/index.txt" | sed 's/ //') fi install_files "$_url_base" "$_file_list" } install_mounted_fs() { local _dir while :; do ask_until "Pathname to the sets? (or 'done')" "$SETDIR" [[ $resp == done ]] && return [[ -d /mnt2/$resp ]] && { _dir=/mnt2/$resp ; break ; } [[ -d /mnt/$resp ]] && { _dir=/mnt/$resp ; break ; } [[ -d /$resp ]] && { _dir=/$resp ; break ; } echo "The directory '$resp' does not exist." done install_files "file://$_dir" "$(ls -l $_dir)" } install_cdrom() { local _drive _part=c _fstype get_drive "CD-ROM" "$CDDEVS" || return _drive=$resp set -- $(disklabel $_drive 2>&1 | grep '^ c: ') case $4 in ISO9660) _fstype=cd9660 ;; UDF) _fstype=udf ;; *) get_partition $_drive "cd9660" || return set -- $resp _part=$1 [[ -n $2 ]] && _fstype=$2 ;; esac mount -t $_fstype -o ro /dev/$_drive$_part /mnt2 || return install_mounted_fs } install_disk() { local _drive _dev _fstype _fsopts ask_yn "Is the disk partition already mounted?" if [[ $resp == n ]]; then get_drive "disk" "$DKDEVS" || return _drive=$resp get_partition $_drive "$MDFSTYPE" || return set -- $resp _dev=/dev/$_drive$1 [[ -n $2 ]] && _fstype="-t $2" [[ $_fstype == $MDFSTYPE ]] && _fsopts=$MDFSOPTS if [[ -z $(mount | grep "^$_dev") ]]; then mount $_fstype -o ro,$_fsopts $_dev /mnt2 || return fi fi install_mounted_fs } install_nfs() { local _tcp ask_until "Server IP address or hostname?" "$NFS_ADDR" NFS_ADDR=$resp ask_until "Filesystem on server to mount?" "$NFS_PATH" NFS_PATH=$resp ask_yn "Use TCP transport? (requires TCP-capable NFS server)" [[ $resp == y ]] && _tcp=-T mount_nfs $_tcp -o ro $NFS_ADDR:$NFS_PATH /mnt2 || return install_mounted_fs } install_tape() { local _z _bs get_drive "tape drive" "$MTDEVS" || return export TAPE=/dev/nr$resp if [[ ! -c $TAPE ]]; then echo "$TAPE is not a character special file." return fi echo -n "Rewinding $TAPE (mt rewind)..." mt rewind || return echo "done." while :; do ask_until "Skip how many files? (or 'done')" 0 [[ $resp == done ]] && return [[ $resp == +([0-9]) ]] || continue (($resp < 0)) && continue if (($resp > 0)); then echo -n "Skipping $resp file(s)..." mt fsf $resp || return echo "done." elif [[ -n $_bs ]]; then mt bsf ; mt fsf fi unset _z ask_yn "Is the file gzipped?" yes [[ $resp == y ]] && _z=z [[ $_z == z ]] || _bs=10240 ask_until "Blocksize for this file?" "${_bs:-8k}" [[ $resp == done ]] && return _bs=$resp dd if=$TAPE bs=$_bs | tar ${_z}xvphf - -C /mnt || return done } set_timezone() { local _zoneroot=/mnt/usr/share/zoneinfo/ _zonepath [[ ! -d $_zoneroot ]] && return if [[ -L /mnt/etc/localtime ]]; then TZ=$(ls -l /mnt/etc/localtime 2>/dev/null) TZ=${TZ#*${_zoneroot#/mnt}} fi : ${TZ:=GMT} while :; do _zonepath=$_zoneroot ask "What timezone are you in? ('?' for list)" "$TZ" if [[ $resp == ? ]]; then ls -F ${_zonepath} continue; fi _zonepath=${_zonepath}${resp} while [[ -d $_zonepath ]]; do ask "What sub-timezone of '${_zonepath#$_zoneroot}' are you in? ('?' for list)" case $resp in "") ;; ?) ls -F $_zonepath ;; *) _zonepath=$_zonepath/$resp ;; esac done if [[ -f $_zonepath ]]; then TZ=${_zonepath#$_zoneroot} echo -n "Setting local timezone to '$TZ'..." ln -sf /usr/share/zoneinfo/$TZ /mnt/etc/localtime echo "done." return fi echo -n "'${_zonepath#$_zoneroot}'" echo " is not a valid timezone on this system." done } sane_install() { local _s _m for _s in $SANESETS; do isin $_s $DEFAULTSETS || continue ask_yn "'$_s' was not installed.\nAre you *SURE* your $MODE is complete without '$_s'?" [[ $resp == n ]] && _m="$_m $_s" done [[ -n $_m ]] && return 1 return 0 } install_sets() { local _d=disk _locs="disk ftp http" [[ -n $CDDEVS ]] && { _locs="cd $_locs" ; _d=cd ; } [[ -x /sbin/mount_nfs ]] && _locs="$_locs nfs" [[ -n $MTDEVS && -x /bin/mt ]] && _locs="$_locs tape" echo "\nLet's $MODE the sets!" while :; do umount -f /mnt2 >/dev/null 2>&1 [[ -z $DEFAULTSETS ]] && _d=done ask "Location of sets? ($_locs or 'done')" "$_d" case $resp in done) sane_install && return ;; c*|C*) isin "cd" $_locs && install_cdrom ;; d*|D*) install_disk ;; f*|F*) isin "ftp" $_locs && install_url ftp ;; h*|H*) isin "http" $_locs && install_url http ;; n*|N*) isin "nfs" $_locs && install_nfs ;; t*|T*) isin "tape" $_locs && install_tape ;; esac done } munge_fstab() { local _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do [[ $_dev == \#* || \ $_fstype == nfs || \ ! -f /sbin/mount_$_fstype || \ $_opt == *noauto* || \ $_opt == *xx* ]] && continue _opt=$(echo $_opt | sed -e 's/softdep//') [[ $_fstype == ffs ]] || _opt=$(echo $_opt | sed -e 's/rw/ro/') echo $_dev /mnt${_mp%/} $_fstype $_opt done /etc/fstab if [ ! -s /etc/fstab ]; then echo "Unable to create valid /etc/fstab." exit fi } mount_fs() { local _async=$1 _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do [ "$_mp" = "/mnt" ] || mkdir -p $_mp if ! mount -v -t $_fstype $_async -o $_opt $_dev $_mp ; then cat <<__EOT FATAL ERROR: Cannot mount filesystems. Double-check your configuration and restart the $MODE. __EOT exit fi done /dev/null 2>&1; then echo "FAILED. You must fsck $_dev manually." _fail=y else echo "OK." fi done /tmp/resolv.conf for _ns in $resp; do echo "nameserver $_ns" >>/tmp/resolv.conf done ask_yn "Use the nameserver now?" yes [[ $resp == y ]] && cp /tmp/resolv.conf /tmp/resolv.conf.shadow fi [[ -n $(ifconfig -a | sed -ne '/[ ]inet .