ELFa(46`4 ( AA``@ >D<  B00 RHР -LT S`V` c`^`main() returnedc   ),@@(LQ 0/,`|c -0L MR0 40 @, *0"Sp! "00# 0T!oR 0PS 0 $0S`F!0S 0 $*0Xb0 R2p'0S  0T!oR 0PSv 0 $0S`F!0S^ 0 $0SL "00# 0T!oR< 0PS1 0 $0S`F!0S 0 $ 0 R2h)p'0X0S]J082p'0S  0T!oR 0PS 0 $0S`F!0S 0 $0S "00# 0T!oR 0PS 0 $0S`F!0S 0 $082p'XZ0Sh  0T!oRZ 0PSO 0 $0S`F!0S7 0 $0(S"R$ 0 $0S "00# 0T!oR 0PS 0 $0S`F!0S 0 $XZ0  0b, 0Რ qR  0T!oR 0PS 0 $0S`F!0S 0 $0S "00# 0T!oRp 0PSe 0 $0S`F!0SM 0 $0S<  0T!oR. 0PS# 0 $0S`F!0S 0 $40Y:0 ,0 ,r? 0\0 ,0 ,Y?2 0'\~0 ,k0 ,T??a 0\:0 ,!0 , &?2 0'\0 ,0 ,0 ,? 0\0 ,|0 ,e>r2 0'\J0 ,70 , >- 0\0 ,0 ,>2 0'\0 ,0 ,> 0\n0 ,R0 ,;>H2 0'\ 00 -LMP 0* Qp  / 0p@ 0TGT`P0 T@ 0TPp0 T p-LMP@.. 4\8` #8$ 0 p Xp -LM0@!#P  0 (  -LMP@^ p0`  h   p-LM@P U!! `  U 0 Rp 00p -LMP@\ p0  hp  -LM@`<6V #Xp V * 0 RP: 0Q@-@%Qʔ000SS !0Q  k\`!0Q <\00000d -LM`,0KPp0 0PA, $@00K=;0 0P&40K 0(0PT4 (pA Ƞ,Ƞ4 08 X4 ( T  , Z Y4(0 80 4X0 $40, T, $@(, 0T, 40T, $P ,0T `Z -L Mp`, 0 P1<@T  0R PU0 R X 0Z0R0S 400000 R Z$0X 0S ]P0S,0S 0S0@ , KP -PLM,8  Z09c`<0 p10@ 0@@  0 @4@0@0xP 1U] |忽$0( 0$0R$ ( $0(0(0(P(00 T0 $@  0 tT0 $pJ0 W p 0 T0 $ 0T0 $08 R <0R~倻a 0-LM@0 0 0PP$G0 $Q0=;0 0P .0 00(P" R 0)(09 PX QT00P 00< $(,0  R<0Z480 ܷ,fpfT -LM -LM`@]pW0 P  @0h04p @d0T\XT 4K0 , (P 廣rPP  aa agggS -SLMp`@P P0  F0@(K 0( 0,`Ύ0 0 aaaaP0 R D0 R80 P $00sQaa aa p-LM P\@` d0T X0T L0T D0T pp 00儚PEWFW@@W@DW@ -Lh\   -LMP$`Pp )  Dq$0@S00 "$0S0` 0,@ 0 q 0  @ 00(@ q 0-$@P(0,P(0(0x T$ L B$  R $0S|r,0S0,00 ur(0 qra| p-LM00`QPP440Q@@S  j8@4Pp80S 0-L,, Q@ \S0lP8 d0`@ 0՛כ#0 -LM\`pVe ,PV[ U@ 0  @  0 H00S =08@U@ @ 0T P 0TD@0 TP@ 0T@@0 T 0@  0 x00,`0 `0S\d $d `阸 -QL M`pP R 0S,S0 0S,SS000 P@ ( 0S(0S  R0 S0S5 Q'X#<Z pP`  $8@@ <  <`4`  <0 S X宺괸 -RL Mp`' 0 S ! P @ 0TD@0 TP @ 0T@@0 TP0 0 僀00 @, 0P, ,  b )00, @b   @T0h@T,0@@  @-,@Q p000000000000 ,0, 00  0 00  -LMpP 0 P`@,  I 0U40 0 \ 4  u < ^ %@,P @ 0TD`@0 T,@P` 0TPP0 T8@B08 @0 o-\ \  00R 0 0 -LM0P ^p@ 0K  `4\ $0K^$0 0;00` -LM@ \p P`, 0`i -LŸ00`000@Pp0 T 0TUt 0 T0 $P@ 0T@0 T@0 T $0<<Pz7 0T@0 T 0T@0 TlA0 0C\ 0  "!80 00 $1C&  0 "!0 0 Rm30 T0 $P@ 0T@ @0 T @0 T $0 Pܹcc'cc0 -L,  -LMPp@0 T0 TP` 0T0 TP 0T0 TP 0T0 TP0 T0 TP0 T0 TP0 T0 T p-LM@ 0TP 0T 0TP 0T 0TP 0T 0TP 0T 0TP 0T 0TP 0TP`U 0P PT0 Tp -LMp"4 d,0 0@T0偖00 P@0, \8 @T008p僂 0  @TT080, 0\0 80 \4 @ 00C\ 0  "!p0 00 \0C& T 0 "!00 0 Row2ܹcccc0 p-X0LM@PH`0 PT0 Tp`h -Pp @L` 0T@D@0 T 0P 0T@D@0 TP @ 0T@D@0 TP @ 0T@D@0 T$0P! 0 $ 0T@0 T0 $ 0T0 $ 0T@0 T0 $ -L M0 ||!\, 40 p@M ,*0ST1  , *W8E0E@(1 0S:P`劀0S0 0 0P.U@ PU*00 ,*00" 4 x0\ \0@D P gp00 k Pꐐ -1L M! 14 10 1 @00dS1 0 , X1q , 0 X1!R,00 )  kP,00  P0S0 0P` V [0@ 0l@, 0 04 0@ 00C\ 0  "!0 00 p0C& h 0 "!0D 0 R 0cܹccc0 - L 0$ 0 $ -LM  0@ 0 0T p-LMH$,$HP0`@ 0p p-QLM0@`  `N pQP* 0 P(U:p p-QLM0@`  `a pQP* 0PXU:p p-QLM0@`  `\ pQP* 0P\U:p p-QLM0@`  ` pQP* 0 P,U:p -QLM@0  -QLM@ ޴  -(L  -(L  0-" _  P0L @ 00h p-LM@ 3P` 0300PY YR` cUpp p-LMP@`V0 pd2p0H@ 0S' 000K  c 0H@ 0?' p-LM@` P2?XP 0s UP(0Sp(00PS 0U 0 0 20P 0UPp -LM0S.||#0p#0lC0 0 0C\ 0  "!00 00 3C&  0 "!0"0 R0S 00 7 420p`%`K% [)0S ) %0K  20@P&PK& [)0S ) &0K 0VS UR Z  p Z7-0pWp12gZ'1,@0pW 00P7 0000S 00  000 1000 0`P`PDH$ ,0K$H ,K+K*@K12g1, VU000J.Mܹcctcc0 0- @LP0 00KP0P0C& R 00#!t000 `0C& X 0 "!04 0 R0 .cܹccc0 -2LM PR|2   Jh0S`2`h0 0SL200l0S 2 2   1B^h 4$` ,p@dP,` 000S2022/`VOھ21  p,@`0,K  `VOZ`@0S2`VZ|00,0K,pK!0(@ *pK+KdV 00< ZBP202[202" P2$00$0h0 ``忧000,P w_pILtj,9,a p-LM4@PU @$ `00  $ 0!2c1,0  0!2c16`,pXP $ - PLp0@ 0`00p0p0C& R@ 00#!t000 `0C& X 0 "!04 0 R,cܹccc0 0- @P0L00P0P0C& R 00#!p000 \0C& T 0 "!00 0 R00h,cܹccc0 p-LM$ P0S 0 $p4 `  0DPT0T $0 0$0 0$0 0P$00$0p -LM8@6@ 00S<"Z -0@S0L00ph 0PP00P=WP`U L    (  tj4HT` 0-L@LP5 a/0( Y/0( 0hP/' -0LM@p @/00 ` //00 PZpd3 <# R/00Wڀ0?3S -1LMp@+p`0((0) %0K%[R%0K P )U d0 S pW.0++'0K 'K$0 0((0) &0K&[R &0KP ) -`0VLpP@ 0DPT dT0`0 .0V D0PT -!圁LMp0P00$`V" 4 $0Q TX0LH1H<4$0 3000$  $  0@p00C\ 0  "!0 00 0C&  0 "!0 0 Ri*@0D PT$0 0$08cܹcK,ltcc0 -#LM08 ,0 p0 P 4 )3RR 0 A= 0 0   h3 ,0S \,0S 00g 0S@0 ŕ0őSS000@0000&2R& $ ` @0S6`V@DZX 0@00  00 `~0S6V`VZ6 `0S61`VZ0S0 00S000 @0 00   p pR00B"0P0 00    ,  R00 0B$`000 0 @0S   60S0 ` 00`(1 ^?P0 0  0 S   50S0`00`0 C?P0 VE00@p x0 2?Pk40Sh@@j0H 00OK >,P000/ bp -08`P@L p0 T P0 0@e0 -08`P@L p0 T P0  0@e0 p-LM`P@2PUOp 0 @|PP00 `0 0TF2 <?20;1$723ĹԹH  p-LM@8P@`4  00 00S p  0S > S 00p000 d`p 0 00  (000C0  P -LM0P10#0@8|PZ 0ha0 0000 H1 ,0<11p  $00$0 R 0$ 0 00  0@ 嶢p00C& R 00#!000 l0C& d 0 "!0@ 0 Rh%\ܹccacc0 -LM4@0S @440S -L M$X @R0  l0@ $@嘪 h钪ܺ - L  - L6`P@w0 0Q0p0P0`0C& R@P 00#!x000 d0C& \ 0 "!08 0 Rf%aܹcccc0 p-0LM 0@00 `R0P00 00C& R 00#!|000 h0C& ` 0 "!0< 0 Rph` %cܹccc0 0-0 L@ 0T00 0P @TP 00C\ 0  "!x0 00 d0C& \ 0 "!08 0 R0$caܹccc0 -L M`P@P 0T,A/00P T,10T $,0200 TD2 N,10W $5,0 0T,A08 0T,QP!00` T,0b 0T,A0c 0T,10 $  p,/00 T$,10W $,000W T,0 0T,A0 0T,0 0T,10 $GU} -LM@(0SIDX 0S p0S`/ 0800!PU ”(0S0 . X0S& 0 `0 @0(00C0 hԦ0 0”(0S 0 00(0 0 <(V p-LM`ROPPU@Zp -LMD1PS`V 0  ;0 $,10PQ $,10@d $`P@ 0 ʤ,10< $,10` $,10P> $,10= @$@BR,1@0e $`P 0 嘤,10 $,10p $,10` $,10P $,10@ $p`P 0 @( j,10 $,10@ $@   W,10 $ M,1` 0$ CG&, ? "0: 0T Si |S S,10 $ D2 d ,10 $U,10 $0,<<00 TH,0 $0d["@T,10 $,000 TTQ ߣ,10 $8@T ˜(0S 0,00[ "4 0 `0 @0(,10 $",10 $,Q@@0? 0T,00 TS40 [80啣,10 $8@T ˜(0S Dp0C!A 1SAB0 ?0  0 `0 @0(,10 $,1@0? $8@AP`U ˜(0Su@ 1V @T0 K;1 l40 B;,00< $@$<%< 40 ,!40S @TO: 0 0   ,0,D2 L2u ,10 $,APP00 T,0 0T,A00 TW,10 $,0000 T,10 $,0000 T,!00,, 忢40@T: 0 `0 @0(hS S ,10 $,10@Q $81@ 0 哢$宠S劢,10= $,1`0> $,1P0Q $,1@0d $`P@ 0 d,10< $,1P0 $,1`0> $,1= @0$@B,1p0e $,1@0d $P` 0 @h*,10 $,1`0 $,1p0 $,1P0 $,1@0 $`pP @0 p,10 $,1@0 $@ , TH\@dx($X|0T@KLCD0ġ/,10? $,10@ R$@ 0 [80謡s,0Q 0T,10 $8P1`V ˜ P(0S @ 0  ,0,P0 X 0S SXx"SD08 1術1  ,H ,P81$0 b!1317!10A0  0H0 R0 ? R2000 $(0Sk #>#[ 000 @  00 0000˜(0S%0 04 0,@00Q T0|0 2h 3 3,!Gsh =81 $, b!1317! b00" 0(˜(0S (0  $0 (˜(0S 81 $0 (H0 W _4  cP @0()D TҞ -LMD2`A p,10 $PD2U &,10 $8@1@T –(0ST ,10< $D2  j @/ ,10 $  0 c,0 0T,1 0$,0 020T,10 $,A000 T, 00T,10? $,10= $,1@0> $D"p00 #RAp ApBp@|K  0p@$ZF X@ 0 0@ @8 0@ @?0@pPp1Z PUZ |Kf,10b $,1@0c $@D1 џ,0 0Tğ 0 P  2(0 Q000 0 70`8\\(\  0k 0 P  0 P   |K0p@7|K  0 P  |0p1! ,0 00 0 P |K 0@ 0 PA  |K 0 @,00T6,10 $,A000 T,0 0T,A00 T,10@ $, p0 0T,10 $8@1PU –(0SU `PK .0@,@k5 j 0d  0 `0 @0(,10? $,10 p $,10 P $,@@0 0@ T,10 $`U@ULt 1\  R! 0XP@ 0 @w :0,10 $T 4 D2  PU 2S3   D@K5,0 0T,10 $  ,/00 T,00: T,10c $,1@0b $ @0D  0>D2  0  h2)x&p#h 0 -60,10= $D2p00C2  t   Y ,10 $,00#00 T  ,10 $1@!@ ,0 0TT@@   0 `0 @0(BƝN,10 $,00#00 T,10 $AZPAB,10 $p,10 $D2BD2 (XdHPp~ܻ<\Bļ -LM 0!00< -d2LSP `p,10b $,1@0c $d•@ Q`" *0S*0S* Q : Q` }WxVp% D2 ,/00 T,0 $0,0 0T,A0 0T,10 $,@00 T,10 $D2  ,,0000 T,0 0T 0,A00` T`V,00  T,A00 T8 ,00` TŜ} -LM,@00 T,10 $,0p0 T,10 $,0 0T,10 $ - BR0 01AB01LS S+ -RPp T /ڰ,ث|0A_L P@` ̫ ȫ`V@PZ0q/㽫 krs2 -LM`DP@p!W 0   0S00\3Q 0Q%05  0i,10 $000,10 $0 0@-D@ 0000 00#0P00S 0S( D”  P\ 0S 0R 0SR 0S D2 0S 0000P00000 xl0D pR  \ 0S  Q 0S0p0QxR D2 0S  0R !Q 0S0 0S0  R  D200Q0R  0S0 0@- PU#>@'  0R # 000#>T0 0R 0P 0QU # 00PRQ D200000 -LM  R  `Y,0 4 , 0 p0 1術  \,  00,   0  5 ,SR Q. D24 M Y@ 0 @@@@0P/@,  0̠0 @0@|)X `\ 0 Lؚ 0\4 r ƚ,00 TD2 ,00 T 0Y00@ 0 0 000 p0@@00S ,10 $@0 ,0 000 Td42 -L M  衜1p\P`  0 `R00S 0V00P0` 0̠@@(0 6TL 0y,00 T` p-L M@PK` %(0 ̠P(p -L M@QpU`3 @K M@014 3[1   p   @0 #.[ @@   B( R PUW,10 $q ,10 $8<2p W,00 TZ,10 $ ,/00 T,00 T,10 $8PpU' B@0( R'U  ,10P$ ,A0 000 T,00 T,A00 T81 Wđ  l ( ,00 T,10 $ D2y ,10 $r8  n(Y2MU -L M01,@p $D2,,1,100  $,10= `$,1P0> $Dp00#"A AB0D2  ,10< $,10 D2$ HR10QP:p-B\ 00  0020 -LM@ 0 @ʘ 0-LM0 D p0 CBPP0,BA ? 1SAࠣB࠳ 0P0 -LMD2@   ,00 T,10$ p-0LM220@P`3  / 000 0Dr,10 $,000 T,10 $,000 T 0000"2p,10: $P( 0  0 22  0022/ /02 ;00 1 "' A0” @? 0?"0  0?#   0? "`0 P,10: $0 0dH8 -LM0 1` \ 0$0 \, 0$ K(0 0(0 (0Kt 0, SQ< (0 @S@  0^S  D2pW@T  0T,0  ,0KpT ($ ,0M$ ,0  & $0RA-@p`@SPE όOop MPrP 0 Ѝp@-Pb@00όOP`0M0bR ЍpG-M@P`pSό@PE `pO_o 080ࡏ0< 塯 0園2Ѝ -LM0,222@ 0$ @0,00: T,10W $,000W T,0T -L M@K@,10 $8PU ”(0S,10< $,1p0 $,10? $`PhV`  0@,0F 0 .喖00UPPU A 0A 兖,10 $,000 T,0: 0TV 0 y.0<0 o` ? b,10 $0 Z.0 U.BFed:_P3` 0 `0 @0(jp @h -L M8pKP,10 $@20CSl"RHe T T ,0 @0T5 ",0Q 0T40S.Q% 0BQ ,A0 0T•,A /00… T,0Q 0T,0 @0T2",0 @0T,A0 0T,0 0T廓`T`V 0T23 R 2S 2S02v,10 B$@)NP2@02 2bST| ,0 0T,10 $,0 $0,0#20# 0`$,000 T,10 B$@)NP@p 2P02 V;,10 $,0000 }2pSr ,00 T,10 $,0000 T02r52S8^ ,10 $ 2S "2R ,10 $,A0000 ,10 $,000 T, "00T,A020 $,1@0 $,0000 ~E-bPU@p*?0^ 0CSW^ UP:2SPH0H 0SWZ 2SP2SP -L\M 0!Qp00).`@L@ #Ps4d444tt\ltttttttttttttttttttttttttt4@Y00T00S02P50S`0 US ? @"4 RP/ 4P @0 P, K00K, @4 P@  40KPS40` ,0 ` 06P@ 40P R`0L0 @L0S , 40]B`` R3 RP3x#P00#h#h0 P00S 0H H0 0DP D0 H0\D @ < \ X0 0< K@ KD0KR@< H0K@` 0P( <\  RH0X R 0L <0 D0 @0 H0 @0@HD @0 @*D0U0@S  0  0R<DP@ H0BBP<Bp1T ZPX!0@8 K8@  ` 0P1 8T 0P8 0PLT \00 @6@BB1B 0T0 L 80 T8 ††T "T @ L @h -LM01,P $80Z,0  •(0S0 1,A 0S |$ 0 P@ 0@00 @BB0,0 B, 0P`  0`㌒ 0` 0S BB,`  0P@| 0 `q Vb LŸHB"V 0 @4@a &@,10 $,0000 T0: ,0TL201H!RR H!00000<00 04 D"p0C!A  1SA B 0@?0 @U k 0 #@ 0 W 0 `` 0H 0 `0 @0(T -LM,10` $8pW –(0S,10< $   0; S ,10 $ ,10 $,10 $,@0 $,000 @D$,000 H$,1P0 $,0@ $,000 @D$,000 H$,10 $,0 $,10 $,0 $0,0l0 Q$ 4R*A 0`$0,00 T,A(400 T,Q(800 T,0(< T,A00 T,*400 T,A*800 T,0*< T,10 $ 0,0#00 T/ 0 `0 @0( -LM,10` $8PU –(0S,10 $,@0 $,000 LH$,000 D$00 00,0b,P000 P$,@0 $,0@00 HD$E0 L4 phP,'<0 T,A'800 T,Q'400 T,00 T,A(0 0T,Q(4p0 0T,P00 TD2 ,0 0 T,A00 T,00 T,10 $,@@00 T,Q000 T,00 T 0 `0 @0(8 -LM` P 0PP p@ 0@Z0 @pp@U0  pb0 S00Z00S  0序 0-@2   ?L@  ?8Ql0U E 0TEPE. 8 ,10$?U p-LM@2P< S a@T PhBl2l2l"hBPl202phB0l2 PD2  `@T  0S hBT 0R0SL27L2L"'00L2L" 0L2ꨐ(0 P PhPᨐ 0-@PPLR0E p-LM2`S *:@PP@EPUZP PPphEEE2$"2X"8–" 0 0-PL , 00T,A0 0T,0 0T @, 00@TYT0 -`"L,A00  T,10 $ D2@20Sv ,10 $X",0@00 TpO @T [ ,10$ ,!00 T,10 $@2  Q= 6Q gD2,00 TX,10 $,Q@000 T,00  T,Q@00 TQD20D2D20(,10 $,@000 T,10 $,@P00 Th,10 $\U8h -L`p,AP0 0T,00 T,1 0$P 0,0T,10 $pW -!81PL` p@pVL,,0B 00B 0T,A0F00 T,0 0T,00 @TT6,00 TL2# ,`00 T,0 0T,A0 0T,0 0T8`0 VL,0 0T`, 00@TTM -LM8qH B P_ ! ᮜApA81 RO ˇ"bAAN@P@ P`<P6ˇ  "bB>CNC 0@]@ P`"P 00 0 -nP@g0T SS8 R00 0@e 0 P@8L2P8 e0 m*8| 0ep !H L–0X  `AD 감d,4@rHPXMxs -LM,p0< 0T,AW 00TD"L2#5P ',00 T,10Z $/.08,000 TD2b,0 0T,A0 0TP2@TL2 `@@K?TPUP X2 PU—\(0S+P \2 PUD2 81,d00D T,A&400E T,Q&800F T,&<0G Tb,A00H T,&400I T,Q&800J T,A0&O_@ PpPhO2D"02 2X?*0X"2x x22`V x2:X2X2"< \284" R P(4A P D2 |4B P ,0< 0T,A0W 0T448 RL2L255ÃL2D2,10Z $@L˜ L˜ @0L2 0 L2D˜  0@00   9  0 00•(0S@1S 0@! 00-@a 0 0L2D2p0C!00R/0`0<0H!Ri 0@*X0 0C\ 0  "!p0 00 \8C& T 0 "!00(0 R}P-0 7G0 0C\ 0  "!0 00 7C&  0 "!0d'0 RJ0  , u0; 0  811`&,00 T,10 $ D2nL2b ,00S T,10 $ I 0p 0  /0S* & F0 0C\ 0  "!0 00 5C&  0 "!0%0 RD@KM  H0@@6 00?@,/00 T ,00 T,10 $<1@ @p0 81$# p0  <00@ 811`Qe  Rc 0PD?00 $0 0<<00 \2•(0SB000( R0D2@' ,#00L TD2OF#,00 T,10 $ D2 ,10 $,00 ~81 0 `0 @0( 0 0,0(• "r2 2hBa9TQ81  $0 (;Wm81 1   81 Ÿ  81`1 @000L2 9L2Qh@T@00C\ 0  "!0 00 1C&  0 "!0\!0 R)(! 00C\ 0  "!0 00 0C&  0 "!0 0 R2 $(0  $0 (g  $0 (W00 p0p_ܹcc26cc0LUWĿMb 0-@QLP ,10 $@T :s0T 0X -LM0X(,0@ P R` R ↇ000$^ 0– 0P  0P0Po s 00081 1PPP81  81@P 000L2 9L2dChWSP00C\ 0  "!(0 00 3C&  0 "!0"0 R(00C\ 0  "!0 00 2C& x 0 "!0T"0 R ( ,\ W oԁ 00081 181  81@p 000L2 9L2hAhRp00C\ 0  "!,0 00 1C&  0 "!0 0 R/0 0C\ 0  "!0 00 0C& | 0 "!0X 0 R0@00,@53ܹcccc0 -LMa0!@ 00P00!,00 T,10 $ D2X0  D2Ap 0!RApBp 0,0@AT 0Sh@ @T ,10 $ ( @00C\ 0  "!0 00 0C&  0 "!0| 0 R,/00 TR,10 $ܹccUcc008R 00 R Ѽ0006 -L⸢DM 2X  @DK  `D01Q 8 ?O[r1   0#[000  0H H K0H @R H0 0@0T@ L0 L@ T H0SP P0 ? [ 1 P0P LKP K0@HPT0K @^T^P PL \ 0S0ȅ0ȅPT L0@  @X0@0X 00C\ 0  "!0 00 0C& | 0 "!0X 0 R<0[  000xܹcc6cc0 0-!LM0@: L2 _”(0Sc1X QPT BU<  t2}S@2t";0t20,10 $@t20t2 D2 0,10 $Z0D2,0 0T,10 $),10 $P$0 0 (UV -L,ML2`0,  0H0 P 00L < D @ Pr80 03K03K03K02KPK02K02KPP '> ".B 0PU80S080 U,0 0T,10 $APA ,0 0T,A0 0TU' pD2  R U 0 200f" 0,1 0$  L2P30L2<&pPR,10 $DP,10 $PP,10 $TPTp ,1Pp 0$,1qP@0 $@T0D@YT0  PL2P3L2PPc g -LM2&P`, Y p 0 p@L29L2 Wp W1@ 87#,00,0 L2  @0 8#0S D2| 0,00p 0T0   0 , 00 pT W$0!000L"@<#4L2" @@@@<L2"L27L2D2 L2 203 S%S( ,00Z T, ,A0002 T, ,Q"4003 T,00 0 T,A)4001 T2@ "20@ 0"  0 8 #q2gr -L,M0L0 00PSp` @0  0TD"D"  J, 0 4 8 s i @KD K<0KH@ D"0H0 L2@ @@W@\T HPO DQA Q P 00S @0L0 00S,0S L 0 000L0 040 S000,00T80SL 00L0 LU0S 0 T1 \0nD"@@ H@ D@ DH `BR` 0-@2L0SP D2 00,0 T,10 $,0 $,@0 0T@0'> 0BR 0 0 Q\ # 8#8SR0SS00000 R0 0  0S Q0000S0 -L M8`,0K(pKP00*p` ` ,@T D=.8  ,  4@T <08@0 0`  @TP = 8<D P@ TkH| -3bLM@1`p{WHPfPy  p!0W@O k -1aLp P @ @H0H S1H0yyH@1S!( @p00C& R 00#!x000 d0C& \ 0 "!08 0 Rh~Fcܹccc001 p-L M8`@1~0 0 02  P@ U 7kpp -010LM ` PHpH@0T .@xDP0 0C\ 0  "!0 00 0C&  0 "!0l 0 RQ1101!101cܹccc0 0-1@h0PL 0K01P 0yτ1@0ho -PPLU` p1Ah0f`P h@\111T01 0 PPUJ X0 BaJ1h@01 $JhJJoMbp -L,Ma@pTP 80K4K0* H0,P Q008 ` H04P @ :H<0K0 0 P@ <H0P 6j<H 8  0 p#jH 8  0@8j  0  jؒ D p-LMP40%TPZ 1QR H`$L!0S00ŇxS H (180fP00piT T ii`i0SXfLff`fhffpffffxfffffffffhi`\XT4$i0gq,P\p 0-L@S0PHPS,ggggg 0  % '|@7HPPPPMPU  0D R\ R 0LH X00hAPPi0hMi$ Ȓ@h|<01 S1:<0q# -LM `p0@ 008 0, 0Wq S0  4 Z) U@00C\ 0  "!0 00 |5C& t 0 "!0P%0 R p0 0PP ट@00C\ 0  "!0 00 4C&  0 "!0l$0 Rq01, f'xQ01 04 01g/04m/010<D0, 0c q/ k?!O000 O/Q #34c0c8"  3 $\HH3@ 000@0@0C\ 0  "!0 00 2C&  0 "!2  Q0!P!P [000 0 0,P@4,(0S 0   $0  (f/w!(0T0,  100 @ !(0Pp(0h!00QsP 2 44@g,@E#Z `@00C\ 0  "!0 00 x0C& p 0 "!0L 0 R0p00 ܹcccc0 -LM@WP[ p-RLM@`Pp0@Tp -!L 0@0PDsg@a@!p0400!6 fga0s 1 !( @p00C& R 00#!000 0C&  0 "!0 0 RhTY0gU`0,0!}> 1!<ܹccHHcc0 0-0@LP  0 0 101DP0P0C& R 00#!p000 \0C& T 0 "!00 0 R00hcܹccc0 -LM`8@Qhp:G$0S (0S    $0 ($16 0S $S 0,0000i 0S0(0,00 R 0S $00bS WaS 0S0Sq4 z0xfi`P 0S P0S -PLM0`p F4SX 5SO 4S 5STiKf$ P <iCf01% 5$=fŕ!0?0c0@lT0`@0y$5  S00 00@O.0@R>0 60H40tplxPd L`0aiDF   gfff| p-LMb0P  B  0  0 }5$5 SKvdv@v@v@v v v@v@vLw  0 0 (5 0(50 (5 0(50  0 0 0 0 $5S p 0 }e 0  0(5~ 0(50@ 00   0 @ 0 0 0 ,J/Hem Ce]ܒ' 0-P0LL3eH0@  < 80@ 00!e$ܒo -"LM0`, B^ O.@T 00"@\@  0,0  T% 3Z p\ pp0 , @P\  p0,PU@ZpZ Y 1Y44 0\3 ,5S\9! p1    0Y@,0S O. 00! !00 $P P o d O> o00@@yt0T 0Y@ d0 \LY00WO> 4adNܒ,' <`^`L -LM0` PpT#00  4 O> 0 7\7,7/@#b  kD$5 S  00 0@( p&?@Bcdv(P@@k 2Wi$5SS_ V0   00v (5] @(0K#/ŅQ0Q. 00, [+ [0@+$5 S( P0 P%00 %0  5>  0 0$c$c0* [$5 S0 $5 S@ /Pğ0 A L4 00A4$xcIpQ@ (5p@0p@W 0@ =#=,,0J00(5#10T00Sk (0K#QŅQ.0 00, [+ [0@>$5 S; ß0 ` 1C00 W "0 @00  90 0c"c0 =00 P/c</b0* [$5 S0  CT !0 C WC!bb0W !0 @00T1  F >LFh!b$0 B 3 B@!b4 @0 0 0 =<.#=<0G 0 0D@$50  0  0 bh bL @ ?AcNIJ@/0X0 @tb2ܒ@BMb`rl 0- @P0 00L ZP0P0C& R 00#!t000 `0C& X 0 "!04 0 R00hKcܹc`^`cc0 p-,1LM Ra 1@ 0 00X@0@0C& RP 00#!000 0C&  0 "!0t 0 RUL  q DB 0 0 0p bܹc`^`ccc0( -LMs `0@0P0U3p :P`u P@m 0 0] 0 0 0D @ S 3H `00000 @@ 0O.0 00S= r`00C\ 0  "!0 00 t2C& l 0 "!0H"0 R P P i  /u0@0 < $0D0 P` |)qx1T 0L1  000 R  0 00U` 0'A00C\ 0  "!0 00 0C&  0 "!0 0 RD BT1 `T21 P2-0 @0` 4`0ܒܹcccc0p%b -pL0@`P#U0P0O> R PU08 ` `ܒ -L M, t0, O>Q,0ԀXn , 0p3`0 0  @ 00  ! 0 3 00W01 P/PP 30 Q   R R8 0S0  0S0 - 4<#0 0C\ 0 !3 0"C600" 00#!2  QX50QI \u P!0 S P P] 0  0J "0 0C\ 0 !1 0!C600! 00#!1  Q+ R 0S0000P0R00S(0 4_Q,0000 , 00 0, ܀oO 0S Pږ 0S CPP |o0O R  0 00WP 01 P8v_0]ܒܹccp%bcc0 -LMP1 `@ #p/PⴠFMo / 0 20 4 < 0/@0D  0Z00 1 P /0PS0000@0T 0 S00@@@ 0 0 0O.0S ozo _ܒ8 -LM@P `p0ᴠ3Z 1 P /}!0i\?H0(S\ ,0S H0X0 0@0E 0,0000\1  (Q6,Q488^N0U ,0S  ]000o0SPZ 1  R 0 0 0 DO0 S 00p^H0>0SD0(0D0(0o%00C0 $^,^ܒL\h -0p L@0P3U`" 0S000I0S J0 R0 0C 0 0 0R 00000 0 T1 0S 0-@P0Lp d d`0@@ 4SS 00h ^^0ܒ -LMQ@u Q%5p\0$5` S- PU 5@a %0 ,1X((]0 5PU:]5]5PU:0PU`PU0  0  0Pu0PU[ܒȻ  -@L0Pp`% @T]@T 0$%@ R  T0,@u]To]0ܒ  -L M@$ P84Pp $4  `0@r@pP3U`1 P P  R 0S  X O>   1Y  O> ܐ 0 P(` p8#?@Rceo(PP`Pl 2Wj$PP` W 00  0& R0 2  0hh0 @0 0 < $D0484"\, "\0@ Q0 1  00 @0 !\ !\0 0 0EP$@a0 P\0 1  0 0@ 00 M \  z\0P s\0 x0  0\\ 0@ 00 &<P X\0< S\0Mbܒhj0w|s -L M~0`5S& $R O>0S x+\t 0%000L^LN0 0  4>  0%5o \.\Q20) "=  0@00 0 0 00 t=  0X \-[D L-[D 8-[0O> RŖŖA Q" Q Q0S00Q0  O>0S aSM  [0A :l<  0HX 0 @0 0 << R 0 <  00 ;  0 0%00 +s[ +n[ +i[ +d[05 R l Y[`; 0SܠŖ 03"QrꔠЦ(ԩԩpԩԩԩԩԩԩԩԩԩԩԩԩԩԩԩԩԩԩԩԩԩԩԩ0 4S 0 $ 0D (  O> u0 , a[04 [0 g0Su S# 0  Z0 9  0dt 0 @0 ET )ZT t)Z0 ` Z5 R00 000.0@00 0@(% P(?@Bcdm(%P@@! 2U$5SS   0 0 0 0D@$5'0 0S,0  0 0 0 ,5S 0S |Ys0tG yfZ0 00f0 000Y R,7  00 @0 0 000 0 @5 P'?@Bcdm(%P@@! 2U$5SS   0 0| 0 0D@$5(%,&Z&Y00Ŗ% 0 0 ?@BcRdl P@Rd0l0H Pl@l11!@lY 000,5 RH5 ַ0 ȵS00ȅ0$000 4  ,0 0 @0 0]t$Yt$Y8ğ0 YŖYŖ0 4<0$D `Y0 <04D $8|Y0  000$O>R 0< 0jY0\C 30@Sz S0 03  0 0 @0 l#FY X#AY0SB  S0 ,5Y0 3 ,2@@ 0@00 0Q1 P/I0S J0 R0 0C 0 0I J 0jX"XPX00 4X000   0 0@0 X0 0 1Xp0 : X70  X0 )  tX$ R0QLW0\O> ,X00 S R00R00S 5XqXTܒ,`Mb na,4P`t $<Dlt -LMf0@V0@m 4S 0 bd6  0H6 %5S00 Ɵ0a00 00PR0U1 R Rz 0 @00 45$5 SW 0$0KQ##0, 00( [' [0@)$5 S& 0  U00 4   o000 0$W$W0& [$5 S0 |%0 4  0$W0 00  03   000vR Rk$00n$0$ 0@Ry  R\<0 0[R  RRO> R $$#nW$I00J4 %GĔ0 0P0$P4"405.000 0 P( p\"?@Rcej(PPP! 2W$5SS   0 0 0 0EP$5Ĕ0 0P0$004 O> R (0!V 0<<0!V4S  V0 0  0xp0 @  uX| V80pd V0 0$PV\ܒ~=Mb4, \ -L(MH0`0P 00$ Q 00$0S ^ <040tJ܀@' 0 0 L?@@ O.0SS  0,01-6V.000 P e0 _ = V0 D=  FL>  00 6 >D  0O.00CS5D0,0 P03@P 0S R0S  R 0 0 0 u P00S1  O> -O.00CS񟗶PP(@@ Um܀  O> <R+;, 4 SO> x~PPgP$5Sb54  0WAUH (*0<<00 :;  0O> AR$4@KC2Dh00*0S00 =)C40 -B040 0 0 R<K+< 40R  80S 0 CU$, *;U(5 $5S*0<<0 ,UD0 P@!U U050 0S0Ԁ 0 0 000e0 U0SiX  0Π P 3@Z \080  9 084< O>$D  O>X  Q RDT pT[0@U0. $5 S' 7  8  08    8  0045'T'T<S hH  4 Q n@ 0,|T 0  sTpT T J0@DaT6TT |T0@r kH7  0Ė0,0K P, , 0N. N0D 0< 00, [+ [0@1$5 S. 0 &F00 L5   ,Q%T,0SgoS0  0,%S0* [$5 S0 $SS00@0 04  z85  0(5Z @$0K#/ņQ0Q. 00( [' [0@+$5 S( 0  xD00 <3  o00 004>8T#~S$D#yS0& [$5 S0 @ /0 3  0"TS|"OS/@ JSo0@%$5S 1  2 @Ė0,0K P, , 0N.0 N04!!SS0@L!0000  H2  0DP!SSxQ(l!R  I0SH 4S8 $1Q  000I Rx 0o hX1  0<0 @0-0 04ܒ@B% 8Th |(a W A <7 4 ; % TJ pg O ,f h k ^ ܒ \  @l|b[SQ0|Hd iRX dR00  0  00 @0  05  T5  0H%Q QH QQ%0QO> QE0 X 0 LP 0 0 0#@0 00@6 P 0 PPH1n00D&P&P 0PP4S 0 $7  0(D0 @0 0 }8t'Pt'P00 7  00 @0 'P'~P00pU 0 P*P?O> R; ^ 4S50X@D 0UP(4S& E0P@@@ 0 S00ƷxĖDO.0  @0P0 0 @0@ \ p)P0 0 9@@ hO> R  O0S+  *O 0 O r0bO>X ODd M - 0P@0} 00LU@ O> R h)O> `R 0V 00B#h/  ?Accp0 x0  0\\ 0@ 00 @< O4 ( O0@BMbܒ  -L,M` p0P03~00@ D0H 0 O> @ @ 4P0 0$ x t!ph $(BOX!@000 @- 87O(Q@00C\ 0  "!0 00 0C&  0 "!0 0 Ro, O0,0.0V0 4 TN0 0# ܹcdccc0H  -1圁!L0`000pV_L@P 0SO0SL RI0S> R 0 0 0 TP0`V@@@0 0C\ 0  "!0 00 0C&  0 "!0t 0 Rd00am.00S1 p%bܹcccc0 -LM0@ $%00 R0 00$0S< 004H0H  09N0ܒ -L M@)W   0$`@ $$R 4R:04 0P 0Z0ŸP0 0 0U 0 # P^ 0SL0U0  P\ 0S  0\ S  0^࠱ S `,0K(pK0p0` ` ,PP0 0 ,  :4PP  M00`0   PPd :A PP40, : 0\L||T p-LM` @0T 0T@ 0T 0T@0 T 0T@9 0T@ 0T@A 0TN 0T@O 0TH 0T@H0@0 T$P020J T0 0!0; T0; 0O $@0M T0P l R $0  H@ 0O TM 0T@0O T0 7 %0R $0 p@?#όL 0 0T0G $00G T00" $0 00" T0dM T0 T0k -L M `, 0p 0 P崠0 #̠#3B(0+)*@ [0PS 0 0 < <0 0P0SQR0 RD R9 0@ #@!@"@,0  0S  h\ p(0TP  00h #Ġ##Lh0@0 0, l0"""Ƞl  p(0 PW0 0S0000,  0"0000000000 000 0jP 0S  0 0 S00 00 00 v0 0 l = #=Y -`0 RLᲠp P8 0S ,  ) 0 0 030 0@###Ƞ+)*(0 0T00  @@9 "" ?0 0 030SL S  @ 0 0 @ @0 CK 00S@P Q@R@  0 0 030 0# ##Ƞ+)*(0 0T0 000 S000 0 00 03 -LMP0 R @p  J0  S0PQ0R00S0Pʼ0^0^(`0 J ( 0 0  0`R Z V0 `H P 0 J00 A 030?0`200>0 0?<0040 000`000X 0 T P 0 T 0 T 0hJ 0( `0 `s0S0 0 0 4RJ 0( 0 ](|`D -L M0 p@ 0R , 00 QP X 0Uʸ00CXUP 0\ C Q,0 P 020@ 00 ?@0S @ 0# ##Ƞ+)*(0 0T 0 T0^,0S, P@0U20 0>0ʠ0 010 0 !  0?@?<0 0@0 0X0ʸ0U0U 0?0 \A 0\ Q,000 0PQRS 020010 0?<00 00o0S, P0U20 @0>0ʠ0 010 0 !  0?<0000 000AL|0@- PP @ @ P  0 0,,,,S QRP0-  00   00 ! @0T10  @1 @0Th@1 @0T X@1 @0T X?#/Z?B!P`10d!h1VO VO R0000 0 `XP@$0SPX11@TPU0)(0S0>, \p0 0:(84f 0P80 $ EZ? 00|P@0!Y>!0@\T0  @h @T0|P".@40|!.@0|ug$}h -LDM0P $@T P 4/000K0S@ 0 ,8TpQ# 0,0P*:P$:QW 4 , (0 L0 H 1D 000 X R X RJ0B ( 0H$Ƞ 8 $8`< /8 !;0 0# W 0 $@0 \04 $0P` P < l D88 "50 0@ W: 0P0 0 04 , 04 X X0S T ! L001PQ , 0S #T0S0p0, \DH  0p0, \L yD8 W 0 # !" hD8 7 P Y X R 0, ,00C, \X\ 8l;<d˟W@ 0H  1D00 ,@@ W   0SS:@^ c:^E ^ :^ @ D4Q0,0W0 $P5 #P# 40S 0` C00 @0S0P@Q0R0M0?, \ C0 @K H@I J 50=0 S@ѵ@`ѵ`ѥT_ V00TP , 000D ,000 i 0?Rm0?JV00T  R(TV 0DS4 R T}CxyCop ,@0 (00 @0?,00 D4Q jWCSC4\ 5 000$80s 0S00 0 t3C4 0p0H7@Q <7Q45 000$080w0#S- @T' T T 00 0@P@ P r V|A l P P a v<?Q$BP@ P4  R00C##̠#,IJH0K '0=nB5@ Rr W5RR 5Rx4 000$0@@5 D@ $0 6 H $D@10L S,0 & ,H 10S00  L00P 0pF?, \LD H0xfBD H0``BX [BHD4@\ 84\@0, ,0c FB4^0,07?B 5 000$8@ +B4@ 0 ,0@, ,0c8 `<0BW 0 040 , [Y W 4 A#000 04 T@0?, \~ "000  0=><AW 40  gACP 0 $`{s A5 0@+& A0, ,0@ @c, DAW 04! "$# (,yAouAoAlAiA꜔<h @d(<\$8HXp𫪪0, ,0@ @c, XAw0; $000; T)H ,p 4p D L 0p c0"$"bq U T0T(@ 0T -L M p01 h!;!X@T T T 0,0 `V    (0S    $0 ( $ `V& V 000     0ppo(0S $ $0 (P,@tP 0X0[YZ,`  0 " 0$ @ $ 4  P(0SH1R/S0H1ppHq  $0 @( <@0,0 0S0 0r1@,@m 00S0hTg (Tbt000 0 000R00 ppT0HH0F4 -LM`0p @P h@T0A`(@0S F/F ?P -LM4 ?440$0KS80 00 , < <0Su8<00Q8 <0 4HQU @T00 4 0L1 0 00 PP0 P?TP40PQU @T0040T10  00 PP0 |?TP0PU+ $0  0$0@, 0X0 x xc? 0p0CS00 00 , X? R0000 0P pTp0 1`V0@00 0 / TʄQU 00 PP0 < '?@Y<0 0S40$[ 00<48000<0 4$JT$D -5L앟M 00p0`0 0, @QU hR0000, 0 4 @ p X- 0 A0S P N40   ,$ `N ,S 0"""Ƞ[YZX 0  ğ @  $0P@(0S    $0 (0800000 PP00S000)C0 0C\ 0  "!0 00 3C& x 0 "!0T#0 Ri@T 0Z 0 R6 T) B0 0C\ 0  "!0 00 2C&  0 "!0p"0 R0w00 ,0S 00`S 0Q0 4 0   00S, {@DFTʣ =lA0 0C\ 0  "!80 00 $1C&  0 "!0 0 RҸ, 00= <\P,  <M000, 8<0dP8, ` 0@@T 0Z,cܹc  cc0lh -L M 4q ( P, 0 0HQp41pU  0 !01 R PY0 R0PQ00  , R  0T0 0S $00` `1S `VV 0(`S 'W ʇ0(@ P@ p'W(W V000S 00  0 "00 `0 SP QR 0 S, 0 S0Z 000SJ R0T1C 000 1QQ@4 !010 ###Ƞ0`6J/) o 0S ( hW{ 4qpm@000/ N QhF/ M R0L1 (2Pp P :` -@Lhp0P  0< `000/$00$0@`0`0C^  00#!t000 \0C& T  00#!04 0 Roܹcccc0 -LtM<  PD  2L DP (L<@80K4PK 0P@ @ 0,P<  \<0D 00 8 :4P<0D00@  0 P<0D : P<  t@ @D0<@0 0  0@  P<@W@ Q< @ - D0 < D 000 D0 @ @ @D 00KD0 ,00D,0 p0 0 !L0 T?00@0EPP F T0G0X M \0 N00Q0R0S0P H 0T 9 : ; A B C 80<DL`0O0dehfl g t0 ]0x0^|` _a0b0c0dX0Y0Z0[0p \@11 RH8 $ #4"( 3#8(0 < d3 \<0L>1D3 /8ß!0S!(\  0D00  00D0  0" 0Ÿ000 @C\ 0  "!|0 00 h2C& ` 0 "!0<"0 RD@ < ^@  1 0<00N D0 0000C\ 0  "!t0 00 `1C& X 0 "!04!0 R靵雵<  t:<D0$<D0 <08 0DD<  R:<  lL:<`G:< PB:$XPTܹcX\ccc0P p-LM`1d! 0SPO*XaVV R0000 0 p P`! J09`10  P0` 0/!`1 0 `10`1lp`! 0!0@0|80`!@0 !?\pĂ  -0L`pEP@4@TP@' PUU1 h1P0h1@1 R 0S @0  R0Z 6PU0m< 4 380 4! *7  0- 80,#@L(P 80,#(0h -LMP0p @Rh8`` 0Sa:h!40b0C02#1 d1d1$0CRR*D!`0!`!A'` A`10C0  `10`1 0  d!0$ B9d!d10 #Pd1 ! d100P0 mz$0!00| -LM0PpUA{00 `0V Sd 4tL80V`08 @08  800[h1`0Ch1 -0Lx8t0t8l0l8d0d8\0\8T0T8L0L8D0Dh8꜔(@\ -2L0,@2P40 T,24 $``p,”4 $0D[88 hvhO8:| 0-,2@4L $2PU02PE88;80hQ,2 4$00 0 R <2R@0<2000UPE<2@0<2000 0-@2D0 L 2P ,”04 T8;800,”004$,”040 T -LMoP`p,B04 T,•40 T}7,24 $,•04 $0pW`0D"V @0D"D2D2 0+D2 L 0 `  0-,2@L4 $0 ,”?00@2@204 T@2PU0,”04 T@2PU -4< BLMR`<2 8  ,–04 080K4s3@ 000-PP 011 01$0  1 X@00C\ 0  "!$0 00 3C&  0 "!0"0 RU 0S?2@ 000-$@0@0C\ 0  "!T0 00 @2C& 8 0 "!0"0 Rj$ R 1 0 +10 ,( R • H0X*> R $04 -L M, p, Ǒ0 0P0P  R`(0PR@?T , 000 0 (@TP V c3@ 0P00PP t1 01$0  1 <@00C\ 0  "!0 00 2C&  0 "!0"0 RXUP  R@@ 000$@0@0C\ 0  "!80 00 $2C&  0 "!0!0 R"$ R 1 0 +10 ,( 0 R00 27 0cS5;Ӵ5Q 0 S10001q J0C  1 P  01$R Z 010g00 0 %,0S 40<, P 0/- `b冀  -t'tLM0`00? LpR  – ;X – 6X@_– 0@TTP@– 0X@TPZ7Pe 6 R^ }–/ 0TP6B<  <6X$6 R? –6 X2 $– 90 X2 $5 –  9 Xl5 R C– :X'B,08 \–5 Xy4 R – 4X2S–– : .;X4 R 2 $–00@0 T– :X*N00R00 4X– @0XB *;X– 3XB 3X–3 X7S\– h3XB 0X– ;X– :XY J– 2X5B@05%+%00C\ 0  "!0 00 x2C& p 0 "!0L"0 R<24oyY– 2X[–- @0TB1 X'B,0<$ \–1 X\– X1X5<! AP00C\ 0  "!0 00 0C&  0 "!0 0 Ro– ;XA3cܹc'<0h~vcc000` -L? R - 00C S ? C  v -P?L •R`1 p }X2 (•@ T1X2 ,H$H 0 0 0  0P0 P#00• $ 060060 R %0?  R-00• $$0'0 4!W 000,   -3LM3p@`LP0 g P2B'0 0C\ 0  "!0 00 2C& x 0 "!0T"0 R42Tc,2TG*$2T3 2T A— 1X%!8 @ 2A8#  @ 8C82%D— x1X@ 505%@ 0 R70%4P5@ 0 R 90T 0T0. @R\0S\0T? R - 08/cܹccc02i 1i i i 5i i 6i( -t0`0t0L–0 pX2 (@PH$Hd  XC]1S -LM`pR(0S G (0S7$2S,pW`Z/`pT(0S G (0S$4SpW`Z i/ZY04$0(GOY02$0(G p-0LML`5P ;XB :X• :XB 9X• :XB .;X2ҝ• x0XB ;X•: X7S45=5phWh -H9LD$M 0@0,0`@00C)L\8 <  0  "!0 00 8C&  0 "!0(0 R0PKp 0pP@ `酟  c3ǖ~> 0~^00 p0 *,P ǖ'7 4P ǖ}> 00p  0 Pǖ'7 P@x\._ǖ00Pp  0 P@PTǖ>00p 0 P@]ǖp00Pp  0 P@PTǖ>00p  0 P` @ Pv7`_O@ 0K04?S 6    85%55 ` R8 5500808 (5 080%Od 8 01 2800–5 X2 (p4K 0p 3[#202L0CP M%5%?t"4$x2|"8 \"  0pd"R "0"2PS ? ? (4 Rq %0O0aV"RLЕЖؖ# < ? R! 788 #007– ;XB <X<p2 R %< ?  R-0<0 $ '0 #< 28 d0'0  0$0 Q 0- 0t p2  ` | 0# 08(2 c 0]`1@ 000@0@0C\ 0  "!0 00 1C&  0 "!0  Q( >&O1 ?P– 1X2 ('  8–0@9 Xcܹcc&c080@  0 PP<,@6 Pdp@< ? 0   0P11U*IR<R02p@ 3M+p]@<@  0 P@#2p0W2pPpW*K 02[ 8#(# ??P"2 $>  4$ 4 4@K0 _ @&/h "/d4@p5\$\4 0T$000 @`1r  ,`2 R 02[$0S`2_0`23@L23P"T2#34r!  0h<"R' ! P!   P #; FH#0@E020? !0  Q0 E2[ E[0 Kg[:@00CZ PᶣK@#[0xŸPC b 0K 6K0 K"[3[8w 03[[  BP0U3K@QXRU $0< @$=0C!L=$SPP <0$< <0)8<, 0@0  @  0<0< p 8<0,0<0< 8<, 0<0,0L  XT40`Hh@ p-LM@_<2S @`_  0Q2Spj` -LM48p 0X``FX64P@@8 0X480 X㥗480 X㜗V`48 0X4@80 X㉗40 8( 0 48X`wV48 0Xlb -L M00 00 S40 `, 48 0X@pDY74@ PP8 0X480 X?480 X6W@ʐBT#4 ,0pDX74@PP8 0X480 X480 XW@4 P @480 X40 8(0 pD7048 0pDXW@4 80X40040 ٖ40 \x -L M5,=@S\p, ,0}S5;ô5`PV <  0PW`V 0 S01 10C1W Q`p`<P=<(0S0 (0 000\4   (0\ 0,  000   (0\<(0S,00,0 \0 0<( $0 ( Gꄓ3@ 0x00Pp \3 !!$ !0 00!0 0$#@00C\ 0  "!0 00 2C&  0 "!"0"0 RWW  RBh2@ 0x00?P"$@0@0C\ 0  "!0 00 2C&  0 "!!0!0 Rd$ R 1 01+00 (0,0   0S!L1000S!8100<(0S3,4,098D0 \ P|<@ (0S?0 PU U  `2@0`2 (0 0D ?(0 ,`2@0`2H 'D0P 0-LP @P2L @D,T0 0-@LP”L;H \P2LH ,P”0L9H \P2LH ,P”0L0H \P2LH ,P”0L0H \P0S5H P2L,P”0L0H \P2LH ,P”0L0H \P2LH ,P”0L0H \PE|uPP2LH ,P”0L0H \iP2H L,H T P2L,P”0L0H \PP U]0ES0l2lRP”L;H \>P2LH ,P”0L9H \.P2LH ,P”0L0H \P2LH ,P”0L0H \0hP2LH ,P”0L0H \P2LH ,P”0L0K 0-LP@L;H \P2LH ,P”0L9H \P2LH ,P”0L0H \P2LH ,P”0L0H \PP2LH ,P”0L0H \P2LH ,P”0L0H \PUZP2LH ,P”0L0H \~P2LH ,P”0L0H \nP”LH 0\0 -L@`pPW5H x P2L,P”0L0H \LP2LH ,P”0L0H \P \P2LH ,P”`L>P \P2LH ,0H 40P”L,P”0L:H \ -PL@p|P•L;H \bP2LH ,P•0L9H \RP2LH ,P•0L0H \BP2LH ,P•0L0H \2`IP2LH ,P•0L0H \P2LH ,0 8#hP2LH ,P•0L0H \@ ` -LM\ @P`K*pK? \  \ 0  gY2[2[#$0$@ 0T -LMQPP@LLH H "::\P2LH ,P”0L8H \P2LH ,P”0L8H \ -LMP@L9H \P2LH ,P”LH ,P”0L8H \P2LH ,P”0L8H \P2LH , 0-LPLPH :\@@TZ0 p- B0LMB`Ppz@ -1夁L ` 0@ P0@    PpI<W3 @E@A0 0C\ 0  "!0 00 0C&  0 "!0l 0 RWކCP000@;@TZcܹccc0 -\1LMTq 0 `P@ 00`U c _ [ W S O@00C^  00#!t000 \0C& T  00#!04 0 Rpcܹccc0 -LM⚏@0LQ`SPP0T0 QppW0 2 R T U U  U Q!1 Q QQ Q' ,pK0*@KS)PK 0S [P–L 00 \P2L0 ,P–L70 \U𴠠P2L ,0 P 긠꼠ĠȠ̠9P–;2L8 \@P2L ,P@Ti -L M0KP@ ᚯ` T0BS00S0 SppW SK S# S.@K-`K庂K  0S P•L400 \P2L0 ,4 4 P•7L0 \V  (08 4 P•L4 0\ C 040 0 0 5;P•02L8 \@P2L ,P@T 0-? L0BS@_R 0S00|2000SJ0|20 -LM@'2   ? ? R 0p 0  0 ^  -LM\ ?B#<0 c {`,<兒,  @ +(2Q ;445  P2L0 ,P–0L@00 \5 jP2L0 ,P–0L00 \ATP @  0SI 1 11PT@50? `1 < ̖(0S10̖(0S P–0L \ć050+0 0(0 0 +<(E 1 115<5P2L0 ,P–0L00 \P2L0 ,P–0L@0s@'T -"LM4x0t"`8r/PB<4 0L \82s/PR0 4L \5p p P2L0 ,P–0L@00 \5 S P2L0 ,P–0L00 \P–L 0\PB0L \5 ,QU@ P  0S ? R  P 0@pU@PP–L 0\PBL0 \5<5P2L0 ,P–0L0P2L0 ,P–0L@0 -LMPPL0h \PBL1p \P•Lh 0\PB2L4p \5p`  P2L0 ,P•0L@00 \5 x P2L0 ,P•0L00 \5[ P2L0 ,P•0L<0 \P•Lh 0\PBLp 0\P•Lh 0\PB0Lp \5 -AT @ 7 =S CcrT@P•Lh 0\PBLp 0\P•Lh 0\PBL0p \P2L0 ,P•0L`0 @0P ` )*0,Px'̗> 0,H )<4P!̗3=0)0`  0 P ̗,)0` 0 PTINP@̗`00@` 0 PP@U̗>00` 0 P@G}34P4 53#03 #d00 4p1 \400嚟 RR Rw L3L#@2H3OD"H2 0#03(R0 1 0 SS0—\29200"00S002;2`0 0—\8 ? R# ? R# /00CSpD"0<0X20I\P2L ,P—0L0 \%<S P2L0 ,PB0L:0 \P•L 0\h@h0T0S P•00L8 \1SL -LM䌐̐@  0Pp(0PW`,,2 ,U00Q00Sr<0p`D(0S \ (0S&$P 22(C04 pW`ڐ ̘(0S $0 (/D$0(\/02$0(\jj p-0@LMP P .8(`P00C& R 00#!000 l0C& d 0 "!0@ 0 Rpphp,cܹccc0 -L,M\Ÿ0#,0 3RPRT@`@0 0BSpp Q? 4020! @ 40W1I H  !1"2!1"2 0`" R03S SV㰂娂$    0T3SL13&XP?  ,0 S ,PS @0HQ4Q -p 0p00! 00p0 H0S Hp 00  HlKQ@TPl K0  @TT000  T0Hp0}H b|ܹcccc0( 0-0L 000p0P@  0p000C& R 00#!t000 `0C& X 0 "!04 0 R0gcܹccc0 -!L M0000x0ppt`p0t000C& R@P 00#!000 0C&  0 "!0l 0 R\\V @@W 0<`@fcܹccc0d -PLM@E 0RA 2P 8p `堠 V VJ +<W0  p0 (BP00C\ 0  "!0 00 1C&  0 "!0!0 Ro0 0L \P00C\ 0  "!(0 00 1C&  0 "!0 0 R$ V*АЀP0 x p0 0RTp0x 00 h P`" V:d0a* f0400 Tܹcccc0ԯ -L M`84PP㈀ $8 ,   $pR XX30 l @ 0S ,#0 0C\ 0  "!0 00 2C&  0 "!"0"0 R $ 0@0To:x t0 0Rt0x `  $p@ $@\  † $0  ,@+0  , 0  , p0 0p0| R,0H, h0x!2 $m _h08(0S100B;0&P` *0-@@0*0+) <0 90- 020  < 0h ?A3c   0 (<0 r<0  0 B?(8Mb -LMP`p /P@ )0"S S 00)0 l1 ,  (p=P0S $fP -LM0Pp $hQP`> %020 lAT0 L0 T0 !4 0j0 <0@T0 0s  '0s @DXTT -0S 0S2Si i +0S 01 00 (00 $ $000H ! { 0N v i ib ii-00CS񟗻                                                                                                                                                            p-LM0@SP`0 00CS'pЩ$P p P P P \P"Pup -LMPp@`l0 T0S/ 0T*0 T+0S0 !  8p "p T,0 T 0T 0 -@LP`pl!0 T @0 T0  -LMp@P`00CS%9 -0  d 0p 0S  Wpl! 0 $p p00 p -@L0P; S`p> $0S; 0S긭ЭL0  ( p :hX ;w 0p0 (0$ 0 p 00 Sp -LM0@` P,0 t$ d 00(0 $CW> $ $p8@g(0S.0) <ŸR0 S@ * @T J000 R:0@0 d 08(0S0  0 B?(0  0 B?($p $0<<0 T $0 l1 3  $p $W 0 0TʠZ 0p p 0T $  $pJ p-LM@`P0Sܱ( pp  o 00   [ -0LSp! 0 T@ *lJ`@P0S PUN000 05p 30S S & -P@ P`L -$0\0'0 A,  X$!p 0 \0 \ 0 T XC00 T00,0R/ 0,  X0aqJ -`L0p 0@P(0l \ 00\ 0p P$ 0T -`L0p 0@P(0l \ 00\0 T 0p P  0T 0T -LM0pPkp@*  `$T)? T $0 P)00S 0  T 0i?? 0@S)00S 0.p P 0 T 00 0  0 p-LM0@P` 0T 0T 0T\ 0S    php -4!4qLM0`0004@P0S8 S 3 PUNZ@PPU @Z@00C\ 0  "!0 00 l0C& d 0 "!0@ 0 RiP~cܹccc0 -Lp\P` 0S 00 $0 $@A@0  T0 T0@S  0S  00 S0S  0Np  m 0Bp P0 \ 03p  $ @P 0#p P0 \ 0p $0 `" @ z p-LM`@P $  0T0 \ 0 $#P_hԽԽ|ԽԽԽԽԽԽԽԽԽԽԽԽԽԽԽԽԽԽԽԽԽԽԽԽԽԽ000 0p p 0  T 0pP p M 0X0l!!  0 0H  p-LM0@P`h\ 0 p^p 0 T $ $ 0F -LM`@pP 06P0 k\ 0)p _ $ PR XQ00RP6RQ.0l!P 0S%00  0P  i !  0i 0 i}P 0  0P 0 T @- l1 d0 Q@   \000 S@505 3:S0 0贄 p-LM@`P0 T 0ph -L@P`0 p B 0qp \ 0 i0s h^ p-LM@P`0  0K\ 0php p-LM0@`P 0T  0  d 0$P 0T 0p@-@l0<000@0@-@l,00P00P0@괄 p-LM0lAP0 S 000<0`0 T0 Tp p-LM0PlA`! R 0t000S*Q0 2 0 <00 T0 Tp鴄 p-LM0P`@ 0T $0 0R}N=P@T $p -LM`VPp@g TV *0 T9 -0  d00PP1 D R0000 0 00C\ 0  "!0 00 0C&  0 "!0 0 R 00@0 TL1V *0 T+0 T,00ܹcccc0 -0LMP@`e $<S $ $0 00G@@p 0   0T 0T0 T0؀00  0T 0T0 T {0 0 i T p-LM<@PT` hD)0X0   8(0S     0 (8 $  8(0S|  $(0Sa$,,)00S@$0 (0, 000Sfph0,00S4 00 Ph<=000  0 B?(8x -LM<@T 5h0  00 hM -LM P0 ` 0@ v-0Ss 0S̡(@00C\ 0  "!0 00 1C& x 0 "!H1T  QoJ0p4@0 T00P00C\P 0  "!0 00 0C&  0 "!0 0 R  00 0 0 @TJ=ܹcccc0 -`L@ Pp$0@000 T p- LM 0@S00Pa`p AB1!10d@2@d.`0@$T @a2a3c13D@ /&b00?(ph<;ʚ;C, p-L$M8 (0K$`KP0  0.*` ,@Td .< 8  (  4@ T$ p.pLx -`LT $0 0T Tp @P &0P Up T $0 0T T $0xR'x3S % -,LM, P`)p] 0TM0] TM] $@@GLHpW$Z] 0TL -LM P@0] ` pTL] 0TLP P] 0TL0] TL0X`Z] 0TiL0 < 0   Q0- L@P Q 08S0@ܶ  0-8PS@L ╮L4QK]k03PP` p-L Mh@V PK 0hP ,0"  000(^ `08 Z00pp80 -L MH`Tr; @ 000X 0890$00 @0@0C\ 0  "!0 00 1C&  0 "!P1\  QH0pK 0hP? 000@0,0 0P00(@T 0XZp0 0C\ 0  "!t0 00 `0C& X 0 "!04 0 R~ wH|ܹcccc0 - @Lp 0` 0P0O 80Xp0p0C& R 00#!p000 \0C& T 0 "!00 0 Rh4Hcܹccc0 -LM4 < @ 4!P< , 80 4p8  0<0CR76, 0 90>0P`*@G S : R#: , Jc0 @`p`B0 Xp0C$ 0P8 R <0 ,4 0 wP@ 0P0PP`  0 0B@$B -L MX`Ur; @ 000X 08040 0 @0@0C\ 0  "!0 00 1C&  0 "!P1\  QrG0@K 0fP?q 0000 ,0#  0P0(0(?^ Xڨ00C\ 0  "!t0 00 `0C& X 0 "!04 0 R~ +G|ܹcccc0 - @Lp 0` 0P0( 8 0Xp0p0C& R 00#!p000 \0C& T 0 "!00 0 RhFcܹccc0 -LMp, h— lp2  h2l ,* B: @P0  TU  0\20\2 0``V $0Z0``V &0Z>❟ ($8 0eP@ t2 |,[03WP @ 090MP @ 090CP@ 0`9090F?0P!M 0V90"$`0>V 0<`2|"`Vh—`lp2 ` h2l ,h—Plp2 ` h2l4 ,0 h—lp2 ` h2lH ,4 h—lp2 ` h2lL , \8 ,P  T81S h—lp2 ` h2l ,h—lp2@ ` hR@l0 \`hh—lp2  h2l ,`cV\\hBlp2  h—l 1\UhBPlp2 P h— ,0l\dghBlp2 P h—l 0\` Hh—lp2  h2l ,` Vd @`1`u>Vpmj zeh—lp2  t2hB ,0 0l \h—lp2  hB$0l \h—lp2  hB$0l( \hRlp2  h—l 4\hBlp2  h2l ,PhB, _Plp2 P h—0l \hBlp2  h20l8 I,$I00#N>C 0ChR0l lp20 0, Ȅ 0   h—l004 \@3hbAlp2  h—Q0l@ \hBlp2  h—4 :lH \hBlp2  h—P 8l\fhBlp2  h—lH 40\hBlp2  h—l80L \40#f` Pfh—lp2 P h2lH ,` V P x1@Tp!0040`THPH0L8 lh—lp2 P hR3l1 \hBlp2  h—l ,0\dIfhhBlp2 ` h—l 1\`VJA `V@DZ@DdD@%I$d,`0 Wcd -LM HTe | H0S 8$T| 3y~@ 8H SH0$(  0-LMhR@ lp2  h”l 0\0 -X6XLM P P p{ P( F0 0C\ 0  "!0 00 5C&  0 "!0%0 RoCeh‘0P00lp2 P h2l ,PHT hBlp2 P h—0l \2~e00C0h—Plp2 P h2l ,h—Tlp2 P h2l4 , XP$h‘0`00lp2 ` t2hB x—,0 0l \h—lp2 ` hB$0l \h—lp2 ` $hB0l( \T8SP(R hB`lp2 ` h—@0 l\ehBlp2 `倀 h—0l \hBlp2 ` h2l8 ,XH"00N>C 0ChR0l lp2, ` H h—0l4 \hBlp2 ` X(!h—l36@ \hBlp2 ` h2lH ,hBlp2 ` h—l:H \hBlp2 ` h—P 8l\dhBlp2 ` h—0H l\2sd 0P(0C0X(T(h—lp2` h2l ,Ah—lp2 ` T(hB@00l \+cܹccc0=%I$P 40 R(0 R0 R_= -PLMP |"RpW 0``00VhB lp2  h•a0l \3` T2X"0 T2X"YPJ4@T2V0CT2hB lp2  h•l 0\303 (N@gx Ủp1@`㻦XwhB lp2  h•l 0\ c4V`\80\8[P`\(N0\8h lp2  h2 l,|"`ah lp2   h2l ,`Q |"pLXPt 0- LMQP hB@lp2 h•l @0\0#hB@ # lp2  h•l p- @LM`0P00(4`0`0C& R 00#!p000 \0C& T 0 "!00 0 Rpph@cܹccc0 -QpL@P`08S 0 R`,8S  0$ $Rp0S`@` TP$p@p -L MT2 0T26 00%0,80H0,0 ,00C\ 0  "!0 00 5C&  0 "!P%0X%0 RJ`T 0$PpU 0SSW`,P 4P$U  R00R\ Y $0ST20CT200`3 `4 @0 p0b@0 L @0 倠0 `#> 00ZF 3Z5 0L0#3@ 000X#@0@0C\ 0  "!|0 00 h3C& ` 0 "!03<  Q ?0Sp R000R0 A60S!0\p@P R 00c0C20000#:20J0(2@ 00 "0.X2@0@0C\ 0!!  0!C6000 "!1  Q j?$0S`I 04 0hB lp2  h˜0l \Z0 00 0@ 000W @0@0C\ 0!!  0 C6000 "!L0X  Q ?@$0S ?ܹcccc0 -LM`@(0 S4p8PP 0$01l00<@ ,0 00 00C 00$@202LP0080004 -LMlhBP p2`   h2lP ,V5 <0 @ ȕ10C S1 !@ T 0 0 m;WTph• lp2  h2 l,?> 0D <@0 Tp -LM`0Vp0P`0 QhBlp2 h2 l,3 `VZ00hVD0S  -LMh@ lp2  h2 l,3 h# -L$M`%% 0 0 < p D8PP, @ P@ $4D@08 8 2 00 $0880, T4  ,K4 <0 ,0P @, 4040<0<@  *D240<0,  0 0 4 0 22$p<!,\10LP0,0,0, ,0 ,0,Q,0$p 000808hBlp2 hš0l \0S ,1 R) A00C\ 0  "!0 00 0C&  0 "!0 0 Rh=P@᳢| zt0 l0 ,!v  ,(0ܹcc=cc0@Mb0 0  Q-L 0S S 0SQ 0 0 -0#1? $ˀR 4    R 0 0 0 !1?0 P 0SP-(0,#1? &̀R, 6 0 0, R000000 !1?0 P (0S,P0@-@D 0 hPR 0@c0x p0t0@L 0- @LP 0 00MP0P0C& R 00#!p000 \0C& T 0 "!00 0 R00h<cܹccc0 -L Mp0"`@0TP, > ,00@ R 4Pr Y4 ]P0 e 80 0$,S03( 00 0*   0S0000Y <   !<00  [P3A!P 000P0P0C\ 0  "!|0 00 h1C& ` 0 "!0XPS @ $0S U00::h@ P 0P00ɟSP0P0C\ 0  "!p0 00 \0C& T 0 "!00 0 R bܹcccc0< p-QLM@`PpT 00 @DRT0  0 @DRTʃ0p -LM@1SP 0h -Lڱ 9R 9R9 RR 88R" 8R 8R 8RU 8U!0IPPS񟗉@X HhB lp2  h—l 0\0ISh— lp2  h2l , hB lp2  h—l 0hB lp2  h—l 00 S;0\< C00By 0( <25(  4p0< ^000P @<0 8@0*Q< `0!< 0PR < 0A,(0"A 0 P4p <0 @ 000` 0@00( 40 , 84 09000C\ 0  "!0 00 t0C& l 0 "!0H 0 Ror30 $oLܹcccc00 0P  -LM園P  0 @ 0SS* hB00C\ 0  "!40 00 2C&  0 "!0!0 Ro3004p090L`40S_ 00C\l 0  "!\0 00 H1C& @ 0 "!0!0 R6U@ 000}K0( 90 @0@0C\ 0  "!0 00 x0C& p 0 "!0L 0 Ro22 `40S ܹcccc0 p-LM 0@<0`0@`P 0004PP0P0C& R 00#!t000 `0C& X 0 "!04 0 Rpg2ܹcccc0 0-0L@P80h1 -`V`V` pP0UL`p` l@d 0V0S APP U hmdaa -LM@Y0 00\ hsx 0- 8x 8#T0%PLT0AT 0S 0Z 8R(0 4 aa - 8h LM8#0!P @0 A0T S  &0S  aa -L M @ 6@Co 3 -L M@ 0@3o 3 -LMD0`#((0"t1'ATw T0StȀ40 < 8dpp 88#0 pWEV 3 0-@0P @L cFP 0000P0t -LM0s@S* 00 0000 -LMⴁq`PU @!0@KP^PU $00<0$0@T0 P8:00/ 0S; 0S8 Qa 0R0R S  0R0R S0 Q 0@^S}P0Q0Q0A Q 0 00 0c0c0 0QWubbb؛ܛaԛa` b -P@L@PpP`P0P @D@PPP P  000cbbbb -8@LMxP00  0@LbHbb0 00LbbHb8 04S00 0 0S405bHb00 -$ L0S 00  -L 000 -L!0@]S@t T !0@]S@00D SA Da0DSR\T_T3\TS( @SA @a0@SR@0@\T 3@U@t T_P Q:P00\P0S0p P@$0?Sb4iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiP@0T,1pP, a00/TU# 9T0pD UA DA Da0DSR `TWpD@T7pD0s" @00DR Sa0D_TS7ToPOPP tPTP P xPXPP@(0PbbHbd x  b  -LM||`P0Ulp@?0T UPe > PUP0U00 3 P 0-@PLP % 0S cP  P h 00C0\@P  0SU00hz0 qPP   0-H1L0@S4!0CQF!0D]S& T T T T 00h 00000P@ͺ00 0 0 0n p@x0 0 S 0CRL000 (00  y0 0 0 lQ 𠱜H -LMS@ \00S SL L0L L0P 0^0?l 0ϧ 0       p-LMP@PLU` phu8`r0 ,$0iPp``( L  d  -L MP@0T(*$K(pK,`K$$0 ; $f , @Q h0( \$0T\ &(0DS< 0T:,0H__h pt x Hc -PL`pHpAP@ 00CS 0} @TR@0Sq Sf SZ 0S 0S 00 t4 S 1!0S 2!8S  a1Q- 2!8S( 1 RT T U h1Q 2\!8S UP!000@1@嬦,1@@DT$@D⤦T_ 垦 00CS0 00CS0ڸ0 R刦E儦00  0 00Sv h00S 0So P00S 0Sh Hpfbbbb |Hb   -LMp0@SSHP S 0S iX 0  uP{i  T`0 Q00 28 6S Q 000bb 0S00lbP0pQr  8 80, ,0 0bbbabbbD0<08 pQ(0 0bbbabb-L0H D0pQ, ,0 0bbbabbb 80cR   (0 0 0bbabb p-LMHP@ * D T h0\ `` T` T0V D0\ P00pP 0  0-@@L08PS0S00000  - 0L@TT xP\ lp`bXd0 4P 0S<00hJp hC c`b   0-\L@P 2S P(0P2 00  p-LM`P`@2S@T<phꥵPT0"2 000p  -LM@ K;40S0:00A0 R0   `` p-LM`@PxP  0S  plP   -LM@ P0K  0 -0 SLP` :S0 `0SZ @ p2bS@TP t0`0`p0@2S @T:0T0 P0$Pb  -LMP`@V 0FS \oVP oQfp0S  SP, 0  -L M0PS` :S0 `0SY @0P , 0`K p R2S@TP xW0`p0@2S @T:0T0 P0(jꪴP8 ({  -0LM pR K >TP@`2S@PT P Wp h -0L Mt`, p0 @–R\ ,0K@T00 ,0 S1051P5b -PLPM`\p 0K@  0SV 000b -L1L`MD0 PP(0 `pl KpKt KpP 1l R*t0S@hK 0@@ (0S (l RW xK| K0P x| P@hK0@@ l bp-L X d  0-LM(P@ 0@?0b-00 Cb -L\ b - 0L0S b -L\   b -L\b -LM$@Tb -L\ b -0L0Sb -L@PMK!P 0Q0SH 0 U0 RX7PT刢P冢H僢@倢<<0 4zꌯcbh x anb  H bb4  p-LM`P pP@0T:tPt@0T*dP 0 @T:@p0P 0 @T: t__b -LM@KP -LM KPK -0 SL 0  -L \   00 -L MbPh^KP Z PT@K_P RP,NHE  R0 0 0  -T LM@HT 00  (0R ȝĝ,b  0 0ȝ P-PL` @T pP 0S @TP@ 0P0`0 000 $m遡0S ̝ 0 -p`L@PTp \P 0S0W: ` @Th\ 00h̝X 0-LMl@0S`0hJXHPU G@P@D ,, @8 PU0̝    -LM@.h 0-LMPKP@@$ h0 0-pPL0S`00S @.0 . 0 @T0 000̝0  -0LM@`TPp P 0.S 0U:R0>0>0Up1 @TW 0@̝ -LM0PhS` /S+ bS` `$pK 0S /@x $ h啠$ @PX @ @0f0P,`lS  0a a@ p-L MQP@D00CS Hlt|$0 rp-p0 R 0rp`0K0,0 rPU 0S0pD0 R< 0(`$pFbdhН -40LM @R  ߲_ 00Cs0 -@L`0 SpP 00L S0 @0V0 0S0 S@P 0 a0CSa0RS-P@ןa@0a S_R@ zTh˟꼄TX -L4M0 sS, `@HKTK   a0@S0a SR0S 0S0S\ + a AL00lL0 V L0SZ00V00S 0S + a0BS aB0SVQ000 Qj1 kV@xq 0PS`LK0 PBTU@P !0001 ,0S ,$pX T KT@ |T0cP T K0T0 q0X P=U0:S000 S 0a0CS0000S _0a0B`F|00C ZSQ b0b,b\p -LMtpP ` PXu  0S %D@ @0  4b8b_ -LMP@0`p 0PS$ K"P $"P0 %D@@@0 Œ0s 004b8b_ -L0L0P 800P 0$0Œ0ԝ4b_ -P0LPl<00P  Ġ 0 2 0ԝ4b_ 0-LM^P@ Plx0P 40`0Œ000,@0S  _P000btԝ4b_,0,P 0S0Nԝ4b -d0LPlP0P  404 02(,ԝ4b_ -$0L0S4b 0-HPL0@S P0 T 0 4b 0-`0L @R LP0@0C000PS T00004b؝ -@0LM\0 @T 4b -1LM1\@pP !P  nSP`^ 0! P?@0H0  0lKD h0 l` @P HP@0\ K0[AP@?\80S @#V *T 0 SR@ 2SP @\ 0K0 K@0 | x t pP \0KDAP0@\0 S\  b b| -LM!N, ,0ގ !0!h ꐙę -LMr@W,1R2p U8`40: ?㳀-Π@4/00 000E ?PP( p0 S|0 0t0@0l0 5É\J|Ή U? ? 4HT"X -L3 S   -0L"R"0 0 3S p- @LM`0P001``0`0C& R 00#!p000 \0C& T 0 "!00 0 Rpphcܹccc0 -/0TrPR`L`"0H@T|"$@T2S -LM@  000h -H3L M 80PbT5(3, /003 /0 `"0T2   0""H0T" 0T" 0T"  0T0" T2SHB0l" T0d" T/0h" T" 0T|" 0T/0`"A0 TP|@d"0 PTU@4pK 4P@"0 PTU@4!40O000|" T0`"0 T0   PP"0 T0" T2S0`"0 T% @ %5;5H0 ,0S P,~" 0To b -LM5=@S 2/0Q| @T 0S1000! B!1q <Pf? ˜2 \$Z  P0ᮟ0 (<U!<3 ="PL1    Q (q/PBTb0 P`"0T -0 0Xp"0T%8t"0%\Tx"0T/0`"0T00("Q 0 80 %* 7s5;5 -LMPbT@_0B0`" T|" $1 )Rc 0`"0 Tp1p!”0"c\TM , K 4+[0[^0'0c "*1/0a0` 0 A S0AĀ \!p0^:0^* L("(P+ [ 00C0Q0ԇl"0C0 T0)S 0< ј000, KO -LMPrPT8`O0`"0 T|" $  0|" T40  |"$ 0 |"T|"  0T  2 R; 1l00l02S' /0`"0 T |" $" $" $" $l00l0t" $@Z p" $ T@t00t0x 5 x ;D %500C(0 $1/0T"PB, P`"0,T0- 0 0Xp"0,T%8t"0,%\Tx"0,T/0`"0,TX0?("P< 00 %`p" $p00p0 -2吂LM|2Q`@PpzX"Q]*P2QH H2Q*  L\ ` d F( bܹcc 0U`00C\ 0  "!0 00 4C&  0 "!0$0 R㷏 0@$#1,0p,  'PP ,VU  R0   @0 S@0t`0@0 0t`93@0P00K P00PH00d0 /0  0P 48<@lP0O, 8X1Sl 0 0 R[040 4 4 4PL0PG9#6!,8 R PPPP@P2, 4P1d @_R ,0<00S, <00<0,N(28 ,04,P@ ,0 ,0!,04,,,@ @ 0a4K/ P,{BX09AT40 ` !PU( A 0K0QPP0 H@00S(,X0P0 ~F,J0~ ,B~,<| :X4p<@` bܹccbp>b>bP?b -LM`PX1SQ0 C1  0$KVP@A$ H 00S@ 60S; `o` K0`P! $0S [ E@pp0 S:![00b0![000![00b00S <Up$f0  R*0 S`%*0{b -LM@ t  -LM@ h  @:* @ 3* -LM`@\80P0CSTP0Q@ q | 0"D040A!P000P0P0C\ 0  "!0 00 1C&  0 "!0d!0 R1T0 MPpTq<HT@p00@;0004P 000P0P0C\ 0  "!0 00 l0C& d 0 "!0@ 0 R uܹcccc0 - Lw0@7)00CS........0 X1S  0%00 ; < 0p@-P`Q@1!2n1[/73n1Q1Q0[/ Q@& 22a11U3a11U0S@0S` C0Q@ 0 0@C!0"b12cp0 QX -L4MPK@p0 㚋!!0CXa00/A!b2c2c!babSD[0^ l0 4 Po ^PU \d*!lD2!X0  @00@04   00U \F*!l1!e@X0P @00@04 000  , 0 0 0>.0 N^@PT \*l,1 @e00  0000  .*&\*!l0!X0  @00@04 00 ,00S0c,00,i0CLMN p-L$M@P0`   K0`P0Sp -LsM , `Dܡ  ! 1 儀 |` KpPPȁ ́ @80S P104 ,0S p,W0 0PPT0$ 0 0PP`@K 40PPoP  KPPC[B *D 0@xPP#[@P2S@ Tw С 0J0C p Dq@!TpAkK1 0 jK! . . R l>K! \33 5 Ƞ P!>Km kK1.0Q@ pb 00Cpp!@Dq1T#[@T; 20CS0@;;;;;;ȑY: 01 bpnKoK  m?KPH\5 :0\*  b 0 0b$10#[1 @T0 0X *ܡ  P PpH0!>0kK1 ̑  c. . j?K!#[ ̑ - b  -L,M 0 D 0 ) K3S`@  gP1D RBB)p  0@tP@01 1PP"0PS@ U3 410  h3@ 0 @/P HP) [R0 0S2 @ TD 00KP00T00ST)0[002PU52 0C4 < 8 @S%>`?`?`?@@8K 40K0>01! 1s8 40 !1 4!Q80%000 0a00b 155 1%D R j)@@@ )K@\0 S*diD   D0P@( ) K P 鸡00{b -LLM@Q@D1U d0 ` 8d0K00pW m)jmPp@ `K [){j0`0 0<X0 \ 0P0 T 0H0 L :D0 @ 080 04p < 00 0$p (p ,0 {p0{b0S -L MBpBP ,0 9(` 0@ P@"@2V*0S @T:@W )) 0 PP: (p  0P@0 S 0R , wP -L$M (14 @ @D Pp 0S s P 0 @S@R*0 S  R:R*0< S S4  Q Q 0S8 0 # S S 00000 0S S SQ 00 Q Q Q Q Q < 04S4 0!D0;H0  D  0 0y@ H0Q0 T0S08 ğ (10$(1 `000 R00 D`00C\ 0  "!T0 00 @4C& 8 0 "!0$0 R0 ?@ 1' `8 Q<0S 4?@ #'< `C? '(10+`|00 05P@0@4!(10(1 @$i(1! 0(1,H0 001D  H0 10 0(10(1e 00(1A 04hZ `M P ?'0S,ŸL2, ` 0 b02B&! 02 S7 1b1 R000q`00C\ 0  "!0 00 t1C& l 0 "!0H!0 Rn ?L a'L0 0B01 `pY1?L e&L.,K P@w(1, 0(100,0, $,0, (00(0,,00C,0,(0 ,K8ܹc 0>0Q`P 1.*!a!00`G/ 0B!0b0!P PPP0Q*!a!00` 10G?  B0 P P0PpN -l5lLDM:OT8TT oTY뫦˴=>)Aş00S 0 0D 0 `8 R08 P<0 < D0嬔0S0 0$@`D0|4 ,0p4 1 1d4 l`\ ` 'H N@ NP@v/ 0P44 $05 0O0`V000#3@p@A Q_@Q0@0P K3PK@cFF_Pp00 0~TP@`0*`2880`,3 >0L!C)lS3YE0S P0SB"P000K봤LP0P0C\ 0  "!p0 00 \2C& T 0 "!00"0 RHPK "@11@T`P0d @@ @P@W0S P0 !@ZG0S<10SPplla $09$00 PP@ 00x  A@0q0@00 P 0 @00@0 0 PE b #b܂x$bAbK/K KT1 l < dQ 0P 8P XQ HP Ppd-;H0P @` D P P R   R?0@SD䌟< P 0 b0#60`00\ 0. "&0 P0>0#60X  T00Ppe42OK2cX2 T2( 2 KX"P2<$PU  _PO P & |1S0# 42 kx42  0> Pp p@00@0, p0) 1,   R ,07,02 ,0<,00  0  ,0b&P'0S/KK 82 3VPpH: KwPpD 0@ -Pp#H@"D00D082帀8"82@"82$ 8(00(08",00C,08(0,`VŻ0<n 8@t""0Q]8\F 2 @ 0 b2B&! 02 SC1b1 R08008  Q@00C\ 0  "!x0 00 d1C& \ 0 "!08!0 R (LL"p 0'P2  L< 80Rg 0Rc0R,07^_0H,0C0SF`00C  ? h b_ܹc<)bc@)b(;bcc00{b`Z -LMp$K4 ,@P  `@] PT4(  01 B10R,0 P@( ,K ]Q'00K@8,`P4( 0,0 B0RP,0 ( 4K  ]P@"`V@J,K ]Q'00K@,_P0 ,0`V0P,0 Z  ]@P  -LM40H<`N@~VpNP0p p@ ,H<. <0@R p` @@0S3T< h됐<(KL <0x !0 `` `V D 0,h(00, 0 Tdt| -L  -LM40`S  ,0  J,0\*;,00 (1!P4M4J4D @0S~  8 0R10<0<0<0 Q 0 0 0S0 0 0`T@ T @r/LP,0 + QU@,0"[V? \H h\0 w\Hf0Gv|0 G,0H@H@,0 |1dT0S# H@( R ,0 H@.(1@@1@H0S!000hS., P |0S P0000DqxP/yP  v >H,0.F:!$ EQxCbAb b bc 0-\P@LTF08 S8008< @@P` @@.00 000$0 04 0700700- R  P0ESH(0 0S  0  0X]0d} 00 * \Lm 0 0CQ 00#!000 =C&  0 "!0,0 R\ 00C` 0t< 0000000 h<0 S- 0& $,8L00C\ 0  "!0 00 ;C&  0 "!0+0 R0 0S 0S090(0` V 00 0 0@& 0P0C` 0 0 M``0000 0S RK1S 1 8C( !!090 000~ 0S{ l(x0 S0 S$00 ,K) J00C\ 0  "!0 00 9C&  0 "!0)0 R 0 0S  0 0S%, 0 Y0y 00 * \i 0 0CQ 00#!000 8C&  0 "!0(0 R\ 00C` 0(8 00000, :R0\ 0g0w 00S0 * \W 0 0CQ 00#!000 7C& | 0 "!0X'0 Ru\ 00C` 06 00000V:0090   1S01 10S0  00 0 0@~% 0P0C` 0 M`0S0 0,` Vgv 00 0 0@^% 0P0C` 0W 0 M`@1S `G101@ 1S1 ;0 S0 0SL0S00C0 0 0S0 e0:0F 0T0t 0P* \d 0 0CQ 00#!000 T4C& L 0 "!0($0 R\ 00C` 03 00000V:20`S 00 0 0@$ 0P0C` 0 M`0S0Sr0o 0Sl &i0 Sv0 n 0`0C1S 0 0S 0   QI!1S !10C1!R0 S0S00C00 0Sl  0 0S 0SO qa0 0S P* Q Q00C\ 0!!  0!C6000 "!0T!0 RQ`10   090 00 !!0`  P090 0@ $P`  0 0S 0SVM`0S 0S0 Su bܹccpp@ cc0@4X$\ -LM0@S0  !p(B(iJ0XTbJ0 0S 4hXJ(UJ PJ -P3LMP< PP PPpp3 !g 3!0B0^0`4 \>0NÃ0G@ă. B&, "00 0, ŸL PPG "0 0cC61 Tp,@ @ 0 d R0 d 0S P00B00C\ 0  "!0 00 1C&  0 "!0!0 R* L1\A00C\ 0  "!(0 00 1C&  0 "!0 0 RG@PppZ P P ppT P p pP P  P P p pH PppDPPpp>Ppp:c(;bܹcc<)b@)bcc0  -P1Pq L1 bB&!<1`LP 01Aa  S 00S0PP@00`0P0C\ 0  "!0 00 0C&  0 "!0h 0 Rh6 H0& @`0<)bܹc@)bc(;bcc0h0@-0`S\PX0 Q?#/0 IS0B!@R !R %50萬<` p-LM`xPL 0K !`6 KH0@@<0 @00@ 0pt8a`<)b$;b@)b -Lbp>b>bP?b P>0à PP PP @P@ P P   P   P  P P   P  PPP -LM0@ ;Ph? -<0LM   @)0Sh, b -LM0@ CPhY -LM @ PhI0S00 00 -0SL M00` @ p(P|0 P  0S 0 @ 0 P  # bD p-LM@P`@V0D  Ppph" -L$M00 `5P00Qp6 Q< , 4 00 F$$%`0  00 4@005000$@ 00000004`00C\ 0  "!0 00 |4C& t 0 "!D$0L$0 R0Dp40,p0 80 S 08 a R 0007 0D @0 @000$;T0 H 0S8<01<0S1 D HR00  UP4 004;00L,0#p0  00  4@0"@ 00  000002p00C\ 0  "!|0 00 h2C& ` 0 "!02<  QuҺH  10C10   4 R 4 <0 C 0l   40 l\S 0Sl 800S80 UPH!0@ < 01Q 007000400+ !@00C\ 0  "!0 00 0C&  0 "!0  Q4*00500U!',0/ , P bܹccHcc0P -LM|<t@U 00,yb!Ce -LM\0@Sh=,yb<0S8<0 p-L MQ/|A`"t1) ``@tTA?#)H1 @i0Q?# $1@)^0!S 0SCP @ 0Y@@; 0H@@: 0P@@: 0@@: 00@@:t p0@`:pAbAbAbAbL@b 0L | @ t2Lx p@000P<zCl@T|21Q8 -LM0Sn0Hb0 R 0R  R RmPPw 2nP@g ^aPT T 10HPS 14 T *B0nS& aS @0(T00S1@TL1 h BwS0S! P$$D1 1U4pP,0p0 R 0S΄ 0 B 0BwP 0d 0B|BxBtBpi|B\Ab bdAbldXp(44<DLP`400H400D00 0-LQ@P 40Q P DD1 R 000D 0-LQ@P 40Q P DD1  Q 0 0P 40000D000,0700 000 0-L0\0P   0@\!:KP@0 p-LMD14@ Q ` APU  p4K400p p-LMP`U6P1 40P. P@ PpDD1  Q p,0  0 R U4P 40U phP D1  Q pD@p -0P` QL@p JpT  J`X  JWV  -LMPup@`S 0UP u 0U 0 U 0U P>v 0V 0 V 0V P-w 0W 0 W 0W Pu U SPPv 0V `w 0Wp,0<,0v 0 Vw 0W -0P`QL  @p JpT  J`X  IWV  -LMPup@`D 0UA u 0U 0 U 0U fP/v 0V 0 V 0V UPw 0W 0 W 0W DP u Pv i`wp,0<,0v 0 Vw 0W -L M|   0\   Kq@ T00 0 T -L M|   0\   Kq@ T00 0 T p-LMP`@0S ( T 0T 0T P0T P T DA@@@,0<,0p R0Sp p-LMP@ `0S 0T 0T P @,0<,0p p-LMP`@0S ! T 0T 0T oP0T fP @@@,0<,0p R0Sp p-LMP@ `0S 0T 0T <P d@,0<,0p -Lp`@'PPUK!HP P,0<,00 R*0SR:0 0S 000 ZP -LM5P@/O00Bb 00CS06Bb 0-0LSP P @S000 0-L@P PuS000 0R0 D1 H 0-LP@P0 0D MJ?P,0  0"R   0-L0QP)@1 Q 0P P0@ )T 0D000Q^0 0P |0 Q P 0T@PD P ( 0@T@PP2Ab -LM0SP`p5 S P@ T  <@S0S0 0@T 0 0 S @TW pPD @T   @@TpPAb p-LM`0PQ \ 0 0Q \ p !UP0UP0PUP40@ PP0000d#P0P0C\ 0  "!0 00 l0C& d 0 "!0@ 0 Rp p2ܹcccc0 p-LM0(@KP `hFP0  p0 -QLMp@G P0 S  0R`0S  0REP,` Rڐ0V 0GSH   4L10S0S0P 0R W   Q0 PQ0ba>0>0  00ab0PP0<@0 /000B04 P 0S  AF -L8C8$M`,PPKS``@KC\, 0 40  0  "!0 00 2C&  0 "!0x"0 RPK@K 0 @0@0 ,@4 00pR000 00 2H@K\1 pǏLpPKM20S@#-Q QPn`3% NP KW/ M0@PpK- M"M2 0S @##mSPU`!q p0奎 @K3' M M,@  M4pW 8<@K  P à ]C@TPa`~ pà&M@K0 M4@@pK Mql@Bܹcccc0,%b 0-LP| 0\@ H 0hSE00H@0@- @P0P=9@ =C 0 0P=9@ =C0 0 S  0 \00Z0?B p-L Mp`@PT 0X L2@ OP0 0 pPX100a`@Db0 00CS03@Db@-H1HAHQ0 `0Q000(!L00q`00 C \  0  "!0 00 0C&  0 "!0 0 R@豶d0^ L L0L0lS RL0L0cܹccc0p@- A 1 a0P0 0C ^0 00 0 S0  0S00`P00C\ 0  "!x0 00 d0C& \ 0 "!08 0 Rpp@J갬ܹcccc0,0 P L0SPᴬ -LMP`p P@@ 0R,0 jI#긬!(0 R0S RḬ - L0 P8! -LM0S7 䀟` PRp@ f  P` RU@ 0PSU00000  \>U@0S븬l%bK@-x0 p \ @ 0S \00  0  0@l%b0@-P@Q9 P7 SM ,0 4 ^-0$0$0$h$h$h$h$h$h$0$h$h$h$h$0$0$h$0$0$h$h$0$0$h$h$h$h$h$h$h$0$0$ Q \ 0 Q \ 00 0Q Q \ \ 0 Q \ 0D!D 0S -L M$$@ O 0@u/0Eb 0-LP 0$O/@WN0810Eb$0$0$ 81081 0-$0L8!PR @$@0$ 810CS810$01Eb -L M@PD^`$P T T,pKX* !, 0 $ (0 1 $ 1$00$0 1$00$0  1$0@0$0 T  0000 0BPP BP , $00$0 $0 0$0 A-P2Pr0@$01 0PAa0!000U8<0b 0110 010@ 1 10 0 10110 010110 01Q d1!4 Q21U 01(10(1,1 0,1(A00C\ 0  "!0 00 0C&  0 "!0 0 RA(1 0(1 R,100,0,000,040S 0 0S ,07,0,07cܹccc0D- 1B#20R00S(1 1(1R p-LM@,$PP `AN @,1 0,1! P(1 0(1101 !,1S0 1,07,0P RPp 0-L$((10 0P000S; 3S* P@00C\ 0  "!0 00 0C&  0 "!0| 0 R0j0$!8< $!S08<$1 $10ܹcccc010 0-LM$@$!1!010P8<$1 J0PvP 0 0-LM$@P1 10 1Q#P0 K @P0 1101  !00 S 101 !01  ! 01 K 0 ! 1 0 @P 0-LM$@P1 10 1Q"P0 PK ^@P0 1101  !0 S1%Fτ"0#1%( 3(F @P -@LQPp% RP` @ 0PTr 0 R0 b0h -LMPS`p$ $1@T 40S@TX, Ġ T\0P V RD@T 40S@@T,  0P V 100CS|PAb P-Lp`P# #` lP @T U 0 V  V 00V U U U @@T7P@ U 0 V V 00V U U Uhi -PLM@' P h p-PLM`P @T U,0 ,0  @@Tp@ -L M,A P`p$@,10(,q$ai%0$!<  < $!@ !$10$1! ,1V0,1 0!(10(101 -LM@,`ZmGt G, 0F s(1\$1,10  "0S00ć D1 RF 1381P1%711, 0Z1 HH20  10S] S. 2 T2  B0 0C\ 0  "!0 00 1C&  0 "!0!0 Ro ,   V! ^ U 1010S  5,0H!Z101Z 0S010.02S200ć,   20Z00S,10Z00S H1,0V/`1 5^ 10Sm2ܹcc bacc0 -LM`$!,13P & Kp!(0@ !, , $!> S_ $0" 1 S S  hV51 0140SB  D1 RHV?, 1 A!P0000~P0P0C\ 0  "!0 00 1C&  0 "!0h!0 R ,A1V0 P000HAP0P0C\ 0  "!0 00 0C&  0 "!0t 0 R, b P_ 0@$!C101Zܹ߯cccc0, H*010,  -1LMP@0! p$@ !$1S0,0 ,1(00 0100 ,0 Y`a 10  101$1$  $!1  ,1V0,1 01!(1 0(101q00C\ 0  "!0 00 0C&  0 "!0 0 R0 <  < $ Q001$1(1,1000,00 0 Oo bܹcccc0 0-LX, 0*00D0, !@P 0h$0$PPZ -<#LIM0,  ,0 Pp  006:D R @0S Ÿ,0 S ,p0  00 D@K |"01p 40dK- 0 @ P RP` @JK 0rP`80S ` 0 (@oV Y, $16d JKGCK 0JK 0ST!L000Y/GLi0 pK|` KI$t` $1|K\0 (!T` X 06P0 &L  Ơ0H 墅P` 0P`, 7[` pP`P`S, @ (0 RK: b{bZT - LN -LM@P`pCT0EP@S8A@A@A@A8A@A8A8A@A@A@A@A@A@A@A@A@A@A@A@A@A@Ap $ 1 01410 b4 1S01 Q0 0 0S00 0S 00 0 P -QLp`0S @PU 0 0C W0SUP!P P 0 e00 0@epe0 S)<P 0 0S ; ; 0-LM0PS- 0SC)@ 0R0 0S S 0 B0 0@0@ 00 K` d;P 00 P0-LP@T*@T:P 0S* !0S:0D00?0 -L@`p PP0 Vp P  00 00S0@ R0000 0 p-LMP @T @Tpp@T ` R0000 0 V@Tb 0- L@PqP( 0 S600p $0R0000 0 >p -(1(qLM0 P P 3a@T @T@00C\ 0  "!0 00 0C&  0 "!0d 0 Ri0`@T @Tcܹcpcc0 -@ML0(( I@ 0I@HbFb -LDM0`SP\` p} 0B Sw!XK9P@BX00C SeH$J,J4JLJm:04,4 G0ğ0 L@P00W00SP 3 0u 0p3cßqßoßm3 ̠|ße 0[ 0V0 S<0U KOK X8PP3Q 2R  04L 0@l2 2 (2 "0L 0`X"T"P"(2^ 2R  0kL 0+ANK 08 QPP8!0BSR L 0@wx!t!p!l1 Ϡ7L 0eL 0^L 0W  0R 0 PP`fL 0?-= A bl FbGbFb0Hba p$bEb,HbpbTnba04%bzb(bTsb0t`l'b(tb~bXtb$X -L M@ \QP@@ 0LS$TDTLThTtTTTTT0U8UTUUVVV$V,V2 -1!0 1!06!0 0b6 :CPx10Sp19PX1X!l0  $!A 0@@10S $KP $0-̀0S p0 pJP0dSd00SV h00SX0T0P0L0_ c <`c|dmb4HbFbx8HbFbHbFbHb 0-LMPR@@ K P0 0R 000, p-LMP@`  0STRPPP  60T0\00S p 6p p -PLM0 @ 0 SR0 \K  0 e6@0@-RM@P 0-P\ \Ѝ0Ѝ0@ p-LMP@`  0STRPPP  160T0\00S p 5p p M-PL0@ 0 SR0 \  0 6@ -LMP  -LMP -LPp` @@U  0S*T S 0Z030#WQ$U T 0S: 50W0P00S 450 00@SC 500@C -L@`pP}@T 0 S:U T  5 p-LMP@`P  0S:T\P P k5 0T0R00Sp 4 p p 0-PL@P 0 S:R 0\  >5P -LMP@p`& V00P &5P P`FU@ WVX X`F 5PX@PU0h00h 0  !/ 'b'b -L$MR, 4 00 8 p04pS,H0 D Q ^0S`@0  Pq4 2< @T 10S Uf`|^` `<`d`x`_40S$ @T< R < 82 ,0S D  0cR0  080S (4 R " D00 R= 0H0S @0WSD00D0 4X 1/#4 4P@  Bph@ BW*D B.D 8L Y/u4PY8/n4PBB~G,0 D1 RD1 0S 40,0 D1 0Sl00 Q0 Q Q0 SSPS ``@ 8 T0AbAb p-LMPD1`   @P 0`?1 0BRSo1 @0S1c 0$0$!018,C/SH? X"10C1H0S40\2D1 ?`"D, ?  R; l0h2x0S0 1l2|0p20@SD1  Q020QA:0 @@ =/@@ |B3:0 @-:0/@P P0p0h2,0ᙷ@S$A,A0A8ACs:XBd{ -LM b:  0 @( 00@ 8 $0@ @DH 0PP@\1X@ ` (0@d0, h 40l0H0S40p0D1 0S40t0D1 |@x 0 @ 000 00040|>0 -D11=, , D1 R' l00x0S00|0|0@t00 @ 00x ̊ |0B0 n  .0t@! !$1$1(!(!,1,11 3 V/ M? 3 ? N?D1 M91 0BRS01111D 0 R`00`0D 0 R`00`0 R P  =100CS> @0.10S1t 00K z_!08 K0 X, 84001! 0nO 0rϊO 0vO 0~oO Ί 0O  $0冏O !(0O ,0O 00O 40O 80O <0O @0O D0O HP00 TL0@!0S,0 =9C =C0 ,0 , 00 2$"0 10C1,0 # 0$P!01 !0@ L1@1  00 00!!00  Q0V/@1 >0023Z6?B1 -QLTMQ0DSP Y 100CS,0   V 0 00 ^ 80K`0 \ H D T P0K p`KX @P <  XKP`T   40 T T4,0p p0 8 0px x t 1p  0APd l 0xSv*dKt 1P`sxP K0@@ h0K `0 `0KH \ X0 T D <  XK>P`[h0SS  PK:#:Zc0 `KX `p \P T HP D @ <0 XK#P`@P@*0S @T:0l00S0*d A1P`* d0 T h0d 0h0   `/1P` pd0A0 d0 p x0t0Qx0 t lR:0l S: ` 0dKt d0 1`,0  TT070- -LM@ Py0S| b PU ,;PUPhPa2x"@`@  @SL2  MP@U`@ p ,0"S0f"';,0 @ `U=4 8  @ 0H $ P ,0X 4 ` <0h D p0L PTpUV00PC 00   T 0PU ` ,0 @=4 8 0@ 0H$0P ,0X40` <0hD0p0L PT`UFbmbmb|mbd -LM p-LMQP`@ \0  Tph p p-L M\@` Q 0 pppQ0 \"\ 0 1PU P P 80K00,0 $0080pp 0"pp鬡 -LM ğ4^P`@|3^Y 3C03`  S 00C\ 0  "!0 00 3C&  0 "!0d#0 R(`00C\ 0  "!0 00 2C&  0 "!0"0 RVTꌢ20 >  `P0 S0@@0X@0WP ,0!0R,0w  $10r PUd0Sp  1 @00@0 a0 0C\ 0  "!0 00 l1C& d 0 "!0@!0 R1414!, 0 ,0# =U,0 W U !R ,0 $10 1PU $ E00P#X  0S010\Px_ bnbcܹc0Sx x000hh ('v,0  V?Q1A 11 lba_ #bD t0< 0 0S0#0(0 R0 21lba_ p-LMt0@0$S$0# t0P00`00P0P0C& R 00#!000 t0C& l 0 "!0H 0 R01S,0 և Ƈpiܹcccc01@-@@@@@@0 00 00@設mbmbmbmb -LM0@S`p>0S,0S00S7  0PS0U 0S PPp0Si0h 0T0S <4sp0봭<X4>lp -QLMp0 4 ( ,  0  Q0$ ` V P0S 0 S 0B8S$P0S`V0 R ,Q $0S PP0,`@08JC8 1!Q4K 08SVmb Q-Lp 0  Q0`V @0S 0 S 0B8S$@0S`VP08JC8 1 !Q 08SZ00mb -LM|P04 H0( 0 `00 ,0 $0 JPp0CHAA0)P4K 08S,꜋ -@Pp L4`V 0 h$W  0鸭 p-LM @`PU 0 php -PLMp 0 QP @@YP` Q0S00C $@@00 PW2  X  0P @0S S $@0SP i 0R0 S0 0R,t0 S00mbmb -LM`@/PpU PPN N(0 S0 (0 @00B 0d! P7$` 0\V@@Tʄ@T@ P fA(V 0 !R0,0 4 x,0V|$ 2S00S \0 !R QLTt| -LM @`P0pS[ 0S-RP WdA0S S2 $@0S R 0,10  0P , 0Q % U1S RR =00000S Q0 0Q B 0 R00$P  mb 0- 0L 0PS-(@ 0 0(0P (@ 0- 0L 0PS-(@ 00(0P (@ 0-$0@SPL @ P4  0@ P0 0h'@mbD -xpL@`T 0P$ R U@U00000 mb 000mb0  B Q>mb -tp@0L P `R $0S@0  P PT0mb p-p0LM PR` $0@S T pV V -P T8mb -QLM@0Q 0AT (00@T,00,0,00CS,0" -0LM@ V,00  0@@mb-$ R$ $@@0^*$0S $@ @0S:$0S$$$@0^:T T0S$0S$0S$ $@0@ R:^:T T0R$0S82P *0P ": -LM@D 88#| , `0 aPDq <u8q004!01`  ,0 0< T` R6Z `T<  B?+$X Z 2 8`(0 0,8(,@`(P( P< (0R0 t;|@T0  0 mbmbmb P0-LP P0 RD0@T ,0&P @T000mbmb -LM@ @000000 -LM00@(  e#  0 Se Rd}X% U%`EH00< @0 00 0@ ,mbmbmb -LM@ LR 0@00  0 $0 BR  ?mbmbmb 400Sh40 -LM40@0CsP40B ,Kh(0, 0ahS00  `=94 = B4 00 p004 0pQ=9A =Cpp 000K Z UPX8@` p@0ʏ 40K*H0P@ ,?B  -1Qp  80PXLH`@ @`苫0p0t0p0p0C& R 00#!p000 \0C& T 0 "!00 0 Rk铏cܹccc0 -LgMℑ 0,0 =$ D!(0("4400@$04 T` 0$q$J@0B*  P0 200-K0P$0*K?K "R .K 2 S0 S |x0L0 ,0S \,SL00< %4#: P< Q$  @0@0  c  Ba  @0BSH05 :P @ B Q0 : QHS0#03 LR0S4 L0d0f s  *<R0#03^0S< 8@ 0P L<0 0Q\8@0P  000 0P& ,#,0 m0@4 L , D  -L @`PBpF PI \*PB R?T+ 0T! T U *0DQ 00 pp0000D 0W  U*00 U R000 Pp  >[L t  -LM0@`p& PPpU \!0W P{P  P @R000 P0`  W p`00C\@ 0  "!0 00 t0C& l 0 "!0H 0 RT00D ܹccmbcc0 p-LM `S 00F  00 R 0  000phA!P 0 00`P0P0C\ 0  "!p0 00 \1C& T 0 "!00!0 R0 p镊0 0S0 0  @ P 0 00 P0P0C\ 0  "!p0 00 \0C& T 0 "!00 0 R phYܹccmbcc0 -PL M@ L 0@@T  @T 2     Q0-L@0PA 0R x0 0 PR0 R P P0000 0S0SS RRnba0nbnb-0x0 R0  0^0\\00 0RP00nba0 R00nb0 nbnb -3LM0 3P p\`쒟O B00C\ 0  "!0 00 2C&  0 "!0t"0 R'000\  AQ 0 `\ @1@!T P` 0Q 0Q`0Sf@0T✑!6@P` 0R XA00C\ 0 !$1 0!C600! 00#!0 0 R(@00C\ 0 !| 0h C600\  00#!0< 0 R#cܹcnbnbcc0! -0@LP0A p 0 Sp) `P00C& R 00#!000 p0C& h 0 "!0D 0 R鴈F"cܹcnbnbcc0 p-LM1@sP` p0800 0< 00 00 0@0C& R 00#!000 l0C& d 0 "!0@ 0 Reܹcnbcȭnbcc0@-0@0 00Q000 0 S0  0S00@00C\ 0  "!t0 00 `0C& X 0 "!04 0 R@ܹccnbcc0<0 A P 0-0@ LRPD0!0u 0h^00000 0nbnbnb1 -QL@X F1Q |1Q l1 \\10 Pq 0 Da $PB0 0C\ 0  "!0 00 0C&  0 "!0 0 RU0 PPꑇ0Q 0Q T 0  0 0S$  00000}ff@wt@nbܹccnbcc0~fvt00  -0L S@0000d 000000  xx dd PP << (( ( , ܹcc!@-0 S@ &  00C& R  0 0#!l000 X0C& P 0 "!0, 0 R@cܹcc0 0-0LS@P00 > 0R03:00S 00 0 0P000 0 0 p-LM0PS`  0R:0S00p@00@0@-,M@ 0P000^03:0S#\ 0^ *00  0S   @00 00 00 0000,Ѝ0\ 0^ : 00  0S   P0@-0(M @00 Q \ 00  0S  0000 00 0000(Ѝ \ 00  0S@0 -0pS0`0C0D0< L0bD0 R000Q  0S00``80 0C 80 h2_h0p)@0P0  uP0P0C\ 0  "!p0 00 \0C& T 0 "!00 0 R ܹccCXh05|%03h05 5P%(PB2|P5p% `(`0<0`PlP t0RxPPPPPPPPPP 0PP00 X@@XP0\0 @X (0 Pe<<L 0 P] 0nb 400C40 R000 0 0  R000@ @0@0C\ 0  "!0 00 |0C& t 0 "!0P 0 RZ P9~(ܹccc`cc0  | -LMR@p R0,0 v nR 0Z0QQP1! 0P00 ,00,0 P U Pxa00C\ 0  "!D0 00 01C& ( 0 "!0!0 R%Y00U00SP P ,K P `0 S %`%!* }RZQPZ00Q0S ܹccحcc0 -LT  -LTP q 1`   0@ @T d0 .X@T00@0`00C\ 0  "!|0 00 h0C& ` 0 "!0< 0 Rh>}d mܹcccc0B᜕0 L ꌬc0Lꌬ0  t8c0?t -LM@ 0@|% I% --LMxP0Sp`A \LH0 R jIBZ(@ 0@nb%Hdc` -LM@0 HD00S S (SZh?IhZ%l% --!LM AP00`00C 0ppP0P0C& R 00#!000 0C&  0 "!0` 0 R P0\ 0 lpo|cܹccc0nb p-LM`0@< 4PK0 o0\ u40[S  c0S >\ 0S p b@T& --1LAMP0` 0ppwP0P0C& R 00#!000 0C&  0 "!0d 0 R T0\ 0 pD{cܹccc0nb -<1`@P,1Pp  U00SL 10S@Pp00U00S&$10V00S VV 0 RW 0V0Q00ShqXT0/PW  0U00nbԝnbp --L0LM,  D!0 \  b,0 D1  R000D!  P 00CS0T@b -p-LM@TP` 0S 0>p ^*P P` --LM 0 --00LM Q0rН -p-LM@XXP 0`@^00@ R `pT`nb p-LM@\PX`  0PP=00@ R PpT`nb --0 L M@T@ K ( T0   -L M@@T ( 0 K T0   -LdMϟt  Y  0R p h P l , 0 h p H X H0 %PP p H0W0H0 X0 0  X0  pX00Y00S 2 H0 0%SSRs HT \  pH d ` H L H L  0BZSU<!!h!!!!!!!!p!!!!!!!!!!!!!!!!!!!!!!!!!p!!!!!!!!!!!!!!!!!$ 0 !!|!!`"!l"T0  0` 00x0 0S S S  h`d `0V`S`T`T \ @fT@Dp PX0W0  X0 p X00Y00SP } T@D`Q X  X p X00Y00S` e \r dh @bT@Dp 0PX0W00  X0 ` p X00Y00SP F T@DhAqh  p P0W P0 X0 0X0 > pX00Y00S & h  Brh T0 \ @fT@Dp PX0W0  X0  p X00Y00SP  T@Dʭ:X ,0S ,KIG\@fT@Dp 0PX0W00  X0  p X00Y00SP  T@Dm&`  !cT ` X0p 0W@0X0  p X00Y00S  XTX p X00Y00SL009L  D@K(0`xD0[Sx  p X0W0  @X0 pX00Y00S v 0S  x0@| Tx0  @T@D -0@0` |X Qp <, W@X Q p X00Y00S F x !0B^SX00T  X0 4 pX00Y00S + x0 x0 !0B^S| x@Tx |Q X  >X p X00Y00S   ZX  Tx !0B^Sx0 x0 !0B^SFwD@K%RD@K%OTT@ 0 P`'0 0 P`!`\H 0  H0 `0 HT T 0 0 SH\0 ܥ0c\0 H0T T H+0 H*QH L  L@00L S H L1H 0 L0 RL 0@C0Tppx0 @0Tpp000 hHT0 0T0 b@HL 10L 0 B0@C RH \@ YTT T  m 0`00 Vb WT0dp 0ãT0 d00Q0S-0KP0  R0 :R x3P0 uh l% >P &B`PbP P(K 0a0Ch0 1!`PP0aP T  00S000aP V0  P00cP0 0 `PV PP000lP  U- Pu`` TT @ 0 Po0  PoTT T  0` ` wT00   T@0 00  0 P`P`T00T0 T  0`  T T@ 0 P`0 0 P`l T   0`00 T 0 00S T TT @ 0 P`0  P`0DK P 0 h0 ` D K b&& &(&0&L&`&h&H0T @H lR H  TT0 0%T  0X0/ T 0X 0 T@ 0X 0 0 X0 00Px0L0  PuoL 0  T0P` l 0x T0 L 8H  V t0S# T   0`00 V0 S -Pu`` TT@ 0 Po0 0 PoR, T"x0 l L0  0` T000S T Vn-0Pu``0 iTT@ 0 Po0 0 PoL R D0KD KP0 h ` t0Y00S00P0 P 03R W P  P PaPh hp ` Ph l  S -L܂ -@LM  0- @LT0TP000@, 000  0 0 00嫏@0@0C& R 00#!t000 `0C& X 0 "!04 0 R0juܹcccc00@- 0P^c: 2#80S$H*,0 9,00 0a -LM,0P20#0R0Sp` 0Qc : <"K#80S $H:@@0S 2[02KP ᄏE-Ƞ@0Sp0 p `P@ 0@s  0R0 s$0@S$P10 R$0 @$0@S 00C0|x p-LMh`@qP T0T Q 0QUqU@@0pv[0@Pꄮ&&,0, 0$ Q 0÷ጮ(ob -LM0(h h`} \@\ 0 0S<:r 80  j 000gob(ob000 Q 00ᐮ(ob 0 S-L< 800( S $S 6h2@Tt\& -t0@LMA \!0S(((((,h$h-@T&' -LMA0@Q!ڀ!0Qx @ ^d!00^G@HTHi80 -LM`@PpP  0 P  ,00,0 -LlMpW`Ak Wg  P 0 00 4 HP Dp , P9P8 08 8 0PSD^BQ80H K P0 8 ^ pP+ #P) Z" 080nP0 @0 Po` 0 R 㷤,0( 0C,0 ,b 㩷8W㌠ PK -LMh#@0,0 uPP 0 `,3V $3V &8yy W9,0W0,000 嬐KV&?0W00S 002Vd E2V/  0 @T&?0W00S,0( 0C,0 R C2 ,0S ,0,  @0S$ @<00 0 0@0c01V 1V00 S00000 K 00D0 S00@0@0 0S 0R0cҰ0 ᨨP@ D1 $@< 0 @ 0 D ;tWp   P@k   V 000 00 y bf f |f{f@-wt@}f~fvt -LdM0t tP!0⣒ Px |  7Q`p ᯢ@ 2  P` 0H DP X` T0 P L@ tPt P t0 PtP\ ` pt,0`@0LX ,0 x|0Pnx0Sjt0S T 4@0  , @ 0S' c@00C\ 0  "!0 00 3C&  0 "!0l#0 R g@0,0 0DD#Fc@00C\ 0  "!0 00 2C&  0 "!0"0 R.X x,0#X@0X,0 tQtQt  QL@0KPآP WPT QPX KHgh@K'h`0\ `0K pK l 0pcPl=9 A =p p l p l0 p1Rh!002c2cEA\ d0S`K P`KgPhK\ d0` h0P=9@ =C` \ ` \0 D }P H vP yL oP r@K<0K8 KH0 40KD X0 0 K,0K@KT P0 L Tsbܹcccc0Psb-Q?B -L$M, ,@ p8 0 4 < H H 040ZD 6D2a#0S0CP8c% U#P@,  ,<0,0 R,  1@ 1 @ 1,0( 0C,0  Z<0H0S<0 H 0@  錆E 0-04PLS@ SP0鎦P 0R0000Psb p-LM@P< 0Cw0P04 A !P0000 1R, ,0@@0,0`P00C\ 0  "!0 00 0C&  0 "!0| 0 Rpph f10S D0(  ,ܹccPsbcc0Tsb -LpMW,0 P`*0 S0!?P@  ,00,0 ,0( 0C,,0 0Sp`VP:,0pp 00 -LTM0d lp0dS0!h XH0Kp0   Pl dl pPP *p0 R0:z 3 PKBa2a11J"c11L0 P PXK^L T0PX0|#PP L =9@ =CP L0 t ,0H#@0`,0h0p nh0Sz# X@K9XP0\ P K`K\ 0`cPl=9 A =` ` \ ` \0 2Rڠ"002c2c3t0 R2@0  , @ T0S' Xb@00C\ 0  "!$0 00 2C&  0 "!0!0 R e@0,0t0!F5a@00C\ 0  "!\0 00 H1C& @ 0 "!0!0 R"Yc ,0#Y@0,0 y Y pHKP: d0l pd pl Pd~t pL T0SO0L0 P0 2 0p  Mb?BTsbQܹcccc0Psb; -L M`(puPP@[|P@Q,K0 K!P@J,0, 4K,00$P,00 K000P@040 4 0040$4 000<W0SD00CSD0@0 (0+Q @0$Q0S WpW Q @@  81PMt 㥌@0@0@(}0@0W<@0Qe 0p@ < @0^ <@0AY*0#p@@ 80Pt i@00@0|| 0/Pp@0 p@0@0@0@0<@0 Xsb--0Q$ 0Q |0Q 8000T0Q L0Q0800S@0@000@0}ff@ s@~fs -LM$@pA`|0 Q>x  0,0CS0 p||&ԝT@b -LM`lpvO0 O XIX9夠 P000J8P00C\ 0  "!0 00 8C&  0 "!0(0 R"  0@D  D @0言 $P ";p05  R @0SW 0S t)W}p ^W~p\W; A0GS p  @ p p  pWpW p 0Wm0D"0p" vW Zqx 㱪W Zb0xW W W|Wu 05 0G (0r05WZ   ^DAp09`+(0S.@i20W0S 6 ^  y0ph 0@$  $ #\ܹcccc04tb 0; `0HSꬊ'A0H\XS X #@0`HP``d0\0d0P "30 X00S =S  0@d 0 d HPP"0?0SȋЋ܋QA0 0(!)^  so  0@d 0 d  0=`H kPPT JO  L-0c Z0 =P0`H !j̐0Od  d `00C\ 0  "!0 00 l0C& d 0 "!0@ 0 R-Z,tbܹcccc0 -`dLlMVpP @>V<>{8>V4>5w:D| 0S , x0\ (1$1F0S ڨ-=@uP@ =VH g=V- p=V Gx=V8 p=V ``-0TM00p +p 00C\ 0  "! 0 00 P_ -LM0@  (0 P0S0 -1aLMp @ P H0Spp% 0  0S H0Spp 0  0S p 0H PP @p00C\ 0  "!|0 00 h0C& ` 0 "!0< 0 RTcܹccc0 0-L@PP 0 -1aLp  P @ (QRQLp0 >;-p0.(Ap00C\ 0  "!0 00 0C&  0 "!0 0 RhkTp0m < p0ŒHQHPዴHP  ( cܹccc0_ x 0-0(  SL@P* Up0@0  (0Sژ0  P HG P 0 0S0Pp0@0p0p0@0p0DUp0@0p0 0-0@P L p00p0/P0P0C& R 00#!p000 \0C& T 0 "!00 0 R00hScܹccc0 -0LS0 -L  -LMp@  0 Q   m0 ̌0p"'P00C\<  0  "!0 00 6C&  0 "!6  Q<2S0  <00006 ,0S D,eOP00C\ 0  "!0 00 5C&  0 "!5  Q02# < O`P00C\ 0  "!,0 00 5C&  0 "!4  QO$P00C\ 0  "!0 00 l4C& d 0 "!44@  Q0$|0D R 02 XRd 0U0"00aH0 S/X X!ڜ0PH G=P`0ß=p0Od P d eʤ0H0 SXi02 XR,H0C_"P0 B H0 S;4"p"2HpP00C\ 0  "!t0 00 `2C& X 0 "!(24  Q0"800S#0NP00C\ 0  "!0 00 1C&  0 "!`1l  Qv Ntd!?0PX_]P0pH|H0 Smx R1#K0"尠P< ? 0 , ' x0P$ 0! (1$1F0S  㞜x0@ t@9P02<  q02nN bܹcccc0- b,tblb -LM 2P0S@ 50 -R" B?D0CST@0?0S -0B= ?  8CRԡ!0p000p 50>*,Kmp =P@ , P@0p 5*DA0p 0 0C\ 0  "!0 00 0C&  0 "!0 0 R-=`b0V``V=J`VZM0@   p0  :p0\-ܹcccc0 Q0-L@PA  UPE0 -LMPPc p``1 (`(pK  !P@ (N P@`P@ (= P@p0@:p00 0C\ 0  "!0 00 l0C& d 0 "!0@ 0 R0>0=*Mܹcccc0 0-p0@ 0L50 "20#0 P0S @P 0P0PU00S P ^U?@0hU0 -LM@p0 t hNwx0s S0s-t0 A!`?̠0 S S \h\ !h3 3#2 11>gfffON -LM`P,"0$"111;/"b111AS|0St xQo @TPi zPP@@T10S4 S1 1R0 0l($K0, K! HAN=0S 0 $00!0 $0 q?B6c$  (N=0S(0 ,0 0 ,0 ( (0?B6c, |01c1 @R  1P2;P 0 <0/0"bT uDꘊcQ.$.@.`.h.t.|.?BHh....P0@-0 1@1P0 SR0C BSRP 2P# 0DS00 ER  R R 0R0S,  ,00 4 40R0,0 R4 40R0Pt t0RS -!qL`0@ 00p P( (R3 P. `A`00C\ 0  "!(0 00 1C&  0 "!0 0 RrK \@`00C\ 0  "!t0 00 `0C& X 0 "!04 0 REKcܹccc0 0-LMP  0NnP>T00  Dtb(tb -p1pQp`L 0 S@ 0>B0H 4q`00C& R 00#!000 0C&  0 "!0 0 R B '( #H t00 h @0T0 0@JW@cܹc =bcc0Dtb(tb p-!LM0@0C0 hQR 0\10  0 ( H 010 ` 0 b1B&! 02 S41b1 R0@@00@@`00C\ 0  "!0 00 0C& x 0 "!0T 0 RpphTJ>ͅ(tbܹcDtb<)bc@)b(;bcc0 -0  Lτ0 Q l00  (00H >1>1=1p00|  x0S0 0h0$0(Q(tbDtbLtb -LMQP`/00CS 000 Pi١-p0l0h0PpT0T@ 0 刢 pXB0E/>1 `W>p 0 0P0  )k -LM0@S0S000A?T>N> p-<1<LMP ` @T Q` 0 0c/.!1CQl 0S0000DS00 0@P00C\ 0  "!t0 00 `0C& X 0 "!04 0 RpIcܹccc0 -p1pLMR`PpL0S 0\@l0% @l T@ <00S 00`d d0Vp /0SS@0 00 0C\ 0  "!|0 00 h0C& ` 0 "!0< 0 RiH0cܹccc0 -1qLM @ `^ QU 0P e= ^N ?>1L 0S10`\A00C\ 0  "!0 00 0C&  0 "!0 0 R^N 0\` ^N 0 0H`F V0`bкcܹccc0p@-H1HQ` Q000 0 QR @0Scc \ 0S00 ll 0Q  RR  @`00C\ 0  "!p0 00 \0C& T 0 "!00 0 Rpp@Gcܹccc0 -P"PrLP0@ 00 `R^ R0SP 0 0 0` 0 @\   ; ?>1 @  0 0Q00  0AP00C\ 0  "!`0 00 L1C& D 0 "!0 !0 RG?>1 @ T P0 @P00C\ 0  "!t0 00 `0C& X 0 "!04 0 REGcܹccc0.Rp@-@) 0/.PaCPL  10C00&0b 0R000 Rp0a # B0!00p?>1 A! p Q-L`Pppā!000 R- R0SW 0 0V$ R! 0 @cR@cT@  `dPp 9 00S 00 0V  R@0 0C\ 0  "!0 00 0C&  0 "!0x 0 RF 0 AYDr P0ܹcccc0.@-0@S 0 00\S Ch0P 0\Q 0 0c/.!1CQ<0 e`@- `0R   00\ La/.!0AS1@ e` p-@1LM8@ ` R 0S00C0 00B 0Q` 0n/.!1CQl0S0 0P@00C\ 0  "!t0 00 `0C& X 0 "!04 0 RpEcܹccc0 -!LM0p 00 RAI 0S 0R/ A0 0C\ 0  "!t0 00 `1C& X 0 "!04!0 R,p E@D`KPDK@0 0C\ 0  "!l0 00 X0C& P 0 "!0, 0 R \Ecܹccc0 -`,0pD1P LP@U @ Ck 0m @Lo -LM`,0pD1P HP@U "k 0m @+o -LM`,0pD1P HP@U k 0m @ o 0-LM@,PD1 P \0Q T0Q  0Pm0D1 Q 0,0000at qt @-,0@D1 00S   @m@F 0-1!LPS 0 0S-@ T* 04@S!T:PU R0 0Ո0@0@d@ ᝩll ᙩL㛩P0h闩 PtbDL_@wb 0S 5`1P1l0:@ 00c|0 S01W01R@1@!  00 0 d dR0 0pd0 UX XP5!000PXhAh1p  \ P` 100A00C\ 0  "!0 00 0C&  0 "!0 0 R-30  0Wp Pp $cܹccc00 -LM0  0  -$1$ALMP ` 0; 00    0 5`` 0`pP00C\ 0  "!|0 00 h0C& ` 0 "!0< 0 R2崵cܹccc00 -LM0@EQ!` 000 1 0 * 8p@`00C\ 0  "!0 00 0C&  0 "!0p 0 Rm2YP  0p-ܹcccc0 p- @LMP 0 000 P0P0C& R` 00#!t000 `0C& X 0 "!04 0 Rp2cܹccc0 -1ALMP  9p 0  0%p p`P00C& R 00#!t000 `0C& X 0 "!04 0 R1cܹccc0 -L,M0 00 , 04 0P0R8 H0 @ 00`p`W50 0S. D  0 000D0 80S 0S 40040P @ 0 :00: 0  0倐0:0,,,<$ P 000000 P0 0   @ 00R0S0000  C 0C0S H0 SL  0@WvVs@Pp@0/ 0ORQ8Q00S H R0@0ZZ: P0 0CP  0 0#!: 0 C60 0t: 00#!L:X Q@,0K<0 `8Q ,@Tk: 000 "dPP 9 !!$ !0@@1@ @) 0 0CP  0 0#!d9 0P C60 0@9 00#!9$ Q&܀@@W00 Z00SHX00Z @@P d , T00R00S 0d0  8 堂8 P @<0P, `p000dW/= @0:0::30 |( 00":0P0 0CP  0 0#!2 0C60 02 00#!d2p QXs /0:0,"P0 0CP#  0 0#!1 0C60 01 00#!1 Q .lp!P0 0CP(@1DP0 0CP940SW P0 0CP'30P00C\  0 0#!0  0C60 00 00#!\0h  H P0 0CP | 0 eܹcccc0tvbXtbDwb4;70770L `00C\ 0  "!0 00 1C&  0 "!@1@  QZ )0x7#|@L 0@@4 0   @Pp Q! {pZ00W00S@ PT ( p-LMQ@P ` Q p T  0pQ -L4ML@2 @022P02[tat!p000T2022GPPK092[02,0$0@p00C\ 0  "!0 00 0C&  0 "!0 0 R 0 00S<$)0,2P%ܹcccc0 -LMX`p,0 P \ 0 S*U  ,0K0 0R ,R "R RU 0S0 R00000 \ 0S ,0K0 0 P R R@R1R8 R R  R RU 0S :G@0CT@SW(B\ 0-LM@ KPUK0 0PP  ,00C,0(0, 0$EPT 0-LMP KP@ 00$t @,00C,0(0,  -LM0`S  ,K(PP0 KPP#0 < # #000$@0PT   3S#PM 3S0P3G p8 P@ 00 ( 8 h\0K4 K$@PP40pt0 pI80 00 0 00" 00$p^@LPP QN ,  0R,0  CPP? 4>0,BB(P\< 1 00C\ 0  "!0 00 1C&  0 "!0!0 R ,0( 0C,0,4,K PU0 (00(00,00C,00(0 ,@@0603 0R3( @  (00(0,00p , ~3SI3SG x 6F 0 }PP3S83S 45 50#0$岡ܹcc\cc0$1 -LM0@( K,0 PPo( $`0A?AS ,K0APPQ,PPK0A?AS` 聟! 000  3Sp6@!F0p|PP 0 3S U0S3lA0 0C\ 0  "!80 00 $1C&  0 "!0 0 R000( ,00C,0((0,Pu,X~%(0,  B, ((0,$,G~,00C,0((0%,;~ܹcccc0 -LM `P ,KpP@  0KP@t( 8KZ4K >P@d804 D0 0040 4 弑<K, 40$  >P@G<0 < 00<0DK<00 $ 80,0@0 cP@+0SF  㰫P@!4 (00(04,00C,04(0< (00(0<,00C,0<(0 Z,},}_<<w@000 DW<4o@0,0 0P Z,P~0,P@ \ -L(M 0@` @Kp8 0 8 K4@ , ( @P <` p9 -LdM0DK`p  P@8 P#PPKP !<屪P@0 0c0Q P0SX0   X RX ũPP)X0X0 XK 㺩PPQ `V T0S*``UL 00@L H /L0,  B, L(0 PPTP,{ @ V05@1 0305 w0 S@`V00PU0SX0 `cPP 0-LMP KP@ 00$ @,00C,0(0, u{ -LMp$ KaP`*0 S` 0S 70S$X  奨P` 0 0$0 $0`X$0,  B, $(0,8{7`A1P    t$P0P0C\ 0  "!0 00 0C&  0 "!0t 0 R$ R 1 0+10 ,`(`<81ܹccDwbcc0 0-LM0P K 0 P@) 0S 20$ 0KXP@ Q  R 0S R 厨P@ 0,  B, (0 P0,zK u@K P@ p-LM K`Pڵ@T(K  p 0(0 $ VP@ (GW(J9$G9(cW -L M`$ KdPPp (K 㴧PP$0$@p  P0PP (  0R(0  PP $0,  B, $(0W ,6z P -L M`$ KP@p2$!$P0 R5 (K gP@p  @0P@ (  0R(0  ̧P@ $0,  B, $(0@,y 㶧@,00C,0$(09,y -LM` KP@  0$P> 0S4DPp7@  @0P@  0S-@@TP uP@ 0,  B, (0,y _@ 0,  B, (0-,y -SLMpc  RIW`AhAh1P  \ "㬔L$P0P0C\ 0  "!0 00 1C&  0 "!0 0 R&$ R 1 0 +10 ,(<`8`1  p  wP@X`0p7RܹccDwbcc0 -LM@45P  0& S,0 0,0 -LMp45 Q@`P  QX 0S0Q0U00S3Q+Xȗܗ,8LȘ@HP|dU 8X Z  E t0S  0S 0S  宱  0墱I4o0S SxJp P `, T0 a00,L(0 0` |(_X P0S4 S0W) 0S P `QL@ 0P7W|10S   P9h0p b P X`& L0 ,0 P T,0 0c c 0,,( L0 b0b0 (0S; L0 ,0 X5+ H 0S 00 R1  0 (0    P`L00H0--0S 0  0) 0S 0S0L8+00    b,141<1xbD1 0-0LSP P0S0Sx0x Sl0l P 8 QP@ 8"0@P2070< $P1 0-0LSP% 0SP* 00t0 R R0h0hR6:0S@|@@xb -LgM`V0,0 p[ 0BSPBVFOK c`0qKA 1 堡 q fP@QU3_OKd " |! 20;;x1 0?0mK.K?P@ 0 ,0S ,,~Q0| |0 0P  @K|@P -0) b{b\1ʚ; -LLM @T`PD0 H0 l p LP D` PI pKP@`P80S&@ 0 0>P@|pW- 0R)@ 0  0! sP 0P0  p 0 $@, 0=@0TS (ʚ; -LM@ 0)R  0S S00 h1 0- @LT P P0S S 00S00 @S 0S00  0000 P0hx10 R P0S 0-@LP0S000I0h@Q -LM0 4 0 0C#q!18  `FP40 0<0 (RZLZ<@ P,K  !W5P@)0 P,0U1W<@ P0PU,0   B A8 <Ʈ8 0 4000 (RP PUJ?4PUZZ( (|R5PU<@P0,0 ,PU bxb -L Mp`0S 3R 0 S 0A#140  0a 00c<  80S \OKB2P   "㒐|$P0P0C\ 0  "!D0 00 02C& ( 0 "!0"0 R$ R 1 0+10 ,(<`8`1  'p 7 0@40X 00P (,K  , #10`K\(q 0 PE2 0s 0s 0  0@D0 00000 40 X  PXڜp0`K ۭ0 H 0X0C 00@00C0  B  P$00 00a\UܹccDwbcc0xb -LM ROqa@0T0  0:0@T@T  ` * 00C0 0*S E @TPUh1 &N@`TP R Q@@@TPp  0S @TZ@WP7@TZ&O00$0S 0R0 @, 0 0 0, $Q \0 R0 ` < Q  0Qxb'bxb'bP 4 P-L@p T 1S Q@T 0 S\0 R0S0` 0C#1V P`X`VPP   0 S0*00 * xbP-,, 0 0C0, 00C0{6xb -QL  ^* 0S  ^: ^# 8 R 00C000 p.0 B6C00 T0T08 . BAQ00000Lxb$ybybzbzb1 -@ ML$Ÿt0 @唍  0Q* Q:聟1 e@P1  ުpª`V@vP!t0@!0| D00 V8H0:80 8pp 8 :R00? <.0 B608 0. B600`0S 0000@tP0 S00@@ 0V 0  ?C`? 0P0 000x S 0 S<0X X0001,ybxb_zb_ybzba!Ceaybxbzbybgfffybxb$ybyb 0-LM 0PJ00@  @0h00600=0 ,00,0 b -LM 0`p)00P ' @TPo\0 @T!00  006000<H0 ,00,000600<0 ,00,0 b -LM\ PR 80S|0T0 00Q00S $0@[Q X\0X000\0X0000HA6*=@!00`000A 1 00000\ qp00p0`00C\ 0  "!0 00 0C&  0 "!0 0 R00400R<X =@ !ܹcc bcc0 p-LM00DaP E4!41a Q0S 000000 ,0 phVphB00 000@000 @0@0C& R 00#!000 |0C& t 0 "!0P 0 R@0 00000jܹc0_`ccc0 b00000;0000000 0000000 -3cp @ 008 ; S00L;0000" 00:00R00  p0S 20Sz0000000\0So8 Rfl.0 B60X80 >0HŸC& 0S0 0000@00"R 0 0SAŸP 1!0Q100(Ap00C\ 0  "!0 00 1C&  0 "!0`!0 Rh00500p0@ 0{pp00!00000 .0 B600 p08 . `B000000 @\08 . Lcܹcybybzbxb yb zbybcc0$ybybxbzbxb-l0 `0!X0 P P0 S P\0S00 5H4zbyb -LM < <@(P  D 8 0 40 #<ß#10aV УP0SP `V, K4P`,0sS8C00S08d3`TPPPP 0 008P0P0C\ 0  "!0 00 2C&  0 "!0"0 R0\0xr Sxl2@ 0000 U00 # @0 0CP 0  "!0 B00 1C&   00#!0! 0 Ry w000000@00C\ 0 !  0L!C600@! 00#!A$!00 RVN t0050040 0m`@00C\,  0 !  0t C600h  00#!0L 0 R,0S =5H4zbybcܹccc01 0-LP P@ 000:00 R0@0zb ->0~pLMW`80Sv ,* PP 00dŸ:00 R 0P8 80H@bHT@!d 800808 <0 dS< 8 80S:SFЁ1!P@0U00? A00夡000@00C\ 0  "!h0 00 T1C& L 0 "!0(!0 RH8 H g8000g 80< 8p0B<P@00C\ 0  "!|0 00 h0C& ` 0 "!0< 0 R e$`zbܹccybcc01 -x3LMps@lßl3P0 ^00`@3@#0Q 030#0Q 3 Q3@TI 00\ 0R00>bP00C\ 0  "!0 00 2C&  0 "!0t"0 R0\h0P0T0X040@0<0d0`0l00 000 D 0 !@l뼁P00C\` 0  "!0 00 p1C& h 0 "!0D!0 RZ` $0!k@P00C\` 0  "!0 00 0C&  0 "!0d 0 RZz Lm1cܹczbxbzbyb b~b(ybxbcc0 yb1 zbzb -2LM 2b̒̂r  0R0K2) 0@0T0P t00|"000P00C\ 0!! < 00"C6000 "!"00 Rg00 [p0S1 00.\ KP' 00300 0008 h1. Bt!80 P>0C8100 @00000@T 0R8K(, 408b00Pc A=9 =@ @ < <0 @0So0 P   k0 P 0L H 0jW b(ybܹccxbczbxbc0ybybybzb -4!4aLMp0@000 < P0 Pj00  Pp00C\ 0  "!0 00 0C&  0 "!0p 0 R00 00  40S00;00H cܹc1cc0 -LM00@ +00p <R00 00S00 00@ 00 h00500hLl00@000X00\400yb1 -|4L Mph4PQ` 0SP A2q 4 $00 AT 0S @T#000 P0R(0)Q 带PT    YF0S l#000\ 0P0 00 @#000\00000 R000 R 0S  0 0S0 20 0 @$, P0QT" 00 0Y@00@0 *0 b  x50 60 P@0!0 R? Z8P0, R ! 00 00Z0Y0S0!0 R  91P060 r07 SRX 00S*0S$R"*r X00St0 0 0SRr sus0suu0sXR0S0 uq000 0scgX3 -LM 0R ) 0 `R 0 4 P p`0@  ( P0S@ 0R 0@ 0 R@0  0-L @\ P( ^,0,0,00(, 00=` \0 -L,M,0$ 000 `P 0S 0+㦐P@ R@@T |000 0pCW :0S/S W0g 0c #0% %0 0 R2  0 /R @00@0T0S P@s f 020("S\ 0S0 0U0SpLP0K P@KH0 @00HK00 4 ,P Pp L D 8 )P@380[c  R?@# *\0× 000]0/St @0 &||pR u|aB00j| ?{p>@ ) ;0 pR|dN|PJ|pGWc:0/S Y0+̏6 {)0{b({b -LM$P$ 0 0#40 @ Rp8  Q R 4 00  ( @0 < o%, 0 /S K  , 5R  /R  2R0 /R, KR, ,0 lR ?Ó00b0 /R07 00S09940S009900900S 0:00  0T 4 T <0 0  0@ T0@@00@0T %00@060 ='P R R0 j7ã000b0 0 j00 0 R090@8 Rd RR R  00ck00CS<< R;T0$ 780S2 T0$  3#0S G@0S%00< (P  @00@08Q   (!`20S 0 0 j 0 ( |`V   0S  8 R|`V   y(00K #X0@@ @ p<QT0$   @00@0<@@@00@0W 0.S0.S0:, 0/S  0b0j007, 0/S 0 b0b080SV0S8 0Q0R00SH@090%({b @ -LM80@0 p,0  # `0SdV 0 R &PP p ?00ZT0$  P0  @00@00`0CS ZT0$ ,0S T0$ 0 @00@0,0S 0  '$0@ < RP  ' 僀p33 -@ MLdd 0\PwP0P @L@HHH0H @@@@hZ038}b$}b~b(}b}b}bf`0}b p-LM 0PS`@<P @ @@@x:Ppo:3: -0LM`@Vp ធP $`VV v7v@PP ` 0$0 P0 00$0$(0$0p t/Y 0&@ -|0LM0Sh0@T 0S$@TP0 $ \V`3H- P L0S PP 0R}b p-L M 0@004L0P0 S000t ` 044 P 0  PK P 0 0 0 0L0p`e`}b0S  0"S  L00 \ @0D0<0804000,0(0H0$0000 00 -L M|||S00 x3@0T40 ,0Xs0P3`,  T (C RJC R 0SC C`00C\ 0  "!0 00 2C&  0 "!0"0 R|wP 000@8@6널4,00P0@0@@PR $P0 XPUA`00C\ 0  "!0 00 1C&  0 "!0\!0 RP~00PU XQ\0\0\00X\ @H00H0`00C\ 0  "!0 00 0C&  0 "!0l 0 R 80S 4!0|0<0wz~bf` bܹcc}b(}bcc08}bT0S ` Rd0d0d0 QT0` S`00d d  -PL`Mu 0Kp d P0@0  P8p 0P 0 P P~b -LM800CS\2\"p2?0P`@T | 0V[ @Tr2  0 S |000D 쑟00C\ 0  "!0 00 1C&  0 "!0x!0 R|0p `| |00| p|0p|⠏TP < +< <0;<0+  H5|8 80S@0S  ,PT Y80S  $  40 840 !)q b ~bܹc@@!T@0\ 0   0V0P@@T@ 0004P 0401'10 R 0S  R0\7@ \ $ \`  P@d0 Rd0 0DzPtb -LM@0  010 p-LMP!`@4T  000`VPZp# p-LM0`@P  0p20P$0<$0$0<$00 0-$0L @P R  01 R P 0\ 0$0  0-LP@P P 0S  :P @  0S 0@ 0S 0 @  -LM`@pT P| R0 U@W LyX @y0 P  py}bd44 b4 -0LM @000C& R 00#!000 0C&  0 "!0t 0 Rd^y`0` R 0SDDhQy ncܹccc04nb #b44 -1L M 1R ,  ȁ đ0 !0p!c1QtPEU:a0 10S00p0tPEU*W , R 00 000 p0 'R@$y1@ 00000000@0@0C& R 00#!000 0C&  0 "!0 0 Rp XH,0SDx b #b'a_ܹc ccc040@-QMP0 @-PT \ ,P^Ѝ0Ѝ0@ KFbг -LMA\-P   -LM@pPp `pPH00H0 0QPp0S P- L p00Csp0 H Sp HhSjv4 -LMP`p`dd5 000hP V P0SR @R VP P0S00<000000  Z00:00U@4T0 0C\ 0 !  0`$C600T$0  "!04$0 R005000#08QP@ S0 0C\ 0 !  0|#C600p#0  "!0P#0 RlQ  V P0S4RrVQP u2B0 0C\ 0  "!0 00 2C& | 0 "!0X"0 R R P0S R P0S/1 00! @00!l0S㴑> 1娑@00C\ 0  "!l0 00 \1C& T 0 "!00!0 R@0 zP@0 0@00p Rl0S u@00C\ 0  "!t0 00 d0C& \ 0 "!008  Q ܹcccc05545 -LMr園P 000l@T 00 \ @RZ/ 0H"0 0V$0@0$0}b p-LLMP `@0`K80 \ ` < 4` P pP0T@` -L~M P@0K ( 1 " ! Q P@ (0 S (jQ2T`,p0 @T$0^K48,0m/Pj/j/wpA A b: -LM@0`u/K(0 l PP!$0T@T4 ,p0 !P,00C,0(0!U (0 S (Q$048,0$/Pj/wNKj/҂pQ Q ,I,00C,0(0,I b: -LoMl1Ldd0@,0  ! p Tᮡ  P@ TW XA0 ,0S ,PW X*1,`S 0!PP$0480.Pj/+wPPj@uKj/`01 1 uoK9& b}b: -L Mp$ K P@;$ $`@00@0$ ,00C,0$(0; 80S@ ]0 @0sP@|PU 0S(K T|PUT W`0 @T-(`,H 0-LHM D040 X \ 8 0 \KP7P@ 0-L00 -LHM`Pp.@TdK   D0`@ @@ d <0 8P P@  0ST0 0T@00@0T  p-LM`PP@ P@8 0R@ p @P a -LM@(p 8% KK PP 4 00 `@0"0 0 P  \0P p  000 kK PP PP \ R0 P PP uP % 0@0 \܀ 000 $#  0K⤐K0 )K9KK  @0@ 0 @$PP' P 090@T4 0 00  P T0$ P80SP  PP   y@Kd  p0K 0@PP  0 (00(0 ,00C,0(0v ,Gs {b -LlMp0`$0 @,PUK $0 S $N D0P dP `0 \@ P@KUx@#|T0L0T 8K0$PU 5u b: -LMC0,0 pP,P@ 00  l( $K KP@` H`K tP@p/PF@ 0@K K P@p 80S-@ 20S 80S@  P@ 0fP@   0 @Kl  `d  p`K 0gP@i 0P@` D0p0D000 p0! 0$3  X0K``K0 $K4K DK @0@0 @P@ Ph a,0 S ,M h 090 s @ (00(0 ,00C,0(0k#,|F0Sa# 0 P  0P@D b{b: -LMԀ0p$0 `+P@ $0 S $M@PK sP@9PF 08K K P@PK 2 @dTp s b; -LsMp0`$0 Pk+P $0 S $HMzOK RsPP@F 0K{/K PsKT@-0 P$048j/1 s b; -LMP`.+P@0 RK 0K@ 0 夀 ` P@pW@ K]P W  d K~ 20:#: Q0 <   Q @T0 0BK K0K @00  Q㄀ 0{b p-LM0P@0  0K 0  @ P0|`KSd {~ 0|0 00:#:x0 0K K0x pK 0R p{b -LHMd@Kp `@0<0 ` d @ 8` }PU%T@80Q0 `P @ <0 d 8` lPPT R0P 0 0 @ KP+P]@KPP T0R 4TPNL -LMP`.`p0+t@TK&0 @  ` 0 $P@0@KSd } 20;;|0 0m 0K Kp"@LaKQ 0R @0{b{b p-LLM@ 0 `K`80 \ ` <` 4@ PPP<K<0 80 L00 0 0* LP< K pLL0S p -LhM`0@PPQ 0SL$8 RH 0RppS3 S W0S@0P@ SK 0 PWlKlK0@T0@W0@T  -LLM0 `pP/00  0pK0 D0H0 l p L Dp 9P@`Q `l`@` P@0 * @  -LM` PD0K0  P pKP@ 0 @T0(0S<@ p jq0 -LM` P0K0  P pKP@ 0 @T0(0S<@ p >q0 p-LLMD0``K@80 \ ` 4 < PP  pPf PP -LtM`0Kh0  l d` PP pHK80SP q08 0b00K @@KH0 D 0 4P 0P ,` 8 P -LM` P@0K0  P YP@ p0 0  T0$ @0s# G(P㄀K|d {0@0 0\ @0儀K 0@ P@00CS@{b -LlMP` K6P@  0$p 0b  {T0S $0@0s/ 'P㄀Kd {0@0 0 @ m 0,  B, (0 ,B0儀K 0 P@00CS@{b -LM0P#Q` K  @00   ` P@0  p  p T0儀K$@Pd  | S{0:#:0 0 @{b -LhM0`#88SP; KP@  0$p 0  T0S $0@@Kd {0:#:|0 0v @  0,  B, (0,A{b -LM` P@0K0  P #P@ p0 0w  T0$ @)0s, 'P0 R 0儀K 0 P@0KT@hd z 0x0 @ t 0 @@㄀K0sг{b -LM 0PK`0 0 0 P P@ p0 0  5T0$ @)0s, &P0 R 0儀K 0 P@0KT@hd \z 0x0 @ t 0 @t@㄀K0sг{b -LlMP` KP@ 0$p 0  T0$ @)0s8 _&P0 R, 0儀K 0e P@0KT@d z 0x0 @ t 0` @  0,  B, (0 ,@@㄀K0sг{b -LMpKP`Td yP@,@K= 0K40040  @0K0  ` P@ P0 0L  eT0$ @ (0 "c1, ah $ 1d0 \ ` 0@,K mP@,0s0,0 $0s0$0 {b -LxMpK`Ptd uyPH,@K 0K40040  KP@  0$` 0 T0S $0@(0 "c1, ah $ 1d0 \ ` 0@  0,  B, (0 ,@,K ^mP@,0s0,0 $0s0$0 {b -LMpP @0K0  P AP@0 `  80@S @T0 匀K )@T@d x p0K 0:@{b -LlM`P K&P@,0  X "00  @$P0 0H a80S@ P@  g ,00C,0(0,y?@K4d xh0K0 0@{b -LM` KPPx p  0$@! 0 R P) ,00C,0 (0, =? -LM0"P`D0 hK0@ d0 h <` |P@AX18!Q K0@ 0 ` jP@]PpU 80SQ 80S@ X@X@T$ KW <U9DKTTQOM |\[`P4V[t?<0 0TP 0 0U T20 0y@KTXD K0@@80S@DKTYT ,,0{b p-LM0 `P0 K0 0  P P@@T|@Kd w0|0   ++x 30K KP@ pKP p{b -LHM0`@0 0dK< `0 d 8` P@ TP8pWP@ @KPP PP@ <0@@T0 00 0PT@ K@ -L -0L| "88 #$OR >00CS 0 0 T T < H T 0 400 0 < 0 -L M@|  0 P@o  -L3P8> -LM`p|P?>1EP!010 P?U@U  |L1 "  40 $,Q|  40 KP@   | 0 @|  0@* @T ?|>1 1E  m0  | D`<0;<0 | !88#Q bL>_> 0-PL|0  Œ*P@0| 0| "8|8 #$ 0|40  !Ƞ40 Ƞ!$, nQ0_> bG-p堑`aN`M\0[ xx1&V1d1后ETX1""ᓆ L"b l A N AD%X$1U`; P ! 10UPc "*0P  00U: QPc0 20\00{.L B40Zx000\ | 0Q0Sd00@a00Ѝ8 bųE.(b,bnmЇ$bk_k P-LPp>;T!52c~HaȀ2ca10 0\რ+ <@4TP *[O[O @@R: 0``( AP*0 P@:00@C "b"b0#l00X d2111H"c#b1 `130$PQ4b0bЇ>@-0PSpU0 0 000@ S  p`U 0 0R0@0 Sb0 S .000@ S  LpL`U 0 0R0@0 S00E-` M@p 0 0 \0 0.\T.0V0 Ѝ.\ D\ 0 S.S\Z\RP J0 S .S RP \ZUv R0`@e@c\ 0  0S Wpp0S 00Np ^\\pPEP*0  0S Wpp0S 00Np^00P0#02SPp3^_000S00W V @V^P 6!10F000nR^`VL 0 S 0n0 lS0d~0^ 0*0^ 0:bP0u S .S PR y0.STWVM0@-P| U@B .U@ 01 c0 C  0 R0Z  0  01 PJ0 R0Z PJ0 R0Z P J0 R0ZP0@0000  0@000|@ S .S A-@pP@  0Xx= ?0 1 C@nT0 7#30 T00SP-@T`,J 0P$0S!^Z@TJ 0P0S^Z@TJ 0P0S^Z0S0S p@-@?\00\0AS`P?@01 P0 0RPu2 0?0 1#0C0 R0; /R0 0S"QZ0 R0( /R" ^ 0SQZ@0 R0 /R 0SQZpp@Np00a0C0p00Np00a0C00a 0C 03  QZQ p R .RAQQ 0Ғ?AcON -,0L;0 0<b8b -0LM0吐pP`,0 ࢂx 0  AT 0U @ 0V0W,0S  , P b8b<b@- @  0 201 R 0\ R R  0^0T,0S <b8b0S R00  -LMt<0 L4Qp0@0 <  PP4 ,0KkP@C3`  0 S P00 s`00C\ 0  "!0 00 |3C& t 0 "!0P#0 R@i]08(#@,0P, @ @4@00 *@ ,wYP@ ,T 0 0Z ,0t t0sn 4K  00K P@ \4 a40 h 40 i 4 0464 0464 0464 0474 0474 0t4 04 84K,0 0垩P140PH@ `0T*^ 0p ^ AQ0S 0P4 H0 @0T `: Ъ.QP40P 4Ǫê4忪P@@ -L M$ ( h0 pe h0b t t0RpF R` 0`t0sY h0S t@\ T0D0bD` $K06Pp,$H0 P >  PP7t0 qD0 4Ht0T$p T q! (0'$g (0K$p Pp( $\ W (0SD{@ K<0T$p<0R@@ -LMQ@p``#T\P 0@30e^X05< 070 0`ȨPP X 0X H 00\T D a0N 0-LM P0@0  @0 -LM,0$P0C0`p,0 P(K,KT PE5 0P@40K(, 0倨P@-0X0H0 R $0U  P 0 PE AX0 0S 0ĨP@ 0X 00U00S駩0天 -LM00<0 8 @ 80 @0PG 0K , K0uPp9<04K,0 0%Pp*40H@ `0T*PU  0 @ H0 `0T: aW@ OP 404pP4LP@\ -LM0p`P(K,K 0 P@(0K(, 0ѧP00,H 0R *@T T 0S H0 0R:P   -LM⤐Kp  | PGP@$  ԁ0S   O@T8$0@-@T2PQ @0(0$ ,᝹P@|`80S|0" 0Q}0 Q $0 LM0  0P@ e $0U 0V@ spTԁ40 08  0,0000 05t0s/ KP@  0@*P000$@KY 0IZaN0Y IZayN M| R00 03@ K,Z 0 Q10R`\ s0  0P@  yo t` -LDM|` p< PPH BP8 V2 ?0@ 0@@P DU $00D0  0PPx04 8 5 40 K0pPP0 ,0(H  P 0崠 OP|0@@4PD 0R w80S P8;mA<hꜧ ZS4K,0:PP4 00;00040H@g8 M8 P0 $@ ! 041   042 0 $" 04400 $" 042 $ x01QS 2?S8 "QL  0488<,0 0$(,0 8Q8P 020%L Rc840S_0 4SZ82 t0  048<840 048 00020x08 t \ 6 8tp\ 5 @QB 0A?8 H0P:0@70\T 3 HO@T,0X P)@8,0!4@  8L0HX,024 80\p8 84 0@` $QP08<@@O8@D@@8 @D00cO`08 p0HL x0 3P Z Z 83 \0 8 t0h3\@Q8 808h0h08hO8 lGR8@ 1@\0BX0`  ᎜P.\ K P'@ PK K 0@ PKD @ P VP0  !0  0 ,0S ,?+ 7+;[0 [ 740w 5 <0QLKN KO0K0O0 JK0F0FKH KP0[ 0P0K6 b8A0{b -LMP` V$ P 0@ B`TǴŴ P`ႤṴ 0 6@`uȴᩴ -LM@ 坴- -hLWMH 0 ,0 `! `A L! h0\! 0d h! l! p  KKBd!0t1 P 0@ 0 7 ,0S ,idA `H0T SI 20 Pl1 P P\'P80BPWP7`   Rh! 00 w`00C\ 0  "!0 00 6C&  0 "!0&0 R{H!hA0@Hl `1t 1R2X1  t0s dpW \=K/=KT XF`\A`PXd`0x a0`Wp!\P E\ p1K`N/KO?KPL 9QK8@!0ĚPL D@1@ H0bP!S0!Px1 0U*0S S0p1  Q @pA 8 H Px1  @ 0 PU:dA0SpHA R0l0l0t!d0TA00`MKx XxQH0 0LPH0 t0 pĂ0 4ȌD \p<3 (K 4 }p\- KK PA?(KA/(@K0K0000d0 Sp! :MK PL h1S lAh@D 0lA T0h DD{A?( K K?K 0 48<S<1ST \D a0C<X1`p 1HF,`$`d2 (@K 0Kp!MKp D@r\/=KQ<0R0@ @@ S\A RrWnKA_t0 s<041 14 (KW 3 W) (K00000d!0S:MKqPL @ 0h1S lA@DlA Th1 pWڬ @0@ MK 0(KKK,0F@(0KKK,@/h W @PD P  P?  P< P Pp  P5h  P2PX P-P P* bHA@bp>b>bP?b  8 8 08M 0-LM0 P\0@ 0  ^ \  \ T bQ Pg 0 -LM`P\ p80@0CS\TP0\@ | | 0L!D0400A0!P000ZP0P0C\ 0  "!0 00 0C&  0 "!0 0 Rq00T \T0`\pP0T0T|pH<5@T@ T.ܹcccc0\A 0-0L@Pt 0@!0l 0"P  0 0.$00tAAdl@ 0-LM 0Px @ 40O00  B00RM M M hM M M M M 0     ;0 0 0-預@0 @$0 @ M! "Y lpb"`0%&&/@&0O% & "!! @!0P @`! ЍCCX8^n좙N - QLM, 0 40 Q :Q Q 080 40, p Wtct3@ 0h0"0&PP L1 01$0  1 @00C\ 0  "!0 00 2C&  0 "!0"0 R80aW0?T2@ 0d0"0%$@0@0C \ 0  "!0 00 1C&  0 "!0!0 RH$ R 1 0+10 ,( `0Kq:070A4 p0.0 c+0\ 0@$0  g\ 000S 08< 4 Ud Kd0S 0 0\0S0 āUh K \P*U 0 P: cR 0P*0 60\*W \*0 RUil K>l000} 0 RUUp Klp0w x0P:UD 0 P: cR 0P:0 ~ | `0Kx `0Kqt0àqǠo0<àl<ǠjhpfldbP07*0q[U 0 P: cR 0P* 00A S@-@**\ *!00S ꐀ   ( Ȁ Ȁ 00@S S ST!0S * R:!0R0SS `S0SS 0@S S S 0SP`S PSpS S0  P P P00S*00S:00*S:0P @P( - @LM h f`p -LM( Q0`0  0 R1S 1 R j 0R0!R0q50S 0S 0R+d\ 000R00R00 A  P`2P11 0AP PQ2P0P0@0@` 0a!R0 0! Ro+ 6  6 0\0 A PDHL\<Ptb(B -LM@1SA(P6Y0Z0J0@(@`  p(@1000 ([60Y%X00` q l0R0 000  0@AV@ @@ p `F0V L| p-0LM` 1PS. 0@0 00"0@1@0@0C& R 00#!t000 `0C& X 0 "!04 0 Rpph髜Lܹcccc0 p-0PLM `@0T00 3@T@`00C\ 0  "!t0 00 `0C& X 0 "!04 0 Rpphfcܹcbcc0 -1qLM 0`0Q0)10PU ,0S+PU@00C\ 0  "!0 00 x0C& p 0 "!0L 0 Ri@ADcܹcPtbcc0 p-0LM0`PS@ 00P  `0S 0 0`0S  0 0`xPP $ 0`S00@ ph Dbb PgU; 0S8 U0S6 0@T 20S  @T3PT UP\ x 1`?Bc00L` S g0 U R0PC\XP0S @gfff, ,00S0 000@b Q00 00C0b -LM܀`0 V$0  % P"0 @PPPTU 4pK_. ;4 }'P`PU@00T00S$0 S $ bb@hB -LM0@S  P, j 00ahfꈔ Q 00 p-0LM`PV @T 0  R @T`Vp 4.P 5 0S 0 S &.Ppb p-0LM`PV 5 @T 0 R @T`Vp0S -Ppb -LMX- 0pW @T 0S @TpW PU 0`\ *0 0#\:Z iP  P 00 P$0  Q 0 bHPLH0Q P 0 RPQb -pL W`4 @T 0S @T XR 5 z-P Q r-P0PP*0 0#P:P P-L`Pp @@T Q P P@ @ 0S0C 0 @@ 00\ 0 $0\   ?| 0-5P0L5ǚ @T %T@TQ 0 S01 10C1zV0h% -LM5@05⣚%h  -LM@{% h 0-@PTL @SVT00000 -(1(Q(!`@0T0L0p %5R0C/@T@`00C\ 0  "!0 00 0C&  0 "!0l 0 R\0hꇗ(50S cܹcbcc0 0-@0L@PT (,P @T00b -LTM`V, Pp@x 9Vu 9t Vh T90SP9V t,0 S ,ttP h9%Vx T9V H9V <9VW 49VI \D  0 x 0, ⷙ5 H(P000P0P0C\ 0  "!0 00 l8C& d 0 "!0@(0 R ̖-RPt0 `  GPtz t1E  'q< 00\5   XGX'P000<P0P0C\ 0  "!0 00 6C&  0 "!0&0 RtkF&P000HlP0P0C\ 0  "!80 00 $6C&  0 "!0%0 Rt1 450SP0SZ  Pl%5ATy @Tv t0 Sq0nX0S cS Sr B/t ;/ D$`0tPK00%| % 5 05LP`0`0C\ 0  "!0 00 4C&  0 "!0#0 R @T 0S 0S @T?*ꢕ#S SS_h3VO 5\3V T3VzPOt0lPKp0K@ %Pu@ @ )@ /0k\@P40S  \0SX 8U2V2 VD'P P= P ,1V1V*1V 1V 1Vt0!1V1t0D X#` t0 1V 1V x1Vl@K@ /t0@ p0KY%\ 81V 01V1V 1VD0V) hP6* bi$ii$zi xBFixIi i i i ܹcccc0qϖLi$i i i$Fi@Hi Gi i Jii i 5i i$~i i 6i(KiŠi$xi i$ -L,M!P P0U,0  1 X 0S P @0@ 0RPCT PXP0Pl1 ,0S `,P0pD1XU.LK(  - 0S7 U@` 0S<Kc$ PU Y"Z 00pZ@ PETUXUP0 0eP  0 ="- p5"<K ) ,"P PE p bbB -LM@Q 0 S01 10C1R -0LS``PU t)PV PU  PPD  PpC P@T Z)P6 $@T, nP@$  .0000$0 $( 0@000@00 pp  0P*' T,0P/S},0P9Sb p-LM@`TP (P @TpT  R0000 0 P 0S P00CS00$ R( (0l0(0  $(0pP R000 0 0 b -LMȀ 0R$0 0@T 00@T$0 S |$@`TP 4pKV`F' - !PP@T bB -1LM@ T$ P o(P $@T$0 S $\T  R0 @T 00@T@`TP 4pKV`F' (- PP@Tb bB 0-P0L@PT &(P $@T0T 000b 0-`0L@PT  (P $@T0T  0P"0b -LM0@S SL 'PT(  'P h0S| 0-T1L0MLQ@ T  8'P< $@T(@K&'0 (0K'KP@ <P$<P@D@K y+ P@ <P 'P@0 S X0 T @T @zTb bBB -L$M@0Q0  %2 800S80 0 S h\<55P2K4 K 800CS80ʴ5<55 bBi -QM 0P P -Ѝ0 Ѝ7P0  Ѝ -L$MAPAUD H p@ `2 Z P@S 40( 40 \0S @40  TQ 4 R*TA@@0 R4 L \ 4PK  @0P#P 1  5 H0S02K H@ 0 x1  80S $00c~  "PZu 1000@*K  d* `*D0 S<KrX*R2@   1QC001S0 0000!005  !) \b@00C\ 0  "!(0 00 2C&  0 "!0!0 RƐ  @O 1a0 1@00C\77 S~ 0 B0 0 }  0g0g$0C0C4!0PH T@0@4PK )@BKT@04PK  P=P02KI (^/@0<K0D0 @0 @)\@0 \@PA 40 @P80@0C`80p%bܹcccc0ʚ;B p-LM@`PQ ph -LM`p@ 0$   R \ 0S  R\  .%Pq  (%P11<<1000 |000|0 "48<#X 5 86U5  UO $6U00SF0SA0S> 5R: R1 00C B 0 !  80S$00c  N@T 1000 ) S0 0C 0 0d0d$0C0CbdQ i%N$t000d嗀4P0   0Sn P00C\ 0  "!x0 00 d4C& \ 0 "!08$0 RF(T `000 0R1000S@0@0@0`00C\ 0  "!0 00 3C& x 0 "!H3T  Qr i.000M0S"000 00 垏2UK 2U"r040b2P0   0S) \P00C\ 0  "!(0 00 2C&  0 "!0!0 RQjӎ000 00 O5il#5T!Tq070@a<1P0   0S) P00C\ 0  "!0 00 0C&  0 "!0 0 RPꁎ000 00 r #Pt i{LTcܹccccc0pb5݆c@-@@:@0\#" 00  @Z004f`\ 0-r/0L@P0S0 Y 0X \ZP@Y 0rm'01<0 0hJ00@0  8000E  /s?(0  -LM!@R \0700r!R\@-@ *,  0!\ "0! ":$@-^p`*#!^ ",!1 #: td 0-0LSP@/ S /0 & &0S0S 0S0S0S 3000  00 00l &d0ST &L 0^ 0 000  0 yms -t4LpM P00`K8K0p 0P@) 0dP00C\ 0  "!0 00 3C&  0 "!0#0 R000[ 80[A)lCP00C\ 0  "!80 00 $3C&  0 "!0"0 RT 9 "0S   @"P0xb00P00C\ 0  "!<0 00 (2C&  0 "!0!0 R 7 PP@@  %  %00 p10S!00>A0!TA !P00C\ 0  "!0 00 1C&  0 "!0 0 R4x@P00C\ 0  "!t0 00 `0C& X 0 "!04 0 R7Ncܹccc0 -t3LpsM P00`K8K0 0pP@A) ,cP00C\ 0  "!0 00 2C&  0 "!0"0 RT q !0S  @ !P00CS0) (BP00C\ 0  "!0 00 1C&  0 "!0!0 R Ƌ R0700dA 710C1P00C\ 0  "!0 00 1C&  0 "!0 0 R4鐋@P00C\ 0  "!t0 00 `0C& X 0 "!04 0 Rfcܹccc0 -@LMh -1A`L 0 S P00W |q`00C\ 0  "!H0 00 41C& , 0 "!0!0 R/U+ r 0(00 \0%0 0 0 XX0Z Y@P< 0! r xPcܹc =bcc0Bȁ b -40LM @P0 >A0b -LM`Pp@ <P 5TP 4 30Sp00p0  Q Q\ßXCXs 000 0R~000(#S`0`00`010z{20p   0ĒSW Bp00C\ 0  "!0 00 2C& x 0 "!0T"0 R/h0| 0h0 | 00C\ 0  "!0 00 1C&  0 "!0!0 R000  嘊0000QH00C\ 0  "!0 00 0C&  0 "!0 0 R7 (\H/|<VH40 3A0 =4 cܹcccccc0BpbBQ0P0ȁ0Qx0Q *p0Q  5RA05L00R  R R / 0Q0\02i 1i i i -  0@  -@L`p  P P @  0` pP0 c C p-RLM`@PPU@p 0-L P@\p 0  !0P \ 0 ~P) 0CXC -QPLMpP` J WH 1RG 1RB 0S?0@S000000@ PU P@U 0S @T1!  P UR*01P UR:$ 0U0P00S O@ P ` `T @P` P5i 6i( \ 00S \P p-LM0 PP `@u  0#U TpT0000 0  @ 0S 1 \1S0S 0  0S -0S 0 00Sp@-0 PbUe Q@ * 0`R@ Q:Q*0SQ:?T00S eP*0SP:Tppp p-QLM`P@ 0 P @4PT P 0S P 0Sp0@- @0PS1!^d0 0S1\@ *0 0#@\:00Pf` -LMPp0 S,P 0  0PP0S 0 0 ^0 R*0P  R: 0 0SP0 0S0SA^@PgU 0 9 0YPUPP`V 0 0Y`V,0U 0 Z 1!P@ 0 S @T 0ST  ]P XP @-0S<@ 00  @ 0 -pL` P@ 0\* 0S\:0000Q0\ f03 0@@ 0  P@@0P  0   P 0@@  -L MP@`0UPR` U0 V|Ք f  p@T0TS@DT0TS $P`U"0WP 2 AWkPP0DUpZZW ! 08Pp8 |10@0t d1, K0X,0pS0@ T*0S! T 0 0P0P0P 00P Q 0`0^00 00 00LT@ T*0S |   bPpg# 00 FabHf`\bPlCPf` 0R P* 0R P: p-LM0P@S0` 0 T\ 00 00 0P0`@pH p@bC -LM0 @ pQ8 T :9 0S EWZ2[V 0S80 0 0pV p 0S 'uL--P@ o @ P D -@pL 㪺PP X0@T L` R@TP0$bPtbb 0-LM@P0 l@?"d0d0P0 0S0 0P p 0Db̀bPtbbD P-L@P p0PP1P FP` T`p`P `@1Sh~(p(P ! hbP0 ,0 0P0!R00hb -LM@ \ <0S 40 Q0 Q0 0 -LbTMŸ000P  pl  P0p g P@` 0]Yl  4  P,80080XA0 0C\ 0  "!$0 00 1C&  0 "!0 0 Rl0 lK ppXPl@ 80p080l0S 40  0p0  Y h@K@ p 0dP P ( 00 0ܹcccc0b -LM@ \ <0S 40 -LlbTMhŸ 0P000pl0 X P0p   P@x 0u Xl  40 ,80080A0 0C\ 0  "!0 00 1C&  0 "!0\!0 Rlg~ 0 lK pPl@ 80080#l@T 40  0p0 hPK@% 0d0  \ 00`0 <0S 0 T @0 P <04 p X 0S h@K@ p0dP 0S(  00 0ܹcccc0b -PLM@+ 800CS8040 00  B 8Q#@P 0S0C 0  g0h hDb̀bD E P- L 0SC hH,E -LTMpp `@Pt@ P3@# 0 t0 &30#0P00Sl 8 0 0R* @\  T00R00S T !000hK@fphK\  t0d `p L  Z000 c Pll@0S-Pl9Tl\ 0S 0S40+  \hK@, 0l p`l KhK\ 8` 4P d `p lT\4`@ '40 040l0 l `A@bbb -LPM\`Kp@` `@` K 0X0 0P 0T 4, V; 1 0    0; 0Z00 0@P0C@ 0P00P0 0C 0  0|KK {PKPS @ @ 00 0ecܹctvbXtbcc0@wb܁b|0 R p0Q ,0( 0S <Q00Q 400 0S <QTԅb0S  S  0 S   0 R010`0 BS RA* 0S RR0Q 0Sڂ 0-@LPf>1P P .  b T 0@ T@d @T 00 0 "4 40i8#8#$ 0$  0!0i 00 0i0  BDS1 <1.X0 ,0S ,n0 = 00 0NP  0 0@, T00T0aTz` bԅbJ܅b -L M 0@p@A`0d` 0p0#!dP0 0d0  0pp -LMKdVX? B8c0@ 2c2c@2`ϠAl  8 #, E.Mb -L MQ@`*0S S 0`*xp0 pŪ``P PUNPGP 0-LM PP@ 40P00 KPP0SL L@808 P000h 0- L"48<P#HP1 T P"48<#HTQ00ADT@Q<0\@| 00 T@ RL 0hJT:<0\ T0L0P0SSP@0 -L$MȀp0P4`K$0 * 4P0S L00P0 $0S $8 0@P  0ppD0<0. 10 S  bJbpJ - 0L nPLb - LMR 40 S 0 0 yK -(!XL"x H` P  hU H -LB!!Q#7011A!1 ȠB1 B0A0 x!0hp00 cT1(0000 c( vB ! a c0#7%c!c1c X@008 #HT 00 0 R 900T| ?A7c%c!c1cW XEنf`f`f`f`f`yf`&p%bf`f` 0-P0 LR0 0Qc@0 0 0? B7c011@x0 l000!T 0)L0L " 0/up%bf`f`f`f`Eنf`f`f` 0-LM0P [[@[0[ P@0f`@K -L(M,`KD 4pK4 @$Ÿ$ 0@  Px Q eB!2b2c621b1c \ڼ0P*0 RP 04P:1!1!@P @@8hQ2[S@ ` B1 2P13[@S `,@"!@00Q@0   00\ eB!2b2c621b1c1\ 0T뺋ʋLKbpbD\ԅbpbxbbTK\bXKbdKb`hlK -qLMQa@0 T00 0 S00 00C000CQ 0 "!000 t0C& l 0 "!<0H  QT Ppbܹcccc0 -LMY0@S y000 R^` "2SX00X0 o0X000 0X>0S3 0S0 ' t 0 00t *P000 "48<#Q000 R000 0S  bt8X~ P["P 0%0S q Q 8 R(00(0  oR00S 1ȗǟ 0  Q  00C\ 0  "!t0 00 `7C& X 0 "!('00'0 R^ 7PU 0QI PUP0#$0$ h("( "4 4Z0< "48<#8 4 p6 0hƟ00 00` C \` 000 0  "!0 00 6C&  0 "!5  Q kO!$)-"("4 4Z00S 5  Q hP 000 @`P@U $@00@0` "4 408#8#$0$ 4 0ğ00 00C0\0 0  "!d0 00 P4C& H 0 "!4$  Q40$040 ğ0 10 N3 0ß00 00C|\ 0  "!\0 00 H3C& @ 0 "!3  QoN"  0P00 00d C d "^ 0  "!000 p2C& h 0 "!82D  "Ÿ  000 0d 0C \d UD A 0S 0S 0SdN00Cl0\0sYP@`Y 00 0 R 0S < R 0SR t R 0S  R 0SR1|00|0 $R(00(0 t00t00%p00p0P@`000P@ԅb܅b Dܹccbcc0xb|bbp@-0@P H0^ 0%0S" 0 R T 0\ <P5 X0^ 80^ 00^ (0^T 1<1400 0Rԅb d -L M 0p 01 cQ  0  0 R~ 0Q0R  Rh P, U  "48<#0!$(,"P:,P PU, R3 0 "48 <,$#8(!8 ,"hCV ڲ "48<#V7  "4 408#8#$0$  "4 40f8#8#$0$ UA 0@ $(,.4,8 <"(!(#8R`c-ڲ0#$04V ` R000P |%00C00f8#8#$0$  "4 408#8#$0$ ,0S , 0S00p,00p PU,  ,P "48<#X P"48<U#, `V0P00 001S Tt@ `F4`j0V0C0P   @`_00C 01VP8#8#$0$00S 00  000  R000 3@ 0 b|3B&! 02 SNX1b1 R000,c@00C\ 0  "!0 00 2C&  0 "!0"0 R0 0 0! 0 0 0!B Z @ 0@ T CL 㻇$" h00h0 0S0 0p 0 p02! 000 !00C0Q Q00z\Q\1@  t P00B 8a@00C\ 0  "!0 00 0C&  0 "!0 0 RY 00S0<0 0 0 0 0 0  00 00K V괆bܹcc<)b@)b(;bcc0܅b@\ L p T 0S p@T 3R ,0 S ,l5rz@0 R  3Q H0S <Q H0SQ P U 5SP1pP-pT 0S0  T 0S0 R ƕT 0S00S R; 2Q5 H0S <Q/ H0SQ P) U 5S@ T  0S @T T0pT;p :1P7pw 000s 0RP@ 0 <0K; K0@K80 圿@Q  0!R 410cSb# l ? X  |P h0  HP2|@t 0h!0bS5t0`1 S`500 1R 40 :|0S  \ (0?0 Hu k 0RpQ lLP a0lS0V 8 ȟ  0000|  @_X| 0 |P h0  HP40 ' pL@  0Stt7 R  0t0O0@'t0t   0L@}j  &0 ?08іHPKd`K R R0 0 D0@ @KGKH@K0 \K4Kd@KcKK0 &Q Qw ! 0 S- 00 %0 S   0-P p  DX P58P101;   R $5@T2 0R #3Rʌ tK 0n P P P  9Ppğ1010 SH1010P 0 ? ( M I0} C0H0KGK D d0KKcK0`0 &K]3 底P  ~` 0R00 R P41010 D0  $0Z0 0 y 0 `N0t0 0<4(<"4!7!t00 0CP   "!p!000 \1C& P1  00#!(!00! 0 R?P 1P@ 0 000t 't 0 0CP   "! 000 x0C& l0  00#!D 0L 0 R0Z53(dcܹcccc0Tc44 0\0!0000 SQJ -LMD@@6S S6St0 R`062{L(0S|h! 3QAQ @QF -L,M0@S`P(r 0S R 0S0S0S R 0S0s VV 0FSqgV Vc 1 R UY @ \H @ 0R:W00Ø S i%L0 ៾P ' p-LMDP@`ᓾUP 40phνp- P y̌ Ƞ,8 0  ( "(4R! ,ȠLTc -LLr @@0 9 Q+(0 0  LTcJTcp%bDTcHTc -LMh@ d0R\0\ 0Q00040@ @ H@HTc/up%bDTcJTc0@-dd0`@S =0RHP00Q=0P(0$0/ b 0$dcdc dcdcgfff p- 1 QLM@ 0 a00t0& @0 0C\ 00#!0 00 0C&  0 "!0 0 RpphRtL`H@00C& R 00#!00cܹccc00@-0 0P00 @0 C& 0R 00#!|000 h0C& ` 0 "!0< 0 R00@ܹcccdcdcc0 0-L@P;}PU@Z0 -L4M0#,0 p 0`00tv |\ h 0bS700cS60(R6ʀN/(0x0(00O/\#9C1 S 01&6 SƱֱS0ü6#0@?0|2 R |PU 6S6S@0| R P 40 L0t1S\0 V 8SFʰ0 G P!P 0QPV$1 A@10@1X Bp00C\ 0  "!0 00 1C&  0 "!0!0 R ,0S x,~0|ǻ4N0 8)0 0<@K\0;0K0<0K( 8 P@ L0 0L0λ 06$0 0$0Q<00P [ [/ 5t0%K>`PKdK(0`@XK0P( L0V bܹccpRc:\cc0tLFr(dc\ -!a P0L00t @0XqN/,0P0,008O/Ɍ0L^1 Q0 30r00r0@P00C\ 0  "!0 00 0C&  0 "!0 0 Rh{h0,`0 a \*P0 \:00<000cܹcpRc:cc0 dc -!aL MP 0@00t /40040\Q|0@ S \QX1pWL1L!,0l0Q=*80 080x0L!0 ?08<{@P00C\ 0  "!0 00 0C&  0 "!0p 0 Ri<00<<0! cܹcpRcdc$dcdccc0 p-,!,QLM@ 000t 6 S; 0\ ,00a S1 0 ?0Pz`@00C\ 0  "!0 00 t0C& l 0 "!0H 0 Rpphcܹcdcdccc0MЍ -LM QpP`  \ 0S'0 '0 W 00@T  RTD,@ 6,0 Wꐤ < ĥ < p < L x ī h ԩ D p T8: Z 0+07G00C\ 0  "!0 00 6C&  0 "!0&0 R , A 0P0 0Sx0Dh0  iBQh0< iP &00SK S. Px% 0:0t P dL%L080008%60 ?0y P[7bP 0S PQPPַPJG0 S0S0S 0S 0S 0SQ0s QIiP&lj 0S 0S سP 0, *P 0 <| 5n0H00  C 00C\ 0  "!0 00 2C&  0 "!0"0 R H0S0@| 0 yQϠ 0u# 0 0<2  00# 00  C 0CS0 sf?|| 0 0 0r 0r0h0  Tkh0  ck-}0 $A 00C\ 0  "!0 00 0C&  0 "!0 0 R U W W  U 0 Q  0o 0ol,qܹcccc0pRcEL -霣LMß` @Pp^@ RD: ^1 ^/) 8C`00C\ 0  "!0 00 2C&  0 "!0"0 R !naPS P) \B`00C\ 0  "!(0 00 2C&  0 "!0!0 R S0 T *P P 0S0 Rڰ7R'P 0S0 Rt0t000t00T 0 T* 70t0 0@`00C \ 0  "!0 00 0C& x 0 "!0T 0 R W 60P }ܹcccc0 p-LM0PS P0S0 P@|ܳP@ p`&P Fh0 00t1@000@070p (dc 0-6| SL@@Pڲ0 0S L P@!0X@z -LM6@S P P P ȱ 06g@T 6S|0@6P S000 0όw060dc -LMY`, P P0SR` Q!:K/WP@W3(K0S S KK0}P@ 0KMK~}P@,3, # (0K p0R00 R Y> X DP @0 2 @Rp00C\ 0  "!0 00 2C& | 0 "!0X"0 R  2 ,0S 0,xp5X: @ 0 2 000 @ 040 Ap00C\ 0  "!0 00 1C& | 0 "!0X!0 R/ K64040 00 0(K 0 S S X@ TU5 0Q0  h 70S%V h0L@mHK0 P 0SQ  M 00 0DK 0K 0ԛ0004#0R R ,0S00S40S80S 0, ㇤PPc 0S 0S$0S(0S  qP#0RU+ d%0P # 0S00  h (50S2V h0'L0HK  BPP  00 000 @P0Z\J0S  K 0$K 0O( R 0R8 R 0Rh0 0n Rn 0  0;P@. 0P0  h 30SV h0@HKL0 P1 @L@0Sx $K 0 K0$00P$0'  0弶P@000! Q  0 ㄁KxK0000 0@X< 80"(  0 卵@HPKUH@KGK0K dPKzHd@KcK0K z}@HK:H@KGK dK$K 0D0 1d@KcK06K0`0 i0S 00 0^    (0 0(0 0 >000E (00(0>000 R U00 dRP0dU|0K uPp | 0R0% *0` G0KDdc bLxdc? ʚ;K -LM@0@@L@0 \|h @0 -LdM̂0Q@,0 p`P㰢 0S ,0S ,:u0SP0@ShP P T2 R Vy Pp 0t0 x U 0SYdK \KdK0\yPYA p0t 0R:l@Kh0 pt{@HK@PK^0 G0KHKƦpp HK00 1yPW [&[xdKH0K d[\K&[0姴Pᨆx0dK  dK$0 c0Kd K\KppL  dK0\KdK xPp` x` Z|` b L _xdc 0-QLMP 0S0S 00S P0@ SAPP T \ 0 0HP @0S  0Z  xdc --LM` 0 P0S40 (p#*Z (08 S, 8pC3   0 Pp1  80S $00c  `V7pS 1@0 00y08#8#$0$0 08 (00310#12!0S1 00 0! !48< (#( (!(!8#8!QA"A"4 t8#8m#$0$,Ÿ ,0H 0,0@0C>PpZ, ,080!00A00 00C\ 0  "!0 00 |1C& t 0 "!0P!0 RY  Sk 0 B0 0j  0f0f$0C0C00P00 00C\ 0  "!0 00 0C& x 0 "!0T 0 Re (0S9p!ܹccxDdccc0MЍ -LM Qp` 0Q0V00SQ񟗅 T ` H (  ( 0 \ V Y Z E5P   xP0P0C\ 0  "!@0 00 ,5C& $ 0 "!0%0 RX4 Ph0 44  s t R *hTh$@ 000h  +  !`@d@00C\ 0  "!0 00 3C&  0 "!0#0 Rx  v mh0 E 0S 0S$0S(0S 8a SY0 $(,<4<#:*K) K)0K]P' 0 $(,:0# # #8 0)[ 048!,!$ <0# #$# 00S 5t4 R h4pW @T V 0S @TpW  +[ i0, O\C \C00S <P  T0 m fpP -L?0@0c80 !<\ P!TP 8PtU"\@P P<p 00"0d{PT   !202T PT0PT00T Qp00C\ 0  "!\0 00 H6C& @ 0 "!0&0 RsT0@ @PP@`TLPT&U`ş` 00"0{P@ 5" "PPQ`00C\ 0  "!,0 00 5C&  0 "!0$0 R"0 PL0 IPPc\ l 0l@ 0 ᕘ㪼Pp0<0 H`0P h@`d0d , Ġ `P̌$Hh, 8#$X`0.$%Čd@S&,#4`$ 0(̌4#Y 0 84`T @ 0@`TT@  0X`0p0 ? 0# 0cP@T L 0l$PPpT \p ՏppWPPTP~hLPKH KT0KX@K8` , X @c#PPpG P 80hcVW Q <;/ܹcctvbXtbcc0ʚ;MM4MTMlM0 0- XLp[$X`AXAX1P  L "y<$P0P0C\ 0  "!0 00 0C&  0 "!0 0 R"$ R 1 0 +10 ,(<`8`1@ <4(<"4'< 0 ջܹccDwbcc0 - 0SLp!P@,$,,$.lV`V 0 @ ሾM00`鏿Pp -LM@㈺0$ 0 0<0 ,  , 0<0 0- 0PSL@ 0S00  0 0#<0 ", 00IP@ -LM  T0 P pR P P P  0S0 ,60 S | < Z 00 0K%P\0 0 PF0 1000<08` 8`V3 VQ V$ d́ RH0 N8Q Q P Z 0SR ğ@0`P`` +0PP 00  @0 ;cS0!0 崐  00600P W 0ğ0 ?@P0芑4P@/+0QĠ0A ` 2ڤ0S.Y `+ " 0/S ᐙ$\ 0 ` 0V 02" @_0S0SPP 00" R    0PP 00 - J 00 lQ!X0O T S QRl %h0\l 0SڬQ 00d :R0000g &P 0PPK0S0c0 S0 00600 P 5P@5 00  006000K0Sj 00:00{ey0SSt KkAK 0U$P0 \0R 0  P\00   02|~|MPec ecM -LM@ 8PT0@ U ap@ R< 0< ,50 S@ 0000  <+@@@ 0S^Y 0KK 0@RK:0S* IP0@K00` ?` 0@0CO0 @ Nğ 0@@K  @;4 @ 0hR !   0P` <0<@_0 S:0S* N d0S Xʨ` 0S,a%PH LP@jd R`@d@ڨ`0@S`0`Rd %d@5l0Sd ` `Sd dh ^Dhl T0! 00000' 0T @0S\pʔz ^00$00,000#, %P@ K_t700 s*700 000*QhhPl%l0500;0000 Sm0Sj@@ g?00K  0"P@0 @@  0P;P@  0Q18ec -LMTAP0p@` <P  \0 0P  0 -LM, Tpԑ0 P@,0pW4 @̠0h18 80  `<`  €0<4!0X0SW  << 0<8,04 0MP W  7P,04 0`;P<0<<0Q004qpW4(A(!P000"P0P0C\ 0  "!0 00 0C&  0 "!0 0 R900@0040000 0`0AXYcgcܹcccc0 -LPPLPp 0 \ X 0 \09P>017 A 0*1:TPU U U\ 0xPU* 0 0 33.PP':@ @0:'9): l0P|xtpPPPP|Pm 괈8   "lP@ 012 02!  `0 0C\ 0  "!,0 00 8C&  0 "!0'0 R 0  0ꈇ7  | "ZlP@ ` !2 02!  40 0C\ 0  "!0 00 6C&  0 "!0&0 R 0 P 0 <0 R 1 /90 R 1ee/1`ڽPPL%@ 000  #R60%0Nh ,#0Q0R00SX R R'`U@00C\ 0  "!,0 00 5C&  0 "!0$0 R 5 #@00C\P 0  "!0 00 l4C& d 0 "!0@$0 R < PP#000@00C\#ꬓ 00"0ckP@ 3 !" "PPQ\0 0C\ 0  "!(0 00 3C&  0 "!"0"0 R0 0 PPn2 0x0"0kP@ \2" "PPQ4"0 0C\ 0  "!0 00 1C&  0 "!!00 R[0 PP ϺPޭU!P1 0D0"0jP@ (1" "PPQ!00C\ 0  "!0 00 0C&  0 "! 00 R 0 P0 PP   U4rdcܹcctvbXtbcc0PP 0-LM@P(U\|x |00\0\M0@0 R 0S$0,@0$0 R0lbP~c -LMP@ T0P0h p-SL M`PA $0: PPU@0$0\0- 0 @\ 0ϼP@ V  00 q$0@0@$0Tt #T T@p@ q@0$0pp 00PP -l5LDM0d0 `T R` ) PP 0S$0PpW @ 줟0$嬭 0@$080$`0uPP$0@`0Se l4dP80 ,P L0 XK\K@H K0X@ 嫿P\PO0V0#U00S $0C#U U0S\0SX03 U0S PPL08 0bL0 UU u i0 U0  00\$qzPPPP U M00. r@L0KT0 P@@0K0T K`PH d 8 P DP 4P 0 , XK 0@ H KX 80V0#P00SP $00,h Q,2 P@0 B#U U8 R9UL<4(<"4!<!1RL 8 @@H K0X P#PP p Pp8Qm  L0 aLp Pb 0((!pPW0 b0p PpP <PP jPpW 0 0d 80 , L0 XK@ H K0X@ 课#PP$0 NL08 0bL0 ;  b@fcʚ;PQ0gcQC&  0 "!.00 R8(0SS800 `0004p 0 0!44 0h<  80S$00 00h =]@ 0͟0 "0[PP 1 01!  l- @00C\ 0  "!d0 00 P=C& H 0 "!(=(  QX0P 0p 0L 0 0 `R \0SA ) P 000<4(<"4 !<0T,0`H<  004<0 440`0`Q < 4( <"4)< `08P, <$4 ,< !$ 4*,%<Z = Z` 1V  80SF \\;@ 0H[00D "ZPP 0 1 01!  *0@00C\ 0  "!0 00 :C&  0 "!:  Q0P 0p 0P 0` <4(<"4 `"<V# m  80S @ 0 0"0ZPPሉ 9! !岑)@00C\ 0!!L9P 04)C6000 "!0)0 RVIP p 00c,  80S0 R@1@! x 0`d0 0 V   P00`eV @T0@@T0 00 0 08 40(0 0 0p40 $00 a7@ 000" Z$@0@0C\ 0!!`d 0H'C6000 "!0$'0 R $ R 1 0+10 (,Z0S   0 0 Z  1 000\\, "48<# P*0 QPF bP  0S 0R0@-1@  Q T0Sl `R 000S00000Q \ P@00C\ 0  "!p0 00 \0C& T 0 "!00 0 R00@cܹccc0p@-4GO`C/Iπ``E?`40410 pCGO 0R !1R IπE 0R$!1R``-41 T PP \ !1 01!  0p00C\ 0  "!0 00 4C&  0 "!0$0 R00P00P 000,0 0,0 0,00,0 8 <PPRk  P@ P<4(<"4%<0 04K8`K JI$00  00aSʡ01  00c<  80S N>P   "2P` 011 01!  P00C\ 0  "!80 00 L?C& T 0 "!0x/0 Rt00`00` 000,0 0, 0 0,0q 0,0 5   L8 R55 !<4<("4!<0 q<4<5<( "4!<0 q<4 5<( "4!< 0<4(<"4!< 0(<4(<"4!<0, r  4Ba<4<("4!<000,$,!$#, 4 r  D4Ba<4<("4!<0 {$00 @00aS?1@0 0c<v  80 Sj THڬS3p   "1P`  !1 01!  Xp00C\ 0  "!$0 00 3C&  0 "!0"0 R'T00`00` 000,0 0,`0 0L0 ,0`0,0 <4(<"4!< 0 L0,AO$00  00aT$00 @00aTo1   0 0c<`  80 ST A1P  | "H1P` `011 01!  4qP00C\ 0  "!0 00 0C&  0 "!0 0 R00`00` 000,0 0, 0 0,0L 0 ,0 ꄵ$00 @00aSʠ0u8xcMbܹcctvbXtbcc0R -LM pT0! 0 < 0 ` ` T0$  00CSn80Si0 0 9 0 0P` 0 M00P@@T 000 $ &P0P60 @ 0@PP VP ~ 00ᔻV 0K00 0PT 0R )0S ]00( `P 0@ ^H $   0K `R O !<00P 00c<@  80S4 U< KK5PP Yʔ!0P 00c<  80S U KK 0PP 0K✠K⠐K  P`j ag 0娀  aP00 P0,$,!$#< K  0kP㨀>rV( V( Q  R  cQQ 70V00S T0$ ``Q  0;0000  0S 0SX00 Ꭹ`0K  P R @  0aP00 Y0,$,!$#LT@TژH`zr0@ l P0 P0 3 0P0R00S   <S T 0KP`x0 0R0 f 0 @ aP00 N0,$,!$#<<0崀  aP00 %0,$,!$#< r0 ;R0  060K  0P㴀 b0K  LPYK  0|PP 0K  7PDK  0 eP9 q eHPtq <S( 0   T060T 0KP`00\0 0  aP00 k0,$,!$#P T 00 C0@K P@@P 4FhDK 0P@Du0@K P@@Pa< 0@`T0P<0 <4<("4!<Pp >0@K \P@@P80@K OP@@P80 HKH |P@Hwn$00  00aSg01@00c<m  80Sa U5p   "$P@ t5! !Hp00C\ 0  "!0 00 5C&  0 "!0$0 R 00 @0@ 00,0 0,P0 0L0<,$,!$,4 ,<, 4  (<0l$00  00aSʓ1@00c<w  80Sk WIڤS3   "G$P@ |3! !P#0 0C\ 0  "!0 00 3C&  0 "!Ÿ"00 R'W#00@0@ 00,0 0,P0 0,00,0 P<4(<"4!<00,Ad4m+n$00  00aW$00 @00aWE1@00c<_  80SS Q1p  t "#P@ X1! !,p00C\ 0  "!0 00 0C&  0 "!0 0 R00 @0@ 00,0 0, 0 0,0 0,0 $00  00aSʡtTecܹcctvbXtbcc0cR -LTMT T10NP S`P X \ l dP H0,$,!$#<h0  0@\l l0  QT 0 S<  T ,0Kxl@T0 4 T!<00P@00c<$  80S U< 0K,KPP\\00!0P 00c<v  80Sj U\00K ,K 0PPl@T+ 01@00c<  80S ^>`   ""P@ 1 01!  }`00C\ 0  "!0 00 |=C& t 0 "!0P-0 R00@00@ 000,0 0,0 0 <,<4(<"4!<, 0 rJ 01 00c<>  80S2 t\t<`  h  "a"P@ L 1 01!  |`00C\ 0  "!0 00 ;C&  0 "!0+0 R00@00@ 000,0 0,0 0@+,00,0 (<4<("4!<001 00c<  80S Z:`   "!P@ 1 01!  z`00C\ 0  "!L0 00 8:C& 0 0 "!0 *0 R}00@00@ 000,0 0,0 0,  , 0001 00c<`  80ST \Y\9`  P  "!P@ 4 1 01!  y`00C\ 0  "!0 00 8C&  0 "!0(0 R00@00@ 000,0 0,0 0,  , 0001 00c<  80S W7`   "=!P@ 1 01!  w`00C\ 0  "!\0 00 H7C& @ 0 "!0'0 R00@00@ 000,0 0,0 0,  , 00(q- 6 Q 01 00c<  80S PVP6`  D " P@ (1 01!  u`00C\ 0  "!0 00 5C&  0 "!0%0 Re00@00@ 000,0 , ,0$ 0,0 (<4(<"4!<0,<4<("4!<00q 4 Qj 01 00c<^  80SR |T|4`  p "c P@ T1 01!  (t`00C\ 0  "!0 00 3C&  0 "!0#0 R00@00@ 000,0 , ,0$ 0,0 0<4(<"4!<04<4<("4!<000CSh01 00c<  80S R2`   "P@ 1 01!  `r`00C\ 0  "!,0 00 2C&  0 "!0!0 R00@00@ 000,0 0,0 0I ,0,0,0 H0#((0"4(,8#$ \0 4K8pK`   "P@ 1 01!  ~`00C\ 0  "! 0 00 4?C& < 0 "!0`/0 RV00@00@ 000,0 0, 0 0,0Q 0//,0 00<4(<"4!1 00c<t  80Sh UHf6p   "P@ 1 01!  嬕p00C\ 0  "!x0 00 d5C& \ 0 "!08%0 R%U<00@00@ 000,0 0,0 0\,$8,#$,00,0 !,0 0\ ]8$00 @00aU$00 @00aU]?P 1 00c<v  80Sj UHc3p   "_P@ 1 01!  |p00C\ 0  "!H0 00 43C& , 0 "!0#0 R'U00@00@ 000,0 0,0 0,0T0,0 <4(<"4!< 0 T 0,7ꇞ$00 @00aU$00 @00aU1 00c<`  80ST Q1`   "P@ 1 01!  \q`00C\ 0  "!(0 00 1C&  0 "!0 0 R00@00@ 000,0 0, 0 0,0T 0,0 $00 @00aSʠ0NS$00<\To-, xcMbܹcctvbXtbcc0R 0-LM@ 0KPP 0sL0f -LTMT TT X L  T0\ !\0T@0Q<` l0 `d h \\0h $ 0@ ll0  QL ( S<  X,0Kkl@T0 i X!<00P@00c<Y  80SM U< 0K,KPP5\00!0P 00c<  80S U! 0K 0,KPPlP] 01 00c<Q  80SE Y9`   "P@ 1 01!  @y`00C\ 0  "! 0 00 8C&  0 "!0(0 R00@00@ 000,0 0,0 0,0h0+,0 " 4001 00c<  80S 4X48`  ( "^P@ 1 01!  w`00C\ 0  "!0 00 t7C& l 0 "!0H'0 R00@00@ 000,0 0&0, 0 ,0R0&,0 H00&00000 04K8pK X0<P0  0aP0<0 '0,$,!$#LdP@d@ 4"ZVRl\b h _ 0\``XPK 0PPX  `0@K MP@@0<aP0<0 dP X <4<("4!<PPP0@K 'P@8@0@K P@8@`HK 0H HPH` n 0,$,!$# 0@K P@)0@KP@0@K P{@0@K Pp@F$00 @00aSEecԅb0g`'0{bc|cp%bcc0ܹcctvbXtb \0s^ 01 00c<R  80SF dPd0`  p "8P@ 1 01!  p`00C\ 0  "!0 00 $1C& , 0 "!0P!0 R00@00@ 000,0 0,0 0!,00,0 \ȡ<4<("4!<001 00c<  80S R2`   "P@ 01 01!  r`00C\ 0  "!0 00 2C&  0 "!0"0 R00@00@ 000,0 0,0 0,  , 0001 00c<s  80Sg S3`   "qP@ 1 01!  s`00C\ 0  "!,0 00 @4C& H 0 "!0l$0 R&00@00@ 000,0 0,0 0,  , 0001 00c<   80S T4`   "P@ 1 01!  pu`00C\ 0  "!0 00 5C&  0 "!0%0 R00@00@ 000,0 0,0 0,  , 00\(q? `6 Q 01 00c<  80S V6`   "P@ 1 01!  w`00C\ 0  "!<0 00 P7C& X 0 "!0|'0 Rw00@00@ 000,0 , ,0$ 0,0 \(<4(<"4!<0,<4<("4!<0\0q <8 Q{ 01 00c<o  80Sc lXl8`  x "6P@ 1 01!  x`00C\ 0  "!0 00 ,9C& 4 0 "!0X)0 R"00@00@ 000,0 , ,0$ 0,0 \0<4(<"4!<04<4<("4!<0c$00 @00a Sʑ01 00c<]  80SQ \Z\:`  h  "P@ 1 01!  z`00C\ 0  "!0 00 ;C& $ 0 "!0H+0 R00@00@ 000,0 0,0 0, 4 , d$00 @00aSʣ01 00c<[  80SO \<`    "PP@ , 1 01!  ||`00C\ 0  "!0 00 <C&  0 "!0,0 R00@00@ 000,0 0,0 0, 0ꑗ$00 @00aSʥꅗ$00 @00a S<01 00c<^  80SR ]=`   "P@ 1 01!  L~`00C\ 0  "!0 00 >C&  0 "!0.0 R00@00@ 000,0 0,0 0, 4 , 0>$00 @00aSʢ01 00c<[  80SO _?`   "qP@ 1 01!  |`00C\ 0  "!l0 00 XAXP8 80D  <aP0<0 ő0,$,!$#`   "PP 1 01!  ~`00C\ 0  "!,0 00 @?C& H 0 "!0l/0 R00P00P 000,0 0,0 0,0尟0,0 $00 P"00aSʡ1@00c<t  80Sh THڴe5p   "NPP 1 01!  `p00C\ 0  "!,0 00 5C&  0 "!0$0 R%T+00P00P 000,0 0,0 0,0X 0,0 <4(<"4!< 0 X0 x$00 P"00aT$00 P"00aT1 00c<t  80Sh THڔc3p   "PP l !1 01!  @p00C\ 0  "! 0 00 2C&  0 "!0"0 R%T00P00P 000,0 0,0 0,00,0 <4(<"4!< 0 0,8[~$00 00aT$00 P"00aT>1@00c<_  80SS xAx1`  l "?PP P1 01!  $q`00C\ 0  "!0 00 0C&  0 "!0 0 R00P00P 000,0 0, 0 0,0 0,0 |~$00 P"00aSʡ$mܹcctvbXtbcc0R -L\MT P T0\ \!` @0`0 P d 0Tt0 p tp0H $ Q<   ,0KX hP lP p R0 P !<00P 00c<A  80S5 U< 0K,K⛤PP` R0t!0P 00c<  80S U \00K ,K`0{PPp\L X0s 01@00c<  80S ]=`   "PP@ 1 01!  }`00C\ 0  "!\0 00 H=C& @ 0 "!0-0 R00@00@ 000,0 0,0 0,,00,0 X 匜<4<("4!<001@00c<[  80SO @\@<`  4  "P@  1 01!  {`00C\ 0  "!0 00 ;C&  0 "!0x+0 R00@00@ 000,0 0,0 0,  , 0001@00c<  80S Z:`   "P@ 1 01!  tz`00C\ 0  "!@0 00 ,:C& $ 0 "!0*0 R00@00@ 000,0 0,0 0,  , 0001@00c<  80S{ PYP9`  D  "+P@ ( 1 01!  x`00C\ 0  "!0 00 8C&  0 "!0(0 R:00@00@ 000,0 0,0 0,  , 00X (q 7 QN 01@00c<B  80S6 W7`   "P@ 1 01!  dw`00C\ 0  "!00 00 7C&  0 "!0&0 R00@00@ 000,0 , ,0$ 0,0 X (<4(<"4!<0X0,<4<("4!<0X 0qf 6 Q 01@00c<  80S U5`   "MP@ 1 01!  u`00C\ 0  "!P0 00 <5C& 4 0 "!0%0 R00@00@ 000,0 , ,0$ 0,0 X 0<4(<"4!<0X04<4<("4!<0\4K0 8`KP8eccp%b0{b|cxcMbܹcctvbXtbcc00@K "P@8dHK 0H OPHd 0,$,!$#p   "TP@ 4 !1 01!  `p00C\ 0  "!0 00 >C&  0 "!0.0 R$U-00@00@ 000,0 ` 0, 0$, , 08 #$,00,0 ,,0 0\` v$00 @00aU$00 @00aUl4?P81@00c<t  80Sh UHڐc3p   "P@ h1 01!  <p00C\ 0  "!0 00 2C&  0 "!0"0 R%U00@00@ 000,0 0,0 0,00,0 <4(<"4!< 0 0,;u$00  00aU$00 @00aU1@00c<_  80SS xQx1`  l "CP@ P1 01!  $q`00C\ 0  "!0 00 0C&  0 "!0 0 R00@00@ 000,0 0, 0 0,0 0,0 u$00  00aSʡ$qܹcctvbXtbcc0R -L 0X;* 0A00 S 303p 5 0 5+:P`'<4<, 4$!< , @!$,,@00KP 0 A  P0R0P0S 0U:000S@@Dt@ uğ P 0E b0B&0! 02 S1b1 R000x|$P00C\P 0  "!D0 00 04C& ( 0 "!3  Q RS Vv 3 p0 a0B&0!01 S`ʁ1a R00    0  0  ,C0ßp00C\ 0  "!0 00 2C&  0 "!2  Q"0 V K00S0 S  009dŸ@0 00-p0_ 00`0p{SNK 0K1`P00 8 0p Tz0 cpUH )@PXX@@ P P@@p@8@  P@,8@A P  P P  p@A@A P@AFOAPPNAbOAPMA~OA 0S0K P \0RwX=bb8>bp>b>b>b?bP?bec -L\MP Td d` l PT X0 \ Qh p 0;#;S & 0,$, $,#,.0 , >Ο@0 Z D   P40KώZ`8  P!<00p 00c<~  80Sr W< 8K4KjpPlp Zr 81@00c<f  80SZ ]=p  |  "BP@ `=! !@-p00C\ 0  "!0 00 \`L K^9 &P%@0 0@0 )0K KЎP@H0K K ŽP0 KK 嶎P0 KT QP@@ 0a^00 @<4(<"4!̃0 a^00 0 K+P ]0K K {PS@0K K nPFZ@ 0 a ^00 D0 KP1@;H -0 KK JP"0K K >PK  K0mP  q0K K 'P]Th $00  00aSP Uec$UܹcctvbXtbcc0R1@00c<x  80Sl UHlpl0  x "P@ 0! !00C\ 0  "!0 00 1C&  0 "!04!0 R)U%0 @@ 0|0 0|0 0|00|0 0 <4(<"4!<00, +g$00  00aU$00 @00aU -LM@`p]0#0 0P  \, 0 @0 P00C\ 0  "!0 00 2C&  0 "!0"0 R 7@08 0R@0000   P40<"}Pv 0``PW000 zR 0 m1P 1 1 bB&! 02 S5ʌ1b1 R0@@00@P00C\ 0  "! 0 00 0C&  0 "!0  Q0fs P0 0 ,K,0@fm m@Aܹcc@,0 0 R0$0 \R0 Rz<0PS( P"?A3cPg@Ÿ80 0P= sP. 0 R$ < Ġ /0 0\0 d0, 3T0,M,<00<00, H ,0 0P <h04h0T `P<@0  :]@,P 4 R 0 *J0,0  @0<0(0CX0/"b\0P T00x0 04,Q,VUUVHVxVVVVW -LM 0 0 $5S @ 0dpPPT 00CP0 H A0`TPAVXPK0K  "PpK0K {"P0S  P0(00 0  E0`S 0!0 Sm @(Ÿ  0PpQ `0 V!P0V P`80 VP 0 (0R- Q0S& qI T0S jI` VP d00 TQ[0 d03T0`80 VPHH P000Q 0 T 0 (0RII  @`0 0K@@HP0H00 @A 00 K1HP0 @DPH0c I鬠0 R -L M0p00 00 P0, S j V@ 0,T@#S V L#0S 0C0Ÿ 0P 0 T 0P@q0p` 0S  0 ]z 0Sh0 0S 0Sh0Po0`0 `F 0 R 0h0 0 0 ` 0S00d0X0 0S``l0P0S 0S' P00SP0 ` 0S JP 0S``l0P0S 0Sl0P0s  0S0l0P0sJll00Sl0  ,0`@ 0PQDtL#0S0__@LT4WTWlWWUW -LM P@,`0 4 0<  D D@/">C2"/P!008BS@ C4p?#@W8 40$tDCY8 ,0 <  004,  `lT@,gP@1@#W<_P@1T@XP2@p"S 0 S08 SL3 R2PPP2@p"S 0 S08 SL3 RPX P"00 SPPP#00@ SPDpI,@PD `P"‘\00pS04pS ࠡ`P PP ‘\00@S04pS ࠡ`P  - PL\`@pP 10SBt0 0Z8 0 T 1P-@ `,@`VP3"0 SPPP#0 SP8 0`X8 T`0l!`!R @ R D0| 2a n@j`& -LMPp  P,P ,@`VPUPa 0 P` ,@V,0(`VP 0 PP`,0UPV -LM PP`4  T 0cSP\q8 0 B0C0 Y0 0 0! d ,K0EP@,H"H`Q@ 8  3S F2 0O 0 T0XP<0 0!8?\>`0 0/ ?> 00cR#@[ P80iW00\!8?\>`0 0/ ?> 00cR#i P<PX!@!400C40 g!40040T0XP%0 @?Q>`0 0?>0 0c$00C$0 P B 40P 00C 00@0 00,E ,x,ZFTU p%b -LM PP 4 pP0 00W~ 0 0 ! 0d 0,KDPl,"H`0S 3S 'FY00W "0O00W T08 WsW@!40 S@TTA 0 0P7^!?Q>`0 0ς?>00c ^$00g$0 P g 40  0W0g 0 40 g0C40!400400,哊$RE,Y,E 0 ,?0 8 W00 ?Q>`0 0ς?>0 0c8 ^$0g0$0 P 4  00 0 40040,E0 ,U p%b -LMH2@Q`0o`T p Po 0Pc (@80  P(W`@ZD 5 000C0 P B 00C0\%@1R6 |0P A%@P90 0` PE+0 RX0  200000C0 0 RT000T00C000 0哢 800c@` Z"P U T -LM `Tp 1S0 0 ! 0d 0,KvCP, 8 80"H@0S 3S 8Dh$% 0WP0SPU 0PG0UC0SPEUT3 Q, 8 Uʼ000  P@ l?p >14 PHX P0 ^ 0 S40\4 \` 0n0rP02U8(@8  P80PU,080 , 8 8C80`?`0P,080 U W -LM `pP4 PP00 0 0 0! d ,K0BP, ,划H Z8  3 S D 0S P2 U0O@ @P> Z!\000/ > 00cR#< 018 a^ Ϡ\0.Q 00/ dP  p1PR\0/ WPJ @1 Z\0`000?0Q0P PP0.Z\0!00> 00c# 00 0C 0  P B 40 P00C0 ,C0W W0 00 P 2 020 0U p%bXW X,X -LM p`0PR 0O0  08T 0A0U2Sʼ@X0 $0X: hs 0`ş R00p  D000 00 ! 0d  ,K0AP,,$HZ 3S C4 0O 00U 80A040 ?80 d448Z`0.!48000?.a 0 bS1P4 0< d T0USZ% #@?T>`0 0/ ?>1LQ 3T`0 0?>0 0cZ$00 0$0 P R  0 0 0480  34R`008008?.a 0 bS1P< 0 2 `R4 `0RA < P00,B$08 0a$08P×n 0 0n 00000 P 000\%1R |04@PfJ@P^0 @0` <PEPl1 RX0  2000000 ,1 RT000T000 0R0` Z`0PB L P! 0 R`0   0K000 P 0 000\%L0R|0Pk0 ((LX|XXXUU p%bTXXX -LM Pp,0 Ww*0 0 ! 0d 0,Ki@P@, ,!H`X4  3S A`1 0O 414AQ\000?00p S28 - 08X\000/ 0100 0W0p50 0 0  P 0 P00 ,A00C0 P B 20C 20< =S0 U p%bY 00cR#0@g0P 0 S P Q,0` X", 0@ 8,0, @/>QU 8\YYYYG-M$PP0gl0h `Qpb?>1 E   @$?p > 1^ࠡD T! 0  S \ d@E? >j1^࠱D T!@  LP \l0 \ 1 Q0 110b1X10l1$5S!0SL\ T3Ѝ?>1 E -LM P@P 0 x85 0 00 0 @ R@  PU00\pP@ (` VV V 0 4R@_i 0SE:0SA:0 @T00 T00S  Rʠp0(`VP@PZ P@P  0S:0S: 0S @0 0@>PP?V8 8%0@P0L 0`@V \  0a>PP (0 P0@ xK P`@ PP 0x0(    i 0S:20S/*@5L 0`(0 @ xK 0vPP \  0Ph@ 0d x02T0 0<H @0@P0`|0Kd KPP | 0` B| 1X`tKV P    pd0G0 0@K@=PPO`@K|0H \a V pQ @00xK  PP3x`0` dG0 P@ d03 T0 d0KH<@%0@P>PPP ?\00Sa@  =n>>t`K V@ *0 a00V@:Q00 TkD 0 7h00dh0   R0ad0F0 K0T=P `0KH =(> 0 s> RV? P0! 0xK 00  zPP x`P` 0 0Pi? d0 3T00 P00!a c==0<Hx0@PL> Rt 0 0 K0<PPZ0 @0b0 0.? d03T0 0 T@ 00xK  PP;x`0t` 0 XP? d0pK3 T0 H<10@P=PP"` 01X` X0 0  (0 xK00 @  @UPPP @@000x1( P U  < =S>00K L0R-PK ?@K 00 KKK K0P00@0S:0  Z Z- M ЍJ -LMPT`$ 80  000    0 08 00R00S 0pKUj  0 R 0U 000O 0 R U0D  0 R 0V( 000O 0 Ry V0  @ H0P@   0 R 00 0 000 O 0 R  00$ H  0 0\%1RC P` 0p0 0 0$@x`0dCA0 4K0;P@@0Q4x40 H v8 R T0$ @ 4a<4;4<,5Sʠ0' 70V0   V 0000uU0aU 0000RTLZ -LNKgMTQ`U@|a 8 0BRS p 0S  XQ0S R PP >K ᨡ 0P(P,P4P 0 PSlQ  0.K0T1QSNXaqVJlT45S:05XS*00^K01 `qS?K 0 0PP 0 R 0^K000nK ` :q L:;000  0L<0K0K AlX850p1  0 R 0~K0l^K000P `P?~K@ 00@.K@`Klq8Kt 0KPSo`t0堀 p0UOl0 t $x! t!t1 aR00X0pPK@/0Sjt!L Rt! PC@KBZ 0S1( ? 0p0 \aQ  `!P 0S!0(0 0p0p`P U pՠ000  0PRoK p 0S㠀1( ? 0p0 0 S0p (0P UP@K p 0S㠀1X ? 00 p0K 0 SpA 0 X0PU 0 R 0^K000TaV8+0   YXK@ 0 l`PtS/ PKt0 p0QO0@H K㠀t 0S t.Ka00h1dA0e@K 0 RYtPt Z\@ 0T PQ 0SG 1p0.Kh1dA0PE\!0OT`aS\\6 0S `a.K1p0h1dA0) \QUlQ0 0S ^K000\aVBlQ0QT @aT pՠlq^KT0`Q3/nK h G|a p堀d|a 0S ^K000 0 R |qg /0 00| 0 |ah00fh0K0`q WNKlP Z p 0 S# 0S:0S*la LS>R-`0 .K a0000Qꠀ 0S:0 K0w`a VjNKlP  0S" 0S:Z0SW*la LS>R-`0 .K a00D00Q= 0S:0 5`^K1( 0O& 0S!0(0 1p0p` U pl P01R/0 0S:0S :l0@h  q| pࠀ| lKS>0 lAL R-NK ?  K00@ꠀ 0S:0 1( nK0O`!SlQ~Kd @FP@tQ@K  0 K@ (|P1 qPpq R| P py 0 R 0 00l1h0 |AxQ p堀@|A c0t 1X t^K1X a0OPXqW0K0 ta0R00X0  p堀0^K000>l>KP @@A NKPp` S?K 0P0 PP 0 RY 0^K000Wl0@ 80S L1pqHg8LD; L8L8 VlP  p 0 S# 0S:0S*l LS>R-`0 .K a00@00Q@ꠀ 0S:0 0.K00K0NT 0( S/& 0S :0S:(0S$h0S! 0S 0(pS  : 0 R 0 0f00` 0S:0 0TaS頀Xq0S0TS bhZ -L4M0 P0 80 P T 4 0\ D H0 t0@H@T H 8XH^00@ 04D@ L@ D9< 00 m85 ,00,0<0<0 <80&Q0 >< TPs<<PP08<|HT 0 PP  P$P80Bd4 P  QD 00 ttP00C\ 0  "!@0 00 ,4C& $ 0 "!0$0 R0 DxthA@ T0$ @<6PPT Dt H0@B4T 0cpa@DVHTp 80SRHaV]D0SS b3 @ 0D2 bB&! 02 S;1b1 RD 0D D 00 xR@00C\ 0  "!D0 00 02C& ( 0 "!0"0 RP  TH )<00 :00X7d "L0,K0P P,0TU T P  0R0d ",KT0P0PT0 ,0PP P0L0 00P0 \<7KlH4 D @P P  P  P P P  P  PPt Pl P<60`L? b@bp>b>bP?bZ -LM @0KPP0 K 80  P 0 5R/8 0S#:0S:0 00  ,K0\5P@8Q,854H 0 80, ,6 LRS>-0`pǏ00  0S:0 A-P8@T`p T ?>00c0Q3@T TX0X  0S  R1 018Ġ8\800CSt`````0S0 #Q00 #LQ0 R0S800CS4P(l((((000 10B0  2 R0  00800CS 000 10B0  2 R0  00800CS|hhhhh0S1 S20#B1  0S 00 -LZ -h1LM`Q`!00pKP@<1K[ -L4M$0@pH D@  1`j 0H @@DQP nU0x@ KmP@0L(@  ?DK 0*1PPwD2H\%R0 R1Rh0 S/31PT3h PT3h0 SD 00:00D3(5(0, C40@P PUL #8 P R4 i0@d 0 DK1LP0P L0 +D0H}D280P Y 0$%R ,0YT ,0Y$%H0\8 K4 00 8 ,` J H0"hdTc [\%T0R 0 R80Rh0 S8P0!RTc -LS΁D 0 Q/0D@$P4`P05S`P RD0D0 0 < $0D000@ <T06PD P DP}DL}DP ,|D ,LDPOPDxPWX00 9004X 0X040 a bhdTTZ[[[E-0 LS03R %5p00P5,5S ڬ4S9Ӭ4հ4S@0Ӱ400tA/SpPo5@"p%$\ZH0L0SO/͎ -L M$0Qp `; P@ҍ X00#00' PP@р L||  0N 0Q i@GP|||$0ԑ:$0  -$0L Ppԁ  dHP@`@0 S@`V QHP@P @ )g0 0Zj@ 1kK -p`P\LP0d -40( 8$@<( @`@, T0C0,0VZ  4Z 0MBl , D WT,\ p-LM80@SP0 0hl0S  NF`V p  0i0S0 jBG -LMa@@ -RPp =SAT8 K8 4P , 0@  gG8p $0 #=0T00S<K <0PpST 0$ @ yf  0i0S  pj@ =SPp; X,X8\ -LM4 q8  8 PU4,0KPŸ C@T`0T"0}v p@00@0, `,002 0P@ ,FT P0 0 0$@x`0dCA0 0K0U-P@ ,eF0.8  e@x00 H )0.0x00p1 4,0KP@A 0S@@l0P0S 0S1 0P 0S@@l0P0S 0Sl0P0s ,0T $000\%0R ,08 0,5Sʠ 0p00t0 0S0l0P0/l,E80080Pcc_XcccT@-@1T0, T:F@ 0000 0S00l0P00 -L MP, 40@ 0 PPp#8  R4 g0@d 0 . H`w,QE -80p W 0\'d0T   c@000h 0.`00h HQL5H sP5,5S,>QS. -0,0P0 SHŒp011pGW,00P000 p%b p-L Mp@P0Td``  pH@`"< 80`@ph 4g`0cL\T\Xc@-QM@ 00CS 4DT P0 Ѝ@-@Ѝ $  DH -LTM8 @ 0< P0 @D@  45R 05R@P @@,@ 0S <P0  0S<< 0000`PU`VP0D@P E PH 0 < d P` 0 S/ <@0S:0S:D 0\ @D@08%\0pcWp!L0 0OTSp0@` h d h 0S 0SF0SC 3 R9 d@< 0H@S00 $,K8Q4P@&H<$,@0cXX pL H@ P@,,@,@ 0SvP<<000,,<H$ 0AS ,K8H 0+ Td0 0`@R4* 0S:0S:\4 4K,@K8H 00K @+dD D@RS>L-0`ɯ00  0S:0 0St0p D@ S>L0R-P@K ?  0D0X00\0 0 040D0X0 0\ *<0 0S:0 <D <d P` yUvD -L\M0 08  4 00PL 0UT0 p4@80S S &T8l  8 0l R0000  0S|6d t6X 0S 0lS00S 0 Sl 0< S"4%R:05S:8408 0P0R00S l  R:0S*M X 0SD 0@K0T`\ ^P <0l P <8@850  lX!RPPl00@P P H P0,KB0P8`Pkl0 Po 0 S 0S:0S* 0S l 0@ 04 R0000LL 4$, Z` @0P`<  P0  #Q 0S:0S:<@00e`XHH8 \P`\0S<@H0 0Sf ,w*X00V0S8P0008PUkXQ0 0S 0S 0 R? 0;08@PXY4z L^xfV T0@0K@\0@8@l X b0P@88X0Q\ R  0` 0;080P1 R 0, $R0000 4,b*,|),0H Hr< S>0LR-pK`@K ?  pK0 0@ @`K eI 0S:0; L@DK 0 `@VP*D0S'\ P P`XW0T (Q  R 0.SR 0.SH0P 0PW -L8M0`\@ p@: \@7 P@0< K8\08 pPPVP@@T0( R)0[*0[S""[0R0 0R@ R e8@00T@ K0P@ @P T @PR8徶@..h]- -LM@ KP 0 0 0-@DP L@r<P00 4 0 0 -( L0S 00#8g` 0-LMP@ KP  0S 0Sl0P0S 7F0000 0- D0@L PP0s[0餳 p-LMP0 @B 0  P 0s[ 000Hp @_ 0S0( 0p0070@8@8@p餳0 0S00D d< X R  0S 000 p-L M0@ `Rp KSL0 R= 0 00 0 R  00 0 O0 0 R  00 0( OH0P@ 0 0 R 0  00O0000 00 0 00 H  0@0 0 p%b -LM`P@2 80S777777777T0$ $PV 0Sh0d `0X 0S  0S 0pSt   0K;  -LMp0P$K`K0 R 0 00 0 R $00 $0 OH 0 R $00 $0( OH@0  0 R"0  "00O0000  0 * 00 0S00p00 0 0 R00t000 0 R00(0p0H0 0S0000 0 R000 0(0 0 R000D0,0 0 R000(000 0 R000@040 0 R00 00080 0 R00$0H0<0 0 R00d0X0D0 0 R00l0P0@080S; ST04 $  L 0S 00[D080T 00h/4[8$0Hl0 00 $00H $0H0@0  0 KKp%b -LM@P0S` p0s 0s0s$0sH0sL0s@0sD0s3 T0$   0Sp00R tP R 0Sd0X0 x3 R 0SD0D0d0X00H00D Q  0 R00#d#X R q T0$ } 0Pt0s4  00K R000080Sp mSf 40p0PT4,0S:00 S*(qI T0$ C  0S00p  P @tP \0  0&WP(q00000(s00 000Pq T0$   0Bu X 00sT0$  S0s|0sgr 0Sd0X0?D 8#8S: 0Sd0X0#8#888d0X0  0S  d0X000d0X0+Fb -@P 0` R00p  LQp sP,Q 80S  % 0 R00tsP   0!:0 000000<  0   O -L M`q@p  w 0 Sp00R psPP   0St 0, ,0  0, S 0pShZR0 PP  00   0 R00tpp 0 R00p@@PP00 0PP( PPPa,0SZ000Z 0S 0;0, R 0S 0;00 0 0 R0, 0, t   0 R00pwP J00 o og 0Sp00Tc 0St00We rP^W 0StppK 0Sp@@A]E p-LM080S 0 R00 d X R  0 R00 d X R `T a3_3px3 0  0u` MWt HW -$"LEM0`,0 8 Rpy T T0RpW  RPcP1 RW 0Sd X 10S VW  V3T1 ,0S H, 000000000 0P 0 0C000C0000v Vw VMOK ? 0UP /V*V&V!V b]0{b -DLMM`0 P,0  0H1 HQ9 H1L 0RD0R TTFT!R00 S L0 0C0 RL  00C0L!000L 0LL!0 0C0 RL1L  00C0L0008@!S~0 R@<0P0T00S*T"0S L1DS 0 0 0 @!8S@FLD!0P 00 .R@!8rS @3 0Q@@!gS@(8P@$ !S/</8/00 0 0 00NK D+P@/8 xR b]]]]]P^ -LOM0,0 `#0Q p 0 KKI>KPpP1P 0S 0 0  p   0 R  0S00t000 Pp  Pp z 0 PC/ A/2 ,0S ,:0000@P1800 00000000 0PpdT0( 2RSOK0L1  0@! U/K  < PpE 0 R0000 0 00 PR0000N|T1H  0Pp3TRPpMOK 2TP 0GpW y R P10o0 0C000C00000000P.TR  0S00t00t07 b0{b8^hP -LMPp@` Vv |0S |.z.00S Bu jRi.g. iP 0 R00D!dbp>b>bP?b<)b@)b(;b -LM 0ST0@@(0TS 0Sh0  0S 0 hM 0S(p Cw  T[ T [0T[ -LM`@\80P0CSTP0QA q 0|0 2D 4 A!P000P0P0C\ 0  "!0 00 1C&  0 "!0d!0 R$T0 NPpTq<H唹T@p00@;0004P 000jP0P0C\ 0  "!0 00 l0C& d 0 "!0@ 0 R$ |ܹcccc0`^ - L 0000 鐶~b - L 0000 鼶~b -LM0p@ `R1!0$K?0 R= 0 00 0 R $00 $0 O0 0 R $00 $0( OH0P@ 0 0 R 0  00O0000 00$0 00 $ H  0@0 0 ~bp%b - L 0000 鐶~b - L 0000 鼶~b -LM0p@ `R1!0$K>0 R= 0 00 0 R $00 $0 O0 0 R $00 $0( OH0P@ 0 0 R 0  00O0000 00$0 00 $ H  0@0 0 ~bp%b00CS llllllmm @00 0 ; < 0 0-LM0@  0PPS00000P@;0 -LMP@p 0!#61080S#PnPnPnmmPnPnnPn4 0 R00(p 'P` 0 00 4 c)r*P`0$KS<00<0>H$@  0P4d~b -LEMŸp , @00y N?KPP81` 0S  0S00t 0 R 0 0  p  PP PP  0 8( (1 ,0S ,Չ0*000p1"818  R00  0  0 StgP5  0PPMOK  8 0P"PP 0  (810彞幞 (00 00818 8 gP 0;0  0S00tti喞 b0{bt^d 1s s 0080<00 s00< 0S00 Q0 0 0S000-<0@Q 1 ! 04  Q000   dR ,0000 0S0@Q1 0 ! 0,00 00@Q191 0 S  -LM @P `Rp% Q 0R 0UP#U($@`p6 P ڠ6 $ 000  嶥xUV -L0M0 `P0Sp: : S@ (@@ٸ 0P@' T0 Pp0@Q !R"0 0S00505 0d0 L D`(@0ˆ ǥycp%bWW^^ 0-FLP僸\ ,0Sq 0 S R 00 -LMP @ 00Q ^ 0RP 0SZ(@O 0" -LMPp  P,P F`VPUPa 0 P` FV,0`VP 0 PP`6UPV -L M @p,凒0PP 0Ɣ&0,K PV$,0jH`PPUI jԷ?>1 1@R#P P; jƷ!0bR0S- PP0S$ P ]PP?>1!E , B 0H 0C0,6$0"Q , -L M P,劂@BP00  0ƕ&0,K* P^,0TH(` (`a>1 1@R#@  d> aq P/ 0lA0 P@~团.!1D0,0C000*  R0C 0,& 101, (0J"p `ᴳP;  $O ,X^^_ -L M @`P`$ U0: 0 , &$K P$0$`Hpض?> 1@PR#  0,0 00D 00$` $ ; 8_XXY -L M @PA \00\0SC(媶,6倢0 Ɣ&0,KL 0S-,0(H`凶Qp Q ;  ' 0,&0 00 00 Q,& 10C1X0, 壣< R,o ; 嵡 峡P_p__ -RLp`$P@ $P`AA0Qd زP 0l1 P0PjL凡P @ὲP; X X_Y_ -0LM ; 孡_ -L|M0   0 Q0p  0 Q0 Jʠ a0(@T &0xK PPx00x (0 v|K 0 PP  | p(0000&0P x &|02T0x0 0x0<Hx0@P0Kd KPP 0` B1 X@t0KT0   d0H& xK0A PPNx``K H0QA T   0 |K  0BPP/ |@dH@ |   0&Pe  6d K3T0` H<兲0@Pd PP0SL 0A xU x xD 0t@KTpL:Q! *0P ʀ0dKA`0&0`% x 00: 00x 0 @PW 04C0 00 000Ad0D& xK0 Px `0KH x x  6Tp:T;0! 0 o|K 0 PP |@@0| 0 pA x 0P&0P  63T000<Hر0@Px7 0 &K0G PPT& 0  63T0 0 |K  0HPP|@X@t@ &0Po x p0K&0 |02T0x H<厱x0@Pxm PP`0| X 0X0 0 嚟 Z -L M @^ 0    Q -LDMT@d ` d0 h P`P刀ԡ 4@h pTXpKU\PK  0gP@sQ\ #0(1( `!R0 0  R` Vh 0S ,!$0(0Q0` 0 A1QXP\ p; X@i T3 U 00d04  0 00P @  H\@0X0T00S 0S $0`V * h0^1 ,1 S 0DS\0 pU (0` 30000$ `V*h SH,!0 0Q (00 3&T00 DFL0 ,00,0-P@ s  J P b@-0 : S l0@@0p-`P : S R0V@l0 u L0S d@0  dPpVu -LMPp@` R 0S 0S1ST0$ %$K6$  000 >0 ]EP 0S  " 0 0 p -LM@TP$  0`K60" 00 T00 0 U00 H 0@0bp>b>bP?b` 0-@PLB/  0000 000000 -LUMX0 ,0 08`1 Q`0p h 0l t &`1 B@00PT`UoK@eW?K TT1 @ P XA DA T  T$T80B4P 000P0p0 LP$P00C\ 0  "!0 00 4C&  0 "!#00 R0S W 0 \q ?Pd -D1P0c0Wx1 $*@TMoKPd  S`!>K0\ hPd l1ğS t@t Pl1 xU:h!2 2@ 2 b2B&! 02 Scʈ1b1 R0pp00p48@00C\ 0  "!0 00 1C&  0 "!1  Q-0@h!P0S:`!0S:PP R d1Spt0a0 d 1 ,0S <,}0Q 0]Q$t  Pl 0t!p! bp>b>bP?b -LlM0 ` 06t0  h 0` d0 @l@ , p @4 0d `>h@h0@ PP<0 X@ \ h x  4T0$  00CS4` PPl 0@RR@0 8@ H0 D0 x\ 0 008 H0 4 l0TS1 4A0S-p@L@ pP t t0 BOK|  @K ث 06000`00 ` 4 4@00@0`p 4k>00 K604T0PPX R x0S00`@0p 4=:P0P60 04p /:P0600d 4<PPK0S 4 T0 K0PP>0 `@X0 S0;04p >06x Rc 04d <PP!0|@Px0lx00S, 400 KT0PP 0   d@Q 0Q 00 R BX`\ 4Xp =060044@00@0` ,f}8\RD<pD D0H<  SG00< 8 0b@0 ?4 /P#  !|t0 0c p ?;@_UT pL ,K/0 PPLD`\ 0-LM0 \P&@tl  00\\ 0SP 0S<P00 $@K?P@`Qx0 0R@`pd0S0@ 0Pp@d ` pϫx0V`0MKS >K>Kp @Pl!ᾫd<0P0@0|0S |0`P/VUh1 0@ J H F D B @ > A?(K < b@aXaha -L M@0Kx RK/P 0<000Kb0K/P(000<000 -LM@$K_` 0K pP$0 0 L0S, `0) 0#60C S8`@`H`P`X`h00$a<0000000000 0  -LIp` b "bC@0cc@0T~n@@ p`b%0 @ W%L 0T0Q00S ,0V 08W@3tpa_- ^  0>0>0 S   -L MRPLA`  |*00΄S 埂 㘇 0o0 0?qtg p-LM@ LQD,00`0,0**0L1pt0 00@- @58 0  0 @2(  0P 6Oc -bLMr, 0@00,0( tB00C\ 0  "!@0 00 ,2C& $ 0 "!0"0 Ri4́,000C\ 0  "!0 00 1C& x 0 "!0T!0 RFL@1*0PP?00p  10S0 ,0P04,0p00C\ 0  "!0 00 0C&  0 "!0` 0 RT 000e~`$Zpܹcccc0tcg 0-LM@P Q 10S Q\ 0Sl, - 0P PnK,0 0 1C0SAbc2hh #b -0P@LT`p , 00S @TV 0 R@W m!@U1S10S SL0 Q* Qp `0SPAb"c -1a0@ L , P(Q@00C\ 0  "!p0 00 \1C& T 0 "!00!0 Rh10 S, 8 0p0@00C\ 0  "!0 00 0C&  0 "!0p 0 R` 000TLH0* 0h*f}cܹccc0ct -|0LM\ d \0+ KKp!! SA(d(P#T 5oc8cc h -L$M8 04 S8p0CP~:wp 0`ZC%Z0>0>0S1#  ~0Z@ p<0  40,K@ P<   X00 P00S 0 X3ZP<@e, T @!8 =< P d0p` @000 ` J0  u"P0000,h 00K L00  0P<\ %U"t" -2LM ,0 0`p,@p娐PLA P 0~,p^,K 0  n TP@ 0) P00(]n؇cԇc8c4h`Lh`g`cc't\0ǠȠŇ@`P'0 ` p P` P000U 0 0 /00 0)P(n PP lhhh -0ap #6RL`QP: P@ 2% " ZU:s%@T  P PU@  0S:P 0S*2 "!6L% -0a #6RLP Q@: PJ6% T: R p$`QV  @P 0S:Q 0S*% -LM.0 L (0K^ #̌P@# 0p` @@7 PD ,1, UL0`pc!  0  #@T  ~0 04 !jzZEUd,4H0 h p0S }),0 0thcc 0.  0 -LM0@`p P000 `FH0 P0000 . . (0KPP J0  (Pa  " -L$M>L0℡~(K0p!p@0 `P `@@PJ<1, WL04 c P` 0P@  4 `GW600S,,4P `}0 @@@9"@Th40 44 4 zGQ(pl8c'tii i p-LM΁TL0K! 0@`P `@Pp8c' -LMPNPA@Tp`Lp,K, X0   \$ 0,_GL8c'Di0 p-0@LM P S00*vP0P0C& R` 00#!t000 `0C& X 0 "!04 0 Rpܹcccc0 0- @LP 0* 00P0P0C& R 00#!p000 \0C& T 0 "!00 0 R00hcܹccc0 -`L0S 0 !,B$ R; 00S000@T \p\P 0@0 T0,  S(<@0hxЇc<`t܇ccX0 -$XPi -LMxxxqx@Tl 0R 0TP!F@ dTP`P @TPPU3 1 0000 0 C \P 0!!  0 C6000 "!T0\  Q0S -HctܹccЇc܇c\icc0 -414qLM  a  P@0T!6U @FP00C\ 0  "!0 00 0C&  0 "!0x 0 R h 0S,G0 0C 0cܹc܇ccycc0Їcp@- 0@ 00`000 C \P  00#!x0 00 d0C& \ 0 "!08 0 Rpp@Xܹcc܇cccc0 -L$AM1, `  0 SP000 p`00C\ 0  "!0 00 0C&  0 "!0h 0 R0  ,00 !Pܹccp 0 0 000 p-LM `P0S @ @phup -LM P`0S   @ @sm[`p0 @000(!`|30 P0000 01 LP 0`p0 @000 `T30t P000D,0QLP0  m p " -LM0@0CS0&0`p P000 `30 P00000S00@`QLP P 0KP P 2"c -L M `Pp @00d#0P2  @F P 0 00P L( mHP, U0 4 p 0S @0SE "S 8v@T mLDpP&(P 00S0D00D0  @0@-P U0 0    $0  CH"&0I 0pp5@T smLPU(P 00SK40p 040Dp0D00D0  @0@L R 0D0S  0ppL D0S R dR 4 <004080$ 0wu4 <0 80 $ 0 j$0  CH"&0 V"jj -LM`LpP0 P@@$U, H@,PT( ( $0,L H8040<  @0FT0D  PF T F0T0(@Tj k@kXkk -LM@0`p P0S+W@T   ?C00cSP @TP ?C00cS <$kkl lVUUUlH0l -LEM00,0  pKŸ2"KoK.X2!'X4@P2 0 000 0P  X( " @ Q  Q6 T "0&! 4!00B@@T  R R R 0 ,0S ,,:R0  "0"2@@ @T   R R  RXRP b R0ԑ00đ\0 0R010201<0 0R*000000AbcNN -L$M0 0 4 S@P` 0QT, KP`>,0 $@0\A 0 S:2\7*Z`!>20K0  0 @P 00 >2Q2^:40`, R ,00C,0,(0,0Z ``0K |0 0,0 @p` -L$M`4 :#:S @>0. Q< "&0@ PD  H D H?0 KP 0D0 8 0,@PL@  1 0<S-*$<0Q*0 S` 0S]$04 <S1& (0 $Q!0V)0K*)K j[^Vp:00L00 S  0<S: H4@ DL V8 (*80S0)0K 00 HaP 0S)KZ )0[ S  )Kjp!^V:0 , 000c P ) K D  -LM 0  S 0` p @ 40S0@0S0 (PU`p >0~pW  0h:#:S P:SQ:Q:J q   `PS7 5  0 &P 0SR  R ,0( 0C,0  ,/  0 @`` 0K P000 P q ,0 0R,0 $ 80SS SPS P9 QS@@S- 0   000  : 0K  0PH  10S     0@ |0 P80 J,0( 0C,0 : O,D/ VʦU^  R  1 0R-*  (  -LM`P@1/ 0S, *"*@S>0NPb@` *T p  004  |, KP,0$ @D P mZ  -L Mp0*"*0>0>0SpbFZ@ W>: W< @0` P000 `,0 5P0000 0P ,0KE0  ,P0   " -LM ! ^>0.@  aR0@  P@ P @@ -LM*"*>0b^@0  LP@ P@ -L0 *"*0>0>0S b^  0   0P  0 -LM*"*>0b * 0H ,6S# `p0d$#&@PQ : 0`\:P  c -LM!>0 a 0* P   -0LS   0 ` P P # -L  -L,M00 R0, P4 8 0@00 0S ,0>0>000  #20#0 Y030"8S8 p`004 $&80! 0 0, < P@<X0Q9 `p0 @000x"`L+0d P000@- 42 H)&R R 46S  @ ,  0N,0 0P@, {\ 0 80S 0 @ oT 0 < d <\ Tlj 80S   |0@ 0  P 4 00 T|0 0 , :#:S 0$"c 0 00ܹcc @-@00C& R 00#!l000 X0C& P 0 "!0, 0 R@8ܹccc0 -,1,L(`P ! p:h 0`0 AT 0 S, @TP0 0C\ 0  "!0 00 0C& x 0 "!0T 0 R 0S0Scܹc8ccc02S,2 R 000  0 " "00C02 0 R l0 000 202  B 00 0202 R  0cXc`chc2-0C22HSD000   202  B Xcc -LM2@ P0 00  202  B 2 0h0h0   @@2402   " @002cXc`chc2 03 R 0+ 000 202  B 2S2 R00|00 0h 00  0<02 0   R  0`ccXchc202ᴺ2020@-04 "QP h@?!l!0 ^:0A^P 01:?01c10@c -LM , 0 "X00 ZY"0@0ŸT0d0l h`x ^ `Y0  a0<"6AB4  8 ^0YCQ< <0 b40Zi8 1P0@8 04j Xf4 "*p@0&04`  8pj0>00 00>0 0 0P  P00( ,0d 0 @\00`T@@0DPXL@L  00 0 c8N4M8cXcDancB} 0R^PA0 pW 0gS*L@`0S:>0 N@ T *$PK0S J $噴T:J|Ph5*DD@0>0>0 0 0p`S@`0A8 PNLZ0S J1` @ 0R:P@DLZ60 0 R    R  B1PP @P0UT7L 0R( 0R0S*0B60 0 B0CR0  R  B0PP @P0U 0R*60 0 0R0  R  B@0PP @P0Uc8c oLo 0-LP@KP@ T0 -LM,  \00 4 W 40SbX%Q*!p WN `Vx!0S`VT!0VZ: R`4A (A0!X:`V!0P0fUq څ1eAD PEU @, Z 00  00O0 0040t 00Z00 oXjKTIM @P 0<0AM4o>M(ZKcpooccoo,p`p|p -2L M0X" 0CX PUPUxbd1h">0> ,0 `J,0P0,0 X!0X010 1 X 0E ` h0dP3q PU,  Q 0 0 00   #&h:` !0 0h `01 P#&:h`  P!UDF X00 P0000C\ 0  "!0 00 0C&  0 "!0p 0 R `0Z 4,  ox4oyLc8ctܹcccc0Dap - LM cL0\ , 0` @,pP 000 pIL8 00\,@L(>L$0$do9Lpcq8qDq8cPq -LM,0 `@S <00 R4 @0R D0Rg'Z 00S, 0 Q00S(0QP X3T3L Q H3 Q 0`8` p8pT TJ 0!`V R0000 0   B 2 $00C$08 R 2 00 @004@ 04 00t,0"S 0",@I @`" 8Q 24 0R2oZO 1P 1(&Ah :` ,0 0!0 0|`P0P0C\ 0  "!@0 00 ,1C& $ 0 "!0!0 R,0 0 0` " "000@Bd1`VbT@EL0!`V0TaVPQ3cc b8c~bhqܹcccc0 -LMp^U R2`  Ÿ#&h:0` 0P! 0 0 00 0dB`00C\ 0  "!,0 00 2C&  0 "!0!0 Rn R 000 0 0 " "00C0"0 0"ZS " 0PT H1"(`h P :0`0 @ @0 0 p`0`0C\ 0  "!0 00 0C&  0 "!0 0 R @ 0p " "000ܹcc8ccc0 -LM2P 0` V022p  䂟#&:h\` 0 0! 00 0Bp00C\ 0  "!h0 00 T2C& L 0 "!0("0 Rr R 000 0 0V " "00C0"0 0" 2A AR 010  0 " "00C02 0: R H12 000 202  B 2S02 00C 02<2p0`0000P0P20$ 0R00 D i\ R d0V( 2 0 2ܹcc8ccc0cXc`chc -`LMVp At00TPPU `V2  "  0S 0$"5$2 -XaXqL0$ R0D0 2@ TPR1D@h R0000 0   B P 2<20 0S0@@@ 0$ 0 0$ \0 R 00S0@@@P 0 00 c8c|lb p-L M Kr0 "Q `KP @/1l1 0^:0A^P :?0s8 c! 01pV0b0 0ꀲcc p-L MP`@ 5@@@xt0l l0@@VX0X ET`@@1@0STpct0c(c4cLaPa -L$Mp0 0 4 00 P4,P Ǡ,K 0 PPO\`0 젟 @L T 0  @@!\x0  , X,@ 0P4D 04 4 00P,jVJ0,0cqLaPa b8cq(c4c -D!L M0PC (@0`p P000 `e!0 P0000 ,0K@@ 0S 0  | A,P`喱{@&#,0@@ #,@ La0c"4ccPa -L U00R0S 0̠ W0U0V00S 2T 0  TV U0P0UA  V  0!6 aP0 U00R0S  0 0  0 0 -`0@LTpPP P W* 2$"  2 021F0@T0 $C02  !202!2  0 p   0!6 000 X0 0,A0 0 0z!|c -LM800CV!   bp ` 4Z00@#:0#T7H@T 0Z0!02 02 @TyX 00 \P= Р2@ Z00S 盭!2022@02H@T,yb$P, -1qL!MQL 0Q 0@0`1 H  0P@00C& R 00#!000 0C& x 0 "!0T 0 RioME40 acܹc b8cqccc0pp 0@-d@0/C2b,S03S0#S<0<<0bQ/BR@ H@0cVUUU -|1LMt!pQ000\!CXA0\L0 0  "!00 00 1C&  0 "!0 0 R.PPp `@ 0Gp?1 0V1`0  @ ?CSD00D SD0\4 ,0PR0S ۿcܹcc b8cc0cqVUUUc -L MDrDDDD <00\0@y P\"001 @00C\ 0!!  0!C6000 "!|1  QLU, 8 0 08 @0B6C Wp  402"  Q  ڪ  Rg 2d0 `0K$ T  Tު۪˪202X08! W8!  2  0a h0K @0 0@0!6 k K ; P 202 @@ T  K 0 !6D 0 P  ' 0!6 0P P@ @@ 2(10(1q,10,1#c -8RL101;@C@0T1A d0SsqP1d0Sf@D 0 ^pc@dlh0PN 1@T ZW ڸ X@ ZW"0S00 0C00"`Zھ" 0 P  W<1pG0<1 0!6 P 2J02 J `2"02p T00R00 S n8,P101zchcXc`c -LM Y3P0 > 0 @TQQ:34 (0  0aS < 8 00`VԢ'PQ B/ 1b10 ^:0A^P:?Pu &Q` TB?!l!0 ^:0A^` 01:?0S p,1c(f1P12" Q4 0*R0#  R <P, P\ , 4pABP2#40,!0Q!0000 00C0" $00C$0" rppp" 000 PP,00S ,0 8 l0 < RP@0RD 0S@w48,KP0lP,0 ecc8cc -LMp@T' P`Q0000 0002000@0$ 0R@0$0 D @Ti8cc -@0LM@T 0( T  @@q p-DB MLP8  $ `  0`\TP`PXL `0`0<Ta 0`|t`` 0`<( a`($a! 1`<0!,148!t0dx |0hxph0L!`pcqq$r`rrrs4stssss8txtttu,uduu8cu 0-L@M 0@d@@y P0 S@0̿P!\0PPPJ-@Tx 0@ d Pb5X Tx0 PZ50hC8=cXauc "bȇc`uvTa8c vv cv - L@T`P 0U- @T 0PQ @00 0S 0  00 00 @0D4P H$!Q0`Dd`d00d00\S 0  00@T 0S,q,1, 0 b1B&! 02 S31b1 R000Ġ00C\ 0  "!0 00 |0C& t 0 "!0P 0 R g \Xacܹc<)bc@)b(;bcc0@-0\ P p@@4S DP \Q DQH4H40H4H4DSDd00Cd0Xac -X0LM\  0R \ @ TT000@Xa p-d0ML` @P0 K@ @4-P0,d(4pK0C+AIP@D hT1` zP@_0SGBKAG>KA0C+IP; 1` Y( PU! WpG 4 O#J6; 0FP@An2$FP`@*DTU WpG Y|@<0@d |4  bc@V`Pv\v bwpvXac -L|M@0XpP 0 0P@80S S @0X 0 0%$ d2!b10S pP 0OP$K8 4#RZ 0`E` 0 VP @QCN@ 0 !k=0P C@\0PP@s* 0R50X @00@0R 0X!000dh00h04!T0,0 $4>0CFT0 0+P`d<<;0 *P 0K 0P@qp KT$;, PP@cT04 H0L$4 R00P4q b0_vc({bvvvv$wTc p-LM0@( +($00PឿP(0; (ͻP` 0 00p@80S$ 70@ P0  Gt$h00bh0@?P eL0(,$0+0*\p3@ ~: bcTa8w -L M @ 6@( -L M@ 0@( -LMT0O$K4#&:@YPI ($@@b0O&8#J6$Qkt7 QoA!P000@NT`P0P0C\ 0  "!h0 00 T1C& L 0 "!0(!0 Ri| @0 040@+00 P 000岪P0P0C\ 0  "!t0 00 `0C& X 0 "!04 0 R iʶ9ܹcccc0Xw -L6LH$M@08 0(Ɵ< 0$P(2 @ @0@0C\ 0  "!0 00 5C&  0 "!%00 RW@ 00  <0O8僄< RH @ H D 壛 80L$@D ?4 \K4K 00K, KP"00s, 8  LD ?J4`Pp40D, 0 ` Pe1T\$p0p0CH0UP\@ 0!! 0$C6000 "!3  Q<0^$ P0l$ R(: 0S$:06>0. U$ & @0 b$Kp @@P$0 0c#& $ a86  e$0 0e#&B xA- p0Q:>a2 &#l"b0QPop*H00p "F!V: U p -L0HK 0 [0P@/ U8 W00W00SbP R00Q0#02SXT:0 0C0 S U X0 a@ v0HK 0 - <VPP TX y b p-LM0 PU@ p0 S@`@0P0@0 @  ' b -L M0 p` 0S 0S0000P 0-LMP1@0T0 U( T0S% (@T@T 01 P0S @0@T0h0  (Q,0,0, 0<0000S @0 0@0000S0@c\ada0S@-*@,  0 000@0y RQ-L 0P0000 P 00S000. z RQ-L P P 00S00000Si.4z -L@M\TK K < 4 <#:0K [0*":("000I.\z 0-PLMU^ KK @<4 Ġ<̌,ʠ#:0KK@ P 0[S*0":(0"$000.z -LMT2@P H2R@p 3S,0S00S}40Sz80Sw 0  QV 0`Sh0Sg 0  0P\ 0R,0  0S0sJ 0SI R 0S0S0S P5 02,\ ,48 <#R: AP, 00|OP @0  0,\,, P , #P010く/Ԯc bc -LM0@,0 @0  0  000 h01!p 1!pZW.PW&UPE!00C0PP*p 48<#hK\ ,,00@ OP c\P1郚A`PX UPE000P:Pp 48<#hcK\ d,,00@NPZAP p dh\`c -L0M∢ 0 ( L H SP`0S/50S 0S 0S0s ,0S00S40s{ DKD`K<@KH0K Pk H0, ,pLKP L0S10L0 (0 S h(H0S<0H0 HQ,0sS$[ 00S40S80S0 0@@XNP0,0S 00S 40S80SQ  l0` x0cl RO0<4< 4l :0 l 31 bz_ -L4Mß Ƞ, 0(,Y`P\0 "P 0S PŸ,0 S , R 0S0S0S R P0s ^ HK ID0YRX T0 Ÿ@KY2\\ 1@ 0TL0 h0p W@X YR,0S00S 40S80SH0S 40G 0T00\00S @0S l0:0\/  =P@0S X 3S@0S<0S80S40S ,@K =PZ 3 SP0\ 0RP0 L,@K =PT =P(HKs bz| _ p-LM`P@ PI=00P3,@0 |p p-LM`P@ P/=00P3@0 bp -LPM✡0``PKpDKA(0 d` = =4K40[S/ Kd@KxK 1P 0 1\@0[d 0@0K@["tp0  K@ KT0 P dP 0S \00\01g~K KdPpQ|)L5T <5T5` (K``C; P K0[ pS (K@K K 1 0 1\KdPp 0P WY 4e\00CS\0H4T? !<4T 44T8 r 10aR001#0p 10bP001#000|3T 3TU @:1.I?jUy @:1 q8#0000q#0000L|g!2R/W2TO 2TX1X2T p2Tx2T d2TW X p L2  R): p (2  R*0S  00SP 5#$0$  R 5R00%"48<#P g|1T @1D1^L1T\1T* 1VL1T T:@10SPW  0n 1T3(e -NaWu 0Q0 T 0Q0Q*00Q 0 bliHLi0UiViiileiHgildiHfiHii"i !i i ixFixi %i i ({4{Ri Ii Qi Si Ti p%bi Gi Mi >i`{Ni0WiHPi Oi Ji(Ki -l9LAMpWP0, ` 1  5 -0S S/cH0SV< Q5 HP`PP,蜠K E 0[S  -0S h@ 0 SRx8 RV5 H0S |0SH|0[S` q (0000q'00 00 0 @P  Ad00d 7@ 0 0Y0  ǟ,0 S x,  P0005S Y  P d0 ZKK95$#Ġ0Č6K7K4xKl p0 lK0P .KKPKt0 P 0S0 0F0$ dK#9\K0HKc0KdPK9PƟ@K.DDHK CKHPKGKs%P@  ?P 80S0C80ŵ@T 80S0C80Ŕ0 .K00 PA 00S 00$x5 H0K P] 5| PşHK 9%P@7  >P 80S0C80A@T( 80S0C80 .K ~P 0S0 00$10Nx4 R*4 (0  h'%GOK@8HK dK  ,ğ(P0Q Q j'P  % .KAP 0S0 00$103 R   (0&m%g@K@W8Xß HK( dK0 0'P  R T%F2 R e(0 Y hK g8P 000 ` F)P0 82 R 0<L |&Pl 1 R0 1 0) i&" b&NVO  P`7| 700( 0 )0 X1(  5 0`00|00 R` 0S  0S`00 0`N U 0 R &0 R 0[S0[0S[Q5#$0$)K%"48<#Q ,PS b_p%b{܏GbFb{{0||Ԯc|| p-LM@ PY0 `0S R Q000G0S ph |(P0`00 0s(0 `%H} p-1QLM` @  R0000 0 T00 0S S 0S SS008'0SD0@ R9 \00C\0 0@ 0 b 0S0C 0( @`00C\ 0  "!0 00 0C&  0 "!0d 0 Rpph$8 <% cܹcԮc}cc0} 0- LQP 0 @R T0hp 4 -LMM$0YZ,0 0P X1  4Q x4Q -`4 ,0S X,$ 0S^0S[F/0SSV0SSRQO3XS O3X0P p@/`Kxh6  : K:U00  3  R0TK\0KShP 0@ X !xK :U0h0  d  1P` 0@QP@0pS0S 12XKOK60)v2Xq  SK }:0T1 `V OK0 S `VT\ h:T< PU p ` 0S0C 0 00 R 0PV PpP!0ST PU p ` 0S0C 0 00 0@0S00PVPpP!"a(~@-|0\ 0S \ Q @ 0 0R 0 0^@0 0a p-LMp`@PT 0S @T 6@,40 0P0 S00@@ pa -p0LM@T 0S @T P ] P R0600 ha -LKMğ0ğ,0 0P! 00P1 \` 0S\,6 Pp 0 0 PU 0S:PU6DDi0 0C\ 0  "! 0 00 3C&  0 "!0#0 R P1003 ,0S ,.麞0SU P 0 0 0R 0OOKp0p0~3 T! T\MK00 3 (K P!00jP0S+=B0 0C\ 0  "!0 00 t2C& l 0 "!0H"0 Rd R0600 0S0C 0) A0 0C\ 0  "!0 00 1C&  0 "!0h!0 Rh,N DS/KT1PA0 0C\ 0  "!0 00 0C&  0 "!0 0 RP700/0S\p W 2P 00 0S p bܹcccc0L~1i -LIM✁0a!$0 0p P 00CS 0/ hAp00C\ 0  "!40 00 1C&  0 "!0 0 R $0S $鑝.= R000 P 0S0C 0 MOKW2KK00X0 K LQ/K 6 bܹcccc0\~2i -pL@P 6 `V70 0 #@T6@  -LM@P6Y P RP0S0S 00S0 0- @LTP 0S@T00S 2P@-`p000 @0:P^0) S^0S \PP\00A000P0#" 00  0#" 00  P0S\_la_ -LM0@S S  1PP P 0P P P0P P錏 -LM@P P P 0-P0L@T P0 {1P0@T00Ԯc-P* 003P: 00 ? >-RALQBp`L~ E1PUe 0 S\D@ @\P0 S  b8~~ -L M`0 X, 0 2PU8 O@KT1 PU0 R) 0 P@ 0X0Ÿ,Ÿ 0 0>> Y 0 0>>P@ 0 0 0>P@ 01 @T p0S @T00 R YDJ P?J8 $1 R 0 0 \ P00Q00Si"QPW,p 0@ 000, PʿP, p0bSʳX0 0 R PZ 0b4cc_~ -LMw, @pT`P 0S$ @TW  @T 0 R @TU0 0 R`0 h0 RP6,0SW y  Pp0_ -LM@ @0T0  0 R @T0K Q%X0SA  AR 0 RQ R\0500S\ \S:00S S* S00S S:00S S* Pb_ 0- LP   @H/ A/ :/<0 -LM@ =   h -LpMpxPK0@X 0 /x0 p`K A u30 00   00#0 Q   bFbGb p-LM P\ 0S \pQ  R X00G\`@` \^ %P QP ;PTTP .P < .P T# T 00#0  p  .P00 0  00  0 00   2#PT0S .000   P GPP PT@#__ -LM@pPrPT T kPD P1@T T `P, @T'Pa0S( 0S 0 @ `( PpP@ P`p(,0 h`0S h(0( @`0S(0( < `0S(   b_,d -LMtP0夀K@(x,0 -  -5%#000K$2 8K4 KK 0 n qT`K@@0  \0K[ K@ 0@ 4@  PI@%P 5X0S0 000AK`-Q G@K@KKKK 1 !0 1\ڸ0[00K [ K  WP ,0 S , WP/P t0 R0 T KP ,0 R  b@_X -L|MPK0`x@(p$0 G- ,LKhKK8@0 @P 0KKT0KSKp0KoK,P (P 8@ =P $0S D$80 0\0 b Ā_܀ -LM⸁QR Q$ p`]\ 0 l R .R Q 0ll RL .RJ Q?QDKPK [ v, [000[S  A0BS 000S |@KX,ᮓK 㼓 [PKⷓ,00l0 0 %"4 4  0 1$0 S $4l b0 p-LM(aX 0R@0 P 0BS \0 S*0 R(  0S  p,X0S 58J0 R (  x0 R PPSH,K[PP b_<t_ -L0MԢ0p(0 < PU 0` RP U PU `0S6 VPDPKXB<, pp 048<@x 0  @+( +0@0D@0 0$L@ 00L@0 @  0L40`(0QD0 0@ D0 0S"@ R@T 0 00SZ @@$ PP9 $& 048<00 <$ 0\0  0@4<2DL   800,0#2P,6  0R0P00S@T  0S@T Q  0cPT  0cPP000D ` VD @ 0SX0@T 0"R@ 8 }T8P w0S P0S`SZ @0`C0(0C8#88#$(," @"(  *( *8 0Vw* *80 0 B0 8SBD 00b'000C080! S P 0P U8 X'H0@\ 1 0@80Ɵ4 6` 000 00C0\0 0  "!|0 00 h6C& ` 0 "!06<  Q 8 UPP R8sR%ş0D 0b0l%00C0H R 1 0@ş@08 XO4ş45 0,00 00C0\0 0  "!0 00 4C&  0 "!4  Q飐d$ X4Tğ 0T00 00C,0\0 0  "! 0 00 3C&  0 "!3  Qm#3  0tß0x0 0@0CT0\0 0!! 8 0$#C6000 "!2  LR R:07`P@ @q)PE( l)0 0@8 8 s@ D 0SL0@ 8e(%0S( p%PmWmO!00C0\0 0  "!|0 00 h1C& ` 0 "!00#08 HQW 1 0@M80HP1D$0  0( $P E,0K8 VP<080 x , 0R0% q*LaaLcܹccacc0_Hcc_DccTcK -PLUp `2X !@@(( (0 >Z P$4D 00b0 00C0MHcDc0 0   00 80<808 8<<80808 < -`sLM T0, Hß00 0 0R0 #00C\ 0  "!0 00 2C&  0 "!Ÿ"00 Rb8PU U 00C08P<0 Ry U\\ 0RSKpA @a0@RSD0SA La0LRS00L S:WA @a0@RS `A@0@ \-P+^pG`PP@W Y @*0.S@00U* T:4 00 S*40S0C40  40 S400C40 00c 0XA040 0 v0 , fo 1@ 0 00$@0@0C\ 0  "!0 00 0C&  0 "!0 0 R$ R 1 0 +10 ,(<81݂ۂcܹctvbXtbcc0Dwb -QLMP`pd V00UPT0 SRJ00SSFPES`FLSH0SBj0S>0S:0 S6?Q3 ?R0Q0E\) R0FP$ Q$ @R" Q 00S00S P0pi0\0jS\ 0jSg qP -L Mp, 0p  4p 0SAR0 > 0`V @ T 0 R @T40S` pV,0 `Y0P mP P  0   P  000P P040 b -LPRM40 020 pP 0$< 0 W8 `x U @T 0 R @TWPU0X0`P`80#2   X0#00 PK EP<  0 <  4 R- R0' 0R0"00c,$,!$#,,  ,K  00S 48 A 4 8 100S00,0 08 04<#$ 0P<0 <  <0 bp%b -|#L4M0Pp,0 Pp 0R0% :Z- HK10 H0KG K0c HKT0 f@T: h0 A@TW2 h 20S'B@HKLP0 ?]P?PP |2 ,0S t,?@LG\@0S  PK 0R ?2P@ r0:S,0S00S40S80S , P0S 0S$0S(0S T PQ 0"0 # W (!08@PX  h 00S!X{B@P0LHKX \P X8?PP0P0 pi0?@L[@0S  PK X0 L0K GPP7 L 0R0% 0* bpc? Dcʚ;K -$(LM0'Q,0   (\ 00S:p:00(L00 (( 0@℠K 0  K0P` K`KPK Kd 0K@KK`KPK  R 0 6@T 0  >P0 @T0[Sp RE  c` 0: 0000@S1\6   0:( @@] 401K<1 0P Q 1 0@Q 1 0C0@\ 񟗗l0H`x 0S 1 0@\ 3 ,0S ,0S1  0@0S10S10S10S10S10S10S1 0S1B0S10S10S10S10S 1t@K KK0  tP 80S0C80 R01 R;=|K0 0[0S1@  TȠ }0@P+^TPK(@L0( ?M@ 00@S*@PL ( @0 R 4@40(0@ bԮc_X_hȃ& -LM@Ph`epb @0 xa -&LAM0p,0 `@0PK Z - L6 R @6 R 0R0%P s:Ui  KrK n0[SU 0[SI 0[S 5 Rş@0 <5 ,0S ,xK| F0[0S0S @5 R K0 03H@K0@K KG0KHK% P` 0P 0S 4 R80S0C80űK KKU @K P80S0C80ž0[`S 0[@S KK P00  3 R K KK)NK(H( {  Pz!R0 ! 僑Q Y0 00 S T3 R` KyK@ KKY0PI 0PO !@! 0K@/( !R3삟! 20SPAdPK@K%`K!0KxK c0KdK0K0KKK~\KK zKK vFK !0@_P@KKK0 0KK`39 f1 R K KK J0[0S@@RT1 R K KKd= 1 R K@ KKw 0 &0 R K KKi0[0S5#$0$.K0[0S5#$0$-K0P@ E?K DP p P  0R0%P {*L b___,c(h@_ _`ȅLlcK - (L0R@+!0 0 h 000 <PU90P0 0Sl P 0Sa 0SW 0SM !@( B("("48<##80@@ 0:4( y 40 0@@ P Y 1 0@Y 1`P 0@ 0@1P@ 1 ,0S ,V00S000 00S0 0 000S000P  00S0 0 0a}< kbAw 40w00S8 !48<#,#80 4-00S' 00S !48<#,#8 0 4 00S00S 04 d1P@ 00S 00S 04 00S 51(p47P4 c !0@Wp 1  0@070Sl> @ 0T  # 0@)05S1#=#=\4c̢cܢcܮcccc_c__4cc p3T0000aa 0V13T T +Th0@1)0 RH0PH 1,0 S ,<Th0  )0RH P11P@ <T (^P@  00Q  )0RH0SH 1h DK)0D qRH PhhH t@PK ` @ [R R Y 0S )00 SRHPhhH T?0[0S03K?0[0S )0;RH PhhH : b<0P+r)rܹcctvbXtbcc0Dwb(Q( R0,S  3S00! 00!R0 -L8MqP@ `PY 1 \ 3RC @,R/ )R R 0 S  R0\:L0K 2VL0[0K0[ 0QR+R(@\:H0K( 2VB0[ 0@\:T0K 2%[h00SV T0[<R0\:L0K 2VL0[0K0[ 0Q bLX p-SLPMPK0`@0%0PP@ ppp p-L MQPP0S S +S 0PPp-p4 0 ph 0 php$_@p -LM1p 0S 0 S- 0 S*0 S'0 S$X8h@0  Po/00#@ 0( Z0S 0o0C0 MRM.0l0T'Z0 , P 40 80S0C80Ō'00P }6\@000 S   0P&`C@<?TR `h  0 @<0S 1 8  0 @ & Ɵ 0 0S00S 0  /5 R %P 40 80S0C80ڔ%00u00@ ( <0( H<!0 R \0R:1  R \0R*P&\ 1 0@0 R <!0 R \0R:1  R \0R*00 \0400,0 0\Z ,4 R 0@55 R R  R R < ,0` Pi <0S 1 X0@X3P@ 00S\ A\ I::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::Y 000  0 0@<0S 1 H 0@Y  0@0 R00Sl000h00Sb 00SZ0 0 0V 00SP P<B 00 \0PMp, `V+ @ jP,0~ P 80S0C80ڈ 00x , 00,0   hP @4 \_M@tc__p%bcܮcĢc__lcc -LM 0 PpK, 0 U pᬐ `  Q~QrQf<QZl0@S @h0S 0@d0S 0@`0(S 0@0fT0S90`0(@CT00':X pK= Pppp0pK`P ` R XC 00`  `0 <00l0S X4 0 0 l  l00lh0S X# 0< 0 h  h00hdP X 0+ 0 d0d  dP0S  0S0S0S 0S p @00 S U  0S  0Q0  40 0Sc 80S0C80[0 0Q  0 0 0Sx Qd X0<0 X0 400  1Q<1 1 P0@UE 0S<  R9 555S2 *0@\ 1 X 0@Az,L KQ 0LK S h,0 S \ ,ZLP 80S0C80LPU 0s000x@KStK\0K @Pt \̠t 5   R R  R R 00 R R R R l Rp00 x0Stt ^\ \U: 04 0(S1 h0@t<4\<("4 0n0C0t S 0 )d0 S  00 h0S   l0S,0 0  ,00 0 Rǟ@ 000Pp 7"$ " 0  1 dǟp@00C\ 0  "!<0 00 (7C&  0 "!6  QW 1:)01 6p (@PP 9 @0K  G0P0   0n8#8#00!$ S  n  04<#$ 0  @ 0D8#8#$(,""(  0",Pc 0 S  0S00000 ,,<,0 0D0p0@\ 1 p 0@ ^ 80S 1 `0@p00 *W Y0 kpZYaP4P@ Y*(@07 4P@ >l9(Q= 1 (R1 05.1@01 K  |0K! P1 @01 v00So000k00Se 00S]0 0 0Y 00SS00SI"0410 RA>00S8 00S/d" 0410  00S  b QA@0 1<^<11    000S0 U 0S Q1  0S U 0s00\s  Q 1 P0@ R 1 0@5S 0@\ 1 X 0@3k P 0S!P0S^ 5Z bcĢcܹcctvbXtbcc0@wbcccP_bܢc0SP@ T EP@Q 0S  EQ X0<0 X0  Y PG00Sk R 5 000 a `P30@0 X 0@  P0 LKLK  u-\K  0S@  " B \K B@D:l>)h<)d:)`8)8#8#$(,""(  pK Pppp `K ! P  dK !P  hK !P  lK !Px z - RLM, LbL@ 0@00PP $011 01!  q@00C\ 0  "!0 00 1C&  0 "!0!0 RSUM X Z    o,0P@ 0,00$@0@0C\ 0  "!0 00 0C&  0 "!0 0 R$ R 1 0 +10 ,(c*a0  [ʚ;@ -L`P@\ )R1S*P 0\0T00S #T T PP0p 0 :RpW 0 :Rpp" 0 0pT \ # -@0`TLpP) P$`U` 0S{ U#X P P`@#{# @{@ b -L4MT0pP,0 D5\P W`@8 0FSALdHeeegT R 0\0 0S$0S \,0 S ,0S@T5㮠@PKsPP` d4 R X4 P 5`S10`0-0T RTKRT 0 Sr3T0[ 0 T RXK?X0SX0[0ǕT 0SP0S0S0S Qd 0SQS0SI 0HKL0 0 H0KG K@KLKL0S <`V 5S0S$ @T 0\  @T\ KNP@[ 0S0 000@0QPT00J00S5#$0$ 00S1`1 Rj1 Pe `P 0(T% 0S"P0S0S0S Q; 0SP 81 RA,1 P< 0`S @T1 V 0S @T' SPT  R000 00S1#$0$ ᲩP  5㴞Pp7 $0P 0 0P b b_ HPb p-LMP`@ ! U  U U -p0 0V0 0pL0 0 0V00V 0 Q50_ -PLM@  R5hFQ0000S  -L$ML0QPp,0  @00 Rp 0S ` Rv Rs0)S     0000cS 0,0 S ,00CSYk m8mhmmm RO 0S 0S> ,2 Q6*Q 2 Q/ 0S0S0S 0S HPK,@0 H0KG K@K P Q 0%R 00S  100S1#$0$ *R  c00 SY R 0 0R 0" 0%* R  0 10R f R0S 00j < R 0 10R0S0S b0HP 0-0LP@ A"P4 1 0'S($P)  P P P P  00h00S00000S 00S0 0 0 00S0ʚ; -LM 0@(S@a1p    PP l012 02$0  1 4p00C\ 0  "!0 00 0C&  0 "!0 0 R"U 1:)0100 0( B(0 0( @ @t 7(bܹcctvbXtbcc0P0 S00!0S00!0<S00!P00! -LM`P 0R@ K:T 0S20 0q Q0%@ :T   MP000 @0 ,0K -)P@` , 0R0%@ *#0S00q 0j0 @P0 0(0K )P@` ( 0R0%@ * CSd0+PU@00C\ 0  "!0 00 0C&  0 "!0x 0 RiT\0  ]D0L ?0#3 0cܹccbcc0X_Mb -L M0`S, P@ pF PC V 40 40T 40 } PqTZ!1  ,  0  0⺶ 0 @@pY .5G 1!S:R+ 8C8Sڴs 01P0 S @T 00!1 1 Ba  0@00@!@10 !01 !1 0 ! P@ H0pPAp1Pp\0S @40b&@0 y\@PZ q P@` 80< 0CR80EȋMb__X0GS S S#S 5SS ʇSS S p-LM@!`\ XP P sp3000  00  00p#P00pQ 0 0S XTpPUϵ( ( p, -SLMpP@` R00Q00S3R`U-  6P$ W W *`X  0X0P00S` U `   -1L M0P40 1, 1`000 101`PpU0 @W(0 S(:PV(`(@U(W ,0X 0 4 0A 00C\ 0  "!0 00 0C&  0 "!0 0 R0R0 0D D  00!!00 %!ܹccccc0 -3LM0P@0 34 2, 080 20 028 pW<  ,0S < ZMT@PT @08T#X1e< 1< < pXW,0S< 00  < 40R00 8 @ 2B 00C\ 0  "!0 00 1C&  0 "!0!0 R8Q<X @ ፽P?L00X 80$0< ( 0538 r0 H10aR001#,0\040P !0 T@PT 1e 0( S`"X@TS|0 0  O08#X2, rܹccT_cc0\ -LM\0@,0 `p XK[ hKW 0R60帐 0 弐 Đ 0% P@ i:T_ `xK B0S@ u0S.0Sş@0 f,0 S |,OXKݳh 0S hKԳH (50S xKʳ$  óP @(0X0ST0SP0SL0S&[4R t0S d0S`0S\0[Sx0[S S pG@K uP R010 0S  0S 0S 0Y0R00Sh0[ xKSppPP`z K0P@BY Y0 00 S 8s0S[ xKN Y0@4PXK QPL T;X0ST0SP0SL0S 0XK@ @002Q0@0 XKx Kh-hŸXK%P"Ġ0 0Č2 XKx KKX0ST0SP0SL0S)XK 0H@KxK@K0 H0KGKP@ 40  00 R TVe 㗲P` 0  p0S 0 R w0[0S5#$0$'Kp0S0P@ 0K PĀ@  0R0%@ *H b__ c،@lcK -LM`K  0 , < 0S VY0@  0 0 @Pp  !1 01$0  1 l@00C\ 0  "!80 00 $6C&  0 "!0%0 RoW 0 0S"W V 0S @00 0     0@00 :0` dK0HK@  0V H0Kc KG Kd0K\PK  $ R0S R 0(S@@K   0KK 蝹P @@K (` x0(0     0  Rr Rh ^H 0@#$(,""( :( @@ K0R0 $  K@dZ 1`P 0@ 0@\@0 \ 80S0C802 ,0S ,ϵ E P Y@ 0 @@ 0P 0!1 0 Y @ @  00S0 0 0 00SP2 R P 80S0C80 0 ^TG  PP@@@@KJ5#$0 $<5K4P %KX` T0 P@K\PK1 <1 KK吠 1@ 0D00_$@0@0C\ 0  "!0 00 0C&  0 "!0 0 R$ R 1 0 +10 ,(KLK0T<0K0 43K[T 8 4  <4(<"4%$Q0S !E60$?0D@$#3 000  04 8 <4<("4!<0PAPP @ P,d0Si A TQ 0S& @Q  0 A Y0 00S 3 RF KY0 D8<0K@ @90 $(,<4<!4"L T:0S\  \ SP1:PT0@S 2 R ¨ 0P2 R ᵨ 0 R 0S  R0S\ 0SX SR 0 SB K`e0 K0KK0h [0  /h K0h [2 00h0K1\K 0$(,<48 00 Hꀲcc -0LMPp`:0P:X@PH +P PE 0R08@8iPi`Ac -SLM@2~s H00H0( (0 -L0\ hPa+_ -LP/,,,,,,,,,,,,,,- -  $(,04@DH< 0- <LM00CP@ SN-.....-----1? ?0 0 01 K"0 0 ,1  ,x; ,$0 Sh.X.t..0 L  K20C0 10 徵UU33P -LM\@  t\ u\\Q10` R``*J@`z, 0 V. @   | l,0q6S P Q q0` QJz Q sY QPF @04  @TZ00e/C1"/ 0bl SxkrPd ,0TL1D,`ꌯcl:db|HȜ؜ -QLM@|xhݶܶhٶ`նPж$@˶H4,ŶD h $HT|̝ p-LM0~n0`pfGPP$ 0f0V@0*` Vh( K,0K JTZ:D#" P, 0 00 H tcc -L -L$00-@P 6 0 -0LGPz -LM`pEPQ 0 0S @QP|%> p02SN H%%>!D @A0AS= R ;%4 0 , %00 #0BWS t9;;;;;;;;;;;;;;8;;;;;;;;;;;;;;;9;9;9;;;;;:;;;:94:D:;;;P:`:t:;;;;;;;:::::::;;; ;8;H;P;X;d;;;t;;;;;;;; 0ts0A0CS Q X@@0S $% , R|2xl2D PL4 8<40$ 1?3?3  0  0x0!pn x ell%10?30 @U0P%  0?200  024PP ȠԠd:Hܠt>xă-`phd $, 0-@PL> `Sl h0 $$ à 0 < 0 $00h@HT -pL`@Pu$ T 4 Z DU pP@TXD4(4P`dlph -L0 Z\@`%Z' !00St 0t  rW\PD  e/tdDLT -O8@LMpOSP!b$ $00S 0 hdX@@  ft@dD|hT -@$40$&S !PL$pdxl dVHꄡtdDTLײꌜ ) -LMpL`@PL 08P$1( <0D $00HL!000wwww -LMY  `Q00SpP @ZJ $0 0T@TZ S@* $0 0@T T: -LM\  Q@@Tp` PYJ@ ( 08@#8 XPUZ TP*@ (0@8#8 PX U: -LM\  Q@@Tp` PYJA , 0@ \PUZ TP*A ,0@ P\ U: -L@p`P! R ,0 $10 i|\ ?}0.0 R,0 >x p 00eᬷ ! R ,0 $10 >|\ }1_lbd%b 0-0 L@  ,0P   H0 RH 0h0,qc b_ p-LM0@S`P: S S00 S S R/ !R0 R R R =R 0 R R R =R=S Q `P0  R R R 0  R R R0Spp -@Lݼ0SP P娠娀p`0$Sx@ $0Sx0x @00 00 00 <0 40 ,0 8_hcxcXc`cctclccpcdc -L⟼L0D0 ^@x <h00 !D\c_c|c -PLM`@P Q pK 0EP 0S00S 0P S 0P0S 0- P dK⭸P8\00S 0L!X0T  P L  HD  @<  8$4 ( 0,, 0 (4$ 8 < D H\  d 1 100 1`08<$100 p-LM0 @P0 "!HN 0L`L @000ph y Hph bc -L,M \`p V\ H0C 0x H$&R   R  R0RႡ0僡0# XL P P KpH00CH0 p 020P0LP 2 HPK A @ i8!P \$6BS@-L!@0 H@) -1A `L0 SP0 0- p`00C& R 00#!000 0C& x 0 "!0T 0 R *dPcܹc=cدc -LM @dc -l LM@Q00 03 4h)>h  !_\ -`3LMX#P3P#LH3t| v0C0Sp6 pWߝ2" 2 ?#<C4!2P >P@ dPb|R 倒@ `P(0 ` @@FP`D|4"<2P@0,0 卿P2"@0ᅿp`hW * W0#03V UH ` 0```\`0S JJ 4ZU`Qp0W:Da,30pK,`KP 5PP<< !@@ K9PPP0<0`80@!Y0 1&Rl0xL! PL1>LP@0L!0*4 S 40L0C0lZdWȰc4`ذc #bc԰ccc bl<`tȢ_a___c,V`D| -LMQ300CS'\p]]<]p]x]0 z~0\ 0S- 0 uX00S000  0K-0 ~_c4bp@-P0@S` 0 t ?2c0TP00 R 1b!00`P p__<`_Qa -L@A,@` pUaPP 0  0 P0 0   $ ( 000$0(000b -L MP S$(`p@, (KH,K @4P,00$`p(0 -L MP$(` pQ-0V80, @ R0@\00T00S\0, $0 0( `0  (K,KU -L$M$(p 4 80 0 R8 P0 UQ0 `! 0@ 8T@!,K040K PU 00`V00S P P00 $0 0( 0 -L00$0(000 0-LMP@ @40H0S?Q'cb$c0LMnP`p4 a;P@G 40 R08 &8 P00U* V쀟 03    0Z UJjF:804 0S80 x1@X, K00KLP 0 0 00H  }tcc>0 >0 K:tM0@- 0@^0 0@T 0 P^0@ЍS0@P ! -LM8 \` 0p 0P0c <0  \V@ i 0@2Z, K00K M, 0Sv 00 R!(8.:(#8 #: 4  08080S 4\@>0. T:00R \ RC 0 0c4 :#:  cP!\4 4<  000aP0S Q @ 0 R@ ,040`VP@0V 00 ^\ <,0 0S0":$:&4 0  4 K ꀲc 0-LMP 0 .@K PP@ PlfP*40 0\ @4:Q0 : @0 \0 0 0@-P@P`p. ^  R00\:\*R:^ >00 0 bS0!>0>00>000 0S0l0l -L@㬀TPp`  (0@T -L@, TPp` ,@ T -L@㬀TPp` 0  @XT -L@, TPp`1 @\ T@-^@>0.  Q:00R^  -LM@`TSp R a :@TVPbUP!W W `e L 0D@WHctc -LM`0VPp R a :VP@bT@!W W `d L 0D@WHctc 0-`@L\0P 0  ,0R 0 0S0hܰccDȤ -LM`PV r @0S  2S @2S2S lphd0JS qqqq80K0@<  0 P cc b #bدcta  p-LM( \@SP`8 0   ( $400S8@< D Hx6hdH Tݤ L٤\dl(HԮ$0DXht -LM \@P`p  0 P`0L1 -LML ^0P0p @`H   \l 0 `p0 L1@  -l!LM000 0.!0 S@C$1HpxL17 X1: `N @0@ PP 0+P HmQ P   0m0.S4  0S00T?  @0 R  0H 0@c bدc p-LM@0P`XT" T 5K0V0P00S 0[0ppTK/0V0P00S 00pK0V0P00S 1[0pcį 88#4S S - LM(4P`0Sp @"0p#}P`(0S00V00\00S 4@Q0 0CS ~V00\00S(TA0SP~(4 SJ  @\. 0 PnD* 0 :#:cQ! p`*  @Q`1h#R& /P  p`0S000S pp`V  Q#  X*圲`00E cpccc p- 88LM#Đd0`PP 06 ?S RcP%&:FFp b<`-@-0  80@0@ h0 T@ 8 H0D000H0D0 0404440044ꀲc-88P0S P0S00 40C4H0 Q H0D00C0CH0D0440C0C44䀲c0@-8P @+ 0Q P00RP @0 0@0 P0 "  4400C4 0Q  H D0 0CD0H 0D H0 0CH0D  $4 0C4$$4 0C4$ꀲc -@ LM0|@  Ah دcc0@-x@PQ0000  00 0  0 Q 00  0P0a- 0S  R0000 0 0  0 B 0S 0S0 <00 0 00  0a -!LM!:Q@T!h' 001PQ 匝p$ KZP$0W 000p`0S &21p,宝lP@ aca -0L0b0@PT'0P$ p@0`$0  2 0R " 0 R 0R0 S |y&1?00CS0 0Lhk<0H0 @0Hꀲclcaac -LM@+ǰ 0Hc -L 㸰 -L 㯰( -LM8@PTp`  0S 0` @TH 0L\R S @Q Q Q \ 0h0hS 4S  0h @T\  ipL -LM8@TP, 裟` 0U Z 0`@TQP U00P00S V} \z @R U Z @T@c ``` *(": 1Q"( 001 0R  0*"%,`V pG W 0S/  10#R0 S d2D0Sp8bQ 42 R 0R  2H10a@ 0S0S a 1P U P@R `@TU VZ`(*(": 1"(Q 001 0R  ! 0 0p 0S  0Sp0Q 0 R 0R d0HP000S 00 0P `ꀲcclcXc -LM@ 80 Q@ j @ 00 8 40  `0 :8p#*  ! #8R 001 0R  :#58PQ ,  0`z  `"`0 0PPU^ 0@Sc  H0D 0C H0D 4 R 0` 80S U7 0S+  0S P U ,P,QH0S  0S@T00S  @!@ 0S P 0S  0S D 0S 0P 4$0C 4$U 0S  0 S  R H0@w0H 0S  PXccc -P@LM`pg 10S 0QPP 0SK SI \W- 0S! 10#VR0 Q S 1D0@S0H 0S 0PT 0S 0S|0< p 0S \0Lp `V  Tp@p bcc -LM8PU\ 1L D H 0S 0ppU> X@ TY l1TV  *(":1"(Q 001 R``40C4 :#%40C40 T00p, 0 R( 0R%  0PU@X8@ 0S 0Sh0X0,@0S 80@ 0H bclc ac -LMXԙ0 @$ 00 4( B0S 40$@$$aa -L,MpD P4 @# ,9",KQP i/ 1b10 ^:0A^P/:?0sh1c, 1! 8WL   8 8Q 804P : #5 @ QH D H@( >0S @# #7@Q g/ 1b10 ^:0A^@:?0s'c!001@Z? @0 L 40RP @0 U^$7Z P T  < 4S44SSD0 SH0H0S S 6!aV@0`0ó @0` lW  D@0`00@0< D `00Q00SH  0S H  H 10#R0 S 5D<  0%W 5 Y^D0S8000$ $D UF X5Wt `5 Rp 0R0l @SPKH 0S? H0 0S4Z+ 4S44SSD0 SH0H0S S 4!AT@0`0ó @0` hW  @0`00@0 v (400S 4 @CH3 YU  8$0 )2 Q 0 H0 t3@e 0Sb P3P\ 638 P< Q  2W 8<  倚0  H 0S? `=D U: L0S7 2H1L4 h2QPU^W `2 YH2 PT!  b< 4S44SSD0 SH0H0S S 1!aV@0`0ó @0` W:  @0`00@0< D `00Q00SH  0S H  H 10#R0 S 1D<奓 0@ 0S 0P 00KS0l00 04 `b)*(":1"(Q 001 0RX0l00HcccXccدclc a -L0H@0ꀲccXc -LM PP1*%:8#*!% f V `!R#8 001 0R :#uU@*0SZU@:0g0h0L0H U:8(0@000ꀲcc@-0$,@0S!*4*6 ,<1P 001P : #P 0S ( 8. :(#8 #:T -LM`0 P 00S@f00 T # 3V8 4P *&:8#*&! 0#8Z!R 001 0R  R `u : V#p*@Ti Ug 2$pQ R/ 1b10 ^:0A^p:?0s`"c!,01UNRP@4"HUp2 @0  @24pS44S@SD0 @SH0H0S S 1!AT@0`0ó @0` 1YH   @0`00@08Q(4  4 8 j V:0 Vl:80S 40S 40 0S0,  0S 0 0S  0S |00S \0   ',0KS0l,0 0m0H!ccc A-LQ    hN -LM@0@0@? -LM@00@@1 -LPM!`Q%F 0 010 P40 > :#5p W8 7 \ 3 >0 U#FT3 Q DϠ/ 1b10T:0ATϠv:?0s"c!,01" R 8\ 0V \ 0U\ 0 @00@0 U  8 X8H $4  0 2R 0 HZ1 R   0SW a0 +18@ 偗>0 x{@ Xr0,0KS0n,0 0 #F0Q Ϡ/ 1b10T:0ATϠ%:?0s c!001" Rr 8\o 0V \h0U\c @00@0  m00KS0n00 0ccܰcD_ b0l -,0L ^  08 bc -!*(":LM1pQ"( 001 R0*"5P#F(K` PϠ/1n10T:0@T`Ϡ:?0sT c!(01P  0Z0a00c - 0LQp@Lt1 T ?= ?0SN HH!00`00  "! AR00  00#!0S  S0@ 00 0C\ 0  "!0 00 t0C& l 0 "!0H 0 R mx0Q bܹccclccc0 0-0LS@P 0SP200T* 00S 0 R 0T 0 R 0S 0S  R00h00 0T   0 0 0P00cc baa -LM 0@S000L00c -PLM` 0S 0Sz0000CS0. V( 10S 0 R V 1 R 0S 0S  R00x00 0d   0 0 040s1$!VLq& 10S 0 R *I0  0 $R$4$4$4 [im@00#!0 hP0 0  "!0000~ꀲc baaدc #bV`acP-0 R0P  0S 0S  R00L00 08   0 000aca 0-h 40L\0 U>00HP@@H0唣@0Xcaac p- LM400 U>00P|@H0\\` 0 S`R0Vp@Xcaac|lb p-LM` 084P4@0@ @@@H0 PU^0PPp`hPH00D@pXcacaaa0 0  c,c -LqMXWll1 0, P Pa%*LDaDl@PT 0 $#:.1  H@T060pS:<,,0@0, 00C\ 0  "!0 00 p0C& h 0 "!0D 0 RI4cܹccc accc0 0-0 L"*("1"(P  \! 0 SP0:#%0;U>0,@H000دccc@- 0 0 0 21 0 0s#0@$ ! 0#:8#*!#800Q! 0 S@ 020000دc@-`Pp !:H$$X 00S | $:1P 001P:#50 000!S$010 0-0@P$L 00 0S0ڀ0 R pP ` `000@0  0@0$0)$ƧvHcc aa -3堓LMp00P 0, 0 p0S P U:YZ @:4s4C<,c00#S$ 0" "0"0"00a3C?6C#Z!"00#Rea!\"0T2@P"@L2  @@Z4Ÿ4 0,,PV0 "R@bŸP 0$T D@C 0@;0!@H0 @-0!@:< hPJT:kꞒo`P@) E1? P 0 01  @`P 1 000R ;P= u9W 0pĀ 凐児acc ca,caaapc԰c4caa aaa0a(aa_ aaȧaaLa -!:LM @0pSP ` ,P`@:$ #Ŵ0 \  H@ 0P DP V 0 0H@ cLc0P, 0 0 S Ss @ 8 < Z4 $ 00Z 3 #@46S``V 0088 00,)*^>>1!H006J00 Z4,): R H<$PP4 8#8ZS#0 @)`p@V ?>0U.!Q @ HT008J0)6<+0 0"+U>1t0H00 JX P0P 0 80 D0@ 0<0 404 0 80 (0$cIJS 0PP0!?#=?00c?S @Tjڢhw,@Y@ BP@CPmPFP$eꀲcL`ta  -LM(p`1S`>V#1(KPQ @/ 1b10 ^:0A^P%:?0s c!(01B@T H4$4D\8@T W 0 *4@TX0l00ac -!LM!:1P`U!, 001 pR(`J$JT 000`帀00 0+; 00А 5P0Hp@:#:S P@*:#:"*S:(21@PT0 P 00 P aaLccaXc - 1LM@@pPP, K?PU$: 8 #! R#8 001 R :U.#5  d0H*ל `  0@-AP4 8ccc -LM@p P 0SPTT0 R0 00b81Q00@RK@V`_<`_0 -LM娚B2< r R0S tRP "88 #$0L H2`巜P 0S@ th P0Up7*!A06T&*46!SAQ  x1 :P p`UJ1 16T:0U00 pW0#02S0ES坌囌 ꍌ劌 "88 #$h偌(0S} dꨶc@V`c__Lpcp\ccx@B̴ܴ 0-LMPK P@ 008@c -LM0@Xc -0LS S  -L@LL`P. pᓠL!.@ L1:40c4L1L@H@L!L ゠0V800`H`0 0 04DC -LM 0@  hT #b -:#:LMS`@PR pK Dp"  jVJZ뀲c -L M00' H ~p@g0>0L ^| PU@`H@ $@K,0  ;$ 00ZUzj\_c, p-LM`00l H0N@0d0>0^P 0?,0 L 0L0H p囉뀲c_4 -0L P 0-LMP@,ZheD80<0  @00S0 00 0hqjHD -LM@Q"QdQQ?qp4?q`/\0qT*H&X<"d(x hpx -YMLM⠒8 0pP<@ @%  ,0  0p"8% D (K0`d4 0X4 0S! ?K ?K! D 2% 0S7 0S-[nK`F`F0 P0S  1q ,0S ,Tm0 |廊0SQA0 L宊0 8娊[KHKH/ 0S30 P 0Sp"0R  0qr`/z0p2  0 r0S0Hh08c bfȵ$Hh -LP $ _뀶 p-0L Mx` P0 P K0S@ p@ T 0 @d1 \ta|a -0pL M00x` V0@ P  KP `0 04P`(?p 0 (@W0taxa aԶ -L Mx0@`SsP`X1s /0Ss? r`㝤Pp 0d1` 0x 0$0K`0 0P (0Kd0 0Pp $ 0$( pݣ( 㻣P $( 0pѣUP 8t`$ ( V  -LM0pP0` 0X0L Tp@`<PP0` 0 0  0p$ @0PDw KP0 d $K0S < HI><P!` 00$ `0  0 aaH p-L Ma`P@0P TP@V0S0 , ,1T ph0!ph꼉$ؕT -LMx0@sPp`  0 ,2 ,?x00P W ҈,4VP 4,$0K(K KWX1 S s 0&W0S,24 Q $^;? (0R r ` 塈W $[?R`X!d \ W028  0eVP4` EW( 0`kV0`\q0/020  P W `t`,HFܷ p-LMX`X@0PD K @劈 KP 0S jp bL @ -L.h5긷c pc -QLM@ 0$峘P  -0L塘P -2L"Ÿp,Mp4000&0P D004(00P4 (00@4 $H1X$H!@T@%XUXiȇ04c/0\0@4/0\!1 px!Ll1 p`!PP1 pH!T41 p0!X1 p!1\ paA`DPKD  04 <@ 8 @` 0 , gn0@40 D @@ @< 8 4@ Xn|0| Q Wd|$clc_e8LTdp|cpc D_t_x\cD p-LM004PO/,x`@ 0 R!040O/\004 ,d@ H0 DR 040 \Vp _ȸ0  0V`V` 0- PL @bP0_ 0- PL@W0 P0 0_0 - . ~LMpNW`@* 5A0p0dzPP :#:0T0 *` 40J`TZ:g tc -LĄ0 0>0>00lP  10t -L⫄0%($-!R!$S ^  -LM@0K KK0S(00550 4 0-LM@P K0K K0S(0055 0!4P0 -LM5 @R4$ R R @0BS 0BS X000 @4R R  h Q-@ L<0A ^  0  7  됹a p-L MN \@ `P0`PSp `pG-qԁA 090 1C&   Q 00#QY l  030Y P000 0& P0P0$0(@0,@04$00 00 ` 0 04 P(@,  0R  000 X0C&   R 00!QY4acc 0000ܹcc @-@00C& R 00#!l000 X0C& P 0 "!0, 0 R@=ܹccc0 0-0 @P00C& RL  0 0#!t000 `0C& X 0 "!04 0 R0cܹccc0 -LMpW!聟00@00#!a P00U00;00!00p 0!!0`00 0 0  "!}00#!000 0 0  "!g00#!060 0 0  "!Q00#!0X60 0 0  "!;00#!0aܹccc@-0  "!X@X0  0 "!, ,00Q@ZcDܹc0 -0L Md C\0@T 0Q @0 ZE0  "!ܹccc4a -PLM Up8` +90@!T  000(`,00p4PP00#! 00 @@X4 @0.p 0!!Ӄ 4aԹmb -LM4 \!0@  "! R0000 0 0!!4a -L "Mp"0W00 1C&  ,  '0@0p0`00 W|0  Q 0@!!@0  "!0   ! 00   0  "!PU ,, P(`V @0 PUV 0!!L0P000 @0C& 0 , 0 0C60pܹccc04ac -80LM@/040\lc -LM܀004/0\巘{'{W 0`0P40@/G$,| 00`pW@gp02.040\ @W ˂lc$c(c c -0L`動ppP*Ppp3:5Wl@ 004\0p0 40\0 040\0`lc 0-L0@L2P00Ϡ(0Bl@D 00lcC(c c$c -LM q0\ P S  0`d @< <0 00!A  8@B@@0Sp 0SX0 T @/HH0S0Q,%b(%blc8Mb\d -Q@LP <0Sa!p00/0004,X!0<0a8ϔ0,0S0 =9C =CS 0\) Pp 00C\ 0  "!0 00 0C&  0 "!0t 0 R k0S00 R@0 0 0 lcܹccL%b?Bacc0 -dL 00Ba 魋h__ -PLMP? 0S  1P@, ,00C,0 , RUPEؠ/004,Up` 0/04,W0`05/0`000P`p0 `0@V:(0`U04\__lc_ -LX  0 P0$0B(0P S 07,cx cd̺ p- LMQ0`00@0  "!\ R0000 0  000  "! 0  "!p,cc p-LM0@P`S       @ 6D0P!!00P ` p@@@~,c-0!! R R0000 0  0!! D7 0- L00P000 0C 0\@0 0  "!0 00 0C&  0 "!0d 0 R 00hB꾪ܹccccc0 -LP鐸 0-LM0P00 @4  PP<2 @ 0HD00L R0H0H0 0P 00 S P0| 0440\X@P P0 @P8 04*~,'~ĺc`$ _4b8HDDPt -LM (p("$RS0QUO p@TH \`V4 p414! `0 lp   0 Q0p0h 0Rp0(X@00C\ 0  "!$0 00 1C&  0 "!0  QF0p0pQY0p09^p0 lK0.\@^/, @Tp Wp00p0^N b_ܹcccc0Ļ -L Ml 2"`  $(0QS0@4p$ R RK S KS S d2d"#8C@4, R0,0   R@  R`    . 0\[/,0\Z/0\! 00 !400L P, XT H0 09900( P0 P 0.\,0[/\0Z/\00@00C\ 0  "!0 00 0C&  0 "!0 0 RD80 @tK S ʖ Sh Sf_0`Nܹcccc0 - 1LM p` lP!1\ @ldhpd hP00C\ 0  "!0 00 0C&  0 "!0d 0 R U@ HPh02@Tcܹccc0ԯ -LM0@4`pp, ^/,^.,PY/,@UO X p0  hQ,d0 PPh  Q 10 <  0 S, ' ܐ0 0C\ 0  "!0 00 0C&  0 "!0h 0 R s000 ,00 ܹcccc0 -LMl0hhp@P&0pP` 0 0 9z_ĺcȺc_4bл -,0L( &0ĺcȺc4b K R-L`p@0 6KR- R+ 0 #8 C< SP P  S@P  S`P P P BD0.@P\0[/\0Z/\00 ᑎ @K R ʖ R R0`N -,1,a4 p 1!@PL^/,.,0Y/P,@p00C\ 0  "!0 00 x0C& p 0 "!0L 0 R@U cܹcĺcȺccc0 -8184 ,1(!P` ALp^/, @T0.\@^/, @T@0 0C\ 0  "!0 00 l0C& d 0 "!0@ 0 Rm0cܹcĺcȺcP`cc00 -Ly -Ly0R R | 0\q 0 Q  -LdM,3x0 | t3| , X t0_40t#0 02  P;.XK  @0S S P@0'\00pztt.X2X0S0H1H!|z<2  |50|5(2  |5@0|5|5Y@C 2/@ H_50%0Pmzx@K d!t 0/x0Kl KuP |Zz100|0\0d0lL1h! 0-HP Y DZ1 ,0S ,,\|9z!0`/͊_0@@%0%zP0`@#Hh P 8`p@5͊P%00|dz bp ((<X_`<-~JHFD -1ap @ $LP P00$ ;004P$ $PxAp00C\ 0  "!D0 00 01C& ( 0 "!0!0 R5 0PUb p@0SP 0@! 0UP0U p@0SP 00@ 0UQ07dLxGpncܹccc0`h/0_`_` -LMD`!88#|!bPp| P100CsPQ/ò00ò0@Q/000000Q/0 00<0`1H lCd!6ctQ PP P gv0YphXp0 -LCM⠁ `1pcIK$ @0 h1PS ,----x,00 ;004 0 <0 A&0cx30x3e $0S $ZQ? @5Sx[?0Q  t <tT@0 |@a5S05 \wX0YX<w00 ,p(p$p b`hHT 0- @LP0p 00$P0P0C& R 00#!p000 \0C& T 0 "!00 0 R00hcܹccc0 -L M @ 6@,0' -L M@ 0@0' - LM!P!(`P@C 0pbP`)0S* |5` Q 8Q2 R  Z0 10  Z0 10 00vb``ob`|50/|5f 0`y_ - 0!4LM#P^`P@ 0pAbP` U0 80  U0 800 Q /b\`h_ p-PLM`eӆ<(0?00,8@4t 0s 0 0 xt S; N%0P < .0$X0 00$8r`p~WEV -LMPp@ `卆$((0"4400$L0t@0p1 \D 0Z@\h 0 t \K@\ ( i]vt 0S000'н - XX%tLM' `p $_ P@l"  |Ő0s 1Vm (1V 1V t 0_l _l 0l}1V ?Ke/ yP1V8 :D10S  0p?aPl |% |%0 l"HAPl t# 0S0000V |50|5'ap" %44000 0|~Al 00 "   0l2 0S00|5_mdedAsd rdAhdk~gd' - 88@#DLM$`^Pp 0*H0 P(TBĠ*0 ^tPPPP _ -LBCMB\`, p 8 8#T % ^P@ t# 0 SȀ(PP#pP`  0S ,0 S ,W0`QH!ء00 t3 WNQⴡ0 Q_ Pa0|%S0000t00@0000( S0!d`lC0PA P( h1S\99999t0 S 00t4! t4! s0(S 1 !pbS0!W㑓)`h@00,K0,0B[/tK/K<KKXtPLH~|_ b_ؽ__H,8L` -L`tPP@ P rP0pW U ,㎄( 6H&@00;00000Evvt#00鈾~ p-L$Mt#@0PSp8`K h|5 @0 U00K10K002K8 KT0t,0 rP <Wt2[2[  NtJt0uľ p-LMP@8`P+ 00 00000 0 0 S0$0@00 @ 00 40 ,0, ,00 400pp<CF 0- 0@ JLP 0h02T -L$Mp12l1,0,0 ` ^8p 6^~6 00@6 /P 8,  0$00$0'  oO 0(+@ş@s,tP0$0 o0@ ,@0S000 2080 080 00S 0% 0p4 p(S4 X0 ,q P0eQ0<0, 0b0`0C 0P4 Q0@04@ 00 E<$ "X@0 0@e 4 0   Y 0 5p%p@ 0D80HP0 (0$ q@3 Pu0* @4 _Ƞ,Ƞ0  D L$0 0$00R }$0   0w  "$0 0$0400@ 0P0 pp40 S 0!0(S Vڰ0S0K 0 9p)p@2 5P0.4@000 0S\0#1 0 W0 1 P ,{P 0 , 0(+@T @4 _Ƞ,Ƞ0  0 pp0 0 4p$p0 0p p,@B0000 J0P@80A X,q P@T0(0T4 00Ś  0 Vrsp`G'@lȿ -LMP12l1, p ^ `0@yR420 Pc 00 [ 0@@= 0T R P0$0@(0 T- 0 r0$0@T  0 0 0 000 bQڰ0 0$0c zT 0  (00 q00  LdX @ 0p@q0@0$0/ E  0 qo'l<\ p-LMPJ `@ R~0 00$ 0 ( p(phH p-LM`J@ PQ00a000  ph?(. -LM02ct$Y1 pP,` 0 S GHPJXJJKH`KIKTIjo0$00$0@ 0PCt00 k(0!L00 0@ 0S 000@  @ @0 000C000,   0S\0#10 0 00S  0  0" 0 00 0 @p(0  pp0$00 0L+Dp+ 0$0( dY 0  0@p@0$0 @*z@ 0PA00 (0! 0} 00   %0000@d@ 0ؿP@00 (0!T d@ 0ĿP@00 (0!] d@ 0 ᰿P\@00 (0!Y d'C ,DLT-08$0"R(00  0$0+ (  2( S0<0( 0@000$0 -LMđ0勯Kp _K,0 @  0S @ ?(K ?Kd1 @2 Xa0( K\0< 8R P(K0m ,0 S ,hR  709 S 0#" 'P0!" P0"" P3XX SS  ?K^  ?( K @" b NEFX' -L M<`Kp@ P0<0K0 60K@?4 K7@KSK00 5 KP3[= -LM 00 0 @R 0S .0 0 0S -LMp\W`pP @WĠeT 0@T8so4P ko_(_d4< 0-D0@LT4P 0P0H_P -L44000040 080nhH_H -2L M R 0S 40S 2 Q0"b>02J /+b212b2c2cJ!{~TŸTp 0002c2cZ P 0002c2cJP0 0 S1   002c2cZ  1 !02c 2c"bJ"bZ1Ϡ Bl02c2cJ:_ Ue2e2cd!J \1 P1Pa`n(@2`!J0!!Gp@0/K30K,K40K- K.@K0PK1K2K04K400C\ 0  "!0 00 0C&  0 "!0` 0 Ra_H_L%by-nmt_E.ųQcܹccc0 -d3LM\pp80S8c8#P(00000K8P' CP00C\ 0  "!0 00 2C&  0 "!0"0 R lBP00C\ 0  "!80 00 $2C&  0 "!0!0 Rp(0[,[1)[a-[1a`.0[+ [vL@ L1"b0"bS#JB!00*0[t!SMDJ1QpZF0 Q0818!0 Qp$02c2cP C0"b>CA 000X0@0Z <0TWp @h$ o0f5f#/@!bP Exf` lW`1CADLs  \@Rm2qH_L%bܹcccc0nmt__ųE.«*\ -L M8@4T 0 @@ba̺c -"LMp0@ 00 `RP0U"qPhFP?0S UDcPP/ |00C0`Bp00C\ 0  "!0 00 1C&  0 "!0!0 R|l1\a01p00C\ 0 !  0 !C6000  00#!0 0 R@p00C\ 0 !  0l C600\0  00#!0D 0 RPmcܹcc̺cc0 -LM @Pd!000$00S(hG̺c -L,MRP,`Kp@ 7|%40K,KK P@ P030[4 [2[81[<4U @ /0[0 [.[8-[<4 00t0 ! l0 N -LM2(KJP`0p {,0 @p(@K@ @0' -L M$PK@p`{0:$0K{  D{  @{  <{$  8{8k$P0 P ` PKs' -LM2(KJP`0p {40(K $`KPp@ @R0 -L M,`Kp{L0PH@X@0 ,K@+PK(KP P00u' -LMP0`Kpc{`{@0K UP#K0 /K.KP @,PK -L$M@4`Kp<{ 9{`0PT@!$Z4K-K [0 3K2K@ P,@K0 0 0bS00-0  4$ 00bS -L MYP pR`@0 0SX1 h 400Sd  0P@8 04SOX00 0>S  400S Y00 R  048 @00 R 08< 40@Y00 R  048 @00 R  0480@P  0@P@RP0 N -L M,`K@P]z0p0(0K([pZ,K0 +KP pP -L$MP @4KD@` p6z``$U-Kz4K 0 3KP `p,@K -L M0pK@` zz$P_0K*K[0$t$h .K)`K(pK@ P'@K -0L@ p50S hCEPu,0P" P 0`V U004P< (0;4P00@ @0$0 0ShV hP 0,0hT -LM0$ @(X , ,0PQ LPQ XC @a@!p000  P0!PB0 Pp00C\ 0  "!0 00 0C&  0 "!0 0 R X 00Sp |P  0,0 ogܹcc8cc0@ -Lp`PP Y@  }` 0$0  00 @0 000P 0ҕ20•U`9 _pp2 @ P000P0P0C\ 0  "!0 00 p0C& h 0 "!0D 0 R ܹcccc0 -LM,0@S$iPjiij0jPj`j|j00Cs0 0 00, 0S P;p  ,h0S l 0-LM0@0S S T@D P0`` PAP0@DS000Sa`lb - `L$0p04PSu0@0p0CS0Օ Q?kk lllll,mkll4mk00  Ap00C\ 0  "!|0 00 h1C& ` 0 "!0U >U vt>U :c ,0S ,?>U@ >U Q=UK 2=U) =U 0Sdh 0,8=U =U  0 0  0 0=U :$=U =U1001100<U- <U :<U <U1<  <U :t<U l<U 05o   <U M<U< ;U ;Ur  my;U ;Ug  n e/p>;U ;UV 0kd;U \;UHQ #  oIP 0g;:U=:U"*:U :U"P,$:UQ Qc00 "  d0 0@GGP 0 P'000:G:U 9U? 9UyɟP 00`0 R0@0( P00C\Y 0  "!|0 00 h9C& ` 0 "!0)08)0 Rk0FSL8` 9 8 bB&! 02 S61b1 R0@@00@ȟ`00C\ 0  "!P0 00 <8C& 4 0 "!8  QA 0PJ '7 `7 bB&! 02 S4l1b1 R0@@00@ ǟ`00C\ 0  "!0 00 6C&  0 "!6  Q 00S6 0" 0#$0$   BR !d&46 P$6 bB&! 02 S1b1 R0@@00@şP0n0 0bJ10000 2 0,$,!$#, \@Zf@0SAt@ 000 R0P0 $@00C\d 0  "!0 00 l4C& d 0 "!4ğ@$00 R`mj  0@@@P& #3 @ 3 bB&! 02 Sʰ1b1 R0PP00Pdß@002 <4(<"4!<002 0#$0$ 0 S0S0002@ 2 2 bB&4Po2U 2U  @0D,S 0\PKP@HPZ0[Y [$ R !cP@ 0P@`@K P 0 KP0"  6[#$0$&K $n0U 0H10SU0U 1U} 00U0v0Us 00Un 0 bH_ Q@c Q hc@c c c c c c c c c c c c c pd sd ccedA c@rdAc c cmdqdgdfdhdcmc ccܹccX=bcc0<)b@)b(;bddQQ` -LMP e,0 0 Ni, KiB2`  0 S 4 p00 t`00C\ 0  "!@0 00 ,2C& $ 0 "!0"0 Rmi d0( 008,!2040 1 R  h  h0*@KϠ<0  DX@B<0`0`` P4` 0 0bP  0  4 Ph40S )(0 ("4400$ 0 0,0| o"d Fh00 \pcܹccX=bcc0QpWEV -L,M` 0 ؀"4pKP@ .h%4K@(0K P P@-P# [$['0[(["[(,&[!P[8<%@[$ 40 RQ  0cP  N -L$M@4 ` ,@ p PP ,0K ) 0K@@@ p'P@,0S@@T,4 ,0 , 0^ @@0 N -LMP`p $P P@ $0K   pPPPPP $\00S 00  00  t -L$M@`p 0@ ~ PPb 0KN 0@@@@ pP@0\@@T I 0,0K 0+ K  *K)K4K@@@ pP@0Q@@T, [00 0+0[ 0  * [000 0)0[ 0  40S T 0 #@  0  N -L$M,`KP @pNgY0,K0 (K$pKP @@@  -L$MP $ 1`L  Pp8 (K$0K @@@ `P@$ R@@T00$000$ 0S (0S T0 @  0  N -L M0pK@` f$PE.KD$h$t*0K0 -`K,pK+@K)K(K P PP@  -SL M@ Qr2` 00Q00P0 Ģ`00C\ 0  "!0 00 |2C& t 0 "!0P"0 R}f  3P`0 0@T@b@bXhJ! @0L\U 0 @o`1@ 1 1 bB&! 02 S5h1b1 R0PP00P@00C\ 0  "!0 00 0C&  0 "!0  QD 0N^J0D@T;`2  PSܹccX=bcc0<)b@)b(;b -L M0`KP peG0KP*K @(K8)K0 -K,pK+K@ @@ N -L M(`KPp e@K}(K0 pKP @@v -LM@}̠ 0@ @c -L M0@KP `peBU0K/[@/K&.K)K4 Π0 -pK*K`(`K: -L Mp0@KP` nekeCV0K/['Ġ/K)K8'KP 0 *Kp (pK - ML`0 PpPP@0nT `:PP` -LP -L 4pK w_00&((*&<&%4K20K1 K0K/`K-K,PK p0PK:00 0 00<H0 @ 0    P@0S 1: BO0SZ0  ^ S S  S S S  D 40PS@P  0`440 0 S@   048` 04D0 _^@ 4K 00K @ @x0^ 0?0S0S,P K0@p K` KHP<L0XP#HP T@ 4PPK0pK@P0\@$<T`0 dP `@Kp@K40S0 440 Q -L$MP 60@0pQ2,Kl  *[5,KX0L @` `0S0@00 K鐰l -LMK 0 0-L0P@DP$0(L (J 00 1010_H -0L MP@ K$00 SP0d0 4 ꬴ p-h`LMP P@Zt0d0t0 @   t00t0@T@t00t0p - 8LM 8`#$""R/0qW+ D@1%01<.1P U100  0S00000EPP 101 _ 0- 8 8#T%2AL00A?S 0S ~D1010D   _ p- 8LMx!8#0 AP00D`  pd 0 40\PP p< 4081MPPyPPt p0`0 <000 0  l0S80000PP hI-/0 +0 1014PP;PP_ -LM0p P@@0 KD`U@ -W@ 00;00! !D 1 ^H R L0R00<P <0LS700\ 0R00<800LShh|||||||||hhhh00;0000;8 Q 40 \ R  R  R 00 000R 00000\ 00\ 0R00<< -D0!#p0<!4#2PLaL 00T 8@[P:tAt!P0x00( $( (0$0p(U4P0P0C\ 0  "!0 00 0C&  0 "!0 0 Rh  H04000<;00`@`0@ P000帷H PL0S P0HL0_ܹcccc00\ -LMD`p0S 1PU $ R(0(0(00(0 00 ! !00< ;000@ 40y0S!   00 0 <0+@400 000000 P00 7(KlX00000<0 ( K(0K0000JK '0[80'0K<9[ 8 $&0K% K$K  0 < P0 0  Q 0 0³00 0 004`F0?<` -QL M`@p% Q00? 00$PK UD@$K`&&T0 "K!PK `Kp@@ @00 0<0000#> -L0@ ^`Pp ^ 0000 P00V00Sa0 C 0^0 -`Lp$MV, K0@ 0P 40(KP V 0 0T0D(K0 $`KPpP PK -L$M`0p, K@P(KU0 00#>00tTH0DW@@@0 (K@`'pKP P00u - `414 L@ p(P0! p0BS W\\\LLLL\LLLL\0@  0S Q000m0S 0ҵ޵8ҵ<ҵ 400$Y 80 ( 0@ 00X 000(0@00B  00X 000(0@00S/40 1800 80 -L M@` p4PK 0g1`V00 0TT0S 4 00rcp`S㱿꯿00"c1a *  -L M1@Ϡ PNlpa4PKV8\0p  h!8 n /T40s 4!,!?L3cS 08T0S$ ,0S0\ c1W< 9!0<0  ?B3cS!3$0J0$008 b!!0 •᧎<E!U U080SgfffT%bMb 0-LM0@(()0K[ S 0K )(^ PU 00++ 0KK$0 ɋ0(()KP[\0K  )Pۉ( 0- @L aP,00 0dS0@00@00⚋ƾ 0 T0 0  -0P2c1RL@,p ` (HK@D 0,0T (0 0S0T00T0 @  -LM` @\ Ƞ!$C"a,Ƞ@Qp 0 @ @宓0,P@000v$0T0 0`0 S00  -L   b0 0  4>0  a h -LMP p` a @,0 R@\(0 @D޼TT00@ 0DPT T000000 ! (0 +0 0T00,00@ 0T 0X0S 0,0T 0S00(0(  +P 2  D04 T0 00X 0,0 0l  -L$M ` @0p4 J2S{ Pn 0  (0'  00 `0P,0K%  ,K+K*PKF4 0S= S \=X!0,0T ( 0S( Wd000P%00K  0K/K.PK 0(@@ P= 0,0T  0( 0S W 0ndˈW W l -LMPp a@,` W 0S (0"oP W " 0BSXl04ß;0 0R=#0,0T 2ßS(0  R,ppp \0 0 0 ᛑ0 0}.? 0 ᐑ0}. 0 0(0 Pᇒ{P(0 P R000  0@ 0S000  劐0 0 > 0!0 0T  00 #(0 0 00   g0000@00 `d 00 (00000d(0Qc(00@0I\0SdX D(0XS 000<ˇ$2S`,t L0@- @,PU @0T00\0#(# 0$ 0 T0PXP0l  -LM `,Pp 0K NĠ@ KKPK崅000  0T0M p-LMP`!"a,@  \40T0p飐 0 0 00 T0}.? plh -PL0 aR@,p `  4<0,0Ŋ 0T0L(00T0l40 ( 40(S"4S`40 ( 40(S"4S` 0` -LpL`PAO #PP PU1 0 0 QP  -LM#P@ `;\0@T 0SD S8 @T(;;;0mb_H Q-LP8 `Pp@aFQ00`V00S00@0@T 0S S @T`LP00KP0zP 02$04 4n9mbG -LM R"0 @000C 0 0\ 00#!0 00 l0C& d 0 "!0@ 0 R1cܹcc_c0 -&LMf0弆 ,0 :0 6 r "4"@ !$"R@pK0`&P ;PPH ,60(&@T N 0K45@Pn :0: eܥ܅pKⴐK:Q R a ::@0 000埜JP㙜@0@0C\ 0  "!<0 00 (5C&  0 "!4  QU$QU0 S*R  0P l40SQ ]:Pd R R b R:@P:@0 000EJP?@0@0C& R 00#!000 3C&  0 "!|3  Q~U 0K8\[UP 0SQ   p rS S@ 0R@0 0D0 dp0S  0CSSp0D 0S 0Sx  P00SR 0S 0SPx x  0S 0SPx x   00  0! < Q08 0000,0S0?0,080S00, 8WEV  -80LSP`p (0S KKT r> 1R0S [PV# J(@2@R0`! 0R 0R: 0S  P 0 0 V08/e/He/HWEV -LMp( @8D@8PGX, `L T(0 "<00 @ ἢ P@jHo@ H 0S 0S`v  P00SR 0S 0S`Pv v  0S 0S`Pv v 0 01,0 0T0,0 @0(0<00  mP@H( @0e?C\ 0R 0e?C@T e/9H000 O@00:00唝0SP (HWEV -LM(`< @PtD8/\") T0S`Q@ 4<0(` 4# S0 S00Y0 4 8EF0@4000;0000 0 ``0`0`00 -Ll18 -Lf1L -XALM 0T!  0T! 0T! 0T! 0T h0T  0T 0T (0T 0T 0T 0T h0T  0T`-4 0,^0^ 0@1a`xd -LM܁ Q 00#QY Z  030Y P$0P00 0 0(p,` p0@` $40 0@ 0 0@ 0 $4P (p,`@  Q 00!QY 0SYQHPD@000! T0 T atc`c p-RLM@P9  `!0\0\00S\r pQ< 0SD,DDDpT0S 0Sr00V0S` ,0 a -@LQ`8 PPH T00T0SV0|1!qPEFFFT`0HM.$04 V000M.TP4 0(,04@0@!! 00 PP@0  "!鄠 $04 V00T 0V PA@> /_ a`mb p-LM40@S  S R 1Q`00#! R0000 0 0!!0S0px/ a -TLM@ 0Q@0 Zr 0 @6 0 aP  p-LM@P`/  |e+(0tH0 L8 P`0 T0d  $8P4 00 X0pphX  0-(0PL@ F 0ES |``H`8$0P 80 -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 0 00000$8P0 4# 8P0 $4P0@8$ 4@ 000 006 @006  0000008$P0 4@ 0-@L8P0$ 48P0P $4$0 S8P0 80 -L)P  p-LM@P`  tP*(0lH0 L8 P`0T0 $8P4 00 X0pphE ط 0-(0PL@ 7 0ES dddLe H0"S 00 H0"S5p H0"S 8P0 $408$;P 80% 0 -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 0 000008P0 $48@P0$ 4@@@DTf$f$f$ff$f$f$f$f$f$f$ff$f$f$ff$f$f$fg000000000006006 -LM@8$P 08 -L2P  p-LM@P`#  tY)(0lH0 L8 P`0T0 $8P4 00 X0pphN  0-(0PL@ 7 0ES hhph(i H0"S 00 H0"S>p H0"S 8P0 $408$;P 80% $0 -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 000 000008$P0 4  00000000000006 -LM 0T@89P  @%#,00R0S ? 