* broadcast /p') ]] && v4_defroute edit_tmp_file hosts manual_net_cfg } populateusrlocal() { if [ -f /mnt/etc/mtree/BSD.local.dist ]; then /mnt/usr/sbin/chroot /mnt /usr/sbin/mtree -Uedqn -p /usr/local -f /etc/mtree/BSD.local.dist >/dev/null fi } questions() { local _bd _td ask_yn "Start sshd(8) by default?" yes if [[ $resp == n ]]; then echo "sshd_flags=NO # disabled during install" \ >>/mnt/etc/rc.conf.local fi ask_yn "Start ntpd(8) by default?" no if [[ $resp == y ]]; then echo "ntpd_flags= # enabled during install" \ >>/mnt/etc/rc.conf.local fi if [[ -n $MDXAPERTURE ]]; then ask_yn "Do you expect to run the X Window System?" yes if [[ $resp == y ]]; then sed -e "/^#\(machdep\.allowaperture=${MDXAPERTURE}\)/s//\1 /" \ /mnt/etc/sysctl.conf >/tmp/sysctl.conf cp /tmp/sysctl.conf /mnt/etc/sysctl.conf fi fi [[ -z $SERIALDEV ]] && return set -- $SERIALDEV _bd=$1 _td=$2 ask_yn "Change the default console to $_bd?" [[ $resp == n ]] && return ask_which "speed" "should $_bd use" "9600 19200 38400 57600 115200" [[ $resp == done ]] && return echo "stty $_bd $resp\nset tty $_bd" >>/mnt/etc/boot.conf sed -e "/^${_td}/s/std.9600/std.${resp}/" \ -e "/^${_td}/s/unknown/vt220 /" \ -e "/${_td}/s/off/on secure/" /mnt/etc/ttys >/tmp/ttys } finish_up() { local _dev _mp _fstype _rest if [[ -x /mnt/sbin/swapctl ]]; then /mnt/sbin/swapctl -a /dev/$SWAPDEV >/dev/null 2>&1 while read _dev _mp _fstype _rest; do [[ $_fstype == swap ]] && \ /mnt/sbin/swapctl -a $_dev >/dev/null 2>&1 done /tmp/sysctl.conf cp /tmp/sysctl.conf /mnt/etc/sysctl.conf fi echo -n "Making all device nodes..." cd /mnt/dev sh MAKEDEV all for _dev in $DKDEVS $CDDEVS $MTDEVS; do sh MAKEDEV $_dev done echo "done." cd / md_installboot $ROOTDISK populateusrlocal [ -x /mnt/$MODE.site ] && /mnt/usr/sbin/chroot /mnt /$MODE.site cat <<__EOT CONGRATULATIONS! Your OpenBSD $MODE has been successfully completed! To boot the new system, enter halt at the command prompt. Once the system has halted, reset the machine and boot from the disk. __EOT md_congrats } ROOTDISK= ROOTDEV= VERSION=38 VNAME="$(( $VERSION / 10 )).$(( $VERSION % 10 ))" SETDIR="$VNAME/$ARCH" FTPDIR="pub/OpenBSD/$VNAME" OBSD="OpenBSD/$ARCH $VNAME" SERVERLIST=/tmp/serverlist for _opt in d f l m n p s; do ulimit -$_opt unlimited done dmesg | sed -ne '/^OpenBSD /h;/^OpenBSD /!H;${g;p;}' >/var/run/dmesg.boot DKDEVS=$(scan_dmesg "${MDDKDEVS:-/^[sw]d[0-9][0-9]* /s/ .*//p}") CDDEVS=$(scan_dmesg "${MDCDDEVS:-/^cd[0-9][0-9]* /s/ .*//p}") MTDEVS=$(scan_dmesg "${MDMTDEVS:-/^[cmsw]t[0-9][0-9]* /s/ .*//p}") IFDEVS=$(get_ifdevs) SERIALDEV=$(get_serialdev) THESETS="bsd bsd.rd bsd.mp $MDSETS" DEFAULTSETS="bsd bsd.rd" for _set in base etc misc comp man game xbase xetc xshare xfont xserv site ; do [[ $MODE == upgrade && ( $_set == etc || $_set == xetc ) ]] && continue THESETS="$THESETS ${_set}${VERSION}.tgz" isin $_set xbase xetc xshare xfont xserv site && continue DEFAULTSETS="$DEFAULTSETS ${_set}${VERSION}.tgz" done SANESETS="bsd base${VERSION}.tgz etc${VERSION}.tgz" : ${EDITOR:=ed} [[ -x /usr/bin/vi ]] && EDITOR=vi export EDITOR [[ -f /etc/fstab ]] && umount -av 1>/dev/null 2>&1 umount -v /mnt 1>/dev/null 2>&1 welcome if [[ $MODE == install && ! -f /etc/fstab ]]; then cat <<__EOT You will now initialize the disk(s) that OpenBSD will use. To enable all available security features you should configure0123456789abcdefhX_),8wzhX_ċ d DK T hX_, a  w ^  hX_ 0 hX_: 0 }hX_<`ehX_+ahX_,(ghX_)  0  hX_  0 hX_g4* 0 hX_ 0 %U_hX_ @LJJ@2X Xd$`X_X_[_[_[_[_[_X_X_[_Y_Y_[_ ʚ;5ym8@ E82(@AAA==(A*X_X_X_X_X_X_X_X_X_X_X_X_X_X_gQ [_[_ >(Qc+,Qc>0Qc?4Qc?8Qc?@+H+X+;p++=H=L>>>>?P???? @T@@@@$AXA0++AUUV VVUVXVV`V`VhVpVVWVWW,WVXWUxVUUUTTWUVAPVAVA@VA@qA qAqA qAD@ @ D @ i @ i@ @ lExEEEEEEEcatspXʏHX\@td  AD@(:47<7D7:d777x<|=|88>L7T7\7;78,8H=L>89>?P????h9T@@@9$AXA$nooHpDqdr|rr,tTuvPxtxat@)l)[;,=>>>>>>:><:p:D7:;<D<x<|===> ;@;\7;<<=H=L>>>>?P???? @T@@@@$AXA?d?CC$EX_,Exbddde e0e@e\eRdde e0e@ed<nlneh$h0hH_P_X_;`___H=_`(`>?P????P`T@@@@$AXA]]]^^4^:<^@^H^P^:X^^^x<^^ _>H_P_X_;`___H=_`(`>?P????P`T@@@@$AXA8l(l\|L|؃\|L|\|L|܊T\|L|  \|L|<0L[XPxxPi8`8u`\xax!8`xqxr̾xsxtxu̾xvDxxxxx,xxxxhh!hhhhhb b bxxxxxxxxPPQQS D DDxPxU`8x`xpxhxPDxx\DH\p8` WD2?2?(77l87   XD31   77l87SB1 B 1 11111NeN3NQ"NQ!NQNQ&3NQ&!NQ&1NQ1NM1NI1Nm1NE1NE^ & b .,f,b,b܂bܚbܑb܎b܍bmb܁ e T C B ꂀ"T"B"TB BBBB    eB" (  $GNNNN01@OP1 O0O00O3O5O@EPFPHP>??  ` ~ ^ "' AAA AA'CEEEEIIIINOOOOOUUUUYaaaa aa'ceeeeiiiinooooouuuuyy"A"E"I"O"U"a"e"i"o"u"yA^A`A*A~ACE^E`EI^I`I~NO^O`O~OU^U`UYa^a`a*a~ace^e`ei^i`i~no^o`o~ou^u`uyH Boldface.iso1 t_wfllllllll||| 0 `F8ll8vv0 000000 0 0f<0p000x6 0>p00p>p|`08l 8llF`0| 0|``f`?8`DDE9  2 2 a>wc`aaa?