0Z p-LM@P`((0H0 L8 P@00T0( `R phq( $8P4 00 X0ppho !8D! 0-(0L@P0  H0"S0ES0lk lDl0%0b_p00M&p! -LM@8$P 1<8 p-LM 0`0@P( 0?.AB" ((0H0 L8 PP00T0P0 $840  X X0 \0  ph,ph'$8P04\!!D! 0-(0PL@ 7 0ES ,nLnmn H0"S 0UY0 H0"Sp H0"S 8P0 $408$;P 80% &0 0-0LP@%8P 0 0q 0Q 0P00 p-LM0@P`l'D`t@000 4 080 < 0H0 P 0L0T0 X  phHo -LMD`pV' XP% P<0A P@U<0  <0  <0 < `V!<0  PU<0  <@! 880  < 0 <@ 0<  -LCMpPIoKUIK0 $ @ $(̠ l& `&U 0 $0S 8$X ($̠& b""_ p-LM P@~ 0`^ p~ 0`^0` -LLM<@lKP`d Kh0K  P p  1 P P@ 004 P8`0 d0\ hl H0 0^P0 X D `LA,M9p@P R?QL1HQ Z00 qz0, 2  $P  LP@8  . 0 (0 BP@   P P  T , 0@2,!;0@2B 0 @  @ L2@ A0 @ L25L2ᒏP@7',1!0 $@0@0 m xP@D2 ? 0<K PP D$ 0<$ @7<@ (P T ,10 $D2H"_0,0000 T 0  H2? P D2@ PPt @ E.@Kᨮ,10 $,00 ?0TD2,,w000 0 TL2 =0#0Y00S0@0 ,`00Z TL5@0@ L2;L2 0  0  4  4,0 $4, 0$D"4    ὔP፥B,10 $D4,1 0$u?D",10 $,PP00 T,10 $,>0 $,1@0 $@D,s?00 T,1 0$83D"(L207L2a 0 @  D20D2  0RT ,10 $,Q@@00 T,0 [0T,Q00 T,0 x0T",00 T,10 $ D",10 $,10 $,1@ 0 $g,10 $D",10  0   0@0  L22@" 4K8K0P@ @@.P4 8 Tj 0,K0K@ @@PP@@XW},,Ur1HU <!\8#\Q( "(R0SS S SSȘȘИИИИИИИИИИИИИИ p-LM2@BP@ D@ 5 D` \4TPp,10$  -PDL p`:L2V4L24L22@ D2@W @ @X@@VHH"Z@@0@ ,10 $X000,V0000 T", 00 T -LMPpP`M  0pᅎPB ,0` 0T,A0 0T,0 0T  0p}d,10 $l p,0 0T,A0 0T 0]DP@ D2 ,,0` 0T,A0 0T,0 0TZ 1V! W00Y @  0*@ 0@" P?PL27L2,10 $`,10 $ ,10 $ hpdp -,10L` $@2 ,1p0b R$,1@0c $@D (C@= 71+%2 0,10 $ ,/00 T,0 0T\P{Dw8s,o kꔽ,Ll -!L,p00 T,Ax!00 TD2   h邏8!,00 T,u/00 TD2,10 $,``00 T,A.00 Ts?@,H$800 T,Q$L00 T,00 T,A( 00 TD2-A '>H 4 %ž0H@2D"05SH<2-A '>H 4 %ž0H@2D"05SH<2 -LM@PD2 7D2HA'>,"%0(@2D"H€ -LM@P0 0 -LM@P0 0 -LM@P0 0-A H'> < ž0HD"@20% S<HH"2L28L2 -LM@P0 0 -LM@P0 0-A'>L80 ž L@"D20SH20H2<2V-+LH"A'>$ Ɍ@ 0@2D"L€H -LM@B 0 SA'>Q 0@2D" HL")<2L"HP0@2D0"0 H2 0H21b1`-" 0HSL,BA'>" H 0@2D"Lv-" 0HSL+B@A'>" H 0@2D"L -LM@PD2 7D2 - L -LM"@0S SB  A '>  -LM"@0SB  S 0yA '> L2 0L2 SC  -LM"@00CS ̧ԧܧB '> L2 0L2RA C D  `& -L M0 p= 0P`  2  S S  ,Z  SO @0 K$K0  @@P 0 040 8 2>0= P 0(K P 00 $ ($ @0( ` (P@|T lh`L 40S , *0 Ptn1H -LM0`4pP 0T 0X 3  3.2.2"@ M@ 2?q0L?-@@h,10 P00St P2  I?<2  42 ,2&  ,J?22  292?  EK?1K  1R1X  ^>1d  1k1  A? P= `05 AϠ/\&  HT = @0.FP@o  I0TM `0T P0T|0  I?h0#  `0(X02  <J?D0F  <0T UQS#%&')*+-./12R -LDM4 T50P @ 0P , P d PPT \  P P4"` PdP P 0XP (PP (08#8 PX0 (X   XLK=P  Ƞ4\P ,H@(  0T S T 0 = Q0 - PD P T  \ T 0 p`0 B?d  !h P#@P`838#@0#C?Pp``0 0dh  1=P5PA?AS00  0X;ˌX 0X0P X0 0 \ 00ɕ\00Ʌ 0 S Ʌ 0مL"S0 0ɕ00PT  T C 4 0A0 0 AQ  % !020 ,PP (\0S Tl,0 S ,g= P e= P1  P U <1 00D0 09 1 J4[S 08#8P T0 (K4[X S$  P(T K T -("(@X P X0T X bU    S -4p0`PL 㾮( H M 00R  (- A05R 2=   !P=0=?@H$H0 X=A?AS  Z Z=0=- -@  -MH$H 0@X p-LM4`0P@&0S p_ 7\ \0 tD0 Q08 Y j/l&l/ 0- PL@$%P  0(0 PP  -LMB4p0 àa)0 0P0!0!0PSa?tA 00 (0C"(0~ (0"(w00@ P0(U"h 0g (0"(` (0"(Y 0@0P0U!h@@ 0F 0E("(0> (0"(70@ (QP"h@@A@C@@ -LM@mh -4`0pTQL@H 00I X 060Z 1000O 000P 0d 0 0@ 06 0K 0h 0L 0IP 0 0P8U#H 0-L@P (w0 T y| u 0T 0T :X=0hB`sb -0 L$0@8 @S(@0 0@R8 P00S00 p-LM@P `$U*00 U00 Tp 0-0@LP T (0 0- @LP$00 0 T0 $  (0bs -0L $ p-LM@` P( 0P  (0#4 04 X ( p p-LMP` x $@ n@p -L@P`p[\ 0@@l -LM@ ` G $ pP U \ 0P T $P  &0 T    0T $ P -LMP`#pP@ 6 D6 A0 X0SdpeT@06 G 0- PL@( 0$  p-LMHP` $H0 X ph p-X0LMH$HP0` X ( < 0p -(LH"H  P`p  80<40 h 0-8@L#8P X ( 0 p-(LM"(H`0P $HX0 Xp p-LM8P#8` X (@ (H$HHp p-(LM"(@P0 `X8#8 %XX0 Xp -(L"(@ȠP0 ,x`XT 0X@T -(L"(@P`0 pXT0 X@T -(L"(@P`0 pXT (@T -(L"(P`@0 pXUڰ0 X㊐0 XPU@ -`(VLp"HP 08 #X(U h"H - L@` pP 0X 0X \0 X (X%X W0 @ @@|U -LM0`4p@\ (0"(@T0R 020U H aP008 @0< D F  0X (P #P -LMPH$HXph 0` 0 ` 0>%X@d@D@`0 48#82 q04 l -LM(0K@KP 2[S   -L@p`P0 T-  $P0P S (-L@p"hP0 X  ( V0P S  p-LM@P` @  (@H$Hp -`8 L#x@P08#8S0   @     -8LM`p#P @  0@8T#@@0-0  P`CR@    0@8T# -8LMp`#X@ 0P@ T -8Lp M, #@`P0  Ƞ ,hp0 SPpU@,0@@ 000 0-0P40 0P 400PC U, ` 0S V,@pP  /0 SPpU@400PU,0@  0 S40PpU@0  Ƞ ,h$0 SPp U@ -L M0@4P $ `( x 00 ,0 *, =B0) 0 0  (` 0T 0T :X0 X ( x (08] #u`0] 0 0 0] 0 X 0 T~ ,0=  P P ߐ -L4M4`00Z T0 d  X (Zp Z 0f ;1#XL D0K 40[ ("(0 H %@0[2 [0L0 30P0 $ HpW@ P* P +!"H (U0"( 0H pW:H00Z p #0P`Π RU:L 0 0gQ 00A0D0S 40[@@0 S<,00 [8[0Q,0  DKT 70[S% HS `0TL  0T :X 0X0 T20[080K7@K ` [ 080K@ [)rL  0F? RK gP0@00K y000 7 $!0 70K8 K`$ -L$M4p0`@ t08M #X9 ( 4 40"(0@0 ,@@ ("(%.8 010 A  U< @ ! U  U Uk  U9 U 40" ("()0@P 8> R@ 08K 0 0K 0(T00U0EP80F P000K 00[S @忐 ("( 0@ 0/0[S.0[S0  00 < 808 <0M?0倐 P5@04(@ 0"(("(>  l1  (0"(4@H$H z00 0 K o00K 08 P0 0` 00C 20>@  8 < 04S < 808< 0M? wSu 80 8 0QR p-LMnP@T Q 0 SP Rp 0-LP@@T0 -HLM($H"(P`p, ("(,K"0[![ (0"(!K"0[ (0"(![<@K"0[! [H$H0  0 80 -(LM"(P`p0 X (0K A[(H@ (K0[ [0  (K0[ [0  ( (K0[ [ 0  (K0[ [0  0- @PL:X 0X0 0- @LP(0 08#8 X0 0- @LP(086#8 X00 @- L0 ( 00P0S0P 0 ( P 0 8-#x@L@`P1 V 0FS 0F`` (!0 X (0!0 Xp  V `F(  0F0!0 X  -L@P`j 0 8#h] p0]  <X` ( < X0V8#h0] h 4B0>3 -0L (P0 P00 p-(8BLMS@P"(R B`` (008#80 X pp p-LMP`  $@ @p p-LM@P` @0 T p -LM400pK@P .`  04 @0 [PR @0  0K@@4  ("( 0.[Q R.0[S/0[S@ 0 -@K/0[S,[8 P0(",0K8 0-[0>\:2  .0\ -K8 80Sp< L^< 80S @ -[eΠ 0-[0, [ 0p<0   0 M?@p Π 0 0 -[ 0  {p<0  d忀0M?p~ 0 0 0 <0 ῀Rq -[^pW  ,[ p< 0 p0  < 0 <0  5@0M?@,[SR -0L M '0K& K( K%K$K@0`4p<`P P U(0K@2(0K$@KR -P@ 0L`p}@ 0h3 0-L@P 0 @R2"0R-\0΀ L0R00224 NS0S"$PRS -LM0@P`$004PP (pR  PU 2UU 0E8#> $0| 2 x  P 0 RPi  P :^^ C^%^ ^^ Z^U^[0 00  , =S  (^^! 0 000 00a 0  pP  P*0   X=S  (^^ 0  ;;S0 a0 P  P0   0#000 0   l0^ 0 00-P 00C 20> 0`00HY WQRP -L M40p0 P`X 0 7@ 0 00S ,0  Zh0JŇ(́@Y,0X  )000 0 0  -L,M (`4 8 04< V@ Q 00 00C8#XH 0 0. K8 8- K ;1Q#xH 8 L L0EU8(0K8Q #XD +K,K+ K, K  @@;1("(#x 00K/@K7H 1D("(0 ^H 0L8#8QH0 8 4@ <  .0[Q0E"(+PK,PKD .0K+K,KP -LMp0P@`04 0 % ;1#h 0@$ 0 0$0 @@ 0  0"0x 4 0 n   !D 00C 20> 0p@00R p-(LM"(@P0 `X 04 X 04 X0 X0 X0 X0 X1 X1 X 04 X1 X1 X 04 X 04 X2 Xp$ @0C1a!cP0$I-\`> 0>  H0 R`\ 0 S*0A\ -P[Q(L"(`pj%X@ d@@$@P@@T -p@T`LP: 0P@ T: p-LM6 `P;@ p6 0L6 -0dYT@p 0-6 L@P6 000h, p-LM6 `P @p6 06 0d (T@ -LM0pS` ;QX%(@dV` p-LM6 `P@p6 06 0 d T@ -0`4pL@Pe0S  0S t -L4MH 0P04L0 ~1P  @RDK:;1("h  #xH\  0 0@0S*PgLWA0ST0 00@    ("(0 f L0PDT -L,MH 0@04L0 +0P  `RDpK*P,;1#XL0 A0S 0`0S*00h  H@\  }0 0  L0 -0L\M91 0`4p P, 0P0 1 ,0S , P@  0@ | K0OS|K4@|K  0]Ka^KX@ zKxK`K0 @0 0 |KP00  000| KAPZ>  H A0 b -LM00p40`@J@0P0,0 2`AN 0 PA0@U0 X (,0P0,0 ,0P0,0 , -LMH$H40 00[ -0LM<`@Pp000, S04@P00S 0 00000 0$0S 0 R 0 J 0 S ,  0F/00 0S , o&P 0 0 0 -LM@0S< 00S  0P  -LM`@ 02Pp 0UV 0UU00000U/ U > 40 A0o LP U DP >P.000 4P.000  )P U | !P.000X P000 4P, 0004 Q\@-@ 0R\ 0 00ܹcc @-@00C& R 00#!l000 X0C& P 0 "!0, 0 R@ܹccc02`O0 IMb8#8- SP 0S P 0S\^ 0\p/ -L000d 00400 6 <80`05pP \p  (0K80O^W P(@,K@*HL  0-L@PB  ,0\R0h (0 ,, -LMpp4 )@4)0|0 S0  ;8#000d $3R3R*3R 3R*3R3 R 0 405 2R{2R*2Rk2R25b:0600"SS228`00<0 80`V P |P㬀80`O^V Pp0t@ 09 l%04 p5S A,0K0K4 @yp5S P p5S `p5S4 9pt 0@ R0 0$1R:1R1R1R 0R00R 0000000g0Rd:0R0^0R 0R 0Tt0R0O|0R t0K`0R d0F$$K$J$$!$.0$|' $$$o&$%'v&qqʄ -LMpd) ,|0S 00@#A>000d 0 506 0 040080*3 `0<0 2P P*2Pz 2Pv 22Pr p0t `0FS5880`VP \ 080`O^V Pĕ\  ,0K B0K@4S `4S 0   @ P0#4 ``<4 Yp0t  @ P ?` 00 p0t    @ P0#4 ``<4 up0Pg:h0PdbaP0P]H0PZ*=@0CSVL'%$$% Q&S&"( ( -LMp0t@  2"r,`9r! d2 pL"0U RB = ,K+ K@12d1 ,0K @T,[ P+[@p12dQ00@TY pt0@ @ ! 0 T0p 0 ͠ 0S Ɨ+K,KR01,0K, [+0K  0 ,K+ K0,[+[ 0Q ,K0 0Q 0 ,0K+ K|0+[,[t 0Q 00+0KT0T 0Q, 0S0!,0K, [+0K  x>A```` -LM8 P8p0@ tp0@tD p0tH , p0tT @ @$41 0@00 4 @98D48 < p,@!8,27, 2<O^< p4Qpt 0@ p@t 0D pt,0H p@t00T 8om4! 0T0` D#@3 QQ 03Q (3Q 3Q 3Q 3Q 3Q 3Q 2Q 2Q 2Q 2Q 2Q 2Q "2QQ{ 2Qx |2Qu t2Qr l2Qo d2Ql \2Qi T2Qf L2Qc D2Q` <2Q] 0,"SS RO000 0R0玁0 C800 ( &  1 ,!`, 4< 04 {< R <X< @93<  0R0` C` @90 0'0  R0000 0S0:0 0 S:'0 00'Α0 0 00 [%&$!$J$K$$$$$$$o&'v` -  808 0 0 0 ````E-08 P` @TP0 p0P:P 00^0:0SS00Q  00QQ0 0Q```` 0@-P@ 000 000 00```` -LM`4 )4|0 S0 1!00d 0 405 1Q^ _1QZ 0601p`0 080< t@ 8 8 80pWP  g0Pᬀ 80pO^W Ppt80@ 8  0l%04Tpŕ\ ,0K4 @0K@/\8 8 pŕ4\ 0Y0,0Q0Att 1 it -L MP`0p0t00 0H 40 p0tP 0p@0c,Ÿ2t@ ,  p,@ pWOY>pt0H p@t 0P  ! 0T0g! 00 4 2 00, 8  R00ą 0g a 12  07\00L000Ũ0 ` 12 # 0# 04h0 PQ 0 0Rg0 0[00g0000 t -LM4 *0`S(0#4080 408 "3R 440  0 p0@ p0 P <S  40S 3%P 2P }2Ps 060440|0 S0  60+S2 d000 00"040` <588@80pW P8 P㬀80pO^W Pp0@ t g0 l%804 p5S A,0K0K48 @p5S P p5S ep5S4 80p t 0@ 0S0 1P0?S0}0y0S0P 0Pk{0j0P 0Pa 0  p0@ p0 P =d1t07 $,4w1G1@'21 -LMP@p0H tp0tP 0\"0c2#ppB2  ,2  2Q2 R020ĕ!0SQ00ė`, `VYpt0H p@t0P  ! 0T0f# 00 ? = 00 6 b"f, Q0|  Q  Q  00| 06\00L000Ř0 ` 12 # 0#d0 ,0 s|00Q fjn`````` -LMppQ0 @3g1tP `*0 S(0#4 0 P @ p!p1W0`4p@0P!QWP5Ť4Fڤ4S$(> W 7 04 0 u4S@,0K0K @04S 0FP W @ PP  < 4P  0e$4 ɩI< -p0`LtP p0T t 8 pW P@4S PONU @UU YBP8 8 p -`L)P`p@0 <00 |@880T +80@T -LM*0pS(0`#4@ 0P @ |0 S0 !00 !Qc [1Q0 1d00<01 `04 8580PU@ 4SONP @80Up@tPp <<p <T0 00 T0p@tPp 04p pPt@x 04x 6 D0Q40 00 0 00HF@(DI -LM8 08 0 4 ,4可^4 0Q8o~80 0! 0T200,0  a002Q 0S0@0 20,0 04  00 8p`0tpS4^VPTP@  !,22 4Q[PXP8 p0@tAs@ 80tPp`Q@ @0sPAp40  0P Q55 @0080t@p0As@  @RA80@*R40ȁ60S4040tApP`s@0p< 0 @A 44< mp0x t8 @P00@  ``` -0LSP p`p0tpPt`@P @00P hp0tT pPt`@T $L4<T -0LMp"x|0 S0  `1 00X16 d00<0H1pPt@ 4 5`08 00 p@tP 00 pPt` @ $H@8@8 80PU@ 4SONP @80ULHH -L$M8 4 803a410* <0 (0R8#4 @ 0p!@0  h1<\0 4$<PE 8 20D0 D0pP @tp `@A 44  Z8@ 0 @0<S0$0@7,0K40K<@ @<4S4<8 @0M$, < p -LM8  < 0 t0p@0 8@ !  , 80,4 *40叟0S40 8@@A@@ ,00 @0 R8oP8<0 0! 0T40,0 , j 0080 S"` BX@ 0 SP4 84 @,A08@T@D0 @,0 0010"00"`P @ R0!@2@ 04 00 0@  88@ @  00P0 @007 8 4@0!A,0`@08X@Dp0@ ,0 @TXPh&PA04@ @ &l04 @0 4 0.0 '80@4 0`A, @08\@Dp0@ ,0 @TXPh&PA04@ @ &l04 @<<== -LM 0@  pqW35W p0 Sr 0@ ,`4 R 0D ,0S *$0 RV 0@ \0 SI*P$0p R 0D \T$`0 00ptD0p@0t `0`0C\ 0  "!0 00 3C& | 0 "!0X#0 Rozj S #`0 00pt@0p@ 0t `0`0C\ 0  "!0 00 2C&  0 "!0`"0 Rt >jr,B,"P0 00ptD0p0t P0P0C\ 0  "!0 00 1C&  0 "!0l!0 R& j$8A8!P0 00pt@0p0t P0P0C\` 0  "!0 00 0C&  0 "!0x 0 R i 0  p p8p0  pܹcccc0 -L M p[4D2[Pt 0   @0  l H  0lTb 0 $ @ P00PL s|G0 S:Ӑ0Ռ0W0|0 S00 40 8!A> 000d 0 506 1!`0080l <* (0R#480`ㅀVP \`  (0K80O^V P@,K@4S `` 0 @  0 0@ PHUW  -Lp  ,0^\RQ1 t1 1Pt@  0\ m08Q81` 0 pt p@0t `0`0C\ 0  "!0 00 0C&  0 "!0x 0 R h T0 ,,1ܹcccc0 -Lp 0,  Rdp?T&0L!01QxN  6\k&0 01Rx  <\k%0 01R| 0 ,@0S XXXX4[ \m  H0m0S   ak0S] 0  0P4ğ  UP 2200T200C\ 0  "!H0 00 44C& , 0 "!0$0 R 0#P P mg 0 $  $ 0 $ 0 P $  0Ty (dB2P 0 pt p0t P0P0C\` 0  "!t0 00 `2C& X 0 "!04"0 R@XgQ1` 0 pt p@ 0 @i H 0 i $ 0 @ 1Pw00 2R0q  0\a\q0|0 S0 4 h"A> 000d 0 506 H2H"<`0l 8 0(K P` 6 0($ @P1(p@ (Px U! @18 3d1TP@ 0S 4S `HU 8 (Q(1` 0 pt p@0t `0`0C\ 0  "!0 00 0C&  0 "!0h 0 RY eWP1HUW  \1ܹcccc0 -d!L`1M, H `, L1L0,0D!D0P 04 , 040 8 8P1 @0e!pS1#D 0   PP%U4 80 0R4 80 , 0 , 0, 0 , ||0,t t0 0 0, |0,0L|0 oHT1ghHhhh -L03a`^q\0@@L0 lŇ`֟PU$T l%` -L M1 p`$$x 1,0 $, @0 Q 1D!00 0 0 P$  o04 <0M>000 P$013$0@ P⊡ X00P  PPX, 001  8  604$1(L`p -LMx0@  001<@$0 01 $ p-LM0 h0 P@` 0 <@Tp 1 0  -00L!0D $ -40LM@0D T -00L!0L $ -40LM@0L T -40LM@0T \ -LM`P )婞2pQ0 Q0 @0r P@c |0 S10 !000㜡d @40 0`<58 @l(rPC P1P!  D0 84( K,0K( 0 0 04S5P 4S 0-pt 0|},K (0KXsPp|@Dl|@k  -LM810,0 ep P `,@0(`VOp0tL 01pp,0wpP  Q10Y ! 0 T 0w 0Wp <040 P0S RQ0m``0@-p0"R 0\P0X@00"R  ^0S0( 0R%9Xa`$0(#00"(R0 Q(0S009 -LLMpt0H 0#80`l0 )Pk85p 0 p0@ p<  0`K80 P@% 4 0S0060 $0 |0 S0  `4P00X$X4d 00 040< 85Pooodqdqq4pPt``0P @$H@P @88P 8 80pW ` P80pOnW `Wl0? W: 0  R4S Cd0KhK  @4S  0^$P Wl0l 0 l0 l p@tPH l 88H 4S `l $D02pPt``0H @H $D@<@4H 1p`tP`0P @P @00P pPt`P @$HP @ZpPt`T @T $L4@<T 0 Q 0   0 p0@ p0<  8 `KPH D 00   6LlU06`@06@Xa(u sU -L Mp` e,P, p0tT A 100p0@000 0Z_Yo ! 0 T % 0S000 PR0C 000 ,00,0 pt0 ,00!,0000@p0@Q@ t@A0  H0!80,000,0 0 R0 0Ņ333 -LMP$2p0,0 `,@0YO` p!t@ 0Xo, ! 0T0,0 .0S000 PR0C 000S0,0 0\ vvv0w0w0 0 z0 00pH t 02 0S00ą,00LS wwwwH0   ,Q$00`3e3j3p3v3 -LMp4: a|0 S20 "p@tP00d T 00T pPt`@ @@ $D@@<4@ x!p040` <85 t D῀8Fp0t@ t`p@PP@ @PP00@ 80`VP \ 080`O^V Pĕ\  (0K L@,K@ĕ \ 0  }tz} -LM0 4 , ,0C, 叏 R, 40S00^pPt`@ @$D0@ @L<4@   0! $ 0!0 T ! 0T00 7010!08 @,pP@At`D@@  822 , @pP@AtpE@` @A844 ~0 RC0S0 ,0,4  0.4 ,`4`9`1` p-LM0`!$ 0!P $ 0PP!0Tp -LMp0pt@ 8  Y P `@4ZS PON U @`  0$ H8"20S$ 8 -LM`L) |0 S0 (!(1d $!000840<56` 08R:000480pWP .\ 080pO^W Pĕ\  (0K T@,K@;ĕ \ 0`4  -LM, Fp0tD 0 ,`0XoY o,0! 0 T,0p0@80 A@ tp0D@ t4  00(  %  0!4  0 P0@00080pP!@ A1@ tpD@t 4000   ,0!P4 44l4 -LMp4 < 4|0 S0  <0S000 < 0R000<0S006000#;00d #p`tP040` <85P @P $L@@4<P pPt`P @P @@00P p`tP@ @@ $L@4<@ pPt`L @L $D<@4L p0t 8 8 p)t08  p0t 80  d<0SM80`V P P㬀80`O^V P 0S l%4 04 p5S < 1RA0K@4,0K @p5S4 0 Pp5S '80p 4t 80 pPt`H @H $L4@<H | ̉ -LMT 8 p0t0 2"0 40 , ,P,可P, 8T p00t4 R o80 4! 0T@,`01 0.00 0000 d 00 0 H 00@,0 10! P0 4,  04 ,80ApPtZ@pt1 `@A 44 8H pPt`@H $L@4<H @ \000 QS0L00 0S0@@000 8H p0t0 PO 20 S2Ʌ0SɇGj` `n -p0`tt L8 XP @4pS PONU @5 ,/0S  8  -LMp*08 S(0#4 0偠 R R R R R  |0 S0 #3d #000` <04508  SR6 R R td04 8080PU"@PS ` p0t4P 0 12#   P}80PONU @ Rm R' R% R# R! 0BS8RQpPt`X @$L@TX !@ @4<X pPt`P @P $D@<4P p`tPT @T $D@<4T pPt`X @X $H8@8X 80@S4 ,0K  , K00K8pp5S 0 0 ,&h0K l%`8 0BSR:80S0 6040ꅠ80ASH` -L MPX p`t@ 8 00CSix0DSW1堑, 00 p,@0pWOXo ! 0T p0 !t@ 0  00 0bZ30 0S00ą  0p !t@ 00,  Q 0S0@0 0 T DD0D@@0@80000|```L`\`h``````` -80ZLP `@p0 $ 0S 80`ONVp @ G-0S0 0 T -LM`d(`84 PP P8P H8P @8P 88P 08P p0tP 8 '7QQ 7Q 7Q 7Q 7Q 7Q8  8 '7 QQ |7Q t7Q l7Q d7Q \7Q 80 Dd4000 $7R 7RR 7R |0S 00&A>000d @4@5 Ɵ RR VR vR R RR X6R P6R R R R R R~ <6RRx R6u %5QQm 5Qj 5Qg 5Qd 5Qa 5Q%] 0`  <08 5RRN 5RK 8E`%\5QQe P5Qb H5Q_ @5Q\ 85QY 05QV @5@%<545  8p〆  WpPA` t 0pd@0t 80pW 4RR |4Rᐄ 80 \0 $0 T0 $0 T80pW P GP#80pO^W P0h#d3QQ X3Q P3Q H3Q @3Q 83Q pt80P 0"2QQ 2Q 2Q 2Q 2Q 2Q 2QQ 2Q0 8 '$4 04 V4S 0`"QQp $2Qm 2Qj 2Qg 2Qd 2Qa 1Q^ 1Q[ 0K4B ,0K@4SI !1QQ% 1Q" 1Q |1Q t1Q l1Q P 0X!QQ' H1Q0# 8 4'8  0  0QQ 0Q 0Q 0Q 0Q 0Q >A/>:4 064@0K:r꜀0 L0P 6@060000:00GhMhbiMibuuRur3M8M0M````ܟ  -LM`0 t3RR^ h3R[ p,@PpWOYo! 0 T +  2 "   0P2 2  <\W  p !t` 0 P2P"008 $2$"0080 $p0tP @ ;:   20S`1  1 R20SU!0S00Ƈ  20S T1  H1 R20S020ƅ(!0S00Ƈ  20S0 - 0 R) 0B0 T0 G  000S |0  00S 9 ! \00 0B0208M0M'`!`````jn -(@qL` 0 T $0@ , 0P^h 0T   T  0S00 -LM0` ,8pWP @4!S PONU @;2 )\  0p 8! -8 ZLp `4S OnX ` 4S 0 0QQ$ 0Q! 0Q 0Q 0Q 0Q 0! $8 `)P8  l0A  0T0@ $  hMhbiMibuuRur -03a`pM@ 0L P m0$0 10 T5 $044 \ -`pfL  P 0m0$@0 0< T 0\ -L4M@ pV D6VI 0,K P- 0,$4 0%Q] c5Q5Q:5Q5P 5 D p , (xx0S 40S P0K  0 PPĶPP|, 0x,00 0P PP媶P 0 $4d  005 0$40060` <D4P 84P04P:(4P 4P l 04\0H ,00808 3ZH0#3L P0Dp4#P D  03jx1ଐ 㜐l%|p BP|H 0 1cA8 4 0#< 0<0/8000 P 0`< PLV 00P P`@PD LV8  01ca 2 0 <0&.<000 P dD <P80U<0/L000 P@  B&0<@ ,@=P0<0@ \!0\ s 1` \080t!t1h l0Lh1P \1P T1T1P0,1` \0(1P 1=<@0CSQ 0D0 D 00Q 0Q:0Q00Q 0=C0CS@lHHHx060H1 < `008!pS00W80P \ (0K80pO^W P  0 0@d  :9d x@,K@ĕ\  0 4S 0S00H -L,M, "0 p0t@ 4 p0tD p0tH 08 p0tT @ @`00 00"0!D0 4D0` 8 n,0 < 4 8 ,@4YOpt40@ p@t 0D 0!Q pt80H pt0T <Q,o@0< 0T,DpT10 0(H0 1L0 0H T0 40!2P 8T 40 8 ( & 0S!PL0 bH1< 0h< p0, t00  0200 00   H0<0< 0  < u000r== -80ZLP `@p0 $ 0S 80`ONVp @  #0S0 0 T -LMP `@2@p0t$ Ps  $ 0@ .P nkmf|0S 00t!A>000d 00 506 P1P!p<0`0l 4p8p 0(K P A 0($ @0(P@ (Px X  ' @183d1 T `@0S HX 8 HL  \1-|0| H t0t L0P D0d 0`0 XX0X T0T P0P L0  0|0 T \̾ - 0$L0 $ -LM@ Ġ00 T - 0$L2 $ -LM@ Ġ20 T -LM@ Ġ40 \ p-LMP0 `$x0@4 0$0 0 Rx0$ phc $  0S $$ 0 0 phf H` -LM03`p 0,  Rdp?DHP 2\Q <\Q0@@ ,0@S 4 ti 0 \i0S   aQ0S] 0  0P1  UP 2200Q200C\ 0  "!`0 00 L1C& D 0 "!0 !0 R 0#P P iM 0 $  $ 0 $ 0 P $  0Ty @dP cܹccc0HHdx  0-!L 0, 0 , -LM 0  A0 0\ -LM0 A8  #0 0\ -L M*0PS(0#4pp6 |0 S0 |1|!00d 0 405 00CSHhhpp0600!0`  <08 `@ P80`ONV @0 R p0tH p0t8H  $0K x$ K(0K>4S 0 0 (K00H  -L MP0 R p0t@ , t3,p@ tD , !00 p`,@ 6pWO`0 R$ 0 R pt,0@ p@t 0D p@!t,0@ pt 0T 0! 0T00) ' 0 R  22 2 1!,0 0, 0  111 2 00% # 00 0S h1h!002,!, 0  0'0 ~$1$!0,04", 000 0S 0 002,!, p0tH p0(8tH Op0p 0,04", p0tT !0, .334444 4 -80ZLP p@0 $`80pONW @ $00 T0S  S Zn -LMpt0`4 40P )8 Z4|0 S0 1!00d 0 4 5 R_ dSR\ ]5RY 0601 `0< 8 80pWP  g0Pᬀ 80pO^W Ppt80P 8  0l%45pŕ\ ,0K4 @0K@pŕ\4 0A\4 0 8 8 `0eR RoR0 R(0R 0Ren -LMPpp0P tptX p0`t\ p` t0jx!2#` @, @TόYpt0X p@t0` o! 0 T00  0 000c1 0P00@x 00000c1c00  00Q  A`<` -LM8XpP `@4 S PONU @`$080S 8 -LMpt0`@ p0P t@8(|0 S10 !00040 1d  6 `0<588Lp@0tP 80pWP \p $0K80O^W Pp0t@ ptP ,@(K@`\  -LMP`p0@ tpp0P tp0WT X t0 07 80 0, 40 ,A)^όpt 0@ p@P t 0pWT X 00t,0So! 0T00"  0S40 00 0 55$$‘0 ,@ 0N,@ X000H000S8 00  04@0  Q0 -LM`() <|0 S10 !000400d  `0<6 58M80pWP \ 080pO^W P ĕ\  (0K P@,K@ĕ \ 0`  -LMPp0@t@ 0@ 8 p0tH p0tD 4 p0tT , ,p,` 0pWopt 0T p@t40D pt 0H p@t80@ ,\o0,@! 0T00/ - 0 , @ 0, T@0D0^  0080 180 8@0A8@ 00  00 `04@0L4@  P@@4  0,,4  nj, @44$0#(@0"(R (0#(#<S R P -L,M `0 0 40 ,Ġh4pd 00PP 0,`L PLK< 8 4p H D@ @P 0` , 廳H| -QLM@  -!LMq0P 00 2`l $B 000 l T• 0q T2 p $•0@0 0p T@• p $0@@ J0T2 r (@00C\ 0  "!x0 00 d0C& \ 0 "!08 0 RdGcܹc'cc0 -!LMq0` 00 2Pl $B 000 l T– 0q TB0 r X2 p $–0 0 0p T@– p $0 @ WJ0Tڬ@00C\ 0  "!x0 00 d0C& \ 0 "!08 0 RFcܹc'cc0 -LM?0$pKtSP@` xS "@K!`K1[T0 -L M@Ϡ (Kt\P`p x\ &PK%`KrKMU v` -LM2`4 ,  $, 5p  B  0 T–  0\B  0\–  0\B 0  \,0QU@ P  o0S&x P  0@pU@PY – 0 \B 0 \–  0 T, 5<5 p-LM 2 @P( `06S # 2  (”0;8 #8XV p2 (0”08 #8 X2 (”0;2 (0”08 #8 `X 0-2LP  (0•98 #8 X@ I2  (  @TT 0hH? ?RD2  $•0@0 0 T '= -L,M p 0 4 Y@ 5 @!Έ0,K   @@P N 00K  PP\0$@@50 (P0 1( ˜?  $˜0 0 Tf 0 P  0 3P 2 p $˜0 0p T2 t $˜0 0 0t TVH@_2 $@T⪶F]`40K P0 ˆ` `*0,P˜80KH4  ;4P˜FM@A@  0 Px˜8 A ;P`O80 2@ 2\5@0" @ 2L0@0"0@ @ 24d0 "2 22"@00"2  0`]l2 R "0"8E  40⡩@庨@>0"= Z228+824 00,2 , <85|2T l-h+ 0   0   0P   0` < < @  0  0  @ 0  <0< P(X@d dhlLT@`$81H -L M≏Q^ p`P@0; 5Q,00; 5—000  P< V`U>V@P<??7 -LM` , 副0 , 00 r 00, P   7~P@0 S –P@@  P;H–  P <B(0S/, 00 ?Y,00  0 ,000 00?Y0 –(0Sd0  $0 (< 0,, #$0 (7 -LM`4p(0S"P0@T00V0– (JJQ@DD 0–(0S/ x20,000 \20–(0SXl00l0 h0<0Ph0ᨲ– "1 $0 ( $0 ( $0  (l0 0l0p83.) $@0 10,000 00–(0Sw 0 $0 (|yvsp–(0ST0  $0 (,0  $0 (?$XHp 0-4l0L0l0P  (0•08 #8 XEK2  ( @T! 0000T 0• 0  \2  (0•08 #8 X2  (0•@08 #8 X0'$ -l1LP`04@S/ 0 {0R(  t00t0x00x0 x00x0x0px 1x0pQ (0S2$[  5;5P0S0P R%2  ( pWPH 000W 10–  0 \( -$!$Qp0a0@00L0 0e0E 0@宦p00C& R 00#!000 0C&  0 "!0h 0 RhgAE000cܹc0cc0 -LM4p5Pf  0X2  ( Ht10S? jka10SEP010S 10S t0!0t00Q 2  (0•08 #8 X2  (•0 08 #8 •0  X1S   Vixphl00l0•  0X$ ""(@H\lx -D3L@c M@ 0p, 0$0PP 3 !!$ !0pp1p pТ@00C\ 0  "!0 00 2C&  0 "!0\"0 RUx  R?2@ 0(00л$@0@0C\ 0  "!0 00 1C&  0 "!0!0 RS$ R 1 0+10 ,p(p0<2  $•0 02  $•0 0nHcܹc$Zcc0 -5L 0-@LL0@Pἓ000,  0 -,3LM 3p@`4P0 P2B'0 0C\ 0  "!0 00 2C&  0 "!0d"0 R=D2Tz<2Td*42TP ,2T A? = S+ =@S @Ƞ !0L8#  @ 8!C801   2  $—0 0 TD1  2  $—00 0@ Y505%@ 0 R ᵯ4P5@xϰ`0T X0T,0 0߳cܹccc02i 1i i i 5i 6i( 0-t0@0Pt0L4 1S00h -4@LMpPE 0U0z5 =5— (0—08 #8 X2  (0B08 #8 X—0  XB0  \—0  \P?`,P84BT (0S2$24`VPZ WP`(P4GT (0S2$24`VPZ  i8(w,ꦡt 4= -L$M0@ 7G3"pR 3R 2R  Zg @χ0 ,K @@ 忝P@S7 χ0 0K @@嬝PL278 04K P (—, 720 4$ @14 p (P0T kt2, X  `   @  P< 8   0  0  0  80< _07T0`0R N: -LMP6΅O 8壟 0 ➟\3 # 00 3#3/ @ +D(8<$X…@ąÅxP'"0BS񟗛xxHx 0K c *2[ ""L22RD02z"02=?0?m ` 0U Pg!P02>M0 @p 0D PR44P@9.P:Px3 ~O N@1`Ncs᢫,ؾ=PQ5<2S 050 4 0ᣌ$2Se幾귾e b y嫾⧾0 02>0X0u? R0 06#00S00&0,. 0-PL; 0 SD0S6<l 00/00@C00 06Sx0 h0 T T006S  0ͻ 00 00 -L\MSC 0S`l d h pt  0SĖ?0` K@0 @ @ 0 PĖ0` d P@`<3( QŖtT\lP h@ Yp #\m ,0p@r`000 2 !PUPt p0`0p0 p(0 \ŖŖ\l"htT00"h0b0`00d t `00Ė(0S-040TĖ(0S Q 2Q!!0\2 S dC> RhX $0 (` $0 (0,0 \0KJ @T*1\K h0S0@h0  p4 t r P T K4 0 00 UPT :{4l0$`tĆ474$04$0`44 044704|~88 - 2L@1\`! ,0᳠ X Up p42 0!X \(P"x U_P0 "@`^T \pc̆@0  m鮚88t~ 0- @P0L00P0P0C& R 00#!p000 \0C& T 0 "!00 0 R00hW5cܹccc0 -C> RL  + 0B>>Q P4$0bS4% -LM 2@h2\``" , 2–@\P<"C.,U  2" rR  , 2"䁟QR@  ,T 2!, 2@!,T 2|!,P 2+, "@0+\ 2"R  5\ 2"R  5\ "5 \ "5 \ "0+\ 2 ,\@0 88844(4 404 0- 2LP,,0@% 0 000 ,\0 -LM2 S, `0pZ ATP @ ˯K `0S5`<5V P T`@V*K 0(2S ,0S ,嚛 2,, 2@0,\Y7?   2,, 2@0,\ 2,,? @  2@0,\*7 b p- 1LMQ `0@00D 00 R 5@.f0@ܘ`00C& R 00#!000 l0C& d 0 "!0@ 0 Rpph3 cܹc`cc0 p-LM 2@ , 0`1 B^P\C. p0S 0 2b3c!044#0d [0phu2-0CS 2, "6-\ Q0 C>d [,. 0-@L6‘ 0P|5=50h 0-6N 0PL  ?2..0"0  l0,  P0 / P,2 0CS020з -LM6 p  P^ χ0џOP @PjPj2S"@ 0  0CS@@'T`χ50O:^ P@ P`GP(+2tS* 0,K P@ ,$ P0, p (P fbU ][ 0  `d χ0O_P@ P`P $ <(1HXt 0-PQL@l3"3SS3SS 3SSS0D3H#L3P#T3X#, 0-LM_@!04#P,7B&PA1Q20CS, 2*,).0?;C0C ?; 8c0 2].BS B-> 00 * 0 30"_Pl0鼶0 Kb1[01K![[` p-@LM XvT1T!0P5 H1H!0 2 0 0p 0& 0L” \<0 0 ~#&0 -1LM @R2S a0S 1  4TU+ U 0S44044_"pK  52[:2K"[ 0S4TP !P2[<2K"["K  2[S  2[S  2[  :2K"[ 44 0R44 P P2[<2K"[o, -LMhÐPp  p 0` P@N 000p p *,P@80 04P@&hØ0  0P@` x  80 00 00 00 4^0 X SH 0-LM@PT \ (0 S  $  8 00 000$0 (@ 0-LP@L jP 0 0~ p-LMh3@4PP4` p 0HT tTxTp~| -# Lp0ß^XD" 2,P\ 2pŸ^`" 6:\ 2"RB.+0\ 2˜@t2\l" 0\ 2˜@\H" 0C.\2S:S$ S 20CS  " 0A.\ 2˜@\!-84\QV0AS5Q " Q10?:+\84 $S4$4 2-, 2 0-\ 2-, 2 0-\ 2-, 2$0-\ 2-, 2$" "<4< \~8(8$888 p 8,8 p-LMPP 0` @V 0`S0x 00@VP4S04pj044$4~0@- @QA 2 <0 H4S0& tTpH40Ĕ0"00!00 0 0H4S20 S 420x0 P UP B tT0(000 <0( H4S00000 |~ -1LM `R07 TĐxD(0$pSqRG 0 0@S,1p T@R 0qTĖ(0S xD0X ڴ5;5 X0 0 X 050峀X $0 (p00p04$4X $0 (~| -RL MP`8 $0 0 "3R)ĚAp 0 P`P,0$@ "Ě(0S $0  (PrP2@ 00<0tPP (2 !!$ !0``1` `@00C\ 0  "!0 00 1C&  0 "!0!0 RQUJ H1@ 0X002$@0@0C\ 0  "!0 00 0C&  0 "!0 0 R$ R 1 0+10 ,`(`T :HH!6@ 24? .( *3,&(![ 0 SPK 1[  [p @Q> 0A @>-: 0p01K![t <@8#X N[/q!y012 s=:CSdghgghggg h hgg h h4hh,hh,hhh4h4h4hh$h$hgg,h4hgggggggP@}  P@v1[:1K![ -P@l![0*0Q!K1[: Q1[: 1[:1KP@Rk: 0-LM1@S[ 0S 08"PPK jP1[:1K![P0 , 5 \ LPP1[|01K![P` 9P1[D;1K![P( *P1[ 01K![PPKU P1[01K![U !K![P P1[ `0R1K R1[ 0 1[`01K1[ 0R1K1[01K![xPs Poj40R 0-LM1@S 0PK P;1[;1K![` !KQCꌃ1[ 01K1[ 0R1K1[01K![@Pt0S P1[t p0R1K 1[<1K![,!K![%P0p P0R1[<1K![+!K![P 01[`01[@0 A -LM<@/0<,R/0< 0S<0< P  KcP1[<1K![P0S01P -LM0@SwP Q HPP -LM0P0CS!rP@  K3P@2[?02K"[`P@P@0SN 0SSD SB S: S2 0S) |P@ `pK @T @T 1[$ 08#h VP@P@ FP@P@ }P@ Q>Q.2KP@ 0-8LM 3Q01K@PA. 00, ?0 0A.\< KPU1[1[;;1K![0 -0LM 1K@P0A. 0, ?00A.\8 KVP0 1[;1K![00 -LM K@AP? 0SI  K 8P 1[>1K1[![ 01K1[,@01K1[!K01K1[<1K 1[<1K(0SPĉĉ1[;1K![P  0S ![ P1[;1K![+!K1[;K -L M0@(@ `,P" K[P@2^02[ :2KRR2[2[<<2K0BPPS"[2[*"K2[=Ã@0Ó\\Ń2K 0 \ 0SS S &K P@ 2[:2K"[*"K"[(P@"[!P@0S5 BKP$pK @T }@Tx2[}0E8#X 0SSn P2[| e@T \^0EP@8V#X 0S S  ULP@2[ 02KR2[2[002K2[02K"[UP@  0P@2[p02K"[P@{ P@t2[;2K"[P@j00CS0S0SkP@ ]P@SU&K P@G2[02K"[@ "K"[qP@H &K P@12[`02K"[^P2[@92K1꠆ 0-0@LTP+?@@@, 9:6+\0 ,0 0-LM0PS00 , K@KPM1[ @@1[9 SL  SL 0 \0 -LM0@ ,(0SDP\0S0 \ 0-LM @0BS0SR 0SP R0S0PK +P %P1[   KP KP![  1[  |0S 0(0K KoP1[S(P; S ; S |0SS 1S 01[; S1[; S0 -LM0pP ,0` ,@0DST1ST| TP 0DS@ 6T 0^/,P' 0-,@0 3@1T0^/,P0 , @ 0^/\ @0 \@00S00 01^/\0 ,0A`0 \P` 7 S&pK 9P` 2P`{2[ A00CSv R0SORK *0S?IP`\1S (K* KsP`R2[S 1S~ 0,,0 0,\@ aT 1Sh 0 1,,0 0,\U*P` 0 \*0 , 0 \0 0\ 0-,@pT0S01 -LM0@S?`p0F00 PU 0S 0S 0SP0S0S P0S "K ]P2[P  SP dR R2[@002[  0 ,?@d0 000 p-LMP-@`K %\ \0 1[ Z0D8#Hp p順 -LM 0@6 \0 , h9 -LM 0@6 \0 , h! -LM@8 #80CpP S,U  `K 0 066 0 0  0\0 , P -LM0`@ ,pK 60' \0 ,vP8#hm0 ,0 0 `w0PUXm -LMh0!XS@`+d0S& Pp 0,0 ``V V 0( 0\ii\[ 0-h0SL@!Xd0S0hP0@ , 0 \0h\[ -0LSP`= P5 0SS& S$ S p 5@pW0SW((**P@ V("(P@ 0 , p-QLM@`P.0S0(6 \@20 ,@?Tpp ; 0 p -0(SLP`"= P5 0SS& S$ S p 5@,pW0SW((**P@ V("(P@ 0 , p-(LMQ@"hP*0S0(B6 \@K0 ,@ Tpp 9280 p -LM0S@ P! px8`8V04 \ 04 ,0p, -LM@08P `#x ?88PP04 \h0, -LPP@ 0SwSj p P@_0 , 1` \0 ,0 Sd 0 \0 ,0 S.}0 S S P@ 60S  0S@0,, <4<,\Q 0 ,p0 ,0L@0 \0 ,D'0@0 \0 ,' -LM@P 0 0CS갦5P  00CS KP1[91K![+P -LM 0@S` pK0., H0.\ |![p, Xs1[<P 0, 1 \`a p-LM8Q@U p`K N J1[)  C0SP ;0S1[0 `u U0., H0.\pppS` 0-LM @0BSP!0 0p 0R0 0 KP 01[8p0> KP[p 0 BptR(8xp 0RPPUPp t0p l0p T00p P0p H0p@0@ Q<0PQ4 PQPQP A0 A A A A0  -LM 0S@  !P0  0P  0 p-L M 0 00@KP!P p1[`K0 lP1[);5 R0   ]P1[*:6B& 0K K6P2[![002SPS0nS0S000 p-LM 0`K 0 @P.P ![0C2 S"0K!K 1[ 0P1[ 0C3 0p P p-LM0`K 0@ PP p1[K 03 0 P1[0 P[@0)C3 R0 0S=3 0 P1[*:6B& 0 P1[0 p-0LM0000 00000@SP#`K P p P1[ 0SS S S Vp pp0 S0SS0 0 -LM0` ,0p0C8@S00008888HHx@00@00000 020 0 R 0 S;52K"[ 020@00"0KP2[;C52K"[R0  0000200<@000000000  0 0000 000000 0000 000000000kP00;00v 0\0 0000 000000 00 0P ,00;PP00S`  000P U00.89)9)00b6#1&$ 0] -LM0@00  \0 ,h -LM0@00  \0 ,h -LM0ȠP ,Ƞ`H0L |4,808@S$ 0- S* $PK$00$0 $  $0\0 ,p$0 0$0  \0$0 -LM0@ Ƞ P<,@ T$ `*$pK8#Hh0 ,0`0@$0 qV: -L`P8p@k0 ,0PS S%@T T 0P0 \0P0 \0P0 \0@P0 \0 ,30#P0@P0 \y0 ,30#0@T0#02SP  p-LM0@ ,80PS8`' S p0P0 \0 ,P 0 \0 ,ph0P0 \0 , P0 \0 ,n P0 \0 ,P 0-0LP ,80@S @ S  0@@S 00h\@0\ @0 \0 , @0 \0 , @@0\ 0-L@P#:0 08#X0U 0U0 -8`L!H(\P"xW00 dW0S Pf 0SR 0SI S S _X*  !60X:P!0TSQ   !X* 4 <X0: 0mC 0@P 0S H0S0S P -(p"LM WP!`*1@ 0 \JPㆀp` @ 0, V : -LMȠ(,"`uPP%Up:0 @AH@pPPH 0\PPW: , -LM`p`P@U00 < ,0@T:順, -LQ Q  0,7P -LM@PT`, pKT @0 08P#H 1[?T08#h0V 0[@@ 0Kk#P@pK0 1[ @0# 1[[SɌ# 0KI꺺 p-0LMP1K@`K0 m08P#H.1[![>T01K[ 0K a c? #P80S S p0 , : \p麺' -8L!H(\`"Xp&U   dU R R! 8 R P80S  0@T 0X@ h h' (-"@TLP!x8`:P6 0WSQ   !T*0 "! 08#HP T:T: -LM8p Ƞ,Ƞ H.P ` B("(V$+*  !0 @0 ,02P08#HTT {08#hV:  ("(~  B("(w -LM0S`)K*K+K|S8 S 0S 0 ,% 0140 0 40'0<0 p凁00 P@\+ KO 0 P@) Kjd40) [q@Y* K[4 W0*0[=#=*0K* [^PZp00 00 W:Z 800 S80 Z <* K4*0[<@0*0K* [;0 ' Y3P0)0Kd40) [% 0#4+ K*0KYd 0 04 00 }0!, p0 ,@ ptW:W < S  7 p\W:W0<0 ,@ pPW:0,0\꠆< p-LM@K0 `PU\0  [ ȠIP0![00 p p-LMP@`K0 408P#H, [T 1[#4000C S @08#H T p0 ,00#0p - @L> pR0 RpPU `3)*0R1+@ 0\0 , 0S;@0 0\0 P,U` 5:1Spp -LMP, P Ppd W11@`2**0P1+@ 0\0 , 0S;@0 0\0@ , T`5:P` `@T*0P1R,,0\0@ ,T5:@ T*,` W0 *p@ T`:;1SJ0 S4\0 1" 0 2" \  \00  12\ 0 3"\ 0 -LM 2R@PP0RqR,,, 0Rh 0RR,,0\0 , 0PE!R,, 0SR,,0\0 , 0S!R,,0 -`0P4L@8UDp:U)U' A0U!+@ 0\0 ,0!S +@ 0\0 ,41S -LM@PP` P 0P0V,,0\0 , 0pA!V,, 0S0V,,0\0 , 0S!V,,0\0 , -PPL`p P @0TP1V,,0\0@ ,T;!( 0r` p-LM0@Sp0,,0K PMQ![C (1RRQ!18 1K`P1^3 @R <<<0!2200@S 0!22008#Q0!220!2200 (0![R 0p!F -LM0@0C Stttt P <  P0S S  0,\0,, 000 0-0L S0S@ @ P08#Ƞ>10S (AR 0,\0 -LM0@0C Shhhh00000,(P 0S 0,\ 0-0L@ ,0PS:S%S  R 0S R  0 \0 0,' WU0SW 0-0L@ ,0PS:S$S  R 0S R  0 \0 0,& W0SWU -LM0@),0 x(,0 \(,0 @(,0 $(,0 (,0 ',0 ',0 ',0 ',0 |',0 `',0 D',0 (',0  ',0 &,0 S/ 0&,0 &,0 &,0 t&,0 X&,0 <&, 0,&,0 &,0 %,0 %,0 %,0 %,0 x%,0 \%,0 @%,0 $%,0 %,0 $,0 $,0 $,0 $,0 |$,0 `$,0 D$,0 ($,0 S/ 0 $,0 #,0 #,0 #,0 #,0 t#, 0d#,0 <#,0 S0#,0 ",0 ",0 ",0 ",0 ",0 S0h",0 @",0 $",0 S0A,,0 !,0 S 0!,0 !,0 |!,0 `!,0 D!,0 (!,0  !, d@@@@@ @(@0@8@@@H@L@P@T@X@\@`@d@h@l@p@t@x@|@@@@@@@@@@@@@@@@@@@@@@@@@@ @4@<@@@@@@$AAA AAAA A -$QL0T  (Q(P ,\X -$1LS   S\-0\,1 *\=<0 <<L \,1S \ 0<,1 \XG-`0M@O0L 0P 0  @P@ P(P,PP00 ^`@0@00 `P0@ Rf  0P@ 0\K @\A \4 \! h1\ X1\ P1\ 0Ѝ0P@ @0pW P@0`PU` ` P `@0 P J0S(1S 0@0S0 -LM0@0CSX@@XX00040,00 ,-0 R4 Q 9 S0 S00 ,00000 S0 00Q00 00 ,04 0 004 0 0-0l@ LP0 \0@ ,0 -0l@`L P0p  \0@  0\ -PLM8 PP 0Sp Sr S> SS 4K Ip@040C* K08Pd`#H2[Ġ0L8oS  0Q 1P8 T#X 000c8X ER 8004K `@0* K08P#H2[0A 8}S XV`!TU0f8@!#X Y7#X,! 0AS008  * KP2[0Sxl<08 0|<s0s00* KuPn2[=3S񟗡(202P0Pn0n00.AD@&A𫪪D? p-LM 0@SSP) SS S S p K>P1[<C40`K 3P![9 S0 (P1[x    KP1[00 -LM @RR R R00R0SR 0 KP1[ 02  KP1[? -LM4`KP@ . 0S T0S4 X0S h( KP@L VP@4 -MP@* FP@3,?P@"[6P@X ( KP@ &P@t-P@&Kp @T#2[92K"[)"K"[08P@#X3,P@"[P@00*K, KP@2[S{6K8 K5P@u0S/ X\n3[1Sk&K  p=P@`bz  208P@#&0[pWWd`X:K0X0i P@B 3[1S&Kp @T2[92K"[08P@#X006A[/ N5 -LM@Q 0S0K HP1[L'S  R  dP ^P p-LM @0BRS`Pp0 S S S  KPVI0 S S; S/ 1[01K![0P0S S p KP1[01K![P p KP1[01K![ P p0P0.\1[01K![P p<S/S S0 S S$ S 1[01K![P KNP1[01K![P0P0.\1[01K![P p0.,Pq K"Pl p p-LM0@ S`PpSi  KPV<0S/ 1[01K![P0S S p KP1[01K![vP p KP1[01K![fP p0P0.\0S 1[01K![OP KP1[01K![@P0P0.\0.,P 0-LM0 S@!K S 0 KP 0 PPK ~P1[<1K![P P iP1[;1K![P![ p-LM`P@0!, ,0@T:p 0-0LP,,@ 0,,0 l0@ T T 0 0 -(LM8" , 0 #Pp 1 R Z,`K)C 0b8#Z4 *@ 0  8#H T 0 0 !,0"+\08#Z:40S @4 T04'070 8#H T 0 0 !"+,0\0  @0 !8 "+,Z,  0  8#H T 0 080"+,0\0j0c 8(#" p-LMP0`0@0D 8#H T0a0@ 1!"+\0 ,08#HT:p -LM0@,, 0,\ -LM0@D ,0 S P RT[ p-L MH @0$H 0K KP!K!K`AK\ 0 pK\ K~\PP *0 0R:0` -L@0SP``0SP <0pR` `W0 IAMT p-LM\0PSp0 ,8S@ p`V P0P ,0@0 @,T p XT[0[ -LM PP@ !P@ P@`pK z@T Ss@THN1[0S 0F8#h  P@ P@,P@ P@ P@`  5@T .@T4 1[j0F8#h@BP -LM40 S@ 0, 0 \ -LM40 S@ 0, 0 \ 0-40LSP2N 00 ,0d @T 0T 0-0L0CSP @0 ,0 @T0T 0S 0a p-LM0@SdPg:SS |p0 ,gg0D ,0PUpU' 0-`0LS@00S( 3P 0 ,0 0l \0\ , 2PU 0U 0!P P[ -LM`0X S@0,0S  0 \P[ 0-0#SLP@ 0T00< ,0 A@TTP[ -LM0H S@ 0, 0 \P[ -LQh 0 Q\ 7 0,00,@ T[ X -0LS:S< S 0,T[ 0-40LS@P1 S 0U[,?0Q[,\0 , 8 \0, ?00[,\40 0-0LS@dP 00,,0 0,\0,, PU0U -LM0,S@ 0, 0,\ -LM 0@S K0 0S1[<1K![0 -LM 0@S K0 0S1[<1K![w0 -L M`K @ȠH 00 <4, 0 ႐kP@" PP*Q0* K 0pS0  P@0[008#X U:r -(L!x"h@9PP0S P*P0 S 0P0 :LP -LM0P (@ p`0 8@#8 X  0 (@ 0` }VW  08#8 Xp 08#8 Xp -LM0` p( 008#8 PX0 (0@PNU:0S -pBS00W0LMSP@`Q$ 5430:-hP@ -0( @ 0 0 X0  0\}P@  0(0` S0 ,X00 X -BLM8Z`P#x@4bWQ$ 5430:P@ 80(0 @ 00 X0  0\V0 0\}'P@ 0(0 S -L0KM@c 6P0[0 -LM@ p`do P%K %0[ S c Pd\cUdU 0 m0 8#8 f -L M0, P (0<@00  S: S 800 p W3`cP@ ,0( 008#8 X,0 c#@$4 0\tP@ 0S00p` W@0( X@B 0-LM 0PKS@  00S1[<#1K![0S ~0S1[:1K![ -PLMU`!p&**K@ 0@PH$HU,0K PUPU ["[%P 08#x W: p-LM 0`S p0( ,@) P0 ,PLd_1UT 0 ,0L0 \0,,@ p0d ,X%X@ 0,,$@! qP$ 8 #8S 08 ,( #P 08S0R,8 S ((0"(R,8S(0!S` -L M p0 4 `  X  P   @ , < 0  dY}  0 0  ,0  00<  -L M0 p`P< , %΅ (K 0 YP } 0,K P,$ @6, P (P0 T|(@L&L$8#8Sy 'm$($6"(Ra 6R 6R6 R $ !"(|0,P2L( 5 Sc %5 QQR 5QO QM QK X ? Rt5    P5Ox0 SS& SS ? RR 0B RSR4  iz$0S00 z , 4P292 @ 01 @ 0 H$?"? 4 l"y$ 8S Su"/ ?l"y3R$ 3Rd3 S Z" -?"  1Pt TP3ŗo2 < 0/2$,3 S1 $3 S # 8SS %0D S2:22/ < 02$2 SF2 yp 0$$  @0$ ` (P T `%y4P0 p@< `4yT $y yp`|1H$$ 8#8S0!S" -@0MLP4K8K`0 P@ @@UP,/408 4538%00 5@ŅR> H0 w 0 0 $5(%0( 0%J0$p,50%  Ȁ0 P tx@ŕ<0K0K00p p D,P@ŕ=0 0 <  D04Pq@ŕ= 0D0p  0 P^@ŕLH%D0 PO 0@K Ppx) 0@$ `@T1@` (P< T $]xZx (50(5PxT KxIx@5L$@5L@5LD 8@5 < 0@5D l)x \$x Lx <x`-`1H0` -45 L8!$ -LM4E 80 T -458L $  -LM4Ő@80@ \0P5 -L M45`8T DuTU,@X5PS+l4 458 $4ŖP8 $4Ŗ008 PT$45@8 $@00 wU 0U}458 $4Ŗ@8 $4Ŗ00@88 D$H4ŖU008@ \@Ŗ(0S= $X5Xpj 458 $p0WXu `00g0\%000458 $45P8 $45@88 $P0@0 %w(0 L1 (@Ŗ(0S U  $0  (@Ŗ458 $Z4ŖU800@ \@458T , @ TZ\5_458 $Zm458T ,@ c458 $; 08 v4v4ŖU800@ \P4ŖU00@ 8\0v@5$ܒ(D -L M`4E8ŖSP00p @ D\\u`0TUX5P: 00 0 @Ŗ0B??0 0  P@  ev4Ŗ80D \,@4Uʠ,ʠ(p8He 0H @l\W@8 G0 R0 p -LMX5PSDeTuL5 @E (0S W$0(@E(0S  (01(4ŕ,08X \4EW008@ \4ŕW008@ \0P5 -LMT54Ő@S008@ \@%D$0P5 -458L@ ,$0(#00"(R 0Q0Q3C -LM@u h^H$6 0-LM$@KP (($ $ 0  \0@``6 Q- Lu -LMRPP@0p @zCP` 0  W zu C -LcMq0P@$0 0@@R00}/#\B1\uTTT Su0P0 $0S h$WXFuTa0S0D!0000iK1 0@00 @`0`2S+u@4 0P$@X0S 008 R 0  0S0 00C0^t8&00X 80P0Ht 8t0P0 b(` H_=p98X p-LM0P\^ @L |0|@%Ql`lPll l0^ pP%P <t8r0t,`-<P`c=`x p-0@LM P0000S000 00`OP00C& R 00#!t000 `0C& X 0 "!04 0 Rpphcܹcccc0@- 000 R R 000  0  @00C& R 00#!t000 `0C& X 0 "!04 0 R@Fܹccccc0 p-LM0P\2S `0S @ 0 @iM0\2S 0S ? ]00\"R P0Sx@002c1 T HMP0S , 00C00O@L@+O$` -\1\LM 0H0DDq0P@ 0T0! ? Q00!00 00P00CQ` 0 "!000 0C&  0 "!l0|  Q  80 0P00@L@Tcܹcccc0 Q- Lis 88#$R\\ 0R01SP0SQ 00$`<`ȼc - 8LcM‑8#P, @F0 SBHaH1p  P kK -0S! 0#PzLPP @p00C\ 0  "!0 00 0C&  0 "!0 0 RU ,0 S T,zU  @P bܹcc`$cc0, 88#P0 $`ȼc -L Ƞ Ƞ,4MP@p <2 QPPy(2Q 2Q 0ό1Q 0B~S001<P   0 d0T N  VS00< R V P0KH0 @0KP T TD 0 ,p L` 8` 4 (00S 00<1 P0T0 V 00S X (TH Kx?T H Ks?PT H0Q @0QQ(0$0p<`UU@Ut}f~fȼc 88# P-L=@0P  A p 0 R p)`P00C\ 0  "!0 00 0C& x 0 "!0T 0 R\ ,勆ܹcc `cc0c@-0@ 00Q000 0 S0  0S00@00C\ 0  "!t0 00 `0C& X 0 "!04 0 R@ܹccccc00 R=  0 ` -1Ls 88 #4 S@pP`0 1P0 0`000S( `P00C& R 00#!000 0C&  0 "!0p 0 Rpph 000 00 00p=ܹcccc0 p-LMQ@@P Q pTP P0S \ R 0`S aX\ `1PS 0-LbMP@0 @S0 4P0-L0S600`"R 0fK1 0 S t!R00 0`20JH0@ 2c 1HP vo? blx 000d` 00C0d` -LM  -LMPp^@`   0S & 0S ^ 0S K0P  0R 0 0 0 0 0 00  -LMp $0K`PP@0 $PP @ @` $>$0 $P$0( 4$ P@0 $$0($0 0- 0 0CSL@ 0P U R 0 0 0 00C00  $Pe[% 0 -LM0p$0 PR<D0 `20#0V00Sw10#0V00S D00%0 00S] 00P@D0H1 T A!` 000$ R 0h1`!0\QG$0S Dq`00C\ 0  "!0 00 0C&  0 "!0 0 R` 00 D00D00  ᗂ0 00 P@D00D0y$8lܹcc=cc0101Q 0-80@ 0$ u@@00C\p 0  "!0 00 0C&  0 "!0 0 RW,K 0 u,P,|oܹcccc0 -LLM02c10 @ @0@Shfx`B -LM@M 04 P*0S 0P: -cLßM @PU@p ࢟0Sy (PUR00C\ 0  "!0 00 |2C& t 0 "!0P"0 RN0e PPE 0 `@p 0@  0,P/ 04P00 0 P 0PP 8 0e/0S: 0S:( @R,0,0,0 00 C B\  0!! x 0d C6000 "!08 0 Rܹcp`ccc0t`A-0@P 0 00R( 0Ȁ(,,P0p`0 C \  00#!x0 00 d0C& \ 0 "!08 0 RAcܹcp`ct`c0 -LM@R@\dll2lR p@0T00 0 R} @T(0K@ P`) Bp00C\ 0  "!0 00 1C&  0 "!0!0 RY(0dx$@(0 @00@S00  Q@ @00   R 0 0 0@ p00C\ 0  "!0 00 0C&  0 "!0x 0 RT EP 0`$0ܹccx`cc0A- $0SQA;0  0 0 00R 0p p @0 `0C& R 00#!|000 h0C& ` 0 "!0< 0 RAAcܹcx`cc0 P-0L 0 d@T\a1 1DQ@T XcXCXT#00LßQD  [\ 0S 00B0S S3  L\J\X 0f P` 2X  0S00S 0S  ` K`P ` `P L 00S 8 \V f0X0f840` pPP` 800B0S Sf Pd P010  P 0S}?d0000dB0S0 S`\ X @ 0T4`090 IP@T* 0 [  [01 0CĠ UKV0K3 bHн..dxx-----.0.L.(h... -L MX p, 90S 0S,`0Vʆ0AP P , `0VX 0 DXZ  P X0S  0S<  3 K P  T+[ aP 0  0 00  `PP    [ ~ [  q l d 0SS00D Z4 Z0 /$/L/|/// -00QLX0 Q S R 1 e!\:0> 0C0 n>S -LhM ` PPpK $P@ < R RXp0 SD0Sl -LM 0@S  P 0St0  0S   -LBM p0004p`PD@tX0 \XI b0@0X0 @T@0s 3@R{ CKA A Bf0h0C.K BP B180@T<@P @W8  ~W0S S}A}0T@4 x f@ $ P< } @$Pk~Sj 0  @G0kP 0 S 00SX 0@TCXV00S@  4LHT0jl0Ȱ00``%`000 p-LlM0 d0 @P`KP d0T@p -QLM@ W0SW1 1 -LM 0@~  ^ 0 S 0000 p-QLMP` Q pd@V*h0!@RT:0p0t?d` -P80PLp0p\Pd` V@*h 1S@ T:0 >h 01d`f= N 0-LM@P0K  !T TdD P00C0 Q *h0\ 500  <sV08z001\00` -LM5 `0P\ 5 l00Sl0 H0S f @D4PD $ H@80 @ (P@p"0^P< p X0s  4XL0P@p0LPP 0GPT L p=8;Df 50@050Pl@P8@L@TP>T@;P@頲 0-50L0@ 050l PBUlPPPTPLP8PDP0f} DP88PLLP  -LM4p^@` 00 4`o 40P 0j004 40@E  -LlM 4@T`pK$ P 0 04P $0S $$8@KPi4@K bL1 -LM4@04 0 -LML P @0 @TK@@d1 -L M@K K 0P -1LM<0` 0 0@40PP h/U0 0p0i0E/3040QP 0CS6 #P111s- P0U1S,0 0 Y$0 (P @ =5 F9500` ,K0;|t E1<0SS!0@S0010<x1̼cs`Hutxt -QLM@CϠ m? R  0S T @ hJ Q0- L@P Q 0|1Sm?@D= p-LM1 S@P\`|P50p<`}TE 0 1̼c -0 RL`p@ @*PX@ P 0p000 @WP:!hE? R 1S 1S 1S m$>FO4\ u4mv4>FO4 g400BaꐼQ -L(M0PS`| LpX @ W*0@ 0SLK S <00p0 T:!PjP @T*0P\i@T:@T*0\O@T:L0W> P>Q1 P @ LK0|  @ET8A00C\ 0  "!0 00 0C&  0 "!0 0 Rc LKgqQ*0P \ Q:0LKpQ*0 \ Q:0,LK pܹcccc0 -LMm? R`1S  K` T!R\13 0K <\ 0[D!2 0K HQ 0[P!2 0K K0`0 Q-L H0Q 00(0Q`1 W@W@ W -0PLPp@0S' p+0\1c?@L`c alg 00@W0@m0045\R00daha1 p-LM00P@K4U` 0 000000p 00C& R 00#!000 p0C& h 0 "!0D 0 R 00C0ܹccdacc0 0 ̼c -L|M`K0 K pK@X:PP< @0S<6[S4 t0S 8\X 80Kp[Ƞ 80S4^00 1S80KḀ@40Oφh Pg40RφL P_40Uφ0 PW02H2\2x222 0- LP@0RPP 0 P 0S 000CSPPP 00 -LMP`@Q Q000 4 080P@XY\` 0X0 Y 0\0 ` 0S4XPp X0S0S S0 X0Y R 00CS񟗩4LLDL0 Y0X0S S0BS #0QT 0S0@T<0S~ =Q{ X Ru R00e 4D0 P iM4<@0 PX0SI 00p@rPp @TZX 0S/ 6S, 0S' S|2Y T00BSPPP0 im,%Q  QQ1P X S4>H0 P P= x iP>0S4P 0 S00S=  X0S 0@Tf 00S> 00S<  iPPJ a > < : 8 6S(0Y0 00S PS 00Hн22x222 383T30"t3x33 -L`p@P@PRPU@ZDAD!P 000  BR qP00C\ 0  "!0 00 0C&  0 "!0 0 RAT P0X1 *0 ~ O8S@pܹcccc0 -QL1  Q S 0S 8 -L`p@PPPU@Z@P`@PPU@Z@`-p -LM0@S  1S01 1S$P P1 010C1P1 M3 -LM`pP @ 0TP@@ Ƞ,Ƞ 0000 R P@@= -LM@PP`  h0!T` 00040 R Pࠁࠓ=Y0S 0r0Ss 0Rr0 R0S0w00ZR0S 0{ z0 0$S$0 -LMP@U`1p @^0<0L00MQ0PNPOPRPSP L0 -L ML0Xp 0 8@8P`DD!LMNORPPQ@S`j -L MP0pN=U``GGGL0 0 10S U0d0e B0C f0g 0S0)0K h 0C4i0 j k000nmo@lp)PK)0[s@p0qr^  ,c 0P00p000 0 0PPEDd 0 P@00 0S Ax`= p-L M0PS@- 0BS,< T 0R0P RA R*R# T00CS000@  0PPpph90\# SN b 0 T T 0Q0ph bD 0@@@ 0@ T R 0\`@ `@48" <S^  hi0jk 480T9 -LM0p5`,? <5 ??\ !?@?\ RU@ P5<5% ?@+;;1D"  T0S +;;!D0U@P5T -L M?@ \K @0 0K 00KKKKKKK"P ~>6 -LM 0S4 0 0P 00H` -L MPp`@W> S> P R!2 `2/`2/t2/2rr, KpP D.>,@$0PT,Pv 0 Sj00S0" ^0@T(@KQ!`000* >~ cR1!0@5 t1t!0 X 0pSB* !818  `0`0C\ 0  "!0 00 0C&  0 "!0 0 R  ظ00S4"00S,"  T=Hн6* *6ܹcc7&"\)cc0t9 -LM@(  0 qS0P9 1` 000%@3*P00`00C& R 00#!000 |0C& t 0 "!0P 0 R  `ܹcccc0Q Q? -RLM`P P$ ; 0 0y PDrD2@ 00003PP 2 !!$ !0``1` `衟@00C\ 0  "!0 00 1C&  0 "!0t!0 ROUI <1@ 0L00f3$@0@0C\ 0  "!0 00 0C&  0 "!0 0 R$ R 1 0+10 ,`(`: -LM@? R5+Q P 5;5Q 0S010C1<P5 ;%5 E -L M0`5P@ 阁1p @~0 @/ 005  00 @ <7PA 7P; R42S- 5@@05%+%p00C\ 0  "!0 00 0C&  0 "!0d 0 R i鯭P (@p0(2ܹcc7cc08 p-LM@? ?  PP?  &nPP ̠4 L Pp L2p T;P8p8 -@?`LPPpTT2 H2 \ 82\k*02\[ (2\* pB0 0C\ 0  "!0 00 1C&  0 "!0!0 R%$ = S =@S @ 8C8p@2%@2  ?  @2 ?  @ 5050 R0{A 0l4Pp5@pC0 P0\D0P\}ܹcc2i 1i i i cc0i  -L MP0/@ qTo t00t01 0$K000 $ 1S'@00C& R 00#!x000 d0C& \ 0 "!08 0 R e ܹcccc0 -0 5P=5U@4LPP8P7<Pl`PpPdPX`PpPPPHPrjXbBdrjlbP <"P0<2w 0q 0P 8 P082a x0[ d0P 4P4RL ,0F 08888909 -L M`$ piP@ V Q0 00 P`0 00 0 KPP 0S0 |P ! 0 0 @ 0p c -L M0@S K K 0 ` Q-LpP 0S00@T 0a DP@ 0T p-PLM@` <$0TA,!<0 ph00;;; - QL MpPr<0Sl8P@e 00K4 K400 ,0K( KP` (04@KP  @#P@B 001< 000p R+ A0 0C\ 0  "!0 00 0C&  0 "!0 0 R'̪04`0 0lpp@4(00 ܹcccc0 0- PRL R1<@T  0?0  ?0p0Sl0 0 0-0LS@P0Pxx 00 S P <0 T  \0 0hCh 02`V_ԯ Q-LpPba0<@T[ t1R 0 DD!000p R0p00a<00C \ 0  "!0 00 0C&  0 "!0 0 R 00@x400   H.& cܹcccc08; 00sS0S  p-L M 0@  P`0 PN0S ``0 R pP0 R@@00S  R0 8404b``V_ -2LS`Pp@<0SP @  UtP,+P  Q- L[.P; -RLM@Pps)P`r T\PA.Wr @ 0@@@ @sP<p1p h1P).H#P H!.<0l@p04.,0 q00 84 0@X(T!t0@12c10 0!/B!0  500Q 00 0 h 0P0@T<+4+`;ch;c;H``x`z;; -LMd@P``p"00  0 0  0cd4b`c - (Lp(P"!$RO01SK RJ RF1<`VB @T$ p!20#p0 0lP!  0 Q0p0h 0P W 0 !,0 !, 00 0/T`0 X 0K<0 [p|`ejԯ+ -1 L R pk 1<`Ve @T 0S,h 12I 0 0 0 $H1 R 08!0 0P 1 1<0 $@0P  P0P0C\ 0  "!0 00 0C&  0 "!0\ 0 R@|`ԯؼcмcԼcܼcܹcccc0 -0LM`0 ^@ 7 1<@P 0@S h02@|`ԯ -0LM`0 ^@ 7 1<@P 0@S h02 @|`ԯ -080  QL 7 1<0Sx*|`; -L M@ ^ gp( ^$2`>00 0 000t2T+ H2T oH2T @2To00 R 080 400 PP 0 $0PP00S#P |1 1QP"P D1 H1QP" 0t + 0TP0Sx 0  0BSR 00 00S4 00{t 0S   00T (0TVWEWLWKW@DW@RW @QW PWQp (>!P00C\ 0  "!0 00 1C&  0 "!T1`  Qp0Hp0r  ,0 p0W 0   0 0z  r@P00C\ 0  "!X0 00 D0C& < 0 "!0|`ܹcccc0 0-0L 000p0P@  0p000C& R 00#!t000 `0C& X 0 "!04 0 R0鶣cܹccc00$ (0  -PLM 0 0 PfW P-L`@ 0PU R@B $ph02T@Dԯ p-LMpP!/ PU,  \ h 0 \2pd0,R 0 K P@@ ,`0h "0 T@Dpԯ -LM2"0!Q2@< 0Y -LM2@p( R U)1<`V W 2s 20 2ih'2 02p  lPp`i,'p' %;<,<P< -LM2@Pp5 q+ Q41<`V! U 2022 S04 0 R0|0@ #PP  hD'P0U2pP'%clx<<< q-LP@p Q1< R ß 3  p R l0U Ru)B00C\ 0  "!0 00 2C&  0 "!0p"0 RV2]0,b2R00C\ 0  "!0 00 1C&  0 "!0!0 R2p`V) l02 1<   1<  h$1<     0 2@00C\ 0  "!0 00 p0C& h 0 "!0D 0 Rˡܹcccc0 -p0LS Q R h$0 $  Q 1<0 S 00  p0 Sl  -qLMP`K QG<@TC $$"p000p T 0"0 00`<0`T 0`0 0Ap00C\ 0  "!0 00 1C& x 0 "!0T!0 RB !p000p R @ 0@mp P00R00S`@p00C\ 0  "!x0 00 d0C& \ 0 "!08 0 Rܹcc<cc0Qp 00 0-4PL0@S\00#P00c -dLM \L@0KK <P <P  ccc 0-d0L \0R@P 00$\ 800S04 ccc0 `c0  `cv -H0LMQ <\ 0 40@c Q-0L  pS0  A b00\p40 -LM0@ 00 R 0tS0S00Y -00L 0aS@4  P0t00 R00+R00p0P00C& R 00#!000 p0C& h 0 "!0D 0 R h00  ܹcccc0a 0-LM@P$KT 0 P  0@SQ0@SP  0 0@S  0>0 XW 0Ra R R P-L P ?#?00cSP{`{h{p{h^^P Q hQ h - PLM@`PA T9 T# ,q0@<\ 0 ?01 <0!! <0 <0 <0 <0 <0 02o@ 0(@"P00R00S0P 0200 RpP0 b`<Լc -LM0Pp 0崁p@6`6@D0S0ץ0CS`` p0  00CP0ҥ0CP0p 0l"!0pP 0 o: (0 p 00 0o` -LMܠHp0$H 400pP~6`b6 0p < P)$p 6 :w0 _6`C6P 0` 0-h0 !Xp0 L0  8#UP@008#HT` -!LM0, p 0庁@ 61 8C00C8#0 p04`0p0@6P5  0 P8  X#, R Z 0J  X` - LM0p 0帡5 J , 0 8p C04p@0`5P5  0J8 P #,0XY0I ` -8!LM`p0 P@510`00C8#8 4,0 5p z50P  00 p04`0p0@{5P _5 H0 !0 R8, Z#X0H` -TL M`p0  @JX35 0`8#84,0 C5p'50P   00 40 0Jp 4p 0`@%5P 5 \ 0I!48#00 R, X040S0C040 4` -LMܐHp0$H X0`404p4 0p 8%X h`#80A404p4  1@T@` -H!LM0  9p  4t  / x *|! r"0 @ P@rc -LM0@0LP7PP/P'pPtPxP|P0T h0|00x00t00p0000P00L0c -QLM@ :Q ,0@ 00hh -LM@L `0 ,0P04 <0H(0 8@D |0p d00 l\0 ` hX   B+0Q*L0 Q:D 0 0bS  0R 5P R 0 R 000C QT 00T0 -LM,@!0 !S`pP; \0P0S1 `0 X01`0Sa` 0T 3n\ L 02" T W 0"P00T 32aS,0000,0,0 0 ,0 -LQ%lllllllDPx lllllllllll($h R,0 B0,0 L^ T 10`S  AR*0S R:0T 30a b0CS  <,0 0,00X00R(0 S 00(0h4= 0A-L`p^Sg(  0    8888 HHH       Tȣ    <L     Xd  p               $$$   ,          LX            `lt@@( )p@@pp(0Ap0,0Ap,0 408<@@P< ,0@P `0Q0 X0E\ E0E EZ,0  0@ 0048<@@ 0Q`0 0E EX0E\ EZ,00,0,00c00L 00 D00cSP0BQ0 0S 0 0CR0T00T0000( k) p~ p|000t0X0q00\0l00%AQ ,8DP 0t 1` 0p 0x 0| 0 5Q0p 1`  -LM%A@5Q6|ȧЧا@A 0p 1`    6Q-L 0S R0  \Q-L 0Q 9Q;Q000 00 S0 0Ä0$Q   0 S!01000C0pQqQtQ 0SS0 0  p-LM3A@QܩT0S PU:4  0e P 00T0p00 0 PU:T0S0PS J  0  PUZPU*`400 00PU`: P0 300CRT0 0`V*P U:`V:00000 E00PU: 0 !0A- LS/,,D,D,DDDDDDDDDD4DDll0 S!ʈ01000C000000 S0 0Ä0 -LM@,`@PpU ( 0W0R0S D 0 H0bS* 0S!( 0W0R0S  TPU`,0@T01 11( U P ,0  P" P  T02Q# # 0@S0IZ*^Z 100j0QA PLX T 032 CQ*0SQ*0S 0T 32QC"T01 l` p-LMH0PUP!`e0V@ D P0 S$D 40P\ 0T0pD&P\ 0 R 0 320CQT 0pD+ p-LMH0PUP!`e0V@ D  P0 S"D 40P\ 0T0pD&P\ 0 R 0 320CQT 0pDo+ p-QLMP@K :Q P\ 0 R 0 0CR0T0pp0T0T 043 -L@M0 48 mQ`( C PMQLQCQ _AQN -@Q (0S ( 0TPR35 nQ@1@!pg\ Š%5 TP45%D 0 0aRP 0CS00P0 0S 0 0CR0T00T0 D0R 0cS0!PcP0HQ DQ0S, 0Q01 c, JQ KQD,( 0HSD 0Q   B P R 0 R 0 BS T 0T S0>"R ! B0,0 `0T00 S0R !0 TS2 a0 BRDpHP0S 0 l gR@1@!aL^HD HPDp34fQ @XQ- "PQ(0TPpS>0 gR@1@! b\ Š%5 TP>%d45%.cQ0S$ T 0Q3S<$ pW@*L0 0/S5꼽PԽԽX`ԽhԽԽԽԽԽԽԽԽԽԽԽԽԽԽpԽxԽԽԽԽԽ0@TPp @TTK 0X@K@IPwT0X @p004 8PJ?p=|=i?h?l?p$? -LM@P`p 0@0 00P+ 0@`@ 0@@`@ 0@ 00@p@`00 0 0-PLU@ U$L " ^0 /R 19R00C P^L0 0 C000^L00C"=AQ$p!R,00 ,R ,0,00,0 p-LM,@AP0CQK$,,,4Pl!R@ ,R@,@p!R@ ,R@!R @ ,R @ !R@@ ,R@@T@` @` 0V!R@ ,R@ p-LMP@p !0@Tp`@t 0!0@T@`@x 0!0@Tph -LPp@| !0@TDD@`01| 0 !0@ TL 4S!3=8S>08S, >8 ST3T#1 $t2Q h2Q `2Q L2L2H2@2Q 82Q,2,2$2$2222Q 2Q 2Q111Q 1Q1111Q 1Q ʼ1Q 1Q1Q 1Q1Q ʈ1Q 1Qx18 h1Q `1QX1T1<1< @1}<1{81y41w01u,1s1k n1!10 101;C h`@7>>>>>>??? ????$?,?4?`   P`0R P 0$ $ G00taxa`|apa -@0L R 000 0S 0S 0taxa|a -4L,\ \ ta|a 0- 0P @@ @  @ @RL x0T tp  0x@0R  Q 00# 0Q 0 000 -L M; S, # Rr Re R n T PPM P `@0`0VA` Ƞ ;,HnP; S) 0 @0D T  8:S00S@ 2T@ 30D8S0D8#H8T@ 008#HA0A12,R0V0 R00T2T; 00 2R 2R R;00A Rx!t Ha[00f80 0-0 0(0 0#0 00 00 @00 00 < 0 <T 0 ; sT 0S 0 R R0V&0V#0 9,pK T 0S 0<0 0 ✀  -p!LM04 S\q1Tq080 0K  8P`@`V@DPEAJ3[ S"[00b0cS  0KX8@ @08@ 040`၀?000 R # 3 R?H0`?À 4@ 0R # 3`` 4S @08#<@8oS: S>; S P 0 R0,Rl -LM@Q <`<0000000000000000000000 -<00000@ L `+ p\&0S \\ 0PP*; Sh!,\1R 0P: R: S:#:A >; S= ^; x   Sp , d0R P0 R:U  hK P0S i @@ p-LM0`PP@ SѼP 0\  00  00  0 \p -L,M@  `^Q 0S `^ \ ^PK aQLXPpPKa @0T*<@8oS: S >; S|p2Q} @ T:XZ WePKa @p0T[* ; S1QO: Sʠ,ʠ >; S<@8oS: S <= S= 1P: 1P7 |1P4 TP*00@ ;   S 1Q P0 R:U 1 c0 @0Tp:XZ } 10 p@: S:#: >; S Pw: SZ%Zr >; SPPm0SY h@@0Q 0`c0 @ 0-LMPK@z\ 0 @p[a -LM8@4\ (0( $0'00`taaa -L MQ1!`0  R 00ࠟ0 `0p0 C& R@ 00#!000 |0C& t 0 "!0P 0 RY(oaܹccacac0 - ` Q0@ PL0@ 00@0@00P000C& p#pR 00#!000 l0C& d 0 "!0@ 0 R}aaܹccacc0 -LMp0PP쀟0AT :P@ 0 A4ᔀ `P@ V !0 S0SV @ 㯺``@@ ( (-"L@pPP@0 T0 `04@S X`V0p 0O -L p-LMp@p`TPX 00d@Tp 0-D0 (("ALXPU 0X00` -LM@X@ p-LMp@pPT `00X`d@Tp-00 Ƞ Ƞ,1X0S`@-$ @.MЍ@` -L M`0V,0 :4V%4V" 4V L4V@ ;4V% X0S\0S p@ppTP ,000 0 d@PPTU 4V 0x0 X@T D1` Q 40P 3VX@T 00S00P3V <3V0S Sooc3V 3Vp@pT ^ 00  00d@TX@T~ r"`000P 0 P?#<00cSB  კUPP0S00S'(B`00C\ 0  "!0 00 1C&  0 "!0!0 Rt }r0D 00\A`00C\ 0  "!(0 00 1C&  0 "!0 0 R}p@pT9 00 R d@T0 0RX@T% D1 PaWbW`Wvt}f|fW~fcWܹcccc0-00 Ƞ Ƞ,1 X0SB` -LM@P `0SX0S T0 S `0Sh& p-LM`P |㮷P@|0 p04 p`+0 00`x 0pL` -PLM`@@ pPdP`0ph0p R0pd@\Q 000SXQW d 0R`0h0h00h0hd Pp d 00pPppWx0S px 00 W 0-`PL\0@S 000Sd pRh0h00h0h0d Sd 0p `00X0S 00 -LMp@p`Tp 0P \ 0d@TWPpQ \0 S\0 S -p@QpPpp TL\` 000Sd@TV \P `(0$8 Q!0  Q:l0@-P(P  $08@Dt @\ 0 0 A\(@Dt0 -0` 0p@0T0L0P  @T@p00C\ 0  "!t0 00 `0C& X 0 "!04 0 Rh{cܹcacc0-LQ@0 0R, 0 S aP`a,0 P 0SPa -LM0@`PUp@ T0 0$ R, PUA`00C\ 0  "!l0 00 X1C& P 0 "!0,!0 RZ{W 0 RZ 0( RX P@`00C\ 0  "!x0 00 d0C& \ 0 "!08 0 R{ܹccacc0 -LuM℥0 0`00 $ (0 bP(L@ 00Q00P0 %@00C\ 0  "!0 00 4C&  0 "!$0$0 R0V 00 t$000 \@0 Q0000 $@00C\ 0  "!0 00 3C&  0 "!3  Q< $ (  VVz Vu4#V80B 000 Rb 08  80"0 0C\ 0  "!0 00 2C&  0 "!l2x  Q3088 08"10 0C02\P 0  "!0 00 1C&  0 "!1  Q z z@围8!@V Vp! Vh! V V VP! VyH! VvV8!Vq0!Vny[ <v.y nP@0 0C\ 0  "!x0 00 d0C& \ 0 "!08 0 Ryܹcc@bp>b>bP?b -LŸp0@P`P@r U ,0U 0S?C0,PV 00V 0S3G00`00("X0XAp00C\ 0  "!$0 00 1C&  0 "!0 0 RBy@p00C\ 0  "!|0 00 h0C& ` 0 "!0< 0 RyPܹcccc0 -0@0`LpSP10  `0P0C& R 00#!|000 h0C& ` 0 "!0< 0 RUxcܹccc0 -0@0P L Pp 0(S"x) `P00C& R 00#!|000 h0C& ` 0 "!0< 0 Rxcܹccc0A@-0S4 S/0!0@Ġ\@(00\$ 0nQ T00T 0@bS 0 S00T0P00SS0U` -LM P`%p@T K0  KKppp\! K0 !K@ K0 KK@@@4 0S 0P 0Qc 0-LM0P S 0s# @ K0K0b0@@P@ P00[4S 0P00A p-L$M@P` V) K0 0)K{0400 P00@@ (K0(` $ P c<p %000 0)0K0) K```S4`Hcl 0-QLMP$ 4@T00 0 K 00b0@@@3P@ 00P0@40 01000^ K 00b 0DP@00 P4@TAtAQ0@-P0@0 " Q 0* 0 S0R R R00 0  0  0\ 0 0 0QEQ QQ 00 -`L@pP h00000000 -LM@00KK0[0 80 K0 -L M@ K00KP<  0-0LMQ@P( 0Q0 0 00Q 0Q 0 00KK0[0 80@ K0@@ 8 W@W@ WW -LM<@T 0cc 0S 0cc p-d`MLP@ 0Q K 00b0@@@@ pcx p-LM@`P| 0 P p  R 0O- Y I* Xb$\(  O-`Q* @@ P@ @Pp$DL%T\ @pP$HH @ PpD%\TP ` RPbin4_cksum: out of mbufs p pgQMW@PФP``$($,Q@Qx       x         @Q@ Q x        Q0@cA@0  0  0  Q@A 0Q@Х@PP484<  0  )?) 0  )?)^18#811  R R 000 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 2 R 2 R 2 R  2P00 R@A0P0A R- Ybs_notimpl_bs_mmap: args at 0x%08x - Lbs_notimpl_bs_r_1: args at 0x%08x - ?bs_notimpl_bs_r_2: args at 0x%08x - 2bs_notimpl_bs_r_4: args at 0x%08x - %bs_notimpl_bs_r_8: args at 0x%08x - bs_notimpl_bs_w_1: args at 0x%08x -  bs_notimpl_bs_w_2: args at 0x%08x - bs_notimpl_bs_w_4: args at 0x%08x - bs_notimpl_bs_w_8: args at 0x%08x - bs_notimpl_bs_rm_1: args at 0x%08x - bs_notimpl_bs_rm_2: args at 0x%08x - bs_notimpl_bs_rm_4: args at 0x%08x - bs_notimpl_bs_rm_8: args at 0x%08x - bs_notimpl_bs_wm_1: args at 0x%08x - bs_notimpl_bs_wm_2: args at 0x%08x - bs_notimpl_bs_wm_4: args at 0x%08x - bs_notimpl_bs_wm_8: args at 0x%08x - |bs_notimpl_bs_rr_1: args at 0x%08x - obs_notimpl_bs_rr_2: args at 0x%08x - bbs_notimpl_bs_rr_4: args at 0x%08x - Ubs_notimpl_bs_rr_8: args at 0x%08x - Hbs_notimpl_bs_wr_1: args at 0x%08x - ;bs_notimpl_bs_wr_2: args at 0x%08x - .bs_notimpl_bs_wr_4: args at 0x%08x - !bs_notimpl_bs_wr_8: args at 0x%08x - bs_notimpl_bs_sm_1: args at 0x%08x - bs_notimpl_bs_sm_2: args at 0x%08x - bs_notimpl_bs_sm_4: args at 0x%08x - bs_notimpl_bs_sm_8: args at 0x%08x - bs_notimpl_bs_sr_1: args at 0x%08x - bs_notimpl_bs_sr_2: args at 0x%08x - bs_notimpl_bs_sr_4: args at 0x%08x - bs_notimpl_bs_sr_8: args at 0x%08x - bs_notimpl_bs_c_1: args at 0x%08x - bs_notimpl_bs_c_2: args at 0x%08x - bs_notimpl_bs_c_4: args at 0x%08x - bs_notimpl_bs_c_8: args at 0x%08x V`2-@@Pr?0RW` 0//0` B`p Bp` B`RE0C`R9`0T0`0l0x0000` B`p Bp` B`p Bp` B`p Bp` B` B`p @R B`p R BRR `L1p1d1X1` B`p Bp` B`p RpPP2-B@P00O0RW` 2111` B`p Bp` B`RE0C`R9`2L2X2d2p2|222` B`p Bp` B`p Bp` B`p Bp` B` B`p`p@R B`p`pR BRR `D3h3\3P3` B`p Bp` B`p RpP2-D@P?O0RL` 3333` B`p Bp` B`R:08`R/`484D4P4\4h4t44` B`p Bp` B`p Bp` B`p Bp` B` B@R BR BRR `5(555` B`p Bp` B`p RpP% $0000% $00000& $0000 -L R l\000Х000 R 0 4 8 <0 R  R000Х000 -L R l\000Ѥ000 R 00#40#40#40 R  R000Ѥ000R 0 R0#400#8 80 RR 0 R 4800 R## 8##,0R0@-0#88@$HHP%XX,ȠȌ8 R0R0@-0P8$#H$8#0@8%#X%8#0P 8,#, 8#08.#.8#0 R0RC-R :08PHpX hx R R:x08PH R R:080 R R:0 R0#40R}A-R:#H#8##H$%h%X%%h&''x''(,,,,.Q R R :#h#X#%h&$$x$'( R R:0 R#X#H#$X%0 R:0@ R480V`0-2P? @P4@54?3P0p-2`? h@@PPP`5P65?3`pp-2`? @@ZJJJJJJJJJJJJJJJJJJ }J xJ sJ nJ iJ dJ _J ZJ UJ PJKJFJAJ=Q:Q:Q:Q:Q:Q:Q}:Qx:Qs:Qn:Qi:Qd:Q_:QZ:QU:QP:QK:QF: QA: Q<: Q7: Q2: Q-: Q(: Q#: Q: Q: Q:Q:Q :Q:QA ? QA ? QA > QA > QA = QA = QA < QA < QA ; QA ; QA : QA : QA 9 QA 9 QA 8 QA 8 QA 7 QA 7 QA 6 QA 6 QA 5 QA 5 QA 4 QA 4 QA 3 QA 3 QA 2 QA 2 QA 1 QA 1 QA 0 QA 0 \aBC`B0QA 0  0-LBP|@ 0S L| 0SPeT 0S \00LS `00000S  0SbQ1QR0@-P@ 0bàR? B0QQ000-P@P@0Q0-P@P%@ 0Q1Q3:P: R0P0QcP  R0-P@P@0! !Q@-: R (2 R R -PPPP RrPP B PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R- RP1P P1P RrP1P  B P1P B  R010 1  B R0q0`0q0`0q0`\0q0`0q0`0q0` R 0\6 R B0-81, Ġ%̌T$\D#L0P  R0 Ġ01#̌  R R B0-81, Ƞ%ȌX$XH#H0P  R0 Ƞ01#Ȍ  R R B0-81, ̠%Č\$TL#D0P  R0 ̠01#Č  R@-@08#8S  0   ` `! R0-P@ 0bR03 B008V```0 B`3`1`1c11c!0"b2c3c0acP@8V`_ NR- R 0S0 \R000Sa@\0S S0S0S  S 0S R  0R P0Qc\R0@-P@0 A@P `R00\00Sa@ 0zR @R00Q00S ZR 0 PP ^0b0Q &,'$(#80x25PPf 80x25PPf80x25bfPPf 80x40P(Pf 80x40P(Pf 80x40bfP(Pf 80x50P2Pf 80x50P2Pf80x50bfP2Pf (@X,,H d"*' "eYj$@@h>@@h@<`>` Bh@xM0Lp90j^Q 1W jvQ^Q09`0pj^r0@~100MW@ 1eX` @xj"` x@ h x jjjxP0jHj]jjHj]j&z=znx=z=1=21NyeXfxf1f21f|@fhie AWe@aj^Q q xe@z=zx=z jeAe^e@ h j "xee>00  0T0xee4T4x 44 x4@ 10z0?|eX y0jp]@j>] y j]]x0 yjp]e@@le "|e 0e]?*d# e]?*d"De"deBD@je 0e]?s@j:0jteAdjj]dldtdtjbtdt#dJtd^taj^e]QqeBD\|Qj`]Q\dT|^lAj^e^D!j^e^DjV]0eAX| 1f fQ4L=(d|e> 10eeLj"j eeTj"j eeeLj"jeeUj"jl0QuQ]Q 1e6E?>6ue^Pefj Bnj jDj^ j];&1;\nj ee^eTf &eFjj `nbn|n|n|ndd0fpffv`f=d(e`F& ~nbe^e^e^e^00000004l21l21l21l21l21l21l21l25~& nj nB~1jv4jv e BfAfj^jA 10jvFB 14A~14e"1jj XmHmHm 8m  hm (m hmm8m hmm"l%0l%l* hm- l1 hm20Xm2 hm3Hm5l7 hm8l< hm=lG hmHlK hmLlO hmPl[$@Xm] hm^Hm`HmiXmm hmn0Hmn hmolp hmtluXmw hmxlyl|(mXml hml hml hml hmlT XmXm hm llm0Xm) ltl9Xm. hm/l2l7l8 hm:tl>`l@ 0l@ hmAmF hmGXmKmR @lRlShmTPlUme0Plehmkluhmztlzl| Dl}l4ltl%0l hm l hm% ll tll hmlll 0m hml`l ltl%@ll hm0l hm Xm l) hmlaXm hm0l hm Xm hm0l hm Xm hm%pl`$l hm$l hmhmm hmm hml%8mH hmIlLlN(mPXmV hmXXm[ hm\l]0`l^hm`$li hmk$lo*0mq"hmy& mz"(m hm$l hm (mmmm(m hm mmm$l$l(mm hmlB(mRl hml hmmk:ll c$l hm`l hm0k hm hm#04l/K hmA(mY(mZ hm]l^(ma3  fuZ]agikkm%2K} }}}%}2> > >>> > > >>4x5x7r x@t xxxx4x5xxxxx6x 7xT8 t4j 5l@`@`7j @`6j@`4z`884t5r@`X@`PP``XXP``@4zhh5~~4|X4zhh5~~X4|r\jr]jr^jr_j\rj]rj^rj_rj|`@`H@`@@@`HHxx5r6r           xxxx(C|z(DHHNA~ NC [sF  .6*6.$*6.$ %+2> 88888 9 7 6 97 5 9 423 9 2 9 1 0 9 9 \/|\/O|/-| n;AvXaM ְdx   L   4  < KCopyright (c) 1982, 1986, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. Copyright (c) 1995-2006 OpenBSD. All rights reserved. http://www.OpenBSD.org  $<x@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@netconnetclsnetionetlck!#$%&'()-0123456789@ABCDEFGHIJKLMNOPQRSTUVWXYZ^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{}~Ͼ󨷵ǎԐѥ噞᷵ǎԐѥ???????????????????????????????? !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?Ѫ?????????????????????????????յݯ????  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~UP   H K  K ( K! d n;0&AvQkkXaM~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@|22h20@ 2 |22h22vmmapbsyBUSYWANTEDTABLEDCLEANCLEANCHKRELEASEDFAKERDONLY ZERO PAGER1FREEINACTIVEACTIVELAUNDRYANONAOBJ%% Xă\ăhăl  ptx p p 0p `Ȟp pОP ؞P ܞP @P P    xx(,@0,8< @D @H/LoPT0/lp X l` h` @l` `p` |&` t` x` |`  0 @ ` `  `  0@Pğ`ȟp̟Пԟ؟ܟ h0@P| `p  $ ,0 408<DH P<0T<@X<P\<`dldpdxd  Ġeqnecsccmiplvsvchilsgeltgtlenvdaiadbibedeafdfalsllsrasrrorpmzsdep0.01.02.03.04.05.00.510.0AA  $,4<DLT\dlt|$,4<DLT\dl $,T\dlĥ Хܥ DLT\dl,@Th4<DLT\dlĥХ$,4<DLT\dlĥХ $,4<DLT\dlĥ $,4<DLT\dlĥХܥ$,4<DLT\dlĥХĥ,4<DLT\dlĥХܥ̦̦Ԧ4<DLT\dl $,4<DLT\dlVAPVAVAVAVA VApAqAqAqAqA qA,rA4tA<tATAlAt A|A`A `A `A PTA  A D ȧ,D Чli ا i  i , $i l0$i l ,i l0,i l .i 0.i !i 0 !i 8)i 0 )i 8-i 0Ai @l -i 8Ai HAi XAi hxȨĨبԨ$4<<DTdtĩԩpxypx$y8`zLl`z`z`z`z,L`zd@````` ```@Xp,@\| ,@X(T  D  8p(P        ( T t     $ P h      8 d      @\x <Xp     0Lx@h@\x 0X(X Dt 4X0XPp   4 X |     < d !!!"$8$P$$$h$$$%&&&(&@&d&&&&& & 8& T& p& &'$'' '4'P'l'(()),)@)X)|)))****(*@*X*p*+,,,,,X,|,,,,, , 8-h./0000D0d00000 $0 L0h1122345545T5t56788 808H9h:::::;8;X;;;;;;;8; L; d; ; ; ;;;;8;P;l;;=>>>0>H>h??????0?L?t?? ? ? ? ? ? ?@?X?h@ABCDE F<GTGhGGGGG0H`IJKKKK KK,K@L\NPPPQQR<SLShS|TUUUUU(ULUtWXYZZZ4ZT[t[[[\\\]]@]l]]] ]D]x]]]]L]|]]]]D] ]!]"]#(]$`]%]&]'](8])l]*]+],]0D]1]2]3]4,]5d]6]7]8 ]9@]:x];]<]@$]AX]B]C]D]E(]FX]G]H]I]J]KD]Lp]P]Q]R]SH]T|]U]V]W]XD]Yt]Z][]\]`@]ax]b]c]d]eL]f]g]h]i]jL]k]l]^^4^X^^^A^B^C^E(^GD`la|aabccd,dHe\flfffgg(gXgpggggg g 0 g P hx i i i j k k k< lX mt n o o o, oh o o q r4 rL rt r r r s$ s8 s\ s| s s s DL\dpdd$(4d<HdPTd<\d<hddpdxddddPd , 4H PdldddddddddDLd\dld|ddd dddddddddddddddddddddddddd5150ES SCSI FA1501 Addddd d d4@d4Ld4Xd dlxdE4dddd$TG!A  !@@@@`Lab Pd\egQ` ,h8iV 2 3!k\`lm\V.""""K|3"""""tD""""q"""# #"##" #@Z(#t̝8#@#H# `# "l#x##y#"\#####"# #"#"$$$$$ $0($@8$D$P$DT$`#d$l$t$ |$$$$$$ $!"$"$$$%"%%,%<% "H%XT%|d%l%`t%;%%< p% Ļ % H% ̼%8%P%%%)g%:g%%h&2h&6h(&rh@&3iT&rid&qx&q&q&#r&&&&'&''3'5$'E,'UP4'WPH'WQP'WR\'Yh'PYx'QY'RY'`'`'U`'V`'`e(be(cede(ee((Fv<(pwH(`(h(x(((( (P(Q(U)V)X()Z@)T)h)|)))))))))** * (*4*<*D*L* T*==\*==d*==l*==t*==*==*==*== *== *****++$+4+D+PT+E`+HD+p++Q +BX+++++ +++ +0,@,P ,,,<,D,3@ L,3@`T,3@p\,%5d,Et,I,Q,a,,,,!,#,1,3,5,A-C-c -u,-!8-1D-DP-G\-h-t- 3-R-R-)R-7R-9R-CR-FR-GR-IR.KR.LR.MR(.aR4.cR@.RL.RX.Rd.Rp.QT|.UT.WT.aT.q. . .....x.x!/`8/xP/xU(/Y4/YD/u`T/x``/xal/xpx/xq/xr/xs/xt/x/x/x/x/x/x/i0x 00(080H0X0h0x0P0Q0_000000P011 1d,1e41d@1P1`1p1111p11111122(20282#H2%T2'`22l25|2.B20B2B"d2B$d22222;2;2;2"3"3",3"<3" L3" `3" t3"@ 3" 3" 3" 3" 3" 3" 3" 3" 3"03"p 4"p4" p$4" p,4"p84"p@4"tL4"tT4"t\4"th4"tp4" tx4" t4" t4"t4"t4"t4"t4"t4"@t4"At4"Ct4"Et4"Ft4"Ht5"It5"Pt5"Qt$5"Tt85"UtL5"XtX5"Ytd5"`tx5"dt5"ht5"it5"jt5"kt5"mt5`55`5566D/$6T!86k@6kH6kL6kT6k`6kl6kx6k6kDk 6k!6k"6k$6k%6k&6k'6k(6k)6k-7k. 7k/ 7k07k1(7k2<7k3H7k4T7k5d7k6d7k;t7k>7k?7k@7kA7kB7kC7kE7kF7kG7kH7kI7kK7kL7kO7kP7kQ7kR8kS8kT8kU8kV 8kW88kX<8kYD8kfL8kg\8kh\8kil8kj|8kk8kE28888D푠8홠8888 808`8p99 90(9`49p@9L9X9d9p9|9[9CuDP19T19P>9p>9DA9PA9QA :RA:SA,:XA8:dA@:pAT:qAh:rA|:sA:BB:6C:7C:AC:BC:EC:GC:HC:IC;LC ;MC;SC,;TC8;XCD;aCP;cC\;iCl;nCx;pC;qC;rC;sC;tC;uC;vC;wC;xC;yC;zC;{C;C<C<C<C <C0<C<<CL<CX<CX<CX<CX<CX<Cd<Cp<C|<TE<BG<DG<IG<LG<MG<NG<OG<PG<QG<RG=SG =TG=UG$=VG0=WG<=XGH=YGT=ZG`=fIl=nIx=BL=DL=EL=FL=GL=IL=ML=NL=PL=QL=RL>SL >WL>YL0>ZLH>fL`>FMx>LM>DN>EN9JN>HN>PN>dN>hN ?DP ?FP0?RPBS$S$%S$S$S$S$ S$!T$"Ttq(TtP4TtX@T]HT]hXT]idT]xxT]T]T]T]T]T](T]8(T](TUU0U8@U?LU?TU?`U?Ā`U?Ȁ`U?hU?pU'xU'UU6UUUUFPUpUU<U<V<V< (V<(8V<)PV<0hV<1pV<HxV<TV<V<V<V<V<V<)W<*W<.W<,W<2DW<2XW<2lW<2XW<2XW<2XW< 2W<"2W<#2W<%2W<02W<12W<22W<32W<42W<52W<62W<72W<82W<92W<:2W<;2W<<2WWWWWW XXX$X ,X3DA33(8XXWXpXX0XX$YYOI"4YPLY``YtYYY !Y "YIYY9Y Y Y&8a'8a)Y*Y,Y0Y2Y5Z@ZAZp$Zr$Z8ZHZ\ZhZtZZZ` Zb Zd ZZZZ[  [ 8[ L[d[|[[[[[[d[[[ \(\@\\\[&t\'\(\)\0\1\2\3\4\5\6\7\8\9\:\;\<\=\>\@\C\H]I ]J0]K@]LL]MX]P\Q\R\S\T\U\V\W\X\Yd]^p]_]`]d]e\f\g\h]i]j\k\u]v]w^x,^yD^z\^{\^|t^}^~^^D^^^^\\\\\^_,_D_D^X_p_______^_,_^` ```` `! `0`1 `2`a(` 8`"@`#L`&T`'d`(p`)`-`.`0`4`5`7`<`K`P a`a`aa0ab@a`Ta!`a#la$xa0a1aHaH]$a$a$a$a$a$a$b $b!$(b"$4b#$@b%$Pb&$`b($pb@$bB$bC$bD$bE$bF$bH$bI$bJ$bK$bL$cN$cP$ cR$,cS$8cY$Hc]$Hc$Tc$`c$pc$`c$c$c$`c$c$c$c$c$c$c$d$c$d$ d$c$0d$@d$Ld$c$\d$ld$|d$d$|d$d$d$|d$d$d$|d$d%d%e0% e1%e2%$e3%4e4%4e5%4e6%4e@%DeA%TeC%`eD%`eE%`eF%`eG%`eH%`eL%leP%|eQ%eR%eS%eT%e`%ea%eb%ep%eq% fr% fs%0fv%Dfx%\fy%hf{%tf%f%f%f%f%f%f%f%f%g%g%(g%(hlO(xl0(l1(l2(l4(l5(l6(l:(l?(lA(lC(lE(lG(lI(lK(l0l2l@3lA3l5j 5l5j5ju5lv5 mw5mx58m5Lm5\m5lm5xm5m5m5m5m5m5m5m5m5m5m5m5m5m5 n Bn!B,n"B@n#BXn$BXn'B@nRpnRnpnpn pn0pnqnqnqnqnqn qo!qo"q o#q,o$qDo%qLoq\oq\oqhoqhoqtoq|oqoqoqoqoqoqoqoqoqovoxpĄ pńpʄ,p˄@pLphp p!p"pAppRpTpqq q~,q`r8@q`s8Hq`w8Tq`8dq`8xqq @qaqaqqq0qq{`#q{a#q{c#q{e# r{f#r{h#,r.0PQRSTUVWY$Z4[4\@]P^``ldxefghjkl̀m̀n܀~  0<L`t0ԁ(0@0LLXh0xĂ؂0  4HXdt|@ABDЃFЃPQRS ae(g8pHqXrhtxuvxyzЄ{|0H\lx̅̅܅,8DP\hhhhhhp@AІBPQSX,Y<[L`\dhetfghiklmnopЇq܇r~$$$0HXp!"$Ј&'(Ј)Ј+,-,0@1X3hCGH`chlmn̉i؉j؉lmpqrstuvwxz؉~  ,8HHT``lxHHTT@DEFHIJĊKĊLԊMԊNԊOԊPQRSTUVWXYZ\]^_N (!0EW8EXDEhPEh\E!hEtE|E"ȄEaȌ1  ċ!̋@ԋ܋   , <DT!h#th  !jBMyxfČf̌f܌f̌f܌f fff f$f4fLfLf\f6lfxflfff0f2ffȍfЍf؍ffffff  f!0f#<f%Hf'Tf0Hf4`f@lfAtfBfJfKcc 10q13qĎ14qЎ15q܎ffff f ,v4w@PLXZ0 dZ8 pZu|Z3Z3Zq3Zr3Zs3Zu3ďZv3ЏZw3܏Z5Z5Zp5Zq5 Zt5Zw5$Z=0Z=<Zs=HZu=TZ0M`Z3MlZ8MxZhMZiMZuRZSZhbZibZfȐZ fԐZ!fZ&fZ)fZurww w"$w,w4w@@wHw!Pw"Xw#`w#hw"#pwcx))6ȑ8Б9 Rgؑhiefu v0w@xP!`QpR"2CĒR̒z ؒ3S1V3S3S3S 3S3S$3S=(3S43S<3SH3SˆT3SÈ`3SЈl3Sшx3S҈3Sӈ3S3S񈨓3S򈴓3S3S̓3Sؓ3S3S3S3S3S 3S!3S"(3S%43S&D3ST3S`3Sl3S|3S3S3S.3S3S3SĔ3SԔA}#OH@"HCH CHD(H0H8 @JHJ TJ`JFhdt|9999999 ȕ9 9ԕ999999 999$949<9D90L9@T9P\9d9 p90x93959@9E9F9H9I9P9Q9RȖ9UЖ9Vؖ9X9a9093959@9A9E9F 9H(9P09Q89R@9UH9VP9`X9a849 `9a t9b |9c 9d 9e 9f 9U9U9U9qU9U̗9Uԗ9Uܗ9U9U9b9b9c9c9%c 9&c(90c49p@9pP9p\9pl9px9p9p9uȘܘooo o oo o $U0(U`8Ua(UbHUcX)h)x)BI) aM M9ЙM(ܜD+4P8TTHUTT`l#!  hqȚ hrК4ؚ |b eW =!(=!4)L iX`;'h;4x;5LL=L=L̛L LLLL 0L!DL#XL$lL&L'L)L*L+МL.L1L2 L3 L40L5DL6XL8hLLLLfLLĝLԝLLLLL$L4LDLTLdL xL!L#L(L@LAȞLB؞LDLFLGLHLI(LJ8LK\LLLPLQLRȟLS؟LTLULVLWLX(L`8LDYTd/ x/ //ytyyy y̠yܠyyyy,y4# <# H#T# d#x# ## # # ԡ#P#`#### #@,#%8#`D#P#\#Ph#Px##ĢТܢ 2 2 20 2D 2X Ghp|  PPPģRԣRRSPW3``` `0`D`P`:gX`d`jl`t``````訤`谤̤6@UԤ` `$80X<YHiT`lxaqv̥ܥ ,<HTdt& $80X<YiĦ`xqЦ"$8"0X"<Y"i"Ħ"`#xz({(|(}(~(80$@04C0DD0TP0dQ0tS0W0X0Y0e0ħh0Чt0001111,1D1P1\1p"1x#1G1H1I1d1h1w1Ȩx1Ԩ1`12$222'2820I2 X2<Y2,i2Ħ2`282D3,I3DB$8B0XB<YBPiBĦB`Cx8R\aL,r$rl8r0Xr<YrxirĦr`sx15ĩԩ8(4hDP\8888%tqhxĪ̪Ԫܪ      $0<HT`lx ̫!ث"#$%67 8,98:D;P<\=h>t?fghijkȬmԬno(4@LXd`pa| ح ( 8DLT`l1x12BJ\PP@P@ PeԮPPZZPfJ ](]0]@]@] @] T]@]l]]]sssss s s įs̯sdFs Я8د @W` a{!{!{!= pW(u0<DTXhp  P"#İ%̰(԰)ܰ+,/134689H<LB\ClDtExHJKLMNPUıW̱Zر]`afikqs t(w<xD}L~`l̲ܲ$04DLP\t|ȳгس(08<LTdp   ̴'д18<?BHO,Y4]<cDfPy\dtԵ  (4P\p?xDY[]+`lotyȶzԶ (0<PX`hxJMqvķ̷Էܷ   ,%4=<OHaP\dpxl*ĸ$Ը8ظ;b 48D`P{X}lt|0%7 ;T}Թܹ$,#<1D{LT3\==d@p3@lOItJFPSP3SltcJ. #$sH6s#6@6 PH#6`OH#6`bF M#asM΁3swO 33i`J`c,c<3 #hM #h##acj3 Nv3 6-3PNPDF##Ɓ#a Jac6-3#hW`愀#愀sKa O#AObHFV#s)Bg#sw2|<LزjNgc-xfjn3|P`P##< #%aOo##$+fj 3cCM #a15l8?#a31 5 9=~-   x33|`B~`)1`C~"X<\"3%|>`> 3B~#:nl8?B~B؃|3/B؃|ă3&8+26##k#c 3|`  k#c-<4830| ` 3 #b cZ3cd# v3 3B##"#"(#"#"B#JaE#3 bG# 3 bC##D#sM3'##&KOO"va F$Hڀ#4#Ja@#AK`#I0I`w#]b#c3-c#Ja#APb#Ac̆_+gcz|#hH##c|#cJa6#Ac37 #c`c#|ocKARaN#Ac3 b#Acg#cc#|gc3@ bcc|+@c|@cC|g@c|#c3*c +3)Ccކ3 bڀc|{c3, .c,|3=gc D|#acrqpcrppqrqppcrppqrqppc##3H#HCڇ#c nCvwc nCvwc#tC@Dt$&$scuZF&JudNsc{cv3>gcc8+8+2 1 c26:>c26:>c8+@2@6@:@>cZ @]cs #ss#f ##bswhA###BT+}}}} } > > > >  >> ! >> >  @DHL  @DHL     &(`& 0&0 0 `"0 0  JtT4$   rq! 2r!qq! 0  S1B1SSA1B1B11qw!! RSQQP@064a2]G4" w! "0.vpq4qʄ$!$J$K$$$$$$$$ $ %% % &o&S& Q& R& '' ' ' ' ' '  ( !( "( $( %( )( *( &  t.t.At.it.@=C0>F0>H0>I0>E1R5R@R1l^q3q3d13I1(I2((I3(iUm((( x~)R,3M(8M(0 (0M(hM(hb(iM(ib(u(uR(ur(33q3u3v3w3s3r3=5=5w5q5u=t5p5s= @ĺAĺBĺJĺKĺdeddddSd5dednddHd(((T(U(6(>(f(g(~(((((\(](^(_(ICiCvCCnCRyCRzCR4,"66 h7797 7889f9 ZX8h:;;222CC @ @  "2"]G4" w! C0ae01S0 3@ Fv PQUVXZEUPU`V`)0 I$567129=PQejk348;<>RSTUVWXfgY):Y$]$l&dh'ixv|w   &'(yz{u^_`}~IJKLM (((((((((2222222<<<<<<<<<FFFFFFPPPPPPZZZZZZZZZddddddddddddddnnnnnnnnnnnnnnnnnnxxxxxxxxxx   #&) !%),036:=#(,159=ADHKOR(-38=BFKOSW[^beh<BHMRW\`dhloruwySY_dimqtwz|hmrvy|rrrrqqqq)lP@ & 4JPJ.0TL7T7LNM !0Fh'$D!0 X \@`@p@@@ @@ @AA`:F:5:5:FP fG$2V0g DP" `@ p` `hh!hahv TT  1,4 DTdt 43 xa       =0TJ`)hxf(rp !"#$$$1020G G1!<G 'DL\htGe2 ' !!   w     B$!(30W rW 8W HW W \W@lxx x x x x x xo 33Vvvv v$v<vXvt l7P@8hV P   4  D " !T 7l W    Pp Zp \p [ ( @ LX`\ p\ 3 xng"" ""A0C0E0G0H0 N00# @# T# h#7 @e6!jj ,< L Xdp23vJP#U q q xx xx xx xx<"< x(4 D Xhv@AX  f  0U$`e<y5iHBT$d0p8  g ah eh ih wh a t9D^X^ t^ ^^^$^%^+^n^z0$0<H\pH||cz @ @ @@di BBcU(""(@" `HcAPd_t_|______s__A#9    U0 U0    $ 0b X< P0H `2h P%%@%FFF 0F@dAdAFAF0BPBQBFCFC_$_$,4<p' <#4D T\hl9  U(W0WHWPhhXh00000 010@0P0`0a$0p4 @H9X} @x} } } %eeeeJ@qqq0qqqq$q 8qXqlqqqq"0 3, 2( 4 @ H`dpDZZ Z 0p85aaaaa@aAaEa`aaaaaaaM aM(aM8{H{d{{#{#{#{%{{~a)b 1` 8bS&@,p% s%q&8@ PX Q` lt   4D#X'h)|+3 'J $ 8 cL t` x ]  HR ! f ^4      1   0 D d x          4 | |"  oB|$o  8 H 9 !X \ ;| z ʀ  = ^ & ` ' ' $ a-< -D ah L  qT  \  d t  80 $ l\  \     !L L% L+ L-0 L.H L2T L8p L\| L] La Lf Lm L L LL$Li43D3.TU pKTu   00(08n HZTZJ hZP|ZPZPii11(sQ E= 6,DD\; h; |; ; 0; 0VbQFQF Q TO   x$ 0 < LAXo`~0x~0x~ 0h~2x~2x@t000`@          CC,C@CSAHS`l!|$1!160 P ` cj0jDjPj`j!x55&x5'x5(x5)xE E{1@@@ @ O 4 @ H TWZ`\   lt 4@#ĺP 4  TT"#($D(\0x68=@NOQVX Z^ a(d<j@kXmlnxqtx}~<tP0<T`dt 8P\,p|̰D , <T"p%'()@CEGLS VW4]l_HbXepfjlmnsv{|  0DL`x (l4HXh  8@ L$T6\8dDlGet^cknouwx{|p ,4DL\l(D4@D1L4TEdNxUci{}   4 H d l `p x         ! !!$!8!H!P!'d!-p!5|!0!3!:!A!F!T!V!Z!dn"p"|"}4"<"P"`"t"""""""" " # $# 4# D#! \#) d#< 7O #Q #V #W #Y #Z #g ̰v #x #z $  $ ($ <$ H$ P$ \$ d$ |$ $ $ $ $ $ $C $\ k $y % X % D (% <%9 ; D%A X%b 4o T~ h% % d % 0 % % %E %R %v %  % &= &\ L} $& 0& 4& D& `& t& &U&f&s&&&&&=&&'$'D<'c̱eH'lX'd'l'0p'x'E'K'c'fP'''A(J(g(o (((<(P(l(t(B|(q((((5(S(r(((4&)'()W8)~<)T)`)t)1)E)h)&))))** ! )"̱x$*p'$*!((*,)43<*85@*y5D*#99X*@p*A|*@<tԡtpx      lTabcde f g h i jklmnopqrstuvwxyz1!2@ 3#!4$"5%#6^$7&%8*&9('0)( ) *!+ , --_.=+/[{0]}1\|2\|3;:4'"5`~6,<7.>8/?9:;<=>?@ABC D E FG HIJK,L!MN-OPQRS T/U*V-W+X Y1Z2[3\4]5^6_7`8a9b0c.e mMqQ@zy2" 3#6&$7/{%8([&9)]'0=}-?\./0+*1#'2#'345 6,;7.:8-_d<>| .'`0+*~5^2"@ 3#!4$#6&$7/{%8([&9)]'0=}-+?.|/01'*2'*3456,;7.:8-_d<>\ .'`|0^~-+?\0345d<>| .'`|0^~.\0345|d<>.\`0^~q,?azw&12~ "3#!'4{"(5[#-6|$7`%_8\&9^'0@-)].=+}/0$1*2*3m4%56;.7:/8!d<> bBeE hH iI jJkKlL|,?nN~aArR,sSzZyY2 "3!'4"(5{[#6$7%!8&9%!8'0-)}].-_/0$*2`@#3mM4%5@#7:/\8=+g= 2" 3"5%#6&$7/%8(&9)'0=-'?.^/{[0+*}]123@4#5\|6,;7.:8-_d<> 1!2" 3!4$"5%#6^$7&%8*&9('0)--_.=+1#~2#~4'@5``d\|2"#6&$7'%8(&9)'0--=.^~/@`0[{1]}2]}3;+4:*5\_\|1!|2"@ 3#!4$~#6&$7/%8(&9)'0=-'?./[0+*]1}2}34{5\6,;7.:8-_d<> eE !1@-2_ /3#!;4$":5#,6^$.7&%=8*&[9(']0), -?+'.xX%/{0wW}1qQ|2qQ|34"5`~67fF8\ q,?azw&1|2@ "3#!'4"(5#6^$7%!8&9{'0}-).-_/[0$*]1`2`3m4%56;.7:/8=+~d<>\ xje.> u i d c htnbrl'"poygk,<qf;:-[{.]}//?0=+3s4-_6w7v8z9: ;<=>?@ABCD E aAbBcCdDeE fF gG hH iI jJkKlLmMnNoOpPqQrRsStTuUvVwWxXyYzZ#6^6,$7&7./[{0]}3;:4'"6,<7.>8/? aAbBcCdDeE fF gG hH iI jJkKlLmMnNoOpPqQrRsStTuUvVwWxXyYzZ#6^6,$7&7.--_.=+/[{0]}1\|2\|3;:4'"5`~6,<7.>8/? eEzy1+|2"@ 3*#!4#6&$7/%8(&9)'0=-'?./[0!]1$}2$}34{5 6,;7.:8-_d<>\ -'?.^`~0!]/[34{2"@ 3##6&$7/{%8([&9)]'0=}-'?.<>/+*012345\|6,;7.:8-_d<> .+*/2\|4qQ@1!2" 3##6&$7/%8(&9)'0=-'?\./0+*~1}]2}]34{[5|6,;7.:8-_d<> 1!2@ 3#!4$"5%#6.=+/0[{1]}2]}345'"8;:c.d\|/? IqQ@2' 3^#!4+$"5%#6&$7/{%8([&9)]'0=}-*?\.-_/0~1,;2,;34i5"678.:d<>| /1,;`2,;`3'aAcCeElLnNoOsSxXzZ bB{cC& fF[ gG] iI jJnN}qQ\vV@wW|xX#zZyY>1'~2" 3+^!4!"5%#6/$7=`%8(&9)'-./QP01qp2qp3$4506,?;7.:8-_*d< bB{ fF[ gG]kKlLmMnN}qQ\vV@wW|zZyY1!~2" 3#^!4$"5%#6&$7/`%8(&9)'0=-'?.+*/0123456,;7.:8-_d<> mMoOpP1!2"@ 3/!4$"5%#6?$7&%8*&9('0)--_.=+/[0']1<>}2<>}3;:~4{5#|\6,'7..8d /^^[0]4``{8aAcCeE gG iIkKlLnNoOsSuUzZ   uR2w w]xyIw|xJzR{7$| x x x xK~\@#f\\\ \\H@\ N| _~\ ^ v ^E m.}K.AĄ[F0 zjl?|xdX(  v      W 1 Q `  @  0 2 A@ A   @  @ @   P0 P  A   h }  } } } @  85     L+ L L2 D   O  {lo  A F  @@@ @ @AA@:F:FP 43W  !      @ @ @ @ A n n@n @nn@0Df @  Q k k"k"k"k"k @^z BF |9 88$D@ 'W W@ @EEE }WQ  k"BFFeeeZZ Z 0145|7   !"#$%&'()*+,-./0000000000:;<=>?@00000000000000000000000000[\]^0`00000000000000000000000000{|}~00000000000000000000000000000000000000000000000000000000000000vt100dt,  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^%% $ $ $ $ $%% %%<%%$%4%,%%d"e"`"  " %" #!#%# # # # ""*#d"`"e"+"4"""""<"C"!!a"""")"*"'"(""!!!!#@[\]^_`{|}~@[\]^_`{|}~|^_`#@_^_`#_#^_`^_#@^_`~#@^_`~^_``#_ABCDEFGHIJKLMNOPQRSTUVWXYZ@ `P0pH(hX8xD$dT4t L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}C#cS3s K+k[;{G'gW7wO/o_?0 !!( 1!2@3#4$5%6^7& 8* 9( 0) -_ =+! qwertyuiop[{]} as d!f"g#h$j%k&l';:('")`~*+\|,z-x.c/v0b1n2m3,<4.>5/?67*89 :;<=>?@ABCD E F G7H8I9J-K4L5M6N+O1P2Q3R0S.W X  / ,-.2"36&7/{ 8([ 9)] 0=} ?\ qQ@z+*'() +#',y2mM3,;4.:5-_V<>| '`+*~)^2"@3#4$6&7/{ 8([ 9)] 0=} +? |'()+'*3,;4.:5-_V<>\ '`|^~ +?\'()V<>| '`|^~ \'()|V<> \`^~&12~"3#'4{(5[-6|7` _8\ 9^ 0@ )] =+}az$q'm(%)+*,w2,?3;.4:/5!V<> 2"35%6&7/ 8( 9) 0= '? ^{[+*}]'@(#)\|+3,;4.:5-_V<> 1!2"34$5%6^7& 8* 9( 0) -_ =+('@)``+#~V\|2"6&7' 8( 9) 0 -= ^~@`[{';+(:*)+]}ps\_y{}\|1!|2"@3#4$~6&7/ 8( 9) 0= '? [+*]'({)\+}3,;4.:5-_V<> !1@-2_/3#;4$:5,6^.7& =8* [9( ]0) ?+' xX%eE{wW}!'(")`~+qQ|-34fF5\9 &1|2@"3#'4(56^7 !8 9{ 0} ) -_az[$*]q'm(%)+`,w2,?3;.4:/5=+~V<>\ `~)<> W  FE7JG7H8I9K4L5M6O1P2Q3R0S.-N, [{ ]}'",<.>pyfgcrl/?=+o e!u"i#d$h%t&n's(-_,;:-q.j/k0x1b3w4v5z:; <=>?@ABCDW X 6^6,7&7.qQwWeErRtTyYuUiIoOpP[{]}aAsS dD!fF"gG#hH$jJ%kK&lL';:('",zZ-xX.cC/vV0bB1nN2mM3,<4.>5/? 6^6,7&7. -_ =+qQwWeErRtTyYuUiIoOpP[{]}aAsS dD!fF"gG#hH$jJ%kK&lL';:('")`~+\|,zZ-xX.cC/vV0bB1nN2mM3,<4.>5/? 1+|2"@3*#46&7/ 8( 9) 0= '? eEz[!]'({) +$},y3,;4.:5-_V<>\ '? ^`~!]['({2"@3#6&7/{ 8([ 9)] 0=} '? <>+*'()\|+3,;4.:5-_V<> 1!2"3#6&7/ 8( 9) 0= '?\ qQ@+*~'({[)|+}]3,;4.:5-_V<> 1!2@3#4$5%6 =+[{'()'"+]}5;:S.V\|s/?2'3^#4+$5%6&7/{ 8([ 9)] 0=} *?\ -_qQ@I~'(i)"+,;345.:V<>| ''+,;`eEoOaAsS&lL,zZ-xX.cC1nN 1'~2"3+^4!5%6/7=` 8( 9) qQ\wW|zZiIQP!fF["gG]$jJ'$()0+qp,yY>-xX#.cC&/vV@0bB{1nN}3,?;4.:5-_*V< 1!~2"3#^4$5%6&7/` 8( 9) 0= '? +*qQ\wW|zZ!fF["gG]%kK&lL'()+,yY/vV@0bB{1nN}2mM3,;4.:5-_V<> 1!2"@3/4$5%6?7& 8* 9( 0) -_ =+oOpP[']';:~({)#|\+<>}2mM3,'4..5V ^^[](``{5eEuUiIoOaAsS"gG%kK&lL,zZ.cC1nN O FZfFZGM4B  " 2 VCƦKL@# H@ J [2X" ҫ  ҫBi>G=W :0P f?  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abc  !"#$%&'()0123456789@ABCDEFGHIPQRSTUVWXY`abcdefghipqrstuvwxy0123456789abcdefghijklmnopqrstuvwxyzOpenBSD4.0RAMDISK#217 @(#)OpenBSD 4.0 (RAMDISK) #217: Mon Sep 18 11:58:24 MDT 2006 OpenBSD 4.0 (RAMDISK) #217: Mon Sep 18 11:58:24 MDT 2006 deraadt@cats:/usr/src/sys/arch/cats/compile/RAMDISK dackirqsizeiomemiosizdrqdrq2channeldrivetargetlunphydevfunctionconfigurationvendorproductreleasereportidconsolemuxslotwsmuxloopbpfiltervga_init_screen: no font vga_init_screen: no fontvga_common_setup: couldn't map vga iovga_common_setup: couldn't map 6845 iovga_common_setup: couldn't map memoryvga_common_setup: mem subrange failedvga_free_screen: consolevga_doswitch: disappeared vga: pcvt font support not built in, see vga(4) vgadrive at %s channel %d drive %datapiscsi at %s channel %dwdcspl%s channel %d: reset failed for drive 1 drive 0atapi type: %s c_bcount: %d c_skip: %d missing untimeoutwdc_probe_caps%s(%s:%d:%d): using PIO mode %d, Ultra-DMA mode %d, DMA mode %d using BIOS timings%s: transfer error, downgrading to PIO mode %d %s: transfer error, downgrading to DMA mode %d %s: transfer error, downgrading to Ultra-DMA mode %d wdccmdwdccommandwdccommandext%s:%d: %s %s(%s:%d:%d): %s physio split wd ioctl request... cannot proceed user_strat: No ioctl TagSCB %d - Abort%s Completed. Bus Device ResetSelection Timeout%s: ahc_intr - referenced scb not valid during SELTO scb(%d, %d) parity error detected %s. SEQADDR(0x%x) SCSIRATE(0x%x) non- Unexpected %sDT Data Phase Illegal CRC packet request No terminal CRC packet recevied CRC Value Mismatch %s:%c:%d: %s: Someone reset channel %c %s: Transceiver State Has Changed to %s mode %s: Spurious SCSI interrupt NONEaic7770aic7850aic7855aic7859aic7860aic7870aic7880aic7895aic7895Caic7890/91aic7896/97aic7892aic7899Illegal Host AccessIllegal Sequencer Address referrencedIllegal Opcode in sequencer programSequencer Parity ErrorData-path Parity ErrorScratch or SCB Memory Parity ErrorPCI Error detectedCIOBUS Parity Errorin Data-out phasein Data-in phasein DT Data-out phasein DT Data-in phasein Command phasein Message-out phasein Status phasein Message-in phasewhile idlein unknown phase80.040.033.020.016.013.410.08.06.675.75.04.44.03.6%s: WARNING no command for scb %d (cmdcmplt) QOUTPOS = %d Attempt to queue invalid SCB tag %x:%x%s: brkadrint, %s at seqaddr = 0x%x ahc_intr: seqint, intstat == 0x%x, scsisigi = 0x%x %s:%c:%d: unknown scsi bus phase %x, lastphase = 0x%x. Attempting to continue %s:%c:%d: Warning - unknown message received from target (0x%x). Rejecting ahc_intr: HOST_MSG_LOOP bad phase 0x%x %s:%c:%d: no active SCB for reconnecting target - issuing BUS DEVICE RESET SAVED_SCSIID == 0x%x, SAVED_LUN == 0x%x, ARG_1 == 0x%x ACCUM = 0x%x SEQ_FLAGS == 0x%x, SCBPTR == 0x%x, BTT == 0x%x, SINDEX == 0x%x SCSIID == 0x%x, SCB_SCSIID == 0x%x, SCB_LUN == 0x%x, SCB_TAG == 0x%x, SCB_CONTROL == 0x%x SCSIBUSL == 0x%x, SCSISIGI == 0x%x SXFRCTL0 == 0x%x SEQCTL == 0x%x Unable to clear parity error. Resetting bus. %s:%c:%d:%d: Attempt to issue message failed data overrun detected %s. Tag == 0x%x. HaveHaven't%s seen Data Phase. Length = %ld. NumSGs = %d. sg[%d] - Addr 0x%x%x : Length %d Bogus TAG after DMA. SCBPTR %d, tag %d, our tag %d for safety%s: BTT calculation out of range SEQ_FLAGS == 0x%x, SCBPTR == 0x%x, BTT == 0x%x, SINDEX == 0x%x , A == 0x%x %s: No free or disconnected SCBs %s:%c:%d: Missed busfree. Lastphase = 0x%x, Curphase = 0x%x %s: Interrupted for status of 0 (?) ahc_intr - referenced scb not valid during seqint 0x%x scb(%d) HOST_MSG_LOOP with invalid SCB %x %s: Missing case in ahc_handle_scsiint. status = %x Unexpected busfree %s SEQADDR == 0x%x %s: %s: Infinite loop in critical section critical section loop%s: ahc_alloc_tstate - Target already allocated DT%s: target %d synchronous at %sMHz%s, offset = 0x%x %s: target %d using asynchronous transfers %s: target %d using %dbit transfers %s:%c:%d:%d: Bus Device Reset Message Sent Abort%s Message Sent ahc_intr: AWAITING_MSG for an SCB that does not have a waiting message SCSIID = %x, target_mask = %x SCB = %d, SCB Control = %x, MSG_OUT = %x SCB flags = %xNo or incomplete CDB sent to device. %s: Issued Channel %c Bus Reset. %d SCBs aborted Protocol violation %s. Attempting to abort. Completed command without status. Unknown protocol violation. No SCB found during protocol violation Target did not send an IDENTIFY message. LASTPHASE = 0x%x. HOST_MSG_LOOP interrupt with no active messageUnknown REQINIT message typeTarget MSGIN with no active message(%s:%c:%d:%d): Target Initiated PPR (%s:%c:%d:%d): Initiator Initiated PPR (%s:%c:%d:%d): requested %dBit transfers. Rejecting... (%s:%c:%d:%d): refuses WIDE negotiation. Using 8bit transfers orderedhead of queue(%s:%c:%d:%d): refuses %s tagged commands. Performing simple queue tagged I/O only (%s:%c:%d:%d): refuses tagged commands. Performing non-tagged I/O %s:%c:%d: Message reject for %x -- ignored (%s:%c:%d:%d): refuses synchronous negotiation. Using asynchronous transfers %s: %s on %c:%d. %d SCBs aborted Unsupported adapter type (0x%x). Ignoring %s: WARNING - Failed chip reset! Trying to initialize anyway. hardware SCB structuressense buffers%s: ahc_init_scbdata - Unable to allocate initial scbs %s: No SCB space found SG spaceUltra Ultra160 Ultra2 SingleWide%s%s Channel %c, SCSI Id=%d, %d SCBs%d/%d SCBsTwin Channel, A SCSI Id=%d, B SCSI Id=%d, primary %c, shared data%s: Host Adapter Bios disabled. Using default SCSI device parameters %s: unable to allocate ahc_tmode_tstate. Failing attach Infinite interrupt loop, INTSTAT = %xInactive SCB in Wait List scb_index = %d, next = %d Waiting List traversalWaiting List inconsistency. SCB index == %d, yet numscbs == %d.found = %d, qinstart = %d, qinfifionext = %d First/Second Qinfifo fixupInactive SCB in qinfifo qinpos = %d, SCB index = %d Loop 1Disconnected List inconsistency. SCB index == %d, yet numscbs == %d.Disconnected List Loop. cur SCBPTR == %x, prev SCBPTR == %x.Inactive SCB on pending list Bogus resid sgptr value 0x%x %s: Program too large for instruction memory size of %d! ahc_loadseq: Could not malloc%s: BMOV not supportedUnknown opcode encountered in seq program%s[0x%x]:(|%s%s================== Dump Card State Begins ================= %s: Dumping Card State %s, at SEQADDR 0x%x ACCUM = 0x%x, SINDEX = 0x%x, DINDEX = 0x%x, ARG_2 = 0x%x HCNT = 0x%x SCBPTR = 0x%x SCSISIGIERRORSCSIBUSLLASTPHASESCSISEQSBLKCTLSCSIRATESEQCTLSEQ_FLAGSSSTAT0SSTAT1SSTAT2SSTAT3SIMODE0SIMODE1SXFRCTL0DFCNTRLDFSTATUSSTACK: SCB count = %d Kernel NEXTQSCB = %d Card NEXTQSCB = %d QINFIFO entries: Waiting Queue entries: %d:%d Disconnected Queue entries: QOUTFIFO entries: Sequencer Free SCB List: Sequencer SCB Info: %3d SCB_CONTROLSCB_SCSIIDSCB_LUNSCB_TAGPending list: Kernel Free SCB list: FEATURES = 0x%x, FLAGS = 0x%x, CHIP = 0x%x BUGS =0x%x ================= Dump Card State Ends ================== Untagged Q(%d): (SCSIPHASECard was paused %s: failed to create DMA map for %s, error = %d %s: failed to load DMA map for %s, error = %d %s: failed to map DMA mem for %s, error = %d %s: failed to allocate DMA mem for %s, error = %d ahcahc_attachcmd fail %s: board is not responding %s: Illegal cable configuration!!. Only two connectors on the adapter may be used at a time! adv%s: unable to allocate control structures, error = %d %s: unable to map control structures, error = %d %s: unable to create control DMA map, error = %d %s: unable to load control DMA map, error = %d %s: unable to initialize ccb, error = %d %s: unable to create DMA map, error = %d advccb%s: unable to load overrun buffer DMA map, error = %d %s: unable to create overrun buffer DMA map, error = %d %s: unable to map overrun buffer, error = %d %s: unable to allocate overrun buffer, error = %d %s -set: tag queuing enabled w/o disconnects unknown warning %d I/O port increment switch enabled %s -get: Chip is not halted Couldn't get MicroCode Start address I/O port address modified EEPROM checksum error IRQ modified adv_init: adv_find_signature failed%s: bad signature%s: unable to initialize board RISC chip%s: unable to create control blocks %s: WARNING: only %d of %d control blocks created %s: unable to load MicroCode%s: unable to initialize MicroCode%s: adv_scsi_cmd, more than %d dma segments %s: adv_scsi_cmd, error %d loading dma map timed out AGAIN. Resetting Bus %s: exiting ccb not allocated! %s: timed out [ecb %p (flags 0x%x, dleft %x, stat %x)], AGAIN sync negotiation disabled espESP100ESP100AESP200NCR53C94NCR53C96ESP406FAS408FAS216AM53C974FAS366/HMEout of memory %s: unknown variant %d, devices not attached : %s, %dMHz, SCSI ID %d %s: unknown revision code, assuming ESP100 %s: resetting SCSI bus ncr53c9x_ecb[NCR_INIT(%d) %d] SELATNS [ncr53c9x_select(t%d,l%d,cmd:%x,tag%x,%x)] [0x%x, %d]->%d [ncr53c9x_scsi_cmd] [ncr53c9x_poll: rescheduling] [ncr53c9x_poll] %d:%d busy [ncr53c9x_sched] ncr53c9x_sched: not IDLE (state=%d)requesting sense sense=0x%02x resid=%lu %s: QFULL -- throttling to %d commands [ncr53c9x_done(error:%x)] [flushfifo] cont [rdfifo %s (%d): %02xncr53c9x_rdfifo: bad flag[wrfifo(%d):ncr53c9x_sched_msgout %x %d %s: reselect from target %d lun %d tag %x:%x with no nexus; sending ABORT %s: reselect with invalid selid %02x; sending DEVICE RESET %s: msgin: no msg byte available %s: phase change, dropping message, prev %d, state %d %s: unexpected MESSAGE IN; sending DEVICE RESET %s: reselect without IDENTIFY; MSG %x; sending DEVICE RESET got %ld extra bytes cmdcomplete unrecognized MESSAGE EXTENDED; sending REJECT %s: wide mode %d async mode max sync rate %d.