`  0  0f`vvf`    ` 00`000000006??a@ 0  @````@``@? !? ?1```@```0 00`gop``````p@??`@@000  000 ``````p?```<     `xx``88`9  ?0```g ollg`0? ? @@`@`````a``````````` `````` 0 @a``````````````````@a0@0@000?00000 0 0@0@000?000000x` ````a`` `0````````````````````````80acflxx|ngca`px00000000000 0 p`pppY`Y`Y`M`N`N`D`D`p` p x X L F G C A@@@`0 ````````````` @0@00`0`0`07000000x `````````````0@8@#a````|ngca`p0`` ` p<@`@``F p` ` ` ` ` ` ` ` ` ` p@?`@000 f f f v w@3@7@;;p` 0@8   @`p` 0@ ?   ?``00 || ||1`0009 ```gop````````p`xO1 ````p@0`````1 ````````p9`p0``````0`   1```1?`? `@ @ ?0p00790000000y 08````acf|x|ngcnf`f`f`f`f`f`f`p'y0000000y ````````p@8q``````````@p````  ````````p`8````s48000000x00@8 0?  @y00000009`p` 0@0@ pf f f 7@;@;@p@8  ` 0@0@  xp`A8 p`8    8 >`6gC0000~|V`s@ o`?0000?o`@ ``00`0?a00`0`00/@)@(@(@)@/@0``0`0`?` 6ll6 `??0/@)@/@*@*@+@0 33 ???<f0`~<ff< y00000009>`0000x?```?````````` 8<0`0`0`?l6 `` 6l08@@@@08 8D8D8@@@@ 000@9  ? @@` ? @@` ? @@`  ? @@` ? @@` ? @@`   # ##CCC` `````` 0 @  0@0@00?000 0 0@0@00?000 0 0@0@00?000 0 0@0@00?000 0  100`0`0``0`0`0`0`0@1 p` p X L F C A@@`0  ``````` @0@ ``````` @0@ ``````` @0@  ``````` @0@ ``````` @0@ 0`  0` `!!c`c`f`f`l`l`8@8@8o p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` 0@ ``````````8```acc````````ac 000900090009 0009000900096@&``?fff v@;1 ````p@0  0``````0`0``````0`0``````0`0``````0` Dl88lF ````p@8 'y0000000y  ````````p@8 ````````p@8 ````````p@8  ````````p@8 ````````p@8``#c`f`f`l`|@8?`` y00000009`y00000009`y00000009`y00000009`` 0@0@  xp````aaaaa`` 0@0@  xp8_t_  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ͳɿپ̴ްp_p_2q_)_a_-_?_____ _0_@_  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~_o__ _0_@_  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~     _a?_T_d_P_&P_!t_@X,$NetBSD: blockio.S,v 1.4 2001/06/02 11:15:56 bjh21 Exp $.symtab.strtab.shstrtab.text.start.data.sbss.bss.arm.atpcs.ident< !_(@.__4__ȅ9_D_9I_KL_y  5aGL__  >"^8- c:pEh@UnlJh{8$Q42H4. D l_zt',/dlB_4Op[X i>{`(LO4et`ltCl7\,  pt,~ D / XdtX)x0Ľ<Hb_Rx\1e cr0_{8) m\px,L~ 47 8a &b6hhA,XS;\f\w:$_H<y  5$(@_XPb,x$)S3@C<`G<NLbJDrd=y`@ <D<x $80 t<TCP&#'`e3X"<;`CLp`Y6bLFr`I |%Џh\aXH\a b 0b4b0(H*0E3$CxHGHSu _I j`V{TT +|Bx)d_ m |h047$="T\0ta>jR,Y3krda_\9$8|(X`U( - Hc ė p, <09 LcF g \ Sg T~ Sc X ) 4a_ 0 ̃  4 P9  hf0 P]c  h' T: ,QxM ,aW g_ ^ bn 8 5 @   a h / h L < ( D ha VX ء# P, h(: bR `a q \}  ؃X t mp |  c_0 9 h h !  + ;t?  