%02dMB/s SDTR period %d, offset %d extended(%x) save datapointer restore datapointer disconnect %s: tagged queuing rejected: target %d (rejected sent tag)%s: sync transfer rejected: target %d %s: wide transfer rejected: target %d msg reject (msgout=%x) noop unrecognized MESSAGE; sending REJECT ident TAG %x:%x%s: TAG reselect without IDENTIFY; MSG %x; sending DEVICE RESET gotmsg(%x) state %d[ncr53c9x_msgin(curmsglen:%ld)] %s at line %d: no nexus %s at line %d: unexpected MESSAGE OUT phase [ncr53c9x_msgout(priq:%x, prevphase:%x)]%s: waiting for SCSI Bus Reset to happen %s: identify failed, state %d, intr %02x selid=%2x %s: RESELECT: %d bytes in FIFO! [intr %x, stat %x, step %d, prevphase %x] %s: target didn't identify backoff selector ncr53c9x: no nexus%s: MSGIN: unexpected FC bit: [intr %x, stat %x, step %x] %s: MSGIN: weird bits: [intr %x, stat %x, step %x] MESSAGE_IN_PHASE %s: unexpected bus phase; resetting MESSAGE_OUT_PHASE DATA_OUT_PHASE [%ld] COMMAND_PHASE 0x%02x (%d) DATA_IN_PHASE STATUS_PHASE ncr53c9x no nexus%s: step 1 & !NEG %s: !MSGOUT (%s:%d:%d): selection failed; %d left in FIFO [intr %x, stat %x, step %d] (%s:%d:%d): select; %lu left in DMA buffer [intr %x, stat %x, step %d] %s: unexpected status after select: [intr %x, stat %x, step %x] <>%s: target didn't send tag: %d bytes in fifo [%d] %s: STATUS_PHASE: msg %d %s: can't get status, only %d bytes %s: ICCS: : [intr %x, stat %x, step %x] %s: invalid state: %d sync nego not completed! %s: unexpected disconnect; sending REQUEST SENSE %s: SCSI bus parity error %s: DMA error; resetting %s: !TC on DATA XFER [intr %x, stat %x, step %d] prevphase %x, resid %x %s: !TC on MSG OUT [intr %x, stat %x, step %d] prevphase %x, resid %lx %s: illegal command: 0x%x (state %d, phase %x, prevphase %x) %s: SCSI bus reset regs[intr=%02x,stat=%02x,step=%02x,stat2=%02x] [ncr53c9x_intr: state %d] %s: nexus in reset stateDMA activetagged DT %s: target %d now using %s%s%d bit MHz %d REQ/ACK offset xfers 13.3??3.33async siop: can't find my sync parameters%s: unable to allocate script DMA memory, error = %d %s: unable to map script DMA memory, error = %d %s: unable to create script DMA map, error = %d %s: unable to load script DMA map, error = %d %s: rejecting invalid wide negotiation from target %d (%d) %s: rejecting invalid PPR negotiation from target %d %s: ppr negotiation for target %d: offset (%d) or sync (%d) out of range %s: ppr negotiation for target %d: transfer width (%d) incompatible with dt %s: ppr negotiation for target %d: sync (%d) incompatible with adapter %s: ppr negotiation for target %d: no DT option %s: bad offset in siop_sdp (%d) clear fifo failed %s: timeout waiting for DIFFSENSE to stabilise %s: invalid SCSI mode 0x%x %s: switching to differential mode %s: switching to LVD mode %s: switching to single-ended mode siop%s: can't alloc lunsw for target %d %s: unexpected phase mismatch %d %s: selection timeout without command %s: unexpected disconnect without command != NULL%s: siop_intr() - we should not be here! istat = 0x%x, dstat = 0x%x, sist = 0x%x, sstat1 = 0x%x need_reset = %x, irqcode = %x, siop_cmd %s %s: script interrupt (0x%x) with invalid DSA !!! unknown irqcode %x unhandled message 0x%x scsi message reject, extended message sent was 0x%x scsi message reject, message sent was 0x%x our reject message was rejected %s: done without command, DSA=0x%lx invalid retval from siop_wdtr_neg()invalid retval from siop_sdtr_neg()MSG_IGN_WIDE_RESIDUE: bad len %d invalid retval from siop_iwr()%s: extended message too big (%d) %s: target %d lun %d tag %d reselect without command %s: target %d reselect with invalid lun %d %s: reselect with invalid target %d %s: reselect with invalid target error, DSP=0x%x reselect failed %s: reselect with invalid tag %s: command with invalid status (IRQ code 0x%x current status %d) ! %s: unhandled scsi interrupt, sist=0x%x sstat1=0x%x DSA=0x%x DSP=0x%x parity error %s:%s: phase mismatch without command scsi gross error %s: DMA IRQ: DMA fifo empty, DSP=0x%x DSA=0x%x: last msg_in=0x%x status=0x%x current DSA invalid parity bus fault illegal instructionsingle step dsp 0x%08x dsa 0x08%x INTRF %s: unable to load data DMA map (for SENSE): %d %s: request sense failed %s: untagged command already running for target %d lun %d (status %d) %s: scsi bus reset cmd %p added to reset list from urgent list cmd %p added to reset list from ready list cmd %p (status %d) reset with status %d, xs->error %d cmd %p (tag %d) added to reset list %s: unable to load data DMA map: %d %s: can't alloc siop_lun for target %d lun %d %s: can't malloc memory for target %d siop_start: bad statustimeout on SCSI command 0x%x %s: unable to allocate cbd DMA memory, error = %d %s: unable to load cbd DMA map, error = %d %s: unable to create data DMA map for cbd: error %d %s: unable to create cbd DMA map, error = %d %s: unable to map cbd DMA memory, error = %d %s: can't allocate memory for command descriptors %s: can't allocate memory for command descriptors head siop: resel switch fullsiop_stat_intr %d siop_stat_intr_shortxfer %d siop_stat_intr_xferdisc %d siop_stat_intr_sdp %d siop_stat_intr_saveoffset %d siop_stat_intr_done %d siop_stat_intr_lunresel %d siop_stat_intr_qfull %d lc%s: fatal RXD error, attempting recovery %s: recovery failed -- board disabled %s: reset: EEPROM checksum failed (0x%x) PIO mode (internal 2KB window)2KB windowchanged 32KB window to 2KBchanged 64KB window to 2KB%s: address %s, %dKB RAM, %s %s: disabled due to error %s: command never completed! %s: eeprom failed to come ready %s: reset didn't complete %s: bogus xcvr value in EEPROM (%x) %s: choosing new default based on card type %s: WARNING: no media options bits set in the media options register!! %s: this could be a manufacturing defect in your adapter or system %s: attempting to guess media type; you should probably consult your vendor %s: unknown device ID: %x -- defaulting to 10baseT %s: guessing MII %s: guessing 10/100 internal %s: guessing 10BaseT transceiver %s: guessing COMBO (AUI/BNC/TP) %s: guessing 10baseFL %s: guessing 100BaseT4/MII %s: guessing TPC (BNC/TP) %s: guessing 10/100 plus BNC/AUI %s: bad receive status -- packet dropped %s: transmission error: %x %s: initialization failed: no memory for rx buffers %s: unknown XCVR type: %d %s: watchdog timeout %s: no carrier - transceiver cable problem? %s: failed to read station address : can't alloc list mem : can't map list mem : can't alloc list map : can't load list map : can't create rx spare map : can't create tx spare map : can't create tx map : can't create rx map xl%s: warning: SCB timed out fxp: %s, address %s %s: no phy found, using manual mode %s: Disabling dynamic standby mode in EEPROM, New ID 0x%x, cksum @ 0x%x: 0x%x -> 0x%x %s: Failed to malloc memory %s: unable to create rx dma map %d, error %d %s: unable to create tx dma map %d, error %d fxp_stop: no buffers!%s: device timeout %s: fxp_mdi_read: timed out %s: fxp_mdi_write: timed out fxp-d101afxp-d101b0fxp-d101mafxp-d101sfxp-d102fxp-d102cfxp-d102e%s: timeout loading microcode %s: failed loadfirmware of file %s: errno %d %s: phy_read: bad phy register %x %s: phy_write: bad phy register %x %s: failed to force tx and rx to idle state %s: reset never completed! %s: MII without any PHY! %s: failed to force tx to idle state dcne2000_attach: setup failed : where did the card go? ne2000_detect%s: remote transmit DMA failed to complete ne2000_write_mbuf: negative len%s: %d silo overflow%s, %d ibuf overflow%s comprmcomstartcomcninit: mapping failed: unknown uart %s: console : ns8250, no fifo : ns16450, no fifo : ns16550, no working fifo : ns16550a, %d byte fifo : st16650, no working fifo : st16650, %d byte fifo : ti16750, 64 byte fifo comattach: bad fifo type%s: can't establish soft interrupt%s: probed fifo depth: %d bytes kbdauxkbc: cmd word write error kbc: aux echo error 1 kbc: aux echo error 2 (%s slot)pckbc_slot_enable(%d) failed pckbc_cmd: send error pckbc: command timeout pckbc_start: command error pckbc_start: send error kbccmdpckbc_set_inputhandler: bad slot %dpckbcintr: no dev for slot %d pckbcihaerror %d loading SG list dma map buffer needs >%d dma segments error %d loading buffer dma map iha_init_tulip%s: couldn't create SCB SG DMA map, error = %d %s: couldn't create SCB data DMA map, error = %d error %d loading request sense buffer dma map SCSI Parity error detected SCSI OpCode 0x%02x timed out %s: target %d using %d bit %d.%d MHz %d REQ/ACK offset %s: unable to allocate SCBs, error = %d %s: unable to map SCBs, error = %d iha: invalid EEPROM, bad signature or checksum version %d.%d%s %s: unsupported OHCI revision %s: reset timeout %s: SMM does not respond, resetting ohci, legacy support%s: blocking intrs 0x%x %s: unrecoverable error, controller halted %s: resume detect %s: %u scheduling overruns ohci_add_done: addr 0x%08lx not foundohci_rem_ed: ED not foundohci_abort_xfer: not in process contextohciabohci_root_ctrl_startOHCI root hubohci_setintr: 0 interval %s: isoc TD alloc failed ohci_device_isoc_abort: early return rd%drdattach: device name too long RAM diskfictitiousrd_idleAll breakpoints used. Already set. Too many breakpoints. Not set. No breakpoints set Map Count Address %s%p %5d %-12sdb_commandCount missing Bad modifier Ambiguous No such command Malloc debugging not enabled. the kernel did not panic procscalloutbreaksextentsmallocobjectpanicpoolprocregistersuvmexpvnodewatchescrashhaltrebootpoweroffmachineexaminesearchdeletebreakdwatchwatchstepcontinueuntilnextmatchtracecallshowboothelphangmandmesgddb> Bad function %#n Argument missing Too many arguments ELF[ %s symbol table has bad start address %p ] ELFbad magic[ %s ELF symbol table not valid: %s ] bad e_machine.strtab.symtabsymtab unaligned[ using %lu bytes of %s ELF symbol table ] symtab corrupted= 0x%lx %c\%03o%-*ld%-*lo%-*lr%-*lu%-*lx%-*lz: %*d%*o%*r%*u%*x%*zAddress missing Value missing Syntax error Symbol not found Divide by 0 Negative shift amount ^R String too long Bad escape Bad character Bad character in number End of stack trace. --db_more-- -%*lo-%#*lo-%*lu-%#*lu-%*lx-%#*lxFaulted in traceback, aborting... Starting stack trace... %-12s%#*ln %s+%#lr[after %6d] bsd[ no symbol table formats found ] No slots left for %s symbol tableUnable to find symbol table slot for %s.invalid symbol table name%s %s%s Sifting table %s: db_printsym [%s:%d]+%sBreakpoint at Stopped at RUN AT LEAST 'trace' AND 'ps' AND INCLUDE OUTPUT WHEN REPORTING THIS PANIC! DO NOT EVEN BOTHER REPORTING THIS WITHOUT INCLUDING THAT INFORMATION! After %d instructions (%d loads, %d stores), radixmaxoffmaxwidthtabstopslineslogUnknown variable No value All watchpoints used. No map. Too many watchpoints. No watchpoints set Map Address Size %s%p %8lx %lx Unknown size %#8n = %#8n Nothing written. () Score: %lu/%lu db_hangman/etc/firmware/%sdp8390_initdp8390_start: no header mbuf%s: NIC memory corrupt - invalid packet length %d : failed to clear NIC buffer at offset %x - check configuration %s: device enable failed arc4_stirextract_entropyrndrdRRIP without PX field? RRIP with incorrect flags?RRIP with incorrect NM flags? IEEE_P1282RRIP_1991AIEEE_1282SPcd9660_mountroot: can't setup bdevvp'scd9660root_deviceCD001%/@%/C%/Eisoinodefhtovp: directory crosses block boundary %d[off=%d/len=%d] fhtovp: bread error %d fhtovp: crosses block boundary %d fhtovp: lbn exceed volume space %d cd9660_strategy: spectag VT_ISOFS, isofs vnode elf32_load_fileOpenBSD#!/dev/fd/%dswapperfork initcfpendcannot mount rootcannot find root vnodepagedaemonfork pagedaemonreaperfork reapercleanerfork cleanerupdatefork updateaiodonedfork aiodoned/sbin/init/sbin/oinit/sbin/init.bak/dev/consolewarning: /dev/console does not exist warning: /dev/console error %d initexecinit: couldn't allocate argument spaceexec %s: error %d init: not found no initinitclocks: unable to register softclock intrfileplfdescpldup2: fdallocfdlockclosefkqeueplknoteplkqreaduser mapping failed kernel mapping failed %d init died (signal %d, exit %d)waitppwaitWARNING: thread `%s' (%d) exits with status %d unable to allocate kthread_qlockmgr: make up your mindlockmgr: not holding exclusive locklockmgr: unknown locktype request %dlockmgr: non-zero exclusive countlockmgr: locking against myselflockmgr: upgrade exclusive locklockmgr: processor %lu, not exclusive lock holder %lu unlockinglockmgr: pid %d, not exclusive lock holder %d unlockinglockmgr: draining against myself lock type %s: EXCL (count %d) by processor %lupid %d with %d pending not locked lock type %s: SHARED (count %d)malloc: allocation too largemalloc: out of space in kmem_map%d,physbufphysio%-16s %-8s %18p %s %5d %5d %5d %d %#10x %-9.9s %-16s COMMANDSTRUCT PROC *UAREA * PID %-10s %18s %18s %18s VMSPACE/VM_MAP PID %-16s %-8s %18s %s EMULWAIT-CHANNELWAIT-MSGWAITPPIDPGRPUID PID %5s %5s %5s S %10s %-9s %-16s usage: show all procs [/a] [/n] [/w] /a == show process address info /n == show normal process info [default] /w == show process wait/emul info procinit: mallocprocplzombieplucredplpgrpplsessionplpcredplchgproccnt: procs < 0idlestopzombiedeadonprocADVLOCKCTTYINMEMNOCLDSTOPPPWAITPROFILSELECTSINTR SUGID SYSTEM TIMEOUT TRACED WAITEDWEXITEXECPWEUPCSSTEPSUGIDEXECNOCLDWAITNOZOMBIEINEXECSYSTRACECONTINUEDSWAPINBIGLOCKTHREADIGNEXITRVSOFTDEPPROC (%s) pid=%d stat=%s flags=%b pri=%u, usrpri=%u, nice=%d forw=%p, back=%p, list=%p,%p user=%p, vmspace=%p estcpu=%u, cpticks=%d, pctcpu=%u.%u%, swtime=%u user=%llu, sys=%llu, intr=%llu mawn%c%5d %-10.10s %18p %18p %18p plimitplsensorssensors kthreadsigaplpauseissignal coredump%s.corehashinit: bad cntsysctlsysctl_disklockkern_sysctl%s,denied attempt to set clock forward to %ld denied attempt to set clock back %ld seconds nanosleep%9d %2d/%-4d %8x %s ticks now: %d ticks wheel arg func smashed stack in %spreempt: cpu_preempt not yet implementedsetrunnable not configured unsupported >>> %s probe returned %d >>> probing for %s* mapply: no match function for '%s' device>>> %s probe won >>> no winning probe root device %s not configured %s at %s%s (root)config_make_softcconfig_make_softc: allocation for device softc failed%s%dconfig_make_softc: duplicate %sexpandcreatconfig_make_softc: %sing dev arrayconfig_make_softc: device name too long%s detached config_detach: forced detach of %s failed (%d)config_defer: can't defer config of a root deviceconfig_defer: can't allocate defer structurewrit%s%d%c: %s %sing fsbn %d of %d-%d (%s%d bn %d; cn %d tn %d sn %d)disk_attach: can't allocate storage for disklabeldisk_detach: disk_count < 0disk_unbusy: %s: dk_busy < 0 rootdev=0x%x rrootdev=0x%x rawdev=0x%x cannot open disk, 0x%x/0x%x, error %dfilesystem type %d not known.. assuming ffs dk_mountrootcannot read disk label, 0x%x/0x%x, error %droot filesystem has size 0bufq_default_alloc: no memoryintrextentplextntextent_free: start 0x%lx, end 0x%lx extent_free: region not foundFLWANTEDWANTEDNOCOALESCEFIXEDextent `%s' (0x%lx - 0x%lx), flags=%b 0x%lx - 0x%lx extent_print: NULL extentklogmtx_enter: ipl not implementedphpoolpcgpoolpool_init: too much uptimepool_get: %s: page emptypool_put: %s: page header missing page %p, nmissing %d, time %lu,%lu POOL %s: size %u, align %u, ioff %u, roflags 0x%08x alloc %p minitems %u, minpages %u, maxpages %u, npages %u itemsperpage %u, nitems %u, nout %u, hardlimit %u nget %lu, nfail %lu, nput %lu npagealloc %lu, npagefree %lu, hiwat %u, nidle %lu empty page list: full page list: partial-page list: no current page cache %p: allocfrom %p freeto %p hits %lu misses %lu ngroups %lu nitems %lu group %p: avail %d %p no log curpage %p FailReleasesPgreqPgrelNpageHiwatMinpgMaxpgIdleNameSizeRequests%-10s%4s%9s%5s%9s%6s%6s%6s%6s%6s%6s%5s db_show_all_pools%u%-*s %*u %*lu %*d %*s %*lu inf%-10s %18p %18p %-10s %18s %18s Allocatorusage: show all pools [/a] pool(%p:%s): page inconsistency: page %p; at page head addr %p (p %p) pool(%p:%s): page inconsistency: page %p; item ordinal %d; addr %p (p %p) kernel %sassertion "%s" failed: file "%s", line %d%s: table is full panic: splassert: %s: want %d have %d spl assertion failure in %slogprikprintf%llx%lld%llobug in kprintf: bad base0123456789ABCDEF(null)0123456789abcdefaddchangeddbdisableenableexitfindlistquittimezoneverbosev--- more --- 0%o*UNKNOWN**FOUND*%3d free slot (for add) Unknown devno (max is %d) %3d at disable %s flags 0x%x ???%3d %s count %d (pseudo device) %s [] ? Unknown argument %3d can't change free slot change (y/n) ?%3d %s changed flags changed out of memory. alreadyError unknown state %3d can't disable free slot %3d %s can't disable pseudo device %3d can't enable free slot %3d %s can't enable pseudo device command args description [count] number of lines before more enter ddbdev add a device8|10|16 base on large numbersdevno|dev change devicesattr val|devno|dev disable devicesattr val|devno|dev enable devicesdevno|dev find devices this message list configuration leave UKC[attr [val]] show attributes (or devices with an attribute)[mins [dst]] set timezone/dst don't know toggle verbose bootingUnknown routine /%c/ Unknown attribute Unknown pseudo routine /%c/ Value missing for attribute %s ? Not same device type No more space for new devices. No device of this type exists. Clone Device (DevNo, 'q' or '?')Insert before Device (DevNo, 'q' or '?')Device not complete number or * is missing Argument expected Dev expected 8|10|16 expected DevNo or Dev expected Attr, DevNo or Dev expected timezone = %d, dst = %d Unknown command disautoconf verbose %sabled Unknown command, try help User Kernel Config UKC> Continuing... sys_ioctlselectpipelkpiperdpipewrpipeclpipeplttckoutqttwritettyrub: would panic c = %d, val = %d load: %d.%02d not a controlling terminal no foreground process group runningrunnableiowait cmd: %s %d [%s] %ld.%02ldu %ld.%02lds %d%% %ldk empty foreground process group putc: required clalloc b_to_q: required clalloc WARNING: mclpool limit reached; increase kern.maxclustersmbplmclplm_copym0: null mbufm_copym0: m == NULL and not COPYALLm_copym0: off %d, len %dm_copydata: off %d < 0m_copydata: null mbuf in skipm_copydata: null mbufm_copydata: len %d < 0m_apply: len %d < 0m_apply: null mbuf in skipm_apply: null mbufm_apply: off %d < 0m == NULL in m_pulldown()unixsockplsoclose: NOFDREFsoaccept: !NOFDREFsbappendaddrsbappendcontrolsemi-panic: sbcompresssbdropsbcreatecontrol: message too large %d acceptuipc 1uipc 2uipc 4piusrrequnp_attachunp_bindunp_connect2unp_disconnectbremfree: lost tailbufplgetblkallocbuf: buffer larger than MAXBSIZE requestedgetnewbufbiowaitbiodone alreadynchplcluster_read: DONE bpcluster_callback: too little memoryClustered Block: %d addr %x bufsize: %ld Child Block: %d addr: %x Clustered write to wrong blocksvop_generic_revokealloperation %s not listed in %s. vfs_op_descsvfs_opv_init: bad operationvfs_opv_init: operation vector without default routine.nameilockfpllf_findoverlap: defaultrelookup: null namerelookup: lookup on dot-dotvnodesvfslock%s_mountroot failed: %d vgetvclean: deadlockvclean: cannot reclaimvclean: not cleanvgonemissing bdevvgonel: not cleanmissing aliaskinfo: vp changed WARNING: some file systems would not unmount retrying unmount of %s failed with error %d syncing disks... giving up done softdep vwakeup: neg numoutputvinvalbufvinvalbuf: flush failedvinvalbuf: dirty bufsvflushbufvflushbuf: not dirtybgetvp: not freebrelvp: NULLAGENEEDCOMMITASYNCBADBUSYCACHECALLDELWRI DIRTY DONE EINTR ERROR GATHEREDINVALLOCKEDNOCACHEPAGETPGINPHYSRAWREADTAPEUAREAWANTEDWRITEINPROGXXXDEFERREDSCANNEDPDAEMON vp %p lblkno 0x%x blkno 0x%x dev 0x%x proc %p error %d flags %b bufsize 0x%lx bcount 0x%lx resid 0x%zx sync 0x%x data %p saveaddr %p dep %p iodone %p dirty {off 0x%x end 0x%x} valid {off 0x%x end 0x%x} VNONVREGVDIRVBLKVCHRVLNKVSOCKVFIFOVBADNONUFSNFSMFSMSDOSFSLFSLOFSFDESCPORTALKERNFSPROCFSAFSISOFSADOSFSEXT2FSNCPFSVFSXFSNTFSUDFtag %s(%d) type %s(%d) mount %p typedata %p data %p usecount %d writecount %ld holdcnt %ld numoutput %d clean bufs: bp %p dirty bufs: RDONLYSYNCHRONOUSNOEXECNOSUIDNODEVASYNCEXRDONLY EXPORTED DEFEXPORTED EXPORTANON EXKERB LOCALQUOTAROOTFSflags %b vnodecovered %p syncer %p data %p vfsconf: ops %p name "%s" num %d ref %d flags 0x%x statvfs cache: bsize %x iosize %x blocks %u free %u avail %u files %u ffiles %u f_fsidx {0x%x, 0x%x} owner %u ctime 0x%x syncwrites %lu asyncwrites = %lu fstype "%s" mnton "%s" mntfrom "%s" locked vnodes: %p %p, %pall vnodes: %p, %p,syncersyncer vnode sys_mountmount: lost mountunmount: dangling vnodesys_statfssys_fstatfssys_getfsstatsys_getfhsys_fhopensys_fhstatsys_fhstatfsvn_lockvop_islockedvop_lookupvop_createvop_mknodvop_openvop_closevop_accessvop_getattrvop_setattrvop_readvop_writevop_leasevop_ioctlvop_pollvop_kqfiltervop_revokevop_fsyncvop_removevop_linkvop_renamevop_mkdirvop_rmdirvop_symlinkvop_readdirvop_readlinkvop_abortopvop_inactivevop_reclaimvop_lockvop_unlockvop_bmapvop_printvop_pathconfvop_advlockvop_reallocblksvop_strategyvop_bwritedead_read: lockdead_write: locktag VT_NON, dead vnode dead_badop calledchkvnlockfifowfifortag VT_NON, fifo with %ld readers and %ld writersfifo_badop calledspec_read typespec_write typespec_ioctlspec_fsyncspec_fsync: not dirtyspec_close: not specialtag VT_NON, dev %d, %d spec_badop calledspec_open_clone(): cloning device (%d, %d) for pid %u spec_open_clone(): new minor for cloned device is %d spec_close_clone(): freeing minor %d of dev %d for pid %u dos2unixtime(): month value out of range (%ld) denodedeget(): pcbmap returned %d detrunc(): can't truncate root directory, clust %ld, offset %ld deextend: file too largeextendfile(): attempt to extend root directory extendfile: pcbmapmsdosfs_lookup. .. doscheckpath(): .. not a directory? RRaArrAamsdosfs_sync: rofs mod dev %d, %d, %s msdosfs_createmsdosfs_write(): bad file typemsdosfs_renamemsdosfs_rename: lost to startdirmsdosfs_rename: lost from startdirmsdosfs_rename: updating .. in root directory?msdosfs_mkdirmsdosfs_readdir.msdosfs_strategy: spectag VT_MSDOSFS, startcluster %ld, dircluster %ld, diroffset %ld (LOCKED)bpf_detachd: descriptor not in listbpf: ifpromisc failedbpfbpfwritebpf_mcopybpfattachtoo many interfacesif_attachhead: mallocif_attach: mallocif_clone_listifioctlifconfif_getgroupif_getgroupmembersegressif_group_egress_buildifpromisc%s: can't handle af%d lo%dlooutput: no header mbufifmedia_add: can't malloc entryifmedia_set: no match for 0x%x/0x%x ifmedia_set failedrn_addmask: mask impossibly already in tree Mask for route not entered Non-unique normal route, mask not entered rn_delete: inconsistent annotation rn_delete: couldn't find our annotation rn_delete: couldn't find us %s %p at %p rn_delete: Orphaned Maskrn_init: radix functions require max_keylen be set rn_initrn_init 2raw_usrreqrtentplroute_init rtable_addrtfreertfree: %p not freed (neg refs) rtfree 2ifafreertrequest deletertinit: wrong ifa (%p) was (%p) rttmrplrt_timer_init: already initializedrt_timer_queue_destroy: rtq_count reached 0 rt_timer_remove_all: rtq_count reached 0 rt_timer_add: rtq_count reached 0 rt_timer_timer: rtq_count reached 0 route_outputsysctl_dumpentryroutearp_rtrequest: bad gateway value arp_rtrequest: malloc failed arprequestarpresolve: can't allocate llinfo arpintrarp: attempt to add entry for %s on %s by %s on %s in_arpinputarp: attempt to overwrite entry for %s on %s by %s on %s arp info overwritten for %s by %s on %s arp: attempt to overwrite permanent entry for %s by %s on %s duplicate IP address %s sent from ethernet address %s arp: ether address is broadcast for IP address %s! arptfreearplookup: unable to enter address for %s revarprequestrevarp[NULL][ ifa_addr= ifa_dsta= ifa_mask= flags=0x%x, refcnt=%d, metric=%d la_rt=%p la_hold=%p, la_asked=0x%lx rtentry=%p flags=0x%x refcnt=%d use=%ld expire=%ld key= mask= gw= ifp=%p (%s) ifa=%p genmask= gwroute=%p llinfo=%p (NULL)Route tree for AF_INET (not initialized) in_controlinvalid argument to in_lifaddr_ioctlin_ifinitin_addmultiin_delmultiin_pcbinit: hashinit failedin_pcbinit: hashinit failed for lportinpcbplIPv6 pcb passed into in_pcbconnectinterneticmp_erroricmp lenicmp_reflecticmp_mtudisc_timeouticmp_mtudisc_timeout: bad route to timeouticmp_redirect_timeout: bad route to timeout%d.%d.%d.%dipqeplaeshmac-sha1deflateip_initip_savecontrolip_outputip_setmoptionsrip_attachrip_detachrip_usrreqtcp_inputm_pulldown malfunctiontcp_pulloutofbandsynpltcp_outputtcp_output REXMTtcpcbpltcpqepltcp_inittcp_respondtcp_ctlinputtcp6_mtudisc_callbacktcp_timer_rexmttcp_usrreqtcp_identudp_inputudp6_ctlinputudp_usrreqipip_input: should never reach hereetherip_inputMD5Finalrpc denied, status=%d rpc denied, error=%d RPC timeout for server 0x%x krpc_call: sosend: %d bind failed nfsbioread: type %x unexpected nfsbioreadnfsvinvalnfs_doio: type %x unexpected Process killed due to text file modification nfs_boot: using interface %s, with revarp & bootparams nfs_boot: socreate, error=%dnfs_boot: GIFFLAGS, error=%dnfs_boot: SIFFLAGS, error=%drevarp failed, error=%dnfs_boot: client_addr=%s nfs_boot: set if addr, error=%dnfs_boot: server_addr=%s hostname=%s nfs_boot_initnfs_boot: bootparam whoami, error=%dnfs_boot: no suitable interfacenfs_boot: bootparam get %s: %d nfs_boot: mountd %s, error=%d nfs_boot_getfhnfs_boot: portmap NFS/v2, error=%d nfs_boot: bootparam_whoami: bad reply nfs_boot: bootparam_getfile: bad reply nfs_hashlocknfsnodeplnfs_commitlknfskqlcknfskqpwnfskqdetnfskqpollnfsconnfscon sotypenfs send error %d for server %s nfsd send error %d receive error %d from nfs server %s Egad!! short receive (%d/%d) from nfs server %s %s (%d) from nfs server %s impossible packet lengthnfsreply nilnqnfstrynfs_requestis alive againnot respondingnfsndlcknfs sndunlocknfsrcvlknfs rcvunlocknfs_realign_fixup: no memory to pad toKerb nickname short Kerb nick verifier bad Bad kerb verifier Not fullname kerb verifier nfs server %s: %s build > MLENnfs S too bignfsreqplnqnfstimrcld kerbnfsd initnfsidlnfsionfsauth1nfsauth2nfs_mountroot: root/root on %s nfs_mountroot: getattr for rootswap on device 0x%x nfs_mountrootswap/swapswap on %s nfs_mountroot: getattr for swap WARNING: no swap nfs_mountroot: can't setup swap vpnfsnfs_mount_diskless: vfs_rootmountalloc failednfs_mountroot: mount %s failed: %dnfs_args: retrying connect nfs_mountnfsdismnfs: writerpc iovcnt > 1nfs_remove: no namenfs_remove: bad v_usecountnfs_rename: no namenfs readdirrpc bad uioEEK! readdirrpc resid > 0 nfs readdirplusrpc bad uioEEK! readdirplusrpc resid > 0 .nfsA%05x4.4nfs physio/asyncnfs_fsyncnfsfsyncnfs_fsync: not dirtytag VT_NFS, fileid %ld fsid 0x%lxbwrite: buffer is not busy???file system fulluid %u on %s: %s %s: write failed, file system is full ffs_realloccg: bad blockno%s: optimization changed from SPACE to TIME dev = 0x%x, optim = %d, fs = %s ffs_realloccg: bad optim%s: optimization changed from TIME to SPACE dev = 0x%x, bsize = %d, bprev = %d, fs = %s ffs_realloccg: bad bprevmode = 0%o, inum = %d, fs = %s ffs_valloc: dup allocfree inode %s/%d had %d blocks out of inodes %s: create/symlink failed, no inodes free ffs_clusteralloc: lost blockffs_nodealloccg: block not in mapcg = %d, irotor = %d, fs = %s ffs_nodealloccg: map corrupteddev = 0x%x, bsize = %d, size = %ld, fs = %s ffs_blkfree: bad sizebad block %d, ino %u bad blockdev = 0x%x, block = %d, fs = %s ffs_blkfree: freeing free fragffs_blkfree: freeing free blockdev = 0x%x, ino = %u, fs = %s ffs_freefile: range: dev = 0x%x, ino = %d, fs = %sffs_freefile: freeing free inodebno = %d, fs = %s ffs_alloccg: block not in mapstart = %d, len = %d, fs = %s ffs_alloccg: map corruptedffs1_balloc: blk too bigCould not unwind indirect block, error %dffs_update: bad link cntffs_truncate: newspaceffs_indirtrunc: bad buffer sizesoftdep_flushfiles calledffs_mountroot: can't setup bdevvp's ffsWARNING: %s was not properly unmounted WARNING: R/W mount of %s denied. Filesystem is not clean - run fsck WARNING: soft updates isn't compiled in ffs_reload: dirty2ffs_reload: dirty1ffs_mountfs(): obsolete rotational table format, please use fsck_ffs(8) -c 1 ffs_mountfs(): Sorry, no UFS2 support (yet) ffs_statfsupdate: rofs modffsinodino1pl%s: typeffs_write%s: nonsync dir writeffs_fsyncffs_fsync: not dirtyi_ffs_size too smallmangled entry%s: bad dir ino %d at offset %d: %s bad dirFirst bad Second bad ufs_direnter: newblkufs_direnter: compact1ufs_direnter: compact2checkpath: .. not a directory chown: lost quotaufs_linkufs_renameufs_rename: lost to startdirrename: EXDEVufs_rename: same fileufs_rename: lost dir entryufs_rename: lost from startdirufs_mkdirufs_readdir: lost in spaceufs_strategy: specufs_makeinodemode = 0%o, nlinks %d, inum = %d, fs = %s ext2fs_valloc: dup allocext2fs_nodealloccg: block not in mapcg = %d, ipref = %d, fs = %s ext2fs_nodealloccg: map corruptedbad block %d, ino %d dev = 0x%x, ino = %d, fs = %s ifree: range: dev = 0x%x, ino = %d, fs = %sifree: freeing free inodeext2fs_mapsearch: block not in mapext2fs_alloccg: map corrupteduid %d on %s: %s ext2fs_indirtrunc: bad buffer sizeext2fs_readdiri_size too smallrec_len is smaller than minimalrec_len % 4 != 0reclen is too small for name_lendirectory entry across blocksinode out of boundsbad directory entry: %s offset=%d, inode=%lu, rec_len=%d, name_len=%d ext2fs_dirbadentryext2fs_direnter: newblkext2fs_direnterext2fs_direnter: frag sizecheckpathext2fs_writeext2inoplext2dinoplext2fs_mountroot: can't setup bdevvp'sext2fs%s: file system not clean; please fsck(8) ext2fs_reload: dirty2ext2fs_reload: dirty1ext2fs_statfsExt2 fs: unsupported inode size Ext2 fs: unsupported optional feature ext2fs_rename: lost to startdirrename: linked directoryext2fs_rename: lost dir entryext2fs_rename: mangled dirext2fs_rename: lost from startdirext2fs_mkdir: blksizeamap_lookup: offset out of rangeamap_lookups: offset out of rangeamap_add: offset out of rangeamap_add: replacing null anonamap_add: slot in useamap_unadd: offset out of rangeamap_unadd: nothing thereamapplamap_wipeout: corrupt amapcownowpagecownowamap_cow_now: non-resident wired page in anon %pamap_splitref: split at zero offsetamap_splitref: map size check failedamap_pp_adjref: overshot targetamap_pp_adjref: negative reference countuvm_anon_add: can not allocate %d anons uvm_anon_adduao_set_swslot: uobj = %p uao_set_swslot: attempt to set a slot on a NOSWAP objectuao_create: kernel object already allocateduao_create: hashinit swhash faileduao_create: malloc swslots faileduao_create: asked to enable swap on kernel objectuaoeltplaobjpluao_flush: strange, got an out of range flush (fixed) uao_flush: weird flagsuao_getuao_getpageudv_attachudv_detachudv_faultfltamapcopyanonget1anonget2flt_noram1flt_pmfail1flt_noram3flt_noram2flt_pmfail2flt_noram4flt_noram5fltagain2uvm_fault_unwire_locked: address not in mapuvm_fork: uvm_fault_wire failed: %duvm_swapin: uvm_fault_wire failed: %dschedpwaitscheduleruvm_init: page size not setuvm_km_init: could not reserve space for kerneluvm_km_suballoc: unable to allocate space in parent mapuvm_km_suballoc: submap allocation faileduvm_km_suballoc: unable to create submapkm_getwait2km_allockm_alloc1wuvm_km_alloc1: non-released pagevallocwaitkmthreadkmallocvmmaplkuvm_mapent_alloc: out of static map entries uvm_mapent_alloc: cannot allocate map entry# uvm_map() successful calls# uvm_map() back merges# uvm_map() missed forward# map lookup calls# map lookup hint hitsvmspplvmmpeplvmmpekpluvm_map_clean: weird flagsfork: encountered a submap during fork (illegal)fork: non-copy_on_write map entry marked needs_copy (illegal)MAP %p: [0x%lx->0x%lx] #ent=%d, sz=%u, ref=%d, version=%u, flags=0x%x pmap=%p(resident=%d) - %p: 0x%lx->0x%lx: obj=%p/0x%llx, amap=%p/%d submap=%c, cow=%c, nc=%c, prot(max)=%d/%d, inh=%d, wc=%d, adv=%d OBJECT %p: locked=%d, pgops=%p, npages=%d, refs= PAGES : <%p,0x%llx> refs=%d PAGE %p: %b flags=%s, pqflags=%s, vers=%d, wire_count=%d, pa=0x%llx uobject=%p, uanon=%p, offset=0x%llx loan_count=%d [page ownership tracking disabled] >>> ANON DOES NOT POINT HERE <<< (%p) checking pageq list >>> PAGE NOT FOUND ON PAGEQ LIST! <<< uvm_page_printit page found on pageq list anon backpointer is OK checking object list >>> PAGE NOT FOUND ON OBJECT LIST! <<< page found on object list uvm_page_bootstrap: no memory pre-allocateduvm_page_init: lost %ld page(s) in init uvm_page_inituvm_setpagesize: page size not a power of twouvm_pageboot_alloc: out of virtual spaceuvm_pageboot_alloc: out of memoryuvm_pageboot_alloc: pmap_growkernel() faileduvm_page_physget: called _after_ bootstrapuvm_page_physget: out of memory!uvm_page_physload: page size not set!uvm_page_physload: start >= enduvm_page_physload: tried to add RAM after vm_mem_inituvm_page_physload: unable to load physical memory segment %d segments allocated, ignoring 0x%llx -> 0x%llx increase VM_PHYSSEG_MAX uvm_page_physload: bad free list %duvm_page_physrehash: WARNING: could not grow page hash table rehash: physical memory config [segs=%d of %d]: 0x%llx->0x%llx [0x%llx->0x%llx] STRATEGY = BSEARCH number of buckets = %d uvm_pagealloc_strat: bad strat %demergvapager_mappagedaemon: deadlock detected! pgdaemon%s = %d Current UVM status: pagesize=%d (0x%x), pagemask=0x%x, pageshift=%d %d VM pages: %d active, %d inactive, %d wired, %d free min %d%% (%d) anon, %d%% (%d) vnode, %d%% (%d) vtext pages %d anon, %d vnode, %d vtext freemin=%d, free-target=%d, inactive-target=%d, wired-max=%d faults=%d, traps=%d, intrs=%d, ctxswitch=%d softint=%d, syscalls=%d, swapins=%d, swapouts=%d, kmapent=%d fault counts: noram=%d, noanon=%d, pgwait=%d, pgrele=%d ok relocks(total)=%d(%d), anget(retries)=%d(%d), amapcopy=%d neighbor anon/obj pg=%d/%d, gets(lock/unlock)=%d/%d cases: anon=%d, anoncow=%d, obj=%d, prcopy=%d, przero=%d daemon and swap counts: woke=%d, revs=%d, scans=%d, obscans=%d, anscans=%d busy=%d, freed=%d, reactivate=%d, deactivate=%d pageouts=%d, pending=%d, nswget=%d nswapdev=%d, nanon=%d, nanonneeded=%d nfreeanon=%d swpages=%d, swpginuse=%d, swpgonly=%d paging=%d kernel pointers: objs(kern/kmem)=%p/%p swapsysuvm_swap_init: can't get vnode for swap deviceswapmapswp vnxswp vnduvm_swap_init: extent_create failedswapdrum_addsys_swapctlswapctl: copystrswapctl: miniroot copy failedswap0x%04xswap_on: miniroot larger than swap?Preserved %d pages of miniroot leaving %d pages of swap swap_on: unable to preserve minirootdisklabel regionswap_off: swapdev not in listswstrategy: vnode type 0x%xsw_reg_strategy: swap to sparse filewarning: resource shortage: %d pages of swap lost swapmount: no device swapmount: no device 2 swap_deviceswapmount: copystrsbrk: grow %ld failed, error = %d uvm_coredump: user process with submap?uvm_deallocate with null mapuvnsyncuvn_attach: blocked at %p flags 0x%x uvn_attachuvn_termuvm_vnp_terminate: io sync wanted bit setuvn_releasepg: kill flag set on referenced object!uvn_flush: obj=%p, offset=0x%llx. error during pageout. uvn_flush: WARNING: changes to page may be lost! uvn_flushuvn_cluster: offset out of rangeuvn_getuvn_getpageuvn_iosyncrd%d: fixed, %d blocks NULL pointer passed to ip_ecn_ingressNULL pointer passed to ip_ecn_egressNULL pointer passed to ip6_ecn_ingressNULL pointer passed to ip6_ecn_egressin6_pcbconnectin6_pcbnotifyin6_ifloop_requestADDDELETEin6_ifloop_request: %s operation failed for %s (errno=%d) in6_controlnd6_prelist_add succeeded but no prefix prefix ioctls are now invalidated. please use ifconfig. in6_update_ifain6_update_ifa: addmulti failed for %s on %s (errno=%d) in6_update_ifa: failed to remove a route to the old destination: %s in6_update_ifa: the prefix length of an existing (%s) address should not be changed in6_update_ifa: valid lifetime is 0 for %s in6_update_ifa: prefixlen should be 128 when dstaddr is specified in6_update_ifa: a destination can be specified for a p2p or a loopback IF only in6_purgeaddr: failed to remove a route to the p2p destination: %s on %s, errno=%d Couldn't unlink in6_ifaddr from in6_ifaddr in6_unlink_ifa: autoconf'ed address %p has no prefix invalid argument to in6_lifaddr_ioctlin6_savemkludge: no kludge spacein6_addmultiin6_delmultiin6_are_prefix_equal: invalid prefix length(%d) in6_prefixlen2mask: invalid prefix length(%d) in6_prefixlen2maskin6_ifawithscope: output interface is not specified get_rand_ifid%s: interface identifier generated by random number %s: ifid: %02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x %s: failed to get interface identifier %s: borrow interface identifier from %s %s: got interface identifier from %s %s: got interface identifier from itself in6_ifattach_linklocalin6_ifattach_linklocal: failed to configure a link-local address on %s (errno=%d) %s: no ifid available in6_ifattach_loopbackin6_ifattach_loopback: failed to configure the loopback address on %s (errno=%d) in6_nigroupin6_ifattach: %s has too small MTU, IPv6 not enabled in6_ifattachin6_ifattach: %s is not multicast capable, IPv6 not enabled in6_ifdetach%s: didn't unlink in6ifaddr from list in6_cksum: mbuf len (%d) < off+len (%d+%d)in6_cksum: out of datainternet6icmp6_mtudisc_callback_registerENOBUFS in icmp6_error %d icmp6_input: unknown type %d(src=%s, dst=%s, ifid=%d) ICMP6 checksum error(%d|%x) %s icmp6_notify_erroricmp6_notify_error: in6_embedscope failed icmp6_mtudisc_updateni6_inputicmp6_rip6_inputicmp6_reflecticmp6_reflect: source can't be determined: dst=%s, error=%d /usr/src/sys/netinet6/icmp6.csanity fail: off=%lx, sizeof(ip6)=%lx in %s:%d (src=%s dst=%s tgt=%s)icmp6_redirect_inputICMP6 redirect sent from %s rejected; must be from linklocal ICMP6 redirect sent from %s rejected; hlim=%d (must be 255) ICMP6 redirect rejected; no route with inet6 gateway found for redirect dst: %s ICMP6 redirect rejected; neither router case nor onlink case: %s icmp6_redirect_input: lladdrlen mismatch for %s (if %d, icmp6 packet %d): %s icmp6_redirect_input: invalid ND option, rejected: %s ICMP6 redirect rejected; redirect dst must be unicast: %s ICMP6 redirect rejected; not equal to gw-for-src=%s (must be same): %s ICMP6 redirect rejected; no route found for redirect dst: %s icmp6_redirect_outputicmp6_mtudisc_timeout: bad route to timeouticmp6_redirect_timeout: bad route to timeoutip6_initip6_input: packet to an unready address %s->%s ip6_savecontrolip6_nexthdrip6_nexthdr: m == NULLOpenBSD-currentcannot forward from %s to %s nxt %d received on %s cannot forward src %s, dst %s, nxt %d, rcvif %s, outif %s ip6_outputassumption failed: hdr not splitip6_setmoptionsip6_setpktoptionsip6_rthdr0nd6_init called more than once(ignored) nd6_setmtu0: new link MTU on %s (%lu) is too small for IPv6 ndopts == NULL in nd6_optionuninitialized ndopts in nd6_optionndopts == NULL in nd6_optionsduplicated ND6 option found (type=%d) too many loop in nd opt nd6_options: unsupported option %d - option ignored uninitialized ndopts in nd6_optionsln->ln_rt == NULLln->ln_rt->rt_ifp == NULLrt_llinfo(%p) is not equal to ln(%p)dst=0 in nd6_timer(ln=%p)nd6_lookupunspecnd6_lookup: failed to lookup %s (if = %s) nd6_freend6_rtrequestnd6_rtrequest: bad gateway value: %s %s: failed to join %s (errno=%d) nd6_rtrequest: malloc failed nd6_ioctla router(%s) advertises a prefix with non-link local address default router list contains a non-linklocal address(%s) ifp == NULL in nd6_cache_lladdrfrom == NULL in nd6_cache_lladdrnd6_output: can't allocate llinfo for %s (ln=%p, rt=%p) nd6_storelladdr: something odd happens nd6_storelladdr: sdl_alen == 0, dst=%s, if=%s scope error in prefix list (%s) nd6_ns_inputnd6_ns_input: src=%s nd6_ns_input: dst=%s nd6_ns_input: tgt=%s nd6_ns_input: invalid hlim (%d) from %s to %s on %s nd6_ns_input: bad DAD packet (wrong ip6 dst) nd6_ns_input: lladdrlen mismatch for %s (if %d, NS packet %d) nd6_ns_input: duplicate IP6 address %s nd6_ns_input: bad DAD packet (link-layer address option) nd6_ns_input: invalid ND option, ignored nd6_ns_input: bad NS target (multicast) nd6_ns_outputnd6_ns_output: source can't be determined: dst=%s, error=%d nd6_na_inputnd6_na_input: invalid hlim (%d) from %s to %s on %s nd6_na_input: duplicate IP6 address %s nd6_na_input: lladdrlen mismatch for %s (if %d, NA packet %d) nd6_na_input: invalid ND option, ignored nd6_na_input: a solicited adv is multicasted nd6_na_input: invalid target address %s nd6_na_outputnd6_na_output: source can't be determined: dst=%s, error=%d %s: starting DAD for %s nd6_dad_start: memory allocation failed for %s(%s) ???nd6_dad_start: called with non-tentative address %s(%s) nd6_dad_start: ifa->ifa_ifp == NULLnd6_dad_timer: called with null parameter %s: DAD complete for %s - no duplicates found %s: could not run DAD, driver problem? nd6_dad_timer: called with non-tentative address %s(%s) nd6_dad_timer: called with duplicated address %s(%s) nd6_dad_timer: DAD structure not found nd6_dad_duplicated: DAD structure not found %s: DAD detected duplicate IPv6 address %s: NS in/out=%d/%d, NA in=%d %s: DAD complete for %s - duplicate found %s: manual intervention required nd6_dad_ns_input: ignoring DAD NS packet for address %s(%s) ifa == NULL in nd6_dad_ns_inputifa == NULL in nd6_dad_na_inputnd6_rs_inputnd6_rs_input: invalid hlim (%d) from %s to %s on %s nd6_rs_input: lladdrlen mismatch for %s (if %d, RS packet %d) nd6_rs_input: invalid ND option, ignored nd6_ra_inputnd6_ra_input: invalid hlim (%d) from %s to %s on %s nd6_ra_input: src %s is not link-local nd6_ra_input: lladdrlen mismatch for %s (if %d, RA packet %d) nd6_ra_input: bogus mtu mtu=%lu sent from %s; exceeds maxmtu %lu, ignoring nd6_ra_input: bogus mtu option mtu=%lu sent from %s, ignoring nd6_ra_input: invalid option len %d for prefix information option, ignored nd6_ra_input: invalid prefix len %d for prefix information option, ignored nd6_ra_input: invalid prefixlen %d for rfc2374 prefix %s, ignored nd6_ra_input: invalid prefix %s, ignored nd6_ra_input: invalid ND option, ignored defrouter_addreqdefrouter_delreqdefrouter_select: called unexpectedly (forwarding=%d, accept_rtadv=%d) defrouter_select: more than one router is installed nd6_prelist_add: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_remove: failed to make %s/%d offlink on %s, errno=%d prelist_update: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_update: nd6_prelist_add failed for %s/%d on %s errno=%d, returnpr=%p pfxlist_onlink_check: failed to make %s/%d offlink, errno=%d nd6_prefix_onlinknd6_prefix_onlink: failed to add route for a prefix (%s/%d) on %s, gw=%s, mask=%s, flags=%lx errno = %d nd6_prefix_onlink: failed to find any ifaddr to add route for a prefix(%s/%d) on %s nd6_prefix_onlink: %s/%d is already on-link nd6_prefix_offlinknd6_prefix_offlink: failed to recover a prefix %s/%d from %s to %s (errno = %d) nd6_prefix_offlink: failed to delete route: %s/%d on %s (errno = %d) nd6_prefix_offlink: %s/%d is already off-link in6_ifaddin6_ifadd: failed to make ifaddr %s on %s (errno=%d) in6_ifadd: wrong prefixlen for %s (prefix=%d ifid=%d) in6_init_prefix_ltimes: preferred lifetime(%d) is greater than valid lifetime(%d) rip6_inputrip6_outputrip6_attachrip6_usrreqrip6_detachudp6_outputspsrr1r2r3r4r5r6r7r8r9r10r11r12usr_spusr_lrsvc_spsvc_lrpcund_spabt_spirq_spFaulted in DDB; continuing... address %p is invalid address 0x%08lx not a valid page framedb_fetch_reg: botchbranch_taken: botchscp=0x%08x rlv=0x%08x ( rsp=0x%08x rfp=0x%08xBad frame pointer: %p Bad user frame pointer: %p %sr%d=0x%08xtrace: pid %d not found swapped out at %p frame address = %08x frame address must be specified spsr=%08x r0 =%08x r1 =%08x r2 =%08x r3 =%08x r4 =%08x r5 =%08x r6 =%08x r7 =%08x r8 =%08x r9 =%08x r10=%08x r11=%08x r12=%08x r13=%08x r14=%08x r15=%08x slr=%08x mainbusmainbus_bs_alloc(): Help!mainbus_bs_free(): Help!cpu%s, #0x%03x-imbimbrangeswiblxblmulSnmsmlaSnmsdumullSdnmssmullumlalsmlalstrtdaWldrtstrbtldrbtstrldrstrbldrbstmYnWlldmXnWlldrsbldrhstrhldrshswpdmoswpbmrsdpmsrpFmpF2bxclzdmbkptSdn2eorsubrsbadcsbcrsctstDn2teqcmpcmnorrmovSd2bicmvnadfPRfghmufsufrsfdvfrdfpowrpwrmffmlfdvfrdpolfpbopmvfPRfhmnfrndsqtlgnexpsincostanasnacsatnfpuopstfQLvldffltPRgdfixPRdhwfsrfswfcrfccmfPRghcnfcmfecnfemcr2#zmcrmrc2mrccdp2#ycdpldc2L#vldcstc2stcund%s %08x #0x%08xp%d_f%d#%s[r%d]cpsr[%c - unknown]%d, c%d, c%d, c%d, %dr%d, c%d, c%d, %d, rrx, %s r%d, %s #%d{r%d-r%d}^[r%d#0x%02xf%d, c%d, No support for this CPU type (%08x) in kernelcpu.cachecpu.nocachesa110.cachesa110.icachesa110.dcachecpu.writebufcpu.nowritebufsa110.writebufUndefined instruction in kernel WARNING: not updating battery clock Warning IRQ's disabled during boot() real mem = %u (%uK) %uMB cpu_startup: system table size inconsistencycpu_startup: cannot allocate UVM space for buffersavail mem = %lu (%uK) using %d buffers containing %u bytes (%uK) of memory cpu_startup: not enough memory for buffer cachecpu_startup: no room for system tables; %d bytes required_bus_dmamap_load_raw: not implemented_bus_dmamap_sync: mix PRE and POSTunknown buffer type %d _bus_dmamap_sync_bus_dmamap_sync: ARM32_BUFTYPE_INVALID_bus_dmamap_sync: ARM32_BUFTYPE_RAW_bus_dmamem_map: size botch%s: SA-110 with bugged STM^ instruction rev 0rev 1rev 2rev 3rev 4rev 5rev 6rev 7rev 8rev 9rev 10rev 11rev 12rev 13rev 14rev 15step Jstep Kstep Sstep Tstep Bstep Cstep Dstep Erev 10step Gstep A-0step B-0step B-1step B-2step B-3step B-4step B-5(IXP1200 step A)(IXP1200 step B)(IXP1200 step C)(IXP1200 step D)(IXP1240/1250 step A)(IXP1240 step B)(IXP1250 step B)step A-1step C-0step D-0step ?step C-5step 0ARM600ARM610ARM620ARM700ARM710ARM7500ARM710aARM7500FEARM710TARM720TARM740T (8 KB cache)ARM740T (4 KB cache)ARM810ARM920TARM922TARM940TARM946E-SARM966E-STI ARM925TARM1020EARM1022E-SSA-110SA-1100SA-1110IXP1200i80200i80321 400MHzi80321 600MHzi80219 400MHzi80219 600MHzPXA250PXA210PXA27xIXP425 533MHzIXP425 400MHzIXP425 266MHzunknownCPU_ARM2ARM2asCPU_ARM250CPU_ARM3CPU_ARM6CPU_ARM7CPU_ARM7TDMICPU_ARM8ARM9TDMIARM9E-SARM10ECPU_ARM10SA-1CPU_SA110XScaleCPU_XSCALE_...wr-thruwr-back**unknown 3****unknown 4**wr-back-lockwr-back-lock-Awr-back-lock-B**unknown 8****unknown 9****unknown 10****unknown 11****unknown 12****unknown 13****unknown 14****unknown 15** IDC disabled IDC enabled WB disabled WB enabled LABT EABT%s: %dKB/%dB %d-way %s unified cache %s: %s does not fully support this CPU. %s: This kernel does not fully support this CPU. %s: Recompile with "options %s" to correct this. %s: %dKB(%db/l,%dway) I-cache, %dKB(%db/l,%dway) %s D-cache branch prediction enabled DC disabled DC enabled IC disabled IC enabledunknown CPU (ID = 0x%x)%s %s (%s core)Processor failed probe - no CPU ID Vector ExceptionAlignment Fault 1Terminal ExceptionAlignment Fault 3External Linefetch Abort (S)Translation Fault (S)External Linefetch Abort (P)Translation Fault (P)External Non-Linefetch Abort (S)Domain Fault (S)External Non-Linefetch Abort (P)Domain Fault (P)External Translation Abort (L1)Permission Fault (S)External Translation Abort (L2)Permission Fault (P) uvm_fault(%p, %lx, %x, 0) -> %x UVM: pid %d (%s), uid %d killed: out of swap Non-emulated page fault with intr_depth > 0 data_abort_fault: Misaligned Kernel-mode Program Counter kerneluserFatal %s mode data abort: '%s' trapframe: %p FSR=%08x, FAR=r0 =%08x, r1 =%08x, r2 =%08x, r3 =%08x r4 =%08x, r5 =%08x, r6 =%08x, r7 =%08x r8 =%08x, r9 =%08x, r10=%08x, r11=%08x r12=%08x, usp=%08x, ulr=%08xssp=%08x, slr=%08x, pc =%08x Fatal abortInvalid, Fatal %s mode prefetch abort at 0x%08x trapframe: %p, spsr=%08x badaddr: invalid size (%lu)mmrwpmap_enter: no pv entriespmap_enter: failed to allocate L2 bucketprefetch_abort: page is already mapped - pte=%p *pte=%08x prefetch_abort: pc=%08lx proc=%p process=%s prefetch_abort: far=%08x fs=%x pmap_init_l1: can't get PA of L1 at %ppmapplpvepll2dtblpll2ptpplpmap_bootstrap: WARNING! wrong cache mode for primary L1 @ 0x%lx pmap_bootstrap: WARNING! wrong cache mode for L2 pte @ %p pmap_bootstrap: No L2 for va 0x%x, pa 0x%lxpmap_bootstrap: out of static L2spmap_bootstrap: No L2 for L2 @ va %ppmap_alloc_specials: no l2b for 0x%lxCannot allocate L1 KVMCannot allocate L1 physical pagespmap_map_entry: no L2 table for VA 0x%08lxpmap_map_entry: can't find L2 table for VA 0x%08lxpmap_map_chunk: no L2 table for VA 0x%08lxpmap_map_chunk: can't find L2 table for VA0x%08lxpmap_map_chunk: no L1 table provideduser pmap (%p): pmap_kernel (%p): domain %d, l1 at %p %08lx: %c |0000 |8000 |10000 |18000 |20000 |28000 |30000 |38000 pa 0x%08lx: krw %d kro %d urw %d uro %d %c va 0x%08lx, flags 0x%x dumpconf: bad dumpdev=0x%x dumping to dev %u,%u offset %ld dump device bad aborted from console i/o error device not ready succeeded area improper area unavailable dump to dev %u,%u not possible pagemove: size=%08lxvmapbufvunmapbufisaisaattach: can't map `delay port' irq %d drq %d drq2 %d/%d iomem 0x%x port 0x%xisascan>>> probing for %s%d succeeded >>> probing for %s%d failed >>> probing for %s%d >>> probe for %s* clone into %s%d %s: iosize not repaired by driver >>> probing for %s* finished >>> probing for %s* nonepulsededge-triggeredlevel-triggeredisa_intr_typename: invalid type %dcom_isa_attach: mapping failedkbc selftest: %x pckbc_attach: couldn't map%s: unable to establish interrupt for %s slot %s: using irq %d for %s slot : can't map i/o space %s: overriding IRQ %d to %d %s: warning: can't establish shutdown hook : can't map mem space lemac_isa_probefootbridgepci bus %d%s: Cannot map registers: DC21285 rev %d serrsdram_paritydata_paritymast_abttarg_abtparityfcom%s: Unrecognised IDfootbridge_intr: ctrl=%08x footbridge_intr: pcistat=%08x footbridge_alloc(): Help!footbridge_free(): Help!footbridge_pci_intr_map: out of range interruptpin %d line %d (%#x) pci_intr_map: no mapping for pin %c isairq %ldirq %ldfootbridge_pci_intr_string: bogus handle 0x%lxNo memoryfootbridge_intr_establish: IRQ %d out of rangestatclockhandler: Statclock overrun clock: hz %d stathz %d profhz %d clock%s: Cannot install timer 1 interrupt handlerstat%s: Cannot install timer 2 interrupt handler/usr/src/sys/arch/arm/arm/softintr.csoftnet_intrhand != NULLsoftintr_establish: unknown soft IPL %d: consoleserial_rx: can't establish soft interrupt%s: Cannot install rx interrupt handler%s: Cannot allocate rx buffer memoryfcomstartfcomcninit: mapping failedfcomcons_alloc(): Help!fcomcons_free(): Help!wd: <%s> %s: %d-sector PIO, LBA, %lluMB, %llu sectors %s: freeze lock command didn't complete wdattach%s: WARNING: unable to establish shutdown hook CHS, %lluMB, %d cyl, %d head, %d sec, %llu sectors LBA48, %lluMB, %llu sectors %s: IDENTIFY failed __wdstart: bad return code from wdc_ata_bio()wddone%s: soft error (corrected) , retrying device faultdevice timeoutST506/MFM/RLLESDI/IDE disk%s: %s wddumpwddump: try againwddump: device timed outwddump: unknown error typewddump: %swddump: drive faultwddump: DMA errorwddump: polled command has been queuedwd_get_params: bad return code from ata_get_paramsST506%s: flush cache command didn't complete %s: flush cache command: drive fault %s: flush cache command timeout wdc%s:%d:%d: not ready, st=0x%b, err=0x%02x BSYDRDYDWFDSCDRQCORRIDXERR%s:%d:%d: timeout waiting for DRQ, st=0x%b, err=0x%02x %s:%d:%d: bad state %d in _wdc_ata_bio_start _wdc_ata_bio_start: bad state%s:%d:%d: intr with DRQ (st=0x%b) %s:%d:%d: read intr before drq %s:%d:%d: device timeout, c_bcount=%d, c_skip%d %s:%d:%d: bad state %d in wdc_ata_bio_intr wdc_ata_bio_intr: bad statewdc_ata_ctrl_intr: state==RECALrecal%s:%d:%d: %s drive fault error (%x) %s:%d:%d: %s timed out piomodedmamodesetmultino media/write protectedinterface CRC erroraddress mark not foundtrack 0 not foundaborted commandmedia change requestedid not foundmedia changeduncorrectable data errorbad block detected%s %serror not notifiedtodclockClock has gained %d day%c %ld hours %ld minutes %ld secs %sCheck Condition (error %#x) on opcode 0x%x AT BLOCK #: %d (decimal) SENSE KEY: %s off INFO: 0x%x (VALID flag %s) SKSV: %s FRU CODE: 0x%x ASC/ASCQ: %s COMMAND INFO: 0x%x %c Incorrect Length Indicator Set%c EOM Detected%c Filemark Detectedscxsplgetxscannot allocate scsi xs only the first 4,294,967,295 sectors will be used. scsicmdscsi_execute_xs: invalid return code (%#x)unknown error category (0x%x) from scsi driver scbusyprobe%s(%s:%d:%d): No Additional SenseSoft ErrorNot ReadyMedia ErrorHardware ErrorIllegal RequestUnit AttentionWrite ProtectedBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare ErrorReservedNo Additional Sense InformationFilemark DetectedEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnCleaning RequestedErase Operation In ProgressLocate Operation In ProgressRewind Operation In ProgressSet Capacity Operation In ProgressVerify Operation In ProgressNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Not Ready, Rebuild In ProgressLogical Unit Not Ready, Recalculation In ProgressLogical Unit Not Ready, Operation In ProgressLogical Unit Not Ready, Long Write In ProgressLogical Unit Not Ready, Self-Test In ProgressLogical Unit Not Accessible, Asymmetric Access State TransitionLogical Unit Not Accessible, Target Port In Standby StateLogical Unit Not Accessible, Target Port In Unavailable StateLogical Unit Not Ready, Auxiliary Memory Not AccessibleLogical Unit Not Ready, Notify (Enable Spinup) RequiredLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorLogical Unit Communication CRC Error (ULTRA-DMA/32)Unreachable Copy TargetTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureHead Select FaultError Log OverflowWarningWarning - Specified Temperature ExceededWarning - Enclosure DegradedWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedWrite Error - Recommend ReassignmentCompression Check Miscompare ErrorData Expansion Occurred During CompressionBlock Not CompressibleWrite Error - Recovery NeededWrite Error - Recovery FailedWrite Error - Loss Of StreamingWrite Error - Padding Blocks AddedAuxiliary Memory Write ErrorWrite Error - Unexpected Unsolicited DataWrite Error - Not Enough Unsolicited DataError Detected By Third Party Temporary InitiatorThird Party Device FailureCopy Target Device Not ReachableIncorrect Copy Target Device TypeCopy Target Device Data UnderrunCopy Target Device Data OverrunInvalid Information UnitInformation Unit Too ShortInformation Unit Too LongID CRC Or ECC ErrorUnrecovered Read ErrorRead Retries ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block ReadNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite The DataDe-Compression CRC ErrorCannot Decompress Using Declared AlgorithmError Reading UPC/EAN NumberError Reading ISRC NumberRead Error - Loss Of StreamingAuxiliary Memory Read ErrorRead Error - Failed Retransmission RequestAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRecord Not Found - Recommend ReassignmentRecord Not Found - Data Auto-ReallocatedLocate Operation FailureRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorData Sync Error - Data RewrittenData Sync Error - Recommend RewriteData Sync Error - Data Auto-ReallocatedData Sync Error - Recommend ReassignmentRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data Without ECC - Data RewrittenRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With L-ECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteRecovered Data With ECC - Data RewrittenRecovered Data With LinkingDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationRecovered ID with ECCPartial Defect List TransferInvalid Command Operation CodeAccess Denied - Initiator Pending-EnrolledAccess Denied - No Access rightsAccess Denied - Invalid Mgmt ID KeyIllegal Command While In Write Capable StateObsoleteIllegal Command While In Explicit Address ModeIllegal Command While In Implicit Address ModeAccess Denied - Enrollment ConflictAccess Denied - Invalid LU IdentifierAccess Denied - Invalid Proxy TokenAccess Denied - ACL LUN ConflictLogical Block Address Out of RangeInvalid Element AddressInvalid Address For WriteIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBCDB Decryption ErrorSecurity Audit Value FrozenSecurity Working Key FrozenNonce Not UniqueNonce Timestamp Out Of RangeLogical Unit Not SupportedInvalid Field In Parameter ListParameter Not SupportedParameter Value InvalidThreshold Parameters Not SupportedInvalid Release Of Persistent ReservationData Decryption ErrorToo Many Target DescriptorsUnsupported Target Descriptor Type CodeToo Many Segment DescriptorsUnsupported Segment Descriptor Type CodeUnexpected Inexact SegmentInline Data Length ExceededInvalid Operation For Copy Source Or DestinationCopy Segment Granularity ViolationInvalid Parameter While Port Is EnabledHardware Write ProtectedLogical Unit Software Write ProtectedAssociated Write ProtectPersistent Write ProtectPermanent Write ProtectConditional Write ProtectNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedPower On, Reset, or Bus Device Reset OccurredPower On OccurredSCSI Bus Reset OccurredBus Device Reset Function OccurredDevice Internal ResetTransceiver Mode Changed to Single EndedTransceiver Mode Changed to LVDI_T Nexus Loss OccurredMode Parameters ChangedLog Parameters ChangedReservations PreemptedReservations ReleasedRegistrations PreemptedAsymmetric Access State ChangedImplicit Asymmetric Access State Transition FailedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedCurrent Program Area Is Not EmptyCurrent Program Area Is EmptyIllegal Power Condition RequestPersistent Prevent ConflictPrevious Busy StatusPrevious Task Set Full StatusPrevious Reservation Conflict StatusPartition Or Collection Contains User ObjectsOverwrite Error On Update In PlaceInsufficient Time For OperationCommands Cleared By Another InitiatorIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledCannot Write Medium - Unknown FormatCannot Write Medium - Incompatible FormatCannot Format Medium - Incompatible MediumCleaning FailureCannot Write - Application Code MismatchCurrent Session Not Fixated For AppendCleaning Request RejectedMedium Not FormattedMedium Format CorruptedFormat Command FailedNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorEnclosure FailureEnclosure Services FailureUnsupported Enclosure FunctionEnclosure Services UnavailableEnclosure Services Transfer FailureEnclosure Services Transfer RefusedRibbon, Ink, or Toner FailureRounded ParameterEvent Status NotificationESN - Power Management Class EventESN - Media Class EventESN - Device Busy Class EventSaving Parameters Not SupportedMedium Not PresentMedium Not Present - Tray ClosedMedium Not Present - Tray OpenMedium Not Present - LoadableMedium Not Present - Medium Auxiliary Memory AccessibleSequential Positioning ErrorTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyEnd Of Medium ReachedMedium Magazine Not AccessibleMedium Magazine RemovedMedium Magazine InsertedMedium Magazine LockedMedium Magazine UnlockedMechanical Positioning Or Changer ErrorInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetLogical Unit FailureTimeout On Logical UnitLogical Unit Failed Self-TestLogical Unit Unable To Update Self-Test LogTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has Changedcomponent Device AttachedDevice Identifier ChangedRedundancy Group Created Or ModifiedRedundancy Group DeletedSpare Created Or ModifiedSpare DeletedVolume Set Created Or ModifiedVolume Set DeletedVolume Set DeassignedVolume Set ReassignedReported LUNs Data Has ChangedEcho Buffer OverwrittenMedium LoadableMedium Auxiliary Memory AccessibleRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorData Phase CRC Error DetectedSCSI Parity Error Detected During ST Data PhaseInformation Unit iuCRC Error DetectedAsynchronous Information Protection Error DetectedProtocol Service CRC ErrorSome Commands Cleared By iSCSI Protocol EventInitiator Detected Error Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorInvalid Target Port Transfer Tag ReceivedToo Much Write DataACK/NAK TimeoutNAK ReceivedData Offset ErrorInitiator Response TimeoutLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureErase Failure - Incomplete Erase Operation DetectedCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedSCSI To Host System Interface FailureSystem Resource FailureSystem Buffer FullInsufficient Reservation ResourcesInsufficient ResourcesInsufficient Registration ResourcesInsufficient Access Control ResourcesAuxiliary Memory Out Of SpaceUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change InputOperator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedFailure Prediction Threshold ExceededMedia Failure Prediction Threshold ExceededLogical Unit Failure Prediction Threshold ExceededSpare Area Exhaustion Prediction Threshold ExceededHardware Impending Failure General Hard Drive FailureHardware Impending Failure Drive Error Rate Too HighHardware Impending Failure Data Error Rate Too HighHardware Impending Failure Seek Error Rate Too HighHardware Impending Failure Too Many Block ReassignsHardware Impending Failure Access Times Too HighHardware Impending Failure Start Unit Times Too HighHardware Impending Failure Channel ParametricsHardware Impending Failure Controller DetectedHardware Impending Failure Throughput PerformanceHardware Impending Failure Seek Time PerformanceHardware Impending Failure Spin-Up Retry CountHardware Impending Failure Drive Calibration Retry CountController Impending Failure General Hard Drive FailureController Impending Failure Drive Error Rate Too HighController Impending Failure Data Error Rate Too HighController Impending Failure Seek Error Rate Too HighController Impending Failure Too Many Block ReassignsController Impending Failure Access Times Too HighController Impending Failure Start Unit Times Too HighController Impending Failure Channel ParametricsController Impending Failure Controller DetectedController Impending Failure Throughput PerformanceController Impending Failure Seek Time PerformanceController Impending Failure Spin-Up Retry CountController Impending Failure Drive Calibration Retry CountData Channel Impending Failure General Hard Drive FailureData Channel Impending Failure Drive Error Rate Too HighData Channel Impending Failure Data Error Rate Too HighData Channel Impending Failure Seek Error Rate Too HighData Channel Impending Failure Too Many Block ReassignsData Channel Impending Failure Access Times Too HighData Channel Impending Failure Start Unit Times Too HighData Channel Impending Failure Channel ParametricsData Channel Impending Failure Controller DetectedData Channel Impending Failure Throughput PerformanceData Channel Impending Failure Seek Time PerformanceData Channel Impending Failure Spin-Up Retry CountData Channel Impending Failure Drive Calibration Retry CountServo Impending Failure General Hard Drive FailureServo Impending Failure Drive Error Rate Too HighServo Impending Failure Data Error Rate Too HighServo Impending Failure Seek Error Rate Too HighServo Impending Failure Too Many Block ReassignsServo Impending Failure Access Times Too HighServo Impending Failure Start Unit Times Too HighServo Impending Failure Channel ParametricsServo Impending Failure Controller DetectedServo Impending Failure Throughput PerformanceServo Impending Failure Seek Time PerformanceServo Impending Failure Spin-Up Retry CountServo Impending Failure Drive Calibration Retry CountSpindle Impending Failure General Hard Drive FailureSpindle Impending Failure Drive Error Rate Too HighSpindle Impending Failure Data Error Rate Too HighSpindle Impending Failure Seek Error Rate Too HighSpindle Impending Failure Too Many Block ReassignsSpindle Impending Failure Access Times Too HighSpindle Impending Failure Start Unit Times Too HighSpindle Impending Failure Channel ParametricsSpindle Impending Failure Controller DetectedSpindle Impending Failure Throughput PerformanceSpindle Impending Failure Seek Time PerformanceSpindle Impending Failure Spin-Up Retry CountSpindle Impending Failure Drive Calibration Retry CountFirmware Impending Failure General Hard Drive FailureFirmware Impending Failure Drive Error Rate Too HighFirmware Impending Failure Data Error Rate Too HighFirmware Impending Failure Seek Error Rate Too HighFirmware Impending Failure Too Many Block ReassignsFirmware Impending Failure Access Times Too HighFirmware Impending Failure Start Unit Times Too HighFirmware Impending Failure Channel ParametricsFirmware Impending Failure Controller DetectedFirmware Impending Failure Throughput PerformanceFirmware Impending Failure Seek Time PerformanceFirmware Impending Failure Spin-Up Retry CountFirmware Impending Failure Drive Calibration Retry CountFailure Prediction Threshold Exceeded (false)Low Power Condition OnIdle Condition Activated By TimerStandby Condition Activated By TimerIdle Condition Activated By CommandStandby Condition Activated By CommandPower State Change To ActivePower State Change To IdlePower State Change To StandbyPower State Change To SleepPower State Change To Device ControlLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackPacket Does Not Fit In Available SpaceIllegal Mode For This TrackInvalid Packet SizeVoltage FaultAutomatic Document Feeder Cover UpAutomatic Document Feeder Lift UpDocument Jam In Automatic Document FeederDocument Miss Feed Automatic In Document FeederConfiguration FailureConfiguration Of Incapable Logical Units FailedAdd Logical Unit FailedModification Of Logical Unit FailedExchange Of Logical Unit FailedRemove Of Logical Unit FailedAttachment Of Logical Unit FailedCreation Of Logical Unit FailedAssign Failure OccurredMultiply Assigned Logical UnitSet Target Port Groups Command FailedLogical Unit Not ConfiguredData Loss On Logical UnitMultiple Logical Unit FailuresParity/Data MismatchInformational, Refer To LogState Change Has OccurredRedundancy Level Got BetterRedundancy Level Got WorseRebuild Failure OccurredRecalculate Failure OccurredCommand To Logical Unit FailedCopy Protection Key Exchange Failure - Authentication FailureCopy Protection Key Exchange Failure - Key Not PresentCopy Protection Key Exchange Failure - Key Not EstablishedRead Of Scrambled Sector Without AuthenticationMedia Region Code Is Mismatched To Logical Unit RegionDrive Region Must Be Permanent/Region Reset Count ErrorDecompression Exception Long Algorithm IDSession Fixation ErrorSession Fixation Error Writing Lead-InSession Fixation Error Writing Lead-OutSession Fixation Error - Incomplete Track In SessionEmpty Or Partially Written Reserved TrackNo More Track Reservations AllowedCD Control ErrorPower Calibration Area Almost FullPower Calibration Area Is FullPower Calibration Area ErrorProgram Memory Area Update FailureProgram Memory Area Is FullRMA/PMA Is Almost FullDEFERRED CDBParametersError in %s, Offset %d, bit %dProgress Indicator: %dActual Retry Count: %dASC 0x%02x ASCQ 0x%02xDiagnostic Failure on Component 0x%02xDecompression Exception Short Algorithm ID OF 0x%02xTagged Overlapped Commands (0x%02x = TASK TAG)host adapter code inconsistency unknown error category (0x%x) from host adapter code User command with no ioctl User command with no buf scistrcmdlen too big physio split the request.. cannot proceed DEC RZ55 (C) DECEMULEX MD21/S2 ESDIA00IBMRAID 0662SIBM 0663HIBM0664H3171-S2KZ-CDFRSS2FQUANTUM ELS85S iomegajaz 1GBMICROP4421-07SEAGATEST150176LW0002HPC3725SDCASSONY SDT-5000 3.WangDAT Model 1300 02.4Model 2600 01.7Model 3200 02.2ALPS ELECTRIC CO.,LTD. DC544CSW03DCR-2801TE1.07CREATIVECD3630EAC101FX320Sq01GCD-R580B1.00MATSHITA CR-5741.021.06Memorex CRW-26421.0gNEC CD-ROM DRIVE:2734.21SANYO CRD-256PSANYO CRD-254PSANYO CRD-S54P1.08CD-ROM CDR-S11.70CD-ROM CDR-N161.25UJDCD87301.14scsibusscsibus at %s: %d targets scsibusattach: can't allocate target linksscsibusattach: can't allocate lun linksPLEXTORCD-ROM PX-40TS1.01MICROP 1588-15MBSUN0669vendor-uniqueremovablefixed targ %d lun %d: <%s, %s, %s> SCSI%d %d/%s %s%sscsibusprintdirectsequentialprinterprocessorwormcdromscanneropticalchangercommunicationenclosure servicessimplified directscsibusprint: device type T_NODEVICE offlinescsibusprint: qualifier == SID_QUAL_BAD_LUscsibusprint: qualifier == SID_QUAL_RSVDNEC CD-ROM DRIVE:260cd%s: WARNING: unable to establish power hook %s: not queuedcdioctlATAPI CD-ROMSCSI CD-ROMdvd_authdvd_read_physicaldvd_read_copyrightdvd_read_bcasddrive offline%luMB, %lu cyl, %lu head, %lu sec, %lu bytes/sec, %lu sec total%s: not queued, error %d SCSI opticalSCSI disksdgetdisklabel%s: WARNING: cache synchronization failed TDC 3800 ARCHIVE VIPER 2525 25462SANKYO CP525 ANRITSU DMT780 VIPER 150 21247VIPER 150 21531WANGTEK 5099ES SCSI5150ES SCSI5525ES SCSI REV7EXABYTE EXB-8200 263HHP T4000s TANDBERG TDC 3600 ????TEAC MT-2ST/N50 %s: cannot set selected mode %s: bad request, must be multiple of %d %s: bad request, must be between %d and %d %s: not queued %s: block wrong size, %d blocks residual %s: bad residual %d out of %d %s: %d-byte record too big atapiscsiwdc_atapi_start: not ready, st = %02x wdc_atapi_intr_command%s:%d:%d: device timeout waiting to send SCSI packet unexpected data phasezero length transfer requested in data phasedata transfer direction disagreementdata phase where none expecteddata transfer direction disagreement during senseunexpectedly in command phasewdc_atapi_intr: warning: device requesting %d bytes, only %d left in buffer wdc_atapi_intr: warning: reading only %d of %d bytes atapiscsi: Shouldn't get here %s:%d:%d: device timeout, c_bcount=%d, c_skip=%d, status=0x%b, ireason=0x%x Device Reset WaitIdentifyPost-IdentifyPIOMODEunknown state%s:%d:%d: soft reset failed raiduse one of: %s[a-p]parsediskboot_file: '%s' rootconf: device name too longboot device: %s. root device (default %s%c)swap device can't figure root, hope your kernel is right rootconfroot on %s%c boot device not knownboot device: lookup '%s' failed. rebooting... The operating system has halted. Please press any key to reboot. OpenBSD/cats booting ... Incompatible magic number passed in boot args(hd0)wd0diagcan't init serial console @%xinvalid geometrydos partition I/O errordisk label I/O errorno disk labeldisk label corruptedisa_alloc(): Help!isa_free(): Help!stray interrupt %d%s ; stopped loggingintr_alloc: bogus typeintr_establish: bogus irq or typeintr_establish: can't share %s with %sintr_disestablish: bogus irqisa_irqdispatch: %x dsrtc: cannot map I/O space : lithium cell is dead, RTC unreliablemii_attach: phyloc and offloc specifiedmii_activate: phyloc and offloc specifiedmii_activate: DVACT_ACTIVATE%s: config_activate(%d) failedmii_detach: phyloc and offloc specifiedOUI 0x%06x model 0x%04x rev %d at %s phy %dmii_phy_setmedia: MASTER on wrong mediamiiautnsphyDP83840 10/100 PHY: %s, rev. %d qsphyQS6612 10/100 PHYinphyi82555 10/100 PHYi82562EM 10/100 PHYi82562ET 10/100 PHYexphy: 3Com internal media interface %s: ignoring this PHY, non-zero instance exphy_service: can't isolate 3Com PHYukphy: Generic IEEE 802.3u media interface, rev. %d: OUI 0x%06x, model 0x%04x %s: no media present dev %d function %dpciprintpci_io_find: bad requestpci_mem_find: bad requestpci_mem_find: bad 64-bit requestmiscellaneousSCSIfloppyIPISASethernettoken ringFDDIWorldFipPCMIG Multi ComputingXGAvideoaudiotelephonyhdaudioRAMflashhostMicroChannelNuBusRACEwaySemi-transparent PCIInfiniBandparallelmulti-port serialmodemsmartcard8237 DMA8254 timerRTCPCI Hot-PlugSD Host Controllerdigitizergame portgeneric386486PentiumAlphaPowerPCMIPSCo-processorFirewireACCESS.busSSAFiber ChannelIPMISERCOSCANbusIrDAConsumer IRRFbluetoothbroadband802.11a (5 GHz)802.11b (2.4 GHz)standardvoicedatanetwork/computingentertainmentDPIOTime and Frequencysynchronizationmanagementprehistoricmass storagenetworkdisplaymultimediacommunicationssystemdockserial buswirelessI2Osatellite commcryptoDASPundefinedOZ6729 CardBusOZ6730 CardBusOZ6922 CardBusOZ6832 CardBusOZ6836/OZ6860 CardBusOZ68[17]2 CardBusOZ6933 CardBusOZ69[17]2 CardBusOZ711Mx CardBusOZ711EC1 SmartCardBusOZ711M1 CardBusOZ711E0 CardBus3c9853c9963CRDAG675 (Atheros AR5212)3CRPAG175 (Atheros AR5212)V.90 Modem3c9403c3393c3593c4503c555 100Base-TX3c5753CCFE575BT3CCFE575CT3c590 10Mbps3c595 100Base-TX3c595 100Base-T43c595 10Mbps-MII3CRSHPW796 802.11b3CRWE154G72 802.11g3c556 100Base-TX3c556B 100Base-TX3CCFEM6563CCFEM656B3CCFEM656C56k Global Modem3cSOHO-TX3crwe777a AirConnect3c940B3c900 10Base-T3c900 10Mbps-Combo3c900B 10Mbps3c900B 10Mbps-Combo3c900B 10Mbps-TPC3c900B 10Mbps-FL3c905 100Base-TX3c905 100Base-T43c905B 100Base-TX3c905B 100Base-T43c905B 10/100Mbps-Combo3c905B 100Base-FX3c905C 100Base-TX3c9201 100Base-TX3c920B-EMB-WNM3cSOHO 100B-TX3c980 100Base-TX3c980C 100Base-TX3cr9903cr990-TX3cr990-TX-953cr990-TX-973c990b-TX-M3cr990-FX3cr990SVR953cr990SVR973c990BSVRVoodooVoodoo2BansheeVoodoo3Voodoo5300SX500TXDeltaPermedia500MXPermedia 2Oxygen GVX1Permedia 35000/6000 series RAID7000/8000 series RAID9000 series RAID9500 series RAIDFE2500 10/100PCM200 10/100FE2000VX 10/100FE2500MX 10/100PC4800 WirelessPCI35x WLANPC4500 WirelessMPI-350 WirelessACCM 2188 VL-PCI2051 PCI2051 ISAATP850U/UFATP860ATP860-AATP865-AATP865-RAEC6710AEC6712UWAEC6712UAEC6712SAEC6710DAEC6715UWMPX 5030/5038EN2242EN1217RhineIIrtl8139AWA-100M1435 VL-PCIM1445 VL-PCIM1449 ISAM1451 PCIM1461 PCIM1489 PCIM1511 PCIM1513 ISAM1523 PCIM1523 ISAM1531 PCIM1533 ISAM1535 PCIM1541 PCIM1543 ISAM1563 ISAM1575 ISAM1621 PCIM1631 PCIM1644 PCIM1647 PCIM1689 PCIM1695 PCIM3309 MPEGM4803M5219 UDMA IDEM5229 UDMA IDEM5237 USBM5239 USB2M5243 AGP/PCI-PCIM5246 AGPM5247 AGP/PCI-PCM5249 PCI-PCIM524B PCIEM524C PCIEM524D PCIEM5261 LANM5263 LANM5281 SATAM5287 SATAM5288 SATAM5289 SATAM5451 AudioM5455 AudioM5457 ModemM5461 HD AudioM7101 PowerAL981AN983AN985ADM8211 WLANADM9511ADM9513AIC-7810AHA-2940AU/CNAHA-2930CUAIC-7850AIC-7855AIC-5900 ATMAIC-5905 ATMAPA-1480AIC-7860AHA-2940AUAIC-7870AHA-2940AHA-3940AHA-3985AHA-2944AIC-7880AHA-2940UAHA-3940UAHA-398XUAHA-2944UAHA-2940UWProAIC-6915AIC-7895AHA-2940U2 U2AHA-2930U2 U2AAA-131U2 U2AIC-7890/1 U2AIC-7892 U160AHA-29160 U160AHA-19160B U160AHA-3950U2B U2AHA-3950U2D U2AIC-7896/7 U2AHA-3960D U160AIC-7899BAIC-7899DAIC-7899FAIC-7899 U160ServeRAIDAAC-2622ASR-2200SASR-2120SAAC-364AAC-3642Dell PERC 2/QCAIC-7901 U320AHA-29320A U320AHA-29320LP U320AIC-7901A U320AHA-29320 U320AHA-29320B U320AIC-7902 U320AIC-7902B U320AHA-39320 U320AHA-39320B U320AHA-39320A U320AHA-39320D U320AHA-39320DB U3201200A1200BABP-930/40UAABP-940UWASP-3940U2WASP-3940U3WWaikato Dag3.2Endace Dag3.5Endace Dag4.22GEEndace Dag4.23AT22AT24AcenicAcenic CopperBCM5700BCM5701AC1000AC1001AC9100AMD64 HyperTransportAMD64 Address MapAMD64 DRAM CfgAMD64 Misc Cfg79c970 PCnet-PCI79c978 PChome-PCI53c974 PCscsi-PCI79C974 PCnet-PCIGeode LXGeode LX VideoGeode LX CryptoCS5536 ISACS5536 AudioCS5536 USBCS5536 IDEElanSC520 PCI751 System751 PCI-PCI762 PCI762 PCI-PCI761 PCI761 PCI-PCI755 ISA755 IDE755 Power755 USB756 ISA756 IDE756 Power756 USB Host766 ISA766 IDE766 USB766 Power766 USB OpenHCI768 ISA768 IDE768 Power768 AC97768 Modem768 PCI-PCI768 USB8131 PCIX8131 PCIX IOAPIC8151 Sys Control8151 AGP8132 PCIX8132 PCIX IOAPIC8111 PCI-PCI8111 USBAMD8111 LPC8111 IDE8111 SMBus8111 Power8111 AC97MegaRAIDMegaRAID Series 428MegaRAID Series 434ADSP 21535 DSPAD1889 AudioSafeNet ADSP 2141TC9021BanditGCOHareHeathrowPaddingtonUni-N EthUni-NUni-N Eth FirewireUni-N AGPUni-N GMACKeylargoPangea GMACPangea MacioPangea USBPangea AGPPangeaPangea PCIUni-N2 AGPUni-N2 HostPangea FireWireUniNorth FirewireUni-N2 GMACUni-N ATAUniNorth AGPUniNorth PCIIntrepid ATAIntrepidIntrepid USBK2 USBK2 MacioK2 FirewireK2 ATAU3 PCI-PCIU3 AGPK2 GMACShastaShasta ATAShasta GMACShasta FirewireShasta PCIShasta HyperTransportK2U3L AGPK2 AGPIntrepid 2 AGPIntrepid 2 PCIIntrepid 2 ATAIntrepid 2 FireWireIntrepid 2 GMACARS106SARS0303D1000PV2000PV2000MT2000MIARC-1110ARC-1120ARC-1130ARC-1160ARC-1170ARC-1210ARC-1220ARC-1230ARC-1260ARC-1270ARC-1280ARC-1380ARC-1381ARC-1680ARC-1681AX88140A/88141Radeon Mobility X600FireGL V3200Radeon X600 (RV380)Radeon X600 (RV380) SecRadeon 9500 ProRadeon 9600 ProRadeon 9600 LERadeon 9600 XTRadeon 9550Mach32Radeon 9500 Pro SecRadeon 9600 Pro SecRadeon 9600 LE SecRadeon 9600 XT SecRadeon 9550 SecRadeon 8500 BBRadeon IGP 320MMobility M6IXP200 AC97SB200 PCI-PCISB200 USB2SB200 USBIXP200 IDESB200 PCI-ISAIXP200 ModemSB200 SMBusMach64 CTMach64 CXIXP300 AC97IXP300 SMBusIXP300 IDEIXP300 SATAIXP400 AC97IXP400 PCIIXP400 SMBusIXP400 USB2IXP400 USBIXP400 IDEIXP400 ISAIXP400 ModemIXP400 SATAIXP450 HD AudioIXP600 SATAIXP600 AC97IXP600 HD AudioIXP600 PCIIXP600 SMBusIXP600 USB2IXP600 USBIXP600 IDEIXP600 LPCIXP600 ModemMach64 ETRage ProMach64 GDMach64 GIMach64 GLMach64 GMMach64 GNMach64 GOMach64 GPMach64 GQRage XLMach64 GSMach64 GTMach64 GUMach64 GVMach64 GWMach64 GXMach64 GYMach64 GZRadeon 9000Radeon 9000 SecMach64 LBMach64 LDRage128 LEMobility M3Mach64 LGMach64 LIMobility 1Mach64 LNMach64 LPMach64 LQRage P/MMach64 LSRadeon Mobility M7 LWRadeon Mobility M6 LYRadeon Mobility M6 LZRadeon Mobility M9 LfRage 128 Mobility MFRage 128 Mobility MLRadeon 9500/9700Radeon 9800 XTRadeon 9800 ProRadeon Mobility M10 NPRadeon 9500/9700 SecRadeon 9800 Pro SecRage 128 Pro PDRage FuryRage 128 PKAIW RadeonRadeon QERadeon QFRadeon QGRadeon 8500 QLRadeon 9100 QMRadeon 8500 QNRadeon 8500 QORadeon 7500 QWRadeon VE QYRadeon VE QZES1000Radeon 8500 QlRage 128 GLRage MagnumRage 128 RGRage 128 RKRage 128 VRRage 128 SHRage 128 SKRage 128 SLRage 128 SMRage 128Rage 128 Pro TFRage 128 Pro TLRage 128 Pro TRRadeon Mobility M300 M22Radeon Mobility X700 M26Mach64 VTMach64 VUMach64 VVRS300_100 HostRS300_133 HostRS300_166 HostRadeon IGP 9100 HostRadeon Mobility IGP 9100Radeon IGP 9100 AGPRadeon 9200 PRO SecRadeon 9200 SecRS480 HostRX480 HostRadeon XPRESS 200Radeon XPRESS 200MRadeon 9200 PRORadeon 9200Radeon 9200 SE SecRX480 PCIERS480 PCIERadeon X300Radeon X600 (RV370)Radeon X550FireGL V3100Radeon X300 SecRadeon X600 (RV370) SecRadeon X550 SecFireGL V3100 SecRadeon Mobility 9200Radeon Mobility 9200 (M9+)Radeon 9200 SERadeon X800 GTORadeon X800 GTO SecRS100 PCIRS200 PCIRadeon X1800Radeon Mobility X1300 M52-64Radeon Mobility X1600RS100 AGPRS200 AGPRS250 AGPS5933 PCI MatchmakerMyrinet LANaiAR5210AR5211AR5212AR5424AR5210 (Early)AR5212 (IBM MiniPCI)AR5210 (no eeprom)AR5212 (no eeprom)AR5211 (no eeprom)AR5212 (emulation board)AR5211RefIDE-2015PLVortex 1Vortex 2Vortex AdvantageAVL2301AVG2302ALG2301ALG2302ALS4000LP-PCI 4 SerialBRI ISDNFritz ISDNFritz v2.0 ISDNPRI T1 ISDNF5D6001F5D6020V3F5D6000VME 617VME 270655015601BCM5752BCM5752MBCM5702BCM5703BCM5704CBCM5704S AltBCM5706BCM5708BCM5702FEBCM5705BCM5705KBCM5720BCM5721BCM5705MBCM5705M AltBCM5714BCM5714SBCM5780BCM5780SBCM5705FBCM5754MBCM5755MBCM5750BCM5751BCM5715BCM5715SBCM5754BCM5755BCM5750MBCM5751MBCM5751FBCM5787MBCM5782BCM5786BCM5787BCM5788BCM5789BCM5702XBCM5703XBCM5704SBCM5706SBCM5708SBCM5702 AltBCM5703 AltBCM5781BCM5753BCM5753MBCM5753FBCM5903MBCM4401B0BCM5901BCM5901A2BCM4303BCM4307BCM4311BCM4318BCM4319BCM4306BCM4322BCM4309BCM43XGBCM44015801580258055820582158225823BT848BT849BT878BT879BT878 AudioBT879 AudioBt8474 HDLCMultiMaster NCMultiMasterFlashPointGPPCINitrox XLCinemasterNx10 10GbE643106554565548655506555465555685546900069030CL-GD7548CL-GD5430CL-GD5434-4CL-GD5434-8CL-GD5436CL-GD5446CL-GD5480CL-GD5462CL-GD5464CL-GD5465CL-PD6729CL-PD6832 CardBusCL-PD6833 CardBusCL-GD7542CL-GD7543CL-GD7541CS4610 SoundFusionCS4615CS4280/46xx CrystalClearCS4281 CrystalClearAAR-1210SAPCI0640PCI0642PCI0643PCI0646PCI0647PCI0648PCI0649PCI0650AUSB0670USB0673PCI0680SiI3112 SATASiI3114 SATASiI3124 SATASiI3132 SATASiI3512 SATAGigaCardEX110TXTriflex PCIQVisionQVision 1280/pSmart Array 5300Smart Array 5iSmart Array 532Smart Array 5312Smart Array 6iSmart Array 641Smart Array 642Smart Array 6400Smart Array 6400 EMSmart Array 6422Smart Array 64xxNetelligent ASMCPCI HotplugUSB OpenHostSMART2P RAIDISAPnPNetelligent 10/100TXNetelligent IDENetelligent 10 TIntegrated NetFlex 3/PDP Netelligent 10/100TXProLiant Netelligent 10/100TXEmbedded Netelligent 10/100TXNetelligent 10 T/2 PCISmart Array 5300 rev.2Smart Array 5i/532 rev.2iLONetFlex 3/PNetFlex 3/PBCompexeRL100-ATX 10/100PMAC 9871356k WinmodemSoftK56 PCIHSF 56k HSFiMUSYCC CN8478MUSYCC CN8474MUSYCC CN8472MUSYCC CN8471CX2388xCX2388x AudioCX2388x MPEGCX2388x IR82C599 VLBCY82C693U ISAFEther CB-TXD 10/100FEther II CB-TXD 10/100CG-LAPCIGTC-Bus II-PCISoundBlaster LiveSoundBlaster AWE64DSoundBlaster AudigySoundBlaster Live (Dell)SoundBlaster Audigy LSSoundBlaster Audigy 2PCI Gameport JoystickSoundBlaster Audigy DigitalEctiva 1938Cyclom-Y below 1MCyclom-YCyclom-4Y below 1MCyclom-4YCyclom-8Y below 1MCyclom-8YCyclom-Z below 1MCyclom-ZIQ80310Cx5510GXm PCIGXm ISACx5530 SouthCx5530 SMICx5530 IDECx5530 XpressAUDIOCx5530 VideoDM9009DM9100DM9102DM913221050 PCI-PCI2104021030Zephyr NV-RAMKZPSA21140TGA2DEFPA21041DGLPB (OPPO)ZLXP-L2 (Pixelvision)21142/3Farallon PN9000SX21052 PCI-PCI21150 PCI-PCI21150-BC PCI-PCI21152 PCI-PCI21153 PCI-PCI21154 PCI-PCICompaq SMART RAID 42xxSWXCR RAIDPERC 2/SiPERC 3/DiPERC 3/SiDRAC 3 Add-inDRAC 3 Embedded/OptionalDRAC 4 Embedded/OptionalDRAC 3 OptionalPERC 4/Di i960PERC 4/Di VerdeDRAC 4DRAC 4 Virtual UARTPERC 4e/DiDRAC 4 SMICPERC 58139Viper/PCI550TX530TX+DFE-690TXDDRP32TXDDWL-610DGE-550TDGE-528TDGE-560TDGE-530T B1DGE-530T A1Memory ControlSmartCache/RaidSmartRAID (I2O)SmartRAID 2005SPCI-SCIDMX3194UIS64PH ISDN155P-MF1 ATM (FPGA)155P-MF1 ATM (ASIC)25SS-3010 ATM (ASIC)SpeedStream 1023QuickStep 1000 ISDNLight Pulse FibreChannelLight Pulse 8000Endace Dag3.6DEndace Dag4.23GECB-1211 CardBusCB-1225 CardBusCB-1410 CardBusCB-710 CardBusCB-712 CardBusCB-1420 CardBusCB-720 CardBusCB-722 CardBusAudioPCI97AudioPCICT5880ES366H ModemMaestro IISOLO-1 AudioDriveMaestro 2EES1989ES1989 ModemMaestro 3ES1983 ModemMaestro 3 AudioES366H Fax/ModemES2838/2839 SuperLink ModemES2898 ModemRoadRunner HIPPIRoadRunner Gig-EFreedom GBusWL11000PSST-64PSST-128PSST-16PSST-4pSST-8pATM PCA-200ATM PCA-200e801 SoundTMC-18C30 (36C70)GL24110P03GL24110PGL24110P02PR103WinTVPN672TX 10/100Visualize EGVisualize FX6Visualize FX4Visualize FX2Tach TL FibreChannelTach XL2 FibreChannelJ2585AJ2585BDiva Serial MultiportElroy Ropes-PCIVisualize FXeTopTools Communications PortNetRaid-4MNetServer SmartIRQ82557B 10/100 NICPluto MIOzx1 IOCMercury Ropes-PCIQuickSilver Ropes-PCISmart Array V100Smart Array E200iSmart Array E200Smart ArraySmart Array P800Smart Array P600Smart Array P400Smart Array P400i77516500781179517814/7851/785480658165815479567955/7954MCACPU - Alta LiteCPU - Alta MPISA w/PnPCPUAuto LANStreamerGXT-150P82G267582351 PCI-PCIMiami/PCIOlympici82557B 10/100FireGL2133 PCIX-PCIXCalgary IOMMUEnvy24 I/O CtrlrEnvy24PT/HT Audio77201/77211 ATM (NICStAR)WDT 50x Watchdog TimerINIC-850 (A100UW)INIC-1060 (A100U2W)INIC-940INIC-941INIC-950IPN2120IPN22208849EES ISA2114580303 IOP80312 I/O CompanionPCIE-PCIEIOP332 PCIE-PCIXIOP331 PCIX-PCIX41210 PCIE-PCIXIOP333 PCIE-PCIX82375EB EISA82424ZX Cache/DRAM82378IB ISA82426EX ISA82434LX/NX PCI/Cache/DRAMGDT RAIDi960 RP PCI-PCIi960 RM PCI-PCIi960 RN PCI-PCIPRO/1000 (82542)PRO/1000F (82543GC)PRO/1000T (82543GC)PRO/1000XT (82544EI)PRO/1000XF (82544EI)PRO/1000T (82544GC)PRO/1000XT (82544GC)PRO/1000MT (82540EM)PRO/1000MT (82545EM)PRO/1000MT (82546EB)PRO/1000MF (82545EM)PRO/1000MF (82546EB)PRO/1000MT (82541EI)PRO/1000MT (82540EP)PRO/1000MT Mobile (82541EI)PRO/1000CT (82547EI)PRO/1000CT Mobile (82547EI)PRO/1000MT QP (82546EB)PRO/1000MT (82545GM)PRO/1000MF (82545GM)PRO/10082559PRO/100 VEPRO/100 VM82562EH HomePNA82801DB LANV.92 ModemPRO/Wireless 2100PRO/10GbE LR (82597EX)ICH8 IGP M AMTICH8 IGP AMTICH8 IGP CICH8 IFEICH8 IGP MPRO/100 MPRO/1000 PT (82571EB)PRO/1000 PF (82571EB)PRO/1000 PB (82571EB)82801FB LAN82801FBM LAN82801GB LANPRO/1000CT (82547GI)PRO/1000MT (82541GI)PRO/1000MT Mobile (82541GI)PRO/1000MT (82541ER)PRO/1000MT (82546GB)PRO/1000MF (82546GB)PRO/1000GT (82541GI)PRO/1000 PT (82572EI)PRO/1000 PF (82572EI)PRO/1000 PB (82572EI)PRO/1000MT (82573E)PRO/1000PT (82573E)PRO/1000 PT (80003ES2)PRO/1000 PF (80003ES2)PRO/1000MT QP (82546GB)PRO/1000MT (82573L)PRO/10GbE CX4 (82597EX)PRO/1000 AT (82571EB)PRO/1000 AF (82571EB)PRO/1000 QP (82571EB)PRO/1000 PL (82573L)PRO/1000 PM (82573V)PRO/1000 PM (82573E)82815 Hub82815 AGP82815 Graphics82806AA APIC82559ER82092AA IDESAA7116EE Pro 10 PCIEE Pro 100EE Pro 100 Smart8255x82437FX82371FB ISA82371FB IDE82371 ISA and IDE82437 PCI/Cache/DRAM82441FX82380AB Mobile ISA82380FB Mobile PCI-PCI82439HX82806AA82870P2 PCIX-PCIX82870P2 IOxAPIC82870P2 Hot Plug80960RP ATU82840 Host82840 AGP82840 PCI82845 Host82845 AGPPRO/10GbE SR (82597EX)82801AA LPC82801AA IDE82801AA USB82801AA SMBus82801AA AC9782801AA Modem82801AA Hub-to-PCI82801AB LPC82801AB IDE82801AB USB82801AB SMBus82801AB AC9782801AB Modem82801AB Hub-to-PCI82801BA LPC82801BA USB82801BA SMBus82801BA AC9782801BA Modem82801BAM Hub-to-PCI8256282801BAM IDE82801BA IDE82801BAM LPC82801BA AGP82801E LPC82801E USB82801E SMBus82801E LAN82801CA LPC82801CA/CAM USB82801CA/CAM SMBus82801CA/CAM AC9782801CA/CAM Modem82801CAM IDE82801CA IDE82801CAM LPC82801DB LPC82801DBL IDE82801DB USB82801DB SMBus82801DB AC9782801DB Modem82801DBM IDE82801DB IDE82801DBM LPC82801EB/ER LPC82801EB SATA82801EB/ER USB82801EB/ER SMBus82801EB/ER AC9782801EB/ER Modem82801EB/ER IDE82801EB/ER USB282801ER SATA82820 MCH82820 AGP82850 Host82860 Host82850/82860 AGP82860 PCI-PCIE7500 MCH HostE7500 DRAME7500 MCHE7501 MCH HostE7505 MCH HostE7505 MCH RASE7505 MCH AGPE7505 MCH PCI-PCI82845G/GL82845G/GL/GV/GE/PE AGP82845G/GL Video82865G/PE/P CPU-I/0-182865G/PE/P CPU-AGP82865G Video82865G/PE/P CPU-CSA82865G/PE/P CPU-I/0-282875P Host82875P AGP82875P PCI-CSA82915G/P/GV Host82915G/P/GV PCIE82915G/P/GV Video82925X MCH Host82925X PCIEE7221 MCH HostE7221 PCIEE7221 Video82915GM/PM/GMS Host82915PM/GM PCIE82915GM/GMS Video6300ESB LPC6300ESB IDE6300ESB SATA6300ESB SMBus6300ESB AC976300ESB Modem6300ESB USB6300ESB WDT6300ESB APIC6300ESB PCIX5000X Host5000 PCIE5000 Error Reporting5000 Reserved5000 FBDE8500 HostE8500 PCIEE8500 PCIE x8E8500 IMIE8500 FSB/Boot/InterruptE8500 Address MappingE8500 RASE8500 MiscE8500 ReservedE8500 XMBE8500 XMB MiscE8500 XMB MAIE8500 XMB DDRE8500 XMB Reserved82801FB LPC82801FBM LPC82801FB SATA82801FR SATA82801FBM SATA82801FB USB82801FB PCIE82801FB HD Audio82801FB SMBus82801FB Modem82801FB AC9782801FB IDE6321ESB LPC6321ESB SATA6321ESB AHCI SATA6321ESB SATA RAID6321ESB USB6321ESB PCIE6321ESB AC976321ESB Modem6321ESB HD Audio6321ESB SMBus6321ESB IDE82945GP82945GP PCIE82945G Video82955X MCH82955X PCIEE7230 MCHE7230 PCIE82915G Video82945GM MCH82945GM PCIE82945GM Video82801GH LPC82801GB LPC82801GBM LPC82801GHM LPC82801GB SATA82801GR AHCI SATA82801GR SATA82801GBM SATA82801GBM AHCI SATA82801GHM SATA RAID82801GB USB82801GB PCIE82801GB HD Audio82801GB SMBus82801GB Modem82801GB AC9782801GB IDE82801G PCIE82801H LPC82801H SATA82801H AHCI SATA82801H RAID82801HBM SATA82081HBM SATA82801H SMBus82801H DMI-PCI82801H USB82801H PCIE82801H HD AudioRCU32 I2O RAID31244 SATA82855PE Hub82855PE AGP6321ESB PCIE-PCIX82830MP CPU-I/O-182830MP CPU-AGP82830MP Integrated Video82830MP CPU-I/O-282852GM Hub-PCI82852/82855 AGP82852GM AGP82852GM Memory82852GM ConfigurationE7520 MCHE7520 MCH ERRE7320 MCHE7525 MCH ERRE7520 MCH DMAMCH PCIEE7525 MCH ConfigurationE7525 MCHPRO/Wireless 2200BGPRO/Wireless 2225BGPRO/Wireless 3945ABGPRO/Wireless 2915ABGi960 RD PCI-PCIPRO 100 Server82371SB ISA82371SB IDE82371SB USB82437VX82439TX System82371AB PIIX4 ISA82371AB IDE82371AB USB82371AB Power8281082810 Graphics82810-DC10082810-DC100 Graphics82810E82810E Graphics82443LX AGP82443BX AGP82443BX82440MX Host82440MX AC9782440MX Modem82440MX ISA82440MX IDE82440MX USB82440MX Power82440BX AGP82443GX82372FB IDE82740 AGP82450KX/GX82450KX/GX Memory82451NX Mem & IO82454NX PXB82802AC Firmware Hub 8Mbit82802AB Firmware Hub 4MbitI2O RAID PCI-PCIRCU21 I2O RAIDRCUxx I2O RAIDRCU31 I2O RAIDRCU31L I2O RAIDS21152BB PCI-PCIS21154AE/BE PCI-PCIPowerstorm 4D50TIntense 3DExpert3D5526 FibreChannelPRISM3PRISM2.5Prism IndigoPrism Javelin/XbowPrism GT/DuetteAEONGV-BCTV3AGX016ITT3204 MPEG DecoderIT8211FIT8212FIT8330GIT8888F ISAJMB360 SATAJMB361 IDE/SATAJMB363 IDE/SATAJMB365 IDE/SATAJMB366 IDE/SATAJMB368 IDE/SATAKTIHSSIDS3SSIDS1HSSIcAppian LiteDual SerialQuad SerialParallelDual ParallelDual Parallel BS3 805Leadtek WinFast TV 2000LXT1001EG1032EG1064PCMPC200PCM200PNICPNIC-II8031K56flex DSVD LTMODEMLTMODEMVenus ModemUSB 2-portUSB QuadraBusFW322 1394LS242 DVD DecoderPMAC 98715PMAC 98727MX86250Smart 16/4 PCI RingnodeSmart 16/4 PCI Ringnode Mk2Smart 16/4 PCI Ringnode Mk3Smart 16/4 PCI Ringnode Mk116/4 CardbusPresto PCISmart 100/16/4 PCI-HS RingnodeSmart 100/16/4 PCI Ringnode16/4 CardBus Mk2Collage 25 ATMCollage 155 ATMi740 PCILibertas 88W8300Libertas 88W8310Libertas 88W8335Yukon 88E8001/8003/8010Yukon-II 88E8021CUYukon-II 88E8022CUYukon-II 88E8061CUYukon-II 88E8062CUYukon-II 88E8021XYukon-II 88E8022XYukon-II 88E8061XYukon-II 88E8062XYukon 88E8035Yukon 88E8036Yukon 88E8038Yukon 88E8052Yukon 88E8050Yukon 88E8053YukonYukon (Belkin F5D5005)88SX5040 SATA88SX5041 SATA88SX5080 SATA88SX5081 SATA88SX6041 SATAMGA PX2085 (Atlas)MGA Millenium 2064W (Storm)MGA 1064SG 220MHzMGA Millennium II 2164WMGA Millennium II 2164WA-B AGPMGA G200 PCIMGA G200 AGPMGA G400/G450 AGPMGA ImpressionMGA G100 PCIMGA G100 AGPMGA 1064SGMGA G400 Twin HeadMGA G550 AGPMGA Millennium G200 SDMGA Produktiva G100 SDMGA Mystique G200 SDMGA Millennium G200 SGMGA Marvel G200 SDKSZ8841 10/100KSZ8842 dual-port 10/100 switchMN-120 10/100MN-130 10/1002IVDC-PCX1MiroVIDEO DC20Media 3DMiroVIDEO DC10/DC20Powerstorm 4D30TGUI AccelMPC105 PCIMPC106 PCISM56Raven PCICP-114C104HCP-104ULC168HDMA4 serialDAC960P V2 RAIDDAC960P V3 RAIDDAC960P V4 RAIDDAC960P V5 RAIDAcceleRAIDeXtremeRAIDZ8EMyrinet LANai 9.2MTD800 10/100MTD803 10/100MTD891 10/100/1000MV1000NCP130NCP130 Rev A2PCI-GPIBDP83810 10/100PC87415 IDE87560 Legacy I/ODP83815 10/100DP83820 10/100/1000CS5535 HostCS5535 ISACS5535 IDECS5535 AUDIOCS5535 USBCS5535 VIDEOSaturnSCx200 ISASCx200 SMISCx200 IDESCx200 AUDIOSCx200 VIDEOSCx200 X-BUSSC1100 ISASC1100 SMISC1100 X-BusNS87410PowerVR PCX2I/OVersa MaestroVersa Va26D MaestroMagicgraph NM2070Magicgraph 128VMagicgraph 128ZVMagicgraph NM2160Magicgraph NM2200Magicgraph NM2360MagicMedia 256AV+MagicMedia 256XL+MagicMedia 256AVMagicMedia 256ZXXframeXframe IIMA301GA620GA620T1P2S1P4SCMI8338A AudioCMI8338B AudioCMI8738/C3DX AudioCMI8738B AudioHSP56 AMRNSP2KNetVin 5000Universe VME53c81053c82053c82553c81553c810AP53c86053c1510D53c89653c89553c88553c87553c151053c895A53c1010-3353c1010-6653c103053c1030ZC53c103553c1035ZCSAS1064SAS1068SAS1064ESAS1068ESAS1066ESAS1064ASAS1066SAS107853c875JMegaRAID 320MegaRAID 320-2EMegaRAID SATA 4x/8xMegaRAID SAS 1064RMegaRAID Verde ZCRFC909FC909AFC929FC919FC929XFC919XFC949XFC939XFC949EYellowfin61C10263C81553c1030RPacket Engines G-NICPI7C21P100 PCIX-PCIXFNW-3603-TX 10/100FNW-3800-TX 10/100NX82C501 PCINDR4600 PCIBS21 10/100E-mobility WirelessImagine-128Imagine-128 IIImagine-128 T2RImagine-128 T2R4NV1DAC64Riva TNTRiva TNT2Riva TNT2 UltraVantaMCP04 ISAMCP04 SMBusMCP04 IDEMCP04 SATAMCP04 LANMCP04 AC97MCP04 USBMCP04 PCI-PCInForce4 ISAnForce4 SMBusnForce4 IDEnForce4 SATACK804 LANnForce4 AC97nForce4 USBnForce4 PCI-PCInForce4 PCIEnForce4 DDRnForce2 ISAnForce2 SMBusnForce2 IDEnForce2 LANnForce2 USBnForce2 AC97nForce2 AudionForce2 PCI-PCInForce2 FireWireMCP04 PCIEnForce2 400 ISAnForce2 400 SMBusnForce2 400 IDEnForce3 LANnForce2 400 USBnForce2 400 USB2nForce2 400 AC97nForce2 400 PCI-PCInForce2 400 SATAAladdin TNT2GeForce Go 6800GeForce Go 6800 UltraQuadro FX Go1400Quadro FX 1400nForce3 ISAnForce3 PCI HostnForce3 PCI-PCICK804nForce3 SMBusnForce3 IDEnForce3 USBnForce3 ModemnForce3 AC97nForce3 250 ISAnForce3 250 PCI HostnForce3 250 AGPnForce3 250 SATAnForce3 250 SMBusnForce3 250 IDEnForce3 250 USBnForce3 250 USB2nForce3 250 AC97nForce3 250 PCI-PCIGeForce 6600 GT AGPQuadro FX 330GeForce256GeForce256 DDRQuadroGeForce2 MXGeForce2 MX 100GeForce2 GoQuadro2 MXRGeForce 6600 GTGeForce 6600GeForce 6600 GoGeForce2 GTSGeForce2 TiGeForce2 UltraQuadro2 ProGeForce 6200Quadro NVS 285GeForce Go 6200GeForce4 MX 460GeForce4 MX 440GeForce4 MX 420GeForce4 440 GoGeForce4 420 GoGeForce4 420 Go 32MQuadro4 500XGLGeForce4 440 Go 64MQuadro4 200/400NVSQuadro4 550XGLQuadro4 GoGLGeForce4 MX 440 AGPGeForce4 MX 440SE AGPGeForce 4 MX 420 AGPGeForce4 MX 4000Quadro4 580 XGLQuadro4 NVSQuadro4 380 XGLGeForce2 Crush11nForce PCI HostnForce 220 DDRnForce 420 DDRnForce 220/420nForce APUnForce AC97nForce ISAnForce SMBusnForce AGPnForce PCI-PCInForce IDEnForce USBnForce LANnForce2 PCInForce2 AGPnForce2GeForce4 MX nForce GPUGeForce3GeForce3 Ti 200GeForce3 Ti 500Quadro DCCGeForce 6150GeForce 6150 LEGeForce 6100GeForce4 Ti 4600GeForce4 Ti 4400GeForce4 Ti 4200Quadro4 900 XGLQuadro4 750 XGLQuadro4 700 XGLMCP51 ISAMCP51 SMBusMCP51 IDEMCP51 SATAMCP51 LANMCP51 AC97MCP51 HD AudioMCP51 USBMCP51 PCI-PCIMCP51 HostMCP51 PMUMCP51 MemoryC51 MemoryGeForce4 Ti 4200 GoC51 HostC51 PCIEGeForce FX 5800 UltraGeForce FX 5800GeForce FX 5600 UltraGeForce FX 5600GeForce FX Go 5600GeForce FX Go 5650GeForce FX 5200 UltraGeForce FX 5200GeForce FX Go 5200GeForce FX 5500GeForce FX 5100Quadro FX 500/600GeForce FX Go 5300GeForce FX Go 5100GeForce FX 5900 UltraGeForce FX 5900GeForce FX 5950 UltraGeForce FX 5700LEGeForce FX Go 5700MCP55 ISAMCP55 SMBusMCP55 USBMCP55 IDEMCP55 MemoryMCP55 PCI-PCIMCP55 HD AudioMCP55 LANMCP55 PCIEMCP55 SATAMCP61 ISAMCP61 HD AudioMCP61 LANMCP61 SATAMCP61 PCIEMCP61 SMBusMCP61 IDEMCP65 ISAMCP65 MemoryMCP65 SMBusMCP65 IDEMCP65 PCIMCP65 HD AudioMCP65 AHCIMCP65 LANMCP65 USBMCP65 PCIEMCP65 SATAOTI107OC2325OC2183OC232682C092G82C557 Host82C558 ISA82C568 IDE82D568 IDE82C621 IDE82C70082C70182C82282C8613G+ UMTS HSDPA (F32)010L100L110L200L210L400L800Lx10H100H200H400H/800H800H200HV2011HOX16PCI954Exsys EX-41092OXCB950Exsys EX-41098OX16PCI954 ParallelOX16PCI952OX16PCI952 ParallelQStor SATAPMC/GNIC2ToolsRZ1000HSP MicroModem 56CMIC-LECNB20-LE HostCNB20HE HostCNB20LE HostCIOB30CMIC-HECMIC-WS Host (GC-LE)CNB20-HE HostCNB20-HE Host (GC-LE)CMIC-GC HostGCNB-LE HostHT-1000 PCICIOB-X2 PCIXHT-1000 PCIXCIOB-EHT-2000 PCIXHT-2000 PCIEOSB4CSB5CSB6HT-1000OSB4 IDECSB5 IDECSB6 RAID/IDEHT-1000 IDECSB6 IDEOSB4/CSB5 USBCSB6 USBHT-1000 USBCSB5 LPCGCLE-2 HostHT-1000 LPCK2 SATAFrodo4 SATAFrodo8 SATAHT-1000 SATAVerite 1000Verite V2x00SAA7130 TVSAA7133 TVSAA7134 TVSAA7135 TVPT80C826PT86C521PT86C523PC87550PT86C523_2PCC-ISESES1849I/O 1076I/O 1077I/O 9050I/O 9080PDC20265PDC20263PDC20275PDC20318PDC20319PDC20371PDC20379PDC20378PDC20375PDC20376PDC20377PDC40719PDC40519PDC20771PDC20571PDC20579PDC40779PDC40718PDC40518PDC20775PDC20575PDC20267PDC20246PDC20262PDC20268PDC20269PDC20276DC5030PDC20268RPDC20271PDC20617PDC20620PDC20621PDC20618PDC20619PDC20277ISP10160ISP1020ISP1022ISP1080ISP12160ISP1240ISP1280ISP2100ISP2200ISP2300ISP2312ISP2322ISP631285008580RT2460ART2560RT2561SRT2561RT2661802981298101E81388169SC81688169818081855C465 CardBus5C466 CardBus5C475 CardBus5C476 CardBus5C477 CardBus5C478 CardBus5C521 Firewire5C551 Firewire5C552 Firewire5C592 Memory Stick5C822 SD/MMC5C832 Firewire5C8435C852 xDRS56/SP-PCI11P1 ModemViRGETrio32Trio32/64Aurora64V+Trio64UV+868ViRGE VX86C92886C864-086C864-186C864-286C864-386C964-086C964-186C964-286C964-386C968-086C968-186C968-286C968-3Trio64V2/DXPlatoTrio3D AGPViRGE DX/GXViRGE GX2Trio3 DX2Savage 3DSavage 3DMSavage 4ProSavage PM133ProSavage KM133ViRGE MXViRGE MXPSavage/MX-MVSavage/MXSavage/IX-MVSavage/IXSuperSavageTwisterTwister-KProSavage DDRSonicVibesSafeXcelMagicLAN SWL-2210PA10xNeo-4SK-98xxSK-98xx v2.0SK-9D21SK-9SxxSK-9ExxTigonSTG 2000XSTG 1764Kyro-IISTG 1764X64GXDVDmagic-PRO86C201 AGP86C202 VGA648FX AGP86C20585C503 System5595 System85C503 ISA180 SATA181 SATA182 SATA1901915597/5598 VGA6215300/305/630 VGA85C50185C49685C596530 PCI540 PCI550 PCI85C601 EIDE620 PCI630 PCI633 PCI635 PCI640 PCI645 PCI646 PCI648 PCI649 PCI650 PCI651 PCI652 PCI655 PCI656 PCI658 PCI661 PCI730 PCI733 PCI735 PCI740 PCI741 PCI745 PCI746 PCI748 PCI750 PCI751 PCI752 PCI755 PCI756 PCI760 PCI900 10/100BaseTX961 ISA962 ISA963 ISA964 ISA965 ISA966 ISA551155125513 EIDE5571 PCI558155825591 PCI55965597/5598 Host620462056300530 VGA650 VGA6326 VGA6330 VGA5597/5598 USB7002 USB7007 FireWire7012 AC977013 Modem7016 10/100BaseTX7018 Audio966 HD Audio83C170 (EPIC/100)83C175 (EPIC/100)FDC 37C665FDC 37C922LynxEMLynxEM+Lynx3DMLynxELynxE+Lynx3D910Victory66 IDEVictory66 ISAVictory66 USBVictory66 PowerPirahna 2-portTulip, power, switch extenderFPGA I-Bus Tracer for MBDSZB6120CXD1947A FireWireCXD3222 FireWireMemory Stick SlotVelocity128PCIO Ebus2HMEPCIO Ebus2 (US III)ERI EtherGEMSimba PCI-PCICrypto 5821Crypto 1KPsycho PCImicroSPARC IIep PCIUltraSPARC IIi PCIUltraSPARC IIe PCICassiniST201ST1023ST202140XX4018ANE-344S2PSpectrum24 LA41X382C10182C10382C10582C565 ISAMC322TC9021 GigETC9021 GigE (alt ID)DC-290(M)DC-690CDC-3x5UTerratec TV+Terratec TValueTerratec TValue RadioTLAN3DLabs Permedia3DLabs Permedia 2TSB12LV21 FireWireTSB12LV22 FireWirePCI4450 FireWirePCI4410 FireWireTSB12LV23 FireWireTSB12LV26 FireWireTSB43AA22 FireWireTSB43AB22 FireWireTSB43AB23 FireWireTSB43AB21 FireWirePCI4451 FireWirePCI4510 FireWirePCI4520 FireWirePCI7(4-6)10 FireWirePCI7x20 FireWirePCI7XX1 CardBusPCI7XX1 FireWirePCI7XX1 FlashPCI7XX1 Secure DataPCI7XX1 Smart CardPCI6515 CardBusPCI6515 CardBus (Smart Card mode)PCI1620 MiscACX100AACX100BACX111PCI1130 CardBusPCI1031 PCMCIAPCI1131 CardBusPCI1250 CardBusPCI1220 CardBusPCI1221 CardBusPCI1210 CardBusPCI1450 CardBusPCI1225 CardBusPCI1251 CardBusPCI1211 CardBusPCI1251B CardBusPCI2030 PCI-PCIPCI2031 PCI-PCIPCI2250 PCI-PCIPCI2050 PCI-PCIPCI4450 CardBusPCI4410 CardBusPCI4451 CardBusPCI4510 CardBusPCI4520 CardBusPCI7510 CardBusPCI7610 CardBusPCI7410 CardBusPCI7610 CardBus (Smart Card mode)PCI7[46]10 CardBus (SD/MMC mode)PCI7[46]10 CardBus (Memory stick mode)PCI1410 CardBusPCI1420 CardBusPCI1451 CardBusPCI1421 CardBusPCI1620 CardBusPCI1520 CardBusPCI1510 CardBusPCI1530 CardBusPCI1515 CardBusPCI2040 DSPPCI7420 CardBusPCI interface5634PCV SurfRiderR4x00TC35856F ATM (Meteor)R4x00 PCIToPIC95 CardBus-PCIToPIC95B CardBusToPIC97 CardBusToPIC100 CardBusFast Infrared Type OSD ControllerVirtual NorthbridgeMem1Mem24DWAVE DX4DWAVE NXCyberBlade i7CyberBlade i7 AGPCyberBlade i1CyberBlade i1 AGPCyberBlade Ai1CyberBlade Ai1 AGPCyberBlade XP/Ai1TGUI 9320TGUI 9350TGUI 9360TGUI 9388CYBER 9397CYBER 9397DVDTGUI 9420TGUI 9440CYBER 9525TGUI 9660TGUI 9680TGUI 96823DImage 97503DImage 9850Blade 3DCyberBlade XPHPT343/345 IDEHPT36x/37x IDEHPT372A IDEHPT302 IDEHPT371 IDEHPT374 IDEPyramid3D TR25202ET4000w32p rev AET4000w32p rev BET4000w32p rev CET4000w32p rev DET6000/ET6100ET6300IGA-1680IGA-1682IGA-1683CyberPro 2000CyberPro 2010CyberPro 5000CyberPro 5050CyberPro 5202CyberPro 5252Santa CruzUM82C881 486UM82C886 ISAUM8673F EIDEUM8881 HB4 486 PCIUM82C891UM886AUM8886BFUM8710UM8886UM8881F HostUM8886F ISAUM8886AUM8891AUM9017FUM8886NUM8891NUS201USR9979023CP5610V961PBC i960 PCIV292PBC AMD290x0 PCIV960PBC i960 PCIV96DPC i960 PCIK8M800 HostK8T890 HostPT880 HostPM800 AGPKT880 AGPK8HTB HostVT8363 HostCN700 HostVT8371 HostVT8501VT82C505VT82C561VT82C571 IDEVT82C576 3VVT82C585 ISAVT82C586 ISAVT8237A SATAVT82C595 PCIVT82C596A ISAVT82C597 PCIVT82C598 PCIVT8601 PCIVT8605 PCIVT82C686 ISAVT82C691 PCIVT82C693 PCIVT86C926 AmazonVT82C570M PCIVT82C570M ISAPM800 ErrorsKT880 HostVT82C416 IDEVT82C1595 PCIPM800 HostVT8251 PCIVT8251 PCIEVT8251 VLINKVT83C572 USBVT82C586 PowerRhine/RhineIIVT6306 FireWireVT82C596 PowerVT82C596B PMVT6105M RhineIIIVT82C686 SMBusVT82C686 AC97VT8233 AC97RhineII-2VT82C686 ModemVT8233 ISAVT8633 PCIVT8366 PCIVT8653 PCIVT6202 USBVT6105 RhineIIIS3 Unichrome PRO IGPVT8361 PCIVT8375 PCIPM800 Unichrome S3VT612xCLE266VT8623 PCIVT8233A ISAVT8751 PCIVT6420 SATAVT6410 IDEP4X400 HostVT8235 ISAP4N333 HostVT8377 PCIVT8378 PCIPT890 HostK8T800M HostVT8237 ISAVT6421 SATAPM800 DRAMVT8251 ISAVT8251 SATAPM800 PMCK8T890 IOAPICVT8378 VGAPM800 PCIVT8231 ISAVT8231 PMGVT8363 AGPVT8371 PCI-PCIVT8501 AGPVT82C597 AGPVT82C598 AGPVT82C601 AGPVT8605 AGPK8T890 PCI-PCIVT8633 AGPVT8366 AGPVT8361 AGPVT8363 PCI-PCIVT8235 AGPK8HTB AGPVT8377 AGPVSC-7174 SATAGDT6000/6020/6050GDT6000B/6010GDT6110/6510GDT6120/6520GDT6530GDT6550GDT6x17GDT6x27GDT6537GDT6557GDT6x15GDT6x25GDT6535GDT6555GDT6x17RPGDT6x27RPGDT6537RPGDT6557RPGDT6x11RPGDT6x21RPGDT6x17RP1GDT6x27RP1GDT6537RP1GDT6557RP1GDT6x11RP1GDT6x21RP1GDT6x18RDGDT6x28RDGDT6x38RDGDT6x58RDGDT6x17RP2GDT6x27RP2GDT6537RP2GDT6557RP2GDT6x11RP2GDT6x21RP2GDT6513RSGDT6523RSGDT6518RSGDT6x28RSGDT6x38RSGDT6x58RSGDT6x33RSGDT6x43RSGDT6x53RSGDT6x63RSGDT7x13RNGDT7x23RNGDT7x18RNGDT7x28RNGDT7x38RNGDT7x58RNGDT7x43RNGDT7x53RNGDT7x63RNGDT4x13RZGDT4x23RZGDT8x13RZGDT8x23RZGDT8x33RZGDT8x43RZGDT8x53RZGDT8x63RZGDT6x19RDGDT6x29RDGDT7x19RNGDT7x29RNGDT8x22RZICP82C592 CPU82C593 ISA82C594 Wildcat82C596/597 Wildcat ISA82C54182C54382C53282C53482C53582C14782C97582C925Virtual SVGA IIVirtual SVGAVirtual NICP9000P9100WD33C193AWD33C196AWD33C197AWD7193WD7197WD33C296AWD34C296WD9610W83769FW89C840F 10/100Linksys EtherPCI IIW83C553F ISAW83C553FW89C940FW6692 ISDNLinksys EtherPCIVolari Z7X3201-3X3201-3 (21143)CardBus EthernetMini-PCI V.90 56k ModemMini-PCI K56Flex ModemCardBus 56k ModemCBEM56G Modem724734738737740740C724F7441221PCI-ST32Genie TV/FMDVDZD1201ZD1202ZD1205Martin-MariettaHauppaugeTTTechDynalinkCompaqSymbios LogicATIULSI SystemsVLSIAvance LogicNSTseng LabsWeitekDECCirrus LogicWestern DigitalAMIAMDTridentAcerDellSiemens Nixdorf AGMatroxChips and TechnologiesToshibaMiro Computer Products AGNECFuture DomainSiSHewlett-PackardPC TechnologyAsustekDPTOptiElsaSGS ThomsonBusLogicTISonyOak TechnologyWinbondSMSCMotorolaPromiseNumber 9UMCI. T. T.PicopowerMylexAppleMitacYamahaNexGen MicrosystemsQLogicCyrixLeadTek ResearchInterphaseContaq MicrosystemsBit3OlicomSunIntergraphDiamond MultimediaNational InstrumentsCMD TechnologyQuantum DesignsBrooktreeSGIACC MicroelectronicsSymphony LabsSTB SystemsPLXMadge Networks3ComSMCAcer LabsMitsubishi ElectronicsSurecomNeomagicMentor ARCAdvansysMolexMacronixEvans & SutherlandNVIDIAEmulexIntegrated Micro SolutionsTekram (1st ID)NewbridgeApplied Micro CircuitsTviaRealtekNKKIO Data DeviceInitioCreative LabsHighPointSigma DesignsVIACogent DataSiemensZnyx NetworksAcctonVortexEfficent NetworksIDTFORE SystemsPhilipsZiatechCycloneEquinoxAlliance SemiconductorSchneider & KochDigiMutechXircomRenditionServerWorksRicohD-Link SystemsCorrollaryAcardZeinetOmega MicroMarvellLite-OnV3 SemiconductorPinnacle SystemsAT&T/LucentDolphinMesa Ridge (MAGMA)Analog DevicesZoranPijnenburgCompexCycladesEssential CommunicationsO2 Micro3DFX InteractiveATMLC-CubeAVMCoregaASIXIntersilNortel NetworksSilicon MotionEnsoniqTransmetaRockwellDavicomITExpressPlatformLuxSonorTriTech MicroelectronicsAlteonUS RoboticsNVIDIA/SGS-ThomsonPericomAurealADMtekPacket EnginesForte MediaSIIGDTC TechPCTELCNetLAN MediaNetgearMoxaLevel 1Hifn3wareAbocomSundanceC-Media ElectronicsLavaSunixIC EnsembleMicrosoftOxfordChelsioTamarackAskeyAvermediaAironetGlobespanMyricomVScomAvlabInvertexBroadcomPlanexConexantMyson CenturyTopic/SmartLinkENEAralionTerraTecSymbolSybaBluesteelVMwareZoltrixAgilentNational DatacommPacific DataEumitcomNetSecZyDAS TechnologySamsungAtherosGlobal SunSafeNetMicrelVitesseLinksysNetoctaveAltimaAntares MicrosystemsCaviumBelkinHawking TechnologyI4ArecaNeterionINPROCOMMLanergyRalinkXGI TechnologySangomaOptionJMicronTekramHint3D LabsAddtronIndustrial Computer SourceNetVinGemtekTurtle Beachc't MagazinIntelAdaptecAtronicsNetMosParallelsTigerJet NetworkEndaceBelkin ComponentsARC LogicINVALID VENDOR ID"%s %s"unknown class 0x%02x, subclass 0x%02xclass %s subclass %sclass %s unknown subclass 0x%02x, rev 0x%02x) rev 0x%02xvendor "%s", unknown product 0x%04x%svendor 0x%04x product 0x%04xunknown cy82c693_init: bus_space_map failed (%d)cy82c693_initcy82c693_readcy82c693_write%s: External SRAM, %s access%s, %dbytes/SCB %s: couldn't map interrupt %s: Using left over BIOS settings : couldn't establish interrupt%s: Enabling 39Bit Addressing : unable to map registers %s: unable to allocate bus-specific data fast, parity checking enabledslow%s: PCI error Interrupt at seqaddr = 0x%x %s: Latched PCIERR interrupt with no status bits set %s: Data Parity Error has been reported via PERR# %s: Signaled a Target Abort %s: Received a Target Abort %s: Received a Master Abort %s: Signal System Error Detected %s: Data Parity Error Detected during address or write data phase RAID functionality unsupported adapter at unexpected slot %d unable to map to a channel : unable to map device registers : adv_init failed : couldn't map interrupt AscInitFromEEPAscIsrQDone: completed scsiq with unknown statusAscIsrQDone: Attempting to free more queues than are activeAscIsrQDone: Corrupted SG list encounteredAscExeScsiQueue: Queue with QC_SG_HEAD set but %d segs.AscExeScsiQueue: Queue with too many segs.AscResetDeviceQUANTUM XP343011071NEC YAMAHACDR400CD-ROM DRIVE TDC 36HP : broken match/attach! : %s: invalid memory type %d , using %luK of on-board RAM, can't map on-board RAMpciide%s: couldn't map %s cmd regs %s: couldn't map %s ctl regs %s: couldn't map native-PCI interrupt unknown interrupt%s: using %s for native-PCI interrupt %s: unable to subregion %s ctl regs %s: couldn't establish native-PCI interrupt, (unsupported maptype 0x%x), unused (couldn't query registers), unused (registers at unsafe address %#lx), unused (couldn't map registers)%s:%d: unable to allocate table DMA for drive %d, error=%d %s:%d: unable to map table DMA fordrive %d, error=%d %s:%d: unable to create table DMA map for drive %d, error=%d %s:%d: unable to load table DMA map for drive %d, error=%d %s:%d: unable to create xfer DMA map for drive %d, error=%d %s:%d: unable to load xfer DMA map fordrive %d, error=%d %s:%d:%d: bus-master DMA error: missing interrupt, status=0x%x %s:%d:%d: bus-master DMA error: status=0x%x channel 0channel 1%s: %s cannot allocate memory for command queue%s: %s disabled (no drives) %s: no compatibility interrupt for use by %s configuredwiredcompatibilitynative-PCI, %s %s to %s: DMA%s:%d:%d: cannot allocate DMA maps, using PIO transfers %s:%d:%d: using DMA data transfers not responding; disabled or no drives?other hardware responding at addresses%s: %s ignored (%s) , (partial support) (unsupported): no DMA%s: %s ignored (disabled) %s:%d:%d: multi-word DMA disabled due to chip revision : ATA33: ATA66: ATA100: ATA133 %s: bus-master DMA support present%s: %s %s to %s mode %s %s: can't allocate memory for command queue: unable to map BA5 register space %s: port %d: device connected, but communication not established %s: port %d: unknown SStatus: 0x%08x %s: port %d: device present, speed: 3.0Gb/s, speed: 1.5Gb/s%s: port %d: PHY offline : can't subregion offset %lu size %luport 0port 1port 2port 3%s %s channel: can't allocate memory for command queue%s: couldn't subregion %s cmd base %s: couldn't subregion %s ctl base %s: couldn't subregion %s channel cmd regs : unexpected PCI function %d , %s %s to native-PCI compatibility : cannot allocate memory for command queue , (unable to map ctl registers)540630630S633635645645DX651652655658661730733735741745746748760962963: 5597/5598unknown SiS IDE type %d %s:%d: error intr %s:%d: bogus intr %s: unexpected PCI function %d %s: no known timing values %s:%d: bogus intr (reg 0x%x) : couldn't establish native-PCI interrupt: couldn't map bus-master DMA registers : couldn't map IDE registers : DMA %s: channel %d: can't allocate memory for command queue %s: couldn't map channel %d ctl regs %s: couldn't map channel %d cmd regs %s channel %d: can't subregion DMA registers ppb%s: not configured by system firmware pci at %svr: failed to map i/o space : can't load dma map : can't create dma map : can't map dma buffers (%d bytes) : can't alloc list : could not establish interrupt%s: rx error (%02x): rx buffer error system bus error received runt packet received giant packet FIFO overflow frame alignment error crc error%s: rx shutdown error! %s: tx shutdown timeout %s: restarting %s: receive error (%04x) packet lost overflow no buffers%s: rx packet lost %s: initialization failed: no memory for tx buffers %s: chip is in D%d power mode -- setting to D0 i82562, %si82558i82559i82557i82559Si82550i82551%s: Allocation of PCI resources failed %s: Unable to initialize the hardware %s: EEPROM read error while reading mac address %s: Invalid mac address %s: PHY reset is blocked due to SOL/IDER session. %s: Unable to allocate rx_desc memory %s: Unable to allocate tx_desc memory %s: watchdog timeout -- resetting %s: Could not setup transmit structures %s: Could not setup receive structures %s: Unsupported media type em_set_multi%s: Unknown MAC Type : mmba is not mem space : cannot find i/o space : flash is not mem space : cannot find mem space %s: The EEPROM Checksum Is Not Valid %s: Hardware Initialization Failed%s: EEPROM read error while reading part number %s: em_dma_malloc: bus_dmamap_load failed; error %u %s: em_dma_malloc: bus_dmammem_map failed; size %lu, error %d %s: em_dma_malloc: bus_dmammem_alloc failed; size %lu, error %d %s: em_dma_malloc: bus_dmamap_create failed; error %u %s: Unable to allocate tx_buffer memory %s: em_allocate_receive_structures: bus_dmamap_create failed; error %u %s: Unable to allocate rx_buffer memory %s: Excessive collisions = %lld %s: Symbol errors = %lld %s: Sequence errors = %lld %s: Defer count = %lld %s: Missed Packets = %lld %s: Receive No Buffers = %lld %s: Receive Length Errors = %lld %s: Receive errors = %lld %s: Crc errors = %lld %s: Alignment errors = %lld %s: Carrier extension errors = %lld %s: RX overruns = %ld %s: watchdog timeouts = %ld %s: XON Rcvd = %lld %s: XON Xmtd = %lld %s: XOFF Rcvd = %lld %s: XOFF Xmtd = %lld %s: Good Packets Rcvd = %lld %s: Good Packets Xmtd = %lld : %s,: unknown device: %x:%x dc_pci_attach: can't subregion i/o space ne_pci_attach: impossible%s: init failed, error=%d %s: unable to establish powerhook vendor 0x%04x%s: unable to map registers pcscp%s: can't create dma maps %s: unable to load for the MDL, error = %d %s: unable to map_create for the MDL, error = %d %s: unable to map the MDL memory, error = %d %s: unable to allocate memory for the MDL, error = %d dmaintr: discarded %d bytes (tcl=%d, tcm=%d) dmaintr: tcl=%d, tcm=%d, tch=%d; trans=%d, resid=%d pcscp_dma_intr: empty esp FIFO of %d %s: dma_intr: DMA aborted. %s: error: DMA error detected; Aborting. %s: unable to load dmamap, error = %d pcibisa at %s%s: %s channel interrupting at irq %d pre 1.02.0usb: USB revision %s, not supported usb_attach%s: can't register softintr %s: root device is not a hub %s: root hub problem, error=%d usbtaskunable to create task thread usb_create_event_thread task%s: unable to create event thread for usb_create_event_threadconfigusbevtusbtskusb at %susbreausbreadusbd_add_dev_eventusbd_add_drv_eventusb_add_eventusb_detachusbdet%s: event thread didn't die usbsynusbd_transfer: not doneusbd_start_next: error=%d usb_desc_iter_next: descriptor length = 0 usb_desc_iter_next: descriptor length too large usb_desc_iter_next: bad descriptor usb_detach_wait: %s didn't detach HomeConnectBluetooth3C19250 Ethernet3CRSHEW696HomeConnect 3C460U.S.Robotics 56000HomeConnect 3C460B3CRUSB100753Com OfficeConnect Analog Modem3Com U.S. Robotics Pro ISDN TA3Com HomeConnectXX1XX2URE450 EthernetUFE1000 Fast Ethernet1/10/100 ethernetXX4XX5XX6RTL8151XX7XX8XX9WL54XX10BWU613RT2573USB320-EC Ethernet2664WT-Sinus 111 WLANSpeedStream EthernetMEZ1000 RDAUSB 2.0 Data LinkWarplinkAcerscan C310UAcerscan 320UAcerscan 640UAcerscan 620UATA/ATAPIAWL300AWL400Prism2.5 WLANPrism2.5 WLAN AROPEX FreeLan 802.11b802UAT1ACT-IR2000U FIRI/O BoardI/O Board, rev. 1AWN-8020 WLANAWU-120AN986A EthernetAN986 EthernetAN8511 EthernetAN8513 EthernetAN8515 EthernetUBS-10BT EthernetQ-DriveSnapScan 1212USnapScan 1236USnapScan TouchSnapScan e40SnapScan e50SnapScan e20SnapScan e25SnapScan e26SnapScan e52AirPrime CDMA Wireless EVDO cardAWU2000BWM-168bUSB-HASP 0.06One Touch 535/735MacAlly Kbd HubAU9814 HubMicroConnectors/StrongManNEC Kbd HubAT-USB100ADA70 SpeakersASC495 SpeakersBack-UPS Pro 500Eagle IEagle IIEagle IICEagle IIIEZUSBEZLINKOptical mouseADB deviceSpeakersTrue Random Number GeneratorARK3116 SerialPENTAX Optio230WLL013 (Intersil)WLL013Voyager 1010USB 2.0 10/100 ethernet controllerAX88178AX88772RT2570WL-159gMyPal A730WL-14010Mbps EthernetUC-110T EthernetUC210T EthernetDSB-650CAR5523USB Cable 205UHB124 hubW-Buddie WN210DWL-900AP Wireless access pointAT76C503 (Intersil 3861 Radio)AT76C503 (Intersil 3863 Radio)AT76C503 (RFMD Radio)AT76C505 (RFMD Radio)AT76C505 (RFMD 2958 Radio)AT76C505A (RFMD 2958 Radio)AT76C505AS (RFMD 2958 Radio)ATC-HA4USB USB headphonePC5740 EVDOUSB Audio Speaker1200UuLinks RS-422/485F5U002 ParallelF5D6050 802.11b Wireless adapterFBT003v2 BluetoothF5U103 SerialF5U109 SerialUSB to LAN ConverterF5U237 USB 2.0 7-Port HubF5U257 SerialF5U409 SerialF5U120-PC HubF5D7050 54g USB Network AdapterF5D705A 54g USB Network AdapterF5D705C 54g USB Network AdapterF5D9050 ver 3USB100N 10/100 EthernetUSB100LPUSB100ELUSBE100USB2AR EthernetBCM2033BCM2033 (no fw)HL-1050 laser printerKeyboard/MouseCANOSCAN N656UCANOSCAN N1220UCANOSCAN N670UCANOSCAN N1240UPowerShot S10PowerShot S20PowerShot S100PowerShot G1PowerShot A20Netmate EthernetNetmate2 EthernetUSB Chief Bus & Protocol AnalyzerAndromeda hubQVBE-300 PDACASIO Nameland EZ-USBEasyDisk PortableMy3000 keyboardMy3000 hubCypressKB-8933 keyboardPro ThrottlePro PedalsFighterstickFlight Sim YokeUSB200M v2WUSB54GCHU200-TSiPAQ PocketPCA1500iPAQ WLANW100WLAN MultiPort W200Personal Jukebox PJB100SnapPort EthernetCM-5100P EVDOC11UWL-210C54RU WLANC54RUEye Q 3xQuickCamEther USB-TFEther USB-TXWirelessLAN USB-11FEther USB-TXSWireless LAN Stick-11FEther USB2-TXULUSB-11 KeyWLAN USB Stick 11FEther USB-TXCNomad IINomad II MGNomadVoip BlasterBlueCoreEx1300 hubTG54USBthermometerKeyboard/HubFM RadioUSB2 HubPhotoClipJ-6502 speakersUSB-FOB/iBUTTONTrueMobile 1180 WLANBluetooth 350Earthmate GPSEarthmate LT20Rio 500WL-200UCHUSB 611GWL-240UXH1153 802.11bC-Net CWD-854 rev FAccelePort 2AccelePort 4AccelePort 8PS/2 Active10/100 ethernetDWL-120 rev EDWL-122DWL-120 rev FDWL-AG132DWL-G132DWL-AG122DWL-G122 rev C1WUA-1340DUB-E100 rev B110Mbps ethernetStorage AdapterVigor550ANT dev boardFlash DiskTouch PanelDiva 852 ISDN TAhubmonitorGoldpfeil P-LAN29UOLD-USB/TXLD-USBL/TXUC-SGT SerialUC-SGT0 SerialELSAMicrolink USB2Ethernet1S serial2S serial1S25 serial4S serialE45 EthernetCentronics1S9 serialEZ-USB2U4S serialUSB PrinterISD Smart Cable for MacISD Smart CablePerfection 636U / 636PhotoPerfection 610Perfection 1200U / 1200PhotoExpression 1600Perfection 1640SUPerfection 1240U / 1240PhotoPerfection 640UPerfection 1650GT-9700FPerfection 2400Perfection 1260Perfection 1660Perfection 1670Stylus CX3650XTNDAccess IrDAFalcom Twist USBFalcom Samba USBConnector for DVD drive8U232AM Serial2232C SerialPS/2 Keyboard/MouseKWYSY6Y8ICDB9Y9Coastal ChipWorks TNC-XMatrix Orbital MX200 Series LCDMatrix Orbital LK202-24 LCDMatrix Orbital LK204-24 LCDCrystalfontz CFA-631 LCDCrystalfontz CFA-632 LCDCrystalfontz CFA-633 LCDCrystalfontz CFA-634 LCDSEMC DSS-20 SyncStationMass StorageAH-F401U Air H deviceYP3X00 PDAIque 3600GeneLink Host-Host BridgeGL650 HubGL641USB CompactFlashGN-BR402WGN-WLBM101GN-WBKGGN-WB01GSGoCOM232 Serial converterGWUSB2EGamePad ProCF-writer/MP3 PlayeriMate, ADB adapterExpert mouseCLOCK USBDA LeaderHWGUSB2-54 WLANFlashGate SmartMediaFlashGate CompactFlashFlashGateCrossam2+USB IR commanderHandspring VisorHandspring TreoHandspring Treo 600WinTV FMUF200 EthernetDVD-CAM DZ-MV100A CamcorderDeskJet 895CScanjet 4100CPhotosmart S20DeskJet 880CScanJet 4200CCD-Writer PlusMultimedia Keyboard HubHN210WScanJet 6200CPhotoSmart S20DeskJet 815CScanJet 3300CCD-Writer Plus 8200eDeskJet 1220CDeskJet 810C/812CScanjet 4300CCD-Writer+ CD-4eOfficeJet G85xiLaserJet 1200Scanjet 5200CDeskJet 830CScanJet 3400cseDeskJet 885CScanjet 6300CDeskJet 840cScanJet 2200CScanjet 5300CDeskJet 816CDeskjet 970CseScanjet 5400CDeskjet 959CDeskJet 930cInkjet P-2000UDeskJet 640cPhotosmart P1100HN210E EthernetiPAQ 22xx/Jornada 548Jornada 568PhotoSmart C500HUAWEI Mobile E618OpticalCD-ROMFlash Go!EdgePort/4 RS232Hubport/7Rapidport/4Edgeport/4 RS232Edgeport/2 RS232Edgeport/4 RS422Edgeport/2 RS422/RS485Hubport/4Hand-built Edgeport/8MultiTech version of RP/4Edgeport/(4)21 ParallelEdgeport/421 Hub+RS232+ParallelEdgeport/21 RS232+Parallel1/2 Edgeport/8Edgeport/2 RS232/DINEdgeport/4 RS232/DIN1/2 Edgeport/16Edgeport CompatibleEdgeport/8 RS422OEM deviceUSB2 StorageIDE ISD110IDE ISD105Portable USB Harddrive V2USB cableUSB Storage Adapter V2EasyPCAP310 AnyPoint IIWireless 2011B82930 test boardPrism2.x WLANValueCANNeoVI BlueUSB-SSMRW SD-cardUSB-SDRW SD-cardUSB ETTUSB ETTXUSB WN-B11USB Airport WN-B11RSAQ1 SerialUSB2.0-SCSI Bridge USB2-SCZip 100Zip 250CDRW 9602iFP-1xxiFP-3xxiFP-5xxWM1080APC-60BJD 350AirH"PHONE AH-J3001V/J3002VMP-XP7250 Builtin WLANMP-PRX1MiniHub 4000PKC-180 IrDAHKS-0200 USBDAQOrbit trackballTurboBallOrbit trackball for MacVideoCAM VGAUSA-28 serialUSA-28X serialUSA-19 serialUSA-18 serialUSA-18X serialUSA-19W serialUSA-49W serialUSA-19QI serialUSA-19Q serialUSA-28X/XB serialUSA-28XB serialUSA-28XA serialUSA-18XA serialUSA-19WQ serialUIA-10 remote controlUIA-11 remote controlKNU101TX EthernetDigital Science DC220Digital Science DC260Digital Science DC265Digital Science DC290Digital Science DC240Digital Science DC280EasyShare DX4900Niche mouseGenius NetScroll mouseFlight 2000 joystickColorPage Vivid-ProAH-K3001VKPC650 EVDOHard DiskCD R/W9531 GPSjumpSHOT CompactFlash2662W-AROptra S 2450Camedia MAUSB-2USB10TXUSB10T EthernetUSB100TX EthernetUSB100H1 Ethernet/HPNAUSB10TA EthernetWUSB11 802.11bWUSB11 802.11b v2.5WUSB12 802.11b v1.1WUSB11Network Everywhere NWU11BWUSB11 v2.8WUSB11 v3.0M2452 keyboardM4848 mousePageScanQuickCam WebQuickCam ProQuickCam ExpressQuickCam Pro 3000QuickCam Notebook ProQuickCam Pro 4000N43N48 mouseM-BA47 mouseWingMan Gaming MouseBD58 mouseiFeel MouseWingMan GamePad ExtremeWingMan RumblePadWingMan Force joystickWingMan Formula Force GP (GT-Force)iTouch KeyboardUSB-PS/2 TrackballTrackMan WheelCordless mouseCordless keyboardCordless Desktop OpticalQuickCam ZoomLCS-8138TXUSS-720 evaluation kitD-Link DU-H3SP BAY HubRS232 InterfaceSitecom RS232ML-4500LUA-TX EthernetNintendo Wi-FiLUA2-TX EthernetLUA-KTX EthernetWLI-USB-S11MCR-SM2 SmartMediaUSB-IDE Bridge: DUB-PxxGWLI-USB-KS11G wlanLUA-U2-KTX EthernetWLI-USB-KB11 WLANWLI-U2-KG54-YB WLANWLI-U2-KG54 WLANWLI-U2-KG54-AI WLANWi-SpyRicochet GSSP128AR EtherFastSideWinder Precision ProIntelliMouseNaturalDigital Sound System 80Sidewinder Precision Racing WheelTrackball ExplorerIntelliEye mouseInternet Keyboard ProMN510 WirelessSCSI-DB25SCSI-HD50CameraMateFreecom IDEPhantom 336CX - C3ScanMaker X6 - X6UPhantom C6ScanMaker V6USLScanMaker V6ULMidisport 2x2Digital WalletDimage S304Dimage XDimage 7iDimage A1CD-R/RW DriveMouseFDDMA-620 IrDAEasiDock EthernetMC141555 hub controllerT720cUSBLANSB4100 Cable ModemMT5634ZBA modem1200 CU600 CU1200 UB1200 Plus1200 CU PlusBearPaw 1200FMDC-800DV2000DiskOnKeyGPIB-USB-ABearPaw 1200BearPaw 2400RepeaterPicty760Picty900Picty920Picty800USB2.0 Hub6-in-1 Flash Device Controller8-in-1 Flash Device ControllerMulti-format Flash ControllerTurbo-ConnectClik! 40EthernetGadgetUSB 2.0 Fast EthernetMA101MA101 Rev B802.11b802.11b V2WG111TWG111UWPN111E990E880E885CA-42 SerialNV-902WMerlin V620C-1C-700 Ultra ZoomUSB TO EthernetOV511OV511+MDCFE-B CFMemory Stick+CFDatafab-basedPNY/Datafab CF+SMSimple Tech/Datafab CF+SMCF + SM Combo (LC1)Datafab MD1-II PC-Card8In2model 01 WiFi interfacemodel 01 Bluetooth interfacemodel 01 Ethernet interfaceSolid state diskDKU-5 SerialUSB Serial AdaptorPalm m500Palm m505Palm m515Palm i705Palm Tungsten ZPalm m125Palm m130Palm Tungsten TPalm Zire 31Palm ZireLS-120MultiMediaCardTY-TP50P6-S 50in Touch Panel6 in 13 in 1Serial ConverterAt-Home EthernetWL-503IADSS 350 Digital Speaker SystemDSS XXX Digital Speaker SystemPCA645VCPCA646VCPCVC675K VestaPCVC680K Vesta ProPCVC690K Vesta Pro Scan CameraPCVC730K ToUCam FunPCVC740K ToUCam Pro PCPCVC750K ToUCam Pro ScanDSS 150 Digital Speaker SystemDIVA mp3 playerPS2 to MacXkeys Programmable KeyboardCRW-600 6-in-1GW-US11H WLANGW-US11S WLANGW-US54MiniGW-US54GZLGW-USMMPlatronics DSP-400 Headsettest boardExpress EthernetTravel Flash DriveG2-200G2E-300G2-300Colorado 9600Colorado 600uVisioneer 6200Colorado 19200Colorado 1200uG2-600ReadyScan 636iG2E-600ComfortMouse-in-a-BoxSony PCGA-UMS1PL2301 Host-Host interfacePL2302 Host-Host interfacePL2303 SerialParallel printerATAPI-4 Bridge ControllerPL2501 Host-Host interfaceUSB-1284 BRIDGEScorpion-980NCDMA MSM modemCDMA MSM phoneUSB StrikePadi-Key 2000RT2671USB serial REX-USB60RTL8150RTL8151 PNARTL8187UA-100 Audio I/FUM-4 MIDI I/FSC-8850 MIDI SynthU-8 Audio I/FUM-2 MIDI I/FSC-8820 MIDI SynthPC-300 MIDI KeyboardUM-1 MIDI I/FSK-500 MIDI KeyboardSC-D70 MIDI SynthUM-880 MIDI I/FSD-90 MIDI SynthUM-550 MIDI I/FSD-20 MIDI SynthSD-80 MIDI SynthUA-700 Audio I/FGamepad 203USBXG-760ACyborg 3D Gold JoystickImageMate SDDR-05aImageMate SDDR-31ImageMate SDDR-05ImageMate SDDR-12ImageMate SDDR-09ImageMate SDDR-75JY-DV9USB gamepadSanyo SCP-4900 PhoneI330SWL-2100USL11R-IDEUSB-Serial converterRoot HubSN1 L1 System ControllerPocket AdapterSL5500A300SL5600C700C750E-USB BridgeeUSCSI BridgeImageMate SDDR09eUSB SmartMedia / CompactFlasheUSB MultiMediaCardSony HifdeUSB ATA/ATAPIeUSB CompactFlashCD-RW DeviceSCM MicroSX1X65X75GSM module MC35SpeedStreamSpeedStream 1022Aircard 580 EVDODatum Networks SSF-7X Multi PlayersDigiFilm-ComboMULTICARDREADERU2EPsion Dacom Gold Port EthernetPololu SerialCrumb128Degree ControlsSuunto sportsBurnside Desktop mobileIP-Link 1220DCU-11 cloneCP210x SerialYAP Phone (no firmware)YAP PhoneNetComm Roadster II 56LN029WL-022CN104WL-113WL-172WL-113 rev 2SmartLink EthernetsmartNIC 2 PnPEZ Connect EthernetEZ Connect 11MbpsEZ Connect 11Mbps v2NUB100 EthernetNUB110 EthernetSony DSC CamerasMemorystick NW-MS7Harddrive V2Memorystick MSAC-US1HandycamSony MSC Memorystick SlotClie v3.5PlayStation2 keyboardPlayStation2 keyboard hubPlayStation2 mouseClie v4.0Clie v4.0 Memory Stick slotSony Clie s360Clie v4.1 Memory Stick slotClie v4.1Sony Clie nx60Sony Clie tj25KeikaiDenwa 8KeikaiDenwa 8 with chargerMS3303H SerialUB801RCommunicatorInternet Access DeviceMobile AdaptorU-Cable type D2U-Cable type P1Slipper UIr-TrinityU-Cable type A3U-Cable type A4Type 6 KeyboardType 7 KeyboardType 6 MouseSGC-X2ULSupra Express 56KSupraMax 2890 56KRio 600Rio 800Nike psa[play 120EP-1427X-2 EthernetEricsson DCU-10/11ZD1211USBPS2CameraMate (DPCM_USB)ZodiacUSB-PDC Adapter UPA9664USB-cdmaOne Adapter UCA1464USB-PHS Adapter UHA6400USB-PHS Adapter UPA6400FD-05PUBALLNET 0193 WLANZyXEL ZyAIR B200 WLANU-300CQuickWLANMicrophoneUT-USB41 hubTUSB2046 hubNex II DigitalFusion Digital GamepadArgos Mini SmartcardThumbDriveThumbDrive 8MBU209 SerialUSB/MP3 decoderXXX 1100SM-2000G240TEW-429UB1200 UB PlusAstra 1236UAstra 1220UAstra 2000UAstra 2100UAstra 2200UAstra 3400Panache Surf ISDNUSR1120 WLANUSR9000 SureConnect ADSLMC60 SerialG773 Monitor HubP815 Monitor HubAirsyncG773 Monitor ControlCPiA CameraOneTouch 7600OneTouch 5300Scanport 3000OneTouch 6100OneTouch 6200OneTouch 8100OneTouch 8600DSC350Vodafone Mobile Connect 3GGlobeTrotter 3G FUSIONGlobeTrotter 3G QUADCT-0405-U TabletGraphireGraphire3 4x5Graphire4 Classic A6Intuos A5UR055GImaging DeviceIBM PC CameraFlashbuster-UUX256 MIDI I/FUX96 MIDI I/FRP-U200NetVolante RTA54iNetVolante RTW65bNetVolante RTW65iNetVolante RTA55iU640MO-03M4Y-750XI-725/726XI-7352986L Fax ModemZD1211BOmni 56K PlusZyAIR G-220PrestigeeGalaxAOXAtmelMitsumiHewlett PackardNational SemiconductorFuture Technology DevicesEastman KodakMelcoLeadtekADI SystemsComputer Access TechnologyStandard MicrosystemsAdvanced Gravis ComputerSun MicrosystemsTaugagreining HFAdvanced Micro DevicesLexmark InternationalNANAOAlps ElectricThrustmasterTexas InstrumentsKYE SystemsDiamond (Supra)Primax ElectronicsAMPCherry MikroschalterAmerican MegatrendsLogitechBehavior Tech. ComputerSanyo ElectricConnectixKensingtonLucentKyoceraPlantronicsSTMicroelectronicsHitachiAcer PeripheralsVisioneerNikonCypress SemiconductorSeiko EpsonRainbow TechnologiesI/O DataTDKU.S. RoboticsMethode Electronics Far EastMaxi SwitchLockheed Martin Energy ResearchFujitsuToshiba AmericaMicro Macro TechnologiesKonicaLite-On TechnologyFuji Photo FilmPhilips SemiconductorsTatung Co. Of AmericaScanLogicMyson TechnologyITT CanonAltec LansingPanasonic (Matsushita)SharpIiyamaShuttle TechnologySamsung ElectronicsAnnabooksJVCChicony ElectronicsBrother IndustriesDallas SemiconductorAztech SystemsKawatsu SemiconductorAmerican Power ConversionAdvanced Connectek USANetChip TechnologyALTRAATI TechnologiesAladdin Knowledge SystemsUniversal AccessViewSonicXirlinkAnchor ChipsVLSI VisionAsahi Kasei MicrosystemsATEN InternationalMustek SystemsTelex CommunicationsPeracom NetworksAlcor MicroWACOMe-TEK LabsEIZOElecomHauppauge Computer WorksBAFO/Quality Computer AccessoriesY-E DataQuickshotRolandRockfireRATOC SystemsZyXEL CommunicationIomegaA-Trend TechnologyAdvanced Input DevicesLaCieOmniVisionIn-System DesignApple ComputerDigi InternationalQualcommQtronixBrainboxesUltimaAxiohm Transaction SolutionsMicrotekSUN CorporationLexar MediaSymbol TechnologiesGenesys LogicFuji ElectricKeithley InstrumentsEIZO NanaoKawasaki LSIFFCAnko ElectronicP.I. EngineeringAOC InternationalChic TechnologyBarco Display SystemsBridge InformationSolid YearBio-Rad LaboratoriesMacallyAct LabsAlarisApexVivitarAvisionTEACArkmicroSilicon GraphicsSanwa SupplyAcer Semiconductor AmericaSigmatelDrayTekAiwaACARD TechnologyProlific TechnologyMinoltaCH ProductsHagiwara Sys-ComChuntexAskey ComputerSaitekAlcatel TelecomAGFA-GevaertAsia Microelectronic DevelopmentBizlink InternationalKeyspanAashima TechnologyMultiTechADS TechnologiesAlcatel MicroelectronicsSirius TechnologiesBoston AcousticsGuillemotPutercomMCTImationSusteenEicon NetworksSyntech InformationDigital StreamAureal SemiconductorMidimanSurecom TechnologyGriffin TechnologySanDiskJenoptikNokiaBrimaxAxis CommunicationsABL ElectronicsSagemSun CommunicationsAlfadata ComputerNational Technical SystemsOnntoBeFreecomMicrotechOlympusAboCom SystemsKeisokugikenOnSpecAPG Cash DrawerB.U.G.Allied Telesyn InternationalAVerMedia TechnologiesCASIOD-LinkAptio ProductsArasan Chip SystemsAllied CableSTSNZoom TelephonicsBroadLogicHandspringAction Star EnterprisePalm ComputingSOURCENEXTAccton TechnologyDiamondBayNETGEARActiveWireB&B ElectronicsPortGearSystem TalksMetricomADESSO/Kbtek AmericaJatonAPT TechnologiesBoca ResearchAndrea ElectronicsBurr-Brown Japan2WireAIPTEK InternationalSmartBridgesBillionton SystemsExtended SystemsM-SystemsAuthenTecAudio-TechnicaTrumpion MicroelectronicsAlation SystemsConcord CameraGarmin InternationalGoHubsAmerican Biometric CompanyYanoKingston TechnologyBlueWater SystemsAgilent TechnologiesGude ADSPortsmithAdirondack Wire & CableBeckhoffMinds At WorkAltius SolutionsArris InteractiveACTIVCARDACTiSYSA-FOUR TECHAIMEXAddonics TechnologiesAKAI professional M.I.ARESCOMBay AssociatesAlteraCambridge Silicon RadioTrek TechnologyAsahi OpticalBoca SystemsGREENHOUSEGeocast Network SystemsNeodioTodos Data SystemASUSTekram TechnologyHAL CorporationKurusugawa ElectronicsASIX ElectronicsAmbit MicrosystemsAddonics TechnologyAgate TechnologiesDMIMicrodiaSealevel SystemEasyDiskZ-ComAtheros CommunicationsTangtopPen DriveABCConceptronicMicro Star InternationalELCON SystemtechnikSitecom EuropeMobile ActionSpeed Dragon MultimediaHawkingG.MateOurs TechnologyPilotechNova TechiTegnoAirprimeVTechFalcom Wireless Communications GmbHDynastream InnovationsGIGABYTECCYU TechnologyAudiovoxSILABS2USIAsanteSilicon LabsJapan Radio CompanySphairon Access Systems GmbHDeLormeAcer Communications & MultimediaSierra WirelessAlcatelTsunamiPheenetRaptor GamingTwinMOSCyberTAN TechnologyHUAWEI TechnologiesAraneus Information SystemsTapwaveAincommMobilityDick Smith ElectronicsCisco-LinksysSharkNovatel WirelessWistron NeWebRadio ShackHuawei 3ComSilicomRalink TechnologyPlanex CommunicationsSilicon PortalsOQOU-MEDIA CommunicationsSOHOwareUMAX Data SystemsInside Out NetworksGood Way TechnologyEntregaActiontec ElectronicsGigasetGlobal Sun TechnologyJablotronCMOTECH CDMA TechnologiesMetaGeekQcomTripp-LiteNHJASUSTeK ComputerAEIPQIDaisy TechnologyMicronet CommunicationsI-O DataiRiverAceecaAveratecSweexZinwellSitecomNORMAL_COMPLETIONIN_PROGRESSPENDING_REQUESTSNOT_STARTEDINVALNOMEMCANCELLEDBAD_ADDRESSIN_USENO_ADDRSET_ADDR_FAILEDNO_POWERTOO_DEEPIOERRORNOT_CONFIGUREDTIMEOUTSHORT_XFERSTALLEDINTERRUPTEDXXX%x.%02x, class %d/%d, rev , addr %dusbd_devinfousbdly0 lengthout of datausbd_fill_iface_data: bad descriptor(s): %s iface descusbd_set_config_index%s: device addr %d (config %d) exceeds power budget, %d mA > %d mA %s: port %d, set config at addr %d failed %s: No free USB addresses, new device ignored. usbd_new_device: cannot find HS portusbd_print%s, %s configuration %d interface %d port %d%s: at %s (addr %d) disconnected %s: %d port%s with %d removable, %s poweredmultiplesingle, %s transaction translator%s%s: bus powered hub connected to bus powered hub, ignored %s: no interface handle %s: no endpoint descriptor %s: bad interrupt endpoint %s: port %d power on failed, %s %s: cannot open interrupt pipe %s: no ports, hub ignored uhub%s: hub depth (%d) exceeded, hub ignored uhub_attach%s: port %d reset failed %s: device problem, disabling port %d %s: strange, connected port %d has no power %s: illegal enable change, port %d %s: port error, giving up port %d %s: port error, restarting port %d hid_start_parsedefault bType=%d Local bTag=%d Main bTag=%d Global bTag=%d BAD LENGTH %d uhidev%s: %s, iclass %d/%d %s: no report descriptor %s: no memory %s: %d report ids %s: no input interrupt endpoint %s: unexpected endpoint %s: could not read endpoint descriptor uhid at %s reportid %duhidev_intr: bad repid %d uhidev_set_report_asyncuhidevwiukbd %s: attach failed, %s %s: was console keyboard This port is broken, it does not call cnpollc() before calling cngetc(). This should be fixed, but it will work anyway (for now). too many modifier keysbad modifier sizemultiple key code arrays key codes not on byte boundarytoo many key codeskey code size != 8umassCBIBulk-OnlyRBC%s: using %s over %s %s: bus attach failed %s: command protocol=0x%x not supported %s: isdata not configured %s: unable to get Max Lun: %s UFIISD-ATACBI with CCI%s: got polled xfer %p, but %p already pending %s: BBB bulk-%s stall clear failed, %s %s: Invalid CSW: sig 0x%08x should be 0x%08x %s: Invalid CSW: tag %d should be %d %s: Invalid CSW: status %d > %d %s: Phase Error, residue = %d %s: BBB reset failed, %s %s: BBB bulk-in clear stall failed, %s %s: BBB bulk-out clear stall failed, %s %s: transferred %d bytes instead of %d bytes%s: Unknown state %d%s: CBI bulk-in/out stall clear failed, %s %s: CBI intr-in stall clear failed, %s %s: CBI reset failed, %s %s: CBI bulk-in stall clear failed, %s %s: CBI bulk-out stall clear failed, %s %s: Get Max Lun failed: %s umass_cmd: large datalen, %d %s: Unknown status %d in umass_scsi_cbaue%s: EEPROM read timed out %s: MII read timed out %s: reset failed %s: setting config no failed auemii%s: getting interface handle failed %s: missing endpoint %s: address %s %s: couldn't get endpoint descriptor %d %s: no memory for rx list -- packet dropped! %s: %u usb errors on intr: %s %s: %u usb errors on rx: %s %s: usb error on tx: %s %s: aue_send error=%s %s: tx list init failed %s: rx list init failed %s: open intr pipe failed: %s %s: open tx pipe failed: %s %s: open rx pipe failed: %s %s: close intr pipe failed: %s %s: abort intr pipe failed: %s %s: close tx pipe failed: %s %s: abort tx pipe failed: %s %s: close rx pipe failed: %s %s: abort rx pipe failed: %s cue%s: read MAC address failed %s: couldn't get ep %d %s: cue_send error=%s kue%s: warm boot, no firmware download %s: cold boot, downloading firmware %s: failed to load trigger segment: %s %s: failed to load fixup segment: %s %s: failed to load code segment: %s %s: loading firmware failed %s: could not read Ethernet descriptor %s: no memory for multicast filter buffer %s: kue_send error=%s wsdisplay%s: screen %d-%d added (%s, %s emulation) %s: screen %d deleted wsdisplay at %s mux %d: console (%s, %s emulation), using %sdmuxwsdisplay_common_attach: no memorywsdisplaytty() on ctl devicewsdisplay_switch2: giving up wsdisplay_switch2: screen %d disappeared wsdisplay_switch2: not switching wsdisplay_switch2: invalid screen %dwsdisplay_switch1: screen %d disappeared wsdisplay_switch1: not switching wsdisplay_switch1: invalid screen %dwswaitwsmoused_sleepwscons: copybuffer memory malloc failed wsemul_vt100_output_c0c1: ESC in kernel output ignored \[>24;20;0cP0!u%5\wsemul_vt100_handle_csi[?62;6c[%d;%dR[?13n[?21n[?27;1nP2$uwsemul_vt100_handle_dcs: bad type %d[11~[12~[13~[14~[15~[17~[18~[19~[20~[21~[23~[24~[25~[26~[28~[29~[31~[32~[33~[34~OPOQOROSOpOqOrOsOtOuOvOwOxOyOIOMOD[7~OBOCOA[8~[6~[3~[2~[5~[4~[1~OjOkOlOmOnOowsevent_readwskbdwskbd at %s%s: attach error=%d : console keyboardcannot load keymapwskdetwskbd_detach: %s didn't detach %s: event queue overflow %s: connecting to %s %s: disconnecting from %s wskbd_get_mapentry: %d(%d): bad entrywskbd_load_keymap: %d(%d): bad entrywskbd_load_keymap: %d: recursion too deepwskbd_hotkeywsmux: attach out of memory wsmux_getmux: no memory for mux %d wsfont_unlock: font not lockedpckbdprobe: reset response 0x%x pckbd_enable: command error pckbd_disable: command error pckbd  cd'(r D&- (,04@XPX`ht| 4&'./$#! *+.-4)(% ,__<__Ă__<(_|<܂(_|X܂<_܂P_܂P_Ȁ܂d_x_Ă__< __̂ L_`_<_ _<|4_H_Ђp__Ђ__Ђ__ \`p`t܂``````` `$ `8 `L `` ` L `` `؂t `L!``h!t`!`d!d`x`!(`<`!P`d`!x`ܔ!` !``!4`4!H`H!\`0!p`!``!``!A<`<Ȃ&s`<&``'s`' u`5܌`'44`'HT`'h`'`|`7``:U`V`Ԃ@T \S L0|'ᅠ" <  !!!!!!!"-"/""")"H"a"d"e"## #!#%% %%%%%$%,%4%<%P%Q%R%S%T%U%V%W%X%Y%Z%[%\%]%^%_%`%a%b%c%d%e%f%g%h%i%j%k%l%%%%%%%%%%%%%%%%% %% :&;&<&@& B& `&c&e&f&j& k&-"*"U<"~# # # #)#<*#>-_ { }xYYvw E--   <<cr39AAAAEEEIIIIDOOOOUUUYaoybuiltin@ `P0ppfff8g`ggfgg $( ,h667d778H8@$,4<DLT\ht̽ @DXl@ `Ծ B 0 8 @ HP X`h %l0+t@2xP8|`>pD<11(hh(,4<DP\dlt)+-/13579;=?ACEGIKMOQSUWY[]_acegikmoqsuw ! ` xUU0&`H@?@@PXdTHIS is A memory TEST patternt %Kllm𮭨t<     0h TD4@DTDxx""$$0|H|@"H"0X(,0,0D/ @ @   )T 3 a4h<X$\D@d/TDL4ETDgpD:D\DHh&t *&#8&&&UhddTjxmLrrvst4ww4wLxx(yXy{[8}}ttyclsttyopnttybgttyinttyout0آ,}ج@xԪKKKKKKīKKKKKKīKKKKKKīKKKKKKīKKKKKKīKKKKKKīKKKKKKī /t $ , ` 0`\``\] ^L_Pffs Ȏext2fs@ cd9660msdosnfs ,4<T Ġ$h$(2lockf@` ,747<7D7L7T7\7d7l7t7x7|777777777777777777 شXKķD LE KpF  ~b` x L ( h3,;<;( H;T T; `; l;ص x; ;0 ;\ ;;; ; ;8 ;d;;<  < <H $< 0< <<ܸ H< T<4 d<`p<<< < << <h<<<<<@شD0\ 8d@lķ$\<hDpȺشX0 \   K ئ 8ئ dئ  P  @Ԥ ķK $ \    ئ <ئ h KK D| ܤ p ئ Ⱥئ DK~bشX0 \( (    8 d t L K @ l@ ķK( $( \( ( ( ( ( <( h( d ܰ D ( pl  Ⱥ DK~b$ d Ĵ شX0` \  t   8 d з $ K̽ @l lľ ķ  $ \     < h  KD P p  Ⱥ` D~b|. .. شX04 \h! p# # # $ 80% d( * 4- K3 @3 ķ3 4 $|4 \4 ; ? @ @ <I h @ I I DJ J pdL I (M ȺL J Db k l 20123456789abcdef^^3333 P L #$%&'()*+ʚ;,-.ʚ;/ʚ;0ʚ;1@B2ʚ;3ʚ;4ʚ;C =D$E =F$cde@B@B@KLاO[@T6nQ%l7Jpp@@@@j j j @ lt X! $  ` 6 dF ,2D t D  X D,P \ ||  D(   D    T D   \ D)   DS   tR x\ h^ D(    JpD, dXx|}E#(D<8Q @X,DPXd\`dh|@ $(,408<HL2(@AAA==(A* dd%(i @@@@@@@@@$dcdc $x| @      ?BEFF'' EF''' ?F''F'' F''' F'' EF'' ?EF''' ?EF''' ?EF''' ?EF'''' ?F'' ?BF''' ?BEF''' ?EF''' F'''' F'''''F''FF''FF''F''6:F`t.Db@شX0#\8܁T  T 8 d\ <:\ KK@l0 ķrت$d\#4.<d:h& p( Dqqp{T{Ⱥ\{KD{Tchش4  H8 d\ Lķr& p( p{Pcش\ 0 H8 d\ ؂ķr& <p{Dc(,ԬشX0\3<4 5x5 07888d4<txKE@$Elqķ 8E$@F\HU(YD[|\<AEEE(<ǕAE(E(E(=>AE(E(E(>s<HE=6EIE, pxE,E5E5@H  !Ec'Ec'Ec'a!Ec'Ec'Ec'ʕ!Ec'Ec'Ec'w~!Ec'Ec'Ec'k9!Ec'Ec'Ec'g!E(E(E(*!E(E(E(!E(E(E(ن !E(E(E(v!E(E(E(p1!!E(E(E( $!E(E(E(]Y!E(E(E(!E(E(E( *!E(E(E(wh,!E(E(E(΄!E )E )E )F!E )E )E )2!E )E )E ) 2g|!E )E )E ) 0v8!E )E )E ) Q!E )E )E ) SM/!E )E )E ) T&L!E )E )E ) 00!E )E )E ) n!E )E )E ) ׵!E )E )E ) {‚!E')E')E') !E')E')E')n!EQ*EQ*EQ*]#!EQ*EQ*EQ*""!ET*ET*ET*!ET*ET*ET*|Y!ET*ET*ET*K3!ET*ET*ET*[!ET*ET*ET*2!ET*ET*ET*z2!ET*ET*ET*lԇ%!ET*ET*ET*ױ!ET*ET*ET*Ԯ!ET*ET*ET*A[+C!ET*ET*ET*X#y!E+E+E+)m!E+E+E+h !E+E+E+<2!E+E+E+hm!E+E+E+tI}!E+E+E+x'!E+E+E+Z7k!E+E+E+!E+E+E+ȋ@!E+E+E+!E,E,E, !E,E,E,w|%!E,E,E,8!E,E,E,!E,E,E,/1g!E,E,E, P!E,E,E,zP?`!E,E,E,^!E,E,E,\!E,E,E,!!E,E,E,M!E,E,E,E!!E,E,E, %~H!E,E,E, +!E,E,E,!4w!E,E,E,!!E,E,E,"!\ȍ!E,E,E,"xʎ!E,E,E,#!E,E,E,#!E,E,E,$!EL-EL-EL-$a}!EL-EL-EL-%w!EL-EL-EL-%36!EL-EL-EL-&!EL-EL-EL-&_I!EL-EL-EL-'C?e!EL-EL-EL-'r:V!EL-EL-EL-(V!EL-EL-EL-(!EL-EL-EL-)%A!ED-ED-ED-),!ED-ED-ED-*~s!ED-ED-ED-*IN!ED-ED-ED-+!ED-ED-ED-+^NR!ED-ED-ED-,YT!ED-ED-ED-,1Y!ED-ED-ED--H$!ED-ED-ED--36!ED-ED-ED-.}:!E}.E}.E}..v!E}.E}.E}./^U !E}.E}.E}./%!E}.E}.E}.0B!E}.E}.E}.0 !E}.E}.E}.1{ A0!E}.E}.E}.1ƫ!E}.E}.E}.2$!E}.E}.E}.2,!E}.E}.E}.3ɸ!Eq/Eq/Eq/3p欛!Eq/Eq/Eq/4G(!Eq/Eq/Eq/4TjU!Eq/Eq/Eq/5Y!Eq/Eq/Eq/5̽!Eq/Eq/Eq/6A(!Eq/Eq/Eq/6HeJ!Eq/Eq/Eq/7a<!Eq/Eq/Eq/7!E/E/E/8i!E/E/E/8A!E/E/E/9\]!E/E/E/9"Z!E/E/E/:bE!E/E/E/:G!E/E/E/;W!E/E/E/;R, !E/E/E/<=ێ!EG0EG0EG0<;A!EG0EG0EG0=t!EG0EG0EG0=aEG0EG0E %؆{!EG0EG0E %ɪdaEG0EG0E %a !EG0EG0E %oJ@aEG0EG0E % s!E50E50E %iaE50E50E %=z@!E50E50E %,aE50E50E %S- !E50E50E %@yaE50E50E %/L!E50E50E %qaE50E50E %Mw&j!E50E50E %1aE50E50E %;!!Ex1Ex1E %aEx1Ex1E %*!Ex1Ex1E %'kaEx1Ex1E %!Ex1Ex1E %LaEx1Ex1E %!Ex1Ex1E % waEx1Ex1E %L!Ex1Ex1E %ǬaEx1Ex1E %ȿSn!Ex1Ex1E %1{aEb2Eb2E % !Eb2Eb2E %yeJaEb2Eb2E %6L!Eb2Eb2E %uaEb2Eb2E %E!Eb2Eb2E %!DaEb2Eb2E %ZW!Eb2Eb2E %NaEb2Eb2E %~g!E2E2E %o˱aE2E2E%&f !E2E2E%&daE2E2E%&a!E2E2E%&3aE2E2E%&!E2E2E%&aE2E2E%&!E2E2E%&daE2E2E%&>3!E2E2E%&ôaEB3EB3E%& %!EB3EB3E%& aEB3EB3E%& CTT!EB3EB3E%& +aEB3EB3E%& rcV3!EB3EB3E%& P/DaEB3EB3E%& t!EB3EB3E%& I iaEB3EB3E%& '/x!EB3EB3E%& C<aE%3E%3E%&q!E%3E%3E%&>@aE%3E%3E%&!E%3E%3E%&M=aE%3E%3E%& !E%3E%3E%& aE%3E%3E%&wc!E%3E%3E%&0gaE%3E%3E%&τm!E%3E%3E%&oaEs4Es4E%&K!Es4Es4E%&aEs4Es4E%&\L!Es4Es4E%&zduaEs4Es4E%&vYO!Es4Es4E%& UVaEs4Es4E%&t-!Es4Es4E%&/iaEs4Es4E%&!Es4Es4E%&ZCtaER 5ER 5E%&@!ER 5ER 5E%&*aER 5ER 5E%&IQ!ER 5ER 5E%&,raER 5ER 5E%&do!ER 5ER 5E6&B\aER 5ER 5E6&Tm!ER 5ER 5E6&D aER 5ER 5E6&6c!ER 5ER 5E6&i|aE5E5E6&h!E5E5E6&Vv1aE5E5E6&-JN!E5E5E6&KbaE5E5E6&LW!E5E5E6&4aE5E5E6& J!E5E5E6& _ aE5E5E6&!!E5E5E6&!:aE5E5E6&"kM!E=6E=6E6&"z2 aE=6E=6E6&#'!E=6E=6E6&#e-aE=6E=6E6&$nD{!E=6E=6E6&$6nuaE=6E=6E6&%?o!E=6E=6E6&%!9]aE=6E=6E6&&8{^!E=6E=6E6&&Ea=aE6E6E6&'&q!E6E6E6&'&(aE6E6E6&( Z8!E6E6E6&(}oaE6E6E6&)l!E6E6E6&)Y.aE6E6E6&*Z#!E6E6E6&*a^aE6E6E6&+ג^!E6E6E6&+?rraEn7En7E6&,a!En7En7E6&,u;daEn7En7E6&-Lk!En7En7E6&-iaEn7En7E6&.w!En7En7E6&.>aEn7En7E6&/I!En7En7E6&/ aEn7En7E6&0OHO!En7En7EV'0;"aEC8EC8EV'1:$!EC8EC8EV'1)$caEC8EC8EV'2[S!EC8EC8EV'29aEC8EC8EV'3?!EC8EC8EV'3J0aEC8EC8EV'4h!EC8EC8EV'4aEٟ8Eٟ8EV'5%j!Eٟ8Eٟ8EV'5@hTaEٟ8Eٟ8EV'6z \!Eٟ8Eٟ8EV'6;aEٟ8Eٟ8EV'7-!Eٟ8Eٟ8EV'7qaEٟ8Eٟ8EV'8[!Eٟ8Eٟ8EV'8{-aEٟ8Eٟ8EV'9qO!Eٟ8Eٟ8EV'9jaEp89Ep89EV':!Ep89Ep89EV':6aEp89Ep89EV'; !Ep89Ep89EV';ҭ*aEp89Ep89EV'<)"!Ep89Ep89EV'<s ZaEp89Ep89EV'=$i!Ep89Ep89EV'=qaEp89Ep89EV'>;a!Ep89Ep89EV'>TiaEp89Ep89EV'?gb!E9E9EV'?yleaE9E9EV'@9; !E9E9EV'@RaE9E9EV'A{!E9E9EV'AWaE9E9EV'BX!E9E9EV'BsaE9E9EV'C.!E9E9EV'C-,aE9E9EV'D4!Ei:Ei:EV'D`raEi:Ei:EV'E X!Ei:Ei:EV'Eܥ]aEi:Ei:EV'FJ!Ei:Ei:EV'FU#aEi:Ei:Ec'G!Ei:Ei:Ec'G*aEi:Ei:Ec'H @!Ei:Ei:Ec'HaEi:Ei:Ec'ID1!Ei:Ei:Ec'IraE3;E3;Ec'J!E3;E3;Ec'JKaE3;E3;Ec'Kۅ!E3;E3;Ec'K PaE3;E3;Ec'L9lM!E3;E3;Ec'LdJaE3;E3;Ec'MGZy!E3;E3;Ec'M&daE3;E3;Ec'N!E3;E3;Ec'N]aEEEc'Onj!EEEc'OvaEEEc'vSC!EEEc'dtaEEEc'!!EEEc'FaEEEc'w!EEEc'9aEEEc'#x!EEEc'&JaEEEc'Im!EEEc'aEEEc'.!EEEc']9UaEEEc'N!EEEc'c8aEEEc'ؿj!EEEc'taEEEc'cx!EEEc'ImaEEEc' !E-1E-1Ec' z9 xaE-1E-1Ec' !E-1E-1Ec' nBaE-1E-1Ec' }U,!E-1E-1Ec' ЖaE-1E-1Ec' P!E-1E-1Ec' AaE-1E-1Ec'  A9!E-1E-1E( aE-1E-1E( Y=!E-1E-1E({aEEE({T!EEE(2aEEE(!EEE(.aEEE(#!EEE(kaEEE( !EEE("aEEE(h+!EEE(U-aEZbEZbE([ۨ4!EZbEZbE( BaEZbEZbE(u !EZbEZbE( =aEZbEZbE(!EZbEZbE(raEZbEZbE(%L!EZbEZbE(aEZbEZbE(zљ!EZbEZbE(OaEEE(f'#!EEE(D>aEEE(gv!EEE($#haEEE(TLaEJ]EJ]E ).!EJ]EJ]E ).6aEJ]EJ]E )/۶!EJ]EJ]E )/.aEJ]EJ]E )0=d!EJ]EJ]E )0(aEJ]EJ]E )1O\!EEE )1(0aEEE )2}!EEE )2MYaEEE )323!EEE )3%aEEE )4!EEE )4RiaEEE )5ʵV!EEE )5FaEwEwE )6#!EwEwE )66uaEwEwE )7_!EwEwE )7aEwEwE )8Q!EwEwE )8 aEwEwE )9mP,!EwEwE')9aEwEwE'):~,j!EwEwE'):uaE'E'E');z8!E'E'E');aE'E'E')<0?!E'E'E')< daE'E'E')=މ!E'E'E')=-aE'E'E')>}b!E'E'E')>.aE'E'E')?*v !E'E'E')?yQEaE'E'E')@'!EEE')@]aEEE')A!EEE')ARZVaEEE')BGO!EEE')B!2aEEE')CZz!EEE')CVeaEEE')D<!EEE')D$aE;XE;XE')Ei*W!E;XE;XE')EcdaE;XE;XE')Fa.8!E;XE;XE')FwaE;XE;XE')G[;?!E;XE;XE')G-K&aE;XE;XE')Hwwe!E;XE;XE')H[XaE;XE;XE')II!E;XE;XE')I=ˉaEEE')JtA !EEE')JnM :aEEE')Kvy!EEE')K*aEEE')Lp`E!EEE')L@aEEE')M'J!EEE')Mh,aEEEQ*N%!EEEQ*NaEh Eh EQ*O!Eh Eh EQ*OT!Eh Eh E6{<%Bu!Eh Eh E I6+Bu!Eh Eh E9z6x`Bu!Eh Eh Ef66Bu!Eh Eh Eh 6Dk!Eh Eh Eh w;!E! E! E! @!E! E! E*ua{!E! E! EW'!E! E! E! 2!E! E! E! Vv\!E! E! E! .!E! E! E! 5Ƹ!E! E! E! G!E E E>P!E E Epר!E E E V!E E E E}.E}.E}.M-E/EE P Y)EEE*7EwEwEw?FEEE/tmp/disktab.shadow=jEEE/tmp/fstab.shadowNE E E /tmp/resolv.conf.shadow# E E E /tmp/hosts&1`C E Eb2Eb2`E5Ep89E+hԟEEEfY EEh Eh pHE EIE+xDEE9E+{  rE8E')E')    ( v:bl9q & #}7u+ATx &a9'LD(ԖUǠx u5blB ~oxcV_>E.hbgE}]^O0D}6͸Vz Gg )d9gXBR5P9$kJM 6-#vPb8!:P)^A!H9"zY>$*`sk Zsv[^.$}t'iA,SH }`6ٴ4`zMQfݸB55oC@G}2{.[ֳc9?>ILˌg;|6׀MGM*7MWL,޳NzDS`r6k-2r\9?f2} r>ED+_^L0 @xl!{OIFn9'Vv6ܧMse14>YRv^o0Ft.e!(G(LZHD|BkQl8Avfc ƪhcRCJA ?ȤԈc=Oc\)Qi Un<(Ĩ+Yl9*H.0ҡ9p'O^f8~:XNHS:p idm_ѭx 9uԪ8Pc`W[MA cjMUtb,*`Lp_u=k7mUĀ;tD#!vg)ck7!k"ojT8);q]vo~K{;7 u>O$~6T+ 0Ur2Rth&ؾ 4 'LcFkقGˇ*Y(]s:l4e.Z*1`'&rN<X4y5䃝 k!@nQrAcmA-0#vc?j~O3dҶJ%WB*2"sk+4K@{K1,o6ScQ$>S<6=B!)b\|hqbboWOZ RU4Wvg̩bw– FI*/Kkw^cv>( |4qĥyW([TanaQLE#z#^qr`lp3txT.=R$қV*H^@]bV;5%<lM1®LWkZr#xlk6|AӘʏpH슛Ym]~jh`R+,!֯qٺB#f:.LVk( AtC VU-iJfHb"W"9lZ!5ݑ p^NZ6dac)Ev;M|+Q f^-z4ʖ^*d5& x.?`1W~ . .. catchmod:chgrp: cp dd df edexpr:hostname ksh sh ln lsmkdir: mteject: mv pax tarcpio: rmstty:sync:ip 0 IP icmp 1 ICMP tcp 6 TCP udp 17 UDP  . .. pppfirmware8groupspwd.db protocols)servicesP) disktab  fstab  resolv.conf L hosts ... ... ... ... . .. bin dev etc mnt mnt2 sbin tmp usrvarinstbin.profile install.mdupgradeinstall install.sub . ..chown:dhclient disklabeldmesg:fdisk:fsck: fsck_ext2fsfsck_ffsifconfiginit: kbdmknod:mount: mount_cd9660 mount_ext2fs mount_ffs mount_msdos mount_nfsnewfs: newfs_msdosping:ping6:reboothalt:route:rtsol:umount ... . .. binmdecsbinshare . .. ftpgrep:fgrep:egrep:gzip:gunzipgzcat:less:more:\sed . .. . .. . ..misckeymaps . .. termcap ... . .. tmp db runempty ... ... ... ...ftp-data 20/tcp ftp 21/tcp domain 53/tcp nameserver domain 53/udp nameserver www 80/tcp http shell 514/tcp cmd nfsd 2049/udp nfs nfsd 2049/tcp nfs #!/bin/sh - PATH=/sbin:/usr/sbin:/bin:/usr/bin T=$0 [ "$eo" ] || eo= hex() { case $1 in [0-9]) echo -n $1;; 10) echo -n a;; 11) echo -n b;; 12) echo -n c;; 13) echo -n d;; 14) echo -n e;; 15) echo -n f;; esac } alph2d() { local t="$1" local p="0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ" local sub=${p%${t}*} echo ${#sub} } h2d() { local s="$1" local f=${s%*[0-9a-f]} n=${s#[0-9a-f]*} echo $(($(_h2d $f)*16+ $(_h2d $n) )) } _h2d() { case $1 in [0-9]) echo -n $1;; a) echo -n 10;; b) echo -n 11;; c) echo -n 12;; d) echo -n 13;; e) echo -n 14;; f) echo -n 15;; esac } unt() { arg="$1" tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" while [ "$tmp" != "$arg" ] do arg=$tmp tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" done echo $arg } dodisk() { [ "$DEBUG" ] && set -x n=$(($((${5}*${7:-16}))+${6})) count=0 [ 0$7 -ne 8 ] && l="i j k l m n o p" for d in a b c d e f g h $l do M $1$2$d b $3 $(($n+$count)) 640 operator M r$1$2$d c $4 $(($n+$count)) 640 operator let count=count+1 done } dodisk2() { n=$(($(($5*${7:-16}))+$6)) M $1$2a b $3 $n 640 operator M r$1$2a c $4 $n 640 operator n=$(($n+2)) M $1$2c b $3 $n 640 operator M r$1$2c c $4 $n 640 operator } RMlist[0]="rm -f" mkl() { mklist[${#mklist[*]}]=";mknod -m $1 $2 $3 $4 $5" } M() { RMlist[${#RMlist[*]}]=$1 mkl ${5-666} $1 $2 $3 $4 G=${6:-wheel} [ "$7" ] && { MKlist[${#MKlist[*]}]=";chown $7:$G $1" } || { case $G in wheel) [ ${#whlist[*]} = 0 ] && whlist[0]=";chgrp wheel" whlist[${#whlist[*]}]="$1" ;; operator) [ ${#oplist[*]} = 0 ] && oplist[0]=";chgrp operator" oplist[${#oplist[*]}]="$1" ;; *) MKlist[${#MKlist[*]}]=";chgrp $G $1"; esac } return 0 } R() { [ "$DEBUG" ] && set -x for i in "$@" do U=`unt $i` [ "$U" ] || U=0 case $i in std) M console c 0 0 600 M tty c 1 0 M mem c 2 0 640 kmem M kmem c 2 1 640 kmem M null c 2 2 M zero c 2 12 M stdin c 7 0 M stdout c 7 1 M stderr c 7 2 M ksyms c 8 0 640 kmem M drum c 3 0 640 kmem M klog c 6 0 600 M xf86 c 2 4 600 ;; xfs*) M xfs$U c 51 $U 600 ;; uk*) M uk$U c 28 $U 640 operator ;; tuner*) M tuner$U c 75 $(($(($U*2))+16)) 644 ;; systrace) M systrace c 50 0 644 ;; ss*) M ss$U c 29 $(($U*16)) 640 operator M nss$U c 29 $(($(($U*16))+1)) 640 operator M enss$U c 29 $(($(($U*16))+3)) 640 operator RMlist[${#RMlist[*]}]="scan$U" MKlist[${#MKlist[*]}]=";umask 77;ln -s ss$U scan$U" ;; speaker) M speaker c 99 0 600 ;; tun*) M tun$U c 33 $U 600 ;; *random) n=0 for pre in " " s u p a do M ${pre}random c 40 $n 644 n=$(($n+1)) done ;; radio*) M radio$U c 97 $U MKlist[${#MKlist[*]}]=";[ -e radio ] || ln -s radio$U radio" ;; pf*) M pf c 39 0 600 ;; pci) M pci c 88 0 600 ;; lkm) M lkm c 35 0 640 _lkm ;; iop*) M iop$U c 73 $U 660 ;; fd) RMlist[${#RMlist[*]}]=";mkdir -p fd;rm -f" n=0 while [ $n -lt 64 ];do M fd/$n c 7 $n;n=$(($n+1));done MKlist[${#MKlist[*]}]=";chmod 555 fd" ;; crypto) M crypto c 47 0 ;; bpf*) M bpf$U c 22 $U 600 ;; bktr*) M bktr$U c 75 $U 644 ;; audio*) M sound$U c 36 $U M mixer$U c 36 $(($U+16)) M audio$U c 36 $(($U+128)) M audioctl$U c 36 $(($U+192)) MKlist[${#MKlist[*]}]=";[ -e audio ] || ln -s audio$U audio" MKlist[${#MKlist[*]}]=";[ -e mixer ] || ln -s mixer$U mixer" MKlist[${#MKlist[*]}]=";[ -e sound ] || ln -s sound$U sound" MKlist[${#MKlist[*]}]=";[ -e audioctl ] || ln -s audioctl$U audioctl" ;; uscanner*) M uscanner$U c 69 $U 660 ;; usb*) [ "$i" = "usb" ] && u= || u=$U M usb$u c 64 $U 660 ;; urio*) M urio$U c 67 $U 660 ;; ulpt*) M ulpt$U c 66 $U 660 ;; uhid*) M uhid$U c 65 $U 660 ;; ugen*) n=$(($U*16)) for j in 0{0,1,2,3,4,5,6,7,8,9} 1{0,1,2,3,4,5} do M ugen$U.$j c 70 $(($n+10#$j)) 660 done ;; ttyU[0-9a-zA-Z]) U=${i#ttyU*} o=$(alph2d $U) M ttyU$U c 68 $o 660 dialer uucp M cuaU$U c 68 $(($o+128)) 660 dialer uucp ;; uall) R ttyU0 ttyU1 ugen0 ugen1 ulpt0 ulpt1 uhid0 uhid1 uhid2 uhid3 R uscanner0 urio0 usb0 usb1 usb2 usb3 usb4 usb5 ;; wsmux|wsmouse|wskbd) M wsmouse c 63 0 600 M wskbd c 63 1 600 ;; wsmouse*) M wsmouse$U c 62 $U 600 ;; wskbd*) M wskbd$U c 61 $U 600 ;; tty[C-J]*) U=${i##tty[C-J]} case $i in ttyC*) n=C m=0;; ttyD*) n=D m=256;; ttyE*) n=E m=512;; ttyF*) n=F m=768;; ttyG*) n=G m=1024;; ttyH*) n=H m=1280;; ttyI*) n=I m=1536;; ttyJ*) n=J m=1792;; esac case $U in [0-9a-f]) M tty$n$U c 60 $((16#$U+$m)) 600;; cfg) M tty${n}cfg c 60 $((255+$m)) 600;; *) echo bad unit $U for $i; exit 1;; esac ;; wscons) R wsmouse0 wsmouse1 wsmouse2 wsmouse3 wskbd0 wskbd1 wskbd2 R wskbd3 wsmux ttyCcfg ttyC0 ttyC1 ttyC2 ttyC3 ttyC4 ttyC5 R ttyC6 ttyC7 ttyC8 ttyC9 ttyCa ttyCb ;; pty*) if [ $U -gt 15 ]; then echo bad unit for pty in: $i continue fi set -A letters p q r s t u v w x y z P Q R S T set -A suffixes 0 1 2 3 4 5 6 7 8 9 a b c d e f g h i j k l m n o p q \ r s t u v w x y z A B C D E F G H I J K L M N O P Q R S T U V W X \ Y Z name=${letters[$U]} n=0 while [ $n -lt 62 ] do nam=$name${suffixes[$n]} off=$(($U*62)) M tty$nam c 4 $(($off+$n)) M pty$nam c 5 $(($off+$n)) n=$(($n+1)) done ;; ptm) M ptm c 98 0 666 ;; tty[0-7][0-9a-f]) U=${i#tty*} o=$(h2d $U) M tty$U c 54 $o 660 dialer uucp M cua$U c 54 $(($o+128)) 660 dialer uucp ;; st*) n=$(($U*16)) for pre in " " n e en do M ${pre}st$U b 25 $n 660 operator M ${pre}rst$U c 25 $n 660 operator n=$(($n+1)) done ;; vnd*) dodisk vnd $U 19 19 $U 0 dodisk svnd $U 19 19 $U 2048 ;; rd*) dodisk2 rd $U 18 18 $U 0 ;; ch*) M ch$U c 27 $U 660 operator ;; cd*) dodisk2 cd $U 26 26 $U 0 ;; local) test -s $T.local && sh $T.local ;; ramdisk) R pty0 rd0 cd0 cd1 st0 st1 wd0 wd1 wd2 wd3 wd4 sd0 sd1 sd2 R sd3 sd4 tty00 tty01 bpf0 std ;; all) R ccd0 ccd1 ccd2 ccd3 vnd0 vnd1 vnd2 vnd3 sd0 sd1 sd2 sd3 sd4 R cd0 cd1 rd0 tun0 tun1 tun2 tun3 bpf0 bpf1 bpf2 bpf3 bpf4 R bpf5 bpf6 bpf7 bpf8 bpf9 pty0 xfs0 ss0 ss1 ch0 ptm local R wscons pci iop0 iop1 uall tuner0 radio0 speaker audio0 uk0 R random lkm tty00 tty01 tty02 tty03 crypto pf systrace wd0 R wd1 wd2 wd3 raid0 raid1 raid2 raid3 std st0 st1 fd ;; wd*|sd*|raid*|ccd*) case $i in wd*) dodisk wd $U 16 16 $U 0;; sd*) dodisk sd $U 24 24 $U 0;; raid*) dodisk raid $U 71 71 $U 0;; ccd*) dodisk ccd $U 21 21 $U 0;; esac ;; *) echo $i: unknown device ;; esac done } R "$@" { echo -n ${RMlist[*]} echo -n ${mklist[*]} echo -n ${MKlist[*]} echo -n ${whlist[*]} echo ${oplist[*]} } | if [ "$eo" = "echo" ]; then cat else sh fi wheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root bin:*:7: news:*:8: wsrc:*:9: users:*:10: auth:*:11: games:*:13: staff:*:20:root smmsp:*:25: popa3d:*:26: sshd:*:27: _portmap:*:28: _identd:*:29: _rstatd:*:30: guest:*:31:root _rusersd:*:32: _fingerd:*:33: _sshagnt:*:34: _x11:*:35: utmp:*:45: _kdc:*:59: _kadmin:*:60: _lkm:*:61: _spamd:*:62: _radius:*:63: _token:*:64: _shadow:*:65: crontab:*:66: www:*:67: _isakmpd:*:68: network:*:69: named:*:70: proxy:*:71: authpf:*:72: _syslogd:*:73: _pflogd:*:74: _bgpd:*:75: _tcpdump:*:76: _dhcp:*:77: _mopd:*:78: _tftpd:*:79: _rbootd:*:80: _afs:*:81: _ppp:*:82: _ntp:*:83: _ftp:*:84: _ospfd:*:85: _hostapd:*:86: _dvmrpd:*:87: dialer:*:117: nogroup:*:32766: nobody:*:32767: Wrsd0c@Xsd0d-@Yrsd0d@Zsd0e-@[rsd0e@\sd0f-@]rsd0f@^sd0g-@_rsd0g@`sd0h-@arsd0h@bsd0i-@crsd0i@dsd0j-@ersd0j@fsd0k-@grsd0k@hsd0l-@irsd0l@jsd0m-@krsd0m@lsd0n-@mrsd0n@nsd0o-@orsd0o@psd0p-@qrsd0p@rsd1a-@srsd1a@tsd1b-@ursd1b@vsd1c-@ . ..MAKEDEVttyp0@ptyp0@ttyp1@ptyp1@ttyp2@ptyp2@ ttyp3@!ptyp3@"ttyp4@#ptyp4@$ttyp5@%ptyp5@&ttyp6@'ptyp6@(ttyp7@)ptyp7@*ttyp8@+ptyp8@,ttyp9@-ptyp9@.ttypa@/ptypa@0ttypb@1ptypb@2ttypc@3ptypc@4ttypd@5ptypd@6ttype@7ptype@8ttypf@9ptypf@:ttypg@;ptypg@<ttyph@=ptyph@>ttypi@?ptypi@@ttypj@Aptypj@Bttypk@Cptypk@Dttypl@Eptypl@Fttypm@Gptypm@Httypn@Iptypn@Jttypo@Kptypo@Lttypp@Mptypp@Nttypq@Optypq@Pttypr@Qptypr@Rttyps@Sptyps@Tttypt@Uptypt@Vttypu@Wptypu@Xttypv@Yptypv@Zttypw@[ptypw@\ttypx@]ptypx@^ttypy@_ptypy@`ttypz@aptypz@bttypA@cptypA@dttypB@eptypB@fttypC@gptypC@httypD@iptypD@jttypE@kptypE@lttypF@mptypF@nttypG@optypG@pttypH@qptypH@rttypI@sptypI@tttypJ@uptypJ@vttypK@wptypK@xttypL@yptypL@zttypM@{ptypM@|ttypN@}ptypN@~ttypO@ptypO@ttypP@ptypP@ttypQ@ptypQ@ttypR@ptypR@ttypS@ptypS@ttypT@ptypT@ttypU@ptypU@ttypV@ptypV@ttypW@ptypW@ttypX@ptypX@ttypY@ptypY@ttypZ@ptypZ@rd0a-@rrd0a@rd0c-@rrd0c@cd0a-@rcd0a@cd0c-@rcd0c@cd1a-@rcd1a@cd1c-@rcd1c@ st0rst0-@nst0-@nrst0@est0-@erst0@enst0@enrst0 st1rst1-@nst1-@nrst1@est1-@erst1@enst1@enrst1wd0a-@rwd0a@wd0b-@rwd0b@wd0c-@rwd0c@wd0d-@rwd0d@wd0e-@rwd0e@wd0f-@rwd0f@wd0g-@rwd0g@wd0h-@rwd0h@wd0i-@rwd0i@wd0j-@rwd0j@wd0k-@rwd0k@wd0l-@rwd0l@wd0m-@rwd0m@wd0n-@rwd0n@wd0o-@rwd0o@wd0p-@rwd0p@wd1a-@rwd1a@wd1b-@rwd1b@wd1c-@rwd1c@wd1d-@rwd1d@wd1e-@rwd1e@wd1f-@rwd1f@wd1g-@rwd1g@wd1h-@rwd1h@wd1i-@rwd1i@wd1j-@rwd1j@wd1k-@rwd1k@wd1l-@rwd1l@wd1m-@rwd1m@wd1n-@rwd1n@wd1o-@rwd1o@wd1p-@rwd1p@wd2a-@rwd2a@wd2b-@rwd2b@wd2c-@rwd2c@wd2d-@rwd2d@wd2e-@rwd2e@wd2f-@rwd2f@wd2g-@rwd2g@wd2h-@rwd2h@wd2i-@rwd2i@wd2j-@rwd2j@wd2k-@rwd2k@wd2l-@ rwd2l@ wd2m-@ rwd2m@ wd2n-@ rwd2n@wd2o-@rwd2o@wd2p-@rwd2p@wd3a-@rwd3a@wd3b-@rwd3b@wd3c-@rwd3c@wd3d-@rwd3d@wd3e-@rwd3e@wd3f-@rwd3f@wd3g-@rwd3g@ wd3h-@!rwd3h@"wd3i-@#rwd3i@$wd3j-@%rwd3j@&wd3k-@'rwd3k@(wd3l-@)rwd3l@*wd3m-@+rwd3m@,wd3n-@-rwd3n@.wd3o-@/rwd3o@0wd3p-@1rwd3p@2wd4a-@3rwd4a@4wd4b-@5rwd4b@6wd4c-@7rwd4c@8wd4d-@9rwd4d@:wd4e-@;rwd4e@<wd4f-@=rwd4f@>wd4g-@?rwd4g@@wd4h-@Arwd4h@Bwd4i-@Crwd4i@Dwd4j-@Erwd4j@Fwd4k-@Grwd4k@Hwd4l-@Irwd4l@Jwd4m-@Krwd4m@Lwd4n-@Mrwd4n@Nwd4o-@Orwd4o@Pwd4p-@Qrwd4p@Rsd0a-@Srsd0a@Tsd0b-@Ursd0b@Vsd0cP)Wrsd0c@Xsd0d-@Yrsd0d@Zsd0e-@[rsd0e@\sd0f-@]rsd0f@^sd0g-@_rsd0g@`sd0h-@arsd0h@bsd0i-@crsd0i@dsd0j-@ersd0j@fsd0k-@grsd0k@hsd0l-@irsd0l@jsd0m-@krsd0m@lsd0n-@mrsd0n@nsd0o-@orsd0o@psd0p-@qrsd0p@rsd1a-@srsd1a@tsd1b-@ursd1b@vsd1c-@wrsd1c@xsd1d-@yrsd1d@zsd1e-@{rsd1e@|sd1f-@}rsd1f@~sd1g-@rsd1g@sd1h-@rsd1h@sd1i-@rsd1i@sd1j-@rsd1j@sd1k-@rsd1k@sd1l-@rsd1l@sd1m-@rsd1m@sd1n-@rsd1n@sd1o-@rsd1o@sd1p-@rsd1p@sd2a-@rsd2a@sd2b-@rsd2b@sd2c-@rsd2c@sd2d-@rsd2d@sd2e-@rsd2e@sd2f-@rsd2f@sd2g-@rsd2g@sd2h-@rsd2h@sd2i-@rsd2i@sd2j-@rsd2j@sd2k-@rsd2k@sd2l-@rsd2l@sd2m-@rsd2m@sd2n-@rsd2n@sd2o-@rsd2o@sd2p-@rsd2p@sd3a-@rsd3a@sd3b-@rsd3b@sd3c-@rsd3c@sd3d-@rsd3d@sd3e-@rsd3e@sd3f-@rsd3f@sd3g-@rsd3g@sd3h-@rsd3h@sd3i-@rsd3i@sd3j-@rsd3j@sd3k-@rsd3k@sd3l-@rsd3l@sd3m-@rsd3m@sd3n-@rsd3n@sd3o-@rsd3o@sd3p-@rsd3p@sd4a-@rsd4a@sd4b-@rsd4b@sd4c-@rsd4c@sd4d-@rsd4d@sd4e-@rsd4e@sd4f-@rsd4f@sd4g-@rsd4g@sd4h-@rsd4h@sd4i-@rsd4i@sd4j-@rsd4j@sd4k-@rsd4k@sd4l-@rsd4l@sd4m-@rsd4m@sd4n-@rsd4n@sd4o-@rsd4o@sd4p-@rsd4p@tty00@cua00@tty01@cua01@bpf0-@console tty memkmem-@null-@zero-@stdin@stdoutstderrksyms@drum-@klog-@Hxf86-@ dumb|80-column dumb tty:\ :am:\ :co#80:\ :bl=^G:cr=^M:do=^J:sf=^J: vt100|vt100-am|dec vt100 (w/advanced video):\ :am:bs:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :@8=\EOM:DO=\E[%dB:K1=\EOq:K2=\EOr:K3=\EOs:K4=\EOp:K5=\EOn:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=^O:as=^N:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:do=^J:\ :eA=\E(B\E)0:ho=\E[H:k0=\EOy:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k5=\EOt:k6=\EOu:k7=\EOv:k8=\EOl:k9=\EOw:k;=\EOx:\ :kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:\ :ku=\EOA:le=^H:mb=\E[5m:md=\E[1m:me=\E[m\017:mr=\E[7m:\ :nd=\E[C:rc=\E8:rs=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :..sa=\E[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t\016%e\017%;:\ :sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: vt220|vt200|DEC VT220 in vt100 emulation mode:\ :am:bs:mi:pt:xn:xo:\ :co#80:li#24:vt#3:\ :@7=\E[4~:RA=\E[?7l:SA=\E[?7h:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:ho=\E[H:\ :if=/usr/share/tabset/vt100:im=\E[4h:\ :is=\E[1;24r\E[24;1H:k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:\ :k5=\E[17~:k6=\E[18~:k7=\E[19~:k8=\E[20~:k9=\E[21~:\ :k;=\E[29~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=\177:\ :kd=\E[B:kh=\E[1~:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:nl=^J:rc=\E8:\ :rf=/usr/share/tabset/vt100:\ :rs=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :..sa=\E[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t\E(0%e\E(B%;:\ :sc=\E7:se=\E[27m:sf=20\ED:so=\E[7m:sr=14\EM:ta=^I:\ :ue=\E[24m:up=\E[A:us=\E[4m:ve=\E[?25h:vi=\E[?25l: . ..chown:dhclient disklabeldmesg:fdisk:fsck: fsck_ext2fsfsck_ffsifconfiginit: kbdmknod:mount: mount_cd9660 mount_ext2fs mount_ffs mount_msdos mount_nfsnewfs: newfs_msdosping:ping6:reboothalt:route:rtsol:umount dhclient-script export PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ umask 022 set -o emacs rootdisk=`dmesg|sed -n -e '/OpenBSD /h' -e '//!H' -e '${ g p }'|sed -n -e '/^root on \([0-9a-z]*\).