Q p<`  i  } P[T < D XP D gaD  ( В_ е p x H $& |: ,RN %ph X\u  @ T 0p X 1h B4 v hP D 4  b"p3>lHE<V< c,|s+8(82TP Z @ C dpP&d(/ $7@\AJQ `lL_pD|8$< L081 Hta3d_ ld l e8tb%9X3GC4 O\$@dk,a 4dL\|X8 hp$csn, p@N\"hJ(\8FsRMHh o%0{tat Xp$82ctTFk,  t5d#Sc,Sc;tHxK(FaX6 ,jt=rX\<@\  0S$TFD- 05p WgxamS y(D$F0P:ԕT TЁ0,NT dl .'\-p/J$lXXgx;4sX HW7 < x 3b34a(3$3-' 4h4 %4< <04hB4ȚT4ؾ\4P`h4lF4d4YT4*t4404 4(_4YB4o4h,x4,4p(55|<X#5t15D9A5pP5tX5ab5ti5hLt5V 5,b5.5Tj5@505X_5f_5,5966_66RH060B\J6U_U6p `6gu6ta_66/ 6 ha646L6(6܄_6u 7^_7$N%7,7r 87D7X9$S7[ H]7bi7Eq77lPx7X47u\7L/ H7̂H77h@7"L77(<8f_8s8ba8<.8?8(yPN8H_Y8Dc8^o8+ ~8;8(|8ls8`t>>i p&>(:>xnF>LV>5m>3>\>H>.>_ >HE4>,>D><>9$>X?(?)?L4?Ѝ,;?DJ?XU?<%0e?Gn? y?L(?8 ?d?pF??L?lN ??a8@X@h$@pRc/@7@cE@baM@|S@X%_@Hi@ x@l@P@x^@@a@0@$S0@Da@H @TAd` AOA+A$?A3UA\Aط bA`(jAyAAdA0HxA7pAh1PAQA A ,B9B@a_B -L!B_88BL<BBOBcBhpBd]cB\Bl <B<| HBLaBHWlBjPBB QPC0C=C+#C|2Cf_8Ce_DCRC PaCZrCtC$C.C<C0CH|`C`pCC<4ChD!DD-D=D@-HDXVD`fDc$xD*lDSPD;Df_D7 DFMFUFX `Fn dpF@_|F` F[_F$FFPc8F(bF0XFf_Fe F[Fx\cG؃PGXV"G @1Gp?GxOGbVG bGhapG`TyG`(GBGG$9GԅaGHG$GXGHHTdH\Hv)Hl5H\xPIH YH,+lmHt ,{HQcHwtHHH8H HH ;H; ItdITILV&IHM`0Ie8Il CIhPQIl`I+jIoI8II dI,Ile4IaIPIm ,I|GI PJ؅aJz Jx_ +J cKMPK_KchK(M|xKXf K(cPK KK$HKG KLKt K`<K`8L܊xL)4L8-(Lp 3L܄axALDILI$TLs`L/poL,ayLpx Lh7L @LoLw LDL_L LULUL<MaM,M4MDlCMXaTMSc`MP8rM(M+MX_MSM0MH MLLM|HM_M\LMiaN Np\ N8N# @CN<UNPX`NP oNh ~N,dNlN"N0N0t NTJN4dN NOh]cO@$ O4D 2O,T@OhRO\O1cuOL O* HOT6$OO\COO_cOOh P|EPpp X+P 89P.(APhaQPX_bPxxmPT|P(HPK P@\PP" Pl' P$PNPSQdQT QV.Q L?Q$QQ#tiQl,QЂTQ>tQDQ|@QLbQT%Qp,QX\QR0y'R\Ab`E8Gb^blb U}bXbLbd8dcd dXtd dX_dSce,e'@/e(/(;eXGeP Qe|aeye#ef @e8e'eze ej eeY,eD f*f[_+f `6f8|EfADNf Vf,bf P dlfl vf!fp,fU\ff`a_f]_f @ff_f`$fJchfP 0fpfXgT gpagl"g+g4L:g\ PEg4aSgD(jgRbyg[ gggag@g`_g(ghgRcgX_h8h4,h8?T5h>Ghh]h8mh4{h hh1h  h4bhh,9$hhhi_i 8iԞX,i:i`+JiUi(Hdi( hli\i$ (idUi_i% iDliii dil8 jhj'j(c4j@jpKjbja jj!|j bjvj[cj jajj$j3$j< jhajpkUk:(k8kc EkXXke`gkX skak3kLkpkHlk akxVkkk(hk0 l[HlL/l7@qdq>qhF rnr Rc.r,5rPDIrP Tr=0irurX[ r$Errf_r rtrTrh0r0KrPrxsP 8 sasP8!s),s-w2@FwdaRw<cwElw_wwXw|w<dw$wR xwwaw%wFwt@xx}x<&xd/xWCxl$<Qx\kXxix^8ux( xGx- x 4xC x9xx \xU(x02xL~ DxYy^cy̬a)y T:yPa@Oydy|vy4dy byiaypy41y yNyd yuHy8  zz>(zB7z<TCzxaWznzDzHa(z xzazTzz,zl=z,+({ {8d{ c){h:{D7I{\^{8c{p{Dq{{{6{{h {h{h_{`T8{8h{\|TSD| |'||0| B|J|HX|4$g|%xu|dF||h<|o `|T+@|d|La|||<c|}b}l`$}$Ap/} =}ȋDK}_X}Hlb}$ehp}`J}R}|}m}|_}}<} }}}l}D)$}t@},~& ~-~`6~(J~d4W~ ,h~Xs~t~0Q 4~4~~|a~|<~Rd~ ~~X:l~&x~$~ L` P,, : Q̤ `'0kp4$zX8cH$} Tll]c |Lp 0hTa ?0E&x t1 v>Q \ hhtw.lx9 ǀX ЀS(ڀ]\, a؎XP>l+T$:G tU eh4zH̺\ @x`4΁xށHS<h=_' 8$Vd7fxam+y0 _Xc*˂\8ӂ8H0<$4<EK `(TmXTdlTc3h ˃,݃N t '`9d) @8\j H= @S_txp pD ,v hCHʄT4؄$ ȯ\ l Ԃ @t'<<HP0Z:e qxd]4adDž-܅TZ U   L8&`88HTD$ XMG] e\k@2DvVhxx{ <4 (چ|bA < I" 0)<DC pMhX_4Y _ds{$ttˇPև $FP\a@a)2P8$CT SX `aĉl@a wdDn:m L̈( $و` (b! U0,8YD`N[<Lm\ w`aha_ X<Tĉ@GLЉ,ډPM 0GT X c 8T1-l?cH, Q [j4y ] (Tt\1Ί\P֊a0xD"  pT( H6=HAT.mX{ȜT<4TKp4qȋ[{ td "DqtVt\\ϕX_ 0(@ȇ_ xd!H p10bA(@S@g\cPcpdz[c\ dd Px TRzĖtʖh֖Pݖtw @!`Kc8*Ȅt>DSJ}<c8aj0bx9$ $6$T@R—.ȗȓ\֗_h 4b п,Vl7GXxQ_Mm g_zVua\V 4@Fa˘X_ט@P/d|]c0H (,8ȿ LpT(^ p^$k5X4P>|l0,=tʙ,=֙ \?xy ԼH 4D(@2k?4bKaSt^pT|kuPcHW \p <vʚ|ښ@tdx  Z_/\ ,>,H|0Ua_\ j4v $<T <Λ+ כL $-> x44/ Np7$] l,8uc{pta_tQcɜ0aҜ8ڜXhPGt&TX3<9x ,G,NT]hsȅSc~d@t}(ɝĄ_ӝd 2l c@T:xM|8c<1j(} Q@_c=Ş<̞<ݞ\cbdt adT#:eI7,[4|iWw0a_pX BHUDßhҟ:4LB`lT X_  ) D1t <>AxGO`XX^ pbFrXD||@ $͠Pڠ$odE|2@h*p_<88aE+\^ (m8xa,T$s hE4iaȡT(l, b .8(#l=)4:[_GX_N)a| bl 4v(LLV Ȣ0_ϢhLPߢ$d /\9\4$+(@7C NDX\Leao00{r$T\b4|£ lΣ_XT,$% 3:T 8D@bMh$Vzbt XnsL5 0 {   ɤ6$ؤ!\Hb( c x*D]c2ScA4DJ U\ Da^m|`,D@ _,W5Υ 9Hߥ, ia |",3F$8Z<g3qh0 } $(t@ΦXF٦ Hf$^_'\1@aK \U3g^ 4q$(fTar,ا8Tߧ8_,#<O<T2,=UJT(30`@4l7tD-XX-L?̨HL٨ua8pX "K -$5P>]4Vl*LeLq|@ (4pʩl, ש , 8O, (/d!X.Є_<,WRbt7x<X_pl^c, L,ʪȄ_ԪDH@#p^ch  "D3( C5 S|eu8Pc| ($ǫ@d۫f$K lxa|$\`EDL+DOX5 a=K2adNgIlsHScT b<-& tŬ (ά$׬GTQ`9La& `2TEZ 0gy|~0H 1dXH4ȭlխh,Ș( (,؃,*# 9dA0TL_x^LwpP`5$\dt 0Į.Ү,^c8خpYpt2Da< <#L+$A=]DHbVl6 h[_<sS,`HD04t(!lǯȘ կb,^bDh| atRc'ľ 28=HD@TKx\_gXh _,4_ ʰXWX.$FvH%P0@ BpILXX TcQln8wV  d_\Xѱ`@ܱb$ 8  M  Sca l) H$<@CI"<W(j@T|* 5Pa[ P| Բ/PaPG|a ܓ '(T(6`G;] n$1~LTp4 D &th4 <(E)SRc](nRcH#L&$(<-ε 8ݵc$? \#4O(T`ЦTl\Mx(LhU$hp$B \ƶ @Ӷl0aL= T#h.4<z4K\xDYcl|XaxbT_ia<<w6з@P ,U @p0 +7@PNpL[h<4B,/ a tZ ĸ cи8߸@ T\xhTz" . 9ED,Ujacap0w D 4& a,8pd5 ˹aع̄a޹U(x _T!0V3$=@I, V1POB^kDF=8  ſtҿXic@-$,N8  m4, 4(C7 X4S`b@c@q 0z|Ha`N$Rc@n [tHJ,(0T aXa`\D' =yU^t' tkasM\zD@OZXdv\8X_T^_x_L0\ Lb.,:$> DG|?`^h4ubp9 H,Z]R83\0q*9[cFhVl XeoHd(x <pH$00$U({0La<!<<G |YHi|<rtH0fB|/ -l$ 5 (Ծ $d dZ'7$8n LS@U@`dcn{E  PDuX$ LMSchG4a( &z 2e_D 0Lr]al\x MHlY|Ę`LH|Xp $  (D*`> HKO$ShBa :hxtfP9$ih?d$48 @0_8, >L @+/>8@MHZ, j1\\ _h |, Z ~pPLX$  < $$(xP9LHtF$]Pajs } Dna 4 v )t <"tc3> A TQ5 lYxd̅x} |TaPc xb hcI [@x_x< T(X 0@ t;h FaPXabd_hDXbo$| U_pB4>@\]_NxTD dpB*0AHPb\ai0Vy* `P!O8P08b <H3Pl$|`-h=bJT|]crDdhh|pB|LȪg $uaM L_}P 7*;=XK_@p oHa L8|aNH0 $<_rX8ca@ +7_hEGNh bV`|jĐ_qy4_ ,0d P _<X\@ @$4\gJhVcc <pV |pw7$PT(HTf_Ԩhl,4h Lbx!$- 6=lINb4]d?fP|}5@| c  $OX(,d-$TH"2FAl LNHdln x0`xxL 9Px tDUL88d,w 07pCM̌X4_bv?,d+H p1pD @-d, th^*9zFHxtS4a],mLw]cT$(|=h,P84(^c (.x,p3TS >@LJ(W8 pb tGܣ Gԗdh2ScHJl@ HdH=,&>DP@\d tL$`n8F@\aHX hc7 8f0(7T@0OP^ciVy H(;`<$`4Ga\4#tx?hL80SmXelwX_XDg\*|$ <@X|1@ @(<X#)08Tu`I$XV4 P`03 dt$`#$1*:|I$Ec$ST9X_840kT}b\20x D8lC4C  J2twx?