*/{ s//\/dev\/\1/ p }'` if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES mount -u ${rootdisk:-/dev/rd0a} / echo 'erase ^?, werase ^W, kill ^U, intr ^C, status ^T' stty newcrt werase ^W intr ^C kill ^U erase ^? status ^T _forceloop="" while [ "X$_forceloop" = X"" ]; do echo -n '(I)nstall' [ -f upgrade ] && echo -n ', (U)pgrade' echo -n ' or (S)hell? ' read _forceloop case "$_forceloop" in i*|I*) /install ;; u*|U*) /upgrade ;; s*|S*) ;; *) _forceloop="" ;; esac done fi #!/bin/sh delete_old_address() { if [ -n "$old_ip_address" ]; then ifconfig $interface inet $old_ip_address delete $medium route delete "$old_ip_address" 127.0.0.1 >/dev/null 2>&1 fi } add_new_address() { ifconfig $interface \ inet $new_ip_address \ netmask $new_subnet_mask \ broadcast $new_broadcast_address \ $medium route add $new_ip_address 127.0.0.1 >/dev/null 2>&1 } delete_old_alias() { if [ -n "$alias_ip_address" ]; then ifconfig $interface inet $alias_ip_address delete > /dev/null 2>&1 route delete $alias_ip_address 127.0.0.1 > /dev/null 2>&1 fi } add_new_alias() { if [ -n "$alias_ip_address" ]; then ifconfig $interface inet $alias_ip_address alias netmask \ $alias_subnet_mask route add $alias_ip_address 127.0.0.1 fi } delete_old_routes() { route delete default >/dev/null 2>&1 if [ -n "$old_static_routes" ]; then set $old_static_routes while [ $# -gt 1 ]; do route delete "$1" "$2" shift; shift done fi arp -dan } add_new_routes() { route delete default >/dev/null 2>&1 for router in $new_routers; do if [ "$new_ip_address" = "$router" ]; then route add default -iface $router >/dev/null 2>&1 else route add default $router >/dev/null 2>&1 fi break done if [ -n "$new_static_routes" ]; then set $new_static_routes while [ $# -gt 1 ]; do route add $1 $2 shift; shift done fi } add_new_resolv_conf() { rm -f /etc/resolv.conf.std if [ -n "$new_domain_name" ]; then echo "search $new_domain_name" >>/etc/resolv.conf.std fi if [ -n "$new_domain_name_servers" ]; then for nameserver in $new_domain_name_servers; do echo "nameserver $nameserver" >>/etc/resolv.conf.std done fi if [ -f /etc/resolv.conf.std ]; then if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >>/etc/resolv.conf.std fi if [ -f /etc/resolv.conf ]; then cat /etc/resolv.conf > /etc/resolv.conf.save fi cat /etc/resolv.conf.std > /etc/resolv.conf rm -f /etc/resolv.conf.std chown -RL root:wheel /etc/resolv.conf chmod -RL 644 /etc/resolv.conf return 0 fi return 1 } if [ -n "$new_network_number" ]; then echo "New Network Number: $new_network_number" fi if [ -n "$new_broadcast_address" ]; then echo "New Broadcast Address: $new_broadcast_address" fi case $reason in MEDIUM) ifconfig $interface $medium sleep 1 ;; PREINIT) delete_old_alias ifconfig $interface up ;; ARPCHECK|ARPSEND) ;; BOUND|RENEW|REBIND|REBOOT) if [ -n "$old_ip_address" ]; then if [ "$old_ip_address" != "$alias_ip_address" ]; then delete_old_alias fi if [ "$old_ip_address" != "$new_ip_address" ]; then delete_old_address delete_old_routes fi fi if [ "$reason" = BOUND ] || \ [ "$reason" = REBOOT ] || \ [ -z "$old_ip_address" ] || \ [ "$old_ip_address" != "$new_ip_address" ]; then add_new_address add_new_routes fi if [ "$new_ip_address" != "$alias_ip_address" ]; then add_new_alias fi add_new_resolv_conf ;; EXPIRE|FAIL) delete_old_alias if [ -n "$old_ip_address" ]; then delete_old_address delete_old_routes fi add_new_alias if [ -f /etc/resolv.conf.save ]; then cat /etc/resolv.conf.save > /etc/resolv.conf fi ;; TIMEOUT) delete_old_alias add_new_address sleep 1 if [ -n "$new_routers" ]; then set "$new_routers" if ping -q -c 1 -w 1 "$1"; then if [ "$new_ip_address" != "$alias_ip_address" ]; then add_new_alias fi add_new_routes if add_new_resolv_conf; then exit 0 fi fi fi ifconfig $interface inet $new_ip_address delete $medium delete_old_routes exit 1 ;; esac exit 0 MDFSTYPE=msdos MDXAPERTURE=2 ARCH=cats md_installboot() { } md_prep_disk() { local _disk=$1 _resp typeset -l _resp cat <<__EOT $_disk must be partitioned using an BSD or an MBR partition table. BSD partition table or MBR partition tables can be created by OpenBSD. It is more a question of firmware compatibility disk portability. (Once we can figure out what filesystems ABLE can boot) __EOT while :; do ask "Use BSD or MBR partition table?" BSD _resp=$resp case $_resp in m|mbr) export disklabeltype=MBR md_prep_MBR $_disk break ;; b|bsd) export disklabeltype=BSD md_prep_BSD $_disk break ;; esac done } md_prep_MBR() { local _disk=$1 if [[ -n $(disklabel -c $_disk 2>/dev/null | grep ' BSD ') ]]; then cat <<__EOT WARNING: putting an MBR partition table on $_disk will DESTROY the existing BSD partitions and BSD partition table. __EOT ask_yn "Are you *sure* you want an MBR partition table on $_disk?" [[ $resp == n ]] && exit fi ask_yn "Use *all* of $_disk for OpenBSD?" if [[ $resp == y ]]; then echo -n "Creating Master Boot Record (MBR)..." fdisk -e $_disk >/dev/null 2>&1 <<__EOT reinit update write quit __EOT echo "done." echo -n "Formatting 1MB MSDOS boot partition..." gunzip /dev/null 2>&1 echo "done." return fi cat <<__EOT **** NOTE **** XXX ************** Current partition information is: $(fdisk $_disk) __EOT fdisk -e $_disk cat <<__EOT Here is the MBR configuration you chose: $(fdisk $_disk) Please take note of the offsets and sizes of the DOS partition, the OpenBSD partition, and any other partitions you want to access from OpenBSD. You will need this information to fill in the OpenBSD disklabel. __EOT } md_prep_BSD() { local _disk=$1 cat <<__EOT No special setup should be required to label using BSD disklabel. however if the disk has previously been partitioned in another manner, it may be necessary to wipe existing partition tables before proceeding. dd if=/dev/zero of=/${_disk} bs=512 count=10 disklabel -c ${_disk} __EOT } md_prep_disklabel() { local _disk=$1 _q md_prep_disk $_disk case $disklabeltype in BSD) ;; MBR) cat <<__EOT You *MUST* setup the OpenBSD disklabel to include the MSDOS-formatted boot partition as the 'i' partition. If the 'i' partition is missing or not the MSDOS-formatted boot partition, then the kernel required to boot OpenBSD cannot be installed. __EOT ;; *) echo "Disk label type ('$disklabeltype') is not 'BSD' or 'MBR'." exit ;; esac disklabel -W $_disk >/dev/null 2>&1 disklabel -c -f /tmp/fstab.$_disk -E $_disk } md_congrats() { cat <<__EOT Once the machine has rebooted use OpenFirmware to boot into OpenBSD, as described in the INSTALL.$ARCH document. The command to boot OpenBSD will be something like 'boot (hd0)bsd'. __EOT } bsd base${VERSION}.tgz etc${VERSION}.tgz" : ${EDITOR:=ed} [[ -x /usr/bin/vi ]] && EDITOR=vi export EDITOR [[ -f /etc/fstab ]] && umount -av 1>/dev/null 2>&1 umount -v /mnt 1>/dev/null 2>&1 welcome if [[ $MODE == install && ! -f /etc/fstab ]]; then cat <<__EOT You will now initialize the disk(s) that OpenBSD will use. To enable all available security features you should configure the disk(s) to allow the creation of separate filesystems for /, /tmp, /var, /usr, and /home. __EOT fi set -- $DKDEVS [[ $# -gt 1 ]] && _defdsk=done ask_which "disk" "is the root disk" "$DKDEVS" "$_defdsk" [[ $resp == done ]] && exit makedev $resp || exit ROOTDISK=$resp ROOTDEV=${ROOTDISK}a SWAPDEV=${ROOTDISK}b #!/bin/ksh MODE=upgrade . install.sub while :; do ask "Root filesystem?" "$ROOTDEV" resp=${resp##*/} [[ -b /dev/$resp ]] && break echo "Sorry, $resp is not a block device." done ROOTDEV=$resp echo -n "Checking root filesystem (fsck -fp /dev/${ROOTDEV}) ... " if ! fsck -fp /dev/$ROOTDEV >/dev/null 2>&1; then echo "FAILED.\nYou must fsck ${ROOTDEV} manually." exit fi echo "OK." echo -n "Mounting root filesystem..." if ! mount -o ro /dev/$ROOTDEV /mnt; then echo "ERROR: can't mount root filesystem!" exit fi echo "done." for _file in fstab hosts myname; do if [ ! -f /mnt/etc/$_file ]; then echo "ERROR: no /mnt/etc/${_file}!" exit fi cp /mnt/etc/$_file /tmp/$_file done hostname $(stripcom /tmp/myname) THESETS="$THESETS site$VERSION-$(hostname -s).tgz" ask_yn "Enable network using configuration stored on root filesystem?" yes [[ $resp == y ]] && enable_network manual_net_cfg cat <<__EOT The fstab is configured as follows: $( is found, and the fstype is not nfs. Non-ffs filesystems will be mounted read-only. You can edit the fstab now, before it is used, but the edited fstab will only be used during the upgrade. It will not be copied back to disk. __EOT edit_tmp_file fstab munge_fstab check_fs if ! umount /mnt; then echo "ERROR: can't unmount previously mounted root!" exit fi mount_fs install_sets finish_up dhclient.* ) cat >/tmp/hosts <<__EOT ::1 localhost 127.0.0.1 localhost ::1 $(hostname -s) 127.0.0.1 $(hostname -s) __EOT ask_yn "Configure the network?" yes [[ $resp == y ]] && donetconfig _oifs=$IFS IFS= while :; do askpass "Password for root account? (will not echo)" _password=$resp askpass "Password for root account? (again)" [[ $resp == $_password ]] && break echo "Passwords do not match, try again." done IFS=$_oifs install_sets while read _dev _mp _fstype _opt _rest; do mount -u -o $_opt $_dev $_mp || exit done myname _dn=$(get_fqdn) while read _addr _hn _aliases; do if [[ -n $_aliases || $_hn != ${_hn%%.*} || -z $_dn ]]; then echo "$_addr $_hn $_aliases" else echo "$_addr $_hn.$_dn $_hn" fi done hosts.new mv hosts.new hosts save_comments hosts save_comments dhclient.conf for _f in fstab kbdtype my* *.conf *.tail host* ttys; do [[ -f $_f ]] && mv $_f /mnt/etc/. done ) _encr=`/mnt/usr/bin/encrypt -b 8 -- "$_password"` echo "1,s@^root::@root:${_encr}:@ w q" | /mnt/bin/ed /mnt/etc/master.passwd 2>/dev/null /mnt/usr/sbin/pwd_mkdb -p -d /mnt/etc /etc/master.passwd echo -n "done.\nGenerating initial host.random file..." ( cd /mnt/var/db /mnt/bin/dd if=/mnt/dev/urandom of=host.random bs=1024 count=64 >/dev/null 2>&1 chmod 600 host.random >/dev/null 2>&1 ) echo "done." set_timezone finish_up #!/bin/ksh FILESYSTEMS=/tmp/filesystems SWAPLIST=/tmp/swaplist MODE=install . install.sub if [ ! -f /etc/fstab ]; then [ -f /etc/disktab.shadow ] && cp /etc/disktab.shadow /tmp/disktab.shadow DISK= _DKDEVS=$DKDEVS while :; do _DKDEVS=`rmel "$DISK" $_DKDEVS` if isin $ROOTDISK $_DKDEVS; then resp=$ROOTDISK rm -f /tmp/fstab cat /dev/null >$FILESYSTEMS cat /dev/null >$SWAPLIST else ask_which "disk" "do you wish to initialize" "$_DKDEVS" done "No more disks to initialize" [[ $resp == done ]] && break fi DISK=$resp makedev $DISK || continue rm -f /tmp/*.$DISK md_prep_disklabel $DISK unset _partitions _psizes _mount_points _i=0 disklabel $DISK 2>&1 | sed -ne '/^ *[a-p]: /p' >/tmp/disklabel.$DISK while read _dev _size _offset _type _rest; do _pp=${DISK}${_dev%:} _ps=$_size if [[ $_pp == $ROOTDEV ]]; then echo "$ROOTDEV /" >$FILESYSTEMS continue elif [[ $_pp == $SWAPDEV || $_type == swap ]]; then echo "$_pp" >>$SWAPLIST continue elif [[ $_type != *BSD ]]; then continue fi _partitions[$_i]=$_pp _psizes[$_i]=$_ps if [[ -f /tmp/fstab.$DISK ]]; then while read _pp _mp _rest; do [[ $_pp == "/dev/${_partitions[$_i]}" ]] || continue [[ -n $(grep " $_mp\$" $FILESYSTEMS) ]] && break isin $_mp ${_mount_points[*]} && break [[ $_mp == '/' ]] && break _mount_points[$_i]=$_mp done >$FILESYSTEMS : $(( _i += 1 )) done done cat <<__EOT OpenBSD filesystems: $(<$FILESYSTEMS) The next step *DESTROYS* all existing data on these partitions! __EOT ask_yn "Are you really sure that you're ready to proceed?" [[ $resp == n ]] && { echo "Ok, try again later." ; exit ; } _i=0 unset _partitions _mount_points while read _pp _mp; do _OPT= [[ $_mp == / ]] && _OPT=$MDROOTFSOPT newfs -q $_OPT /dev/r$_pp _partitions[$_i]=$_pp _mount_points[$_i]=$_mp : $(( _i += 1 )) done <$FILESYSTEMS for _mp in `bsort ${_mount_points[*]}`; do _i=0 for _pp in ${_partitions[*]}; do if [ "$_mp" = "${_mount_points[$_i]}" ]; then echo -n "/dev/$_pp $_mp ffs rw" if [[ $_mp == / ]]; then echo " 1 1" else echo -n ",nodev" case $_mp in /sbin|/usr) ;; /usr/bin|/usr/sbin) ;; /usr/libexec|/usr/libexec/*) ;; /usr/local|/usr/local/*) ;; /usr/X11R6|/usr/X11R6/bin) ;; *) echo -n ",nosuid" ;; esac echo " 1 2" fi fi : $(( _i += 1 )) done done >>/tmp/fstab while read _dev; do [[ $_dev == $SWAPDEV ]] || \ echo "/dev/$_dev none swap sw 0 0" >>/tmp/fstab done <$SWAPLIST munge_fstab fi mount_fs "-o async" ask_until "\nSystem hostname? (short form, e.g. 'foo')" "$(hostname -s)" [[ ${resp%%.*} != $(hostname -s) ]] && hostname $resp THESETS="$THESETS site$VERSION-$(hostname -s).tgz" ( cd /tmp; rm -f host* my* resolv.* (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x ELFa(t4x4 (````c`c$$l 444OpenBSD -LTP@0! MP@ -0LM 0PS`@p0 x/ P000`P`0 R ^ *0 0 Q P:00CC 0S SX 00-SL@  @1S@DQ@Dt @Dt0|c -LM$@0S0Stc -< L04S0 00 h+꼂\b 0S00 -LM`pQ 0S5/%p@PPPQ P Q088 8<Q  Ădd p-PLM@@P` ph 0-@L PP \TF5 0OSP8  (00SPTĂ$dd@T -鸢帒<LMP000圂S0: pP=xw @T` 8KX0  \ , (Ÿ8  RŸ8  0 8 90000S0A  10S000 B NT 1p0S0 Sl+ h10S X1X!0T!0SH!@1  !8 700011000S `R PpU90pr @0S 0S  0<e @0S 0Sl m9\fff g %Te TcF%0C%,4  0| Q eZP@E(0 Z/ y p|l1 R/ @pTg' GZ`PAT0 u ZP@0  P|To| # `P@0|x P@X$0 $ $ 4 { 5Y@A|ldllllX7 -0LMPpP`)0 R @;$0 ) 0 @b|0 R yW@ $0@Tj_\N| K$Ki(@@@$00 d\lllllmm$m -1L4M`, P!10 00 @,0P 1P|TBp< AH0`JZ/ 0@K 0@`T9 T7 H$ 5$T) T' =$:$T T 2$/$ 0@K,0<T00 {Zj $0 $ $ 08P@40 j O0PKY@\HmTm`mlm -`L@PP pJ0S p5PpL|鄋 -LM`@P0p  ǚP@ )x0S T *0 $$xm -0L &븂m -qLMʠ`0 P6 \P0d .40( 8%P<(@dl @ed, 0C0  $H0QZ T$ Z $D  \T4n -HL M, 0 [PnP #1RL0S @D@030(#Pp g@#B`@ #v#,Pc P 00 0b0  0 0$ D0QZ T}$,Z y$D \S4 n -AMLX6 M L6L@P p`84 , 0&Yps ?0@8Szꬶĵ D\d 5` YPp0S JP44 R@ 8$ 9P41Ppl4 < @bTQ {T YY P`)  P  PP 0SP*0 P9P<40<4  P<$0R0X0S 8P ᧳TTPP B.K B B8D|P@ 4Pmwppv0S GBK@@'P XP@0DP@Tj_0T@2 R 808P0"8$ 84P084 1 RcBKHHzP] {P5 0P0 , 0  Q P P`| 04D000$ 04~ 04T 0 00TP` ,P` ! P  P  P P`|, p,GnDo|ogjxpj@o o(o$LP P<|P  ,< = =XLP d x=,L+P < \=,<|-<< << ; ;; ; ;;,; ;;,;;,;;,p;l; \; T;vP; ~@;<; w,; $;e#;,k;o; d:h:+]:a: `b0FSQ :M>KQ0C0C pp   InK`F`F.P@ $`?Y0S 4: S < @MKHHș@ ( Pv9؉9^@h9 9T D PQ R$ U9 P^ T Q R U(0  ܤ0J   H/Z 80380S5 0S  8 R 8 R8 R  % R\8 h8 R`8 R 5 Se  88 Rk i U Up80l % X00R00S7 P 0@ P 10135:3P ` X7 R 0B$ 70S4 \7 R R0$ 70S4 7 R 7 R\$ 60S4 60S4 6 0 S4 0$ Sa4%S04 RPؔ6Y> A Д0AP,  6X@JP dV000TU 3 5#:,P( 0V00X@6h1h ? 6``U 0#5 %* % U UU 4S X0 4  \ P  @ؔ  YRJ^   $X T \% P ؔ PY0 <U U%1 ATE Uc ccXe 00S.K05 \pt \ IC6<0S@#/Q 0SKoP\0@  TS050P5 P  P㬄 X#%*X4dPP<5 4< 05 0@RQx# <%!q0`J  0 5 SP L S3 p0# U Ugg Ug gg X 0H,଄  <Ja ` 0b%P@V`!X:5 S S V X X42 v \b 2\b`$"#00C4 =4R 00UV `Po4S\004 e$ V04 0S03$ 54 5 X4 (4 $ u<Qp ,0 S ,jD@vvvvvvPv w w(vu,w@wPwuQQ@`wwwywx$xPx|xxxxy@yX4ttuLTX\dhltxgfff4up 4P  5$ UP2Q 4( Td0 25P%$P ܤ0 0 P B24P%40P$(3R ^3  X4LS \ R 0\J>Kܤ0C@R0 00aAU0!|rP!d0B!U0PBBBB@B`BBpB0BPBBBB|4(KM.KP B4`( Kp$(0K4(K4(K-K0 B$@5 (K 4D% 0K.KH5 4 B#4 `5 4L% $D PT"$`lK``V! ` pK @X K DP,Ġ KHQ. ,KL R$D @5%(PK(`K@d! \!4 $ X! $0@ P \ 5 )0R`06P$(6R0/ D!b0 $v> 0Xp6BNKx6Q%̠%4%(@D@D0 P5&I !0S66TQ$0 N0o00  e T ?ܤU0 U 0A AH7(KJ.KP BX7(K`'(0K$"$d% $$PT0!l |! D! `0 @ p lKd`V,Ġ@ `000 q%4$"]$ 0N> 40Q;V>d8U U Uʠ 5  V:%V#";U8'L40S@.ccT5l P0!01S030S345-*Q$H9U! $UT  h9Q eVPR 9U  T 9R UP9R R/5 WPBNK@D@D*5d9 P  p$ e #)Pa4: S ܤEnK`F `F @P0 t  % `\d4S: 8j\d4S0 T([44 嬄 D D ~gF -LM@(KbP`5  Ppp0W0* R00S 0rS`Fv (P@ oP@Z`F (00T P P (0vj?(0 :(0 T0tyLo|y -PL`p@PDP @T:T @2 ~̋y -LPgM/, `nPBp  Q q00  R P\ 8Ÿ q00  RP 0`SpSapCP 0S.S  :00Y00S ,0S 0S 0S $0S5MK  pI w8pW0SH00Y00S(0 0(0,0S0,00S' 0S $0S ?P $0 ?c02 $00 ,0S ,00 {$, u (l oX aP@ <4k0XyedAyAy wQvyz$z -LMpjQ5Q/jQ& j,Q0S h:4 0jj`8|@|PPjhj<Q@jLjDj<j4j\zxzzzz@zzzzzz Q-0L $ Q*  Vzz -LM`@p=g $K9P6g0S0S 0 8$0 UR#U { p-LM`PU@ T<3PP UTUpT{- 0\ \8 0000ӑS^ 0 ^0X Br0 BS 0r0 -ALM3 0  0 8 0  0  0  0t  0d  0T  0D~  04y  0$t  0o  0j  0e  0`  0[  0V  0Q  0L  0G  0B  0t= 0l 8 ィ,{`{x{{{{||(|<|P|`|x||||||}$}8}P}p} -LM00`Kq@ 00 p<PPS 00@TH 0uS> <S2  0BS^Q 0( 0 0 0 ?R(0  -R   4K P@ 40 R0 0(@7 74P0 0( d*P 0L{7< 0pPP}|̅ԅ܅h~ P-L  0-LMt@ 0PdiQ f@f 80hh0(0 h 0S}4`x -LM0:(0 P0( 0S(0 0 (K  hPP) 0S& =P`u 00,pK J0cSb iSI lS> oS& A0S 0S 0S(0SP0AS, [0 0S0 J~P,00 0oStP J,0(0hP,0 0 0_P,00 0iSUP0 TJ,0$0XHP,00 00.(0p~}</ -LM `P0p-S000P(K 0(P P@  0S 0 Q (W6{R6v $܅0 D0h0S $ "-,0 0$  -LM@#00$0 C 0+ 0 -00 $0 0 0+ -0 D0- -L M0KS0@0,0  K 0 c0 0`t -LM@Ge0 00S 0 $: 00 $ 00 $: 0S00  <<  00 0 -LM@e0 0 -LM0@S  h6 0 << 0 -LM@00$08  0 0(0-K 00 $ 0g@+$3gH -Ldh)g@c -LM K00"P55tP - LP'5nt \ - LP5ot h -A0 LR`P pPJ RDA R pP3 RA R pP R@ R pP 0S 0   0 p  0$  $ 0 p $ 0   0 p  0  0 p ~ -LMx \, P`p 0LSE,4<D0 xfd@dT 1  lfW%X  @}W $8W8}W $8tWp8kW P8bW $08YW00 QW $7HW@ $7?W  76W  7-/W00SW $ \7W <7W 7 W 6W  6W $ 6@W  6W $t6W@ $T6W 46W  $6W 5W  $5W 5W 5W00 tWX5W $85W $5zW 4q@\W00fW4]W $4TW@ $t4KW T4BW  449W$40W 3'@W 3< S S 3$W  3W $d3W  D3W  $$3W $3W $ 2W: b0S Q KdeW " @ ^ 0K0 X"u XK 0SXT1 ,0S ,僩KaKaaKaa0S @K00!dH 0Sqi S  SetplhrI @4 H?d<:d0 6d$ ȋxh`p<؈Ȉ0TXhx `@pP  $4H}$t|x0HXdp| 0-0P@0LS 0@0300 0-|PL0@S d0dc00 0HS@c4c$c0000@ -0L0CSQ tM00-  Q^00?  Q^00@  ,00 0 m̅$ -LTM\ X3XSp`| , xp p <R|0` |0@%0T #|GBpa@ P,4Tp0| `Kx| Pxt KPJ4K|x P}W D TT|0S0t  | l h 0S |`KxPKP& |0 | Ql0Sh0S,0 S , x Pc x Pl1WPP|0 |(1  0P @i`{`0l0  3P|0|0 1.t  uc~pA|@Px :p7 P0Hb<@t@ht@gtČXЌ،D -0L U븂  -qLpM@P`!^ApF@9 -PR`1`00 00Q @` 0T Q" T 1@KqP0: S 0`S  0`SݛT 8  (0܍ @[   -GML M1嘁\$ `@pL x1x!t1Q0T*IKAP4: S 81 R cP1P b$0 S $忦h^0S PP BNK@D0 P  P`1:S^?00 tZbIKAPP0 R4: S<^00 @   -0L 0 A븂 -hLMP`0 4 L%H@p ?0@8S񟗅(0L\d0S0$00, 2 0S 4 ) 0S " 0S#00 #000#0S 3000 t#hCl0P 0 R 0040 s4#0# m$#0S #0S0Pa0Ua 2 R 2 0 R @娂ŸQ 0@Pp [0p"0CSt(U 1P C YU $P 00 U P@ 1\  400ESx tp@KPP bP<0 o `.^ 0 R, KP#0ESU 2 ~@e/$` P C7 00Sd 0 R__P,.pȪH1L1D\QTQD1/@XQP1/4/T1md p-LM@P`dV0Se/ 0U $000 0 ph/p  -3L M0 P` B....200I 2 R Q0 0S  [00RS (0s&0S! dBd_XD600CS0X0ӤX0r Ppp $B00CS00Ӥ0b PpyWYWmp0SE 1 R20S 0 S,   , K P  Q( K@@"X P 0 ./0P 0_+ 00TK 0P6_  P[0S [0S *pm`0 Rt  P`/P1TīWEVTQ/4\Q/md (0fdXgdl -LM@[00CS####################0h"-$ _ꀬȬ8 p-L M 0@Q`Q,~ P*@,@ 0@@dS 2 09R @ ^ 0S0  R@ @ ^ 0S#  R@ @ ^ 0S  R@d0V@    PR@p4,ppP U -h2LM Rp P2pQ 0S  [00RS P?> -L,MB0 80 0P, 4  ~딠p`0 w0S= / P80BUa ,P 0lP 0S 0ڕX څ!,L, D 00Sv Sj ,$$"4Q 80!R,00CS0, 0  ,0, o+,o0 8Q   ,d008P,,00* C R +, 000 08@$ @,E0 08P,,00* C R , 000R,+0R,+ ,x L,T80a ,< g$(408DL\p -LMZ0, #00 00pӑ Y33`   Rx3x!t0d 0P Y ( <, 00 $8 4 <  m+. P@PtB Z 0 Y  0 Y&. P@P[B Z 0x $hY (XP2LL"8@To{0, 8@T$i$e$aP ]T Y 0B@ \0 BS@TZ@TP@\ xCPU@ )T0 D5 400( X0 00CS00  ä0P *L 00 X00 X0XXQ\̰ $4L`l,б<HL`t -LM@0p8(0 pP P@| 0 0!0|PD P@\ o_Ke/3 P P`D e/\ 'PP3 DA@YX`D00CS0X0ӤX0 PpP A00CS00Ӥ0 PpNUnU[(0 S (מTZpW4ZT xZ)<rZTlT14Xt| 0-LM$PK@x,@ p1P h (K`1npH (00  P@0V 0#S14Z(80,0 ,0S0 (,PK$ YYp , 0"S U0S U0 S4Z0$1XTLp -LM@V0S@ -LM@@U000S 00V0S -lL M@p` \ |0 0  Rp P00 0 ǿ``X -AML ; MBK@$ I:I8 , 00 8$ԹP  ^P00 PP :P`` R 00L`P1V4k ,嗸(;P` KK0C 0C00 &yP4V4 P 0S44X0PH`g0S440044 PV 0SX0S440 P0S  440@40@4 &?P+VpPh 0Se BNK@D@D 0*04S\  4 44!\0PpPL W00R00SBj&B~KpG pG I:P 8V`P '*PPBNK@D@D0 044 S;;S(  040&@40@4 PBNK@D@D0 044 S,  0&@@ PBNK@D@D0 044 S8  0\%@$ @$ LP BNK@D@D0 044 S0P BNK@D@D0 {044 S4wP BNK@D@D0 i044 S<eP BNK@D@D0 &W044 Sptv8RP BNK@D@D0%D044 Spt~?P BNK@D@D0p%1044 Spt,P BNK@D@D0$%044 Spt=`P BNK@D@D0 044 SPFP a0BS0S8a AR:R `0A8BV< B.K B BD$ PD4` 044 SV P D4`044 S<$V<4 `- DPT` *0S P #@T:q30  00S044 i04S44S $044 0< 0<$ @T6 TV* tP `D4<$P V ePD4` u<$4 <4V TL"D4f<$P$$V ?PD4` O<4P~ V 0D4 B<$4 <4P m D454 <$0aC1 0 $@@ ]~$@$ @$ k,0 @qS t,) dh$@40@4 /8a$@40@4 [$)$ BNK@D@D0 044 STI440CSpבxʑA$@ @ (Ĵȴv̩\` $<Hd4ܨnvtQȵQ̵صX(XpĶ -LM(0S`d ,0S 00SH 40S Q| 80S0 ,0<08S804 <Ph (PaPY (PR8SIPU@0a Sp>P7<P-00S$0S0S8PU@U2 \aP 0 #PU###< # #8##x}#ly#`u#Tq#wn#<$Tܷ Dt̸ -L3Mp0moKPe/OK 0 e/ KK?KH2 01 2e/$1 (  0S  -d1L(M\@@K @ Dq04Q@K`@@ 0L< 0GC 0B2 0=H 082 030. . < 8 4c 0 ,5 0pB 0`XX V 4@H̹L$dԻ`82P *0P ": -MLM N~KpG ) e/9 , RQ   P PXP 4) KA  BA .K B B)   CP@j(K0PS44S _Q(K0S0( K0@4@44 @@ @\4p*S:\4 X4(KS:X4 0mKS(K008 @Qe/뎎KH:  k *޴P 00CS00  ä0e)(K00qP@ P 0@pSAPOYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYQYYYYQYYYYYYYY8RYYYYYYYYYYRYYYYYYYY$SS(T`TTYTQYYYY0UUYU VXWpWYWYXVY YU[ _OKe/Fe/B  P! LlSe/2E 0 @8 PP 0S WK@ p PP@ 6 07Qђ SƟ6 R@@R@R OKe/e/Z    0) e/P Z  P  e/OKe/e/ e/POKe/e/ dOKe/e/Z  d a 0) jOKe/e/TOKe/~e/z(8PXOKe/ne/jZ  0 - 0) {Z  "     *v7 3]UH0| @P3 RLZ )9@ e/P< tCtt#tPP  R0000ӑ yS0 R000ӑnSU P#00ӑyP p2 ,0S ,  !P@ A e/;O 3OU ҴP@  0p0R $$@PP0S e/PZ  POKe/e/e/ Z j |81 RPZ  )9 e/nP   PM Ke/xe/t ,!*\м4 AD4rdALt|lTȽؽ\QH4T1H`tȾԾ$H -ML M R, p0 @ S a`BV00?V ڰp ,0 S ,0S 0S8 V08ǡ00000PSV4 00 0 ; 0  P@` :0Sg  @1^:0^0n005:0 S0S  0 P<0S9 P@ aP440 P @0  P1 R 0S 00b01@ Q  Pq n P 00f PV P 0SS` 0V0R00S`V@ P@? a`B0S 0S|VBp dVp0( KBNKa@D\0 (K@D . 0<t HTt p-RLM0@`+ a@ R\0"(\` ph ^0S  0 SS S0d0T!\ phK (<<dP0, 0 phit,0\ -SLMp 8Ka`N‡PV(VT` PZ 0S0Sy  PK 0 SSZ, [RW R08 0R 0G @T0 4 0 S?0S< 0S L408   P`1 R 0SS 0J(U` h  0S0S* U" X1 Q *D1 Q :0S S R0000V@@@@@ P鬎A 0hc ((PU2UP 0S S R000(U 88/P0( t$\ -LM&KPpT b[P1^PD1@0!P * U:U: Q:Q"P^^@(1 Q:00Q$^T 0`S 0!@l0Q` PS 0S`0S@0 -RLM0`pl a@QgJ(T` iR 唀R 0$N  0l!00`1 \ p; p0 3 P 0S S" P0bS0c00 Ri7 P i|*0 `0T< 0Sh. 80iXT (@@AP0tXd\4 p-LMKP@ [PTPT`0 R*0R*0@  [P\p0 P0:00 -a0L0p@TP  xM oP ,P0 S R @000?S T S 0?S h`+/ JX0 ` BR X0  äX0 U 4h4 -AML M4 8 , R- MK 3(K 8 BnK`Fs< `F M   RpS3(@K @T 0 0S S@D00(K0?S (K0*S 3(K RTD   0SQ"0000ӑcS &S %S 0@-S+S@84 0D IBK0A0Ab|P@{I0"S 04 Rf<4SZ00 NMK K8+\ 8-Q `@  00* <\' ZP@/48` V%0 =U/ P V  @0aS@ lZ  wL ,0 S ,u  P@<l0   I000@D0{ MK4h <0-gbSe4@D( b<$ 00]??AtH$4Y@0@D0{( O -K0P kS gS844(G< @DmS/4$(4( Q 0a#5<4 44800(K RK AI( K0?S X0  BR X0`  äX0h 8 -LAM MhB>K0C0C4 , p@2(K0PS`V2(K \ @   0@R1(K T1(K `\j1 ,0S ,壐y 0g g0C B#b"Baa  X8 < KLL!LKH 0F0 0@Y <BKJJX@8<$lK;K  ,C`P 0(K;K, S QQa B RR24  4 mL00CS0X0  äX0 Q,4 -$LkM0Ke/ ,0 !4dK0!PP P@ P' @T`t\KX 0@@J T8@ 4T00CS00  ä0 hT`@ QPP  P,#3P P@t x3x tC,@0\#\3P Py@t 3  t-0@8 # 3P Pc@t 2 t8@4"2P PM@t p2pk t4@<@T44T" L2@ 1p@S pb <PRR0SS T * R 0 dR0b00S@<@P!1P P@t T1T$ tDh!h1P P@t 0 tTD0 ,0S ,0  e/ 0 a00RG h0h@ H0zXQ z04 Q4Xȵ\Q\ -8@TLPp60S S 0 (S"H\T& BP`$ 8@T0S S 0R8#H\T@<0 P @Lh\$ -LXM|`K@X pyPP 0rSPF |0@Sb00C8SFF\Ia嘁@VI T@ p1GT0\0CS0<0  0DD PP 0P* @P" @T,I 0@#I T@ 0 T00CS0 (@00T Px0K @1Spl4  -LMp<P@ 0P@ @p <P*`f ax x0P@ @p <0 fP0 0`m((0 m6$@\ -LM"KP< @0S0 @ 0耟  2[ 8#Rp`#P1 0 QS*10@  P 00!10 6P!H0@ 0R!705@20  0 0@-@000<0\00  [00RS?00 Q 0  <0R 8\ *0 SSP(0\1R:0\ $0@!H<0S00/A-p刀0 P0b0`Q0S S ^ @ 0S0T0%0n 0%!Q -0LD0C6S[D̀̀̀̀̀̀̀̀L̀̀̀̀̀̀̀̀̀̀T̀̀̀̀̀̀̀̀\dlt|̀̀̀̀̀̀̀8̀̀Ā̀HhD@<840,($  DDDDDDDDDDDDDDDDDDDDDD$l\(X@dpx<h(d(Ll -L`pPAT 1SPUA@@P  \ p-LM`P@PQ@TpP Q P pQ -LIM MJ~KpGpGP @ , 1JnKS`F1A@TP,0 S ,Ћ ,P0rSJ /(IP@ PrU B>K0C0C4 000 !Pd@0@@ . 勩PP 4S JnKⴀ`F10 "\a0@|$Tʄ1SdBKAA  0Rtyl  -2LMp`@0P0 $ \0 ~ 0 ~ x 0p ^\ :` 0X ^< :, 週4X\ -LM`pP@0 0 08!0 01QQ p: p 02 X P 0 0S ~xP V 0 SS Px0`000< 0S40H. H8 0B,\ -2LMpP0 0|0`` `d@t P0P tT @(B  P\ -2LMPQ  0  @ )@t 0& t 90T:`ypW; 0 \l< X0 @ ,0 0PH\ -2LM`px \p0@PP@ @| <0< | \ -2LMP 0 Rp`0 0` `@t 0 t[ 0 @ 0Qxpx!t<P` @ᡤP @T<D 0 0T @DX\, Q-Lp`( P% P# P! P !@R PP k@T! 0 /\ P8P 7P 2A4 $0!0L\\P0S  0 S ? -LpMpK`P0sep @T X 0S@ 0@0PAprdAedA\ -LP\p@` 0B0C3SO꜏                 $                             $T <0( ,0P<0( ,048  1hIW <0( ,0P( 0<V ( ,0P<0W<0( ,048 ( (0R, ,0R0 00R4 40R8 80R< <0R@2 44 4P$ o`\0 P 0Z<0 0Q&2 -LM0U@p 55 u  % 5P,T$4@  $Pp 4Q 0SDP lPpdP(D0: S  S  S0 0dp{ 00 R000Sg R4?;#003 <0S c#?;0P@ ?LD T@ ;00S  ?+83 0S,3@T c ?2"@@ 0S H2 AR;;S" ":00S 0S 2Ql2l"d2T"H2D2qD?0S0||< K@1Ps1 V@ 00 ~'?!0!t@ 00 o?0!f@g0*?0d!\@T P!P00p 0Q  >0!A@0 0T ~P>0 +@0P 0<0  H04RtQ`QdQ,R0R(RlQ8RQLRm@ 4Hd -LMc0Ss0S 3 R S0S3 Rt3 R hCPÄ?IP,K A0S 3 R| 0 0R  R B 0 S "000 R2 R0S㼂 00CS00  ä0N00`V xx20 0hP&'@2`DBHzP(@ 0S 0+&0  a 000+[P !1aA0 @@AP| c@ 0X$1 v@e0APR0: SN8 @TI0dB@D0 R㬀 00CS00  ä00 ( &808 $0\RtR`QdQx4RRPRRdDRd(lQ,R0 -?MLMt0t` R   0S P Dp0S?KK@D0P@D?+`P` p- LMP|Ut`0   p@0T PࠡV= >l -\0L RL H0 @R0,0, 0[>0X>Q8RR 0-QLP) 0S-   h 0  _P@ڸ0 T ;;S0@0T@|0 t>0<\ 0T C>00  _P@0 08R`QQ$ -b0LP@@xr PP PX"000SQܞtttUڅ;;SNU8U0011 U00R@@T U 1 Q P=<!0|!=l1 h=\=,y<0S u<0S q<0ES U0P0 0 R0Q/PUR<0 S N<0S J<0S F<0S00PXb=00 000`QxH| -1LM R*ʔa0S& !00CSYxx0Sp1  0SK@@@Ԣ0S0 0  0S==[0ȌlȠ@$ K$ @ P@0 HP U0S \p0 q@0T@_0 /0@TP 0`Q00000hQt`QdQ<lmlQ -P@LM0 U 5ࠟP.0 R  0.p`W 80 S80S*0S@0Qs;@ <000PlQ -L M䁟P@P!0SؤؤؤUTj<0000U$ha 0 RQ R 0Q&;!u< 1 R ; T:P0U$`0 i[0 njlȠ( `0P@( Kd$@ P:$0H ;<<T0T|8Rm -?ML M804S?KK (@D, r@Dz r"(K0?[K<(PE0 PE00 PAb0 0PV?KK(@D@D?+:]P`G?+3]P;@@ HP+X@ P000 }P ,0 S ,‚k:0 ;;_: ;Y: T:p  O:` L: ?+\P}m 8` -LMdNK@D0 @Dp (0 Pw P 0 y,NPi,K-*,9,K'$,@ 9P, K50h 6+P9T x+PxRRR\R4RRhRlR -bML$M 0,0 @bmK(`FP$`F T T 06 ,0S ,}0DP0 P!0SZx1 ZQt!0SCb}b]pP0S(P ,!0S,Z -PP0(P@+~P 0S @0Sy 0 00,P\0` X@0 ;-P+PxR\RR(R -bML$Mx0x@ R  +P P L0 Db=K0C$0CP0 0S }Rx -%ML,M%K0(J⒍K JE(H,0 (H %b}K(pG P`$pG; S/R P58,0 S 4,| KH%0R/S /00H5 0H5` %,K( B:KBPW:KP fL%$(K0: S 4 S*PsP5.P|4 R ,PsP00'P@40S(40S- :KL5*KP/QH _KLP T5*KP0:KH5P@0S 30S #a=(K0Q|3|#׸*P#P* $P$C0S3 R *KPP0S 2 R{ "a=(K0Q2հ"mڰR0Sa2  Q V dP|20 S SQ$ 0CS+P0Sh 4B0Sd ("00CS00  ä000V (*A ;%K(JPJuP@ "   {30P!4t,11 0Qڍ0S0  (Ka=  -0QBa=l (KX00SX0X H30l 4R ,4RRRXHpRdR\R4RRRhR| -LM⬡0P,P @1`pD3P P00SP` PUD1 R 4'4P 1@  40$P$ 0S U0 R 4P  @0| ,0K8P P+0ST 000 08PxQtH4R -!LM0S|@ a1@11 WpQPpA\PX@T PZ\A1 R 33@0S`P111P 1 110@1SZX0 R Hl3HX,@\ӯ L\h @HQtpx 0-@0PQ00L ? Q ?;#ʁ P!~ Q ~<Üʘ0 0P 0x 0t0p0 0P03 83Y4 -LM\q0`SN H!3#c1c0cAT R$0S8 Q0S. T P T $`P 00T 0$`00  XPl0(&PC3dAdn@d@000XRPY4 -LpPP 0S ,0SP!%0aV 0S P0S$0 0@0S# V P00 0$ 0 T %P(@ n`PP0000 = -Lp=PP 0S ,0SP %0aV 0S UP0S$0 0@0S# V )~P00 0$ 0  R%P(@m`PfP0000$ -LM@(aMP@ 0S  -1LM 0 bM@ ^0 - ! ^  ^ a0 :#:900 P \0  ^  ^ ^  ^    0-LbM(MPbMK@D$@D0p 0 d0 KX0P  0 @0 0 0S r0\ x 0A0- SPL@ 0]0S8  R0SZ+ 0U+0 -a- `L0Q!0p@[ P20P d 0p QL -+4 $$+ PP \x0 KS- L0P 0 -PL@LPgb=0  <|1  5d1  .Lq0 '41  1$  1*  00   0A0a-  bam` ; P0@09P0: S `0  ,h 0S HP (,$0H8 W! -LTMr0 $0 @"P2b- 0LS`P2`  0L`pPKS񟗞888a=0A 0WPP2 HD 0 P,2 0 P 2  @*$0 S $gq1  0 P1 0 P1 0 P1 0 Pp1$ 0 P$1* 0 Pa=0 0 P; 0| PLPP00S S S S  Pd0 )@0l A 0O Pv A0q (,$$L0 mS- L=0P 0p0 mS- L.0P 0x0 ]R -2LM pR@ nPb0   2  l"0 T2  <2.  $262a-  am` & 1>  P F $04 4!N0 y P Vt $04 4`!f0 h L1^  a P@:0@0P3n000cBP) 0: S `@0 0S@P0 ` `,o 0S P `@0 0S@ Pn#RR (,H8$0 |0 R -H$L|M0 ,0 < P $00CS 4   4圐K R 0  & P3=6K 0 P7#00CS,4hhh,,a=0p`P@00S@b-P ``06 u P03 ($3 0 P3 0 P 2 ](2 ,0S ,o2 0 P2 0 Pa=. 0 P`2& 0 PDR>0 0 PF 88# 0 PQN0 0 PV 88# 0 P^ 0 Pp nP/P*Pn000cP@P00S S S S  P<00cPy0 'sq0b= 0P@60 0C PL [b=0P@06\  03 P 0Rq (,$qQ-H0 4S Q 0 S  qQ -LMPpPb@03 R 0#400"400"40 0"40  0"40  0"400"40 a͠$ 0 `48 0`  !H8 0Da=$"$2T:0D0P300cPP*!0: S `@0 0S@P1 ` `,o!00 P `@0 0S@ %P0 400 400 40 0 40  0 40  0 400 40 a͠$ 0 `48 0`  !H8 0yQ (,$08H P& -%L0M0 (0 H P4H@ AR4  0ASthttHPa`%<%8.K-0K.[- [%<$,0KP0K+K(,0[+[pPPČ%H8 0P`KPH0`P@P`b- 0^ H3 A&S(0 S (gm0LS#H@4B0KAKB [A0[4Pq 80D KC0K 83H@@ 4#H0 4@0K?K@ [?0[4P#H@ 4>0K=K> [=0[4P" 4<0K;K< [;0[4P" 4:0K9K: [90[4P" 480K7K8 [70[4P8"@460K5K6 [50[4Pa=@,@8@4 K30K2K1K4[3 [2[10[ $4(PpPE400K/PK0 [/0[4UDKP2P-000cP@P#D1H`0S S S S\H  ePH<00cPLH0 %EC0HP H 0 @@,@8. K-0K,K+K, [.[-[+0[ 4H0P@b- P0@/HP b=0+ K. K- K, K#08`l (,$ -0` LK$KP P0`P| P$d 0QpL0L {P0, C% XR(, 0-QLM@P&0 R00P0 R0S 0;0 R0 R0 R a= 0wP0#\ 00h$40 |000 0 R`R |8(, p-LKtM @`KPP   \L0  Fp$pw#0 00$ P- 0P ) -LpM`@K[PP X0PpWH0P 0R ,0 ^a$PtRp -LtMpPK@1P1 R* 0R5 0: S, 'PP # 0Q` P X 0x @O$X"0L C$P 0R $tRXR -MLP4M H4p , t * $00C S\ x        3P3 RIKII 4S+P) "#0@P \ `3 RT3T P00##3 ,0S ,j3P 2 Ro 2 BQ R0P0 R0Sx"0;0 RQQ B0S|2 R p2a  02L典P JP0SBB0S1 R  IKAA-P!0S$\1  "4t!`#11  BnKP`F`FU!B4: S>Ap@ Pp! 00#00 d,  %x "B &X RdRXR(,R`R|8d80d p-LtM`KPP 0@T0: S &Pp!L 0"pkPVp! ptR -LtM0@/SP @//㋷`@pKT/ `i0S90S ĵx0\U0SK0S! *x R -@LpMS` Pp0S 0 R K"P0Sl00d0 Rd00HP !00 W"! 0P"8|  -LtMp@W0 P`0S 0 R KP0Sp00d0 Rh00HP 00 "  0"H|  -LM@0Sl`0P 0S 04 !$0 RPdR@\R -LM@ 70Sl`0P } 0S y 04 !$0 RPdR@\R -LM@>0Sl`0嘶P T 0S P 04 !$0 RYPdR@\R -LM!@SP1  0h~!d -*0LM"*@3P  0hh!d -LMRp, `1 0S00000SPP0e0 peR  V@*0S@T*0S T00- x@ x@@T P`W,0c 0  !pWbP  0p\ x/0QQ` 0 RR p-RLM`0 Pp2@0T<  P 0ph  X 0-0@SLP4 4 0R0a 0h2lR8 -ML4M!0QP,0 pG`1 KK`(@D@D V k#  AP p R0 RPa- 0S0S 0 Q 0 ,0S ,wgK(A4A !P a=(K0Q p0| 0QX0P4 0@ Q  0$ ` (L  -0 0R00000L R0000 R0@00x0 Rlah0P PP0 RP$RQRR` QlRh p-PLM@` 0SpwaPP ᧷@P0/S00H 0 S8 @`0 0 PPPPp `dd0 R00T0T QH0  \80 R,0 P0ChR|RQl\ 0-0P LRl0@T 0S @T00SU0 ((P^lR`m -QLP=aq R1 0S  0S0! @0S00 0 P 0P 0P 0` KP DPd00\`Qh QR H -$#L M0PS sP 30C S8$<Xpp2 R 0, K@00KXP0,0 0y0 \ 0D"00" 0"bMb=0@`l `0 @p 1封 * RY 7 R$00  +P0 `ç 0p!勳 P;041 P1V 04!  Ra- 00 R0 0 R  R00 R0 00S  0a @0@00PE00P&B`P0 \*L-S0!^ *\ ^ *\^0305 -$$q0LS`P P: 0-S00 00 0S&0@T0  ᄰ:TP 0 0:S l R1 0 LP0/?0C0 hwRDR@`x p-LM0@P/|P00l0e0SP`ph8<Z0Sph00phRddd -LTMptp % 2p 00@JS񟗈(+,,,,,,,,,,,,,,,,,8+,++, ,<,,,,H,,,T,\,,,,l,,,,,,,,,,,,, +,,-, -,, -,,-8-,D-P-h-,L.T.l.x....,@/p(4qDTA0S`0@0w,0S 3wC彯Pv  4 u{4Po\j43S Pvd43u,3u$33t 2 Pt2 Ps2s2r2rBp2P: \2p2pH2p 2|2 pt2@p}l2pzd2|w2|qP1@ 0S `Pa0CS"-$.$.$.-$.$.$.$.$.$.$..$.<.D.1` 0S{1P1P1P1P1  &t1p1{1[PzqT1z-L1y*D1y'xP0a,AH0pK @p ƶ<1P@x  0儾P@ P⏤UH@ 0u5 0'RDP P0 OBPP;*P `P`P@  ,P).P# \0S ,RDLRH ,8(RRDRR`60Rt`RRR\RRe@4Rpxx -LpM`@pKb@ 00RPP%8P0: SU/00 0D t00SMP    -4L$LM4$䄟P4 $4p $}p 60@DSp=>>>>>>>>>>=>>>,>X?>>X?>>P?>>X?>>><>>>>>>?>>>>>>=<??>?>>?><??>??>?<?@ @>>>@3x3x#000d3+ X3{vH3@c@${P@ P 3 R ) #b尒ŸH0pK  p 2P@l  2债` @ pp`⋠VH@ L2PqH2b 0-S 0!0S "22!0291100!101|1!0&H!1r!!0QSL@L@@@@ R|PP R0S,1 $\P 0 R _ R 0 PPK R`R|R,RttRXRlRxLRDRxB @`R`60RxRRpR4\Re@$ R p-0LM` |@PПd0 P0R4BDL S00CS00  0p ph6R@ pd   P00ᐔ -L0L R0 R  蓟ꐔl   P-L 0S}P1 0PS$ p,ᮩPp`=ᨩP@ \VP  ppP0VPPS0  U  0S( {V  D  p-LM KP} qd R0\4P0 0b0CS#ELELELELELELELELEELEELELELELELELELELELEE`P$K4 V U  0xS S *S p`P0E" $ VUp`P%%K5`P*%F:`P!%O1Q0r 0-LMKPxP @"#  0 S R UPP   B0 0 C 0 0 R -L 0ㇸO m -L0,zO<  -p@LM@ 0\l4 0LgE 0<bB 0,]0$= XO@   H -MLML0P`(0  0S ,(0 S (Z @Rpx 0\S@ S  R wR %UPP`  PI000S  \R 0R 0S =UP 00@0@0S PS" GS0000S 00P 00PPPU0 0gS pS00BNK@D@D ;D 0Tz(v lp  -@TpL 0S T`PUP PΪ@@0`S 0 p`PPP PTldh 0-\0P@LT 0 @T0U$ yPdm -LM0PS x@T l1P0000 <1`V0S`" 1 R @T 0T @T 0TT 00eT 0 pT{Pp  R/00`I @0/S`0 0@4R R/00pdR|R p-!0LM0PP@ 0 R 0 R pp0 " 0/S @T|0 Rp妘PT @`H0@PpUP00dRxR p-0LM`0@P?P6 *P *P 0S p*P P Q  P Qp*P Q P0 R /QPpQ @PQ|R@-0 !S@@T0]P P 0-S P]P ^ \ ]\ P Q0 -PRp0LS@ 0/Sk 0S 0/S6 2 R2 RPp10SS S !Z 0(Pp10SS S +0  \Pp@!00CSk `,1 R.000S S 0/S 00CS00 0 <0C<`0S.000SlS 0/S 000 00C0ꄖ lR  -ML M\\1 `P$ ^KPE840,0S/0Sᬨ0 S0 K0S( .S @ Wp ᯥ P;0W$0 S x$Wd0 K@TTfHbR@t d DPx p-LM@P` 0P D0 L\ 0 pPࠣ -P`L/Q@@e Tp Q@:0Q Q0@*0CQ:0QQ0@*00 01 -LcMZK MpKK K(@DKK( @DN*K", 8KWLK KPH0`K: bK(J,J 0mP'02(K  UT1*00UT1:T3 0 PPi1!(K(K0@cTP 0S 0Y pWp,0 S l,VT *0S 0TP*0S0T0* K\ 0 1(K R K(^0(K RK*K:K(啤ZKX:KZK(8E0S  KP KZK(8TxKQ :K(0nl T\ -LMpXP, @ *0S &S  \S 0T*0Sh /R9R,00`BVP"0S 0S0 `bV0dV @\S R0P -LMp㈮1PU|啷PP 0S`QP@ 0 S/R< P4aP2 T,/00 1  bPP 0S [Z[[4[00 R,0 h@T0 0S/S @ ,RRRtR0R$PxX0X P -88L(0 RJ\RRlR p-L,M(@KP ἼP ᷼P ᲼Pt <8828Ÿ@@4`K@PK$Ÿ0 0 ,0 4 tPV nPF hP6 bP& \P0  40 TP NPp X!Wp@0S <P@0S 2P@0S (P@0S P@P P 0K  覼 0K  蟼w 0K  蘼k 0K  葼_PRhR[ -x0LM @R`0 R P0 RP PaPꔖ p-PLM@3 R0 (a0S= 0#S4 \S. 1PP$ 0"C12d1@cP 0S P6OP P0! 0pxu  `o 0#S@ !P,P  ꔖ/>3(=HX0X P#3!"c1 0c!R 0S R(/>3 p-PLM@3 R0 (a0S= 0#S4 \S. ~PP$ W0"C12d1@cP 0S PNP P0! 0px  ` 0#S@ P,zP  ꘖ/>3|=X0X P#3!"c1 0c!R 0S R,/>3 -PpL`@ 0Sd /DPPp0 S 00C S0u 0SPNP@j U 0SE00-0S1W 0S !0 0P!10@ @@P000 RH 0h SN, a LN\ P 00000 0S MS CS000 0S 07 cS mS00dv,QW0p0@ .QT@}  ( 8T@-0\ @a 0S)  S   0R  0R \\  0 S0S 0 S0S  0R ꌖH -LMPᲣ0pS@ q 20  00S| 0ST`q @ᕣP_0 1 !.B=R pGV0G SRh4ih4ih4i`h4iC111v>C 0C0 !0!>CP00 1 !.BR00 R0S P&0B00 1 !.BR00R0S P0 1 !.BR P 0 1 !.B;R p010!.CDR Pk?C@.PT @}X 0-LPL@DT  0鹯0S0 ! ꜖  -LM⬁PPe 1 R 1 R|1|!11a11acAT pP0 S @T0 0RT 00[L0hXL0霖$qv -dpL0S ` AT@0`V01P@P9L7LU꜖ p-LMP@T0 pǮ0Sx`t 0 h0hRƲX0P 000 H 0 ꠖGRlR -ML0M (R04 ,0  2 ,0S ,(Q4! /!8 0AT ~KpGR0pG8 @TKP@, Q0 O0Q  P D! TK4a=  8,1008 A   0`PS 0S0+0S  #PT 4a=0 S0ń_8  Y$ ꠖG<T 0-LPL@DT  00S0 ^ ꤖl -8L@T`M !0pAT \PP! @T JP@ rP rP 0! 0AKKh T  2P K qP  餖 -@L0`SpP` 10AT P @T P:0G0餖 0-LPL@DT  0^0S0  ꨖ= -0LP -p`LP% 0Ƃ"S12e1PcAT 0S @T 0ST Q EJP@ 0`0 10 A騖/>3@ -1L M@\, `p? ̡1 0, @R@\`0 PPI P 0S: Pda00S0@P! 00S00S IP 00 0 0   )&0, PhPP 0p p00  ` WPP 0X0@ IP 00  ꨖ` 0-LPL@DT  0x0S0  ꬖ= p-LML`0S P0AT  0r@TPOUp鬖 -LM䀟pPP, / 0"c12f1`cAT 0S @TTIP@ pP pP ,000! 0AyI(o0ST 鬖/>3  0-LPP 0A"#12b1 cAT 0S @T00 ST 00 00AI?I0鬖/>3 0-TPL@ T0 04 @00H0S0070갖 R@ -LMP0@SȠp  0S P@p0BS` x0 (00 徐 L 000oI`V$ 0`00갖 Rp -`L0S$ PPUJp0"S@0S w 0RH Q zHPUZH000鰖`R| p-@Q0@LM@C!1`@P  KP*0P0:0 R@U K0P0,*0P0:0@p  -P 0S\ \P00S0 BS|}}|00L\:0000L \*P\:000L\*00L  L 0 00L 0@- 0P@CR}}}`}00L\ :1!P@00L \*0\:000L\*00L  L 0 00L P-  *0 R: R$0 R:  Q0-LP0 S\  0S 3@T0   0$R -LMP@ PpP \ 00CSP0 @ ($ 0t R -LMP, P, 4#, ,(3(cpp0K0CS d, B, l0  , ,2  t , ,2|   a,  ,l2a-d2bb0  00 02R(0 ` >0R 2 "00<(@ /R }   @<0S@P `1`) (@0/S  00C0Xl1 @1) @1  5R K0BS` 0@Q KP0  @P00 9p 0 0 :0 d@0, @m, 0PT , @b, B$ (,H8  RR -3LCM |3 B, Rꨃ83 R  3 ,0S ,KBP0SPdU <"Kٱ d2K0b S Sy 0CSV+2 Kd1KK 0P>KdP2 0P >Kl,20 P  2 X>Kt10 Pa=.K0 PK&K 0P|KP RP@!0S Sa]P K@ 0K@P `p@< 0S@P``0  _+0 Kd2.K@/K N@KPt0h0x\0pP0hBS$  #0 $ 0<2S (@'(PKdA (KPYoK P0 `A \A XA TA PA LA HA DA @A SPdC000 (3>K ?PVXCX_K#^?K@|A 咟PHx!1RS@$0P0;CS040@4Q0S|  `d㤙l㡙A 囙!r 10C1 =At0\ T0 02}>P@ T00< KcK0 ! v`VKe/K:1 + < K eK# R x0S:> A 8o 0S J5  1 刡 ͩ 00Ì bK 0MPʱΧ 0<~D$&r464\&=K@}PpOd&Y?KP0C PoP Y?KP0C PaPwF]?K L0(PK0@00  O? K ^ 300 0p1  000+]?K& W ]?K 7 ]?K ~4 P@ 00  OOK,@@H 0-LP:㎘0^  x0\*P0\@ PL0@ D芑@P@4o TTTT -LMz@u@ -MLMXXb0PpH,0 pp03*0* 201 0 2 ͥ1  Q P1@ԡ`0 810 @@\0P0?P P$JKx!(@D@D0h!`PX- E0P ,0 Q  ,aB 2`8#8P#$0$ @JK(@D @DIK<:(<2: !<(K0<:(<2:(LL!<  0$ЖTTȖ(TT̖TTTT|ՖT -L4MD 0K`D 0P@K0 Z L7  ,  ,=D h0S '0S0 0R0; 6"   R000 0p 6F 0 B0p0 \Ɵ0 ` DX@0S #S $0 0c@BHX@000CS00  ä0( S7 S@PHUp|0 ă ā Ă< 4 <( "4\,<mPEU, pH'W 00CS00  ä0pWQPHpWp!pW T0W6 'W00,?P|0 ă ā Ă< 4 <( "4\,<-pW0 PH 'U00CS00  ä01 pD 0T Phß00p@gU0#DHL'$H 0 \DP0S.W)4S4#0pW@ *0 @S0pW:0pW@ *0Sp 0W:P@K0/ZPKP@0/0 \ 8K❡48 < ( 4" <( "4, ! 0,< `Rc@0 , =9 A0 0 0 =,0 2a, 3c#0OPK< LH0`KqPK@ P K`KPKH 0@PK\,!L@0SPK! !H0Sh0L@Sd*PK`T0 A 0010Z1P7  + pTTTTȖ(TTԖ4  R R$ 4 < \ ̖Жd     MQڲ0AQQ00  8#8LȃLȌ 00Ѝ -ML$4Mx4Q (K @, \ 0 CR 004lK(IITK(JJT$0 t孥 * ᅃ0# ᤥ* |#0S`V* XuVP@uX0 !z - 2zP@ uV0 ?{8#0 r *J *FQ 2 R 8  P,0 S ,s?2@2@P0 Ÿp`0 6@PK0L X0/0)K@ B0/[0/P@@0/P@@K0/֍0/P@ @;K0LP@0/@ō)K0 BP@0/@)KP@P!<0 @ *ɂ oyi kyW gyP@M  ڤf  դ *㭂3K (JJ0 Ǥ *㟂 0RK(II l*㒂Y@A4T T T!h<Ti!\!!T!! -L0 K M00, 000K 0 I p/? 0@ @ _` Q @0 RQ   -LM@ T (0PĔ0P53T -LM@Qsddddt|ܻ $`hQ<`hpxȺкغ}h)0S #!Q LT\p*`XPLHDh84-0#$(,"(h0S S0Swusqo0("#!!!" "D"d"|"""""" #4#X#|######$ $0$X$|$$$$$%,%L%d%%%%%%&(& p-L M0@0aP0 !Pp))j 0e 噡`唡t[VP`F `00CS00  0p ph_(FV`FL&&&&&4& -0L M0 K0 P@ ^0888 (S0 TS& -LM@0 01R4 R(  0 $h&' -LxM0`S qP10  0D0SJ 0S TKPKLKHKDK @K0S jP^ 0 qPV 0 UP@ x0SJ GP @0S? S<4I 0S t(4)a@)$bL)x))) )b b)d)*(*h<P*h*p*|* -T0L8M<0 0  8 @ 4 0K0 , ( $   Z@K3` -MLM⼑0P0 P00S,  1Q  0P1#\Q:,0 S P,7E.K B B0h$ !1`$ (@K  d 8 X \ @&?ᾊ hBNK@D@D 0 P h F0D_0 Fp` "pa*Z -LM r`p&嘅 PP(0Sc P, (0, ( ,0VƗ@0 /j0,000S71P@N &\,0SA&Q200,0S0 00 >0 R @@P0, P( ,P6  c Ɨ@0 S/0,0C0K10 (0吔+Z*a**T -0L)MA1 L0 B0Q 0`!0 `0000L0 S  `0 00 `P(yp@W  ×0001V' @ 00CS00 0S 1P01rXQ0P 000,0 QPZ(bb -@LMT 10C1Jh@-p0\ ` L00n^@` 4K0C4 01PßPoAJD  \ $  0 B00S00Y X 6#1@% "X`P$R`1 ,0S X,Y5 0@89P @" Q 70$ :  0mPPd 0hƑ(0CC1/|gx0Pw00S  n Q<;P9Z`+h+++ b -MLM0tC\d#, 4 <(  P@\434 #A6T8 4 ` #140\F" $p`B6# AV#1%Y X @0 0 M p2Re L 8(LH0PS@*KAAD R& 48 S <8(000 @XT:8H000,0 S ,4 4 0 |00S00YX   D0TPDHNPH @7 Q L 1HH@8H0006#!P*8H0L Q@T *BKAA@ 0 S@@T:086|0  @P0088  <  +HZ+h+++ b+a -0LM PU@p$`-` #T*U0 R  0喃" l`▂#0U<0 R 0 0喃" bZa++,,, -0P0 P00LMS0 P,܀ R0 P.:p$60PP5`@2:(P`@і,F0B໖$ɖ|P0 R0`@004$FṖ00$ᣖ@0 paH,TZa -!LM0\00 \pG\(:`(P``ᇖ,F0Bq$0 ƚ \mPt0t0l h d@d0 H0(00004bZa,aab,( 0-(0@ LRP 0 ,Ւ, 00 0-(0P@LT ,P  T00T0S 0 T @0a 0-LM@0T0 T00S0 T0P7@HX0S|tp0 Rd T0K0 ~` 8x (s-a---a -,- -0LM@ 0h W\ 00CS  00 00  D-bP- -PLM@ @1 Q (P0P*0ES;PU:0U z W/ , Ẁ0 0V`%P( 00@$K}p$ @0 0 /&`$ 000H0G  W00 RbaZaa 0- L8M00 H0 <0 80 40 00 ,0 (0 $0 0 0 D PK@ HK@4 ‘$0$  00C00 aba -LM@Ppr0 `0"pM b0@SB$8@|1 b 0`ip1 h x\!000`01@ m0U>0(!S 10`00!0`00 0@TQ P ۅ0 R T@D\  0;T@DlDžzX T0 R $aaah-DH_at-a -a@EE-Lb p-L@M P`KO0S 0S   p- -LM`t`ğ QS, @ Dd^ 0S 0S p P0S 3 ,0S ,/ 0ṢģL0SD P먓0S 0S 0\CS 0S ?0S 0S , @C 1 D@! T 6`Vh!h1h!X0 d1@L@@0,@ \@ ,0KT@ P@ L@ H@ D@ @@ <@ 8@ 4@ 0@ 6`TP (0@T*0U U@\K (0PT*0U6`V /&ꀠ?>1 L!\  @YP ?>1 A! @TڑRڎZbaa -L M0 \0Z0 Z00S70E 0S 1St5  d50S`P<5&0O @0 V"U 5 RD K 0 0P 0  ㄎTa }D0S Y U`4&B ? PPp` Y YP Y  Y! U@1(@Q0 T PEU@ #6#aᅐPP@T1X@QcT P #0001 01S@  YD3  , \3)&T3 0@L#09$ 64$0 R  "0S Y J0@$00 Pq p2l2    1y'P x2 d` P~ 2 RA @>1 R,9 Qh;Pe@0 ! PPZ @@TP|6#1@DT PM\1 R 0  | P+ h1 !0/i (K0 [@0 ,N0S 0Su P 00M(< XP0S &X^ P D f6C ttbbZa|0,a0aabaTT00XZ01 1$1<1T1d10a1m4 -LM@P.Ppe`VWY!?> DR.000 0. $0`F0V$0@X L0 S00*&P (@ R00  0R 0S R0R0S P 0 R "P` _X0 S00Dō<<<ba5Taa111a1BT1m4 -La8M0&0Q 0  p 0KL P H D @ < 8 4 0 , ( $ @0(0PU *0T0 T00SP (0@U:6pW<0P 40H@ PK0S  ZaTxb -LM`VPڴp崀K@PT 0S  0T @T R 0S `FVP 0  0P 00Ta5 -ML M0,0   BR    xt P d$PTDT$E>K0C4  L44 ,$0ß 3 R( K#d `$ *B>KMK0CL0C L4 p0 R X:p# X*pCp\  X:W$3 ,0S <,* 0S 0 S s S # P"   00C0 " P  000 00C0  LR0S-@<2V᥍@Y P  傐2(KWKK@$ (@U0\4  X$ kEQ& B0O0  0l{ 6`X!0SV Eo0 {5@"%$1 Rk0 P P& Pd P <0:90|sbh22ZZ( b222d22ZD2a)(m412)102L2 -MLM$p\0,0 (`; R 0S L0 S8(K 4  `0 A?(K  A?(K D KK~w0((K0Q 0@^^>KMK Ꮚ~ P$ $\ 0S  R0.S $0'$00Q0Q0 Q00SpG h'dX X (,0 S <,c)00 00CS񟗳  dd$$$0S&&L0S6 `03  00C SKT,T4T<TDTLT\ 0S 00C S' $00&[ P%00C00000000      y0S $\NK @D@D0, S^K PE0 0%5 R $\00 PO$0SL0 R$ 4 RO$\ P; 0: S0   4$009$\R  0.S  00p PS L0S|3(K4!  `0A?( K A?(K KK =v$\0 0 Q0hNK0ᴀ$00$03  0`0C0 d@@Q @T; Q 0S+ 0 SP $00$0P "00C0"l>KMK  PH"\D000.S "P egP00L Rm `0j 0Sg 4\@P^>KMK @dވ$00$0@1  0`0C0 崀=@?PuP( w50.SR 00Ph L0S# `0 0S 0<0P$0 3Z2ab3 3(343a@3bP3x3a33333d23444L4x4444 ((0c -!0L1pCW:@`V QЀ Ȁ0 R 0pGW*0 R PQ 0 R x0 UP`@H000<0 00C000ZZbb$bb 0-L8M`Q QT!00 @D H0 @0 <0 80 40 00 ,0 (0 $0 0 0 K0DS0@T0@@ 00CS.00 0QP 0S P0  00!dHK HKlHK4 00  Fb bbZ$)5 54 -`LVP)P>1 1ER# @T 0S @T.!0EX00C0`FVP 0  @00F!Tbaa -LuM膟0,0  p! 1PW1 1 1  6 \ᔦP  (` ,6&=Pz !,6"! 0&1& `&\ rKX f?K^4 Z(@1^*P P ?> P  RN/ 0`F<0^:6^  ^Lş 0P<,5% \ ?>1/1L.QAN 0 40\1弤 01 0S  1, 0 S  0l` K_KL$1ᰋ,6 1R rK P0S$1ᜋ& ᎂPl0SV1#ፋ&P<6 P90S 0S ) d1 0S HrKr P D  B ß,0 S ,|%C1! 0 000S  ReKL P !&U001&-P hTeK+ P & 4!00! & Pq v1{p ve,6KQ01,&K `,6|AQ000L0SD1 S@D0S!1 S*0\!5 2! 5:? >PN0ׇ? >0N0CS101 ,6 0x ,6!q pX@0 H;Zab5P5x55556a$60686D6bTL6 -PULp`:4@$@TPZ ㏯U:l6t6 0 00 --L E p-PLM@P`l0l R QT D0 Rp80Y R 0  P|6 --L  --L  -LM@g h& --L  p-LtM/P@TK aP0: S p0`rSt È 0-/L@ePU+D0 00q/00(+g+g00U6 -LUMpPKP$P@lK80S-0: S  SU b}P U@P P@0 R000K@P h1: S@ c$^ 666 P-L P 埬6 -QLM@ eP T 厬47 -L)EP 倬7 -kMLM7 6@, @6K0A䆟 A 6 PP6: S 1PK {&P0S| |6 Rq 0 S i\)0Sa L6L&@HfHv@@ @@@@0 00S P5P(0%<00PC0S0S X5 ,0S ,"L%e.K B BP \P @0@T H6<4"D0# sP@0@Tşş%5@0T06 v4 RД3S (0 త4 @@TZ0Q $R |P0S (4 R &6P, ,4@ &PT6&  S0"",3 0P@ Uh 6T#00/>10@3PL x3PTChG T3P= P03$- 6SR ,@!0@T00 "2 B000"S P x2 |lPP\Hd,(PPO@aWT J/ \Lp1  LPP>, K\&R0S%"0!S$ 㾬pu zPL~dje ,\be 뚙?AZaa 71Zaa@7b$baZL7 baat7|77777 8<8d8x8aZab88b8b8ab 9bZZZZD9h9T999t9:$:0:@:H:\:m4 -L M, Zß ?o3弃 ;^P c+ 9#x3R,p / pW,P  0bW@X0EOa.6 0@Ɔ& 6F@VF3 ( &$6?r 0(& 0DE00 @B 0+00 0S02PU D2 00  0 0 00 ,0,0 00000 330330 33033 @0L@0 D0PD00 550550 55d00d0d0d 0 d  ` d0 1 R,d0\ +d}P 0 R,w6P@kU*0 Q@tPU:aAd ,0 a bZaZSp::ZZa:::4;L;@-@0 0   0 0 0$  (@$, (@0@, 0000 D@0HD LH0L 330## 330## 330%% Z -PLM@ 00 R$hkax; -LMp@m`@v^ Pa0@S pd1P  0PUK T q,10  00S 2W~Cp pG R R0! lc.υ`fP%UPނ0FOa.U&pn  0 6 & p@Ȃb0PV6@⿂ $8PX4;̩; -0LM@H H&tP0T c! YedA;<-L0(&S  d0 P0S\P P1 Pa S\Q 60QZ -L: S  S  S H0 R4 S S  S SaL< -1LM `RelP@@ T|1 RRp1 RNd0ST D1 R <0QXp(w00CS0X0@ӤX0,FT& T 00CS00 R0 0  yTYT nTNT 㵩YT00yTP o P00XGo@4(Ta1aaa`<l<x<< -0 @LM̀@@0 ` @@``ƁPUPTp p @P00TQ  p0WD0@@WPbTbZaaa< 0-PL@T 0&"0S @T@T# 0 @TT  d 000X 0000 0 @P@0aZTbPb< p-l0LM@Ɠ0\S` @088 000 0 `PpZaTbZ p-LM0@S` PU 0 '0U P 0 PPt0T p 6 Ul`P6@ S6& "," Z 6T  b4<(<aZa 0-L0P LR @  (Q$P 0鑨 a<1< -LM8pP(2G 2 R b  ? @_lTo 1 RP a@T T rP%#Up@ U QW!0Z00 lQ3L1 R% PZD1 R 1宑o髑 1 !@Pv0 *@C@0P P  ?k@0@ 0P PPUgHzaZaZ baaaaZ=aTbPb =@=X=Zt= -L$M0 !0P@`_ᖄ@K &" $"40 D @K0, }Qd4 ,4 P[ 0@0K,0}QM@4 8@ ԂH4P8pT54 , R0,# @K@_@K0 | 0`Q 00Vs# @0P 88 x 4@0pW s8@0@n80 0 b==a=== -PLM, 00 ]@_l!@K0/a,@@K,< |QG 0 0PP< ,@`K 0|Q.-0pZ o" @ 0R  @@K0 `@0PK_tp _| R,\0 Z<,S00 ,K b====bp@-t@00CP`P``?>!@\1 00CPp010  pbba -L8M 0@K0 ,0  -RSL4M@ Ppl h\\1  BRH iT 0, P \0 , K X T L H D @ < 8 4 0 `HH\KP@ 0 P0 X T0 PP 0p  0U0?00f fv|4l`` n|/00f V:TPU L0L X0 0 TP z U \K bQdd -L q 0-LMMpPANK@D0@D` 0 #k 80 p 0S .0>LbH> -LM0@~pp@ -LM0@S F`GXG`G00S lh0 R \P0008<3c넋aT>\>h> -L`PW똡嘁q@!ᶴpb@1 P8H\H\HDH\H\H\H\H\H\H\H\HTH\H\H\H\HxHHHH@@1@@@0 :^r005@0 0QQ0 R|0 R 0 R|0 RP0 R XgkP L呣H0J4pbtb\b>lb>xb`b4@`hdb -0`P0@LpP |DhPlP 00U5k0S828PP$ 0 $hbdb -sL` P00CS00@Ӥ0tE U T T 3 R^ T0M CR `o000- CR 8^00@t$3 0 0 0S= 0^ CR /000T C@?R 00p P0@0@|2|t"0`000R P, Ѥ0R̤p0 CR 0@0R P0Rp0Rp1 R 0^ CR X000I CR 0000R0Rp1 R 0$ CR 000Rqp0 R T 0 R2 0T0Q0S* Dl \0@" eX`j@0N4\bXhbdb`blbxbtbpb>`h -0p`0P@LP  gP@ 000T~0S QqP@ 0 $hbdb -LpM` 0Rp䠟%  .p@ PP  ᳣PP p @TPl0ld0 KtPL, P 3@P$ꌙ4Xb`hhbdb` -PL M@, 0 YP@0 -SX0`SpM 0A0C,S?QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ0,0  `  L4H4 0`00 ( p0SV PEU@ fP PEU@ȃc0S fPPE@ $0S33 |3 00S UD30 0 %Y U Z U  ,  eU "0p0t0 ڴePPUU|eP\PUSPb0S eP 0S0S20S p ` 0pGS # W R0S) 4Q P  PE@1QP Q dBPE@< 000PEU@ 00S1Q 00S  :e0 lP 01S00S00S @ !e|0 kPpY (e|ffDJ4Chfcf\I>dfdJtJJ`fclfpfJJ 0-TPL0@S s<0  0P@0000頙lf p-1LM0`@PP kPUP  kPPp kPx0l kP`P0X00 D~kP< 000p错lfpki zi Jxfi cJ~i g -L,MD0P`K@p,0 ($ | yd Qkp I0S E0S A0S%@PsP<   4kp㕟<@TU  @00PEU00Sp<*,0 S,elfi$JJJ p-L,M`0P@@K0 +$ g| d`0` j0sHDU 7,84 . 0S 3plfi$J K$K -L8M0@(0 LKPp`$ 1| cU0 @ PK7P @Rp0h-S`@dcP8@ D0D jp0 (0S (8KTKlfi$`KpK -PL` M0 p 7P`  f0 Sr200000S0p,K 6P d͞,PU V 0 Sr,200000S cP m TPh0 r1000P^ 00S .{  AR #  {  tAR #ov dGc Cc 00S ZP2  p,Z  FcP% 0 00RSY 0@T 0R @0S 0 0S$0S 0p0SPU{,6VW<<( X KXK0e@eccfhf4CK -L0 ,b(0( ip fclfzi K -4L ,b(0( ip fclfyi K p-L M$@K DQz8 ip$ $TP`  $0 0 ` tip՝ 0$ PS 0@UU0  CR 0 R00겟h 0PU@H00CS00  ä0 Kplfxi KKL4 -P0LMH@D0  \ (0$0  hfdfpfc -0L0 hf -0L0 hf -<0<L00, h0Shlfci ,L -80L4000 0h0Shlfc4i ,L -L% 0000 0tfc -0LM0@S/ h00S00S P00  t,0T, @00 0 0 0dfpfhfc/a$ P0t@l0@BLhfILf|I p-0LM0`0S P pP!K~3P?@T 00S  aP 0S 00S` @TV8Ł04phfLfLKfL -PLM`@Kp| `$`1 @`4@0 DP 00 ,(0g0Scfi MlfM -PLM`@Kp| `$`1 @`4@0 DP 00 ,i(0]g0Sacfi ,Mlf8M p-L,M`0@PK@$ 0 x e`0S Ec P0r00000Sp  ,KO`PX P-H0!gp8 0S(gpfXDMi$tMlfMM p-L,M`0@PK@$ 0 hx `0S c P0r00000Sp  ,K `PX PH0fp8> 0S("pfXMi$MlfNN -LM@0Pp`P  R0@r1000xSY@Qg W _PY r10000D0S  rt10000D0SX0UYDDY 0- qP100000S00B R00000ӑW0C q000000S00B R00000ӑW0C0@00W0\R00S `_P@00 `hV fw`HX(N@N\N p-QLM@P` 00S R00000ӑxS T0S r000000S r000@000STT T00P0SPP  ph78@4T$@.TpHXpN`xN& 0-L0MP@0K; K @ h@0S`  @0[<0K^H0H <0K0eP0 0S 0cflfi |NN 0-L MP0Q 0 @!K  x0Sp + Kq0@KL ^@0@ ep0 0S 0NflfiNN -LM䁟0\pK@8 P`K$0 v@ v0tL0 H0 0L0 Q +P L0H K2lpK1p`K01@Tژ2 rcpURQtPP@1@SPTUpPl rp200000S 0:SP P8l )PPU t@T0, CR 0 R00ꉙp0K1S RU@ Tڴ1S0Sp[\X1PT![ LP0D cP 1S  0 CR 0R00Ll000CS00  ä0 \<00S),0 S,"clffi i8iiiiO4OOOi|OCBOOOXNOPP4$Pi 0P|fDP ->MLDM1圑0 ,   >KK(@DD@D ds` [P bP` 0S;,8>{KL@K(pG $pG>[s s 8P 4p [ nbP@ q<0S <0TP( 0 0CS00ä0<0@T|PZP ,0S<, xfKlffi XPi|pPPP4PP -x0L`! @ T @p 0 CR 0R00t[x0 tttNSpRW` LDLBTP@TDPBD$ZD[3d0S /B0S 0B& 0 CR 0R00-505P d 0 CR 0R00x07< hP4PPPPCBPPPP\Q 0-0L0MP0@@K( 0 r Z|0| aP0SX0 P0 H00<$ ~{ 0S( 0`fflf6i(|Q$eQQ 0-t0tP0Lh@h  \0\00 00tZ@08 IaP$0`fc$eff,elf5i Q p-LM@`00X`PD 8-{@P$NP^Pp`f$eQQR -Lqd0d0`pT{0@#nPp@@Np0 { 0`f$eHRpR -LM@KD004 (z 00`fRR$ef -LM@-D004 (z 00`fR S$e,e -L M0p$0  @pp`0h\z$KP`@-$0@@S z`f$e8SdSS40S 0S0SCHX-L0S 00  S\0SCXX 0-@PL0 Np0 Rz0ClX 0-@PL0 9p0 =z0餙X -Lp4-PP`@l剔d0p0`@0 @z8ne@T( KX=F p-LM0@S`P 00  S&Pp@0Sp -QLMPp W@"cX0$  A0S 0 0 SP @0S@0S$ 00 S0P QWl`||Xt H H00p@0S% 4i領XX4F=@XX -LBM MLCNK@DP0 @D/㋏KKoK,0 PPp X1 `_Pp2(K 0Sc 0( K @<PP@kP,kX(0K 0(K 0QpRKH K <P@PjPP,SX 0Ds ,0S4,t flfKi4XX Y -LM0@(0 T4$4QJ4QET00CS00  ä0 OT 0S 0SSqX)p@K DdBp W0K( `0 ^P`0SP@K( +p W ^P0PGPp 3 ,p ^Pxp @4 @0R0 0  CR 0R000( CR 0R00ה 40) CR 0R00Ĕ`R00CS00  ä0 880< LH20@S& 4Ÿ0S @0 0R 2!0S 2^ 80 00 }0S1@1S^n0\0CS00  ä0 8xp10S P00@T`10S V8` 0M  C00@T PUX0@T  @0S 0 0$0S^ (0S(& fxf`hYcY gY4Zlfi Z6i( Z`4ZDZPZGG 4̩(e\ZPhf4CcT -LMX0Tr$0 0S0+S ($B$ V4PK m DV D]P 1` }01S nA0 x! o]P g01S Dn\j4 0Vl< 14 8#"0! 40K@  DB]P :01S n=| UVP ls00CS00  ä0 d} $0ST$hlfpkcfcpZ%i Pf|Zxf"i ZZZ#i ZZ4Z -(0L00S 0 hf0S 00S "48<#80  -DLM08@,0 0Sο0+S 3`p㓏Kpp <hP,U30: SOK.n UO_K0d \P01SD@ m,3 (K @OOK <FhP,USOK.m UOK0 c\P[01S hcMKWP.m pUO_K0  @\Pp701S ?<1{<1w<1s<1o<1kY g10SB .~m4 6U0L \P01S) (&81S<1S F@<8P Pd2/-P Pdw#  0 ,0S,lfpk4Zxff"i Z[%i [[Ii ,[@[L[X[d[p[|[Qi [[p[[[0e -0LMaQ00p00PZ 0S@T 0 gx0S K  b 00 udJ p-L MK,` 0 AP(0S |muV0000 P00P0S 00p0P@0P0P0 `20p[ p-LMR@!X` 0S   yTZ p@0< CR 0R00}0S7 0CU3* V ,0 CR 0R00e` \0 CR 0 R \ 00O \0 S0 S0SD>0 CR 0R00pph2p[[4 Q-L@ x`B @0S> 0CW31 V ,0 CR 0R00  ` R"R000ӑ0 CR 0P R  U 00 R0 S0 S0S4H p-L$M08@K`  Qk4 <0K 0 :P \ 0kt<0S  lbtf0S 00S Q0S 1#$0$ <ppdJ -LMK,p0 Q`H' 0@S .tW0000T00TQP  {k wkT@D0T0T0 d20[@-^@ 0S\\  P2  RR P2 R\ 0S\ -LM@  H[ -L(M@q0D@K$ ,a 0 k$ R Yp0S3 0S/ 4P%RbP0   Yp0@`TURPPE Vt`Ϳ hʿ@00U00SV  0S, lffi$P\\\Ļl\@P\ - @LM0 j|bY 0-Ll@TlPll 0hލlR 001404 ;Y0S 0h=0cx\flfi \DDfRD0DaR0@-@@@((0P\ P, ,0PRP0@00@-@@@((0P\P, ,0PRP00@0@-@@@ 0P\ P$ $0PRP0@00@-@@@ 0P\P$ $0PRP00@0@-@@@000P\ P4 40PRP0@00@-@@@000P\P4 40PRP00@|@-@@< <0@R8 80R < <0@R8 80R@`@-@@< <0@R8 80R < <0@R8 80R@H -LM`p#d P8 %00X`}P5帕 P@ %< 兝p< 10@GS񟗤̥@@@@@@@@@@@@@@@@@@ @@@@@(@@@@@4<D@@@@@@@@@@@@L@Th@t||@Ħ$4@@PD4T$P@@H4@@$4P($4@ $P@@@ 4333 3#P@3#3330ă80 ;0u3h#@t3P@@`#`3P@#@@x3,#PP@d3`3\3X#PWP3#00Q 3#< e<J2"P2@@@#0Sq`a%2 R2 R 2 R2 Rh"0S0S\2 R42 R0SX2 R 80S(Y 0/;40 "0S9 !0S3 %S" !0S! 1 R!0S!t1 R!!1V   y11 S41 R!1 Rt!t!p! 0S ST!S0 R,08!z(!uTJP@ 0S0 d@ޕ P P 寃|嬃/ɷP  oD00Sb0@l\Hx^|@t]^^nMb_ _D_\___ -LpP`H mPP=XP@0 X PA` `ɄiP0`  (``(0S<0 0P,` P0,,0@| 0S0@LL ,0 00  n]___ p-LMT`@T PP T0S0U@0pn00P 0 RPn p-LM`hPP@0  0P0)\0dh  z00TTPPPPPPP pJrpo](`p` -LM,K~2嘢@ 4pKT ' @,0@PQ h2 R,0S`t7P0 P, 0,0@40Q9 @T40Q& , Q ៵00 0cP l  1 Rʄxx!=9 B = 0 0R 0S(,! 0R`VV `0 0,00 R A Q $08 0bS$0$00,0^00STd 0,000,0,@ m 0Rdnl|g]````a p-LM, 0@<080RFh@@400 S407ڤa08P< 408 8 0R  K⨒0l!8 0Q =9A =C@@  0<1@ Rp<0!p 0R@ 0 cp`8P0800 Vp0 R`8P0t`8PS[|X`8P"2n3c1@./A)b2b3c13N<000S `8P0l?B ^$a@aTaC -PLM@ H0PdS " H0HU<0@ U& 0 U0 xaaaa --M L0MpANK0 @D@D\ 0 P0 ` p0  U` 0S L 4 O] xatb -@bLM0 0Cs0$r r@ 00 0Cs0Pt@$K@Pl$@T 0)@TAQ P |1 p1 R0PQ$T0<ڀ0PU 㤀  0 R0PQ 0S 0 RXP㘀P % 0P 000h壀0FEPP 0UX 00ꐛbbKb -"L,M0S l0S0P L2@P@ 8@@ @@@@P!P`"1h: 쁟PYLPKp) 0L` pZPI0) pL` ZP6@ H0K: ,@ 8 H@ D@ @@ <@ 4@ 0@ ZpP HH00D00!81@P,!0(1 0 10 `@ `|:0 sy: 0io:x ci:` 0PDx 0,0PP d갛8b ^@b n`m|mmgmmXbxbbbbb -1L$M@HK,@ |H0KP0T0@0P 0P @ 0` S@)p p ````   @P ^@ @@@,P 0P20 EPP0P 02S 9 0\` 00,000,0 Q 8,',0 R|m,^b nc(c -LLMTTC`0 $0 PPp0 SP )Q )Q 000  R0S^ " $0S $V \0P R T K.0lZdK@W0@L"0SZ0S T K.0YdK@W0!W 0S T K.0YdK@W!000SPP `T K.0Y ,0L!(lL0, 0RL0RR000,0T K.0YdK@rW T K.0YdK@fW0 x 0>l` g0STR `Q0SK R pG8< 0`m8^4cXcmdccccd01 0 R 000 ^0 0-@0P0LSw0S 0' ; }0PP 0x 00P 00~68H 0tz6$ 긛^6nmm$fb -!LWM0,0  p{}PUaKJ/ Xd t@T LGP=WoK0PS @W 0]KS  @P U00R00Sf0 ,0S ,v \\ K.0 V0 O \  6D0D <6 0$ 34fJi(8f^Hffb -LdM☑@q, KⲠP0K0`0 ` p@ 0K K` `0P` 0 R  )000 PPPP0  0S 0 0 .0\ KCVl`K@ T0 0p P ,0S X, S@ዩ50 m^fnfc -RML 7 M(% 4%  ǟ7 ȟx,  ,  0 8 < @  t' 凋p/ H0@/S`Lpt(0:;;@00S lVA0C2SEh0<00S|090;0:0;j0:080gş80:( 8 07_FKL L4EG.Kx t :  B0p l hP 0 Q5  09,G@ _0:;8y TNKA Rz@ n0S 0 R 4%RQ #NKA ED4P|ß0 R 4 R Xh 0@0HjP00<0 :,0, "NKA 2\3 R 4 R0 S  "NKAl2`P0S2 4 R.". 5P"(@%0 *y/ *(T 2P00(~y10 \iP 3T iPp!NKA P L0 R 4 Rk (`r꼧X@@ a080 00|V00NKA 1Pڠ0 R 4 R Pø;d0 0:;7+/0<0:;:?.A(oogDlg$h@h\h4|hhh'h'hi$iDili@`ipkiiitijo,j LjPhjjjjDdK@0C, @:0C D P$0S `0 0 )RP1"0  NNKL2@D@DP)` 0T `RPH2) 0`RPph Ip H 0S Qx0S 33  0 0> 5 1P$  0 @T @%@T  $VPTT$0 00000000@{Q@T`@0D @ED4 @0R4 1 @P ,O>K)0C* YRp s $KNK@D04% R44:0  4 4: 0 6RPPh0 8EP00 0 s0% 0% 05S8%R 454 00) 0x0   ,0S  < 4 (%R 4<5P(%p2 0s 400) 0   0Q4 ZQʨ&0) %R 0S`\KPE'p@0@QP 6&0@QP6ONK@DP) 0 PQP6) 0PQP(@ @嬨  妨 L p A %r'C$C0@ 8x00MKBKK PhPK@ALI @A L 0ID L H PUd@T]0SV0 NP@0 5 @VP> D%804 =KH0Cˠ 4 $5 4 DL5 D 4 NP H%$Gp  R 0S:HPڠ0   &֤0S ިPͤ0S v @P-$B,:0=KEK0CL0C 0 0Q\: Rhfp 寨;x 嬨/v 2v0 S X*N>K0Cɠ@ 0Cp* @P v05 wPP:`@+0V@0  )0 PPX%;VPtO.K B< BaP a4qBP4  `J@TO^KPEPE 0  P@540S {hBP0vT4BP~ XjB`l<Pt` |04 -<@O>K0C)0C D BPP [KNK@D _RO>K)0C -PpF N>K0C 0C4 PD-D00.% t` fu$l=l 廤P| % 1 PP` JAP 0 U VB,%0Z-PP0  P$ 000P  04S74@<1p h{m0md 8mXm4pfffff4gg,g4gXm8gLgDDoptL`ggh(od ggg 0GRh p4PZ|T #*mK`F`FFKp 0@fP h$p0 SPU1(K Ro ((ԣh4p$S:P0 : LʣP`UY US p 0hS*0V,$,!$#\C0 U|`\) V$夣`|4PGQ00S V 啣)0 CR 000Rs,s,{sph ZV,ps,msn`j`'9P@h4h _p\h | 0* q3  0 3RHh4p$\h 0:op hSd5tP |l0 0R 0q3JKc R000 0x  0 0 Bx 0 07` ( rk4 LlTX$0 &d0Sx\p\h N*0P Sp$h \:@Т=͢IKȢtT0H` 0` G0K@` <` 8` 4` D` HK0@K00 HK@尢EKAA QX\, <4$ ,mr -0L 0'$_븂`s -LM`pPlPP qPL bzp8@00V U #08s@ -P0PpLH^0`S P`⤘1@SP hJkꘜLt -BML M}K0@pG$ $0 [F`BNK@D!0F8PPz8PPC-Kl B4PX0S @@\PH nP6 2P- PD2[KP) XP/ P) RP, KP- M P< 1P/ KP) CP, K P- > P3 K P- 8 P0 1P0 21 .1 +|1 (p1 %d1 "X1 L1 @1 41 (1 1 1 1 0 0 0 0 0A[?[0HP @@[0G @0H P 40K9K3K6Kd<@T K?Vgp (0S4(=4 DTDw p-LMP`0,@KHP 0 *  G 0Spww -LM@P  00R0R  00ShE ` -LM@P h+00Sh# ` 0-LP@P $00S0h'  0` -L M Kw1P@![A[R0 ʐP x0td P00TT0@LP 400 PP00ht@@wwp\w -LM 000000000000 0000 `0`圢0A> 06 pIpq QcPa 4S4S 4?0 <8pP@us*`0A>@t 0 001 0*l (pP|R*?T A.0O0P000B>0,10S 4PU/0K000 q*Y;040 00S 00S" 00 0000000`0` 0 0 0 0000000 0000 `0`0 $4SY*0hЦ(x$x0 -pLM@ 00s)0@$x@-`@? 0"00\ 0S0S000\h -LMZIp q  Z0Y0:H!O 4  6y†04 S4 S* P%0 4 S4 S0 4 S4 S*p 00 0 4 S4 S:T0O YA. P ` `6& 0I6Y$h0 -x0LM@ 4 BN@Ap@0t hz 00Nph0 0-LgP" 0P0Q  0R 0R Q(00A> 000 $$0h(00S00B>0ᄦh@-(0A> 0$Đ6I h -LM@$0AR 0  0R0$$R 005:| L0$$R0$4 A  0@0 0$4 h 0-PL $4S0C! 4S4S 4 A> 0@0P0 A 0@d0 $4T0$0AR 0  0R$$0R* 000hch5=?0/9P6 0S000( p- LM 4B>0 pQ 0P@00QP`@BN@0 A>0A> 00$d0(@K B>R0  40 40 05pqph(phx -LM2Px 404@0  0000 0 00 0 h0 00  0?\00h -LMX@ 0S 00 0 @0S0 04hh -LM@0 o5pq @ -LM̀p`P@TC@!n2A>B.A 0 0$D4 dD P  40 40 4stoh 0-tP@0L 4@ 4@=I 40 04T0@0h0h00 hpD0 00000Sp00000S Xp0 000 X -p000L00 0S0  Pt tf:P@ qL0 0000 0S8 0(0$ N: Xxlxx(0 $ 00 0 ᄖt|t -L 00 0tx p-LMP%$$`$@000$000ptx$t -`Lp00S 0P@$x 0 0S %$0 0 00(`S@0S0S|tp 0-L@LP 0LR0 0CS00 00 00txt| -鐠p0 刀0b? |`PUL@0S 2$0 P0b?U0S( 0f0@mpxt| -錀p0 儠0b? x`@TLP U uY$0 @0b?TU,0@ 00c0m^pxt| -PL0`0pS @5$ 0 R -$ 0 0CR00S 000$$000|tp p-LM|` x0RR@$`0`P0 0R00C0#00`00S c0Sp|txt 0-p@LP#`0P0#D P:00@P*0P0t| 0-t@tP0LS 0S 0S0800 P0S00|t - 0L00S W| 0-xPx@0LS 0S S0S0S S 0S 0S S 0S0S S0|t -LML@00 S00 S S 00 SS| -H0LM0@S ,0@$ 0@]00t| 008 0-L@dPl$ljjPkjXl4lkk,lLM0.0?.00e=@]@0 S=@= +=0S?0SeXC`0SeX@e dM0S P P 0S#0K$`K$K P P 0(K(0 F@(P]T0DcS&}|,|8 4}p|\X(l$P`<}X~0D||̅̅T~ԁXԄ88~8888888888888888888888888888888888888888888888lyH 0Lg,+0S0S ; K0S0S-:0S:  *0S0S : |J0S0S  T0`TD0DP`P ᶿT0VT0`VpD0-PU` @@`T 0*ᗿT0V00@TK6B ዿ ቿ( -1LM0S0 4  1p W NP` |P 0|S`\@Y F@Pp8@ 80S0%S 0sS G080 @=p00@6T:&@4TY P)K 㰞P })[40D@00PPy}0SԦ({ -,1LMP, UBRc}iPp; @ 0,@`@Z0 %S0sSZ   , ,P@00PU:@þT o"}({ -LtMK@=P@x0: S@@ p-LtMP0SK` @ `0S4`d00S0: S w*@d `  pnpܠ -LtMK@T;PH0Kሴ00Sꠦ 0-d0L0ST00pP@u TU 0000鄦0 0S00>ꐦ -L M@000 p`P00T,0  300CW 30SW200CW 9B2 R 200CWUV T0S x20S [,UVP i; R R E20S pWWJZZ`P#p`Pv0X,0 p@q>P ,PL1AP-00Y000 # 1 00S0uv   00S00S0   00S5 00S 00S,pWZ00S0   ,0S 00p 000 00SYk 0 o~ @̦Ȧ{d 0 -LM@`PpTW 000CT0 @T Jp`PvY Z@@TZXZ!o7 @ -01L M0pS` 10S P; i9pP@+u)V 0AP 00S PP@ 0pP@u l0 000 0騦@ -LMp`pP@uV iE 0S<00S,00S 0 0S00CȦ'@I{ P000P  -P0Q0L00 00 000 H - L00 00C0H p-LMP`(*@0  000p P0-L@P@ 0T0h00PP 0PP  -LM@0S00H p-DPLM@`T Pp@Tp  0-LP@P000P0000000000   -pLMP@u) 10S1!00`Q0 #P+hp@ UP@< P00 P8p0t T =  P 0`V00S:00 P``V$0P@` P@@P$@Fx00S00 S 0 P@ P pCP@T0 -pL MXrPp20S200QPW0 P@P v20S @ T T10: P@ P p1@0`PP` x!0$ P@ p`PP,  0,0 @7Qp@ 0000  &0 P` P k @0Q P 0Px00Sl00 @,@ @0PU`XW,x  T0 p-pLM`Pv cP;p P P@0P`40`.@0P`p P P0`p -L0SH hp0 s 0 0  Bh{@ -LMp`pP@u P |00Sh0 tW V P@(0 f K!{| -L M@Kq O p-LM`pP@uxEpP@uPph UT0 ph4|P| p-LM`P@P  P psP@$00S/ ph -L M`P, , SP,0@cT A dxuP@ Ho1pw0x00XW0A ,0@T)y z  V0 U0 1 ,0c@0;p`Pv ,0@T| ,1 ,0@d@ 0@ܠ,@00CT Tp`Pv XW  000S o20@0CTA D0@@Y 0 0@@l|@ -hL6` 0S 0 0S<0040   0+0 |@KLPT -p嬀0L`ȸPPጠ @T0 Ḹ0P0F  c#  b#P@`TLPL0 0DS@0 80 40 00 ,0 00 0 Ḧ, $(40 -L M@@0 S( P@p`p`20S, 2Ÿ  00 r0s 0SR !0S0S1 01 00p 0 00 0S/@@K 0  $1P a,1UP0!c0@P"#P 0 0P00 0 0  0Rph0 00d0 0000 S 0 (0S8( ĦLP T],| p-LM0`SQP@0SPE P P@P0SUfp0SQ 0S0ASQ 00S0 0S  -qaQL 0@ l0T@lT@S   0^ࠡ0nP 0 000 h0 00000nP0<0 0n d0  ,,LP@P ldx$0 000HlLh@P $0 0008`tP p-0LM0@S 0S PpP pp`P R`000SP PT R ,0000SS Pp,P -@LM80 00 B0 @00`0LP  -T0LM0@SJ@000S P @TZL -0L P@ -QPp1MLP0 0``P!A0P000SPh0S `1@HT1@0@T @1@a0 0CRP  UR1000S S 00@0TS P0ø 0D Rڴ000SP W00P00S U PT P00C0LL0 0p<0 0P0000 pTLP -0LM00@0T0p` Pcڴ10U 010`@RP`  TJ1U RZT010Pe0 DPPE0 0U00 ء,Xܡ -p@LP`P 05P  T0P0@` "l@h 0RX0X 0 ?R D0@0 000c 48p L P-L@p`5PU U nU"0 Pa50Sa uꈥ\ |0L 0R 0SPUQL0   RRyxw0 P50000050Sp 0S 0S0STQڨ0   RRPO0 P0 00& 0SI 4Q!0S 40S0ST0   RR(0 `P000 3 0S R0S300PSU T P0 :P000 ßS0 0S_T2QW T g 0 P_T$0S 0S a 000S|2Q00  C\2LB 0 P 0 P000=_S0S 0S  0S  0S 1 T "0  P  T  0 P000 P D10SLSS G >PC <P2 10S ST0 )0P+ 0 @@0@0@0TP 0 PX 000P 0 yP  000$,LP0 p 0-@1@LP T00 P0S1b Q 1 Rb\0 00R 00S 00S00S 0 000 00000 00 p00S d00S *00 00T00048 p|xLP0P00S 00<0< 80Q0(000000(|h<PL0 0 ( p-pLM@0`t lPPCp@ p.,@0t T T000CUP800@&P@0 V000pTL -@0LMTpP-P $@0ꌀ0P0PE( P@ p U `ZP @0<0Pf(0PE0@W0000TL@-p@T* R  :P0b0D 6@0@@0@0 hDd< @-P 0S 00Q D -L``P@ T 0S0S*0 S0SB @ T 0S0S:p R000 0  `0St0 @ R0 0S0S@@0 S$0 0 0 Dd -L^ 0 | -LMH@0S dR 00 000P00鬝 -2LM0pS px} XW"Z 0S 0S *Z 0S0S:0S0S0$2Z 2 00`PQ PU`R?Q=PP;1 `XW f1`P0 00pv  0x@0XW4  0 V;U9@04P 0 `VU a0`P0 00pv  09@0VU80   ĦD0 -LMZP,"PU 0 S 0 S *PU 0 S0 S:0 S0 S01U 00 p ` Q `VpR+Q)Pp4P(0`ZGYE $1p0 00px  0@0P`Z,Y)p P ` V U x0p0 00px  0@0P` V U0 D0 -LM P@p` P@t0u00X00S T00XtuP@tTU@0@ -L M0-S eGEC^,  -*`P LPp% 0S" 0SIPP` _@\@@HP 0`vPU0S%PD)  )Y L `40 , o0h<{h| 400S Aȝa0@S<0 -A @L2$0R20鴗T| -'PLM! $P .P ^P@0 00 `P|@000C 0`@`000T@P@ 0s0s(鴝{@| -LP 0-LM@ PKT 00000 -L M@K0,sώ0s 00@3ĝ -L M^@K |0^0s 0s\0000 H00 0400 S P  -LZP ,0, 0S }@-, (02 S@04Rȝĝ 0-PLMP0K K@XP# 0S00R0S$ 00  0鬑$} P-L0 h~  0-PLM@Y P 0P[0=0C:SGXtttttttttttttttPtttttttttttttttttttttttttt`ttttHttttt@ttthlPhPdP`P\PXP@8P奮040K 0(10 e0$(,dhlܦPPP0PPP= -@LMTd ThL0 !@<840,hH}P}t}}} ~ -LMЁ0P@$0 * TTbA`? 00B S10 0C00B S0hQQ@`,0,SVVE1C B(1`$1 <qK /0S#T`VPK K @0@1` %0`V@K0@ `PK@P0@`0P KHP  $0S4$\XءܡT~=$`~l~|~ -PLM! P P( R0 0 0S 0S l|T0T Q0000K (0,0 K0K00K0K0 e45~~ -l0LM@QT T@ hN$0  hئ~0 R00@ -PLM$ \ R 00S S  P$K ?0000@0pS $0@ D$0 0RV$ 0+SppW0$0 q1 +P0 (K$( $ 0+S0(0 1[_X$0z@0C$0 6a0DPS``-P@<0K0P 0(0 000CS4@X W'P000"W $00Se S$0 $ 0 S 0$ (K8$ $00SR $K 00S($00SH~ -LMP( `P@p@@P0U 0@ 0$K$0 1U0  0 0S SU(00SPPU`  000CSW,tllllUF U IU F 0 0 S008U4 U 7U 4v1 0000vp1 0 00X0ESDU U U (K, K,0S 0 000S U(U 0 W000CS0010$K0$0 U 0  0  ~,XHtQ PP -LMJ@0  -LP0 0S00 -LP  0   0P -LM0K0 = -0L0h -`LPp@`0PSE 0$S T; XP80 0C$S'00@f : 000S -L Mp`P0-S@@000C S U 00V(KX(`  00B S10 0C00B SU0@0X` -LM@ R |00S dR 00X0 0P0 0H00 R 000 $ R,`|\0S R 0 R000000ӑS$0SXA0@Sa @0R0-P00 p-LM@P` X0@0P SP000000STOg0Sp鄦( -LMK -LMp:g@`C@@@@, 0P`^ -L  M0KA 1@ _P1$a0d P@00KT0d  U0K 0  -L`P@M\0K0 0鐆P@ !) 0 K4\0d 0\ 0 K00PKF" $0K p-D1LM00@`1 (1 p0S! 0DS ,4<HD00CS px@T U7`KPP0DS   0@p0  p-LMD`DP0@S 00P9P0  Pp,  0-@ L08PS@00' 0R+0@00, -LM@P P -Lp`$M姯Z, H0  `vp0.0K.K0 w0 P@0@@hp`0Z-00hH  &,0 S ,K -Lp`$M姯Z, H0  `vp0.0K.K0 A0 P@0@@hp`0Z-00hH  ,0 S , p-LMP0ϰ0 0@` 0K K\0/cC!b10@00R0a\-00a  0Spgfff 0-LM@P0$@K 0 O 0S ԭ0 0-L M@P0@K 0 }7{ 0S 0 -`LPPp% %P0 `p`0nS dS sS@P pPpP -LMt qP@f T T Tt h -0p L \ `P@ 00S 0@0 S @ \00ShL D000@000T(0 hh0Pp 0-L@Psj 0 0D p-LM`0PS@ t00SX 0@S  @00ScH(0 0S0 >pppT00C p p000C 000C?001@`0@-H 0\8001000\0 010@`0@-<00 CR,0010 BR0 000@`0@-8 0R (0P@0100 R0@` p-L MP` 0@R$K0S ]J0 /00$0s 0s 0 01$ Kp@ `0@-P 0S0S0X@0^! 00S 0SN00^0`@ 0A@P<00 r0s  P`@-p@0\`0 0r0s 00000\0 @` 0P PPB@@ -LM\X@TLD@0 840 ,(0|u$uudvdvhwl p-LM@@`P8 0S BPl   p60  p -0LMK0K00K 0-L M8P0@K 0 . 0S 0̈ 0-L M8P0@K 0 N 0S 0Ԉ 0-LM8P0(@K 0 n 0S y0Q -LM@u q0r00T00S 800T@qr @ -LMB@6P񟗓THTTTTTTTHTTTTTTTTTTTTTTTTTTT<$TTTTT<tTTTTTTT<t1 p1RDT10SD1@18B01$1@0S, upq' P0mp@q aQP@@ T0 SPO@@Fp q  (0\P$Ħ0 p-LMB@6P                  \              x              (        d pP@u2HP@UʰP2 R B@0`PP`VUP@UʒPL2  B?@0%2z2S P@@r@0`PP`VhUfP@U`P^ph\0P@~t0 u SR?P@09 ep0 s2  0 _0 S*P(Rph=Op0 s ph| |0S0S S00CS00S S p@,0RP phph-p阦@$# 0:S S@.S ?S  \SR R 0-0LP0CP@ Sf     0B0C2S=0 00 0 PE000霦 -<<LM0pSP0:S %S .S) ?S \S / `V $K00!c(PPDP`VPE $K@@!O(P (0S PW00P:g$40d -D0L<080`00 ,0b A0 phܦP$0(0$0 0b0c0A}phPl -0LSPp`@7  r000000S R000@00ӑ0 T00R00S@D 0S 0S uP0S000S&10T00S 0T S@D00XH\00SH00S800SSS00S0S r0000000S0SX000  $00S00S  -0LM0@SԀTpW.0000Sp頠`00CVP@tu 0 0S 0`0CVp鐦<@ -$LM0s0s@ !1 P@R00or00SnP`00CV)pP@u XWp q   Q0 P0  Z$`00CV<@ -LU0S, ,h0S000hV -PlpL† @20SX L0S<@0S0P鈧  -LM@P<0 鄧 p-LMP `@ (0K l0 0"T\;XPP (0 00 p  0-DPLP @囡T000  00p@-p`P@Q|0s 0S 0S tu' 0S$\!:00SP00S0Q 0S 0S tu 0S0S*Q踦p@-0S  0S 0R0S ^ 00S0S:@T 0S 0S 0R 0R@@ -LP@ M`, K00 p`PWY Z 0S0 S` M Z  0 S0 Sp`A , 0S? 0 S, @0 P`R @0P`, P,0S, 0S @0P,`00 ,  0S0S , @0 QP`R0QSW -LM\S\p`@0 :< P @0R_@00hï @ 00 0hï @ 0<K%0SP0PS @K 0P<K 0O<\ 0 <0 <\p00S0 0 T -LM@K=0s0s n0 c -Lr 0 0S0 h -LM@P  pP@umP@0pX W``0P@,0`(WP@  hpP@u|0`0VpP@u p u `VJpP@u @ -L,M@@K `Pr@K` ph200 <q8 r 08@ T<\  Q R`( 0@0C 0, K  `P @0 8 ` P @0puv R@0KD10S D@0dS0c S0 P @,0K4 K0,m@K,#0"0P00S`0P00S Q   H  4  , 00@z00CS0uH00So4, 00  @~@TH0Ħ -QLM@P` 0S!-P 1,0<R A0S* 0S!0S001 &뀁p0S  PP1Wp 0S  01A 0S 1 0S{  0K(0s$@tm K>0 ` PP` h P00 R00SH0  0K 0P  8 -L4MP@pß00K @KP  R0S `  D `VD r0s tu h20S R0S0S *tu $200@_0 K0tu 0S0S*100@_10!0S0S00 ?SRp00pWÏ0K D1t u  y0z 0 U T P @t u  U0T0 " 0 @0K@  Pl q0s  ,0S00S0K@0K0 K0@ K 0Tp@-`^@P  \\ 0S 0\ 0SP@Up^p 0000 0000 0000 -@LMTP oDl< gdah]8(P(h( -81LMXH @@ K|C@ [:nT0  @`Pp%0S0S 0 0?00`0  X 0S L0DS$0   i0P(p@ĦL -LM0$ KK 0 0 P$ - L_ P004 -LML0K Ap@T0[S00KT[4 -FML M7GNK, t7t@D @D0`PXX D';p 20@FS-,2222222222222222+2222@-22+222+2-2-.22222222222.`.t..2222.22.22.220$10122116 R5 :5 R0%<0uKA $P00Q0S Q0(8luKA $P00Q0S 4; 5p$5 k5 gtKA $?Q0S 08:$000N000;0@008`4 R$ = KJ p pGJ HL$ 0 Ps /P* P P $0004SP0;000@P P3 R3 aP3  080@0 P8  Pd3    P43    P3 R0"< P P070$H P P060$T 060$P 070$L 0 70T H L 008rKA %$P00Q0S  n0$000qKA $P00Q0S U0,0|qKA $P00Q0S l?0 0$qKA $P00Q0S )0001 `bVQ$B~KpGpG``\P  2P $0P W0-S x $)Ք'<(LDpdԋ@j\oj -L4M0 4 00[ ,0 ZP@K0@P@P 0L0AP 84 R 0@ D0  @ D t0H0 0D S ;0 oR04  0S00@ c8#8L0 T3 M 00CS0|S0 00 P@7D@000<60SC0S #0P #W00'0 (5L< C444 00 0hBD@0pxk(d2 R  4@ 0SZ ,K00D  PPJ }5D080 ` 1B< @K0 00!P@$ P 1 xX(q@ R xdN(`1 RH@4@0' -L M0@p00 0Sf XPP 0S nSW =P0`0@Q ܸP QIQG  0V0P . 0' Y0  0000V 0`0 ,Kn, ?R0S@p @vU0"Sl 0| Y000 LPH00D 0oSP e ===@>==@>@>@>@>@>@>@>@>@> >@>H>04 7($ R  $ <$ RT ?0 $R (  2 @bTQ04 DT0 XInK`F`F04 xPKt嬄0 s\ Q; Xp@/ ]KPEPE 0ao0 )NK @$4 Z A,0 S ,0   :p&X&]KPEPE, NP TU Yh0@P 4%D@Lp@  -LMp0R@ 0 P`0 BTTP$ "NKP0 p`  0 S P uT0@T@ T94T -OMLMB Ur  , u F ?K@KA [%0 B% 0UK 0 P.yTOKH H Q *W1(K R qP0`S @X0 @Pta 0PS@pPP01PQF % 5P P P 00P@00P0S P&&TK@ ?KRpW85PP 0, BQ40  P,廛DS8VȪ4(Qت < -GML M!0p,0  $KJ`J*K@_ ?K0 K@_0yptV  0SS?A pV`P$ZW0 ,0S ,^`l P-L@ p0 Sp p `P ?P P4  0@Sp0!R騫 -LlMȀ0@K pd$0 `0S" 0`CSP|R0@` @%PSPd % $0S $ $ -LtMpp, `PKY 0<< 0 @@UW U!dʶP; 0W0@ 0[?S. Y  KP Z0@ S @RT00T0ST00T0S\0 ,0S X,奚LU@U@F N ̫$ p-@LM}UX`D00CS0X0ӤX0 PpP x@00CS00Ӥ0 Pppu YUyUp  40$0!400   00!$!Ƞ ! -AML M , @t4D 4$ 0D@4 BBnKP4`F(K S LR 05S(P`PAĬ ?0@- |&>t0@Y.@P?/@@B@DRPN`,0 @`VP$@Z -@L MX &>opn00@X$`pZ p-LM&> @`@R NP PU$@p -LĠ[D 0Pp`W , qp  P .O00 -LĠ[D 0Pp`W,  ;"p  P(  O00sd -GMLM 0`p,0 CMK@D@D 0PX0 )K /oO~@0  pX `V@$p,0 S ,  -LMVO뜐0,0 so P 0  @lP@Q,0\ E0[S ,0 Q,00ZP`p,0  !dHd8 - 0 S[R䈍 -LM P@ ?0 1<00 ! 0! 0 QQ?  0 1<00@X0S o0S 0<?S 0S 0S0?S0S  M-LMPT00\,0 `00S S00\ ,0 !0SS:P% 0@0@ 0? <#! 00!  00 0? <#! 00g,0S 0@0 @   !0$0   pNpp -L KU̱ -`q00 L 0p0S2 @ PP#Uw 11>p M11>.QQ$ DM<J (pMX , 0-LM P R|@|K  0S@ GpX K@0TD  <K 0t|l p-MLM`@0 0 Pp* AK@@+0SP! T*AKAA 0r00000S  r\00000S 0S@\:<0 SpX|{-Q* rh000000S  r@00000S0S QQ:X p-PLMU`x x0d X 0@0:PP0P0p`t p-LM 0@Px0`0X0S 00 0 0卯@P @X p鄋 -0 SL0S S h0 hr7| -0LS S h h#| -LM0@S S C  h| -0L 븂 -QLM,  10S 1 0 RA000x,  00S Sp1I0S; `10S7T1,@<T@@@@ ! 0Pp`SO1 0p^UPP$X U`00Q` e Xp, hP PP `phP`0`@"H0 , ,0 0!0 0 000PD0Xl`4p,'j 0-LPnP z@Teb0h` p-LM`ኮP@P 0 SP UT0  IK!P00@  fpP -9LMܩ 000`fS0  eS gS )))000P@00GS񟗰uuuuuuuuuuxxxxxxxuuux`vlvvvHxxxvxxxvxvvxwwxxxxxxxxxxdx0w8wx@wPwxtwwxxwxwwxwvwxxwxxwxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxT u6 0 00 R5 5 5R95 ! 0 B 5E ,K0, R( P00R0S p AW\5 \EPD%00@%6 ,Kڮ0, R P00R0Sp44r44  44 4 D$4 4:$$000htt0 0 0% X4ZTT 0@4P<4N4:N830000E3 3<3   83 33/3)3 3$3"3 3330CP<3hP PP <b43 R$3P0@S@# 30(pp8P20 P2U0!0 `c CTPV20S* 0S00`F00  10hS"@0003@2 0T03 0 h1R0S040  008P \1 P !<|t!04@T<10SXFV00S0  VJP0P 0p `Fvp 0 `F0 5vpWǂ븂`l|X  DdH<$\Lh4t@p(,  hx@ 0X84 -LM@P pK" op P0Sʄ0   T p`p  00 0M Y -LM@chJ@- 0@R:T 0 S* 0R S R  :0 0b0000 00 0 ! -@L0P00  F T00 0D S0<PP4 0 0PS0h 8 4R00C0 R0   -LM@T- -LP p-0LM0Q 0R0SP  R*P`3S S S 08 PC+P@p頮H -PLM`bPP20StqH  P X20SC<<"0@S@00K 0` <@ @@ 00K@  0@@pK0 K\ , * 1@ <0R0 0S B S@ < lP@t1 Z00R00S H000 810S,10S 10SJq0S 00S0HG EGP0SXD@X00 R00SDX 0S0S0SL 0Y0 R00S <00SDG `Td@Lh8 -x2LM< P \20S``JH"`0P=020p R8K  01@P10pK0P@ 0 0=P10S 8PK(0S0 00S,0S P` Pq0僐Z410S V``V < 0R0! R00S8A RV3 00S/00S+V# p0SR 0 00R00SR C0 0R00\h0 : -00C0P(0,TL@ 0 -@L`P1T T0q4T0S` 0U  R00000ӑ00Q000 Q0 Q0a !00S  R<000ӑ0!0a00Q鐮tXH -LM@Ppt ttt00S$S 0,p 0 0`^S0p0C0$3t0 S 3 0S00 B B0 0 S 4P0@ *P00C0044   0RI r@200000S r2P000PU0_S ,S ^S $S =S -S :S /S 10S  R10000ӑ0.S 0`?QXZ, -P0Q010S$10S p, R X00b0CS0X40h0j`C f0Q0Q a01 p00S  Rh000ӑ0!0a0 Q4S鐮`PXXtXdLH -LM@0p@R`,@ *$R 4Sf 4S P`PR S Y7Kp20O00O4S  0 0 Sr400000S00S_S   P0S r4400000S0_S 0 S 0R r300000S0_S0 Sr300000S00S_S4SPk P bpW00cO0O4S @0 0 Sr200000S>00S_S:   P0S r200000S(0_S% 0S! 0R rH200000S0_S0 Sr 200000Sl00S_Sh  Us 0b00S10PcUj~pZ0O00O4SL @0 0 SrT100000SA00S_S=   P0S r000000S+0_S( 0S$ 0R  r000000S0_S0 Srh000000S00S_S@,@  0 S 0 b10PU,X -L8P ` -L⏃P b0@-@TP* ^ \00S.^ H0 0S \4000 ӑ^ 0@T:0ltX-\0Q 0\ a p-1LM0`S@PP10S U t0 CR 0R0 S 0@00X,?CP$10S U 0 CR 0R0 S 0@0;0!CPU 0 CR 0R0 S 0@0T!L@0 00CS0 ph0  0ph4p$\] -LM@P?`p!!pF@K 0PD\Thx` 1p1' 0`0 R0Y00 @b0Q T00S J0 R 0 R V @PG0P@S@0$&D`@\oK 0CP<P P| <0$\-PPL p 0<1 yDԶ8@qsttj -LM@lP T  Q q0@0  R\ cX -LM@P T  Q q0@0  R\ @X 0-LM0P00CSK @ 0$ ϓ0 R  00@{0D -L0H UxH -LM`PᆥP( @(K,pK 0  (0@Sy~  -L M0@p00 0Sf >PP 0S nSW =eP0`0@Q jP QIQG  0V0P . 0' Y0  0000V 0`0 ,K, ?R0S@p @;0"Sl 0 Y000 LPH00D 0oSP =PD  P40KPsC圃 -0,0K * K#pr ?0L:SlԨԨԨԨԨԨԨԨԨԨԨԨԨԨԨԨԨԨԨԨԨԨԨԨԨԨԨԨԨԨԨԨԨԨ4Ԩ ԨԨԨԨԨԨlԨԨԨԨԨԨȨԨԨ0000S  @@Kp| @ ?@k}2000,K +K.0Se D 00|!0`VQF `Fv  P壿Pp   0z`Fv P@ pNP IP DP  P@D0S  Dp\0l 0 a=#40K`J Xp@<DĸԸ8@tygpjooܸ@6KA B0Ck048\480   82X4"@ ,0<08@Tn p@` P- UU|4S|X@ 1 ,0S ,剁KAA y<P<8#4P   \ P%=0P$0S`7ꄋ -PLM808 4 $@, 奿 塿p븂<` P-L 0F,0, (匿$9 0up 4d -Pp@LP;`"pT@6 "P/@hhhhhhhhhhhhhhhPhhhhhhhhh4hhXhh`hp1`1 11111a Q@b/1`1 RQ |10sM P % @+P900]p p000X렾@D@hpk -43L$M `R@P#4TTP0-S  @P񟗩`hppx 2 @@KDKp  0@ < 8@ 4@ 0p ,@ @@APPDPn@0S_V V@ *0SR 20S@T:u1LP0S   RR 1 R001 pP%|1 R\!0S0  D50S0C00 52N6520 R }5uP` 0  @@PD0l ^ \L X@됷D ̾ؾ4`Lp -LMA%QC|@xx0  Q d\0S P 0R 0000G$@L -@6L M P0R@`,P 0 4P { 0gS 5@DT%U0-S 50 , K P5 RP |||%400@DTd5d%0Q4  S4  040 5 s 54 PppRp@I100 QPP ?103S ;10S4 R0S ,Q  0S ,0@ n0gS 144` R4@4P<$ 400\40SU V V L4U7V @ @4U00T00S 3 R3g.40@S (3 R 0k`4\k1 b0 0, K4 [0@-SBP,P@@L`tP (0P8PP@PPdl0 0@2 z|@T , KO4 0 @T  B@T t!00000@T  @T 00 $0 0w@T {$1 1w @T  w{@T ^cyyph0$ @T {|1m됷4pHȷprXp̺DH_{<DмؼL -PLM@0!P@- 0-S ,@P080hz0000 ꈱ-P000 R b0P P51:P13:4S<4<,!4$ <,0!$d.,0 00 0rS R0l008#8S ȷк 0-LM@0 S  0S 0S0S0SP 00 S 0 S |w00 K 0 (0 $0 0 rPDPU <}P , 000ipؿȷ -L$M şPpP5 d E0@00R0D DDD(DDDDDDD0DDDDDDDDDDDDDDD<TH4P @ +PU U ğ 000U000DS񟗽4\tHKLK`d 0D@ H @ <` 8` 4` 0` ,` {yP5L R-0S  *L) R R H0S U 00S0S 1#$0$0 0 00Sh |P 0H` =yP Z00U @ ᯐP <P Z0 1`V@ 0 P P 0 ( "# xNP P41 R 8  $00`Q U 0Sw0S s0 =000l\`\@TLDȷ̺pܿdJ  кjD̷l8 -LMPU@00S p SpBT  0ϒ005Q^` ^ T0 U   V CR 000Rh0 R \0R \ 0 S0 S 0-,@LP0S KP@0 0-LBMQ0 0C @S```````````````L````L (,x 0S d&q0R L  4F/K<W 4 -0`PL@ p 00B S0B a0BSWBA0BS7BR@P` `Q:0e0b``` -L@LM "00喾P 0;0qȷ -L M0 K@v 0RZ눱 -L`,MDKHKP@  0D @ ,@ <` 8P 4 0` ``PpmHP k`Pd   0ppPYH0p(V V@ *UL0T 0SQ 0@T:k`0U0U@@T P  0@ 8 DP < 0@ 4@ @@p) HPV {(V@*0S 0AT:jjP` 0  @@`pH0p8''0*S  r괾 0 -PL$M6 P- P$ P0 P0   @0@*0 R0 R00x0 R"`0 R"LLL@ H,0D@*DLT\`dnp@@-@T<0 1  0B0R \ p-LDMa0L@0  PRJ 0S ~ X KX@PT9 0S0N j0TS0@  b$H D[*(AQ   T*$0  B LR 00,KSB*00CS00  ä0 0S 8op dC0R PD;P0 R0080 R0"0X4 (@ 0-LM@0PS3 @K bD0TS  c@0PS  YLQH 0  0D0 R " ,0 R " 000\@0@ S)h<0S88),0(0$0004\@Xdht p-QLMP@" 0S S Ul0 R \0pht)0 @`n)p0phi) "48<#h@| p-LM@ `PR)T=  0K0ES0<)00CS<px/) R| Rttph&)lhd`\XTP(D@)  0-L\P@ "10Q0S aT0 R 0h(0 0h(0h(Q R R  00S "48<#800000S@<]  p-L,M` 0@@KR0 P !KT*00 R ^:00( 0S mp鬻( p-L$MPŸPb0 S @0x Rp 0S$r0 S ]mp"R 0tt!3d` T 8PK0  0 80 40 00 ,0 (0 $0 .0 S08 K70K o0 [R R/0[0S Q"[-K"48<#8 0 .K/0[0St,`dP0WP 00|.˺P ,κr`0A<ܲA 0-PLM @ @T T ,|峺t0 d0 RK 4PP .㗺P@  岺P@A@A -T0 ML\@4 <@$P , J@Aذ p-<4(LM<Q"4 L0`,$,!$#\@!P0T0Q00SA1T`U (!P`V ,JpU(UU $Ġ$ $< PD$Ƞ$$< @|| P@ P6$Ƞ $<X HP,$<< (P%DP`@ADP`l -p2LKM@PHK ,@ `Upp 0@CT@#V@PK^I \`D PP@PK00PW @0S <0S80S40Sx V$l1ROK RH[  <YP0,(!p1 ,0S ,k  0 S- ʀS S `V0 00S SpppS SpS Spppp@At|ذ -LM0@0CSlxhh0 Ah!h#A0@-d Q00XB.P@0L#"\ 00  P0S:00A0D -L(M 0K)"[["48<0#Q02K4 2[S2[S X Z4 0,,,!,@K P qZA <4(<"4(< p@*4@8 <#8   Pp p+[*[)@[(P['`[,0[p P@ P`00S W*00SW:2jd ( -0LS00S< 0S S h%Fh60 A-^𝔰1S00CS D           L T \ d l t 0 `R$0SDHLPTX, p-PLMP@a@A 800!S 0 0!S0 P0 ѭ 0 p@0S #P 0S0Sx0 席 R 0S l`P 4 @0 <0 pt<h  X, -pP0@P@TL`% 00000S 0T 0S0S\h!TH 0S 8@,<P@`Xdpt  00VԳ  00NԳl 00FԳ - 0 L30    - 0 L#0 00  - 0 L0 |T  -PL0M $ 0 0p0 0pS`! K$K3P 0S@! K$K3P 0S$0 1$0P_5P0 $ Q 0S$00aSP 0 0QPPW 00S  $000S $0b $0$0QR  0v$0Tc|  -CML M% P` , \ EK@A@%f3P`4 5{5 T`4 |5 t5 md d`50S y R<5 t 050Sp `4k4Pj 50S0 0R r40000S 0S0BKAAS0 0r40000S R0t4000ӑ00S0BKLLH40S : 040S 4$4Q T30Sc0 0S30S S0@04P0@00` 3P@~d43@\4XT30SD30S `43P 20S`4 `4 20S l 2@`4"2Q\20S@Xb0 v0Svh20Sr TR0@P0L3P0@00eENK@D, `4 0PX4S`42MHTUH 0SE 10S< `43P6 p10S T10S <14!41Q ^@10S@p0 0S00S `0@0K3P0@00P 0SEK@\4XLd$@0  ,0 Sh,g   XH l0  - 0 @ 0^ 08 l -AML0CMP00 , 04 4 0P004@@S`BK@ A@"1P 04SBK@ A@"1P 04S44 2庪4443PX2 4TpJ <20S2 0 R r20000S \!BK0LLS0  0 r1000 0S R01000ӑ00S044T d10S 44 44D10S 44 44V 44BKAAAV P44v""/K0 P 4463p 4SP44  RQ  0|@h0 XUa0 ,0S@,f|$  XHL8X` -LJ7@00CS00  ä0 }0S t00S h@h0hP`0Xp01P@`p`p0$0~  -ML M" P4 , 0 ʂK@ A@"0P 48 2巩2 48K t2@ l2@@@S#PP* H埻8 @4p R 2 k 20Sg KAA3P1 利[481PU 10S  BK@R@ r100000S0 R0t1000ӑ0 RBKA00AD10S t ,10S  Q10 S`0 pp0S00S @PpB1P0P0004 K0P@880@ ,0 Sd,ehx   XH lX0 S\` -LMHCD\ <<3|8#0 , 30So$0S 2 Ѩ֨`$2r20 \0庨2 峨ŸŸ"2媨2x2`l2P`2@ L0蔨<242@ 0 刨2 偨21@{ 0u10S !1lq10S !1_d1`X1@T10 |Kp1pqHh C\1AT1T \|00<60S(90@T Q '0@TP0 4,DhL$p0| dx l  8X ttlT` Hı  p-PLM@P`0S00P xP00 \P L0 D忧pV 0 峧p\`Tl -0L 0tx  - 0L0 0 `  -0L 0(  0-PLM@ !0S000.P 1 o~P ~P0 K1 喅\0 0 N |0 0T0 HPH@DX ?0S40 880> l\`  -0L ? 0d  -0L 3 0$  -0L ' 0<  -0L  0L   0-PLM@P\1 T NP@!0S000!P '~P  "~P0 T0PO @,0@0 @0S 00S 0Sh0带00`0@0 P\04@圦0 00 0`\`hDL  -0L 0l  -0L 0  0-PLM@(1 g%}P1  # }P K1 匄\ 0 F0 00 0S000hPt 0@S00000.,0 D0'0( S0000\p` |4 -PL M   KK,P 0S0 00 0P|@0}S t00S\0h0\P H0R@0 P,0  Pd d& -MLMp0P 0 00P0P 0 庥`7.P0 ZP ANK @D@DMP X0 \嚥P 80 V\ 0S( ap L -PLMd   KKW,P 0@S 8080 h(0 0>  -PL M0 , ,K0K0!2,P 00  1G1 00 1 0 84 Ͷ$ R0  0S 00;-0S 0S0@0S 0P0'-P0P000 1,P0`@4@hx     -PLM   KK+P 0| SKK+P 0\S T0T0 դD0 00S$0 (4<D d -P0LM0P01@0P1 嫤p 0\``P -P0 PP 00|S  -P ,Pp0  X0,0uP[U h[l l -PL$M0 , ,K0K!7+P ,0S ,K0K!.+P00 1C, 001 4  4@ 售P 400|S 4K,P 4\<,PP1 00@ <1 41 < $宵1p0S. ,00CW*Ww0a050K00`!50K4b0pS0@0S 0P000,P0P00h00S ,00CW<ߵ4@0 P,0 [h|    -ML Mq0$0 張`㸵PpP@P@@T㪵㧵|rPP 0S`Q/rP@Lq@BnK-0 K@`F4!0ӭ P+0 K0 10S A刣 O}X00 0 +0  TBK@PYV`Pt00Py@ $0S<$_hp  -L`M|q Px t `tKxK\!*t0x 0CSD1 <!81@0P+t0Svx0t00t0 x0Pt0SP p@K Oa{$`@x0 @t00t0 x0 `P \0| Vt0Sx0T  P0 0S< G_  8@LT`h` 0-L@0LDP0P 0000}S$0形P0dx | 0-LMMlPANK@D0@D0 HP DD @0唢 0S$0 ^0  -PLM   KKY)P 0S |0|0 jl0 0@PH00}S <0<0S 0_0$/ d4 -PLM   KK )P 0S |0|0 1l0 0PH00}S <0<0S 0&0$< dDp -PLMX   KK (P<800 (0  'x 4 -PLMX   KK (P<800 ڡ(0    -LMM(BNK@D0@DP+(0 U)0`P00V00S B.KQ B B 0BNKp0@D@DQ+a î`P00V00SBKA0A@)0KePP (0S(] -PLM   KKN(P 0d SKKE(P 0DS <0<0 V,0 0,P  0-0@0P 0 0RLP0d 0-0@0P 0 0RLP0d , 0-0@0P 0 0RLP0d<D -LM4@0S 0S6R 0-T@L0LPSH PF40,0P 00L,T P- L<80 Ѡ,0  +hT l` -L-800SL (0( 0S00DP T -PL M0 , ,K0K!'P00 1唠=00 "p4 tAt咠劽d14  40SDAL 4  0S$A0~vPj`4  0S 0PU @e]T0 P^P@s d p,040@ L0 P0R  0ax TT>  -0L 9 0   -0L - 0   -`VLt Pl@lph000000H0005V ,00h+  @-p0@S @ T00R00S0S `P0S  0SQ0ѷ  Q00R00SU000S 00  0-PLM  1A00堟 P KKr&P 0S 0 0償 0 00 P0 㳩0@0S 0 S  @姩@00D0HD y0 S , ,r0$ t p-LPlM@ `K01 R R; 0S8 0$S \S0S@+0^ 0R 1N 10 1<0K  R 0S`0K  0R@T 0S0 SR 0S0S0K Ac000S 0[S@ $S \S0S0$\( r$300000S 00S 0 S 000S1C0K 1SQ <0K`K ! 1R 00 1R@D0 S,S : ]S8 0\S- $S' rP200000S 00S 0 S 000S1C0K 1S <0K`K ! 1R 00 1R0S 0 0S,S ]S0SU @@T0 0 RK ]R \S0S0 R ]R0S2:0,Sq ]S@n) r000000S 00S 0 S 000S1C0K 1S <0K`K ! 1R 00 1R000S1000S(0(*pptX@ -$0L \00*0d$\  -0L  0l  -0L  0|  -TL P D00}S8080S00( P 0   d 0-0LMS0 lKZ|P@tPu @0 \ ,0幝0嬝0008 L -L MTr0$ S( D P8"$K(Ks$P $0S (0 2兝 2 10S1(0a 㷧0S1 0 1q1@0 P00E0X1 `1!!00 00T11 PU @!00CS00@Ӥ0@t0 S@  1 0U UP 00PUP00CS00@Ӥ0ت@ T tt 00CS0ɪ P0 R0@0TT  pp 0-PLM   KK#P 0S t0t0 d0 00%pP@0<u   P˜0@0%4 H -PLM   KKʚ#P 0Sp0p0 嫜 0%0sK0  -M( 0   嘜 0 %4T  0Re \d -LM00 @P  0 0hull -PLM0 ,  !,K0KH#P ,0S00 0Z0 8 $P0 P  0S 4K⋳pi `0 p吀@ 00 h04dP_4WS00080SOS%4 td8ld X -MML M<ğ P,   % OKAOKA$@"P4  S0X C4 㾗P@ 0X30X 4 3ۛ3 NKI I tt#1Tß5 01 PU  r@300000SP0QcL 0$S \S0? = r200000S@ 0 r2000!0S00@C4PE0CS 4At"0 fϥ4@iQ4 Z% P 4("  fὥ4 矨`000SP0S0q0#00p`1e1`CP 0S 10SX1TP1 1h10S ,A0H 010S 1U! 0ϔV BNK@D@D0!x1 @4 < 8  \ACKX1APA@4 PP4CKSAA4$ 84 1!0?2cS D40`4 KD4`$0RD4 D4HSD0`$0Sr` ,0 S,P(pPl8wd4<d  QP P-L`7 IKP@ 0pSP' +Q 00 %Q r00000D0S  r\00000D0S PP0pS@00g@Xp000000S00@ p0 00000S70@W0@ 20rP000000S00@r$000000S70@W0@X -LMl @Ik0SX  Bk0S<  ;k0S$ 0P 0h -LMP0  ۑ -PL 0   -P- L0  ,0 -$LYM0@,0 4p@` [K  p4Kl  0h d `A fRpP4"0L@KʝP ŝP $LK 0ờP#LK P0㪵L0[S LK 0@RPU u    3 p1Q,,d\xpAP#P3T N p10S S_K <P,^2 RP`آ* PP"0S U 0S S_K <ۯP`,3T P<P`@TV  1 p hcQ 90pt1 @{h]/KpA P J0S x ^?K P xA00p0dQS PPU H10S 08 0啒PPP | _?K,P00S p0\0 N0 ,0S,NH@̩Pl$t|  pkk$ kDldp -LMd@ 0 0CS00ä04((0 0 S ˣ04@  --p1pq0LS00`& TATH P8 4 ؍P  v*00CS00  ä0 qP@T0  ! @V*ڮ0 |.P0PST£p0( DxLL -LAM M8B>K0C0C0 +, * %@$ 団 p< 8 4 BK J4`J U0@S񟗾L{L{p{p{~DP 0utDPp 0Ppqu04S440S (D(g_$ U; #0SS5V4X24UV 4V00V00S30S#30S X X0Sp3|3 .X30 CR 0R0 S 0P0Xu3 00000S "01000C0W2 0BSpRdppW00X00S u2 00000SpW)0U0 U00S@$p0 @<2QP4@ 5dW(UpX-U848S1  8 V-0K`ZP4A PP210SS5V4Vڐ10StA0 CR 0R0 S 0P0"壭4$RB>K 0C c R+#$ښ8Q 00 S Y44044 1V 0  < 0 YR# 00S <$`0RR0F<,0 S x,L<b 0  Dx PdX\ XD0 -LM00 (@(0 B:ء0H -JML M0͟@,͟KK`$͟VSp=͟N_N=,p 0P@004 <P@0< 0 $ 4  Q 0-S<$TU< <@T $d t< p<RY`<` D D D D 4 wP`# <<0S $$<0SLP004Sơ4S 4S;㵡04 尡04 PL; 4 R`T0|S 㛡$0@D4  4S$ ㊡ *0S:`4 2i 4S  spd:IK4 4AAP4: S 0:$p]YV孜HE>K0C 0C)00P GD4S ?4 S9T 9Pz ̠PpI 0SG 凙P 備P=D9`0S 0CS0i` 4@90ȫpq `v  ,4S8P@80<HP 4TSd8P- 84 $R P& ٠֠4DS7@$P ȠŠ4TS7P 4S 4  4S  㪠d7 0S k0CShppS7/4 Pp``@VH70S> 60S 60S6&4S.ʸ4S 4S'4x6# 0C\0\00K.K 6 B B Ɵ0O4Sʸ4S 4S5MBNK4@D@D+$P`60S7 50S |50S/hşP*0S'450/P0S*,5#0 CR 0R004 00CS00ä04V(W0 S!|4 VOh4#0 CR 0R00`(4K.K3 B B0Od40S 30S 30S #4Sʸ4S4 S440@3 0 CR 0R00(<3P@ 0 CR 0R0 S 0`02P@ p` 30S2 20S 20S*x"4Sʸ4S4 S4P2#0 CR 0R002 00CS00ä01O40@ o40@ ]0 Sf1 +4$St1 4儚w&#4S2  .4DS0@ 10S$1 "@P߽004STG4 S0  4S4T 0S0S ,0 S,NIdX,lH,80L 8 l ( -LM00 (@(0 尌娩F04 -LMϟ@`0 _X0K, 0` 4` <` 0>Ο0Οp0 >Ο0p0 P` ՖPH H0S > 0RS ,0S X,00-S X>, P\Q<>@ U4>0S H0S , .0 80 R@0  D0 H0 S  L ѝP! =0S =0SNP00@0S@!<0S<(= p (=p.H@0@0 < X,dPS ,00|SO ,%P@/,@0S 0 S , @<< T00,0Tx  T,l T/0p0WL<0S 0 S,P<0S 0 S ;0S ,o , ,0S HQ;0S  ; ;RN<;PH -PH0S X 0S D fP 0S  $ ] YP@ 4 40S pW%,ɕP:00 h:p) ,00|S ^D ,s0 00S,x  *0S:`: ,e0 00S@:, gN80 00KYP0S;0 Y0 SIXBBP0`0 H`.0: S )0S009 H9@T 0DS0 0S 000㸧QppY90  6p@0 S pWPdUQLȟ80OP< 80S 80S4(T0S,T0S X0S%X07# 0C\0\003|7XK |ǟ0OT0ST0S X0ST7堧4077 L!P`PpÙʈ70S7 60S 60S/ƟP*0S'60/P0S*6#0 CR 0R00`6 00CS00ä046XVn0 Sw5 W W,`V 0S 0 %fPPU 0/p P@0S@0 fP,J80pS,5p05 080 VP00P0  V[5#0 CR 0R00|44XK 0O 50S l40S p40S X$T0ST0SX0 SX0$ğ@04  P`L0S 000@20 0 CR 0R007V v V 00 CR 0R0 S 0`0<3P@ 4p`P0S CP 勉|呉d30S2 20S 20S*"T0ST0SX0 SX02#0 CR 0R00P2 00CS00ä0$2T400@ h0 Spq1 000@ ,f/80 S1p 1p080@+<(D0SD #4zm@ RH0S R0S10S 8 d1Rp ߄00 0,K0 p{Kr: 0$, D0S`0d0D ߚl00S70 @ ՚<ҚlXd 0L X,84l`lx, P4 0@P@w@80S 00S08040S4l 0S0SJ@~<{ -LM0 S 01 `0, 1 a 0 S00SS  |0S$ `͟lP HP < r>#00= =0 >K 喨P [0S S0 L<0S$ L0S la < XޑP(:$:a?B1cSQ8 PUQ  U@ 'jKiKKgK qK mKo/K=KnOK@ PW1S_1S\1SY 8 ө!1 (,10$10 < ȟ4<K^ 4"<  0jKiKKgK fKeKKcKbK aK$K(_K,^K0]K4K8[KK ğpL0DS  p aPE1S00 0Sd >KoP@0S S >K  ]P >K ) PPLC P030 >K 9PxXC0r/K1 家P@SPQ ZOK3(`K0S S 220S3 20S/H3(KKoK\0P1 \ S_K <@@P{P 0iP R `2 0S82  <2D凅 QA Q^ ^ 8 0@X@B)0@0 0  $         $ ( , 04<8@@D  ! 1S0s`0a 0 \^$1  0S >K  yP> X@0P00  ,0 S,rA$ $d,pk|H`` gfffhpp hD}~Hk$Hklt -0L,MP؀0p0U$0 D @KD K `;@T厵00刵?[\H0K @H P<Ғ $0S $A$$ , -LM4 0S@0SA@ -L 0000 -|@0Lp0_T\" 0S0LbLr0 0S 0b(r@(2(R  Q ,BΆDQAφA@E0<1 <10@! @10D!D1t00lH1 H1`0L! L1P0P! P1@0T! T10X! X10\!\10 < 8 3 .0+11b0%b+! ++ Ε0S00 0H$ D,X  t -LM`@00CS00  ä0 埠, 0$00004@@ 0 -DL$M0D ,0 H 00 @ ۍP4@ 3#3Q040 3@T 30S 30S@@S0S;P 3at30S \3dVT3 0S44P(ҔPP74c0@H ,0 P@ ,'F00000 4D P`B000^Z, 82`D H0P4"0@0TP 20S @JP10S {Q0S 0@T4D PK Q0S1Pb0S0@T 4TD P T0S. +0A0S1PC0S 00<K0  <0 K៨P00S0  ?00S" 0,0S@0  X, X8 P @ 4XD'T@ 0-h0LM0 0PK!K0  U@T0{(0 T0D  -/L`PPU1 1UXU/0p0W Q0,@+aD.0PW0PdZ 9X0l000.Pp 0X0U.S100E 00EPEW  Lp -LBMAq0 S P 10S1  RAnK `F`F0X!P"0 0 cP0, Þ10U B>K 0C0$  0 K(4 0BK @@ 娧Pʰ00S0  HU 0K0 +JPP@00S 0S8 =@ PTD' -BMLM07,',70 $'$7$ H , -'P  0 S606+ 6PP6@P6vP6fP6І@6@@PP6 6@6@P@ 0S 劋PP t僋P \|PP HvPPP4060lP5  ՞&P 0S50U0S 50@T@從PP@ 0S FP AP <PP|Eᴝt5P 5  `5X 婝P U P e40NBS񟗕`ht$̿Կ4  4K#00#0H3=0 0 0 =l343 5,3 <3033 ᴊP#h3% '2 2\3 2L30 rH300000S 3U 3 ^3  l2 0"Hyp]2202 2l0 2H H \P Z)6P BNK@D@D+CT2@ D04SBH4 P 10H P4zP@ 1ڑ בH@1 0@$ D4 < 8 4D 0CKdAA A0QS R  1h1 ڟ0S 1 (FP@@T 㦑 壑@P txxhll P$pd `l8Ytj4 x$,@|pDX\0(P@ phT -L  p-LMmP0` 0S @0S 嘌00@P00000S T@0S |00$0 $ 005`p,  p-PLM 200CS00  ä0 ~10S A~AQ SWP P^ @0 SP00U1P`1t~0X!0CS00Ӥ0 PB p?0a0S Q00Np@ P 0S 00S0~0  00S 0S d00 CR 0R00  \0R TㄐL ph逐 xPp@-& @`QP 0R0S  0R 0S 0`S`PQ^ppp p-d d0LM\` X0X PPP0@T000pt p@-AaP0$S!S0S S001  00 h!h1!Qp0 S S8  S0S00 S0000 S S S "S \S0S 0 0S "S P00P p4 0S00 S000ptj0 -PLMp(M1@ 1QQ! a}0p2V*Q 0S 0S H0`2V:6 iYP@U@p`0` l P \<c}0< [}PEU$J0Lh -,0ML  0@}x.븂t -MLM , % 5 P@ " 0S N P:?C} |B^KPEPE0d%eTlWP5P&0S4.<RNK@D@DRP,KR5( K·.0P褟 P P  QC Pd ,TP T&TP .P@ TP  `4TP00c0S .P@ TP@i  TP0S0@S񟗻P %PZ5"P P tP L3YK0AAᨰP5?P %0SZ52YK0AAᐰP5?P{ 0SwZr20S} P PlPpp00 P  RqXr0So Lb11@P@U 5pP ` 2000 pX 0 P0 1"pO PpK 0S1 0 0D!!00!!00 00da11 @`QT $1p+ 0 S0TS 00@T1TGP PP6@P010{<00 ,0St,08t{4PTXpp\xTDx p-LM a00` p 0@ PS,P ppP"P@@\P0~ {p "P\P0r op P P P,P00Ppp8@0S 帅P 0S pD -LM @2@TP 000072P 0-0 L0C@R P2P 0 Q000 P0-L@ 0S Q 0PU*0:20PU:420h120 -L MS( 0$ S 33 P$K(K"$ 0BS (0 2z2 B0S22R(00S(0 2P 0Sp,P 0S (0PP@20S 202 z@ @2 @2 @1 @݄1 ք1P0S1@1P(0 z1d0S0`0XPV  㰄P@pl 㩄P@ 0T.S@DpP0@4!`zTp,, ,vP 10S11  V  `0 Iz R00 V   vP0@z `<h h d0t#|   PX,pL (4 -LM,Qp" ,   /K?KKP2  2S 2S&20S" *NK"__Kh,d&P Px202 O2X"L2WB 2  @22 2S& P`گP`V   0y1y|@KP!O|PKRʆP@|0[S@TB rP@2S |fP@ 2SX PY@TXQ $OP #W00S&p0P  堃0 0A` 0@P0 P夃P@P 0T,0 St,5 !PP8Ll` TP -`LMpP<0@T0y0 y 00@dP `QP !@T0P S00@@0 800P00  -AML83M4ß@0T,0 p0 3 0S 3@ SP @0S 0S 00@T@0SuP@ 0SBʅ00SP/S  0 S R?xDEiBnK`F`F+͂00S/S/00P+eÂ[PPR1X0Q  \ 00 1P0S 00pSh1h!0?2cS XL100$R 1PBNK0@D@DR000SX000.x |P PP@q@ OP0@0x0 ,0Sh,x4lx,dlly QPxx -MLMpp0 S( P`L Tq0SHHA0 @w֔BK@@$!2PP9 1$K R01000ӑa0CS'0t0w 0 \0ww(0 S4(3 H 0-0L0M0@PKS@,  0 㫭0S\@0S7 00UPۼ + 0l -LMp0 SԀ0@0P`P sP (KU(0`P R rp000000S`P T 0S8@, w pd$X -LTMa0qS!0PPPA[ 0r10000S@ Pr1000PU@p rP \1\v000 00200`KdKhK\0KX K T@KlK ], Fl0X T0 h0\P0 d0v.BL0 `0A BH0 0D @ 40 dpP X0S 0h v00P X 0SH@8v `u0pd ,X48x -MLMBNK0@D+p$0 岀ᒇ`ŀP ^KPEP@t0 K0/S |@ rP0S/S$0 S$2 0-LMH@0Ps0 KJp 0SPP0鈹wt@ -LM5@P00s*@ -LMH H0q,0 Fp6&6Kf60S |&Qp6\Ɵ  d@ ( A@ _P$ @T@dTd@K0 %50PCUڔ5 ra@ ş@ş`g0%p `P`Pp%5VF%T5UWPT  Ẃ@ ᷂5@` \ B0%@Pԗ0 04bQ c<" =9 B =<" $8 82 0 S0S*<#NK\<8" 0 T< 4020bS aD"  BD" @2 =9 =D@2 *gP@@&g/ ^m0 l%KHP;%.K@j3/C0ur Z@ W@`0#z N@ K@`t#o%K!jT3OK0ua2g 2crB70@3 #? 2cc#aw0S0S%NK/ :%PڄŸ0 S 0S* @ @" <2S @ @d"`&N !Ps1P@n%K l0 l%K ki1Po0uv ہ@ ؁@`0! ρ@ ́@`x!d1OK0uf2g2crEཁ0@แ8!?` 2cc,! G֖OK᪁Q 0H~sHP 00CS00  ä0 b(,0 S,0.A|8 Q4dų\ , -x3LMp 0@@,0 KH3H0b0P a  B=9 = 0 eP@e/ (l0 jK~ KP@/ S$P @K l~QP0吠KS0SLŸ HŸH2@K00 ~Y~/ ~/ j"ŸP@Y00 d!p\P 0SL0SI@K]/ #PBڜ R>1 P@@PR50S1:PG~P@ B~K k0 @Kk |jh 1@o0ef2f2c BDୀP ᪀0Ϡ#PE0l 2lADd`0 @ĕ@Kᘀ0 S00<@,0 Sh,/.A>P?d4X4|x8ų -LM0`V *0a0`YV@: H1 ےPUP@Ò`VA0S,0 :p0AT0s 0S :000CS00  ä0# ぺ ( P@| 0 @0 C\0\00g T,0p0S,0 `V  -L MD00 K4@p( P0 1[SP00@ht@  -0L M@K 0 K  ? -@4LH 0S 0SDH0a 0S6 0 (H00,H0gH0QbPH0  S00H0 0XbH0 0@X000<H Q0 0H0 H 0S 0S R0 0H 00H 00 0H00S UPS|H0QT{H 00H0P & 0D00 phl#t@8X  -L M00PH$c(0 04 SSpb  6#0WH 00840S<0S 0,Q Z5PH0 , < H@0S 0 0RpGH0dH0QPD:H0Q,H 00u80S 6"0 H0 8ᾇ80080H`! 680QڣOH0 8宇@@8@H0S d1 80 0S0`0808K 㐊H0SS 1 0R0040 070K080KC<3K0S0``0S3 W08#8#$0$$43[4#DHLy$H 0H0%@H 40880 8 (0S8(.$l# dLl@Tt p-L MX`0P#DHLC$H 0,H$0%0@@pt## -L~KM pGMpG`P@+@K H!@H0Kt6 xF 6U 0Me O 0 v>  08eO 0 v>  0`#eT)ei #l(<HTh H p- LM0Qq`P$0  &r$ 0 0 !r$0000  K@ $K $ R r(K0 (0 (  0p# -p`0LH@d0&PR60Sx6 pB6 6T0Sx &00 << U $(  h#Lt4Lc -ML M P, ß  < 0BS8@<K<0@pK@0 @G 00T`K0`T0 S" D 1 S@KHK0hPK0{h0 S X ( R $ R pzl` Pg '@H &PR 40S0@P 18SK001`18@4DH0 &0@冡< 40!1ZsNK@D0 @Do4 H08 6 64 1d1Z`P1\!sNK@D @D8T'H04 &0!J0 04 R8@Z ZK'P  0S '7` 0V' P7 {NK@D @D0h   T,0 S@, #%$ -LM( 0R@40 ,0 00  p, $P p0 X p4 , K 04 (pK0!=0 ( $0  `40`V0 ZE_0  _P t p,K l(, h0K d$0 `4K \4 X`4 S84 O`V@Z0a#4# -LM_0 @ 0$0 @ tp$`KP /E0 0 $0 k$4Q 0( S (K_(##,D -LM^0p 0H0 &f@ p $@ 壋PP(p  (K⟂P00P@@TP @(@ $K ; ([##$`lx -1L M0H`o6p0@S 6  }^P610=S 6p1S&P 0AW2PP@FFLFV6 1 Vo@ o0@o@@i61S2 @0@$S `S(o0T` : o@ o0@~o6@@ 0 坄# 0-T0P0LH@60S 6e&016P1S060#-00S ^0 0-S_0 000S0 0 p-0LM0 S@PTl`d0P@عpT 0s 巹崹˒00pp#T$  -LM⁁@P4 8 0a 4 8`@U> >> > > > > > > > > >L>>>L> >>>>>>>>>>>> >>>>>>>>>>>>L> > >> > >>> >>>>>> >>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>^@Th00pW 0< 084p000$Hl( -LMP@T. p, .T`% .V00.R0SV t0000PtX0000P-T_T _TW$opV @X 0-LM@P@ .R r0\00000S0S0 S0 S K*6PP 0X -PLMpQi@0T1* Rr000000S  0RQ 0 pP`F0'S"S $S `S \S`F\000`F0@0T:V00XmX p-L M`Pᧈp P 1呂p 0@<坷嚷嗷宐ᬐ PK0  ` 1KŅp@0DST 0 7p #$  -1L M0!H0 Fy <00  0< P1<  0041   001 1K/ P!1`P ̌0\000p``| 000 000 h09P@ ,PK 0s ? lD0P#X$ (# -LMp@ d9P@ K r 40R ,pl , -LMb0PH0 pK F  @@%P񟗊FGGGGGGGGXGGGEFFFFG8GLGGGGGGExFGdGG G,GF8p,TZ0 ᔔ -2LM@pT @pT5P` @TP 1 0R 00 !00@0c|!S0"c1QP@T Q  D1RT0S000000@T^ p 0#S 0SUU@T P0  0Q0  d0RT0SL00S@PT,0 #H#l# TZh -AMLMPzK @(pGK0C 0C1 BS 1Sf @T0 ,0S,  P0-H0@0 80840400,0 #<#@### -0 0CS00LӤ0` ^00# P 0 000t0 00p PPQ8 00C 0000P#@#< p-LM@T1PL1`P p001 0000S#Q"Q0P0`pQ q0 00000S-Q0P0`pQqt0 00000S T0PL0`p408 P,0`(0 00p@<X##T 0-PL0@S| p0 h0R`0 X0 T00040 ,0 T(0 000L#HD###T -LM℠0SxpxxPx`0 0 Z@^L0 D0 @Y(000L##DH##T -LM@p P p-LM@`Ppp UP\PP "P H0D0@T80T0s@D0   0p XT -pL`P@xP000PP px0000D0SX0 L0@T<0T49@D0  0XXP,T -pLPBo@P -P_P p0 00000Sk0 pt0 000D\0Q`T0@TH0T@@D0  , 0h XXP 4T( -LM$@" 0bcP | --LM @0| 7Mxp 00S \M^T eH a<00S ,,Q$nH4 4h<8 --Ll i0T TMLD h0D080S ^$ 1 -44 h< --Ll C0T TLLD B0D080S ]$   44 h< --Ll 0T TLLD 0D080S ]$  44 h< -L`@P pR %R0mSP0L rp` PD"@`PT@D ń R00鄋 --L@ 0C<0 ;/P@XG4P@`<?TD!0@@0 (/P@4! P@-T2!0D0 P@"T'!0H0 :P@P@T!0L0 :P@ hP@ L;TT `0P0 0` 4` ;P@ <@E0L!!!?!C!c,B^ B^DHL@PP 010000012c12c1 C @00012c12c1 C @ $ l< h     !p 0-LPdP@4 0S0 P0,! p-RLMP@` 0S(0 >h000pK0C0C`#8 ld8! SD5;<#iKA Act(d8!M@S:rtP cP t( JKA Exd(0@R:q|xP cPT x( ,KA A&|(d8@S:r|Pp cPpz |(PゎKd8H@ HS( l;KA A01(81(Rd8@ST:rV`c0P1(M (PUڈ< 8  P(1S>K0CPU!d8PS*g 0 ( hX d8 [P@t KA kKA A e{4 0 ,0S ,! 4,!! " 1 P-L`( 1ȁ 0@Qd 01 00#PVq` Qxh!0 !PTP Q@ 0O  Q0 Q@L00IP 0@0CS0@0 0P 00CS0p@0 0P< 0R#### 0"LX\H" -LMPPpC 0@ S 0 S`ev 0S쀟쐟0 bPP Pi `0$0O` `$P @00eP(bP C `"###p"H"\ 0-DP@L,000 @@0 0 0 0&L%d0 S- L 0S S 0SP S  #" p-xQxALM00P06T1 P!QP3VU00GUX $ 0nS` lS0 P 0 R0 ,000gPc `0pS`0  qX QX} 0qD=0  00Sn _Pph L= R|QP=- PT 0nS` ElS0? P 0 R03N0S!\  =\0S \>TTTWU 0d HP0P > R > RqXG ?;`0pS`0+? `|? R$! 0nS` lS0 P 0 R0u|?`0pS`0? ? NPD010CS0 0nS` !lS0 P 0 R000  Q0 P|`0pS`0< pP0000  <%X%pL%x&% -`0` LRTLL0<SS,0 0Qڄ04%0%X%"L% -LMܠPp@* W* 0 0S@@T0TbW`BPP l0 R   0#P 0#T 0EE@&L%&D% -LLM0 R8Ÿ" 0 q00  R 0  R1 A0 Sd KP& 0!S] 0SWʬaQQڌ 0  Q @0 0 0 S 0  {P,q$Q0L00YP 0@0CS0@0 $0900CS0@0 0`00P @@0@}<%X%LX\&8% -6LM PR,P l,K6\@Pp P,0 Q@i0! ( P0 S 0 !R %R  Qd 00P0\ST 0 R Rʤ5 N5 P %Q00!Q`uTş0 R`l00P 0 0CS`0e0 |80A9"00CS0D0e!0 0 Pdt Q`l000tP 0$0C`$S0d0 =|00S? h@)>3 , Q@p,  0 0,0P0Cs,0 0 00@b\s Q`l0002P 0#0C` #S0 c0,0T5 2`V0 0 P-ꈂ Vp|000P 0@"0Cp8"S08r0 08l00CS0HPI 0SF q0 Qʠ0 0@T*0 0P T:0@00Pa Q@L000P 0!0C@!S0A0 x40=800CS0u`匐0 QP\00P 0T0CSP0PP0z Lw0P&<%&8%T%LX\dH&# -鼁LMⴑ崡`0SU !@PO 0 SdP? pqP0002@T V T (1 BR A0 0 [ P`00CS0@000.S0 S&P 0 S R@ 0 P0`00&,%@%<%L(%X -43L M0 00,  R W,T P@` ;PpX آ 0S2L0@` T QڐR2 Q@L000P] 0P"0C@H"S0@0@ DR0 <@0 0@CLX p-0LAM 0 @R) 0` DP!\ > 0 Px@P 9PGOK '6H  ,0 $e`XL%&l&& -80L R (@ 0! a=~>`X% p-L M@ΟdP0@D`P K`<P 2[![SC$0BR0`pXht@pt -`0LM @R 0D!S 50S/$^5PPd& -L P> P4 000 S/ S- @PP pP `0S JP@` @@ sP|0p p0HQn@83T>},@P0$ <%lؿ'\'# -LMq@P0S S  [Rb \RZ 0S  S0匡Pc Q| gH `1 @ RD1 0o(0 Q`l008P 0`0CS0`0 0200CS0@000 SH@P@(<%D%LX\'0' ^R ]R 0]S S [S  0]S S]R.Q =Q:Q R]R 0 S 0R]S -PLMPP0`@p T/ 7P* 0 S0 S00 10BS gR  00 Pp00 PP 0P0 P <%%& -SLM p 0%S 0 R ࢟ Qx0  P0 pg \PG 0 R Q0"plR Q@L000IP 0,"0C@$"S0B0 0100CS0A000 R0 pt1 RlA8P X1 0R S 0`00P 0S0BpG0` Q@L000P 0 B0R@ q@0k ho0x1lY00CS0@8h0SL(@00Pi0F<%&&&LX\@%,%% -2L M0r0l^L@4 , 0 000 00,qP`0 0bZ4 @R  P8(PnP!0@00`T@T# U T00CS0@0 4 @ 4 0 zPP00CS0D@0 00%X%&&L&X -LM " P2 P@" " q ğ0S   ?K]PW"R 20R2 84bPU$0S4 E"0S \ 2 1    ?K.P 3 `d 0Q,V,K 0S 2Pß0SH# E030 E\ 0 0%rŸ0 QP\00P 0"0CP"S0R0 W00P00CS00B0 B0 0o࡟0 Up|00PP 0!0Cp!S0Uq0O L0/X00CS0$b"P U" 0S  0E0 K9P0x 0uꬠ0 Up|000P 0d 0Cp\ S0Xp0 0" 0MD%&&h<L'LX\ -L MH0 @\, P40 p( 0&S \S~ 4@TM0 P0p 0cS3 Q 00c Q@L000P 0t#0C@d#S0\C0 n*03/(00CS0C0W0Ȃ T`l000lP 0"0C`"S0xb0 30.<00CS0 00S|9Sz400CSv02 @`1 d Q Tq, 0@TPgꔡ Q000P 0\!0CL!S0D0 0.00CS0x0 `@0 dQ T2, 0@TP(꘠ Q000P 0` 0CP S0H0 e0 &&&&LX\ -LMؐԀdP`01 ^, p@PP@ @q0@0 A0@0,A0 003.(`@@\ -LM"0 s8 < 0s BВ0S2  @0T00@D ڄ0r 0Sl)*(+(+00 00 0 T0@D0#0 N @0?T@Dڄ0qa4PK0 d 1 0C 0 d 1 0C @D /\ `Fʀ1 R!PX D0 80!0C,!,<S0(A0000 00 0@D0 00 00 00  00 00 N0G&L%L(%@%Xh' -`L0 0Cs0 p001 R 0p 0Cs0d0d 00T T00@PT P0@ZT&L% -LM@`^먃0#sP 1 0#^{pP H0@*SH-h.h.h..h.h.h..h.$.h.h.h.h.h.h.h.h.h.h.h.h.h.h.h.h.h.h.h.0.h.h.@.h.h.h.h.h.h.\.h.p.  0 1 "P00Pp2A00X2PH2D2 @bTaz("0S "0S n ! 0 g!0S ZY Z1 :x1@D6xQq+. PP*10S0E= 0 0!K1pp-0S?T%w  r!0S 0S  BK1: S 0S 0S BKmZx0: S.  0 0 `aOf H[O <i4'' 'x'''@'''D'( -LM/@P 0SP :0/S P:0/S @P:0/S@P:0/S  -0L|Md$ }P  00 ~PP 30CS02D2 2D2D2 2D2D2 200 # i|i00S3 3S0S$   ` .P$ $ ` 0 pi/S @ 0T/S/0000a`0 SJi Y`KDp 3S @0 Sm 0: S 0: S  0: S9 ( S  S QP00{L2 R QPq Q2 R Q S  S S-mQT1 R1 R 0S 0: SA C00XD!h8FP40h J 0S h@ 00 0: S ~0: S0 R0S @0)j@P!3S0@0l0Sq}<]h<6\d<(D8(''l(('\0# R00R\R0  QQQRQ -LpM@ Z7p` T@B0S2 R! BpD""00CS00Ӥ0 PpP PB00CS00Ӥ0s PpyUYUi  &7pPpZ (@ T ڥip00T0S ~pT>W6 1 R,0  !0S SSPH4bpKUVP  0R1 !ᷩP Jp PRR9p|4RR//x@垚0Sa  (D,$' '(D&''' -LMMpA^K PE0PE` @ 0 DBp 0T0 jPxph,HP\0P 0 S @ %@(֙(D('(( -QLM@l <0S\THx0S@4 40 0Rh.꫙0D((' -QLM@p 0S`X H80S@4 40 0Rhꃙ0D()' p-LM0AP: #:0$ h?`L3c0(  ,0D?B3c 0BP@BV;  zP G0S N@0<0V$ ᭨P @@10V0 LP '0-S xl.@pL0S LDC41h ;Q @&MbD))() -L 8DP0 R  D4) 0-,@,PL $   븂@)) -ML,MH:D:K@(L8:L , @0 pgS0K*K`ZKLHH 000ܙؙ*P0 K0L 0 0uS0nS0 0 0JK(@D@Dp*P d*PT7K@ @JK(@D@DP zK0(pG(KpG 06P@ ?hZKK0T(PE(LPEL #% *016P@0C0*K( B BS1`@ 10DESAAAAAAAAACCCCCCCCCCCCCCCCCCCCBCCCCCCCCCCCCCCCCCCAA@BPBCXB`BCCCCBCBBCCCCpCCCK@ @"*0 D$epJKW(@D@D :KH00Sb JKL Z&P&N|K@ @) KH KƟ@0 0 0 > 6,6BK@@+) P#%^*,6 (UKJKL(@DL@D0.S 0.  0 l b)00d5   %%000`%`5up@.D50Xa4(K0SjK(`F5`FZ 40XS4̔ 0X0Q000 0S`JP$0s@400 xPd pKlp$L003P0C SW EXFXF4FXFH4FXFXFPE30S d {0S50-S 0S0Z0S000C.Ę:K(0C0CP KAAA)P NK@DK@DLL`#0)A P *@ኵP@00: SP Wp vd@00: S S0S2"2P 0B0S 20SP RdhZ+D20S BK@X+@( 0BK@S@ +P10SO1dGNK@D!@D0@@ P! !%*xA0S ڌ10SL10S _ 0@BK1PAKx AH0 P P 10S0S00SޖP 0S]Wpp yP`\00S \P+T+4)4`644<44D5L+8+\+,5<+H+D5*@d5@+5X+5$54444`h\4x44 JI4 - Lc5 -LMK 㛴P @0S  [0R 0[S 0S) -MLMh% dR pK9K, $ ,> m2P@50S"ӕğ0S :P 40SK KP 40SAcgN[K0+K(PE`0PE,0BK` 0T  P 40SIN `V  K,0PS +'3`30S`G30S = K(AAP3t(K0 : SKR SGPN@ 1P`20SOK  0v _dP 20S:IK(@D@D9K) 4P Uʥ?Y00S 420S 0SD  ,b0SKK(@D @DK 0P Y10Sb0S1 R 1(K0SKh1 (0,  0$  Y9K$Y v MP Y00SϔY$10S (K0SK(K(00)K 00S +K( B0 0C00(K B0  K4Y00S ,0 SP,X+<+L+606P+@+\+xP68+\6 p-PLM`P@S L10SO@10SK410S o 0@Σop00 0uP K0SS0;0ᵣPILQ P@00S$, p0Ϡ/ (@@#bCl(K( $ @  />P,&p@+\+X+ l6x66P+Mb6 0-@LP8P!  PD|00CS00Ӥ0) Pp@ 0@ 0CS00Ӥ0) PpyT0( -pLQ  ፕP@ XP0@S &P`PD1SQ6| -Lp@`PU 0 %0f0@L%0Sr00a000 %Pr0000D066 -L$MB0, S`20S||ix0, P P2c 0S 0 S0 00000 尒0<0 <0  P0K %m/ 30 %P% @0 ?@%0 0 ,,P@0K040 pr0 0@<0@ 0@0S(R&SŤˬ0000P%T P@}%0 0P@ @0p1Y@4'<+646 77'$','<7\7 M-LM01, 0p`S  o00S PD% P@ <%0 ,0 txp `0pS  0S P@P@0 ,0oqY@\+7X+7T+7 - 0LM@ ^븂7 -`QLMY0rSwS ?RPPU XY00G 4P@@ 1,PP10PP4PPPPPPDP 0p000wS  @0P` ?H0090%`0wS  0  P  0 @X@H@L@P@T@ 8 -PLM@Pp`(0S 00wS` rS`U |0 0 0l000d0000  ]VJ`JT@H@P@L@ -LM 0K# `P p-LMD0@S PH`U P)>P0 D0 ` 0C00  p 0-LP@@0D0HL0 -RLMP` @10@P]T@TSQT1Tq 00 @0D00@Dt p000 V@O@0P00 V4|p V00 0P00 lpX  ec8 000DP  O0 0*H@L@ -L Mp@  T,KPt $+K*K < ^' K)K&K%0K(K  ^  $ K` 0# KT, K< 080  4@ %0000 T  <KM0 0 pS L@(8 -LMD0PSp NRL @T @H@)FP0D0@ P`.  gsp0P  00P  00$ 000 P@D`  L`VD0S0S$@  g<0 cP@L@ȠR0@-,ȠP @ 0"\LL ^NNQ0RPBu 0PEu |2\x2LL7&c2c0T2RCV]EH0PE0 0  0  0  0   0   0   0  P @l1'7c2Tb"U cbUI U30 0  0  0  0   0   0  0  PE U @PEu 0PEu 00'7cb2" cb0q[ -`PL p@#.0(Ã$H7c"( 2'H@`c\@^B^BN00QA>AAQAAq 0S 000  b0 QŒ00 , P080!Q,000S*8' -0L0S8' p-QLMP@`p00SV@+00$0!0$D"0$0!0$D"0$0!0$D"0$0!0$D"0$0!0$D"0$0!0$D"0$0!0$D"0$01`FV$D#V 0 0$01`V$D#p8'Q  0 " p-LM`P@@Tp -`PLCM p4 7 0 (1 0JK1 R0ڨKKK 0SK p ?@`PK  R p ?@`P4!' P@-P $ RS΂@ 0p`809 PL0  (,08<lPP- $P Q <01 Q0C 80<<ࠓ80 p-RLM@` @0S01RPPU pPp(0 PS00P(0,0S00,0| (PpVF20`f$00FPS0,0$0p040$`phꬅ0%0 0X00L0 0T00P0 * 2 -$@L40pS` $P0 (P4(Q$ 02(0,00( `cV:4b3(0,0000004PcUP!f 3`V 4f 2(00` 00( 0S00,00`S*0,0 -PL,M4 8 ] $`VZ 0SW 0S0SQ0 S 00440@  < 8 0JpWh: 0 Q7h威pG:hQ D*00 0Rh S.0L T0l pl0T/ PP0L 0Lh 94 094 000`0  h0S*T0 #L B ,K t1+[0SZ0Jp[PW*Z 0JpW:+0[h pc8 VP0W*Z  0JpW:h +0[Rpc8 00P(pG*P0W*Z  0JpW:+0[8pc0P⨁pG0W*Z  0JpW:+0[8pc0 P⨃pGh` 0S|PEu PE0u h ` h0Sw:0S+ S 0l@LT0l` T/^p0PPL Gl0`P00X0d 0XpPP0L 0 64  03T 02L0C0,@K 0+0[SZ0Jp/,0[S ,000 /[0 [0 20C"[0L3  0/ [+0[0SZ0Jppb82[+ [@0,0[pbS80  0@54 00H000HQ W*Z 0JpW:01@ 0C0 @ pa800X 02P0C0,@K Y0+0[SZ0Jp,0[,000 /[0 [0 20C"[0P3  <0/ [+0[0SZ0Jppb8,0[+ [@pb8&2[ D0,0[ 0H0HQ W*Z 0JpW:01D 0C0 D pa8H,0@D 00lR0034 0f@Qt H D0PaS<@P c 0 PeU(0@Pb40e0eU P@@0UP!0ee@0@ 0<PU0< @0S @ RK @0< B0< @ 030S4 WZ< 0JpW4H@ l0@H 0Q00 < H0c 48(4<,(<4 <@SH  14 000p00 L 0L0 <4@(08SR :%<,0RP0 e0e 0L P0l0W0e0l0 $0 4#-4p$`0% -L|Mp t x0 p0pLK W R *t0  0 Z00: LK00SP Y!Q | x ,@K0P00@0,0K0 2K+PK-x0 00-P|00SP| |pY100pcQWWQڀ p0R0P0SKKplK 0p Wj0K Z*t 00S 0 000峠 Z:p\ \   T#T3̠ 0 @@  9x0 p [S\!`0|p  0 0 l0 Q0+K,0KK `0,0KպKځ 0,0K0 "K0 | BPPd06 ,K ,U G0B @T0DLK `0`0C`0 W< 00t 0p W0^ \ l0 R|00  *00cQ0 R:p [QR! C x0  00 0bC10@0 V,0K+K"K# \ 0S x  p +K06  ,K |, G0B @T0D```Vx010 041t33 8 0`3 -L -L4M@P&v0oS000 gR   0尖mS000 0fR   `X0 T0 P H p&epH0@ 0S񟗇tЌЌЌЌЌЌЌЌЌЌЌЌЌЌЌЌЌЌЌЌЌЌЌЌЌЌЌЌЌЌЌЌЌЌ```H  P 0SB 8 1 -R1 0@cTQ6H0SL P R/V``X00L` L0 @T 0 000CS[00,K 06T@S0S0 t,0 R0 X@ 4@ PL gPP `hP@ 30C SD\\\\\\܊܊H RI 0S 0S @ R4 @4 L00L0@8 L00L0@ L 0P D `0S @0SD UP Z 0S0SPQ TX 1P ZTX >@0<x6 i  l`aS0S  <`US0SP 0!R0걁0Ss S4K8 K0K0P0 #80@ 080 Y`V+ `000CS,K@ {P@0S ,0 R D@ @ = P 8@ Rx"00`6P< @@ +0S :@P` _X 2T .wP@ 'pT IX 0S0S0L04]@H8V4d+h+l+`+\9@l9\909 -LM0@Sp JdP`^0   K/ R W089 -L M0@S v>^ 0 K  R 079 -t0LPd0 R X0XP PP00L @0( 4P000(h+`+`9d+:H(: p-LM` `P0@0@\  0S 0S 0S p2 -LM"00Qp,0 w$Ps_`0@0 P`O 4d[$K4!04  PN \P4 T勏K` )0S0 0 (P  !0S0 R0 0  0@ f) 000'P0S d0 ,0S \,q0S 0QO0211?|( -l2LM 40pF ;;S0SQR0SJ R, 0,0  0++PR- 0\ )0S(dP! ?;?00clcQ/\ 0 8',0 X0000000S0S0.P@0S0 & 0 X@0@@@080   0 0S}z02(0@-@ 0!?;?0c\<`?* Q< R:8\0P0S000 0SP P Q!0/S0S*U 00SS 0 S /S R0S00,21  -MLMp0P@AnK 0 `F`F CR 0%U0 U 0S l 9@!0S D 08: S0  (,2((( -L@!x^0hFSP7 !0Q0 0 : SWFH` dQ0 R TQ 0S 00g0hxX!P h$ QXP 4h2((1(M1)( )$) -LCM0`,$0 (@nA/ K0 0R00P00 P0eS&0eJ/K0P 0 0p 0S0  0A? K   , 'U 0SD0 R0 0  $0 S $t1X11,) 0-(P, L@ =#P  $0 0 S0 0001X1 -LCM Ml$E~KpGpG 0,           `$ \$ ` 4* R@ R  d$ 0S3 R 0 P, 0S \~뤃0SZ3 (K 3P\4 4 XT @T40 @TP C0@: S< 0,e P,0 S ,3 2@.PP 2 P2R( K"\$ XD @A08"X2 R0S @lBNK@D@D~ P@6 qd4 S00C0 {y !0@00e 000p?y `k 0000S ]P0$,}s '0SPY 0 PQ 0 QP@ d0SE }B< @0S: ,P7PD (4)1M1|*2L)x))))22)d)*(*h<P*h*p*@) -T0L8M<0 0  8 @ 4 0K0 , ( $   H@Kd -CML M☡0PP,0  1Q  0P1#\Q:,0 S @,EKI I0 0`$ @( K@X d 8 \ `0@0 BNK@D@D 0#P  @00@$;D+t,2* -0#LM0$,0 P`P 0 x Pp@(0S  0 2 ,0S ,`8 "P4 42((0,00h0O0 82 008"Č Rh  0P1OP5~:\z:00/0SIOK,%%040#0PS<,% 00L0TO:0082 S0,  0P1OP57:\3:000PS $01 R 8|@@`P0, P( ,P0h0QO 400Lh08'"i 85@0 L0P $0 0L T: 85@0 L0~02?*1** 0)-Lg1!1Q@@ px`0(40PS $ 04L0T;:0000eW+ A 00CS00 0S 0`00D`0` 000`0 ``< =$0 4L T:10222 -@LMT x00C0h@-p0\ ` L00n^@` 4K0CB4  0D0 04 01@DpPÏPoD \ 0 ?00S00X W 0t/1E $$pWR`P1 ,0S ,] 0 P  `0S@zP1)O  0 Ppz@0 `( B0B!Ohz0pt00 S 0l X 08  [D@ 0(@_R:0S:P h0S02`+h+++2 -MLM0lC\\#, 4 @(  P@[,4(0 B04(  3<  400T` t00\F" $p`"0t/AV#1%Y X @0 0 < \2R_ Q01 D@!T  `,0V04 @@T Q?>1 D@!T 0 T0 0̀0P( X (0KP L H D @ < 8 4 0 , pC뜠0 0P,0`U0@T UP@XKP 0 T `,0V00o02241 2+ -LM0 0,0 0p:40  6 6< 00`<0 @0R)0S&6 RtF p 0d 0gP 46 ,0S <,0 ,   t4 0S R1 < 8 0 B ?] `PP@404 S S` Q V@1(@Q0 T `FV@ 0%0tPP`@T1X@QzTP $0000 00SW4 Q4  A 4 4" 4  R 0s 0 p00t 00pPd4d$00i4 00$4040$0h Rf   #0S q 0p$0h0fPR <0 00x3t3   㳳P 3 l hP3 R! Ht2 R4 3 R <0 R 0SR;Sh0S)|0<(œ R:0S:\4h0S1<  0@#? S`& @CT`0t0@DT `4"80d a( Ÿ.}P^1 R  p (h0<0 0<  0 0Ps,1 R 0tslP  0p4< <0/410r($0 aP X [P0S 0S 4 hP P0  } D _K j 02212|0,HA\101 22X11x+|+00X8101 1$11D1TA<1T1111|A4 -LM@P.Ppe`VWY!?> DR.000 0. $0`F0V$0@\ P0 S00*ㅲP ,@ R0 0  0R 0S R0R0S RP  0 R pPd ]\0 S00Hō<<? 215|+t2T111111Bx+14 -80LM, ,0  @zP02+A -1L8M1q1!00( T (0KX P L H D @ < 8 4 0 , ,0@Q 0PU `TP@  @0U ,0X00P @0P@ XK0S S T1+02+2 -LM`VPڴp崀.@PT 0S  0T @T R 0S `FVP 0  0P 00+t25 -LM$$ @0 @P++A -LM88 00 @0Sh++A -MLMTTE0,0   BR$4 8P % P80  4EKI I4Y0ğğ q`$aA4( Kpp$p4pğV`$ 0d *MKJ J0P000Ss`V:ğ $`0V0 *D0P00\'`V:ß0 q`S00*PP V:MP,0 S |,M0S 0 P00S 0 S s S $#P # 2  00C0 "P  000 00C0  SV;;S T"9(K00MKA@AKK@ $@0 \4  X$ iBNK @D@D0>1 R" 0̠  A0S0?0?00 R=P0 @`n0̠ L8{ 8I  0 0` PPR PP 0:0 ) g 2h22H12++ T2222d2DM1A)1)(B2412)102L2 -ML08M (8Rp, (`  Q 8 Q753 575$\C0S !P W0 41 R77 (K(K  (K0AO0KKl,0S`7(K (K ( K(K0 00RP^^x>KMK rP$ $\0S#  R0.S $0&$00\ &"F 00CS񟗍<xx$0SX ,0 S ,,Ŵ00  & Y05 R E0 S %G 00P%00C0 @0S$ $\NK @D@D0@S^K PE0$0%B5 R lP $\00$0S0 R$ 4 R4 R$ hP 0: S0   4$00^$\OR$ 0.SH00P[S0 41 R33 (K(K  (K0AO0KK,0S<3(K (K ( K(K0$00\P000 Q0hNK0ᴀ$00$02  0`0C0 @@\+0SP $00$0P l"00C0x"f>KMK 6P8"V4v00@P \ P !?^0l!00S 0S ,0D0P>KMK Pe|$00$0 1  0`0C0 崀t$/v@WP_ %l0S 0x0 P\0 R\ 0SY <00M0 1,2X131232(343 3@32P3x318B3M1333d23444L4x4444 $$0c -LM$$ @0 @P2+DB -`!LMX0P!1pCH1W0:<000@`V Q 0 R 0pGW* 000 R PQ 0 R 0 UPy`@uPl000`0  00C0`0 0@0  2H1+2222 -LM$$ @0 @|P2+`B -L4Mtq lPhh!0$0 @P T0 L0 H0 D0 @0 <0 80 40 00 ,0 (0 $K# a Q @L@ 00CS6@ 0QP 0S P0@T000  00xTK /TK% 0STK@ <0 ,2+2281$)5 54 -`LVP)P>1 1ER# @T 0S @T.!0EX00C0`FVP 0  @00妬T2T11 -LM$$ @0 @P++xB -MLM0,0 K0 HK0?(@DD@K8K @K ? x_R@X\$UUd?(K1 U5U3HHKKQ, P0@@?|\ ``N A$e @?AV@0p`/110S(K6$ULqf QKPTPK XP58K1\@@?NA`@ 0|0l(K0?K!d $5dKS@B@h@$5A@l@0` | n?KAd@KK\ d0Tb 8KKP=aHK0(K( B@B8KA %=K(@0@ SHKAX4 ZK(@ @K!HK1  0 K $08 00C bpX dL?>1 H!X 4,(<(,$<HK ,0PKK K K!(K!40(K18K1T@8KAHK@HK K˟HK0 0 (K 0! 8 @˟0 S 3 S (K8 QHK@K0 $08KAK KP HK,0\K0CQK8KK1Ab KK e$5S8(K!pK 8K0K $  K,(00@S0^ TKHK(0 , A0000@K  0RP04080<0@0D0H0L0KKT08K !>L5KsHKɟAÄpX3L Ϡ0.0CSxK000KHKA 0 I0CQ(K!HK 0A\00> 00c@# XpK\ K(0SK.!0\0@0> 00c# K 0X0C 0KUB8p WG?>1 AR!?> p W ^$ ^"KG$0KQ0$0HKA`0.!008 > b0Q0cP8K! 08HK@ Z $5S,Kl p@h0PX`P ^ $%^ࠡ1(K01!p@0SX^ $%^ࠡ101v(0K f(KHKA8K$P @$(0K 8K1HK$A (K(K0(K0(0K HKKAP3P B P5 R9 K8K DK,0QKR$PPL5Ks8K0@P5 P|,0 S ,(K P K40PP0K(K8K  PHKAXğ0 S(K!KT0K0(SHK@TT08K  P HKAh P3 R KXK8K1 SQKHK\0A00RKHK\0@00?0p00S @@THKAK XHK@X(RRKK`000QpKK`000?000S @@@THKAK XDBQKK\0$2RKHK\0@8K  P' HKA4B P K0S(K K\00SHKA\08K RKK0?\0<000S4(K08K0 RKK0?\0000S4g(K08K0 \K8K1 `K8K1 021P1B*B12++`@26BM1BBC1$CU HC\C021pCC$2CL6K8K(K HK@T0\ S(K KT00TSHKA(KT08K @(K P0@@fK@000| (K!p0!SKKT000T  000| @P0 {0` wPE(K!0 SHKA2X0000000$%R8t(K!?l>1 @  KK 0h2RK`00 ?> 00c# 8cW!-(K!0K"0#>PK1(KTHK 0AO K0@ P54C0SPXPr 0S 8KpP0@@?|`N A@ ?$%ARP `A?AP=L0@Po4D P  ;T3$5SDD0S Pf0S`P Kt4 $ X\0  0 00 --L w5 p-PLM@P`l0l R AT D0 Rp80Ig B7 0  @g|6 --L  --L  -LM@c h& --L ߠ p-LtM/Pti@TK QP0: S p0`rS  0-/L@UiPU+D0 00/00(++00+6 -LUMpPKPP@lK8 0S-0: S  SU RP U@P P@0 R000K@P h1: S@ fc$^c 666 P-L P 46 -QLM@ UP T ~4$7 -LP p47 -^MLM= =@, @= _K A=A`PጅP^5: S  PP |PDx-0S< l= R0 X 0S4= &D f40S 0-@,=@(-(@@@ @@句0 0勥0S P ,P(0,<00iPIl0Sd<@T 4,0 S h ,ު(,-K B BP 8 HPd5Tt5x%0%#,0106Pd5@T˟˟+; ed5T `m; R0  V$+0S 0h$ p , L+0 t'#Po70Cɯ5@"%$pWZ0S[0<cQM0ZQڨ0Qڼ /0@L@0S b0*0S2 P. 0$J QQ\  000S 0 b)0S P  00H0cQ  000cH0t)0S pb\0S P  40L0cQ  400cL00S ` Vb(0SX P X,5S05S. S ( 0S>0S 9b(0SbP 0(<Q  <0(5<(0S "b$0SKP{  hH080@_Qn d H0S.0O 0S b'0SV+PR  gL0@0@_QE p L0-0O@'0S a(0S. P* 7 W0S0,%R0S0L%r 0S 6 R @P `P3S x 0pVPT085"d@00PgS0$PP Ve 00 pWD&00/>10@\6PPF 6E46P(@ 6P6 P5& 0%@U5 @pE00j0%S P 4|5    dc L``P` `$h (4La(0S? $0 00L 0P5?T5 V>X5pP0@@?|PN A@ ?$%AR㰠 `A ?A=`L 0D#D3 P 0S U0 00,%0S><0(5 H0S.0O "L00O\P p"000D5SL000<5S,2  2 }000a45 SJ]H0S0O L0-0O021  1 *1  1 |000h1@@4P  0<0|P 00t!0S0b[ 2<t0Pb_ db_ Hb <<`L11|2 71D11(2@722202L7211t7|777C7 8<8d8x812,2CD9D@D2dDDDDE1P1(E82828X12`E222H1<1M1Eh9E$2EE1F8F\F9t9:F0:@:H:\:4 -LM PUŸ ?P1q :&P@V:` 0P\%1R x,Qaڴ RєڒS0ARph0 S\8Ad04 00{ @T 1 , 0 B0 0!Ph 0SP 0 R,Y_@Ph00`T*0 QPd@T:aAa<12D102Tp:FFFL121:4;FG -PLM@ 00 R$hZa1x; -L`pP@u Pa0@S p$2@  0@T{ q10  00S2WnC` `F R R1!![! @4@ P8P00 $ 0``,008 ( |0 @ @  V0 0`V00 |p0B000@ 8@@ P`0 $0 @ 0W`,d0`V0d0( 80 ,PrX8G̩d2; -0LM@H HP0T ] /edA;< 0R  0R 0R 0R 0R 0R, ,0R0 00R4 40R8 80RH H0RL L0RP P0RT T0R` `0Rd d0Rh h0Rt t0Rx x0R 0R 0R 0R 0R\5\%R -L: S  S  S H0 R4` S S  S S1L< -1LM `RjiP@@ m0T1 RU1 RQx0ST X1 R PZ`DQXp<S`00CS0X0@ӤX0/FT) T 00CS00 R0 0  0 yTYT nTNT %0YT00yT  R l P00XGd@@`40@,11(212`<l<@1x<< -1!@@@L0PP7 p0P0@@pp0 +`V`T  e0@0aP00TQP  0X0@@XၟG02x2p21P2< 0-PL@T 0 d!0S @T@T 0 @TT  T 0000 0 @P@0 P2022< p-p0LMd0@SP` @088 000 0 `Pp0212D1 -LM0@S` PU 0 0U Pp 0PPzT 0` Up806"d@00PeS0$b0`0 PUp24<(<021 0-L0P LR @  ($xP 0. 1<1< -LMX0pSD 000(2 R b  ? @_|Tn 1 RX Aas剞@T T iP~|Up@ U QV|!|0Y00 0 D1 R' HlY<1 R0APPP1!@P0 ^0  %PP  ?0P@ @0UH@00gD102L1211P2p2x2=1D122 =@=@Gt= -L$M0 !0P@`_ᖄ@K &" $"40 D @K0, zQd4 ,o}4 P[ 0@0K,0iQM@4 8@ / H^4P8pT54 ,Q} R0,# @K@_@K0 E 0`Q 00Vs# .@*0P ]88 x 4@0pW -8@0@]80 02==1=== -PLM, 00 ]@_l!@K0/a,@@K,< QG 0 s-0PP< ,@`K 0Q.]0pZ o}- X-@ 0R  @@K0 `@0PK_tp  ,\b]0 Z<,L00 ,D2====2 -`2LMPpH08 P0R@00bT 800g\ `"?>1 1FR#  800g\0 8 a@T^ 0/.!1CQT^@PD0 0 ! {0!S 3S 0^P @ ?>1 A!  ?Q>`0 0 ?> 00c#^ \0008 W0$00C0g0$0^10222U `@1 -L8M0@K00 , ~ -RSL4MP @`t pq\d1  BRP \ T 2H> -LMX0@|X@ -LM0@S / 0 0 0 00S lh0 R \IP0008Y`G넋1T>\>h> -BMLM`0ANK 0 ZX0 @D0 @DSP OXP 0S 圠0S Pp|0 @$ Dl0 <$  84 4$ 0D ;CKD0 A, A (4 $ \Gh<A-P8@T`p T ?>00c0Q3@T TX0X  0S  R1 018Ġ==800CS2 2 2 2 2 2 2 2 0S0 #Q00 #LQ0 R0S800CST3 p3 H3 3 H3 H3 H3 H3 000 10B0  2 R0  00800CS3 4 3 ,4 3 3 3 3 000 10B0  2 R0  00800CS4 4 4 4 4 4 4 4 0S1 S20#B1  0S 00 -LDM@P2P 2@ < P (    PP fY sY !1 1 !39p10S  i P| 0 @PX0P @PP8 L  8K0` p  $( @8 4@Kp`,PL  X  0P ,P 4`  b`^00ᶓGGPGGGHL; s@H 9 @9 HI L -p-L M$`K 0P$0 P @ P00 0 P Pp -0-L0PS @ CQ0 1Ñ0XV000S0 --L N --L  --L M((K0(K hG0 R  -LM@4H -LM   K 0KK p@UHH -LM @ \K0   KzpU0 pH -L -LM@@0S  h\4 -LM@@Kp$ pQIHH -LMM B~KpGnK0pG`F+`F(0 +rPÏ PP"KAA NK@D,X  4h 0X UW|,`4 0X W`L$fBpDa008 XP6KAA Xp@EU0S' T 880S@-VT 0S 0@T8800 |  Spl"T(0 SH(fe(H$IHItII= IIL; J p-L$M P`*4@K _P 0` ,` 4P + '*10AS1 0K(0 $@ ` {(KhWd\ {sp H<0! XP8K Xp@ T0S  gpRT80[S [@UT80SS S 0 0R0<0 <K`!40LLL Dp($Jh0JLJhJL; JL JTe4E 0-LMP0@S P \TbP 0@WPMTS 003KK -l0LM@ 0K $0  K$ K 0P *T00 38K -X0L M00 0@0 K P T 3HK -\0LM K"@ 0$ KK@  P (K0$9(03 p-LM@ⶖPP` H7P@`p+P`pG -LM@ϖ0S ˖ɖ0S Ŗ Öh - 0LP`p 0S 0S,s@, 0ll ppX$ PPV0(0 0$`$`@(@霏ty3 p-LMP`P {y 0p$ rP@ e@p0S P\UP@PpUP@ ,H@ppXKxKK p-LM`@PT 0SR(0@VT00P <pbP@p0PS p3L; $J -LM@ r`RK !P0 'U 0 KKK -LM@ 0`p`(Kpj fpPP V $}(K RuP( ur0[ 1S00 0V% (f!>pPR0S R0S R0S$ %$M) $%$FDW0`S|1}0S pv0 ,K,0 T0  (LpLLL p-LM`0S+ JP@'  # 0P00 $0( S ( ( R$0$0phoUp, ,0 pphp3J @ P)I J J J J J J J J J J J J J I J J I J J J J J J J J J J J I I 00,00$0 000J O L L L p-LM`00P 0@T PU 0sp00 0(@T8@0S Upd0S 0p3J -LM`@pT? 00 0(@T8@pT`/ P `(@T$T" 0 0R 0 0Ap 0 0S 00 0P / 00 0jR PP!80@T 0  UR (@T 3LXK$J (0 R 00 0( R3$J 0 3 0:0 p-1LM@T 000 0$R(@T3!)p6 p`2 P#$@K ~P  ` ` $P J F8I K $! 1`R  0(K ;T(0#40S 0:0@0QpP0S P0 01 Tpv0SP0 SP0 S @TDx00F4p34(hLG3LL; 0-L30 R 00 0( R :@0QpP0S P0 0 Sp*0SP0 S{P0 S @T ,034G3LL; 82P *0P ": -LM`PcP( @(K,pK 0  (0@SV! -L M0@p00 0Sf dSPP 0S nSW =BP0`0@Q GP QIQG  0V0P . 0' Y0  0000V 0`0 ,Kٷ, ?R0S@p @O0"Sl 0Y000 LPH00D 0oSP =0l0SKt00S0ڐ0SKt,0S0ڸ 0SKt(0S0+0sZKtP40+0SjKt`4S000Հ[0S0S0 :K0  0K l \bP OL  ,~{L  o3FjKPt Ktp *KP|:A}K(pGpGP`)   P `V:JP @`0Sr0@00S {P  T N0`Vj?0Z,L2  A$L*  9!1NKAnp !h1@p FPNK@D@De/i K>K| jK0C^(!t@P(`K1( K,@0) 9 0 ɠ$ (PKp , 긂lq44 MPM@XlM84MMM44Mo M8NdNNNNNODOhOyty|yOO4@ OoOoO44O8O P44 P8P4TPPPP4PP4QQ4_|4QpQ4Q4Qn4QQD4RRK0C0C``11 K00a庬1P=@1!Ta媬2P xa塬02P<a嗬P2P\"000pa凬2Pb~2Pլ(bu2PչLbl2Pհpbc2PէbZ3P՞bQ,3P8bHH3PTՌc?d3PcPb|0S @3#?UXcP#000IP3#@ =c3Pn40c4P Jd04P<A,4DPP Pdl4Px/td4P&d֫4PոWB 0C @ 00- L@.PpP`0 `R\ 000CP@< 0-N( 3edA84zy p-d0LM0`S@P p84 0SMph4gddRtR -0-LP*P@w$0 5 +3긂 0-PL0@S00   xl0 R 0TST 0S S 0S 㻆4UUVı -LMPp`*p@? P. hd$PK` Lp $0 P r  0$0 MJ$#40S$0 ld U PDKP$  V,VLp -LtMK@kPx0  P P P  14VDV -L2LM<2< 1  424p, 1   p `PPR K Z ,C/K iU@= W3T#1 ,0S ,AȌ 0P|LPTLP 0, L P  L P LꈠKZ 5@Kl p0  ` P @ W P 0hLL rP 4LddVhVlV,lqxVVVVnV -LkMl0`d$0 P P@ 0S@AsKgP $A1" \P 6^KP@ rP1*$0 S $唐 H _P*0 S/R ` ?d ;P*P< ,(oV VVVW(W4W -LMp0PK 0 Ht0t `h ,@0X @. G` 0S  =9|9t9PWlW -LM T` , p4 P  ?P.v>P o>P NKt0S h_.0AUwʤ> >pf  h> d>R`.`pT $0 ,50(5P ( 1D= @ M^00 00 Rڨ R= =$ $RӜշڰ$Rӌղڈ000 0400 B`40AP HL0Q 0 R$:R8R0H0400cL0 H0S.0O L00O PP00Z0\ʠ ZP00P0 0T 4Zʠ ZT00T0˟ T00S1800`0 8Zڜʠ Z`00`0| P80S0P5 00#1t0`+003x0@4e|0d0 |Z;ʠ Zd00d0JT;\` 4@J8@帊@DЛ0P4@;8@@600" 8 000P|0@'8@@"000 夠Zɟʠ Z000 0B00000S010CO 00pǏ| tSΌ/1`G P$p`Z`Z 00 0` |02X3 X3嬠S  ʠX30X38 X3S H܈P0`x@ @ⴐ 00 )1 @@ ` TBP 0|00  0  X@ @ 0 H 0S S0$5P㸀 0P @@ ?|`N A @u?$%ARp0`Ag?A@T0 S< R{`P0@@?|pN A@F00$/>AQ@0P[`7?P?T0 0 00S000ʠ $FP 剐X3 0X3@ 0 腟 80080`00`0 80Sڴş4 00RK 80080 `00C`040040 |00|0l0 0 E0 PKOP?B UpxP开 0Eo0 650 0ЄD5P0`x@!@@^Y l 80 Si  Vg  \Tb0$cH<4@ ɐ00 000@80080 `00C`00 PP0@ @?|`N A @?$%ARp0` Au?A@TLßPp @ PK0?PxP0Eo0 500 0000000 x@43!R@@BऀXPʸPB B0GGP帀PP2 @B 0  P <3 RRR0S G聟 @ @0 R0dŸ  Dp@ PK0?P]xxP0Eo0 T5P0P10`x@!@@@Tڴ00i 0p@PK 0?P1P0 @?|pN A @?$%AR㰀` A?A@Th0 Sd` R`ڣ?/0 0 |9x989444499tW44WWWW XHXtXXX4VUUUX YAQ@0P`?P0@ @ 0P0i0p圁PK0 P?hxP0Eo0 `50D@ 0|0@ `|P00 T DHR0S T0T p 0@TF0{F0S0p P0@@?|PN A@?$%AR㰀 `A?A=`L0`d 0S2$0@$ |0P| $ Q0°0Pè Ű R>3 3  3 0L5 @5LV>00h0Ph0 S:h0PŤ0S0X3/ X#0|`0Pŕ KV>T5 @T50 \X5 =L 0OOT0T$0 $E0 X3$@,@P,00,0@`0xQ0000, B` PZ0 "@p0`S$0bZ/0A P+U 8@P  E0| 0 0 E ,00C,0`@@`@P4F 0|$ d$010EPcUcP#u  RN  MD YP@ :  9 A6+$0| $ /D@$哾P4吾I/ 0,0p`傾P48/  0p Dd`Ÿ`0d |P  B 80lcC80|008P1@-@d C0!C} S|0` 2Q@500h0TXdh0 0Q 0hhC0`40 SHHC@!@C8C0S nWrP T?/0 0 Wq0Hh0 ,5<0 k/@0 00Ϡ΃4 `0>\\|94]<]h]]]]^$^H^4`^|Y|^^^ -LM, ,P@, 0p0Q"0$ `,0 V` e0e\0 40 40@z44 ; :,0Œ8 Eʟ0p:0 , ,00CPʟ+0! * 0`e<` ;pʟ1 <0P0 `$5S@8Dp 0T0T0 1X0 PX00\0 0\0/>`$5SYڴ 0| /`010Ch0 h000h0h0$%10l0 @0`|/l01d0 )d 0R<ʸ 0,0\ 0,p8.!Q0σ\00>00c 8p W 00C 0pd(@`0xQW%00PUDh% *l 1 D, '&0000| m66 ƟRT000T000@|0嬠  =P`S0 30p /PeE<@6Pp Ri  ;00050 80 Y0 (00(0%540( 0l ( 048@Pp- | `!40040\%4800` \@4 45.!Q0σ`004>00c 4  P $00$044 80<0 SlP 8@4 R`0 \0$%R L$?>l 1 D, 4$0000| ß3 RT000T000@|0嬠  P`0 x0p tPePT3Pp R  000 3< 800 S<Y#0i14  4 "2.!Q0σ`00>0 0c x2 <$0 Y0$0L0$%R0<0 plp h@\P@" \ !0$%\ 10 10S1p p0W\ 0$%\ 10 1tt!0 00T1T0$ <08!00 001 0008,0 0 0@ dP0oU X@@@V X@@@ 0|/`01d0@]%.|9x99U 8_ -LA^ p t00 000 R6Pp04WP㌠(p`͇L|0P` 0O;h0d4 ND400pt4844$8|99A -0`A VLP|`A@00000 0`VpcPBO ` p    9 -L M0 d@Π , ` t3 R %=@T 0X3 _R`0@P08  P0 8XP43 03`R`0XA  $5S ?l >1 D,  00C0 00C0"00C0 000000|2 0000| D2<2 RT000T00C0@|0 4 40 P`0 0p }PeP1 pRU 0400C0@, 00R> 4@{P180 0` @80 0` 80$ 0` $ 800`4  4 08 P ?Q>`0 0?>0 0c0@8 T0 d 044X@@@ 3<|9x9U 8_P_9|_ -LMpQl0A d  al1 RO 00C 0@0S\0000 10 d0 l 00C000C0P`,0W**0 0 0$@x`0d C0XKB$PE 0x {00 6) 3 /|9x9U 9__ -0LM`pQ  X0X07!hT<0@ L 0PNP "b 4449_ -0LM`\0p l0 P X0XN0P9P ,0007 h $3 44494` -8L0@S% @ | T | | |  0S0 #Q00 L0 R0S  s4` -8L0@S!  H $ H H H 000 10B0  2 R0  00 @L` -8L0@S!괨 Ш     000 10B0  2 R0  00 h` -L M@H K#0s4 A[TP @TP@ht@\ -LMP@,p1儑儡`px!.pP@4 "P-Ꜫ Ī Ī 0`0``p0 PbUA40Sh0vnX0W 0 Rg4999`9@99 -,bp0LS2 R 2 pRpW 5PPs ء8 P@c #0B SPL L L L 0 L L x l 0tm0S@ dP 5! 0S P P   0S R R 0 R P =P 0S5=&90S0S@ $P #W90Sm r 99999\ -LpMP@T `KP 0 R 80S <0S@: S! p0S : S 0 R !P N=P 0S P (0 RJ 9999` -LM쁟0Q@(0 Pp`i 0: S (0 S ( 0S "  p` K/p 1 S!3 O{PpE 8@ IP v P q<#0  p{0  ,P Y P0  P G PG{ MK7P   ``9` -LM@`P  Vp@0V U@0 @. PPU`VUU -1L$M℁PUp$ `Sd1 R 0: S P$0 S $$&4KU@+[ Q003 Kp@`D00CS00Ӥ0 PpP @00CS00Ӥ0 PpYU00yU0- ,q99`4<`a p-LMP`P @@P0/S+ /&=P0.S P0S@p0S .S0S`V d 00 Q P0S0P,  @@P0/S 9$a -0L Lt븂Da -L(M0`@/<d#P000LXP< CR 000Ri0 Rd \0R R R0R[[4 -40L R(0$0$   Mr9tbb -Ll<0 R4  9 0 9 9K - Lb -LIb -LMhq0S \\PPL -:@!PD 4a@@P!@0P P00FP@ @3 0 0@@Pp@K;0$!  P 09P 0;C 0 0d@d @-ˠ$0K $ @%8qpb9b9b -0LS \|0H0  00S_\-\0S IX c p-LCM``GOK0PL  80 Y 0S |p$c,c -LM$@0 S A004c 0-D0L R 4410P@@T00T8c= 0-LBMdP0FOK\0 P 04 0S |0(*(YP( p4  Q Qq00  R( 0,S00\(   Q Qq00  R( w(%P( pd  Q Qq00  R( Z l=X@d\Pdhddddenee$elP 0eDedeeeff 0-LM P@U W \UXQ UM  0S 0[S: \S1 0\S \R 0S 0 0 0S000 00\S  0S  0\S0nS 00  0[S KP@ ($0Ԁ0S P R" 0pW ` 0@ ,0 S0 ,zn#&0S& P&TPJK(@DP@D *0/\ 40 90HPtP4PPji -LMr0@s `PR |R0VQPq`20  00SG \PD 0, CR 600`0S0$ CR "0000CS00  ä00@%0S % \0R0R P(0\ CR #00圻P 0 C0 b\ 00`0\ P(`0Rt%`vdP fL$ KNP2[S<00Z44Xijjj<{\ht@ -PLM؀`pP@) T 0 S R@D @00U00  0 P P #D <0S1TPxPPfj -LMP, Up & &U0 \Ud 0SDb p9  0r1 P`0@0S*,0   000PU@0S*00K@ 0@ @K @ 00s0s\U @0S*P000K@ 0@ 0&S\SPq(00  00S00@xPX -LM@P P`p W00 g 0 0  N P0-L@P 0wS! sS @T0 p P 0 0-$30 d[{Sp P00$ 0Cb00 0-PLP @gT000 0-LPfP@0 0R0 @@0#Hx 0-SL@p  P` gP@4 U@@V@H hxP @\0000Q00f -L,MS @D ||#lp LP ?PPP4#0SA $GH L Q 0S 0S"0S P0 "PPe{x2p D p2`b`" @ 82@ $2$ ; 00 , G00 080 4 嶈ȉ>DP  0p00  00S& @wPp6 P`7d妰P`2 u |$|4|tP@cxmuxTXgfff|t# |vX0 0-@0PTL 0Qfc@@0vu -XRLMP"@ac?P 0A`V PU / 0S x0S >1 LPl 0S0@  $0 S  1SqQ0S 10Sl= @P@c?0P0P00S` 0+0 0K@KKV0?0 0K00K?V00O0@ ;0 QB KȀ0P@@ RV  0徂 㲀 @, 0岂0=(uP||vv|}u}0} -PL@p` bp lP ?PmPp`t 0P0 PP =㋯0P0 0PPSuL}0fP p-0LM` P@yb?P 0AT K0/3\0 S0 1 !0l p$0=p+=vuP}} -LM0@P,0 #Dbp ?P SPP,0 S ,Xa3 AT #0 P 00LS!00LS0B \L r<lpj\ p]  Qf` XIP@PR  Q8 P3 0X0C S\/ . . . . . . . . . . . . . . l/ . . . . . . . t/ . . T/ . . |/ . / d/ PI PQP'SP0-V +V ,Q@ 埮P \ \ =V1h0l匮P 0a0CS0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Ispmk@hpU @@K`Pp 0 0=00 b200P B\,0000D<ں<3uw~v} ~~~(~0~8~<~m p-(QLM !@5a?P< 0aV< 0 0K.P( 0Q0 R 00 0 S   0S  0XPpڣ P;P< (;pɣpuPtv 0-PLM @`?P 0PPKPK@P 0@0 SR R 0uP -PL4M0p @P0 TP XP $ `p, rP' ?P pPLKJ=PX Lp;sP uP`PX  L K<PX L <Z;0T0 0P0 0!R40*X;$Xd?@^P` 00XPT0Sc 0 00 , 0 00R080 4 x 4`u U 0S C0 P0ŵU u 0  $0StP0;0 T0S H00c RHKh[pP800c R8K^[`Y U u P2 P$ R X圿 P PX2 RP0\U00Su US 0"0  40VG 0S 006|0`71 R,4 }P# 0S!eT0S Xu XuX<<\00 000D8D<e  0d U0S4V  V 00S`FV 0V0 R efPF\`0  @0 < Y@0p0H0 D 4:u@~yyLtvudvvvH~ 0-lPLh @e_0?S L0M0< 1 00S(0( 0hW0uPvuvu p-ALM!P?_?P4 0P@ P 0SPU @Zp: _:sP``V 0-S PpsP@P At0S,9p0S`uPxX~d~ p-ALM P^?P`p0AT K7\P 0 ! 0 rR @0S MXWc@P00`h0 R 00C8S` RV 0  |9uPuhvv} p-@AL M8!P^?P`E 0AT00  K\P: Q40 R 08SS#  R 08SQ 0S 000 0 at:90bPW L0/9pQ 0`0049puPvt~~dJ p-LM 0S@`)p KZP'0S !0P@PB LY0S0eC10C0@0S0$0 R0ppvkuv -LM`p  ^p fP ?PvPpp 0AT W @zP0 [ ڪQ~@T 8)Pu~H~ -LM\` PW  u`ONFd`@ePX OD%BddW_N( FVe $P @e~h4} -LPM@lPK`ᄀdK 0hp 0 0 0|t<h< -LM`SK@P lKK0S@ #3````0SS?KS?K0C0C0`~#S?K0C`VK@nKQKm 0h  l0R=9B\! =C ` \1 `! 0` d 0Rd! =9B@Kh ZK KP T1XbL1Pc=9 A =X T X! T1 PVK0 A0@.U A 0@#U A 0@l6bhX 0 P< 0  40  =Ch! d1 h0  cl0Rc=9 =\! \1  A0` `! \10`! S \1 =9C`! =C `! \1 Ũ `0 cd0Rcd! =9 Ah =h! < d1 d1h!0 SKZKh! d1 w=9C tt?Bh<~t~~~~~ -LM] PPP -D0D L0\0 P E PPP P-L`N \ RT LR0S0f0QE$@F0t0f0Pp F@Dtp 䀟 ` ٲ00H0 0 c@BTT@@DtP @D tu@ @Dt00X0 0PPu0UPPPPPPP -L -L -LZ 00P -LNy - 1 LP@8 `00Cs0䠟p- P P r0 0  R0_S $S@@PP P  q00 0  R_S $S@@00Cs0StPPPX -1L @\7 `00Cs0ࠟp- \  r0 0  R0_S $S@P\ q00 0 R_S $S@00Cs0*PPPX p-0LM@P: 00P:p0@ph`P0`P* 0B0R0T:pp00U0TPPP -LM@@t @Dt 0-@PPL 0PS0 P0 p(0  0 P00X -hP@L` P Lp0T*0V  0S 0T*0V PP - PLM@ pH 0 0  R ^T@?hhXP -D0D 0L0Q0 P`0TvPPP -D0D 0L0S0 P0<^PPP -p0 @L 5`P00Cs0 U0 T  @R 00Cs0(0P@,PPPP 0-0PL@00Cs0 tϠ Qd0AQ 00S 0S0@0Cs00PPPP - L 0   P -$0L; 4t -0L?u -0L6v - 0L0@*PP - 0L0PP -D0L R80000 ,00@PuvPv -0P LU:0` pUh0P0@  `V p0 6` `0. 0Rh?$ uvPPPPPPP-000 0 0 bL1C 00NvvPP000 0Q 0 R LPPP -LCM`0JK $0 @ PTJ P/,1 P0' )S S1 S (0KU*0T0`pP@ g0^S@ (@T$0 S `$JU 00eU@    PPDT -pQL@@0 @dT` :%PP 0@DT*d0 XD0@j@0@^S@D} PuvP 0- L^RP@ ݉P00d0J P0 -p0xP @L@b\`00YD0 <0 40,0 !PPPPPPP -0L,P -0L#P -L -lpLMP\r\`  P0 0Rs 4"42@PTj 0c0@0d0CS01 1E D 0RI 1`V# 0@S0P0cPcTp!h0 0CR& 0R 0R>P*Pt @Dt Q@0T 00t0T 0R P

R0@D?R0 00vp\0 T 00 0S< ^00,P@0 ?00 00XPP P0-L@P T Z$|0 0h S`0 ! XT0hH$H0<B$40 ;$ꌅPnPm<8 -LM∢pQ, S d,@01Q 0H 0@:T$Pj a ,dP00S SYT 0S@ WG@01 R;0@:T;T 01  lH#00 RPq 00@ ,0T1 ?> 1 @  ?>1 @ p 0P UTP SC@, < ,Pd00@TTPUX~WT$ "PnmPPP p-LM<8!00( $A 0 PP Ġ00 PPUP` 0P4GU  @PĠ 0PPUȃP@ DڔP80  p,єPPPP|qPJu̅@-?>,1@LQ 00PP -LM@Q  Q Q Q Q$ h0 PP p-LMP` R @0@0R@PcPbV6@ptPP -L0Qh0 PW񟗩 T P , T ` V񟗜 D T p < d x d \ x `X 00 "" " V  R X V X 08.0004, `@[0T. @0T* @(0V0 0 0  00 , n004 080 PL=@` DA wA0@0@0@0T * 00 U  < @`DA VA0@0@+ 40 0c0 0C Vm Q 0 R00S 0S,0[W 剐Q   l!0F]ShH t t t t t t t t t  H t t t t t t t t t t t t ̯ t t ܯ t t t t t t t t t t t t t t t t t t t t t t t t t t t t H t H t t t t t t t t t t t t t t t t t t t t t t t t t t t t t  t  L   0   0 00S 0  0 0 0 `0S0000 > S<   0 0  00 @ {V @ 0000W(  0 8K KP ]P 0 UPuX p=40UPbP  @0T*  0@8@` DA KA0@0@hb0`0  `   $00(   0 S 8  b R8Kr<P00 0S )00 HKPp    000  $00(   0S 8  b R8K><P00 0S )006 0 | dK@K 0э000 <^0@S 8  b R8K<0P00S00  00@0 媍 KHK 0KPp~ WX  PJ ([ 3[0cഠ00@ 0 R00#0C S-̴  ̴                          00 ?00A `@0  (CXUl4*p-Z C0  0A 0  00#0CSO, , 00)  000p 40Pj]  H R000 0p 40Pԏ"@ 0 ]E]0p00 0 40@U ᴏ d  Xq 0 ` t0|`0 r)` np H0`VH0 f R 3[SD0 RD0 H p00C0 1`VQ 3[S ` RD 3[S0p0 >QA ` :D  0SC' D 0`0V V    0Svv  D gD3[Sp<0DWF `A 1F`pN 40 U B GH0`VH0 `Pク ,M uvv4xԅ`v@D@ Y@P08 @WPL -L MPpQs 0#S  `P@@:T 0ş00 `@ 0`S VPT`0@@T*TQ%XJ K#XG (5  0S8  @T000@ ğ0 @" 0 R +X 4 R 4R 00 @T+X lY@-X=X ?X @4R44@T0@@Z0=X[㈋P 0@S*S0]S =X Z[@00  #0HS                          2- 0,0 0 4 RbZP 0/Z40 0`CA 2020@S@@F^,0\ *000 4  @0@S000MŸ  10,0 0 4 4,0\* @ 4 o[0 @` DA A@,@ 4 0 0 T`V T0S@`@@T 0`SFP[ҊP 0@S*S0]S( @T*T0 @ T00Q00S V 00 8080Z[l0`P`@aYL0 0`S`Z Z vvuP( -`1LM`p+@Q``@NP`@ 0S $Kn $A@4P P   2@#00@0 R0PU 0S 00S 00`AP@P,0 Uvv@\` -L@P@%Tp? #T U@` :P`T`T TU@ :P@T0e  m&8P@:p`p k:P`DT*P@: ^:P@DT*v p-LM 0CP`CA)P @0T *00ᤌ TpX0 @`DA A0@@0@`Adph><l v -0LMpH`C 8 @1Sx7<,8K]wK9y PHvuuv  p | uuPvputTX -L,MH, \00 p4 L H  0S 0@S \ |<V zT,0`S ,0 R V 0S ,0S ,0   D 8@ RD00D0  1S4 `0 7# RP Tq 0ǟ0 ^7 0u>0 0 R^ D 0`;VL@Q D0@ 0J 0!RPU7 ,0S 6 R /0P0H, , 00CS \ \ ,4 0044 |6 D/, 0@3,0 R,0 R @ ,0x00 ~040 0,0 0-PLH P 0, , 0 @@ ,0  00x5 p0S 0@SLUD0 ,0  ağ#080 , ,0#20#0 ,< ,0<0 00݉P@> @48|$,,#0< <00, 0< S 0DS D p D p p T T p 44 4 c/ 0\.a,0 , 00, 000,,0 1P,00 3@  00 0@(&,x, 0T F,0  ,0 R  : ,0x.B\ 00 2,  0 p00 0S B @JJ <$T,0 R X0TN:NQ`R$ =PV ,0S ,0 R ], 00D L0 W ,0 0H0 1RB ,0! Q5 ,0! Q7@4||!4pP@ p*TH  0 R H 01` Q H0, ,0S ,0 R 0` i0S00p000 PU  , ,0S,P |1u4tTX@vuȆ4vvv$TQxlG E  u~| p-LMP`PQP@ 0ST 0S`@0 0@n"w0 $ 0 0@갇t 0-L@F 0FPP$ 0h 5Xvȇ -0LMp@`T P FP L 0V0R00S@R F 0 0 v -LPp`CF  @0;` 000W DM0  0S;0FV0 0N p-LM@`P0=S\ *SZ +SZ@F F 0 ` pXv -LM`pE2/净PP` @0T00SK 0 H PTF 0S 0 U @' TL2L2@ 0P ,2U(.0 00 OP2P 0 PQ000Y @ @ Q0000 F0P9U&10T00S 0 PU10T00SPPU00S U EPP 0 P 00000 0 PP 0`BOTPX0P 0 c0 E@RutuQuPlvXv p-L M PK`pEEP@  V 0 /R 0(00 0plvu -LpMPK`@ PpP@U WV 0Sp : S  S pp@IZp -SLM0@< /0iP < P  KH1  000 , 900PT080 4 4 :4@HpW7 `eW 80 0c S8Kډ-@ @_/0080  cR8KPw-@  O<4 zP 0SPU4,44`,  pv -x0tp00lL @`0PPt60D01 @G70000u|t0vLvu -LM0X pP `ጣ $ Q uP0,K j{ PX`A00 R  0S AQP ,K H{a X a 0,1!ؖ0  ,K({a0 h 0 } 0< 㺖}9K,K {lc,K zT00 !Hu PX|t@RT(RDR8|`8t 0-0@ LR# P0\$ 0S 0S0Q RT p0phTd  0X00\ 0S@ 0S@ Rvuu408@H 0-LMPK@ z80@0S 0@S z0u R -L M,K`PD p}zV`pUF 0KP@3 X XT ,40#00 V  @  00CS0<0U@T@T 0 t@T  Az 9z000!(@u R|t8t -LM pK` z@T P0S 0@  00CS0<0@T@T 0 H@T0" y Ruut -LM@K 8y00 \000y 0u(R,R -LMQ@P 0= S< 06 @`쀟40 0Qp@Q Q 0  T  0R@QT t3 0R0   0S 8)@,i$$(R0R4R,R R؎n00 000S  0S$4 0S0008Rv -LMP00좟000 SQr`岕0 SV Q  Q  00. 00 R} `2 Ry 0Sv QDbj @BPY 0SN P 0S? "” 0S0;004 S 0S# ( 1 1`@ 0S Q !|! Q 0S V PP 412  00S0  | 0  < |&,_0 `P0h;0l`0P@j 0`00@0000@00Za Q_MuDv|v@RTDR|tttx -LM0` V 2 0S{ `VpK`뼠K  PPhڸpKT`V 0@T 0S @T`VH |V (0\Q=9A =C 0(l0c (( Q=9 =p 0( 0b @(( Q  =9A =C0d0  ch  Q=9b @ =  0H {00 0S0 0SS000e0000  Rv?B8R p-LM P 00S QT 0PS4 0S 0 S0000 00CS A0Sa 8 R 0RS  @ a 0S0 * 0SD 0S$ 00S D1 R 0S 0S RA  Cz 0 0S 00S p 0S 0 U  ,00 000ppphP00CS000$phuuvX<XBVPW U V00W00SZ x=)X O&X+  X"t2 ,0S x,=(XT2 R P\P lŸ0S0P0 P(U  P\P Ÿ0S0P0 PU |X&UF ;X |X 1&XK;X |X0x"`ྦྷ|q0FSGLAz@T *Xl (Q dyX0A0EA0US2 " / AE'2`A2&  ]'P@ 0 0S 0S <0S 0( @ 0, <0唧 `vvuXu,u]udu$v vvvPRTR(AE 'P@  P0R }R\ f 300T*X 0S0 0 0U0`00C >X000 P\P 0S0P0 PX< <X>U&P 000 0x&l1E` P\P 0S0P0 P-U0 0 0&U >X00  |U00S @0<X00>X'X2 JZ H ` 00C0 K "Xy2 JZ `00 K}X]2 JZ `0 K0S g h h h h (X( "X 'X @TS2 JZ `@| K p 00000)X \X  00C000"X \X0 0C'X0000C`X  " \X P\P H0S00 6$X "X X\07/0S\X `X2 JZ ` Kr(X000 )X00CS0 P\P (0S0P0 P)U b@P av000( `p 2 JZ ` K5\X 'X "X 0 0j2 Z   &`000 K"X \X P\P x0S00 $X "X X  \00\X `X 00` )X |X (XL 00  2 Z 00` K 0 00T}X |X (X0 00  '000 P\P  0S  [X X'00C0A p-LM0P0`0@V:`p0T:xvtu -LM 0, !B0001 < 40 0 408 0<0 @ 80,` pcP\P 1 R0P0 PUR W U p0U <00c R<KW @P`S UU( P\P 0P 0R0 P U<K U$ <  b R1 @P<00c R( @P8 0 08 @@0 `ʤ0 00C00,TRvvPR --hLM 00CS0< 00CS0$@@ QvPt p-LM@@`w0DSp0P B    $ < (`8 , 0 4 p<408`\400,P p-LM0`0T- X 1 R$ R 00S  RXiz  0S 00S 0S 00 z(1  sX0001, dP  0R@ S 00@,0c aR, ,@@D0S    $0S R;T 00S $<0 0 Isautvuv\Hvdv 0-0LPp@uNP0@00 -0@L MTP@ T A,S-0<,N- 0, 000 C  d@TP0H , N 0 0uv48dv`u -!MLM4ʟ` ,  PT( X8 \ d  @ 0 S\ @0S 1 !KLLl dQh S \SP p\Pc !P@3 X00 SH X\ h R$ 0 B 0d h(R`80`8 0S X\ T8Q ,0`S ,@!P@ 8!mK `F0`F(0 i0_XPX\d h(R`80 0(XePh` @Q 8 R!0AVS񟗄{ { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { H| || { { | { { { p} { { { { { { { { { { { } { } } { { { } ~ 0~ { { { @{ { { T~ x~ { { ~ { ~ { ~ { D { h {     T B^KPEpPE0K,0A+K0+0B^`XP@p86B^K PE0PE0&sp6B^K PE 0C00AS00@SB^KPEPE%0 0 B^K1PEaPE0%spl Ml:B^KPEPEl%02lMl:B^KPEPE<%`}f[ P00{RPPU B^KPEPE0$ls~KpGpG+V[}J[PPlLl:B^KPEPE0 `2}9[@p}B^KPEPE&lLl|:B^KPEPE0$B^KPEPE +([wy*+rB^KPEPEB^KPEKpPE,LSB^KPEpPE\0HB^KPE0+K pPE,0BDlLlJ:B^KPEPEt#{B^KPEpPE0K K,0L+ A0B^KPEPEg&.ZP0p0"3B^KPEPE0)xP TrP@ B^KPEPEB^KPEpPEB^KPE pPE 0` 2B^K PER$0#0pPEB^K0PE`8 pPE 082B^KPEl@Ll9B^KPEPE "B^KPEPEo ZP  ZP B^KPE@PE+Z )*@)*c]`ZP l)*ZP B^KPE~0KKpPE,0L+A$)* KP0/S)*B^KPE0PE 0B^KPEPE0 Vr0 S Sh8`8  p S \Sd80#pd8 h Y`00`8 t<v$uHL\Pxx\u4vHtt{ h 0S 0O -LM䡟䁟p@`P\P 1 R0P0 PV(ꬂ (  8 #U` 00``` 00c R!@P000  V[U(K8P/ P(0PS  b R0@00S(x0ŸP\P L0 R0P0 P0 `vvPRvp -1LM  0((0 $ ](0p000 , P`P\P 0 R0@0 Q@000c R0KP[T@` ]T`FTV T00,$ `DV00vvPR p- LM0`S0C0Px0U  Q@@T0 AQ 0p( P@ 0<0PRvP p-0LM R 0 0P 00pphP0S`  0 0R@0 \T 0 0R0 P 00plj@(0  0P 00pTRvPR 0-8 P0@0L 㦞 @=00v -LM0@=C0 0 Ȟ]v -LtM@J 0S00cS0P@$ T P0 0@TKPx0: SH K 0S 0X S `0S X ,'P 0@@lRpRXR|\R0pR 0-LpMP0@S|0lS`k0 TK  P|0: S\0 0 00QO\Ru -LMp@:``FPP :X`PP%XP@ 0T\S T 00U0L0 R T?W@Z DnXRuu P0-L@ P@(T T0u p-LtM@PH㲝08`KBP0: S`0 0 0pu 0-L@D' P(,0P0h+4m -LM0S ( " 0QOK0bG/o00 KZ'g@!&#z&X   @ 0@S P@1PSlg@0S P@1PS4g47 0}P& &(000)Z0@VWPv&00  36 ! P PP @0 @*0SppƟp@P0PP T@)HDa&`r'0@/SP< P 60S,6T  'n@H&0(D& '0US nUe%5Q000&0@ 0S 0PP P5P` `PP"0S"P@T $@@4p 08 =iPK~P2: St 0`@S@` 00DSg#02 e0L0  $P0``P 0SK 0S8@T 0/%&w R$P PUY00 0SH3  p00`%&zP  00 0@T? 0p 0S hPw @$@$  $ 0 00 k1jp00  P P 0c 0X1W1pSP00S 1SPG@mTM&#UP  &0S 0S0S} H!0SmK;PdK6P!$2R! 2R,UPu UPptn@\ᅛP a{PPI0`pvK  @L4vuvklvdu8vXvjuHuh4C uvXt`txTvPxu`u@H4DL0t`pheu -TL$  @0 <0R4S0 hPU%0S{ĒuGQt -L$M< @ D0  00, 8  PH s @ R1@000  000  040 1T\P@. ,P,0 00S X00 4 0 0DSd | d | p | 1D R&0 R  @0S 0 @000 <00P=, ,0H 8 ,@ ,%,0@ L00S 00 40vu̒ -,0LM@@@hv -LM, 0 ,0#$ 0S 04 80  00S2 < @ <0S2  2[P@) 0@S񟗙ꔘ К К <0S@ \2 P 82 R ,0 R40S, 00,0", a2 Rh,0< R0S, , $0$000$0<0SR,HP@. 0S40S* 0S' 800C80 8 R!d, 00T 0S ,0$  Y$1T 0S <0S 0S00$40S P0SP ,0  00Sy0@ h0 FC,LLy@  0 ` ,uvhvvPHvؒuX P0-L@ 0S PP0 R @P 0S긛 ̛ ZT 000%0S TT uxv| -P`LpGoP@pPW P00 Q @v -haLPp0S  0R7" \ @0 R@BT0S80S W` p0  hm`V#0 R!0 P0@CTT WU5@ `h0 P\ 0P$  vuuuxt p-LMl`PU \ @0 @Rڣy T 0 0PU 00pv -(0LM@T @Tv -,@LM0 01h鬘v P0-L@ (P 0R @T0(v -LM/@SP@rRP0 )D0P0h -LM0P0@cSZ bSZ  `K T 0pR R G  0R `V  $40"WĂ d,(0 ("4S ^PDJH Dĺ 0-L@ᒞPP0+1H P*- X 00Q0000Q0  Qv -La 00zQ0A 00ZQ0ھ;\0;LD<4 ,@$hvp4@HLTX -H`0DpL0f@P9g00fDgP@Rl p-PLM`0P T@᱗@P Q0p 0Q0-@PL0 00h}0 p-LM0`S0 00@ 0P᜗Pf0P00p p-LM<`P@1S@$TpQPp4u 0-LM@4P,,P$ 0 0u\` -PLNMP! p0PH1 `AT P$UHR?K o2TQ?K-KAQH1`PH TP@<`0S 1<SP$U(ꌔ4u|tH 8guX 0-L0M|P0@@Ktt0  R 0S $Q@000* 0S 10u4uv -qLMPP0` 9 PP. P, 0S0P00S R 0V0U00S00 U 0HS0 0Q$`Ǎ @K$ hP0 ^V 0000`QR wuvuu -L,MS0L0 0H S pP T W㸓 DK   pPO 40AU00#`B $?U sU00WP0P0 <#@0U @$T %T  0  goU<PP@ 2 V 21   N<'V<0  L0 T 4D1S +R-R0S-RG D H R T0 SD1S  H0 T R L 0S G$0S LP0S D1@S @1S``!T RDD L!T'D1 S 1 SD  0S0#0@0-S /nP 0-S 0唐 @6@( ORl@0* PORLT@0@S 00$T000RR4uuД|l ԭ 0-LM@P K`!0 S  P00 Q0 Sp 0 0-L@PP 0[} -LDM耟0QP`@$0 P$0 S $JR0pFRUP!P0dP@UdpK  eOP40"p 0ev -PpLM`@*0S @T:X00 S WP*U> ?U< [U) ]U" |U )UX IyWpGY00X00S |NP X pX Y X R0!S@ R0]S@x -RPL MP@p`R *0U5#SP QT:U0S d?S^ *S 0TQ T PE0 P0PS:< S P, 1 0TPES% ,0 S Z0@00  00\ , 0Z,0XP , 0P,Q vP@QSSڿ0CS P, 0TPES,   U0@00  00U\ , 0Z,0XQE\  D0x U ;P r, 03Pk sP, PEU0  g 0@ P ,0X , 0PGZp@-@^P`D R6 R0 ^ R 00 Q00S @^0]STp0-S0S \ Rp0 \0]S[Qp0  R   R( !^` P-L@Pp`*0S @T: `)\ 0W0|\00S V  dMP``Fvx1 -LM, ,0 i?B10Q , ` P@BpU<:T P @DU 00 00 P  00 U 00 6HpG@ , 0hC1 iBS, ,`   P 060  PM 0 0     -LM@`Q 1 PU$ 0Q-P0 Q -P 000#0+P0SPU00 -P  0  0 0:U?U0r ,U00;UppWj#Uh LPc :P. ;P, ,P# #P 1\ !000p01S 0!0 00! 001 p 10 R 00%1S00! ;Pp :P 0 00 P# 0?-00P000:S00P 0T HD0L0-SX^U0 00 v4P 0-LP0 S@5 0  0S0h0S 0\@ 'Se U 0S C  0  00SU0<0he4aP^P0v2|t -LMh4 4  , 00 @媑4q8 3aPPP@,aTX` U`V`P40cap0S0W<0 ^ ~,@\8   00@T pWP8o饑, 4 0, T < 0vdP -QLM@ ^Pp `PP*PU e*0S t^0S0@e P:bUp:0h0 -L`p PPZ 0#S 0@P@ -LM @HmP 00  0/ c 0 0c RPBNK ` P@D\@D` _P0`(K P/R P PP X@,0 S ,x!0S 0.S0.S U0u/S U0.SL`0/S  -LM@p|0`00 0,0< (p0P }SP@20 P00S 0`` S`` og kpoW@,v -PLM`lp@82 T& V`0 0,0$ (` p ` P jꘀ[⍎x0\ⅎ00@0P jP PP PPPPv -pPLM`l@*$ T P (0S0W< 00$  `  ~j\l ujP P PPpPPP0P -L^M\pP`@)T0㠀 0WB , 0 E 00p(Ppp PPP $0BRU@Pkpl@vp 0- 0PSL@FP nPP0 , 0, 0- 0PSL@ +P nn 0P 0 P0 0-0L@P  0S0 0  00 0,Ǎ 0- L @ 0  0 0S[ :Q0a0 /Z0 P0    0h [$0 0 ꈕ -@L P 0 Sw p   0:0@ #  = S , E@0  d0d@0 0 90   0p``V  ,Pp``V@ 90 000S@ ;0 0W$ 0  ]000@Ѱ$00 @꜕ -LM @   0S9 / &:0  P 0S0 0S0:00;0嗰0 00$ 0:p  郰$00 강 -LMP `p* V# @T T@ Y0 `d d0V0 pX f0;p @T ĕؕ -P Lp7 WpG2 @Tdp) @T!  eYP @0a@T@` dYpW00 V dP  X@9 -LM @T 0S  0C 0 P 0S  0-L@P8 50u  0 Q)  Q000  0QS 0*A0 0 00: A0 PA 00 00Np  0S  p-LM @`A v" + 0`KS" PK  㠂P Pq0S   ;0h0 $0p  ^$0 0\  R 0 B `0p   0D P0-L@P DH 0h0 -LMP `pZ XS@T 0PI T@ cX0 0 d0 `dpV&p" VQ@ zZ@`T`d  !Pp@`TV  8X 0 0f0 0S 0 ;0ٮ 00$ 0X \t --LM 2 -p-PQ LP@4MH`KH 0 0  @pꈖ --L4M@@K0B z  -L`M0VPD ,0 < @  @T %T  R 0 B @0D  D @T0D |8 ,0S l,@T 0DLS D D D D D D D D  D  $ D 0 D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D < D D D @TYT A0DS 0@%0DSSk | l l l h l l 0 <0<00 <0 d0D,pK< S/ h h h h h h h h h  4 h h h h  h h 4 Q a@ @ 1!10A00R0guT @P-0+0 0(K0gC Y @Ѫ30#0 P0S X i @ = ShC @ @0@X+YD D I0S C  0  0YpIXDD 0S C0 @0 HXʨ}D00hD0 h0S C0 @0 Xj-P+P/ P- 0P 0@0S# 0C0 00 DIYpD 0xS0S 0C0 00 D p ID 960S 0C0 00 DpID $0gX0000gQ 00SN 00!10 ! g@ \pGX0x00<0倠 8pK0<0 8 K:<0p (1Wp< E08@K8pK,}<00@0 <0@0<0 t@Xqhnlꀠi@fd0 b 0@D@@ @0  @10@00C @0 0@`FQ@ @E C̸l̖v 0-0@ LP0 SlPl0  R0S RR 010000 vRRR -L!PP@`p 0S 0|R0P 0 T  0e@aP00|PRR -LPP`p 0S0@0 p0T d0T 0P <T2Pg@XRR -LMp, PP0@07 T`( U FT&T &T 0PX W  0pV000 ;T`,0S U(0P @RRv p-LM@0S( 0 ER p`0P0 Q@@Q$T00 0h 00`S000 L0RP4 5*p000EPRRvuxvuؖ -LML0@S 80  Q 0PRR -LM$`Kp@H P 0b -(L  P 00DS   ( 0 @ H T \ 0  0  0i 0S|  @t t ` X X T L L 30#0P d<h lpx| `0-0L@P^$,@0h'S^$!? -LP`p@ Tx h |   \ p      W@ `T"T $T \$(P 0S)P$((P 0S)"p"p${P @T }@T}P(|) -- L 0 -- LP4M@@K B 0 0p -P LR`p %R s R ;0B:S                       d |                                   p0  ;R   Z @T @DTʜ @D T  pa@p  p@P 0Sx ?dRX`X@-00dpPg 0S` -PLM`G ay p 0 S P 00P @0S`Hy@PP200P @0S`4y@PP00 P0 00000SP p-LM`P@ex ph:F p-LM@`P0 S   p p 0 0      0S Tdp@P0SVU@ PEP0TVU Sꈙ 0-L0MDPK@ B 0 Pt d d   $ $ h x  0$(P 0S)$((P 0S)${P P P}P(| -Lp@PUjEx0@S P q q ! -PLM@ 0T0   R0 0Q [R P@v-0S00 0\00 Q\0[S 0S0 [S ]SQv -LM@P0 0S00 -LM@P  0S 0=S   -1L M 5q< ,0 0 4 Y ap`VJPU 0 0 S" `VZLY4,0Q *00010 0 `40 %q0@` DA qA@,@ 0 4  xL@T   P000L@T0 4,0Q* 004 0X0@` DA pA@,@ 0 4 Y0<0 v 0 RBX -LM@8 $P 0 (S -LM@$ P h(S -LM@@P:? @ @ @ @ <@ p@ @ @ @ @ @ @ @ @ 0<00<030 b0 <00 <00S WB?0T <00< <040 0<04SvXvpu8S p-LtMPy@P LA A A A B B ,B HB pB B B B B B B C C BPt^00ipXPpp@ 42 p0<0@ "@`@0<0p0<0y}pyp0<00<0A!0<0]pY~p<B0 ! P 0Ӫ0p p0  0 S0`P50@/SJPK7P0: S`pLo000<0yD0 b< @0<0ktu`4SXldt vpu8S -LM@@P-xD D E D D D E E D D D D D D E D E @P000h革told0 hh*<@P po00htuuH` v -LM` p),0 :0W0 PU 0SPU 0SU 0S  o@  )0 A?U0@0 pP0@ 0 P]P [P P]P Ra -LM[@(0Sd 0  hv -LMpP-0`KW1S} @1SmH -LM Q#p롅`a0S  @T 0 S p@t 1 R Q 0T2 0T/ 0T! :P{ { yut @ XQ a? 0  0 0  R X0 Q\@XP Txkk4t[ -|XL0@ ShI HL L ,M M I I I M N Q 8h0Sr P0^@0[P\ XpR 0ǟS7 S 00BS7 0GSWW0 iPtJ 0J J I p7 R cQsQ CQ  P  700BPtJ J J J 6 R6  00P0S P 6  B P00 P``V10@<&SL00@``0  6p@p P 0 Sx @ @0 @*   5/T ` `  P{ p%0 0  R8% 01000C0E0 %0@00};10@S0 D0 0$0@0T0 $00v 0rp$0 0  R$LQl4h4   PY 0 $000 w($0  #0 00 B3  7 P00 PppWP  0P``V @T 3 DTS @ 0 0b 0  00 m@0P 0PV 3'QP  2H 2 RD 0 0S: 0M  0 0-0 @0 TT 0 0S 0^  0(" 0@$ 0 0 0 00  0R 0 @ꠡ괁1`V P q0@0  R`Fp1XV P q0@0  R`F PPEU q@L 0PE0`U 0 ` 0 0` 0? 0@T 0 R`@0 p0 l( 08&00_kklSkk@h0 Ru M00 pW-00Ĵp k  0pWurl[ll(lu p-LM`@PT# 0dR 0@P0@pv0S0C0 vt 0S00v0S00<0 P bPuv0S00ll -PLMpA0S_ PWa$K@0 (K,K @yPPB H1($01 $0T00 (0@cT  R 0000 0 0@@,0,0 +{0S @TYP p300(Q 0ppxtS[kkkkk\s T -PL$M@`P㼒 r0S㨒 T0S PV0 ,K0K4K8@K @0yPs Ve `FVV80S940q`@M,03,0!0zP00SP 1T0 S/R  P4y|1|!x1l1l!@@4@Py1UpU 4@y0P PU48 ^v4fy540P``p;yx0 @ x00qQk D0@@ P[  00xSx[\s Tkkkkk -L$MK0 K @KK @xP@ vy6 0 RPPu -T0LM @R 8 TT^htt@@$t@u0P00 ͽ ldvl -Ltht -LM,@0(S]0000ku -GML M<2 88@Pp`, $"cp fPp` iPp` 1 @bTQo7*1IKaAA Pp4: S Tc낾iBKHH+ P: Lc8a0Y/S/00@Tt p/P`` 0SP :0/S$ V:0/S `FV:0/S`60 SR0@T4 P  ).P40`FV:0/S  }}f@} -LjM M(kKH0 H`p,0 BP;2Q 7P2 R2 RVឆP,0 S ,'Ѐ0S  |ք6: S" KA ABP L6: S <P $ᾄ6: S V /MK@D @D#P.RuK@PKP!R7P KA AP]NK@D @DLA D;= P@k=1( K ! Q@10 `B P00CS00Ӥ0 Pp @00CS00Ӥ0 PpyZYZf`B7PRL 8  }}}  M4<`( -0L$M@  H0 < H@PPD@ <_@- Pp ePbq0Sp h ።@T SP 4@@kP<<@a<D0SFEP=00LቀP)$, 1ϠA/ 0(@@lN#b8K@80 4 0@ , W-Pq<P @@布<.P$<寃@媃0-S @境L0S @嚃H@@ 0 R@匃@刃0;0<`H0P0GPrwhH D a@m}}}<MbHXh }x -LM0 4 P; ,K 㑂p# ,0.#4 P ,K ~p ,0 #4 PPlx)l@ll 00帀\8,$@4,4 00姀꼜ȜМe$( 0-,@,PL $   븂0P -LM@P 0AP 0-@LPU 0S.P000 -LM0@S hp@-0PS00p-\@@T \ P`r00 P 0 R0ATapX -LM0@SK P  00 -LM@08SK  !p 00  O$ 0-0PSL@0S00 RP0P 0S 0- L0@T  0P0Q 0S =S Qh0 `0 00S<Q  !Q >Q  P1P e}} }x -L5눝 0-XPL0S S 0@ S0 00 }} -LOM\0X,0 0P S ,0 S ,,&OKKK`VT lQP W?K+QwPW?K \!QH1SD1 L1@[0P S Tb818S \)<\00S#\! D`K 0  \C0[SD[0 CR 0R P 00xNl~0 pW@X D00CS00  ä0 ND؝ 4 -0L 4l븂4 p-0LAM @P` s]p sP` /0 @bTQ!P 9Pp@GOKPP V{.3PPxLX@Xd -0L 븂p -LMnQ@0,T  hlz00000 0 000H  -LM0p (0 dP@/UoKK/WPKU  S?K\ h0SKK,L1 H1 D1 @1 <1 81 41 01 ),KbL0:# MU7(0 S ( -LaMb>K0C 0Cp( @Pv$6: Sg  S|PW(0 S (KBnK`F`F|!|1(_0S[@aDPP$[NK@D@D  AP62W>C R0 RW W6,~z0S &@PPW d~BnK`F`F+L0)0KW OtyedA|̞ -LM@X 0s ]]]T06at -SL Mp@Py00!1/P`!  SVx y0S@ 0P' P* <W@y?00 \@a` X0P' P* "W@y?004$}l{ty  -LM@ K K 0K @@&P -LM8 < @ P`pm 4K:P@h 4 0R SB P`Z 4 "40@#XP0PS ,KL PP 0 P@ U10 s |PP 00S0 K^P 0 R ;;S fPP 8=P ZPP 0< @0T NPP V Hty$,@| -ML M0$ , p P`:x?000!1 ,0S , AP@ KP 0 4P x0S08x0S !0BKHH F!0@CcPP- ዛ0@S" 0S 0S+ 00L} \ 0$ 0:bx?000, 0gc$DP`dxd -L`S$Mp0K,  Q Qq00  Rp0+S-S-S +S 0+S-S QN QLq<30  00S.^A0.S7 Z0PC Z04 "O1@K00K @0KD@H L P K 00K\ 10(O @/w "00Z w 0V 40OSl,0`( &"0K`PP, P0 Q!000ӑP PUw"00 P pL1  0P81@@K1`E% 80 ,,8 p0@0KX0 4 Wq0K J40K5 B"0@Z$$ `JPU *0 K0 ZP00KU:@ K00K ,@ {V`})V`XH -L00K,M,P0K?Op#$pW4 @@K0 PX @P Oß$ 4Be!5P[ 00Sw"0 0 /";0@@De#%P[0SY8<!!O1@K0@ oP P`O$  !5;B S<0 8 N 0,E @,P00Q 8 0,Puڼ!@@PK0 4K !0$ 0d|8^,Q@00 K00cPE: UcU pP/(hh0DDwgfffQ p-PLM@`PC ph10  00S H100PC r0 0  R1.\P' *\\ 0SU 0B8 S('08C?PPPڌ@PEUp pT00  0<0S000PC r0 0  RXD4D -LMp`#0P@ r `\P \0 P@T -"P@2L MR0@K0 p` UsLz\Ō\pG   a 0a>Ìp4G6pGƃ??p`F R bЮ?Ф@A P 00Q00S Q b`.^L2a?@ C_`0 ]Px 0 ^P0x0Ńƌz(p , 0 KV10U0 0 P@0  0 0 ? -L Mp`@P@<K4K0H0S񟗦8 X | D l $ l l H l  ( L d 8 p 8 X | D l $ l l H l  ( L d 8 p 8D3#cX Q0@ 0 KD0  DK5P0S Mq!000PKp nDBq!00CP3L#cX Q0@ 0 KD0  DKP0S (q!00 KDq!002cX" 00D0 ?0PKQ@  DKP0S q!00h &Dp!00ŸH2D"cX 0QD0 @ 0 KH0S DKPp"00p"0020K00!1cX! 0QD0 @ >0PKA0S DKPpp"00lp"00ht10 KdQ814!cX 0QD0 @ 0 K(0S DK|PLp"00Hp"00D00K000 0cX @ 0Q@D0 00K DK\P,wp"00(sp"00$G4PX`t|ȠРؠ  T48@@0D cX 0QD0 @ <O0 KX@0S DKPx0 R 3p!00 VC*p!000d00KP0 cX 0QD0 @ O0 KA0S DKP01 R p!00l (Co!00x1600KQ1!cX 0QD0 @ kO0 KA0S DKP1 R o!00 Bo!000200KDR\2`"cX 0QD0 @ O0 KB0S DKPb2 R o!00Z Bo!00Q2ګ00KR2#cX 0QD0 @ O0 K8C0S DKdP4X3 R {o!00, Bro!00#3謫00KS3#cX 0QD0 @ 0 K`C0S DK6P@3 R Mo!00 pBDo!002~00KR2"cX 0QD0 @ 0 K0S DKP#o"00o"00d20K00T"2cX" 0QD0 @ ?0PKB0S DKP1 R n!00 Bn!0010 KQt1p!cX 0QD0 @ 0 KdA0S DKPD1 R n!00 An"00v000KP0 cX 0QD0 @ 0 K@0S DKPY0 R n!00QL An!00HD0Ѫ00K <DL`dlСT?G? >uk"00&D4$cX Q0@ 0 KD0  DKCP0S [k"00 @ ~>  z>Nk"004C3"cX Q0@ 0 KD0  DKP0S 4k"00@ W> S>'k"00Bl2h"cX Q 0@ 0 KD0  DKP0S k"00@ 0> ,>k"00A1!cX Qi0@ 0 KD0  DKP0S j"00@ >L >j"00`AD1@!cX QB0@ 0 KD0  DKPw0S j"00p@ = =j"00c0 0cX 0QD0 @ @00K0@0S DK|PLj"00Hj"00DD00 K@PTX\48`hpTG?$P80< cX 0QD0 @ DO0 K`0S DKBP0 R Yj!00  |=Pj!0000K000 0cX qQ00KD0 @  O 0@K DKP0j!00p-`P@0!@`Pp -P@E:::LCLM/\p, J\!h1S   00 \ 8AS, 0110 p0 0 10 46@ d,0 "&`'@0@p 00 `P@0,!O3\ \0 rL03  1S@Rp@- b@0`P \02l`1^1b\@0pRp@- b@0`P \02loQ^Qb\@0pQP:  -P@L.h N\ Kp`$T<  0 p`@A 0-L LP@[\4 '0"0A -LMO@i0S 0-H LP@H0S0hLp0 -LP@,M⌥0KQ0 @ ,@ WSO@S`8 RPRI*R4%0 0 0 s 8 0b038 b&xL@X(8!8HT*@@*TI2@0@b5PA8@8#8XU*P@*U@2 ȀP 0&@-O@d4xB 02d @-M0Ѝ@4=> 0 5ꔤ -L MQ@0K00#  0 0T0P00S00#0 -LM K K!P -LM K K!P -L 0KM#'$ -@@L0MP0  0 L0  00S00 K( KDP(a00D -LM`Rp @t%  P`F @pT`P0AS Q)0 0  00    p-LM @0`SPR0 S    0100p 0S Q0 S  0S0 .R@- P@0@ .\Q00Q0S@@ 0S0 .R𠁢Q00á? P    ( plhd`\XTPLHD@<8ᤤȤDl4 0- LM@P K0  0 p0*Q@-@Q*\?\ [\#\ q 30  00S+.10#0 \00S#10#0 \00S.20#0 \00S  \  0LS00S qX2  00S \\ 00@M \ J @ @ @ @ @ @       0 @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @  \00n  0000D0\  S00000\00a \00b \00t \00v \00f \00r  R   ?\*\ #\[\ 0 \ #3 00000 00@\00M0 0qL00  0 0S-00 ^0\0?0@0\00s X p-LM@QP`0 f0p0  Q -LMP4 Q @pB8 | Pz*QP*Q?Q [Q#Q p10  00S+'10#0 Q00S#10#0 Q00S'20#0 Q00S : Q  0AS00Sp1  00S( \Q PQ T:`4P00 V Q 0K0  jQ@80c@ T4:@D`0K0  j` VPE  @`X -@TL P`p T0g0 0l 0 e@DT * -ML M<$08,0  ,PP^ $P@cBnK`F`F sP 0#S   P< nP  hP33p 0PP( BNK@D @D 44S ?R0Sp  iPP  44S ?R0SpO/2 ,0S ,;BnK`F`F B`rP 0#S \ 7L 28 -P  $PP' BNK@D @D 44S ?R0Sp  PP  44S ?R0Sp BNK@D@D +< PP A0S  PP0SU|0S  0S  0Sp 0ST P@008  @ttxPTr@XH=pjog -40L R4P P00tx 0-LP$P P$@ YP00x 0-LPP P$@ DP00x -LtM@0SK h0鉀P H K 0S x0L: S< ]O00]0P0t -LM@0S00t -h0L,M80 \0 00 T0@4 , (0 $@ 00 8K 0  dh< ꔉP0@-@P  0S ^ 0S^0 @0S SS00@00P0* -QLM@,0 pR 8P4 i 000 h 0p` V Vᘦ%j:$,0P  0\0 p` V000S00 YB080 4 0\08 0\0I` Vp Vᘦ%.:"0\0p` V?`Wpᘦ%$ 4,0P 0\04 0\0Y4 @,0PP`@,0PP`\0 0* --L]M qPM?KC/`KK \1 4Q 0Q .  =K0K0㑟0S cK|1 1  x p@ 1P|ޟP 0S L |1S00\ 00꟟0|1 B3*y0* -4LMQ<@ 8#8Q8:0Q 4 %*0 0K Ġ̌.Č#̌ !o Q *v* -LMP -LMl"  2 ,  " !H p ]0P2 0PP 0SC P P 0S  $481!`)!<[0`X0 `-0ᕯKS/K ڜ1S9 @T  0(KQ QMK0SMKP"3@(K0SS SQ  . .OK @D. |}P-?(K R!  q}0S -?(K R2S "RםK d{K\ǝZ0 4  MK0iPMK* P+ 1dMK  PZ ib Z0S }Z L[* 41`BnZtLD - hbZ0#S ^Zd < R@]K 0@,q"|@B"2@@P 0S"2Pp@ lq$̦ܦDp4l -L,Mp`@ KD0K< 8 @ 4 0 , ( $ ҤPDP@  0`4PP @TD}Dyp -LMp@P `p08K8 (P , 4` p7K0 8K (0S ( -MLM Z,   4 `a V $ 0P@Q X1X1 - Q#Pp' B^KPEPE0$!@|ÿ`|V INK@D@D~P 4: S  R 0 0 ,0S ,嵡aPt $R 0R\ 4 L 8凿`XȧDD -LMh@pP` 04K4 $@ ( 0P `3K, 4pK $0S $nX -LEM@pKK, 4! <K081 P@  #R 00T-* R+ R) R' r0 0  R r0 0  R0 Qh#0000ӑ000\*0 S S S0\*0 S S 3000 \ *0 S S\*0 S S  \* 0 S S S R r0 0  R> \*00 S S SP\P 0S ``Pz0+Sd -S D 4zP0+S0 -S PPUb ?? UP[|,0 S t,宠0S @S P K?KN)`0S @S K?K@)0SP @S  4.P`8~ 81S  K?K() 4t8 0SP @S 8~ 81S  K?K) 4\8 XHh -LM8KKPp <, PP `P@ ,0 S ,4P/K%>KH D LB @B xp -LM✑圁`KK <, ````p@\PPB <PPOP@EP/K%>KH L @B 0S J "00V:`P@ `8%0==0` 0ɍ @ a0AS"dg g g g g g |g g g g g g g g g g g g g g k @0>0@0 @ C. @ @00p+WP -W=W@0D =W << D @0 0X0C S񟗖h Pj Pj Pj Pj Pj Pj Pj Pj Pj Pj Pj Pj Pj Pj h Pj Pj Pj Pj Pj Pj Pj h Pj Pj xh h h h Pj k k IPI< @\  @ R  @0<@0 X V:H   ₑ H lP@N  j 0`@C80@ `< D0R0+W00=WSD  V:H   ₑ H FP@(  j 0`@C8@ <0X~ `< V:H0 0⃑ H0 +P@  j 0`@C8@ 0c` &XD =WRD0=W0VD0 :H ⌑ H P@  j 0`@C80@ =`< R V:H0 0qH0 P@  j0`@C8<0X@ !`0S ,S 00 Y ꒀ;I9 ឌI 0@'͌@ I X@-gQ@ =Q +Q -Q \ XQ0R0- 0+oQ uQ\00@ ! 0 00 0 +^00 -^00 =^000 0@-P 0+S -SXS S5 0+S -SXS @ 0-S" +S XS00 T-00@P^+00P\ X00P0  @0  @0!* --LM p-P0LM@`P8 4T  4m 븂 - 0p@L` GPP0S @TP@ -L 0SؙD 0-0@SPL((ٮ 00 00 ̱ 0-0PS@L喋PP咋 PP0P -LM0`Sp (KWPP (QC 0#S@ S> 0 S RA(  #P0e(0 (⌋P@} ( (0PPP@ P0 S S0 S S  P0P0,K ,0S ?R0Sp0PB U 0@S  R00 RZ@ T 0S 000 ! BX @̯P@ (PP 000  bG0@NG0@00㮊P0 P 0V̱D0D -L>0SD\_*;\* -LM,4C8̓ <.K #h, ?KKK@D3 0# p @ D -p`LFPP wP @P oP 0S0S D 0-@P@0LS00f$ 0000ᕫꐞD -LM(@0S0 G00ꐞD -LM0St (K Q@`Tg ( 0 S RL0L(  S *5(0#` @Rq PU`@0S0T`Å᪬PP `0 S S0 S S ᛬P@00TP@ 0U ` 0S  R00 R@@TP U 0S |00x0V:\nPP 00PP@Ņ,,ǪP鐞0@-Mp` @0\@X\x\@ Q $Qq0 0  R#0C'  Q .Q0V42:ЍQ q00  00S 0gC R17 1RTq00 D R q0 0   Ra0LA0LX** -PLM`p D000@,K0K 0 , ( @@p0 WV0000ɆPP0  0 @@p  C0@C0@* 0-! L0TTf!P@CT @@ T 0C0 0<4 -LMp`PE@匀T ^=0S0d0 @ȥX00U@ <:(+("%Ch8< -LM@(@T0 @8h   B00! RA R0000000000000000Z* * ?0-1pQ LR@` 0S 4P @@ CZ0@< H0k000S@``d@ ?0-1pQ LR@` 0S P @@ Z0@< 0 000S@ttx@ 0-LM 0xcr.0l@h]PTXX0 RP 0 PP@ G0鴼 p-LM@hP`6\ 0 @4,Tp`0@ Rꬼļ 0-@LP 00,@r.0  0h괼 -rSLM"0@P` :\Bp 0P QB0pLB p-LM@hP`M \0 @4Tp`0@ Rmꬼļ 0-@LP 00,@r.0  0h괼 -rSLM"0@P` :Bp 0P A0pA p-LM\@0PSP`PP \@0PPPpPp鰼̼ȼ 0-LP(eP0@P @^0鬼ļ p-LMDP0@S8`p$0P@@@깄갼̼ȼ -@LM8h5ꬼ -LTMF\` \ , d h g l 2%0S U@T %0S :Sd P0@T @T@KD\d QR dPPDDDPP XK 5X0S p00R0Sd@\T00Q00S ` PT0PS l  R T@0,S SS S UP0T0 UP004D,0 S 0,jUT@PPh@T P@K0h LK@&Ph Uh  LpLP Lyh00fs`V tCDK0\HK P@KLK @zPULD0LP 0H3LK2 P@K@P`֤P: h0S@- ƒh@ )R P  T P@ 00CS0 0Ӥ0 P p )0+S:P P P ㅤP TKC\ d0@RSA00~h PlP \QP!00 DQ0SG d0S7 d,0d LKP@K@sPPP L<LWP0T@KPT sCoCkCPP d@T XK X 0SpR`@@K` `0Q&H0 /Pȼм̼Լ@]*ؼ*$* -LMğ !  \ ,    !4@R@ `h4@K K 0  K K ,K  K K K K KV0 \0 x X0 T0 P0 H0 D0 @0 <0 80 40 00 L 0 0 |0 t0 p0 l0 h0 d0 `0 \  !@0pCⅠK  &bPP.0[  R) R' T*00K[p20  00S  Q"0000ӑ0K[ Q"0000ӑ0K[00W?L0@X XKK, }PGK K K K ~K zK vK rK nK jV0S x!@l0S3 0CS/?u@41 ,0S 4,^ KOp>0S   WKP7KXKL00L0 60[S0X K60K#:>00Hip`> 0\ XHXh< 0ؽ0\ -L0Mp0P 0 `@ LKL@KD00D0 Q Q >00 0 S 8 ݆, QČt,t,t,: Sb0 d Sc0 ] Sp0?0 0r0-00w0-00!=@SL CS-0> X! r0-0 0w0-0R00 &R-0! !r0-0 0w0-0R0 R-0 00 0 R 0Rt0T0x00 R 0Rs0S0x00 S ! Ss0S0x0 Sd0 Sl0  S-0 Ss0d*K**%*o* *R0S 0S0S0  R00 -MLM00  0PP `P@T T 0T,S 0S P rr  0PU  0PP  0PPP$ p-LMP0 S0 `@0 P P0Syr0X S0L@0Sp00hr er br -L MpȀ@0`SP(@ &\0  :P 10$ KvP(KF4P  (,D0  $*r|,@yL@-0S@ @ 0 0 0  -LM`Q ^( @`p$ 4 0PB ( K10"P; (P6V00T00S(0V0T00SW ̘P P0 $&@6$ 02P $ 03q$Kⶒ,@y --LM -L@`p.`0 XXPbT  8R8 $0Ey  Qk븂m --L 0-<0@ PL,,8T R 0h긂 0-0L@P 0S&P0 CR 0P0 00R P". 0 0 -L M, ,P0 `@ t00  R-T0@40  +T4 @VV0TP V0T ``|hp$t0 0Q0@Dt0 0Q t0 0Q7 DW D@T\ W00 T00SG' -p"00@40S\00pgS \,00E0XSxS@`PX -PL4MPL p` 0 S@P X 0 S @P L0@KᲶP\!H0KQ, < 8 4 0 p4@HP D `` @0)Sn6 0  ./ }+0U# >E0CS <0pCaH0S  j H N a 0H0 L0U 0R*0 0\)X{} 0-@PL0\*ql0  0!0S T000@CT00^00S 0 uX -LP0SPp:qP`\&*0^S00p\*0]S -S \0* ]R S*-R P0]S-Rx \*0]S :0SS 0 0@SJ0  t0`2  00SH@TZ 0S?W"  0SJ 0 @@000l 0\0Z 0  00 0 B 0SP  h hb  P  000  00 -00-0 -  Pz00 -00-0 -  h00 ]00]0 ] h P & P0S1*8  P+ 8000X -@PP050#-SL [S0 :Sa =S1  pR*0-S `WW  0 00 \  X\*0]S -P0`0 `0S0%*00-S]S P*0S*0=S .0]S00$P*0S0"*00-S]S 'P *0S*0:S 0]SP*0S05l:o h -LM @$Ap\ *P q00  R@ `ePi P0S PP PP  000   PP0S ?0PSX -LM@=>0 00  0- LR@%*0S*0[S 0 0.Q00PQ*0S*0.S [00]S00Q R* -PL@  R)* P*0PS 0]Sp`ePV , rP0 R 0S(px0   0 R PX 00p , 00  RP XHX p-LM0K KP` 0 ]0@K0K KhP`p -0L `@8pP Put00  00S P h ]0S04  4 X p-LM0K KP` 0 ^00K K]0 @0K K$P`p -LMP`@p0SGT1 T00W0 W00Si , , , , , h l , , , , , , < T ` f 00   f  f5"  A,  i f0   f  f"  A    @`pG f 0  f  @D @D`q0 S  -LM P p0 0@W` 1R VNg@0S P0 Dg0S 0S @`P  R Ϡ>1*!">00c # Ϡ j @ tgP@ 0^?>1  ^06g0@WgP@ 0@0'gp@-0`@  ^R *0 00  n^ :0E\  00C 0p -L M, p0 0 S@"* 00T0R00S P*`P0 00 R0#S P: P @ T:`@ T*,,0p-0 R*0 R:@-0@P*0  \: -LM@`p嗼0 00R0XfPU@  P g i霹 0S  Pi}ff- 00/>\ 0S0\ 0@- 00>Q\@ 0R0\00 -0LS8p`0S PU`P 40PU040@0 S @TP -`RL@PpR 0!A000 p-LM0@S`P 0\ 0  !p/ p-LM`\P p@  A 0S0 0H0SHP Z  e! B 0A0S 1>3 01 0-0@SLP0 e0S @ 00h 0-0P0@L e0S 0 0 00 0- LR@00>#R0 (R" R @0Q@PR@P05eP< @Q >3SAQ 00@0QLR RRL>31>#R R "RR R(00(000S0 0>3S S S\(00(0 P L -LM 0R  @T p0R000PP P<PheeeddeE -LuMp0 (, 1 dP`` dPPR 0@x1 0$P}K@{K 0 oK. ́ ȑ q 励uK %P? 1 p~dP@ oK 0 ,0S ,i0 ]10Sdd H0 @Jd 0AhE( -LbM⸠0JK(0 p @)@KkpcZ_K`\!P TjKjK11 P 0S(0 S (iܹ -$0L!00  -LMpj1!W pG T (00 0S @S@S@@@0j!T@QQ10  00S V؁P@ h P1@0\ \|1  00S\ Tڹ`\!\1g0XSxSQQNq$10  0D0SE W0P 0\6 \4|00  0D0S+ |  0 0  R \ 00ӑ@ ṲdP`a\ h000X0 WpGk 0002XpGHX$LH` -LM0  Qt -L M@ 0@A렾R*Z* -QLM  0K  0   0-LP@p P?p U T 0\ ȼpP U㽺먾  -LKC/JK X1 0Q ,Q _?K A xA tD0 bKd1 t DQ + 0S bp'${** -LM@`p(]PP: 0@0@@@@@@@@@0$` $0 P oP@0 hP' 03`P,YZ#| WP ` 03$0  < ᙺP$00$0e]]]  `0S $ )@TD0 003$  3S03Y`` 0SV,0`@,@ ,@ 00|0 04 -LM( Dp$ ` /WPP P Pᣲ@ (@00 00 0S p-LMP`P 3@S0S0@\3S\P(P#x\$0 #10#0V@@Tk\0pf\R0`\P` $0E`U\ -@LT` $0* 0QP3 Q# R 0PU@G 3\3S3 3S S  $00 S/0/R@0( D  P 3S 03$0` ᒹP3ա 03š0 #0$0@P$0 :.$0P[3s7 0$ @Q$0@ 0 S003P $0 :P3 $0p P o 0@i@$0 @2 u[ @@_Q $@ 0 0R 3 P0 3L00 <P  *PP$0   30P0K0 8PZ3 03 PU 0  PU:$000# 0B8S 3S  $0H ̸P3ԡ 03ġ(0 #0 d R-#L 0 0 :Q0-Q@@TLP`=p@$0 3C T TP+ U$0P:$03PS0 /R $0@  h tPp P600 -L,M , 4 `PV , R0H0  $ 0S0H0 L ? ,0H S@@PRP < <0@0 4 $$00 S/RA  0T0 /00TT 4P #0 ph0 D 8 Z }:PP $0 0.S  P@y Qc*D #  00S$0H:<0S HQ 0 03#40000Q08 8@ @0@ 8@ H R L0S P P $0 0D00$0D00 H Rں#0B8RSH00CH0 0( 0 DT Z0{ 40$0:$0?00puP  W $0 P T 0phTPY0S 4 03$0:$0P 0S[ 040. ScU P0SA$0 0YXT0AT T 0@0S ,YQ4 3S#$0 Y 0SY00 0 ,0S4 # P 4 #$0:$040 0`0' 40VP @   4 <3@ 03p00 <0 |@h400420#4 0 BH  L ,0S V4 #Q400d -LpM$0@0PK@P0J 8P10: S S 0  S00D00.S, 040  3S,0Q  3S000P0 E0S D040. S00` Pp` p h 0 0pP 00 -0LRP@` V P  0V @T` 0@T000(00XPpPppX -LM$0HPPp`XP@ 0 $ 0I00D @0(`޾0 -PLM@ @XT 0-00L@ :0S00r?0 00X0XPP 0S PoX R D0P00c00 R3 SD0Q00c000S0 3S 0-@PPL0;0UP1S -LpM$`@P R KPp 0 0R, 0R p00V@@p  ᐵPP p-LM` PP p 0@0W WWP -LtMbp`  KPP0: S w0 0 p( 4WP@# $0 0P $PP 0 Pʼ;#;S + mWPp  P`P*7 WD @ -L4Mp, &$W, Q< , R0, & BX 0BX0 嗃#(R@40 T P?4 P0`Y 00  Y 0AQ0 X`P&TP @0P UR PUJ P"0Y<0 00  Y 0L\0 `g@g' 0L\0 Y 00  Y 0L\0 P@g< ' 0L\0 < RV 0 b0hP,0P㗃#40 Y0`; 0@P0 4@d0fgP!P Y0` 0L\0 ^ T.4 , d/'  0  0L\0  0@P0 ʿ,0T`P0 0V*@T%Pg PY 00  Y 0AQ0 @' 0AQ0 P`0V: 0Y<0 00 0 0  0 P Y0 0L\0 0' 0L\0 ' 0AQ0 4 4P4 P4 40P01@80  8P@ Ph PZ 800cD0 @ 8PP? P10@4 ` aH 84 HPa P4 P4 k4H H 4P4 PH4 40H P D D0P0 PD D0P0 P   P P  `0VL *@T%Pg PY 00  Y 0AQ0 @' 0AQ0 L`0V: -LLM` d d@` @d@ h0 \`K$ h0 PpW:` <Q U@ * 0dR @T`05<5:T 0 00` 0 0Pp$0(0,0 0LPP d0S`@H0SW 0 P0P00 d\ Q D0^ "0D0^`H0S0 t `0L R0Sf R0S]  0_P@ E U 0 CPU 0; HP@ d\ 0hc/0cOdP^*hP@pD0^ 0  d0^p@P:PPTTTPP\zT ;T`@L  0%0D+TPc`H0S[ZTXT`@0\ jPPBp -L M@0TP 1>3S S 0P>3S ? S S 0@U S SS S 0P` 0 P Fp, @E  0@ PP, P , 0@S8 S !S 0P` 0 P Fp@E  0@P 0 S S 0>" 0c O 0 > 0c" 0P` 0 P Fp 1>30@C0  @P @p1>3@!>#"R@D 1>3PLSJ1>3P!># RA -L$M@ ,@ 0 p RP`A>3S S  S PU00^ PE0A>3S aSV 4S1>  0 0r% 0 @Q00dS0  0dV0  ?P   1S P1S 0sS ,1V >3,@0ca0 0@P@D ,@  ,00C ,0 ,01 , `{S@ S > 0  0cO0K ,@00 VP000 KS>30@C 0,0 @>P0!@># R 1>3@!>#"R@D 0a @ K> B000 K@K ,00Ps000,00 P>30 z V  VR  0R MS S  V`EV V@*0 S=090 0V V0V5:-0 SX S&S- S V$ V*  R rlA 00  R _Q 0VV r, 00  R_Q00  V V*0V S VV r@ 00  R_P V5:00 PA >3PA>3 S>3 2 V  0|X -LM0Q, `Q0 AϠ lp 0 4 00XP40`l ^0p U40 @  U V  Vs T e42W  U' u "0 0Q_U  V v 00QF_VD  U u!0 0Q%_U# A?G0CS >2,0X  R 00  @P4  0  @0W  V v 00Q_V pp0  @@DTʎ0 00\@\ d0Wpp~ 0w0r ,@pn 0gX -LM, 0 0Q0 `Q0AϠ l040 0PX`lp U@  U V  Vr T d02W  U' uŸ 00Q_U  V v!0 0QE_VC  U u 00Q$_U" A?G0CS4 ><,00  X^4 00  @P40  @E0W  V v 0 0Q_V pp0  @(@DTʏ0 00\@\ d0Wpp 0x0s ,@po 0hXG-Q0`A $ P !>3Sy < S7 S S S Q@3"Zp0   S S0ZS S S0>#0S S S S "S>0!># R0p !>3 S >3 !>3 S&S S\0X0>0400 S2 aB0L~ -LTMd h h@d @h@ l0 ``K$ l0 PpW:d <Q U@ * 0dR @Td05<5:T d @@Pp2OP$ 0 0( 0 0, 00 000  4 ᭺ 0SPP h0Sd@H0SX 0 +P0P00 h\ Q D0^ "0D0^dH0S0 y d0L R0Sk R0S`  0fP@ E U 0 FPU 0> NP@ h\ 0lc/0cOhP^*lP@pD0^ 0  h0^p@P:PP$NNNTPPYN$N iNd@L  0'0DYNP^dH0SVNN$Nd@0\ PPnp -L M@0TP 1>3S S 0P>3S ? S S 0@U S SS S 0P'` 0 P Fp, @E  0@ PP, P , 0@S8 S !S 0P` 0 P Fp@E  0@P 0 S S 0>" 0c O 0 > 0c" 0P` 0 P Fp 1>30@C0  @P @p1>3@!>#"R@D 1>3PLSJ1>3P!># RA -L$M@ ,@ 0 p RP`A>3S S  S PU00^ PE0A>3S aSV 4S1>  0 0r% 0 @Q00dS0  0dV0  kP   1S P1S 0sS ,1V >3,@0ca0 0@P@D ,@  ,00C ,0 ,01 , `{S@ S > 0  0cO0K ,@00 VP000 KS>30@C 0,0 @>P0!@># R 1>3@!>#"R@D 0a @ K> B000 K@K ,00Ps000,00 P>30 z V  VR  0R MS S  V`EV V@*0 S=090 0V V0V5:-0 SX S&S- S V$ V*  R rlA 00  R _Q 0VV r, 00  R_Q00  V V*0V S VV r@ 00  R_P V5:00 PA >3PA>3 S>3 2 V  0|X -LMp, 00 Q,(P4 0 8 0 Y=0000AϠ0 P0P 4 < 0Y04 `<0P 0 V<0 @  V X  X T sp2Z  V' v\ 00Q_V  X x$"0 0QT_XR  V v 00Q3_V1 A?J0CS$0, Y00R0S0 8寱0 4媱0 80P1P<  0P00 P P0Z  X x 0 0Q_X 긠00 P@DTP0y 00\@\ d0Zo 0h0c ,@_ 0XX -LMp, 00 Q4(P4 0 8 0 YU00 000AϠ PP< 0`Y V @  V X  X T 00 P@DTP82Z  V' v$"0 0Q_V  X x 00QU_XS  V v!0 0Q4_V2 A?J0CS$  0<S 4< 孬P ,Y 0 8°0 4彰0 80PDP< 00 P8P0Z  X x 00Q_X |0wX0X `0Z@n0h0c,@`0YXG-QM@p(,P >3 S C S> #S S S P@Ѝ3"Y0   S S0 YS S S0>#00 000S S S +S "S 0>00 1>3 S 0   0S0 `>3 S >3` >3 S 0&S Sy`0\00 >00`0 S00h0S0`@Cca@-M ^@ P`pX\ Ѝ(@ \@Ѝ@@Ѝ@eE1* -<5L|MHK0 @K0PuAe/ᙴ@ L L R *0S0L  L 0|S :S 00$@$@@L KPڄLFPX00 LP`: @PX0L0P K@X0pP0<T K(@(0T0X K@00X0\ K@,0\0@L K40PL d K@p00, d0h K@80p408 h0l K@<0vp6[>lp K@4np7[0Pt K@4fp7[04x K@4^p7[0| K@4Vp|00 K@P0Np00 K@T0Fp0: K@0>p0,K: 0墛 0K➛ 4K⚛d>F`DX8FL^d3FKD޿L^*FEDԿL(Rh@0AZ0\<(^\2:FPX' D帿%P@@`H PL\ T D P( )ED塿^KHPEPE0!  P@*|1 R H gPD %X(L  P 0‡Pp KAA CXPX E0帛`@EPP  0P@( @<8PFPy`` _EP  ̫00`HH L |P| -LM@p$ u$`K ,PK 0 p P , 0S0$ 0C0 00 R0S   \ 0 S @0:SS |S0:S|S S  0-L@P0h -LM<@0S00( (0H00 -ML$M0cßS0 S, 8 < rP "0S0@05 KAAgP@R 08 0 C0\  ||20  00S X0 S\R000:S #S $Ÿ ^0 S\R00KHHpP0 :R0h;cp0 \ B*K08AWAP=|gP08@0pC0@.š 81 p p@qBNK@D@D0 08 0KA8<(0 A@;0S@ 0 ,0S ,I:80@ @00P dgPP!0<{gPCX -Lp= P@ dCP`$ d0:SS ^S \S $ @^ 0:SS00f^@A`8DP`V DPfd,DP `d P00:P\00BS1P0C@ 0 0/S7SB0@@2S?ht|ht|00:00 0 0 00T 00S:S00ov -Lp= P@/ dLCPP! 0d:SS 0`e\d@ 0:SS00e\@APCPPUaCCPd P  0-LP# P 0R @ 00B SaBQABW0B\70BS>. 0 XRxR @@00 :S0-LP 0:S0@0N@0- 0 Sn@SD -LM K"vtO*$* -LM0`=S`pP,KRP@; U P:0P00@S=S 0S=Sg! P,@BP 0 ,0RA 0=S 0S0 0=S=000P0 @0S 0S` `00cC QBP@ 0 0S Ш0 @0@, 0C p-L@`M@PKP 0! 0S0 pC 0-L M@kH0P (0 $ 00K K(0@  0  ,P 9P 0h<4 B*A`*#* 0-L@@-@0S  S 0Sd@(Τ*(Ȥ*Q0 {b 0wb$h﹤*$%ﳤ* -LM< 08 rSwS@T 00  A, ,0SZ 4KPTpPH P < 0rS <0@4喻,0@, P,00,  4@00@T 0}@T< 0rS 0t4P 80MNM4d0@4`T B4W0U,A,Ah -LM☀@`T 0S `@TT $pK pPj0S V0000sAu$ -0-LMP0 S@   R1 00 cQ  R!,0 偶 0S ~F0C -0-LMP0 S@   R1 00 cQ  R! L 0S IF0 -0-LMP0 S@   R1 00 cQ  R! 0S F0 -0L C -BMLMh#0P,0 0L4  0S 00,3 ,0S ,E/㵓PL$H$ K>2P@@ᖖ00 cBK J JH 妓MK@DPpP 0Sr|`0CK0A S A P2D4 H2@ K0C0C0  A  ᐵ>00C=S񟗗ԛDDDDDܝDDDD4DDDDDDԛԛDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDԛԛ0 S  1S!00 c0T p7C0L4 dPnL$R 060S3/H|ĿпCh@-@^  0 S SS00N0 --L !4 0-LM@P᳓0S 0X0S Q0S  K\ 0 @@P -LM@`POP pWW0S `U @YT :0S c?000@0PTP:@T TW ?PP  㙪 0 -PLUp`@: PP@ U:` `       --L p-LM@P\0X T`T < 4 000 㣡ׇ ph鮇긂mP 0000ӑX p-LM(0`S/   P00 00 @T_Q <0@T_ p R 00c@_ 0(pP@ u0 0 -L '* -2MLM#0@,0 k0/S  P BKAA g+ }p Y W3*WY 0P/S00@83 ,0S $,C/ YP<P"P@aTnK`F`F v0Z0pd  1 0 S/R  Rm/0 0 x2(K RW\IP LDP@ Y 0C/0h@+!PBKAAP@L<: S< S0< ?nK`F`F!+PP|1@(K /R@ Y!Z 0 S/R 0 S*>K0C0C/  +Ɔ Pp* +Րp?00^ 0@C/Z0@h>00SZ I, D\+㰐>00S8 B>K0C0C+< 塐!d p-Q00P00LMSP@`P 0s pg=p[(=P@`I00p 0S S* --LM  -LM0P\04#   R,0 p 1S018 `< @T1 tT?   0 R 0S0q?  0 0S 0 0C`0걓P %T 0S 0S0 0C` 8,0 S |,/BᓓP 8P@pzT|ꐬԶ,8TDX`htĸiz 100Cu@ <# 0Sq 0q;  0 0S 0`0CS0 P MT\ D\Z  @ T *000ɒP d X2 `0 j 0 0 43 0P4#83 04# `83 Z  KK @0S 0 0CZ @ S0 RT `ꌒP T4#0KK@Q4C @ 0Z0C0   0S 0 R@X 0088 bP XZ @&43@4 0qL9  00S 0Z0C0   0S;P 8#0d` 08# 0\0q8  0 0S0Z0C @0 SP x8JZ!3Kg @+0DMSa||̱ȳȳȳȳȳȳԳȳȳȳȳȳȳԳ<3S<  @00CS0000TZ I@XXTxT@ ;6 3K<# -43@ 4C  43 43 8C@8C 3K0``@  43 @4C  43 43  43 @4C 43 43 3K<#Hv3.KXXoRP  <D%00<3 <,00S<3 ʔ<# R  &3K 00X< y4JZ!3KL @+0D:SFh\hx\,,,,,,,,,,\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\@00CS0000?Z  /@xeTET& 3NK0d@3K) =K43@ 4C  43 43 K83083 43@-x4# 4# @x3KXx3.KXᗐP    9 S9ᅐP @< |KKp@u@r@phP@0<3 f倐lP  43 @4C `z 43 4 `r43 4 !@43 043  43@ 4C  43/43 W43 4  43/@4C `H"@ 0@@ < @" t00  0@P@oX \ @-^R  \R n-\ @\00]\0S  R\ A]\ -LMP pR0 0V@ @000媏P`dp@V 0 0 f0 0  f] -LM, ,D0 ` v00  R-V`<  +V< `YY0V Y0V <Q +. 0@K  0O@K 0 K@@K  0KP@@K 蕌<00 KSP T@0PiPepv$B 00Q0`Fv  00Q[ v 00Q7 FW F` VM\< R& 40S 8@T80 W V00S NO"00`D@ 1B"@$$pSƏ4X004 X 80W8@<0W V00S pD@ 0B"@$$pƏ4 X000Q \,0 J00 K\0XSxS`IX -LM, ,`\0 4 P u00  R-UP8  +U8 P4 RR0Uv 4@T0U 4 4@0K/0 㹎@K @@K< pu 00Q0PEu P!0 0Q4 u,A 00Q7 EW EP4U%\ X  W W0 < U00S p"00PD@ <B"D@p$$ŏ X008Q\pw0 R \,00F0XSxS0P40 `X -LM0 @0pP `冀7PP @ ᔝ00@P0  7PP 00_0 ;0P`0@  `VZP p0-LP@H l1 RV 00S  R 1S010 :000P0S  0S 0B0PB0000P 00 0R0 P0PS 0@ <08 0B0 0BP00 @0 0ʜP0000";H 0-P@LT a DA0DSR0D@TP0 \(ˉP.T.Q0D -EMLM@H$ 0r/, 0'H4 YL h Pl4 Y t7 ,0S p,;!4 $Tǟ8(<,"(S\$ D ` 0 l OPpDP 6 0YY`  \4`$ P T  S\4`$0Cd$ \4 V:l6 D 0 l NPpXD(PR `V)*WP` VX !*OP`V H*HP`V x*X4S TJ `\4CS\ d$R00V0#02S`4S T PY? L ""`$00R00S Y! 0S L0  CKA A$H܋D4p cWHD4 0D$ YYX^ X$ YR X Q V@ Vp XVp0% H$] Y\ YY d^`` DUPD3 WX^/ `P" D4 0b3 RD :dd nl3TP:hQh ecT4  T4 ZJ`D40D4 D40hD40D4 <K 㞛<0S80S40s?2 D4%]8YDlkUP%D4|H$D 0 l MPpDcPdd ``QD4!0 2P^D45p#04P 5wy DpCNK@D@D 0MPp:Pd40d4 D4` cpWwD0l D4 D1PP*CNK@D0@D 0MPpPd$ d$ D4P0P ֊D4`p0D4 ϊD4p cWdd Ų߇D$H0D4 D弊D$p0D4 0H$ VYDMHHdH0eT` 0-0L@r/t*PN0s 0  0S 00DMH -L Mr/0PNp X X0c. 0qP  q30   00S 0@T tX3  00S.Q q0 3  0D0S}:\D ,pKn I,0[S6 `S@ 0fS+ "bS @TV0S 3P Ƞ 0]EP 0S` 4ySX`{ ,0[q0@T t1  0 D0S:R .R 0P.S  SP,h!hh1H @0 p@@81  :ƆPz0P.Sl  RPp,ἆ < 00 @p@0 0x@v+h0K ^EPP'\0 s/00c0[DMHX4dh0H -BMLM3@0r/, 8 Mp XY0S XY0S R0s R S 0S S X X0 SBKAAX@ Xt BnK8`F `Fn H2(K Rb 0pS@ 0fSU LbS @TW0ST2 ,0S L,F82P< Ƞ@ <4CPP&@$< 09Pp Q<2  G!0X0P 1 8$0  0 0 <2ySX p  b0 υ@tP. K`g0 , !НP@p PPUZ.0K g嵅p00 0  0 @ 寝\v/00L00SS (  hDMHh0H4$ 0-8P@0LS((U0@0U 0-,PLP 0@T 0o@ -L M0r/ŝ븢4 0S ,K UP@ ,0 S R@0@,  S*h Y,0`` @#R ##P`,VPP r` IQP], 0 S S 0SN ,S!0p0 0 S S0 S S 1pP0`VPP 00U 0S  R00 R@@TP U 0S @@4 0 0@+0K 0 0VP4tVPP @, PPn4 0 ,  P H0 DDTP WDMHdh0H` -pL` 3P@ 0SQP PP QP 0S t0 -pL `P P@ 0S 0S 0P -鬁L0M 0嘡0 0` px1Z>*pUP@P7 P O0 S S0 S S UP`@ 0 SP P`+U`T 0S  R00 RPPU@ T 0S PX000 R X0W@4UP@ PP $0W`40(H` -L(Mp젟0 S( PQP 0@`8PK P@˛P00囆XΞ    t@@0p!lL0\S@0 !$ 0^A(h0pG-@M`@<T8 40 ğ0,`0#0c0, `0cC 7?04 #/(00 ( ~- 0 ~ " #~5 ~ !~7   ~9 / 00, ,: "#:0 :"&!* 1 !00H,x P `@p` Ph%%),%\P0!ē @ 1 )Wh _)| 0* 0 ` 0+p0 `08000 @`@1p0lPz0p[0ˌ0 00400@Ѝ0p"B`b -LM`0(K\p@P.  r($ 8 ( #"., K00K, `0@,<4 Ġ̌(<"4!Č <.̌ (0 $ Ks -LM0`$S@ 3 R (PK0000e@SP0m _Rl zP `P;@ ZP@P5@9P-P.@0zS `S;0C ZS@S50C9S-S.0C0p 0@SW, K00KTPP2,pŸ * =? 0 7?0  ?0 4 [,  9?0 &?  3?0 ? 000  6?0 #? ?00P 0zS `S;0C ZS@S50C9S-S.0C0 Rp 0zS `S;0C ZS@S50C9S-S.0C0 Rq0S  0P0S 0 e0#R0L@0SP0SH@ <~@a 01S x@-!P.*@0 S0ԧ S ԧ RQ 00C210P*0SԧQ <0 C120P *0 S ԧ R 030P: p-@L$MaP2 ` 0( X%X@ ph -LMp0@P 0 0`K 08#HT UPUP#08  0 S  /ϒx -BMLMr0D`K@P ,0 02S0$S aS@ l,0 S \,/@0$SHP 0KY @] P TKDSAK`Z0(H K:K4H  K@TK 0i TN:B]KAKx1 (PE(I(K @PE6I @T@ @?T@BKCK!"41"",!1AK1@TPZ$ @20@0  @*K0 "TK  tK @TK  T:m,H(0@-"Q*|@P0#!0\ "0'*0#" \ ! *0##? 0 \0:00000PE-0``&&&C&̠O 1t@X 00#0P 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 0 0#0 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1@x 0 0#0 0#`&&&C&̠O 1@x 0$0#0 0#P%%%C%̠O 1@x 0(0#0 0#`&&&C&̠O 1@x 0,0#0 0#P%%%C%̠O 1@x 000#0 0#`&&&C&̠O 1@x 040#0 0#P%%%C%̠O 1@x 080#0 0#`&&&C&̠O 1@x 0<0#0 0#P%%%C%̠O 1t@ ̐0@@0#D 00#P%`&P`E-D0``&&&C&̠O 1t@X 0@0#0P 0#P%%%C%̠O 1@x 0<0#0 0#`&&&C&̠O 1@x 080#0 0#P%%%C%̠O 1@x 040#0 0#`&&&C&̠O 1@x 000#0 0#P%%%C%̠O 1@x 0,0#0 0#`&&&C&̠O 1@x 0(0#0 0#P%%%C%̠O 1@x 0$0#0 0#`&&&C&̠O 1@x 0 0#0 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1@x 0 0#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1t@ ̐0@0# 00#P%`&P` tPH0@-@P!0\#0 0(S"Ƞ0 -L0M($@KP"h0dp 0 8#x "W 0@2K,0 00 p,K0K  H,0 0("x00W0p@d  608 0#H,0T108#xW -L M((KⴠPp@"hh   0 8# "Y 02K00 40  z000# 00 s40 0#0K4 K40 00 0("04 Y @  X000# 00 Q40 0#0K4 K40 08 4#H00T108#Y p-LMH`P*$H ph? (-"xPUL`@: 08#XU@: (-"xPUL`@: 08#XU@: -pL MW`,*0K0 8 Ƞ<̌ Č40 ,K ,0 0 a,00 ,@[0P[p#Ġ"#" #8"(W0@ P`: -pL MW`,*0K0 8 Ƞ<̌ Č40 ,K ,0 0 d,00 ,@[0P[p#Ġ"#" #8"(W0@ P`: -pL MW`5*0K0 0#0P0 8 Ƞ<̌ Č40 ,K ,0 0 ,00 ,@[0P[p##Ġ"" #8"(W0@ P`: -`CL0V Mp@CPC,K0K6,K0K08 <40,0   Ƞ0̌Č  0 )0[0"[ ,0#40, [ -0[0"[ 00#400 [ 0 0#0Q`FVPE@D08 <40,0   Ƞ0̌Č  0 )0[0"[ ,0#40, [ -0[0"[ 00#400 [ 0 0#0QR-D?0 \ !Z -LM@t@ğ0 8`, z iP 00 0S$S 00R5:0PK c z z K z  z 'D\@ @'(`@ ?0(LX\ @c@@ '<@<@ (H<@ [H@ @D@ - K(DH [P@ @L@ . K8DP [X@ \/ KX [@@30K`0T@ 0 KP@ L40K, 1K2PK 84K ,0(S(h ,( 0-PL@U !", 1#80!"$ 11PX 0h銎0 -LDM@@ hKa p0(h0 0'00 * 霠 d0  (  ly 0)pgz p`00* 00H '臠\  )  $0( jX 0 0'00 * 霠 T0  (  x 0)pgz pP00* 00จ '臠LP  )  0( jH0 0'00p * 霠 D0  (  Lx 0)pgz p@`00*00)COH臠 0'<00) 00 ( j8  '  ܗ0* 霠 40 0(00w )pgz p0  *  0'臠,00)00pd  j0*00(00LP 靠 0)00*00(w< p{ p 0'0 0)00hh0(0 0'00টT  j0*00(00༖X 靠 0)00*00vD p{ p 0'0 0)00th0(0 0'00T\ j0*00(000H  靠 0)00*00 vp{ p 0'0 0)00셟4h0(0 0'00ȥ`  j0*00(00कT 靠 0)00*00uH p{ p 0'0 0)00\h0(0 0' 00< j0*0#00 < i 0)0#00ud pz p 0' 0#00Xh0( 0#00 ꤠ0*0#00औ4  i 0)0#00thpz p 0' 0#00dh0( 0#00H ꤠ0*0#00,\  i 0)0#00 tPpz p 0' 0#00샟D h0( 0#00̣` ꤠ0*0#00ଓ i 0)0# 00spz p 0' 0#00t h0( 0#00T ꤠh0  (  0 0 i *s pg{ p00)00舠T0  '  ̢0 ꥠ( ଒\ i 00* 00r pg{ p  )  l 舠d 'H0 ꥠH00( 00$ i   *  r pg{ pP ) 0舠400' 00༡ ꥠX0  (   i <* tq 0pg{ p`00)00P 舠D  '  (  0ꥠ    xjVp $ν|*ƇGF0FؘiD\"kqCy!Ib%@@QZ^&Ƕ]/SD!7Ç ZEogL*B9q"am 8D꾤K`Kp~('09|eVD")*C#9Y[e }]O~o,CN~S5:*ӆ*#* -L P @ 0T `  p0S# @T 0R 000 00 @0po P 0p 0 0R @ Q-L@ 0Q`Q p 0R /0媅0 0 0R P  0R0Q 0-LP@0T000@T0  R 00d0R00 R 0 00  0zP@0 -0PSL`p  |P@ @P@  jT0000S ]?*0<* -LM0p@ LP 00 00B S0`Ba0B\W`BA0B0S7`B R Q\S P Q'             0U0P:0`d00c0CV0`ąrppp0d0C0pp -LM 0@Q`pPT*.X0 R0""00 0PT:400 30 SP:00\ -LM0@S 0ہ000 -WMLM0@P=KC/NK, h5 @A (K  2@2  0IZS\&DDDD&DDDDDDDDDDDD&'DD''DD8)L)L)L)L)L)L)L)L)L)DDDDDDDDDDDDDDDDDDDD|)>DD>DDDDDDDD9DDDD,9DDDDDDDDDD:DDDD<DDDDDDDDDDDDDDDDDDDDd>)>>>A)ADD(ADDLA89(K *Y 00I SP100PC0 I R$Y 0U@@22R SK).K?K .  00A SPڅ 10 A0 R0PC$^ 2S12 2P  0U@@" B\ R \ 2PB K).K?K 202 P100PC0 I R$YR   } 2S"12 2`202 VgTB   00\0S㬀K& Q; ':Q <r`>(K VR  "202 @"PaUU&0 "2 0RPEK2 " pUʄ6( "2 0R2 " p>(K R ?K 0C0 20Q2  pʀTp PfUUhE00@ "2 0RPEK2 " pSU0 "2 0R2 " p@ʬ" n` "2 0R2 " p\ʬ" "2PcUUş00 "2 0RPEK2 " p=U! "2 0R2 " +ʰ2"R2 S0K 2 K7P P ?KP Q02 0@,0 S ,o!KP PK KPKeYU K/ PQ3@ "2 0R2 " p>ʘ"2R @ "2 0R2 " p$ʜ2PCUoU C00@ "2 0RPEK2 " pU0 "2 0PPK BKPKKP{K"Rڜ2RS20 "2 0R2 " p>ʘ2P`UU6A00@ "2 0RPEK2 " p!U0 "2 0R2 " pʬ2 p1 0 2Q02  KhP0KcPK )AKZP"K20 "2 0R2 " p!ʴ0 0 20Q2  p K 0C0K@ "2 0K*PKK#PKppl 0@ "2 0R2 " pL@" "2 0R2 " p9ʘ2PcUU1ڔ@00@ "2 0RPEK2 " pU0 "2 0R2 " p 20 2"0Q_KPKPK \AKPKKP~K2Sgڤ1. (K K0 "2 0R2 " pN Kz/O P 20C0 2"00CQ2  p ʆ?K0 "2 R0 KzPBK2PCUUڤB00@ "2 0RPEK2 " p U0 "2 0R2 " TPK $CKKPK00 " 2R0K8PK3PK C P`UU'C00@ "2 0RPEK2 " pU0 "2 0R2 " pkڠKPKdPK lDKPKTQ K00$0(0K0 "2 0R2 " ?KPK'PK % >&B`Ph( K0h`C1!`P0h" 00S00 0hV0 q0h0 p`PV P00 U- >(K Pu`  2"S 12 2`0" 2 ~ 2S12 2  Po " l2 "  2S 12 2 Po  W"@ 2S 1 2 2Po"  2S 1 2 2P2S"12 2 2Po02 )   2"S 12 2`0" 2  >(K   2S12 2`  " 2" "  2S 12 2  P` "@ 2S 1 2 2P`"  2S 12 2P` 2S"12 2 202 P`    2S"12 2`202   2"S 12 2`0" 2  2S12 2  P` " 2 "  2S 12 2  P` "@ 2S 1 2 2P`"  2S 12 2P` 2S"12 2 2P`02 X  " "  2S 12 2`  000S" "  "" "  2S 12 2  P`"@ 2S 1 2 2P`"  2S 12 2P` 2S"12 2 202 P` 2SK 12 2`  "  >(K t@ GYgYT@y 2S"1 -K2 2202 -K/P K/ 뤃P- >(K ` -K-Px2KL -K<KK 2  GYgY|\ggYEeeY"fY \  ``y?(K R- >(K {\0l``\`T ` 0`L K -2 S``2 2 KS12 2  @]"*" l\2 0 z Q 2S12 2  2 @ 2 KS P12 2 202   2 KS"P12 2 202 y   2S"12 2 202 c  2S"12 22 /202 N$2S 12 2 2  092LS1x2 2  P`" 0" 2 x 2S12 2"0X T "  |P `hV`xl`",9D $Y K >(K`2S0 2 KRP 2;&KHPK0S"O7 00 -LMĉp㴐K @4KP  , 0 4pK3pK2pK1pK0pK/pK.pK-pK僁`9K  0Pڸ0@%SP@D @ 0AZSHtMtMHtMtMtMtMtMtMS000CS00 0>S 00, 0, -LMPp&EQ @T` P 0`S @c0`\0p0J@`0 1pq -LM0b 0PUp@ڂ Uk R0  R00@ d 040 Q2 :RP 0E0d0Q0: P!0 <01R\3# -L@PP`9 @P`` p0@P `a(8#8"(0b! aL8U0CȠ: T * 8#8 "(L8 T0CȠ:0>S0>pGS p00`@-@0!"** B\0l Cʠ\7SL l0\20 -0pQ`5L@A 0` P0U 5 \ lU2><``6> U ` 6> 2.0 -L MP@4Q6%z00 600 T`,@ ' ,KP0 ,0 `100 ,02 0 000S  @0 W 0C>C5 `0C0 C>@0C!0B@`@0K00 0 @ -L MP$K`@0(Kp{ 0$KP N0bŒ\0 :CQ -L\M8 4 ] 04ޏxCPLP PP T T0  q0 0  RT  T 0-S +ST T 0 S/ 0Sw T0`/RX0 p9R 10W0C10W0`CT@p /RT@ 9RRHp  @EReR@@ 8L04T  T @04  +RT0  -R 00B S4T #0R 10BST0B0 /RT0 9R T@10 0C/RT@ 9RT@!0aPS^@ ` @ W @@ @lH@@ \W  H D EJZD0 SD@00 HLYO2JVP@ 0 $OWl aD@@0dPU 0 8OPV MU-L"00p0lP dvhtprlptn8QT  P0 SrXN||@??ER$ U@ L`@P 0 NU`ʄ5I1 0 Na&j0jV0Vἐ5XH 0_l ll0h  ! 2u , K00K^d @@p T@,`l0L! 0P`PCP`P`^CN@6@lpP`U࠱ࠡ^ࠡ^pn`nPnQpdp @dd@ VdGd Zh h Uh;h Wp5p hdt 0< 0pcP tpM/O P@P).O aNP@<p`Pp`zP/O %Np`*3 Z] Z/O pP3.O N=LI<p`\p` x0 %N 0 Ma&jjZ dghepcta<LH0 MP@<PX46S / FP/ 0P - 7P`K5I /0 M 0 M1#:x":S5h2\ R `@t<\ O0p`qX46S X N0ndYl"0y\0zi/ P . MP@F[O0<0S, 4`!6S \ <@T 0 hMJ/ P@PH  0 DM>x1#::646SX1#::C (< R%X#46Stpt 4P5?55?5???|AMPe ,  :NP@ ERUlU@ p`@P 0 MU`ʨ 1 K 0 M`K O P`` K@K0 L0 L.O P@P5 P@P Pg@0QtA 0 @ n@ L0 @AL 0 @qt@  L M}/O LP@[/O LBL  40T0 T 0RT T@ T@ TW T 20R) 10BS0BT PX QP U EW !p₠1W`^W 1p⃠W1Ѓ`PT0 T0 00B STP 0RT 0B Q@L@ T0 0ST S}0T@P T@ q -LM, 0 0 S0 J 1P,  4 ptP8P - ` 8#8!"(!82$8!#80a("(40 (bA(U $Bh0SpG W 0SpG WJ0S , 0,P1`8P 8#8!( 8 H!#80a("(40,(bA(U $Bh 1 pRpG W 0SpG WJ0S ,  -LlM4 \80 p`@W00qdz01#:H":S !. P  002Q0 0000K, K0':ც᪪Zp T K J%00ƂJ0 KZ/ l jK. {KW/ PKP@ QFR/ qK0 DKpI P PP QX 0 PP00CP0 X 0j@SP0S@dB C`@ U< U<@ E` ES`@ d0 ` 4 ^ࠃ^4 N4 40P\ PS%$q$q?aCoc?`(?yPD?p`\S񟗹8DLXhpxĐ̐Ԑܐ000@ 0S`VLB0S<2  02 P@0h2p' 2. 2Ύ 000 0 00S 00 6 0upPPl1 ,0S ,|g 0000T1LQ:0@1 14101,1(10p0p0000000PpPt p~lpK? lP@`&yV0@  Pqpi@nx|@4,8( dp\l`t@`EP -"L M>@0> 0T0 ` 0Sk*@T0Z`c Sd2 R  ~nZ&fQ *6 p,K(2,  R 2P8k@0T1 *0kP,0@ 0, PT1:0S  kP,0 0, P11 0F0 Q 000S P!0S0 0 mP  , R0000@ 0f00  j R,  0#P R,  0#PR 0#P LN0 0 0 ,0 `Dd,80h|t0@S P-L @ <0!RF 0q PRQ @`@` 0 R0!0  B8# 010 g!0`BQc R0_m8jcjP`VP@@`@PWP@| - 1p LR@? 1`V=P0S3 T00Q00SJp t!* TyP0 RU 0 RUU00S   mXJꖾP 00Tyc(Xlx -H3L M R0 ,3@T$f 3 R :##:S )f @ T[2 T,K2,P UP2 2pi\I \E000C@; *"*2`21 2!-0\"00 ! RSR00Z0S $2 R 00 cl0GP@ 0 ZR Z 10 % `g s :#:S `riP PU,P xi @$ET P, UU` !@Xi1SRipWPU,P  Wi @$ETP,p U0 00 SR0 :JR|0 R0P@  f cX(l<,08`|<X p- 1LM PR  1 R/0 R *0"*RPb%6 ` V+0 V`pK0@ T@0 0@h!R tl@0S p $0(Xl<,08 -X L0PS HH 00CQ03 00k00$ p-LM`0PS@'00 S0:0 0CR@0l T00\Q00Sp 00kpkt\ p-PLMpPp`@ 0S0X0T S0 ph60 0CR0pwktk -pL0@S`.P0 0S0"T )0 0CR@0x T00Q00SLH똼 00?kJ6k t\ -LM` Pp] :36021V 0RP!