(8FX,R<[af\\o<}Hdh_D 4{Lp _(_l#(T,a_90G(Z\X4j=8Ȉ,2 L)dPx`4x  l0-L*45 |Pcr& HF8fp'HTaZc! a3'l+\?#DLhP\A sL ~X|p@@44^,TF|=$T$84D|\TG|kԖ<yԪHa_-X0(8_>t) `u%2T<̅4DXMh[|ex nLpzv T\; xx\4D$i \ b|_60(V 4CQ XSp_Xn,#ec%_UpMT8V ıXX< dk,,o )1RcA XMX[Xlh4$xt8$ l\c=p& $r0X Ha_H&4\>HTLSc`pVtT},LpTbbHH P*|l$SP"7S<HbXbd|t(}O T@,laTD7`\ @@ ` dd8ha$39 O^lp3OPhLJx@9l@0_td0 / T( @#Xa0̷0:X H UȕalX@l <" 2LGH  bn$T8#7_ T؄_^{eD7$u,\~lT@s |_ HqDX_T8\DP (<\KW d|w~ pxX\,H]c( l v |a()W3 9<?gaDcQc`yhul%4 Vt 8u,X0gaHL(Y_TI|$@ V(4d `EbT_@8p b}MP/0D|O> 1p$a,q_03] DB8P(}\]t_<jhuljPx$\Z da 744.0!)t8\9 DF_\WDn#\(xVXa_,t@wx t_d  `y(,4h>PLP]qd_x,!4TL lPa`P |x 7 B*3, `B|6 TO [8 Pnldl@-(TR0G|`UdP&R((s6vC< JCSd_ m> {Zh4L$T` 7= ,\\<30FHOAtW_g: Hu,|FdeLcP h(b`y Ѕa DG |F)d `:lKF$rWDb^paeTnH"<(FL$ FxFȽ9 D L$z, 81D7K43[o+x0HR\T@d(< \ \< HxHXT E2GpR |^pPmt- }$\W$4~ \ b ,,H4ȝ t DO!Tc249tCOV Tc^4Rlt u D(`]/TT@(tFt^c  Xnt |-P <7ZcHV,_<eHx|ap@[_l[_8+<>0taȼx3U><4OT<]_eYol <{xcXL\bha`d0-@f_ ( $#0 ,&H, r 86 G4D 8fU ^  `g L   1  c 7X l    X ) ! P!c+!x&&,&>>&4J&d $X&,Ef&Tq q&`a|&$\L&H# &&$d&t&5x&,&\&7T'L@ '$ 'F+'P)D'L U'Lg'Ğs'(Lz'l H'w' 'PL','h'a' 'L' 'X((D@)(7(aLH(H](|hs(b |(x6(`bd(_( (\(l ((d(X (\M (/,)}\)(t )*))8)F)x`P)P\)|= e)`1p)\~))$)D)[_)) P)ē|)|H))m)H *0*]*!+*x@*h6XU*c*#m*$|** $*(v d*d0*l*6*8R*)**+ܖ+I@+s'+X_4+(<+0PE+^+nk+X}+ +  +a+ +Р(++E+,+,U,$,\|<3,<,ԫ`J,0 R,$_,z,,\F,x,л ,,,(@,ܗ,Ml,|_(-^c  -N-iT-LH1-,:--I-cR-aY-<j- v-$ua-^c--2$-|?$-O-" |-a-a--` .,C....>.G.Dq \.8l.$s. <.|c.H8.@ .Td.l3 .`$..C.\R/,/L{/>h+/ Rc8; ^c G;Y;r;>d;@t;P;<;j@;X;( ;H;4i|<{`<XC&<Tc:<GM<_<T k<̀v<|<Dc<\<|p<` T<a<0<9p<|<<<= lt=ha%=|cx1=.G= U\T=,bh=-w===X%P==da=]=$=HP=<>,F>a>`!L%>(4>laB>HO>P]>pae>H|u>| >h |>,>6>G> B l>,>e>i>\ED?-? !?xa$-?M?T5_?xp?q~?X_?_?Y?,?(?H?4:$?a?q?_?@B@L6+@p@5@G`=@K@Y@ac@@s@@ X@h0X@@W$@@\@D X@@ d@ ARdA ,&ApZ /ALbl8AI DAxHPAZA9$kAr,A(A|@Ah A AAbhAf 8A\PB8 L BddBL$*B% 6BCB dSB$ZBF8iBP ,xB5$BvB@B4(BB<=B|rB TC>C $C4* /C h>C@OC_aCLhC,M`pCC_cC8$C(lC4bC08CCdaC` dC0 'Ch T DX0D(D_0DAD[_MD[DhDDf_rD yD Dt DdDD/HDd DoD|DV$EOcE $E1E6TGEHSE0hE@1sE|EXEEU@ELpEEEt EDEt& E4EE|aFiaFf_F\~\,Fķ H:FD[DFlQF$^FثhFTzFXF cF\a(FLFdFF04F4y@FP\F GG|G0pD,GXBG RG<heGYtG}G. |GTc8Gt<(G<GX`G(<G,Gp H H"HH# 2H؉ =H&RHC [H&gH0b{HfHa HH,HԄaHH@H\m@H`<HIpI_  I$*I86IWJIV\I\QHcIoI@wI "I`IXa_I$IItIdIBlI` IX_J %J80JܳDJ\N xNJ}0]J@CiJsJTJhJJ$8J`LJJ؛JXxJpJpJTJD KpKlt!K^c?KMIKTe\K iKvKcK9KK8_<KK