*PPr Vf0`0@0@0001300p jPL@\ " @0d!ST 21 @!T 0U '6 p(Kv0(@ T@0 0@gQ 10 QX@ڤ21 Lh!@^ @fd*02&60 ` pV,08@ -0LMR@0 0 80 x R l:#:SX,K0,D(< <00Bg01 0 pP8gP,`,0`V,`  =g @$ET @`,` 00PVP" 'g1 S01t7@gPp,`,0`V,`  g @$ET `,p 7 F RǟW0 0d aQ0  0 6 f01 @0D0 6 R6 RvP 0<& 0Q@0 `600PP0H 0 @FS<6  0 8 0bQ@Qc[P`800a0 5"& ,6 040 D 0 f0S 0#P` `V,`  0#Y`V,`   0#Y V<  0#YZ VD0SK 0SPC 4R4 9 ,0Sd00 AS 0 S0 0 4 P 00< Rp4   < 0#% R5052"0<0 B20 5$0@,0 2f1SJ 0J$600S00  0BB#60040Z@t @f1S 01,  00C 0<#@ fP&,` 0;#;S`,` <0S<  R00,` R00,``,` 喍,`Vm " e @$ET40Z,`V^ 0;#;SW<Q <  R00,` R00,``,` l,`B P0Y0S P80080  0Y0SU@  @ 08 Q @ 8 D0P P0  0P00 0 S D0P Q0 P00P 0080l8 0<  8 ^ l8  0R@ 0P00PPs  vhi  {`  2h@4<8|hpdD,0<X p-LM0<P0C*"*2pB!0`36h1 Rb \] 0\& t!0d1 R1 0R p R 0S 00K  1@ T@0 0  d@01 R @T g R \ 0S * R 0S  0S: Ppgp|@,08 -``LMPp !0@ `0`VQ0@JDX Xb0P00SC/ng`VX@E_Z 0-0L R, P0SJ R 0SX@ZP P P000     D 0 PH  C/5g0!H -LM:L@0cP0S @0cP0SPa5 -PLM\\`p@P0SpC/0pfPUX`EOZm`0 0H -L0M0 @00 R/pİLXdp|ȱر ,8DPXdtt0 (0 $ (K, K00Kdp, E0 0KgPd 0 K0 (0 $ (K, K00Kdp ,0S  0 0 0 0 0 0 0 0 0$0 (0 0 0(0 0 0 0 0 0 0 0 0 0 0 00! 0(0 $ 0= (0 $ z 0-LtPM@KT 0K 0 %  @@Xfp 0 S 00 0@0@ p-0LTMP`XK <@KhK0 0h0 5]0XK< K"@0 dK`0 \0 d0 eagx#Vp M-L@M@ 0p`EP{ 0 p`d;PPk 0`0`KX0屙0S   0_H R 4 40  1@ 0 (@\`$@TpPb`8@ X0pX L H T` Pp GXKFP* <0 0PS` 00E0 @d@ 2 PG 0d KT@@ 0000U X0 D0D\ ,0$@(\ 0000~fxE M0-LM00 0 PS0`" -LM,ş `,  (q 0  0  5 $0 K0 0 0 8K 匠K┐K80P800X0K00 P  0P   P 00 0 X 0YP0S0S 3`0K KP L 帘 32a/@#b! 6hP pj `@ PDMHH -pP@L`r/0W@e T@@)0@"p0V`@ h0 2 `@\0@#$0$ ("("4 400g@IDMH -(!XL"x H` P iT hdTU H -L'T!!Q#7011A!1 ȠT0!90T0A0 !0xp00 cd1(0000 c( S0! (a c0#7%c!c1c X@0 T08 #HT 0 @00׊ 0  S0 900T| ?A7c%c!c1cW XEن8*(,0y.&2,<.4 -@pL᠊ 0R 0SZ`0 P@0E.>? B7c011N0 d 0!T 0 L0L " <,/u4(.0,Eن2*.! !U0@0DP 0-0PLr/8V4@0, ,VB@0S0DMHHhHH -0PL4r/xV0`Sp- S  0@W0 0 R@ 0T0\ 0S 0S0S0S LPp 0@W0 0 R@ 0TP 0PDMH -AMLM,48 <#h0V,0 4  P`F&B~KpGpG 00PSP@ ZH00$H T00S4P 0S`F00 ,0S $,u P -AMLM,$p(. , "h  V, 4  P 0 ,0S ,qP`F%BKHH 040PSP=@:H $H( 0"(lP0P`F S -LMH L p r/0, |UH` 9p 0 1d" L"0 R0t2 0<Sh2 l |2 p2 0^x xD R" P P |x0,X0S @㒟KoK%KAK  0@P񟗢|)TP tQ$ Dȟ 0 Sp" ,0 S XD"0S 0@SD2 yPk00D"DXPOK?K@DH2L42  p70 S TV*00, bZ00`F@T@Q*@$?#<-"-0 0c`0, bP *0S  P*0SPlR Pp4 0 0  RP 00ӑXH -RL M00 , *,p `PU 0 S0? 4` PU0S 00X: iPUJ0.S \S@TpPUZPU0S .U 0@- .R .R .^ABa0B" Q00.Q^APBa@BABa0B UT00B SQ 00\S0@B-R T0\S0B ^0*S 0.S S0S !0B]S.R000Q\R R.R0S !0C]S0S0 0   < 00 , 0 ( Ġ P 0000ӑH -OMLM@ 0r/ , /Q05 - 0'QUT U U U 0R>*l= K AAT !p: To!4oS- I>K0C 0C000S000@S0005\ =000@Q KY/0`00n0`A ` g8"P@ h lxPpd  TY8P< (K OKAPPI $< @REnK`F`F fK4@@ ;P@(K R  )P&+(K0 S S %R0P S S \ \ \00\``V`@,88 P`e $ )P1+(@K0 S S+Pn/Y 0 SS S S ,S PPP 0bSyS fS P 0bSyS fS|zH Y)PW$*(PK0 S SQ\k0P S S \ \ \00\@@TY`, 7 7P@`0DS PH` \ V!* \00 \PYP\ V: P P P 0S S S  (Px((@K0 S SrUUo 0 P S S \ \ PP P 0X r0 0  R  0SMKL LL@K '50  :ON.K B0 B0C P0S  R4E7J4 R2% % P lJT ,8O |(P&(@K0 S S U UP 1115  \ \ \ \ 0 SSz ;S`w 0 SP 6P ;Q Qq 6  0P NKJ J  GPE %4!@% h1 6P`3  Q;Q Qq00  RP 00  !PE4 l1 00 %h1 % 05l!$05  $  \@hl\@K P00 ώlO`  Q;Q Qq00  RP &Y  ! /P P PP0`30E R@ %5E $0$@ % 5 E  BPx 'Pd#(K0 S SLY?P  E "  9`0S= UU`0` HPD SEH`P 0.\@SPpVP *T.@D5PPV:00占P0:0 000,0 S @,4DIPP $ENK@D@D,P.5P ,`5*IP= `p,5`0e SDpPH` \V!* R R00 R0SY P\ V: P P P P 0S S S S000 4ST1o/S0S&1SDMHHhHLt4,DH08@X@L̋lXdpt -0LMP0r/M0pSD Y@ S S@0TP S S  &P`3$K P$Q |H1  00P0S0 ^00 0 0 00T R R R @0TP R R R0S a&P  [&P0:0t Q&P0; X I&P0; < A&P01DMHXHK 0CPcT RL K0 A ,P@)t W~ { 0  |4P`K> @)>K 0C1Kc@@2AlA H D< L @L D7PÓ07S K A 0P@07S  0\KclA18 A 4< 0 < 7mQ T00%Q00S  `@Dvr `W!X< APPD@`PeX } 0PC 0 AP PJ `81 K@@ 0| P PJ ` 1 K@@#@ P(Lh< -LM0@s O0000 -LtMp0|@ $0 " 0jP`KS  $0S $cyAth KPK叀K/) DpPOPfp AK|  -PLM@R  ?  000 -LM@O 0 0 0P0 -LM5 -LMp@`P0T@$K P,0 P00g Z@ꘁ -L\M `\, l Pt 0%S U 000S,0 S ,@zTIGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGIGGGGGGGGGGGGGGGGGGGGGJHJdJJGJ`LJJGGGJGGGGKKKK`LHKKKKGGGGGGKNLDLPLG`LNGNNNNNGNGO OhOpOOOOO P`FmƟtl 0RPgl0S\&1|T l0 S010l$ 0  tl 0l 0l5 Ϡl0BP lll@ N 0C`l R 0L0b0 B`l $ l0 0l(Pl 0S 4 l0S䟕1`|t 0lt 0PR l l Xl (t0Ϡp0 x 09x3a#`!1!1"I2Gq#1/2b11Q3b11Qdßp嬣` !,0/C!b ?@1c!bb1cA 0c0cs0 0^I^"XpGx3l#a1!1!2I"G 22`11R3`11R[[0a Ba4P P 0VS$ gS  _t 00  0 l0 S5l0S p4Ÿl  P1l l0cl1 l l0 S|ըŤldK8@KdKt !0 >hl\PPl@ 0h hKlhP\th 0\t0l 0l 0S$@T @dJPϠ0Bl4? 2cc1D1A,Ql$*0$Ip8Qnm<h<D<$P@y\ -LMTp,@KP` 0  ]>  0S pdQ *0S0 Q*0S0 -aLA@_OReBd @Ap`@@qGTçPDdp@DW00ä?dpG@Q ?T00S L U'@(0 0Ql0 S0 R -LMP LL1R00 mm@ `  0@T1@0pT mmP ` 0@11 T!@ 0T p`P%P_00 0@T0@Tlpk0@Pw(0SHp0T%P00plL $ -#ML M$0PP,0 ` *P 0:S /S .[%P PU  0:S0/S TtW :(@7(@@ T*BNK@D@D+G% +-+).3%PP FP/p@ #\K(PE PE#ᙱKP741 0-$0)(0% 2R,p\ \^3^P2P ZZ0Y0 YQ001001 0 e b 0RQ @Xp@X L0 0 QsX Xp@pL0SP7d0T7 @S^ XX 0X0 1QuM@p0Xp@ X ZX 0SX7. X X  Y\ 0S\70X 00CX 1 RXl0 ,0S t, XPU/D$P8P0X rLltd0S0 C,S R-S+S0SS0SSP@-@  00L S 100C^00L S^ 0-LMPK@ 0P 02c2c20 :R 0 ;0P 0 2c! 0:S<0 P0 00 0-0P-SL@P +SP  U0 0c00 -LM0@JS: MS 00C S00 0P 0/S00    00  0qP 0.S 0fP 0.S 0 0 00 m E-P@p "22a11\3a11\p0Sl S  W02c2cZ@]E ;RPS J^P WXa  102c2c^S,! 1?0c0AZ1`L ` !Ϡl  B 111F/N!b  !@!A! B 0C`aR0B S B^ W 00T` 010S^ 02c2cS002c2cSQt*gfff$I -RLDMP\ ` /\0<S \0@0cd0 0S TKP@ IP00 `R <R `@ ~`@a0S,S ;S XKP@s 0V0R00S D ;Q,Qh Qd@Q` 0011P'RL7`c \\%0011P'R\\ds01u.00\'RT0 0f  P'L7R`c\T0X d0c bL7`'0 Td7 PhY 00 0 0 SmM @ \B"d Y0@ `7"@<KnP@ 0,SPKeP@ ^d TX0]~h al0 0`p LP7`Tdh 0< KhX0@hP KT0@000@000 L1`"`!!X1X1 !h0 "b"b3h0 0XTڄT0>CX0 &@>`@ 0@>S``@ T00c  L7PTdg\ >0@>S\ @ bd  s$<0\@ R !`0@d T0 Q -@LM$0S hp -@ 0LS0 00Ph8A -@LM9h9@A 0-L4P@8 P0Sl!P. 5$PP!\ 0m ,TǃPǃLǃ ;!0hP 0:S H HP 0 ,$!00h8A8@p -@LM9h9@A -LM`\p  0P"P7 S@ u RA @0S@AL0 Kp ] P` T70m= 01(0 R0P R0  Ap p-0``0^80 ``V0u 8 ^N 0 0R 0 0R80L080 A 0V?HE.²QScQ$Iųt -Lh -L,M@<K0 Q 0 Q  -@p0T`LP40c0h 4 -@p0T`LP30c0h3 0R 0R 0R 0R 0R 0c -LtM0 00TK0SPPK?L@K< PhHK Pb@P儀KDK P PY}PTH^DńPڜ4^$ڔ4\  “Ϡ2l1Q`3l1R1R`@4!bH XP/H4^DńPDP$O2d1ap3d1U1UpW 00# 0A0d^ \D H0 0D0 )PH d!PT0;Q@0 v>8# 0ST Ŝ ŏP@@TPZ@ကK?0/0S0 P S@ ňK   P0SÈ0S S UP@P0CS0 @0S0 PʷTKP4\>`0 S; (("(Y 0@S1P1P}R pRJ0 S @TpG4UZ 0`S1PQPJP7  S K`VPE4UZLǕ0 00n0  0STK P` 40R00 ? \0#S gK    P00:TKwPT;0 T0 f QuPLDP0\  “2a1H`3a1R1R@0!^H PPKTK< YP 'lnQt0f\! -LMp@P`\ 0 ~ -MLM 04( S0 0ł>K0C0Cp0 D8 ,(RJ 00S1 P1!88 8( 80QBKL !80Q8(0@ SJBKL@8( 1SA0@(K@1 @( QZ@0S<8 <8.K B8(  0 P1H P'R <(@8 R<( @8XH8( 0>K0C!88!aPǖ\04(D8@X PLLGdUPP P`,8SL'L 0 `bS00 00f\! 0-4PL@4  Z@40@A0f0 0 Lg 0 0Fg@0  R J1u  0Q R@Z -LM@K$0c -L M@K$0@K 0 `RA 0 `RS  0 `RS AR b-  \ 1<20 0 \ ?\"00 0QS@-@0c  \1<0   \ ?\0 @0 @\ PT0 0 -RLM@8"x8S,0 `0hȠ,Ƞ*H&$!PQ # 3(!( '#P020cY ! C2R `0 !8,0S&hh0` 0 Q 2RhF0P13P1 <2 -(0(   1|P ;;( ;S0 0P0 -LM`PP0@ KpD0 K04 4K00M00Ѝ -LM@Pp`EUW 00-_u@T0-`P\9p T0 R @  S$0 -LM`PpP%J6 K`P`,K0 0K00CM-00!OO$P`0"&pЍ -LM`Pp, H0P`pY ,0 p-LM`P@@@`@p -1LM0S``V$ P@pSS PpR SN $8?S @ U=|:JUT!0000à@T  RP;?$ $  u00Q0SpJe\0 \03  0<$0 00P@ $0P0?45WCpSppx p-LM`P@l@P@` ph -LMPP@`pW P `034 `RE0E0BUPU0H @0`043P 0 00` -LMdß@TXp, 00 ` T W 0^0T3("S*2V ,P0;,P02S|5P3 T T00W00ST00W\ /O0`PP#>`P`P`0O/ <`PP`V%^!000P 0\P2 000 ,P 00 0O/O0`*0`@0@ P` 0``!v00Q0 S  P (1U:  |0#03  ,K0f0K "Y` ^X,P0W T ,P0^,P0T^,P0{0^0TDx -RL@M@p $0 0 $ ` `AG P@U0e $ e0(0 21%$ `e( $0 K(K$K$P0 P O4  b p-PL Mp_@@` P0Q S0 U UJA>`o0OoPJ0P` P 0 `p0`S  0 S43"?S04# 0 0 p-;PLMDUEoJP V 0T0U00S pp~UPD 000p5 D" 0a4000V`p -;L,M\< 8 * \PoO 0^8K< K`P80C8 <=PoOoPJ  0P` P`PD @ `Po4KO0^`P,0P`$+`P -;L`p45gSM 3^@$P 0 )V! W2 0 KN0^0 ^0n03  1>0$0 2 A$0 AB B0Q0UzW V2$0 n$Q0 Q03  01$0 0P0S;V V ?"0!P -;LˠP` 45fMà3^@p $0 $U V1$0 N$^0 ^0n03  1>$0 0$0 cAH0Q0\U UP` S:\: 0S00 lp'V U Kn<Q0 Q 03  010$0 1$0 0P0S ";Ϡ\  Ϡ\  y -;@T;LM/UT`ᠯ", (@ 4P 0 H X9 T^(K, KV0X4P 0K4 KM0,4sL'h$H X!1"4 R0#038"8(!,6.(0\ ! 2\ 0C QCR ,p 5U`; i^0U0X00S; -;PD;LM0/EU"4 0P ,@ (0 h Sb ST P ?45(K, K0PU4P0K4 K0P,0454( S b4 ࠑ}~ ,0 4 p?0S`,Ƞ,Ƞ(XB[ 4!Q0#038!8 5"40P 20bP  CR`P`  0P0!02S `FT ^S ;T -;0LMS@ ;0S P  00 45S P{P c45S;0 S-L# ;0S ?S S 00 P *S S 45S 345S;0 S-L# ;0S ?S S0 0000P *S S 45S 45S -!:**@LAB14LM\?@(0R\0l0&03  T`PT P TQx 000T`0R@L0R000 000 l>"0   -p`':@ナ7DL⨊ MXO<0KP  @KX@0H1@0 A@ 0?48@K5 0 ( -LP@K4MH)JJp,jP@ 冪 #T # 3(l0 $(h0.%pH(N.l # R2^P2t 3#S#3t@p#8$0 (, PP@2`3`#\ # 3(t0,( Ƞ##!@ Q020S ! 24`h@^ ! 2ldxY00RKAH D L0 *L`H0DK HKLK0D @T0 0` 0O/ l0T Y 00` 0O` -LP@KlM`K PP<,JXJ@ ,Jᄪ@|40 X%X "| t #[,Hs[2,.\0#03^#38,8 Ƞ&.x 8 "# V2R02 3#h00c bVQ0C2Y0C2S`h0 fh  00|00|0 H0 DK|D 0HKLK>L`dD H0h`Pxt@030# 3# h \|L| h|H ph0l@ 3 #030#0SPLh P DP t ` 0/O PP@Z ` 0O/A?O`PP` -p(  LMP`P' &:::S@ W @0 O00X64460 PP 20460@ -p(  LMP`P3 &:::S@$ ?S@ S@0 O00W VUS S X64460 0460@ -p(  LMP`P3 &:::S@$ ?S@ S @0 O00W VUS S X64460 0460@Q0 0aQ03000100P0R b0@- @P 1<\0 0 ?\4 00-b1R"  @-Sc@#0 401  00S20@-  3#@3@# 0  0bQ@2c0 0@-Pc0 @R#3 e d \@2 n0Q@20p@-X h%X ! $ T#3 Ƞ$ȌH.@!Q2pG-(!X  "(!& ' V#3W#3 Ƞ&Ȍh$a*'x%p,Z@2\P2 3 #P$ PG-ȠM!h,Ƞ !#8() X#3 Ƞ"( X(ȌPA*% ᑌ,Z@#@3H*H F' ᙡ&,QP2 Vp2` P@3@#\#3P, Ƞ%".p RP2 3#^#3@ .,$<0\@2@PTP28 40@0 PЍQPP  :Q00SP  :Q0#02SQP -P`LV@gp0S  SP@D RCA 0\R#R! B -L M@KZPT `0 -L"ɠ2l3c13@"c1MP 1K0  & C -L^M⸠p`OKPC/MK@( h < 8 i&Vat0V$KOK`?cKpG 0@FfKq q A A D1 (0S (2 -PLKTP(K@0CP@ 0C4 d B P@o 3( K!$(,"( R`*R^ 2Kp2 0 IF>K0C"P pt0,^0S 0t t h wdh$`0 K@P@ @$"(0K!48<#8 S*S 0H T H0L P J I@  Lh@hA Hp\ ᭸0p4Slgp PBNK@D@DhL!L1#p@) V$pPvu0#SEKEKALK 0 LAIP4 \ X T $X4P$0P 2hP22p$RhPV0 O Tdp -LM` @0 0\ `0V -pp`@LTP W P `@T` 0V0000h O -LM$@0 S η0tA -LMPp`P@b ,K0,px!0#p  P @\T`E,0S D( 0"00,(0 $" "p P@T` (pP0P (0L 0 "(0 h< mT:@ -Lh\P0H -L  hBm -LM`TPpP 0 S S 0d z" 0 0 @0$ i"@5xEd -LhP0 --LM q -LM@$  0$0KQ \  0  K 1S01 -@LM zxA 0-LBP|@ 0S L| 0SPeT 0S \00LS `000 0 -LDM@ d ᒶP d㍶P`} 0Sh 0S0J0@ @@`KULpP dP00 H XP L T@ fXKP0SVX =0P0P0H0STTA 0@81H  FP 1%P0@ 00Ks00p0d  N X%4 40JH  `0X@\ 00*s00 00(@, 00s00xED -LTM` `\ h0 0Qd 0p KLP0|0 pK0 0Rx0  x 00$0L< 4 00h_  ) 0-LP@P0  P 0S S1P 0h+0 0-L@P P 0S S 00h0S 0h  0-LM@P0S0P  \0G 0 0-0 0 0LS@P 00S 0S 0S  0S 0hP (0000 0 0 0 0 0 0P0 P 0 0 00 0-0LS@P S 00  0S S 000  0 S 000 000 P0-  @ @-0@SC @<4(<"4!<0  -0S C   <4(<"4!<0   0-LM@0 SKCP0 (<4(<"4!<0  -LM0@SK C < 4 D -k 0 0 p-LPd p`0@,$,!$#,B V 0? !<4<("4!<0cS @` V @ P,$,< $,4.l$<("4%<A0 V 0? !@<4<("4!< 0cS @` V<4, <$!4 , (Q0S R$1 !0$1^ 0S J?P0S) 1S$ 0P000Q 00b0 !0000  c 0 S(%*$1 0(! $1   0P $Q( UU0$Q $1Ś 0P 0S( P0U(1( a0 0,1 -LM(0 p7b00VP(pVAv %P! @A@P 1!0 1!( 0P1D!D, W00  ,0i -L`p@<PP  n djP -0LM@ ,0( P00 0-@LPP UQ0P Q0!311Qa0@"a@p@-0P0 @ 0`0  00  00  00 0 0 0 0 00  00  00  00  00  00  00  00  00  #0 0" ! !0"0 # '0$0& % %0&0$ ' +0(0* ) )0*0( + /0,0. - -0.0, / 30002 1 10200 3 70406 5 50604 7 ;080: 9 90:08 ; ?0<0> = =0>0< ? C0@0B A A0B0@ C 1 G0DFEEFDG ` 0V0pG-M0 咀 0P0呀 @P`pL吠叀 @P`p0P0 0 L0 0 0 兀H儀0D僀@@傀P`p0 <偀8 0 @P`pH0$0D @00<8000tw|04vx 0u0 ~}|{@zPy`xp,t( 0 @!P"`#p40$00%,0&0((0'p00 ,04h jl0r s0pon@mPl`kpdq$i hgf) *(0+,-@.P/`0p$0< 10 @2030405080\ \`0be0a`@Xd c_P^`]p[ ZYX9:;@607 8p0T@?0 @0A0B0C0D0^T0 0TD E0FG崌⾉0 0 ZЍ -LM@p4 00 , 08 40L0 Ƞ< S,ȠL 0X0C8#Ƞ3 X0 08\<#X5 0<0e8#h < a X0` 0n0C 00,`0 0X00 00C8#Ƞ DPp@00 0E8X#X4  R 0("X0e8#h 8 0`0l0C0 , ` 8040 ePp80 4 4P㌠!\/ X0 08#X\< " 0<0e8#h<  `Ie00e0 `0@040\ 00C8#ȠQ00X @ -LMP @p`0B8S`RE 00Q 00lU@PT3 V  0S 0Q S0ò000 B0 00C0C0 0 00T00 UU800C800 R -LMP`  a("H T p 0 ʲ0S T0 fP  `ZQ0 Ppd`P 0 0b8#H Tʲ0S  0- LP@0S 0\P 0Q 0S 0S 0S00 -LM@ PQpl 0 RX 00 P) @Y 00d0 0S 0S 0P  0(1 P$1 0$1  $1 0(! @0 d Ƞ Q`ἠ,kP   04p  0 S  1 0]0 00 0S0GP 张@`0 0S07P 0S @ -LMP`  Q@ n, $ 0 0S0P  0Pp 0, S 0 A  ,]0 0  pP!P Y 0(10S$1 0 ! 0S 0P  0P$1 0$1 0-LMP @p 1 00 -L M`@ A nQP, p'P"ᬟP 0 P 0, S 0   \0 0 ğ0 0S0|P  0Pp -LMP<0 80K0 Kp `P@Q0, 10 <KRp8#80CY 0@00PP08#X ("X 0 P L 00< 0@00Q<Y0A  P00<U PP< 0P -RL M`Pp 0 @T 0S @RT ͅ0! A0@ &P@ V00 I P V, 0 10 731 B,0  1@01S -L MQ 1pU, 0 1S{@`x 1Uu 0  \0D 0S0SZ 0 0<3Q B K  1F 0 10S% @ ` 0 Y \ಐ\% 0 Q10  @0 @00, S00 0 P 01-0Q0 P0A P 00 `6 P@ *PP  "P@  1S0C1N00! Q0PQX 0 AQ=Q10 -LMPpPmP@ R0 X 0W@ P  0 AT ^ 0 P @-0@0 @0!00  RCA 0\R! BQ'  0R!&H'<'0'$'' '' 2 2 2 2 2 2 2 2Q 0S !0S: 0-LMPK 00%0 @( 0ST 0S @S 0ST 0SO f[L  E \[00 $PP10*2 D 0-PU@L P :PP  01Z 0 0 p-LM@ P$K, ,0K $0 (` ` P `p -LM`V (  0SP@ p`@ V`pV@  V 1+#,PP 0p0`S0`` 0 @00, eV`pV@ B<B S=  P UP! 0 0e P0 0p0eS0`e0PVPV: ,PP 0 P0f  000vP P*0P` 0PU:⸜P 0 0c  0P0 V,` `pV@ ,0S? 0Y 1! P Q00P00S$ Q ,PPkY 0p0eS0`e^%P], P 0 0e 0  y000P E  bP0g0,0 Y 0 03 0-0L @R5 P-  0P @0P 0P $00 0 00 QB< S  0  0 0c0 000001H p-L M0K K@C 00p!`嘛PUhC 0 SP P000pkP` 0 0 p0 p-LtM@PP`KP0@: S  Q  SL  p( 40R p; 0p0+ 0 p3 -LM, PPpF0S@a@T 0 0S00 p@ 0S 0000 0E#10 0@S000,!0 0 Pp0S P $PT -L M`CPP쀟0S6p@T 0S @S 0ST  P ` 0So`0 .p@ 0E#1, 0@S$PT 0-LTPM@KT 0K  0  @@WpB -LM`@ 0pP`R -LM@5zPP/0:0 p-LMP `@0 : 0ph* -LM@pP  0:0q0:0! -LMp` \0 P@ P@  0-L0MpP0 @0 0SDK@ 0S ,|00@@D t,@ P-L 0 h W 00h*5 p-LM`0p@T 0Pd@00U0  ,PP`@Up0@00pp -dpLMW` P@PUJ0SX@PUZpW`R @0S R@- Mp-LM0`0 @`Lp Mp-LM0`0 @`9pP@-@p `0S0S=S 0S=S PdP U 0S  0R^ 0S ^0=S P00cC10C -LMK -LM0K *P - LMK0P -LM 0@P@ -LM 0@P@ -QRLtMp` 0@S 0S@b@DT*U00 0P0XR00S @ZJJJJJJJJJJJJJJJJJJ }J xJ sJ nJ iJ dJ _J ZJ UJ PJKJFJAJ=Q:Q:Q:Q:Q:Q:Q}:Qx:Qs:Qn:Qi:Qd:Q_:QZ:QU:QP:QK:QF: QA: Q<: Q7: Q2: Q-: Q(: Q#: Q: Q: Q:Q:Q :Q:QA ? QA ? QA > QA > QA = QA = QA < QA < QA ; QA ; QA : QA : QA 9 QA 9 QA 8 QA 8 QA 7 QA 7 QA 6 QA 6 QA 5 QA 5 QA 4 QA 4 QA 3 QA 3 QA 2 QA 2 QA 1 QA 1 QA 0 QA 0 \aBC`B0QA 0  -LM@Fh\T -LM@\Pp` h^\QU0SD R 0S=W00  00CSDEEDEDEPE\EhEEtE|E|E|E|E|E|E|E|EEE0 0%S00 1 0 0 ;00 0 0 R 0;S< W  4 R 00R 0, H@-Q:@- R (2 R R -PPPP RrPP B PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R@- RP1P P1P RrP1P  B P1P B@  R010 1  B R0q0`0q0`0q0`\0q0`0q0`0q0` R 0\6 R B0@-81, Ġ%̌T$\D#L0P  R0@ Ġ01#̌  R R B0@-81, Ƞ%ȌX$XH#H0P  R0@ Ƞ01#Ȍ  R R B0@-81, ̠%Č\$TL#D0P  R0@ ̠01#Č  R -- L`^M@pTA0TPC/M_K 0 KKM?KPE@`1 4a 0a d0K?aK@D 0KQ |A Q A u1` 0S  X-R0 0c BSR48 R p-@P`x BRpR0 BRRR2** *x *J*** -p@L00l8#hP J08#x `0 0c8#h=08#x 0b0C`p`0 -LM@P 0S p7U0R G0`8U#h 0  b Rʂ0 S00@0@@0@Rڰ 0000G000A8  B8 000o -L4M@ 0< 开@ PD p <0Px D0@ 00  0 ZH P L *P0<S`R0000 l , J@0g\0KH8 K8' 0080 0 c4 CP08#8P0 0ZpPP0n0 a B 00ഀD   000#8ᲀL  L 08# apL0 00`0ᲀPD  0<@ D   000 -LLMT X PpP 0L8#hL \\P ` h [00C8S 0@TL s \d `E0S@@KHKd0@ @ b 00H0 0L c@d@ P P3 0S 0 00S L Pp   00008#h\0 0S\`0S L'\0S 0 00S\  TLPT \ \  hT 000 0a0C0 h 0b0C 0X L0mPX L` X0@QPh  L X` eX 8K TP X0LPP4PT 8pW\ 0 RL0X P X -LM@p0Qs P`0 R=V0e S0 0RS 00P U*V0 00Q *^ 0P@  0Y008 8(40Pon P0 00S"P@ 0S 0 00S 0mP  Q p-LM40@SP`$ 000`!H 0 Pp0000000 0 B@ 0p00S40040 -L M`pxQ  0 0C0ppSa <0R@W  P@0Pp  P P>Y 0S00C0pp  ,1R Y 0C\0K 1 00  0 !0  00[\002K)0[* [0 0\ʌ0 0"K+ [,[ \=NO0 0@0@0<  JPPBJ@ @00@ -L MPx`p@ `  1R TI 0CP0K100  0!0  00[P0Z" <0W@  P@0PKp  P MO0 0?@0@0< J PpBJ@ /@00@0Tʀ0 0"K) [*[ Pڸ5P  -LM` {0H20APP p0 101  d 020 0  崜8Q0 00P -L M  !4 0pD $0@SQ!P40 BU00 ,P 18aV U 0, 1 CU@  T pb @ TPU00ZD0 $0@0@@c TD ZF !4 0@  A@ D@ 010CY ?=2!I !U08#X&ʊU0 aP`40@ D0 T0D0Z 1@@ AU@ D 1  L001  Ld@?=2D  $0!E!P@T$ U D0T P U D0TU1@ \0@bT5У 0$10C@/-"@dP`Sd -0p8#(=1@0@A0C$0^^ 18a!$ BVLP ?=2!E.!h}` -LAMp0P 0 XMANK0AnK @D `FS@D `F) \0 0 AK A0A $4 0s1 P   0 pS $ 唔 -L MⰀ0ሐ` 0cV8#Ƞ, F0@p P0 .00 0c8#Ƞ 0 #밀,000 0Pc PEP00@ -LM1@QPap ̎0 Rp8! ,5P8q8pR0-P@ 0bR03 B0 -Lᴃ%s: %s not compiled in instbinUsage: %s ..., where is one of: mount_cd9660dfmountmount_ext2fssyncnewfs_msdossttylndisklabelpaxtarcpiofsck_ext2fscatifconfigrtsolping6kbdlessmoremount_nfsfdiskgrepfgrepegrepumountmount_msdosfsckmknodreboothaltmount_ffsdhclientcpgzipgunzipgzcatchmodchgrpchownfsck_ffsnewfsrmmtejectmkdirksh-shmvexprdmesghostnameff a f8@@|KXfffЉ @@fcbsconvfilesifobsofskipno value specified for %sunknown operand %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationscbs cannot be zerobuffer sizes cannot be zeroseek offsets cannot be larger than %qdconv option disabled%s: illegal numeric valuefiles is not supported for non-tape devicesstdoutinput bufferoutput buffercase conv and -DNO_CONV%s: end of device%s: short write on character device%s: short write on tape device%zu+%zu records in %zu+%zu records out blockblocks%zu odd length swab %s %zu truncated %s %qd bytes transferred in %ld.%03ld secs (%0.0f bytes/sec) summaryskip reached end of inputXjdjgpjtj|jjjjjjjuserquotagroupquotarwautoaccesstimeatimedevexecsuidrdonlyupdateegjo:Rcd9660%s: Filesystem not supported by kernelrealpath %s%s on %susage: mount_cd9660 [-egjR] [-o options] special node %s: illegal value '%s'needsdoes not need-o %s: option %s a value-o %s: option not supportedhiklnPt:retrieving information on mounted file systems%s mounted as a %s file system%s is not a local file system-i is incompatible with -Ponly one -t option may be specified.empty type list %7s%-*.*s %*u %9u %9d %5.0f%% %7u %7u %5.0f%% 1K-blocks%-*.*s %s Used Avail CapacityFilesystem Mounted on iused ifree %%iused Size%-*.*s %s Used Avail Capacity1024-blocks 512-blocks%-*.*s %s Used Available Capacity Mounted on %-*.*s %*d %10ld %11d %5.0f%% %s df: %qd: %s usage: %s [-hiklnP] [-t type] [[file | file_system] ...] ffsext2fskerberos uid mappingNFS exportedanon uid mappingexported read-onlynoatimenoaccesstimenodevnoexecnosuidwith quotasread-onlyroot file systemsynchronoussoftdepasynchronousasyncexported to the worldAadfo:rswt:uvforcerqnoauto/var/run/mountd.pidsignal mountdgetmntinfo:@nfsunknown special file or file system %s.root_devicecan't find fstab entry for %s.%s has unknown file system type./usr/sbinexec: mount_%smountfsstatfs %s%s/mount_%sexec %s for %sno mount helper program found for %sforkalready mounted%s on %s type %.*s: %s %s on %s type %.*s (%sunknown flag%s %#xv2v3udptcpsoftintrnoconn%s%s=%dwsizersizerdirsizetimeoretransmaxgrouplistreadaheadacregminacregmax, %s=%dacdirminacdirmaxprmounthardmfs%s%s=%lu %sadosfs%s%s=%u, %s=%u%s%s=0%omsdosshortnowin95gemdirexecnorripgensextattprocfslinuxversion %d, ctime=%s%s,%s-o[-Aadfruvw] [-t ffs | external_type][-dfrsuvw] special | nodeusage: mount %s %s mount %s mount %s [-dfruvw] [-o options] [-t ffs | external_type]special nodeufs%s: fstab type %s != disklabel type %s%s: fstab uses outdated type 'ufs' -- fix pleaseXjdjgpjtj|jjjjjjjmount table fullspecified device does not match mounted device%s on %s: %sfilesystem not supported by kernelusage: mount_ext2fs [-o options] special node $FreeBSD: src/sbin/newfs_msdos/newfs_msdos.c,v 1.9 1999/08/28 00:13:52 peter Exp $%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) %s: can't read sector %u%s: can't write sector %uNO NAMEFAT%uBSD 4.4%u clusters too few clusters for FAT%u, need %uwarning: sectors/FAT limits file system to %u clusterstoo few reserved sectorsno room for backup sectorbackup sector would overwrite info sectorno room for info sector/boot/%s%s: inappropriate file type or format160180320360720120014402880%s: bad FAT typevolume ID%s: bad volume label%s: bad OEM stringbytes/sectorsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorswarning: %s is not a character devicebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %u-%c is not a legal FAT%s optionblock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: FAT type limits file system to %u sectors/dev/%s is mounted on %s%s: unknown standard format%s: can't figure out partition info%s: partition is unavailablegetdiskinfo%s: unknown disk typeioctl (GDINFO)%s: can't read disk label; disk type must be specifiedbps=%u spc=%u res=%u nft=%u mid=%#x spt=%u hds=%u hid=%u bspf=%u rdcl=%u infs=%#x bkbs= bsec=%u spf=%u sec=%u rde=%u%s: no default %s%s: illegal %s%s: bad %s"*+,./:;<=>?[\]|usage: newfs_msdos [ -options ] special [disktype] where the options are: -N don't create file system: just print out parameters -B get bootstrap from file -F FAT type (12, 16, or 32) -I volume ID -L volume label -O OEM string -S bytes/sector -a sectors/FAT -b block size -c sectors/cluster -e root directory entries -f standard format -h drive heads -i file system info sector -k backup boot sector -m media descriptor -n number of FATs -o hidden sectors -r reserved sectors -s file system size (sectors) -u sectors/track  $T(p̉08< DL T\ d |\lt:tx|  ć#̇3ԇ#܇3233#@ @'@@$,4@HPX`hpx  @@ȈЈ؈y (08@L T ,`hpxȉԉ @@ @(@4 < H T `hpx@@  ԊC$CȊC$ЊC؊ (08@H P X`hpx@@discarddsuspeofeol2lnextminquitreprintstartstatusstopsuspflushrprntoption requires a numeric argument -- %smaximum option value is %d -- %sundefoption requires an argument -- %sillegal gfmt1 option -- %sillegal gfmt1 optiongfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:ispeed=%d:ospeed=%d %s=%x:%lxoflagospeedlflagiflagispeedcflagcbreakcolscolumnscookeddecekeverythingextproclcasenewoldostartostoprawrowssanespeedttyillegal option -- -%s%d %d TIOCSETDTIOCSTARTTIOCSTOPcs5cs6cs7cs8cstopb-cstopbcread-creadparenb-parenbparodd-paroddparity-parityevenp-evenpoddp-oddppass8-pass8hupcl-hupcl-hupclocal-clocalcrtscts-crtsctsmdmbuf-mdmbufignbrk-ignbrkbrkint-brkintignpar-ignparparmrk-parmrkinpck-inpckistrip-istripinlcr-inlcrigncr-igncricrnl-icrnliuclc-iuclcixon-ixon-flowixoff-ixofftandem-tandemixany-ixanydecctlq-decctlqimaxbel-imaxbel-echoechoe-echoecrterase-crterasecrtbs-crtbsechok-echokechoke-echokecrtkill-crtkillaltwerase-altweraseiexten-iextenechonl-echonlechoctl-echoctlctlecho-ctlechoechoprt-echoprtprterase-prteraseisig-isigicanon-icanonnoflsh-noflshtostop-tostopflusho-flushopendin-pendin-crtnewcrt-newcrtnokerninfo-nokerninfokerninfo-kerninfoxcase-xcaseopost-opostlitout-litoutocrnl-ocrnlolcuc-olcuconlcr-onlcronlret-onlretonocr-onocrtabs-tabsoxtabs-oxtabsonoeot-onoeottablet disc; ispeed %d baud; ospeed %d baud;lflags-extprociflagsoflagscflags%-8scchars%s = %s; %d rows; %d columns;speed %d baud;#%d disc; slip disc; ppp disc; strip disc; nmea disc; -aefgaef:gTIOCGETDTIOCSWINSZtcsetattrgfmt1illegal option -- %sTIOCGWINSZnot a terminalusage: %s [-a|-e|-g] [-f file] [operands] @(#) Copyright (c) 1987, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: ln.c,v 1.14 2006/04/25 04:38:26 deraadt Exp $Ffhnslinkit%s/%susage: %s [-fhns] sourcefile [targetfile] %s [-fs] sourcefile ... [targetdir] @(#) Copyright (c) 1987, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: disklabel.c,v 1.98 2006/07/01 16:50:33 krw Exp $hDHLTԩԩX \$`d`\{sƑOJ˻qKIc%*d'`wX\+5/`IIljwt9{~q߽x'yt^d(1<;A9`J;?~]8 PMhumn;^^mMy۶4>dN>`6bh,{sV'2:^ ̋Uo`U;|ب^La5þz( ,:jT^L f`FCn,/sKi;Lun٘n0[fjO/iܺ-X|2g, kJ O Vz+Wm];G)# ĬWm;ءWL1UָjK8F(6.- v0<$L+Ȝto׽ڒ4fxu !0c2b;kOi'єuVkGQN \JDE3v%nNZK6Ap>o`NGLcS̰xR[e9"-פ,<(G~^7f*tN,m0W hHkTz$s2{|c( ڞf>_v~j8󫳫eJՒvg3vK $vT/\Pa e0v S8%jFS0 ~ YiPhla % / *JtW/庹3}lPTotwf$7ш1&jahVKŗ'9c7CQN6$aێ57 J&Z9X\p$w6oُI I ބ䃫U5:jvPAjBb00&b9zen)` ̫THy(5`, \0Vf`@dQ>6k-Lwƚ^ո^邻ZmӸ"}m -cKVbm85-퓔w#(b?yצ)unnWrekRZ8¸Ť8z:pSԃI<|4 2谁-Xdv;n5TZb&3CC_6WE!QPt!N'G9 (Bc i՝/..CEe@Vld3h-By,g-L y.[כOyY-V(LUTXo>Q/^o);vhR0S#KdezaH rX7?($Q3OQKCC悯 ijnB06lMaLQnUEHGHxR6X.4grozYΡ}i$ppuJA`y@ ĘS gY_.N" $&WmjЧOVg0H:@lP7ÐTG<4E _kOҏh) /"X?14]d`SzlXq[rV|N|%!N9e`"GP| Cjڶ`E35b%Gp.FiS^cI6۵Gc]~.qt8!”KCq4 nWLjNٯ ]Ȉ16{e`f|*(b~M0B^hq"k[0*Xk9ނ6&7\n=LFh&9` Nv J/񚄦7`KflC+XsgT*fn=RjXu'3k_Y Yz<ߎǖ sZ5.fK3 q:n8;'909^`0.0BJ3u"Eoh ۍ >}X,UAox>Ks#qB$ms ?0ױQ^2RO+h:I<=!4m-,=az Ugv(PO)pf- Ԥ:Мu$OaC&PAZPSKh`%g7Qt=NHXh~HC2p(: 2d#.5c$a毜TN gKxz hM°B!,~s8G{ WqC @[YNߎ oQU@_Bֵm\mq[ynhZ*Pu`Ѽ6:eb=@SjȍܬiX7,\=9[3|eN8z.geT 2?p -yzn~pIY8Qp3lfhc0P+̹|qx޷9> EKH{0`9DN;ye M7vfFqAH]F9"^~ }9[OQ6͕$fq;7`gAFZ"vXA3Ҳ䰉@Kz@0zpFji~8 _n40O*SDS,.h4SH"r4KlXxP@>Ռ8JSovtHW!\j)&t]* pQ)ynr6oF V;{( 4IU8Dт:Q=Zz#e@vפ~J.l)%驨WϷ=aLx\ɞB̨QڝlL nK~6bD%D»- +ކQmD״'oX_)b:U#N;Wj1WEF!AK550`8l*+s2 7~&堘p`^c t7RXz'*l'OnUjGM.WF}l>L\5d҂Dav&Bw|5>hIm`ޥGy)UOJcqd@W&,T#E`|Za@T8"W(:ds#ŻB]@܂)-Oti E˼áZ\:[(bC rUynvn#y.j g:э~< 6IV*TzJ󐯳s-v'v6)Jqul|$ Lj ID[.pr :sYo`~NGeݠ*9i쯒8^r8L܀jM-On&kN*K:&/Ĩ, H ",4*8 &~D?(S3Z%> S=w殽Z4&NYcڲ*udާR}.&I3#v̿MAL@/4l9 MbcGl$ZQ^ϜH[:B:_NBhvӎuIcCL# 0}1n1^h/XC?\g+0&I=.,0)]^˥5s{& S"1Z5eK>Sc]KGBr#>s{i[cv nb ~؇3{u9("tvݙ77è//D8^2Cp [T41A#l}vyi>ȵROP’dZ{lǓ|SN4n}t~\ơJU/T.A*ukT@!,A \KWIM(c׸ߞ=W1)Xkʱu[`ށGEy!Jv*inW+ޙA[y v&ѩNi3&#OɤPYp,§cN0uBhdUށj݈uqZ͢l7?k"7cN/Mgh$Vz؂@iAKrcNtraMmK>4 iiVpm *4 TQݵI=.p {gZR6]m )|;Ze{i|o"c(}zzu.KФ\}ьܬsf8(7un.=.C.)q7S9R]z,)-_4a\:u_&܊ CUY XxetHHjMcV# rL4zZCB4߈>)>Z0>P| $'QdlMBpq I#I1R$~shɂOPcdẸÖ /e q{PWܱ=(_JquWߙf3y_π-=1Ny8RL $s0O:ُz`-OƯpeXn|ʡKZ8= :9Sp|J J3X `c֝W0rK1kS;kqA EI4ݤI~}{]|}'DS=O|:VJc'mO&4|3KqnK]}fљB™l髹 o΄"Q#C w]a4YjUВkgi@>Gś[~/LYoMvpӊ=&p VG}N/PsyՐbA> [*XS+ϼޣY>1hݍf挒6<̡(]k MO,jrs/\2=n?X$o)yI>ڒ }Gn3d60YmP- 7k5؋&z:5G:k b֋ QtϠ@澌 ejڱ5.L"ޡy4 ӪŔuNCsPvG7xw< /ch8]!OHx`t@,;>8jPF< >S4FiS{FGr7;,U Qxm(M!E^QjLHA ;Kfz2{o"-x,u}7JRa%qWlm[L/ %>,C?Юεrhf L䩏rz@2γiؑ똂Mo[ JÊ^ ,0Omz >#@nZ2.{&;)䴔Kx`#p2$77@\rT]ZnܺbCyJ]qQZ5 &o?p%ϥ[v=///߇^b0~ĝa]g\̜pNY۠ž.YD7t8K(5}k#,vRbh1?ߟO([ CFTa2J-s uE::gϾ*(?t!5IܪCyʒtG'pbBB3ނa_>&Hݱd2!${HCb32/uQo̊kI"IxP${W&NܨUv[7Ad`UlG*=<29C%%`=WB$er9U;xGty9n&+g(6{t$"<-yv=noѱ=!/VL>Bb!nWe]c-,RjD([p0'l.jӺC京9(}Ѹ߻~Ӷ9NXU3|@,[é6vOъ ͳ5rEm[Dt!=<tgh&K^O'#١e1؜?9iPfadosudfunknownSMDMSCPold DECSCSIESDIST506HP-IBHP-FLtype 9floppyccdvndATAPIRAIDunusedswapVersion6Version7SystemV4.1BSDEighth-Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSHFSADFSNTFSUDFBEf:NRWb:cdenp:rs:tvwbckmgioctl DIOCWLABELunknown disk type: %sDANGER! The disklabel was not found at the correct location!To repair this situation, use `disklabel %s > file' tosave it, then use `disklabel -R %s file' to replace it.A new disklabel is not being installed now.Erase the previous contents of the disk? [n]: writelseekwriting label to block %lld (0x%qx) ioctl DIOCSDINFOioctl DIOCWDINFO%s: No disk label on disk; use "disklabel -r" to install initial label%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of disk%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)can't read master boot recordwarning, DOS partition table with no valid OpenBSD partition# Inside MBR partition %d: type %02X start %u size %u no disklabel found. scanning.no disk labeldisk label corruptedfound at 0x%lxreading label from block %lld, offset %lld ioctl DIOCGPDINFOioctl DIOCGDINFOioctl DIOCRLDINFOBootstrap doesn't leave room for disk label\ :Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:nc#%u:sc#%u:su#%u:%srm#%hu:%sil#%hu:d%d#%up%c#%u:o%c#%u:t%c=%s:t%c=unknown%d:b%c#%u:f%c#%u:%sts#%u:%shs#%u:%scs#%hu:%ssk#%hu:%.*s| %c: %12.*f%c %12.*f%c %7.7s%7d%19.19s# %s# Cyl %5u-%6u %5u %5u %4hu %5u %5u %4.4s %c: %13u %13u device: %s # %s: type: %s type: %d disk: %.*s label: %.*s bytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total bytes: %.*f%c free bytes: %.*f%c rpm: %hu %hu partitions: offset# %13.13s %13.13s fstype [fsize bsize cpg] interleave: %hu trackskew: %hu cylinderskew: %hu headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %d free sectors: %u total sectors: %u badsect ecc removable # Notes: # Up to 16 partitions are valid, named from 'a' to 'p'. Partition 'a' is # your root filesystem, 'b' is your swap, and 'c' should cover your whole # disk. Any other partition is free for any use. 'size' and 'offset' are # in 512-byte blocks. fstype should be '4.2BSD', 'swap', or 'none' or some # other values. fsize/bsize/cpg should typically be '2048 16384 16' for a # 4.2BSD filesystem (or '512 4096 16' except on alpha, sun4, ...) re-edit the label? [y]: editNo changes.-cEDITOR/usr/bin/vifailed to start editor/bin/sh # line %d: syntax errorIDEline %d: warning, unknown disk type: %sremovableeccbadsectline %d: bad flag: %sdrivedataline %d: bad drivedata %s%d partitionsline %d: bad %s: %ssectors/cylindertracks/cylindercylinderstotal sectorsrpmtrackskewcylinderskewheadswitchtrack-to-track seekline %d: bad partition name: %sline %d: warning, unknown filesystem type: %sline %d: too few fieldsline %d: bad partition offset: %sgetasciilabelline %d: bad partition size: %sline %d: unknown field: %sline %d: bad # of partitionssector size %dtracks/cylinder %dwarning, unused partition %c: size %d offset %dpartition %c: block size < fragment sizepartition %c: partition extends past end of unitpartition %c: offset past end of unitwarning, partition %c: size 0, but offset %dwarning, number of partitions (%d) > MAXPARTITIONS (%d)warning, super block size %% sector-size != 0super block size %dwarning, boot block size %% sector-size != 0boot block size %dwarning, revolutions/minute %dcylinders/unit %dsectors/track %dcmplabel usage: disklabel [-c | -d | -r | -t] [-v] [-p unit] disk (read) disklabel -w [-c | -d | -r] [-nv] disk disktype [packid] (write) disklabel -e [-c | -d | -r] [-nv] disk (edit) disklabel -E [-c | -d | -r] [-nv] [-f tempfile] disk (simple editor) disklabel -R [-nrv] disk protofile (restore) disklabel -N | -W [-nv] disk (protect) disklabel -B [-nv]%s disk [disktype] (boot) disklabel -Bw [-nv]%s disk disktype [packid] (write) disklabel -BR [-nv]%s disk protofile [disktype] (restore) `disk' may be of the form: sd0 or /dev/rsd0%c. `disktype' is an entry from %s, see disktab(5) for more info. /etc/disktab`packid' is an identification string for the device. `protofile' is the output from the read cmd form; -R is powerful. For procedures specific to this architecture see: %s fdisk(8)You need to specify a type for this disk.No 'c' partition found, adding one that spans the disk. Initial label editor (enter '?' for help at any prompt) unable to get default partition tablePAGER/usr/bin/lessgunzip -qc|%sunable to execute %sEnteringExiting%s expert mode This option is not valid when run without the -f flag. Write the modified label to disk?Write new label?unable to write labelNo label changes.In no change mode, not writing label.Recalculated free space.cannot open %sFilenameName of the file to save label into.Nothing to undo!Last change undone.Unknown option: %c ('?' for help) can't run when there is partition overlap.Partition must be between 'a' and '%c' (excluding 'c'). editor_add Please re-enter an offset and size for partition %c. Partition '%c' exists. Delete it first. The letter of the new partition, a - p.partitionPartition '%c' already exists. Partition must be between 'a' and '%c'. No space left, you need to shrink a partition Partition '%c' is not in use. You cannot name a filesystem of type %s. partition to nameThe letter of the partition to name, a - p.Command aborted Please re-enter an offset and sizeWarning, need %u sectors but there are only %u free. Setting size to %u. partition to modifyThe letter of the partition to modify, a - p.You may not delete the 'c' partition. The 'c' partition must exist and should span the entire disk. By default it is of type 'unused' and so does not take up any space. The letter of the partition to delete, a - p, or '*'.partition to deletePartition %c is currently %u sectors in size (%u free). new sizeSize of the partition. You may also say +/- amount for a relative change.Invalid entry Only %u sectors free, you asked for %u 'c' partition may not be larger than the disk partition to change sizeThe letter of the partition to change size, a - p.%s: [%s] %s: [%u] Rounding to nearest cylinder: %u getuinthas_overlap Error, partitions %c and %c overlap: Disable which one? (^D to abort) [%c %c] Changing device parameters for %s: What kind of disk is this? Usually SCSI, ESDI, ST506, or floppy (use ESDI for IDE)."%s" is not a valid disk type. Valid types are: "%s"label name15 char string that describes this label, usually the disk name.The Numer of sectors per track.The number of tracks per cylinder.The number of sectors per cylinder (Usually sectors/track * tracks/cylinder).number of cylindersThe total number of cylinders on the disk.The total number of sectors on the disk.Not enough free space to shrink by %u sectors (only %u sectors left) The rotational speed of the disk in revolutions per minute.The physical sector interleave, set when formatting. Almost always 1.edit_parmsYou may want to increase the size of the 'c' partition.failed to sort partition tablesdrzFLOPPYxdhdCCDVNDsvndPossible values are:"IDE", Disk typeWhat kind of disk is this? Usually SCSI, IDE, ESDI, CCD, ST506, or floppy.Starting sectorThe start of the OpenBSD portion of the disk.Size ('*' for entire disk)The size of the OpenBSD portion of the disk ('*' for the entire disk). Treating sectors %u-%u as the OpenBSD portion of the disk. You can use the 'b' command to change this. The 'p' command prints the current disk label. By default, it prints the size and offset in sectors (a sector is usually 512 bytes). The 'p' command takes an optional units argument. Possible values are 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, and 'g' for gigabytes. The 'D' command will set the disk label to the default values as reported by the disk itself. This similates the case where there is no disk label. The 'M' command pipes the entire OpenBSD manual page for disk label through the pager specified by the PAGER environment variable or 'less' if PAGER is not set. It is especially useful during install when the normal system manual is not available. The 'X' command toggles disklabel in to/out of 'expert mode'. By default, some settings are reserved for experts only (such as the block and fragment size on ffs partitions). The 'a' command adds new partitions to the disk. It takes as an optional argument the partition letter to add. If you do not specify a partition letter, you will be prompted for it; the next available letter will be the default answer The 'b' command is used to change the boundaries of the OpenBSD portion of the disk. This is only useful on disks with an fdisk partition. By default, on a disk with an fdisk partition, the boundaries are set to be the first and last sectors of the OpenBSD fdisk partition. You should only change these if your fdisk partition table is incorrect or you have a disk larger than 8gig, since 8gig is the maximum size an fdisk partition can be. You may enter '*' at the 'Size' prompt to indicate the entire size of the disk (minus the starting sector). Use this option with care; if you extend the boundaries such that they overlap with another operating system you will corrupt the other operating system's data. The 'c' command is used to change the size of an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. You may add a '+' or '-' prefix to the new size to increase or decrease the existing value instead of entering an absolute value. You may also use a suffix to indicate the units the values is in terms of. Possible suffixes are 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, 'g' for gigabytes or no suffix for sectors (usually 512 bytes). You may also enter '*' to change the size to be the total number of free sectors remaining. The 'd' command is used to delete an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. You may not delete the ``c'' partition as 'c' must always exist and by default is marked as 'unused' (so it does not take up any space). The 'e' command is used to edit the disk drive parameters. These include the number of sectors/track, tracks/cylinder, sectors/cylinder, number of cylinders on the disk , total sectors on the disk, rpm, interleave, disk type, and a descriptive label string. You should not change these unless you know what you are doing The 'g' command is used select which disk geometry to use, the disk, BIOS, or user geometry. It takes as an optional argument ``d'', ``b'', or ``u''. If you do not specify the type as an argument, you will be prompted for it. The 'm' command is used to modify an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. This option allows the user to change the filesystem type, starting offset, partition size, block fragment size, block size, and cylinders per group for the specified partition (not all parameters are configurable for non-BSD partitions). The 'n' command is used to set the mount point for a partition (ie: name it). It takes as an optional argument the partition letter to name. If you do not specify a partition letter, you will be prompted for one. This option is only valid if disklabel was invoked with the -F flag. The 'q' command quits the label editor. If any changes have been made you will be asked whether or not to save the changes to the on-disk label. The 'r' command is used to recalculate the free space available. This option should really not be necessary under normal circumstances but can be useful if disklabel gets confused. The 's' command is used to save a copy of the label to a file in ascii format (suitable for loading via disklabel's [-R] option). It takes as an optional argument the filename to save the label to. If you do not specify a filename, you will be prompted for one. The 'u' command will undo (or redo) the last change. Entering 'u' once will undo your last change. Entering it again will restore the change. The 'w' command will write the current label to disk. This option will commit any changes to the on-disk label. The 'x' command exits the label editor without saving any changes to the on-disk label. Available commands: ? [cmnd] - this message or command specific help. a [part] - add new partition. b - set OpenBSD disk boundaries. c [part] - change partition size. D - set label to default. d [part] - delete partition. e - edit drive parameters. g [b|d|u] - use [b]ios, [d]isk or [u]ser geometry. M - show entire OpenBSD man page for disklabel. m [part] - modify existing partition. n [part] - set the mount point for a partition. p [unit] - print label. q - quit and save changes. r - recalculate free space. s [path] - save label to file. u - undo last change. w - write label to disk. X - toggle expert mode. x - exit without saving changes. z - zero out partition table.Numeric parameters may use suffixes to indicate units: 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, 'g' for gigabytes or no suffix for sectors (usually 512 bytes). '%' for percent of total disk size, '&' for percent of free space. Non-sector units will be rounded to the nearest cylinder. Entering '?' at most prompts will give you (simple) context sensitive help.The 'z' command zeroes out the existing partition table, leaving only the 'c' partition. The drive parameters are not changed. mpsave%s%c %s %s rw 1 %d Starting sector for this partition.The OpenBSD portion of the disk starts at sector %u, you tried to add a partition at %u. You can use the 'b' command to change the size of the OpenBSD portion. The OpenBSD portion of the disk ends at sector %u, you tried to add a partition at %u. You can use the 'b' command to change the size of the OpenBSD portion. Size of the partition.Sorry, there are only %u sectors left The OpenBSD portion of the disk ends at sector %u, you tried to add a partition ending at sector %u. You can use the 'b' command to change the size of the OpenBSD portion. Size may not be larger than %u sectors Size of fs block fragments. Usually 2048 or 512.Zero fragment size implies zero block sizeSize of filesystem blocks. Usually 16384 or 4096.Error: block size must be a multiple of the fragment size. Error: block size must be at least as big as fragment size. Error: block size must be at least as big as page size (%d). cpgNumber of filesystem cylinders per group. Usually 16 or 8.FS type (decimal)Filesystem type as a decimal number; usually 7 (4.2BSD) or 1 (swap).FS typeFilesystem type (usually 4.2BSD or swap)Unrecognized filesystem type '%s', treating as 'unknown' noneWhere to mount this filesystem (ie: / /var /usr)Mount points must start with '/' Can't stat deviceBIOS geometry not defined. You must enter either 'd', 'b', or 'u'. Note: user geometry is the same as disk geometry. Enter 'd' to use the geometry based on what the disk itself thinks it is, 'b' to use what the BIOS says,or 'u' to use the geometry that was found on in the label.[d]isk, [b]ios, or [u]ser geometry$OpenBSD: ar_io.c,v 1.37 2005/08/04 10:02:44 mpf Exp $$OpenBSD: ar_subs.c,v 1.30 2006/07/21 22:56:58 ray Exp $$OpenBSD: buf_subs.c,v 1.21 2005/11/09 19:59:06 otto Exp $$OpenBSD: cache.c,v 1.17 2004/03/16 03:28:34 tedu Exp $$OpenBSD: cpio.c,v 1.17 2004/04/16 22:50:23 deraadt Exp $$OpenBSD: file_subs.c,v 1.30 2005/11/09 19:59:06 otto Exp $$OpenBSD: ftree.c,v 1.26 2005/04/21 21:47:18 beck Exp $$OpenBSD: gen_subs.c,v 1.18 2005/04/28 06:58:07 otto Exp $$OpenBSD: getoldopt.c,v 1.8 2003/07/02 21:19:33 deraadt Exp $$OpenBSD: options.c,v 1.64 2006/04/09 03:35:34 jaredy Exp $$OpenBSD: pat_rep.c,v 1.30 2005/08/05 08:30:10 djm Exp $@(#) Copyright (c) 1992, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: pax.c,v 1.28 2005/08/04 10:02:44 mpf Exp $$OpenBSD: sel_subs.c,v 1.18 2004/04/16 22:50:23 deraadt Exp $$OpenBSD: tables.c,v 1.23 2005/04/21 21:47:18 beck Exp $$OpenBSD: tar.c,v 1.41 2006/03/04 20:24:55 otto Exp $$OpenBSD: tty_subs.c,v 1.12 2003/06/02 23:32:09 millert Exp $Cannot write an archive on top of a directory %sFailed stat on %sFailed chdir to %sFailed open to read on %sFailed open to write on %sFailed open to read/write on %s%s: unknown format, %qu bytes skipped. %qu blocks %s: %s vol %d, %lu files, %qu bytes read, %qu bytes written. done. %s: Waiting for tape drive close to complete...ar_drainUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specEnd of archive volume %d reachedFailed read on archive volume %dWARNING: partial archive write. Archive IS FLAWEDWARNING: partial archive write. Archive MAY BE FLAWEDFailed write to archive volume: %dUnable to append, trailer re-write failed. Quitting.Write failed, archive is write protected.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Cannot allow updates to an archive with flaws.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to seek archive backwardsReverse position on previous volume.Unable to obtain current archive byte offsetUnable to backspace tape %d blocks.Tape drive unable to backspace requested amountget_physUnable to backspace tape over %d pad blocksUnable to backspace over tape filemark.Unable to locate tape filemark.Cannot determine archive tape blocksize.Unable to backspace over last tape block.ar_next ATTENTION! %s archive volume change required. %s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot open %s, try again Cannot save archive name.Quitting %s! %s ready for archive tape volume: %d Load the NEXT TAPE on the tape driveReady for archive volume: %d Unable to restore signal maskUnable to set signal maskcould not pipecould not forkcould not exec-dcCan't fchdir to starting directoryCannot chdir to %sextractUnable to open %s to readCannot mix current archive format %s with %sappend%s: Reading archive to position at the end...directory name is too long %scopyDestination is not a directory %sDestination pathname too long %sCannot access destination directory %sArchive I/O error. Trying to recover.Archive I/O error, cannot continuePremature end of file on archive readInvalid header, starting valid header search.Unable to append, archive header flawCannot identify format. Searching...Sorry, unable to determine archive format.Write block size of %d too large, maximium is: %dWrite block size of %d larger than POSIX max %d, archive may not be portableWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximium is: %dWrite block size %d is not a %d byte multipleUnable to rewrite archive trailer, cannot append.Cannot append to an archive that may have flaws.Archive read error limit (%d) reachedUnable to append when there are archive read errors.File changed size during read %sFile %s was modified during copy to archiveRead fault on %sActual crc does not match expected crc %sUnable to obtain block size for file %sFile %s changed size during copy to %sFile %s was modified during copy to %sFailed stat of %sFailed write during copy of %s to %sUser specified archive volume byte limit reached.Unable to allocate memory for user id cache tableUnable to allocate memory for group id cache tableUnable to allocate memory for user name cache tableUnable to allocate memory for group name cache tableTRAILER!!!cpio_endwrCpio file name in header is corruptedCpio file name length %d is out of rangeCpio link name is corruptCpio link name read errorCpio link name length is invalid: %qu070707File is too large for cpio format %sCpio header field is too small to store file %scpio_wrUnable to write cpio link name for %sUnable to write cpio header for %s070701070702File is too large for sv4cpio format %sSv4cpio header field is too small for file %svcpio_wrCould not write sv4cpio link name for %sCould not write sv4cpio header for %sFile is too large for bcpio format %sbcpio_wrBcpio header field is too small for file %sCould not write bcpio link name for %sCould not write bcpio header for %sUnable to create %sUnable to close file descriptor on %sA hard link to the directory %s is not allowedUnable to link to %s from %sUnable to copy %s, file would overwrite itselfCould not link to %s from %sUnable to remove %sUnable to link file %s to itselfCould not create: %snode_creatCould not access %s (stat)cannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCould not unlink %sUnable to remove directory %sAccess/modification time set failed on: %sUnable to obtain file stats %sUnable to set file uid/gid of %sCould not set permissions on %sFailed write to file %sOut of memoryFile seek on %sWARNING! Major Internal Error! GNU hack Failing!Failed seek on file %sFile changed size %sset_crcFile %s was modified during readFile rewind failed on: %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:Can't chdir to %sFile system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %sIgnoring too-long pathname: %sIgnoring unterminated pathname at EOFls_list%b %e %H:%M%b %e %Y%s%2u %-*.*s %-*.*s %4lu,%4lu == => %9qu %s%s %s ls_tty%s: unknown option %c %s: %c argument missing bcpiosv4cpiosv4crcustarab:cdf:iklno:p:rs:tuvwx:zB:DE:G:HLOPT:U:XYZ0Write limit is not a %d byte multipleInvalid write limit %sError count value must be positiveInvalid block size %sInvalid -p string: %cUnknown -x format: %spax: Known -x formats are:Destination directory was not suppliedb:cef:hmopqruts:vwxzBC:HI:LOPXZ014578/dev/rst0/dev/rst1/dev/rst4/dev/rst5/dev/rst7/dev/rst8Unable to allocate space for option listTAPEProblem with file '%s'Unable to open file '%s' for read-C-Iwrite_opt=nodirabcdfiklmoprstuvzABC:E:F:H:I:LO:SZ6Unknown -H format: %scpio: Known -H formats are:Problem while reading stdin%s: Invalid combination of options: -%cThese format options are not supported %s = %s Invalid option nameInvalid options formatusage: pax [-0cdOnvz] [-E limit] [-f archive] [-G group] [-s replstr] [-T [from_date][,to_date][/[c][m]]] [-U user] [pattern ...] pax -r [-0cDdikOnuvzYZz] [-E limit] [-f archive] [-G group] [-o options] [-p string] [-s replstr] [-T [from_date][,to_date]] [-U user] [pattern ...] pax -w [-0adHiLOPtuvXz] [-B bytes] [-b blocksize] [-f archive] [-G group] [-o options] [-s replstr] [-T [from_date][,to_date][/[c][m]]] [-U user] [-x format] [file ...] pax -r -w [-0DdHikLlnOPtuvXYZ] [-G group] [-p string] [-s replstr] [-T [from_date][,to_date][/[c][m]]] [-U user] [file ...] directory usage: tar {crtux}[014578befHhLmOoPpqsvwXZz] [blocking-factor | archive | replstr] [-C directory] [-I file] [file ...] tar {-crtux} [-014578eHhLmOoPpqvwXZz] [-b blocking-factor] [-C directory] [-f archive] [-I file] [-s replstr] [file ...] usage: cpio -o [-aABcLvVzZ] [-C bytes] [-H format] [-O archive] [-F archive] < name-list [> archive] cpio -i [-bBcdfmnrsStuvVzZ6] [-C bytes] [-E file] [-H format] [-I archive] [-F archive] [pattern...] [< archive] cpio -p [-adlLmuvV] destination-directory < name-list Empty replacement stringrep_addInvalid replacement string %sInvalid replacement string option %s%s while compiling regular expression %sUnable to allocate memory for replacement stringEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern list inconsistentPattern select out of memoryRemoving leading / from absolute path names in the archive ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Processing continues, name changed to: %s tty_renameProcessing continues, name unchanged. Skipping file. File name %s/%s, too longrep_name%s >> %s >> %s Replacement name too long %s >> %sReplacement name error %sTMPDIR/tmp/Cannot allocate memory for temp file name.Can't open current working directory.can not gzip while appendingCpu time limit reached, cleaning up.Signal caught, cleaning up.LC_TIMEUnable to set up signal handlerUser selection table out of memoryUnable to find uid for user: %sUnable to allocate memory for user selection tableGroup selection table out of memoryCannot determine gid for group name: %sUnable to allocate memory fo group selection tableEmpty time range stringUpper %s and lower %s time overlapIllegal upper time range %sTime range format is: [[[[[cc]yy]mm]dd]HH]MM[.SS][/[c][m]]Illegal lower time range %sBad option %c with time range %sUnable to allocate memory for time rangeImproperly specified time range: %sCannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %schk_ftimeFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryFailed ftime table readFailed ftime table seekCannot allocate memory for interactive rename tableNo interactive rename table, links may failInteractive rename table out of memoryCannot update rename tableCannot allocate memory for device mapping tableDevice map table out of memoryUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryUnable to allocate memory for directory timesUnable to store mode and times for created directory: %swrite_optnodir%s=%s is only supported when writing.Unknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format optiontar_wrFile name too long for tar %sTar header field is too small for %sFile is too large for tar %sTar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for ustar %sUstar header field is too small for uid %lu, using nobodyUstar header field is too small for gid %lu, using nobodyUstar header field is too small for %sustar_wrnobodyFile is too long for ustar %sLink name too long for ustar %sUstar cannot archive a socket %s/dev/ttyFatal error, cannot open %s%s: @(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: ping.c,v 1.77 2006/04/13 00:49:15 deraadt Exp $setresuidDI:LRS:c:dfi:jl:np:qrs:T:t:vw:number of packets to transmit is %s: %sbad interface address: %stos value is %s: %s%s: only root may use interval < 1sbad timing interval: %spreload value is %s: %spacket size is %s: %sttl value is %s: %smaxwait value is %s: %s-f and -i options are incompatiblebind-R option and -D or -T, or -t to unicast destinations are incompatiblesetsockopt IP_MULTICAST_IFgetsockoptCannot set the receive buffer sizePING %s: %d data bytes ping: recvfromPING %s (%s): %d data bytes Could only allocate a receive buffer of %i bytes (default %i)setsockoptsetsockopt IP_MULTICAST_TTLsetsockopt IP_MULTICAST_LOOPping: record routerecord route not valid to multicast destinationsunknown host: %sping: wrote %s %d chars, ret=%d pingerping: sendtopacket too short (%d bytes) from %s unknown option %x LSRR: 0.0.0.0 (truncated route) %s RR: (same route) NOP%d bytes from %s: icmp_seq=%u ttl=%d wrong data byte #%d should be 0x%x but was 0x%x%x (DUP!) time=%d.%03d ms%d bytes from %s: %ld packets transmitted, %ld packets received, %.1f%% packet lossround-trip min/avg/max/std-dev = %d.%03d/%d.%03d/%d.%03d/%d.%03d ms -- somebody's duplicating packets!%ld duplicates, --- %s ping statistics --- Echo ReplyDestination Net UnreachableDest Unreachable, Unknown Code: %d Destination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF setfrag needed and DF set (MTU %d) Source Route FailedNetwork UnknownHost UnknownSource IsolatedDest. Net Administratively ProhibitedDest. Host Administratively ProhibitedDestination Net Unreachable for TOSDesination Host Unreachable for TOSRoute administratively prohibitedHost Precedence ViolationPrecedence CutoffSource QuenchRedirect Network(New addr: %s) Redirect, Unknown Code: %dRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostUnknown ICMP type: %d Echo RequestRouter Discovery Advertisement(%d entries, lifetime %d seconds) Router Discovery SolicitationTime exceeded, Unknown Code: %d Frag reassembly time exceededTime to live exceededParameter problem, required option absent: pointer = 0x%02x Parameter problem: pointer = 0x%02x TimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask Reply (Mask 0x%08x) Vr HL TOS Len ID Flg off TTL Pro cks Src Dst Data %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %s %02x%s (%s)TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xpatterns must be specified as hex digitsusage: ping [-DdfjLnqRrv] [-c count] [-I ifaddr] [-i wait] [-l preload] [-p pattern] [-s packetsize] [-T tos] [-t ttl] [-w maxwait] host $OpenBSD: fsutil.c,v 1.15 2006/05/28 15:43:41 thib Exp $lost+foundwrong type to dirscan %d DIRECTORY CORRUPTEDNAME=%s fileerror%s=%s DIRLINK COUNT %s COUNT %d SHOULD BE %d (ADJUSTED)ADJUSTLINK COUNT INCREASINGUNREFmkentryUNREF %s RECONNECTSORRY. CANNOT CREATE lost+found DIRECTORYlost+found IS NOT A DIRECTORYREALLOCATElinkupSORRY. CANNOT CREATE lost+found DIRECTORY SORRY. NO lost+found DIRECTORY DIR I=%u CONNECTED. PARENT WAS I=%u SORRY. NO SPACE IN lost+found DIRECTORYNO lost+found DIRECTORYCREATE (CREATED) (RECONNECTED)makeentryNO SPACE LEFT IN %s (EXPANDED)EXPANDLARGE FILES UNSUPPORTED ON REVISION 0 FILESYSTEMSSETTING LARGE FILE INDICATOR SET LARGE FILE INDICATORTRYING TO SET FILESIZE TO %llu ON MODE %x FILE ckinodeDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDSiblockPARTIALLY TRUNCATED INODE I=%ublk %d < cgdmin %d; blk + cnt %d > cgsbase %d blk %d >= cgdmin %d; blk + cnt %d > cgdmax %d bad inode number %d to ginode bad inode number %d to nextinode Cannot allocate space for inode buffer cannot increase directory list cannot find inode %d CLEAR (CLEARED) I=%u OWNER=%u MODE=%o SIZE=%llu MTIME=%12.12s %4.4s %d %s I=%uBAD STATE %d TO BLKERR b:dfm:npyAlternate super block location: %d ** lost+found creation mode %o bad mode to -m: %o -%c flag requires a %s checkfilesysCAN'T CHECK FILE SYSTEM.** Phase 1 - Check Blocks and Sizes** Phase 1b - Rescan For More DUPS%d files, %d used, %d free ***** REBOOT NOW ***** ***** PLEASE RERUN FSCK ***** ***** FILE SYSTEM WAS MODIFIED *****The following zero link count inodes remain: %u,The following duplicate blocks remain: %d,%d blocks missing %d files missing ** Phase 5 - Check Cyl groups** Phase 4 - Check Reference Counts** Phase 3 - Check Connectivity** Phase 2 - Check PathnamesINTERNAL ERROR: dups with -p** Root file system** Last Mounted on %s starting usage: %s [-dfnpy] [-b block#] [-m mode] filesystem ... UNKNOWN FILE TYPE I=%ubad size %llu:INCORRECT BLOCK COUNT I=%u (%d should be %d) (CORRECTED)LINK COUNT TABLE OVERFLOWCONTINUEbad indirect addr: %d bad direct addr: %d bad size %llu ndb %d:HOLD BAD BLOCKINODE I=%u HAS DTIME=%12.12s %4.4sPARTIALLY ALLOCATED INODE I=%uDUP TABLE OVERFLOW.EXCESSIVE DUP BLKS I=%u (SKIPPING)EXCESSIVE BAD BLKS I=%uBAD STATE %d FOR ROOT INODE DUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYCANNOT ALLOCATE ROOT INODE ROOT INODE UNALLOCATEDALLOCATEpass2MISSING '..'FIXBAD INODE NUMBER FOR '..'DIRECTORY TOO SHORTDIRECTORY %s: LENGTH %lu NOT MULTIPLE OF %dMISSING '.'I OUT OF RANGEREMOVEpass2checkUNALLOCATEDBAD TYPE VALUEIS AN EXTRANEOUS HARD LINK TO DIRECTORY%s %s %s (IGNORED)DUP/BADZERO LENGTH DIRECTORYEXTRA '.' ENTRYEXTRA '..' ENTRYCANNOT FIX, INSUFFICIENT SPACE TO ADD '..' CANNOT FIX, SECOND ENTRY IN DIRECTORY CONTAINS %s BAD TYPE VALUE FOR '..'CANNOT FIX, INSUFFICIENT SPACE TO ADD '.' CANNOT FIX, FIRST ENTRY IN DIRECTORY CONTAINS %s BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'BAD STATE %d FOR INODE I=%d ZERO LENGTHBAD/DUPsummary info for cg %d is %d, %d, %d,should be %d, %d, %d SUMMARY INFORMATIONS WRONG FOR CG #%dBLK(S) MISSING IN BIT MAPS #%dINODE(S) MISSING IN BIT MAPS #%dsummary info bad in superblock: %d, %d should be %d, %d SUPERBLK SUMMARY INFORMATION BADpass5ino_bitmap:ibmap:blk_bitmap:bbmap:BAD STATE %d FOR INODE I=%ld %u: %2x %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. /r%s is not a character device Can't stat %s Can't stat rootmalloc failedrealloc failedstrdup failed%s is not a character device (NO WRITE)cannot allocate space for superblock setupLOOK FOR ALTERNATE SUPERBLOCKSLOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ext2fs(8).SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO FSCK_FFS TO SPECIFY THE%s %s %s %s %s %s USING ALTERNATE SUPERBLOCK AT %d WRONG FPG=%d (BPG=%d) IN SUPERBLOCKBAD SUMMARY INFORMATIONcannot alloc %u bytes for blockmap cannot alloc %u bytes for statemap cannot alloc %u bytes for lncntp cannot alloc %u bytes for inphead cannot alloc %u bytes for typemap IMPOSSIBLE RESERVED BLOCK COUNT=%d IN SUPERBLOCKSET TO DEFAULT** File system is already clean %sile system is clean; not checking ** Fstate = %d NO WRITE ACCESS** %sCan't open %s: %s Can't stat %s: %s MAGIC NUMBER WRONGBAD LOG_BSIZEINCOMPATIBLE FEATURE BITS IN SUPER BLOCKcompat 0x%08x, incompat 0x%08x, compat_ro 0x%08x VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEsuperblock mismatchesoffset %ld, original %ld, alternate %ld BAD SUPER BLOCK: %s %s: NOT LABELED AS A EXT2 FILE SYSTEM (%s) %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION ioctl (GCINFO): %s %s: can't read disk label PARTIALLY WRITING %sZERO'ED BLOCK %d TO DISK bad file type 0%o %s? yes %s? [Fyn?] %s? no INTERNAL ERROR: GOT TO reply()cannot allocate buffer pool deadlocked buffer pool CANNOT %s: BLK %dProgram terminated MARKING FILE SYSTEM CLEAN cache missed %ld of %ld (%d%%) MARK FILE SYSTEM CLEANUPDATE STANDARD SUPERBLOCKSPanic: lost %d buffers READTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %ld (%ld), %ld,SEEKWRITETHE FOLLOWING SECTORS COULD NOT BE WRITTEN:returning to single-user after filesystem check catchquitSALVAGE (SALVAGED)UNKNOWN INODESC FIX MODE %d benstuvusage: %s [-benstuv] [-] [file ...] %6d KcctHtcHtcHcHcHcHc[bHbHbHhHiH|aH$gHgHlnH(oH(oHoHoI r I rIr Ir,Is%d: powersave on (%dms sleep) (auto) %ddBm%sHIDENWIDNOBRIDGEieee80211_status no permission to scanSIOCG80211ALLNODES none restoreieee80211_listnodesnwid chan %u bssid %s lladdr %s %udB %u%% powersave %uMESSIBSSPOLLABLEPOLLREQPRIVACYSHORT_PREAMBLEPBCCCHNL_AGILITY SHORT_SLOTTIME RSNDSSSOFDMCACHEBSSAUTHASSOCCOLLECTSGIOCGIFMEDIA%s: no link type?init_current_mediaSIOCSIFMEDIAonly one `media' command may be issuedmay not issue `media' after `mode' commandsmay not issue `media' after `mediaopt' commandsonly one `mode' command may be issuedinvalid media mode: %sonly one `mediaopt' command may be issuedmay not issue `mediaopt' after `instance'only one `-mediaopt' command may be issuedmay not issue both `media' and `-mediaopt'only one `instance' command may be issuedmust specify `media' before `instance'media instance %s: %sEthernetetherTokenRingtokenFDDIIEEE802.11TDMCARPautoselectmanual10baseT10baseT/UTP10UTP10base210base2/BNC10BNC10base510base5/AUI10AUI100baseTX100TX100baseFX100FX100baseT4100T4100baseVG100VG100baseT2100T21000baseSX1000SX10baseSTPSTP10STP10baseFLFL10FL1000baseLX1000LX1000baseCX1000CX1000baseT1000T1000baseTX1000TXHomePNA1HPNA110GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10GbaseCX410GCX410GBASE-CX4DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDIFH1FH2DS2DS5DS11DS1DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72t1t1-amie1-g.704e1-amie1-ami-g.704t3t3-m13e3e3-g.751e3-g.832e1-g.704-crc411a11b11gfhmasterfull-duplexfdxhalf-duplexhdxflag0flag1flag2loopbackhw-loopbackloopEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapibssibss-mastermonitorturbohdlc-crc16pppframerelay-ansiframerelay-ciscoframerelay-ituunknown %s media subtype: %sunknown %s media mode: %sunknown %s media option: %smedia mode %smediaopt instance %d physical address inet%s %s --> %s phys_statusno carrieractiveno ringinsertedno networkbackupUPBROADCASTDEBUGLOOPBACKPOINTOPOINTNOTRAILERSRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST metric %lu mtu %lu lladdr %s description: %s %s: no media types?SIOCGIFMEDIA media: status: supported media: inet %sSIOCGIFNETMASKSIOCGIFDSTADDR --> %s netmask 0x%xSIOCGIFBRDADDR broadcast %sin_status inet6 %sSIOCGIFDSTADDR_IN6 -> %sSIOCGIFNETMASK_IN6 prefixlen %dSIOCGIFAFLAG_IN6 anycast tentative duplicated detached deprecated scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime in6_aliasprefix %s: %s%s=%o%s=%xusage: ifconfig [-AaCm] [interface] [address_family] [address [dest_address]] [parameters] getifgroupsSIOCGIFGROUP groups:malformed link-level addressSIOCSIFLLADDR1ACFLRSTacdfghiklmnopqrstuxCOLUMNS%s: %s: %s: directory causes a cyclefts_readdisplay%lld%*s%*qd printlong%3d, %3d %-*s %*qd %*u total %lu %s %*u %-*s %-*s -> printlink ls: %s: %s %*s usage: %s [-1AaCcdFfghikLlmnopqRrSsTtuWx] [file ...] mainifconfigmake_packetrtsol_check_timerrtsol_timer_updatesockopensendpacketrtsol_inputinterface_upinterface_statuslladdropt_fill)get_llflagprobe_initdefrouter_probesendprobeadDFfailed to open a socketfailed to initialize interfacesselect: %sfailed to setup for probing routersfailed to initialize %skernel is configured as a router, not a hostkernel is configured not to accept RAsadDfFm1memory allocation failedinterface %s was already configuredfailed to get link layer information for %slink-layer address option has null length on %s. Treat as not included.memory allocation failed for %sNew timer is %ld:%08ldthere is no timer%s status is changed from %d to %dNo answer after sending %d RSstimer expiration on %s, state = %dset timer for %s to %d:%dstop timer for %sillegal interface state(%d) on %susage: rtsol [-DdF] interface ... usage: rtsol [-DdF] -a usage: rtsold [-1DdFfm] interface ... usage: rtsold [-1DdFfm] -a <%s> %swarnmsgprobing %sreallocmultiple interfaces foundff02::2inet_pton failed for %ssetsockopt(ICMP6_FILTER): %sIPV6_HOPLIMIT: %sIPV6_PKTINFO: %ssocket: %smalloc for send msghdr failedmalloc for receive msghdr failedsend RS on %s, whose state is %dsendmsg on %s: %ssendpacketfailed to get receiving interfacertsol_inputinvalid icmp type(%d) from %s on %sinvalid RA with hop limit(%d) from %s on %sinvalid RA with non link-local source from %s on %sreceived RA from %s on %s, state is %dreceived RA from %s on an unexpeced IF(%s)invalid icmp code(%d) from %s on %spacket size(%d) is too shortfailed to get receiving hop limitrecvmsg: %schecking if %s is ready...interface_up%s is duplicated%s is tentative%s is readyget_llflag() failed, anyway I'll tryioctl(SIOCSIFFLAGS): %sioctl(SIOCGIFFLAGS): %sinterface_statusioctl(SIOCGIFMEDIA) on %s: %sioctl(SIOCGIFFLAGS) on %s: %sunsupported link type(%d)get_llflagioctl(SIOCGIFAFLAG_IN6): %sgetifaddrs: %ssocket(SOCK_DGRAM): %sshutdown: %slo0defrouter_probedefault router list contains a non-link-local address(%s)ioctl(SIOCGDRLST_IN6): %sprobe a router %s on %ssendprobeTTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftinvalid namelen:%d/%luno nameunknown qtyperefused???unknown, type 0x%xrefused, type 0x%x%d bytes from %s, icmp_seq=%u hlim=%d(DUP!) time=%g ms dst=%sfailed to get receiving packet informationa:b:c:dfHg:h:I:i:l:mnNp:qRS:s:tvwW-R is not supported in this configurationinvalid source address: %sinvalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit -- %sillegal hoplimit %stoo small interval, raised to 0.01illegal timing interval %sillegal preload value -- %sMust be superuser to preloaddatalen value too large, maximum is %dillegal datalen value -- %sgetaddrinfo failedsetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_HOPOPTS)setsockopt(IPV6_DSTOPTS)-f and -i incompatible optionsUnable to allocate packetsetsockopt(IPV6_USE_MIN_MTU)setsockopt(ICMP6_FILTER)%s: invalid interface namesetsockopt(SO_SNDBUF)PING6(%lu=40+8+%lu bytes) %s --> new path MTU (%d) is notified recvmsgpollsetsockopt(IPV6_HOPLIMIT)setsockopt(IPV6_PKTINFO)setsockopt(SO_RCVBUF)you need -b to increase socket buffer sizeUDP socketUDP setsockopt(IPV6_PKTOPTIONS)UDP connectgetsocknamecan't initialize rthdrbad addr family of an intermediate addrcan't add an intermediate nodecan't set the last flagcan't allocate enough memorysetsockopt(IPV6_RTHDR)IPV6_MULTICAST_HOPSgateway resolves to multiple addressestoo many intermediate hopsgetaddrinfo for the gateway %s: %sping6: wrote %s %d chars, ret=%d sendmsg\%03odnsdecodeinvalid peernamepr_packunknown code 0x%x, type 0x%xNodeInfo NOOP HbH Options: Routing: Dst Options: -%uNodeInfo Supported Qtypes, compressed bitmap, raw bitmap %s(TTL=%u)pr_nodeaddr(TTL=infty) no address truncated --- %s ping6 statistics --- round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms %.1lf%% packet loss+%ld duplicates, IPv6 addressDNS labelIPv4 addressSuccessRefusedNo Route to Destinationpr_icmphDestination Unreachable, Bad Code: %d Destination Administratively UnreachableDestination Unreachable Beyond ScopePacket too big mtu = %d Time exceeded, Bad Code: %d Parameter problem: Bad code(%d) pointer = 0x%02x Erroneous Header Unrecognized Option Unknown Nextheader Listener QueryListener ReportListener DoneRouter SolicitationRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sBad ICMP type: %dNode Information QueryNOOP, invalid, oldfqdn, subject=%s(%s), no subject, subject=%s(invalid)Supported qtypesDNS namenodeaddrIPv4 nodeaddrNode Information Reply, %sVr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->pr_iphHBH RTHDR FRAG ESPICMP6: type = %d, code = %d Unknown Header(%d) DSTOPT IP6ff02::2:0000:0000nigroupusage: ping6 [-dfHmNnqtvWw] [-a addrtype] [-b bufsiz] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [hops...] host usage: %s -l or %s [-q] name lqpc-xt/pc-atusbadblk201sunsun5hilgscdkfrukjpsvnohuberuuasgsflabrplsicflvnodeaddeclklk401swapctrlcapsdvorakmetaesciopenermachdepappletables available for %s keyboard: encoding /dev/wskbd%dWSKBDIO_GTYPEUnknown encoding or variant. kbd(8) needs to be rebuilt.kbd_listunknown encoding %sunknown variant %s%s: unsupported encoding %s on %s WSKBDIO_SETENCODING: %skbd: keyboard mapping set to %s kbd_set?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for dataLESSSECURELESS-E-G-L-mMOREWARNING: terminal is not fully functionalCannot allocate memoryticdcmsomdmbvbbc|^srget_termraw_modeLESS_TERMCAP_ltget_envLINESlicokrklkukdkPkNkh@7kDTERMhcxndadbpcNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketseek errorread errorch_ungetchar overrunseek error to 0ESC^%c*s<%X>Non-match First-file EOF-ignore Keep-pos Regex-off (P)+ [Press space to continue, 'q' to quit.]less %sungetcc overflowPattern not found help(N-th) No %snext fileNo %sprevious fileNo such filemark: goto mark: Command not availableBrackets: [Press 'h' for instructions.]Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableeditchar"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)LESSMETAESCAPE\LESSMETACHARS; *? '"()<>|&^`#\%c%s%c%s%s%sHOMEbin_file%s %s %sLESSOPENLESSCLOSE...skipping... Cannot find help fileCannot seek to end of fileCannot seek to beginning of fileCannot seek to line number %nDetermining length of fileDon't know length of fileCannot seek to that file positionLESSANSIENDCHARSplinenum~ Calculating line numbers (press RETURN)Invalid mark letterMark not setMark not in current fileLine number is required after -lless Copyright (C) 2002 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less Tab stops and then every %d spacesopt_x-" must be followed by 1 or 2 charsquotes %sUse "h" for helpThere is no %s option ("less --help" for help)There is no %s optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric option-%sValue is required after %sNumber is required after %sfakeSearch includes displayed screenSearch skips displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by clearing each lineRepaint by painting from top of screenAssume intelligent terminalAssume dumb terminalDon't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesAllow help commandDon't allow help commandCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: Position target at screen line %dDon't display a status columnDisplay a status columnDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numbersprompt: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directlyDisplay control characters directly, processing ANSI sequencesDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linesDisplay underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: Horizontal shift %d positionsUse keypad modeDon't use keypad modeBe less helpful in promptsBe helpful in promptspostoalinenumtoainttoaiprint_intiprint_linenumap_posap_linenumap_intNo previous regular expressionInvalid patternPlease re-enter search patternNothing to searchLine numbers turned offXjdjgpjtj|jjjjjjojdp @pp @$$q0qDqPqbgdumbtimernfsv3rdirplusmntudpresvportnfsv2ac23a:bcdD:g:I:iL:lo:PR:r:sTt:w:x:U-2 and -3 are mutually exclusiveillegal -I value -- %sillegal -R value -- %sillegal -a value -- %sconflicting version optionsillegal -r value -- %sillegal -t value -- %sillegal -w value -- %sillegal -x value -- %sNFS Portmapcan't access %s: %sbad MNT RPCCannot MNT PRCcan't resolve address for host %sno : or @ spechostname too longusage: %s [-23bcdilsTU] [-a maxreadahead] [-g maxgroups] [-I readdirsize] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-w writesize] [-x retrans] rhost:path node unused DOS FAT-12 XENIX / XENIX /usr DOS FAT-16 Extended DOSDOS > 32MB HPFS/QNX/AUXAIX fs AIX/Coherent OS/2 Bootmgr Win95 FAT-32 Win95 FAT32LDOS FAT-16 Extended LBAOPUS OS/2 hidden Compaq Diag.OS/2 hidden OS/2 hidden OS/2 hidden AST swap Willowtech Thinkpad Rec Willowsoft $NEC DOS 8Theos 9Plan 9 @VENIX 286 ALin/Minux DRBLinuxSwap DRCLinux DR MQNX 4.2 Pri NQNX 4.2 Sec OQNX 4.2 Ter PDM QDM RCP/M or SysVSDM TOntrack UEZ-Drive VGolden Bow \Priam aSpeedStor cISC, HURD, *dNetWare 2.xxeNetWare 3.xxfNetWare 386 gNovell hNovell iNovell pDiskSecure uPCIX Minix (old) Minix (new) Linux swap Linux files*OS/2 hidden Linux ext. NT FAT VS NTFS VS Amoeba FS Amoeba BBT Mylex BSDI NotebookSaveFreeBSD OpenBSD NEXTSTEP MacOS X NetBSD MacOS X bootBSDI filesy*BSDI swap Solaris CTOS DRDOSs FAT12DRDOSs < 32MDRDOSs >=32MHPFS DisbledCPM/C.DOS/C*Dell Maint SpeedStor SpeedStor SpeedStor BeOS/i386 EFI GPT EFI Sys SpeedStor DOS 3.3+ SecSpeedStor Xenix BBT Z[s۸~eWjlO6U$sΞJd$(RKv__7$s˪|I Xt>*/Pq'SToL:[*Ow{w"؋Z/b+".,Je*ͳe.7?goonw?ɯ' JƗμ̼x3/yj3O Yy+ Y=6hۘ_̼16ofޜ.6VP߄[a:8n p~]@ = DFϩ(VJăX4r!p*,\BH1ϲB%V2D!)u!,-WV5 Hx ;:Nb(tgh+R Eb9;_^FǧB<(twC̬%${QbXDyDDSH[pUk-i U֧;4^~I&#R="xdKO<<>+C"XsS-w̉,dq CnR(H K]o,J||avi/㯇n/lrRnc#D0*XL^ykȳ AR@zJD J>pn g C8}sF3xqk֑!˼a!ΖOfcļg"+VvK+N 7F|}7<Af?hOC̄.bUAD.a)#EЎSBT*/bv ./چꥂB?u2 ~0=+V?/ZM-N*/{UV.m.ܤ_.Dїk~ddW;N =1xo8|6/ ,jQR4&nr_>cG.9ߑu GK7.@La#_XVHD結F.#d4' e5Ae=-`4:nysnn!ƃWYb܆PvbA?26$Hbl(u+I*Siݤr[d[q_jDN센 'DKțQ8pSRDa@FS R eE9R_Xϼ_$dh6- -dڛK0$1K&vA!@ BKdT.1t&X(i%`RTUNX5&EnPS3AkAJ}G 㱰\n`\HaS!)R;KSlC)h(@Uw6>{K+Kf&2/'fzeAa΢v9Qj<XX2-8ϰdCq!t75ML+j̋*ۧvsk*D'!hV)ݵZwW E`qQ&TݤJAY{DPWծ ()Ůh6 ~27[WdOFVbx'8e MS,y+۰?@[6 G}A߳܊ݏ:#z^ fs-.0r25]|2T?o;N6+z;)?mzÐ|2;MAgAKD|:*z+y?}v>o>>4XыۅB]@P'~Gz?0Ī |,ߖV]~DgD7١7 @ǵl|ҟ}`: 3Zf|Q/C9qbE<7HR D?t("Eg+jG W(75gfWf.Y3_)g_?D7j fb6㯈:l%΀ޜy`Znհ&mk#ʙ-+=Oml}oG d¨ K g!{L,,P`%- Nnp"e :/0^զRekЧuY \Amk @bB EFB{EM$zGNPpo5Չ XDj]abUjQ&sȗTg-Tq.CUZ89]k74Os+S{Kbu?=fCz"^Yq]yw.n<w@6f4/U((fjqRYjհmuLGPƤ 9>WQq¼P}b{aRxdKn_ZSG)uWG~Qˍ^`]i5pЧMu~֮yP\S m1Eg6`YD|LgEc$JgJL: H\Ie vl%0l>l Xa7jKl}5J QVɽخN ۚ]vc_q˲؛[*eVtݾOLPMC4jmڡo^EUKI"fv$lII0zf1!U!;&7p~і5!FdGJ~txԲ޸zUrI{o$yh>$W:ek$$/zRi(wO9ȮySzjQvj7@mҊ"7I0zKK7.sϻ)a آD`9OuԼfTIM:ɑ\&Q5c#W(5:gVQwL|w#;&1DD֞?yŸ̴ m`;d U ()wVE'ׇ9BqyXVxXdSG>udk'C@p+Dϱ-RwׅvqcNBmo>`BV'{.| n6*8S-dol!ZGg E/NR(dB$)h껳WzaMvsO)FsRt8OXK.ڜL&}ソn?zK77 6\V0ՀM`q4v%\n e+zߑ,[smX1/ue xwp/C% a.AWrVyNND;A)0S]} jQO鏫 xA)bQAy/kΜLt Lrg"X O}_y!ɠ'? Rߕs-Lusage: %s [-ieu] [-c cylinders -h heads -s sectors] [-f mbrfile] device -i: initialize disk with virgin MBR -u: update MBR code, preserve partition table -e: edit MBRs on disk interactively -f: specify non-standard MBR template -chs: specify disk geometry `disk' may be of the forms: sd0 or /dev/rsd0c. ieuf:c:h:s:Cylinder argument %s [1..262144].Head argument %s [1..256].Sector argument %s [1..63].using builtin MBRCan't get disk geometry, please use [-chs] to specify.Please specify a full geometry with [-chs].error initializing MBRCommand help listShow entire OpenBSD man page for fdiskreinitRe-initialize loaded MBR (to defaults)setpidSet the identifier of a given table entryEdit current drive statsEdit given table entryflagFlag given table entry as bootableUpdate machine code in loaded MBRSelect extended partition table entry MBRSwap two partition entriesPrint loaded MBR partition tableWrite loaded MBR to diskexitExit edit of current MBR, without saving changesQuit edit of current MBR, saving current changesabortAbort program without saving current changes ----------------------------------------------------- ------ ATTENTION - UPDATING MASTER BOOT RECORD ------ ----------------------------------------------------- Do you wish to write new MBR? Do you wish to write new MBR and partition table?USER_initMBR is unchangedEnter 'help' for informationfdisk:%c%d> Writing current MBR to disk.error writing MBRUSER_modifyAborting changes to current MBR.Invalid command '%s'. Try 'help'. Offset: %d USER_print_diskBytesSectorsKilobytesMegabytesGigabytesask_cmd%s [%X - %X]: [%X] %s [%d - %d]: [%d] (? for help) ask_num'%d' is out of range. '%s' is not a valid number. %s [n] %s is not a character device or a regular fileDIOCGDINFODISK_getlabelmetricsBIOS fixup botch (secs (%d) > size (%d))Disk: %s geometry: %d/%d/%d [%.0f %s] geometry: Signature: 0x%X MBR_pcopyChoose from the following Partition id values:%02X %s %02X %s %02X %s %02X %s Warning CHS values out of bounds only saving LBA values Starting Ending LBA Info:%c%1d: %.2X %4u %3u %2u - %4u %3u %2u [%12u:%12.0f%s] %s #: id C H S - C H S [ start: size ]------------------------------------------------------------------------Start of partition #%d after end!In memory copy is initialized to:Use 'write' to update disk.XreinitChange disk geometry?BIOS CylindersBIOS HeadsBIOS SectorsInvalid argument: %s Invalid partition number %d. Swap with what partition?%d same partition as %d, doing nothing. Invalid argument: %s Invalid partition number.Partition id ('0' to disable) Partition %d is disabled. Do you wish to edit in CHS mode?BIOS Starting cylinderBIOS Starting headBIOS Starting sectorBIOS Ending cylinderBIOS Ending headBIOS Ending sectorLoop to offset 0! Not selected.Selected extended partition %d New MBR at offset %d. Partition %d is not an extended partition. Writing MBR at offset %d. Xwrite %s %s Machine code updated.Partition %d flag value set to 0x%x. Partition %d marked active. Invalid argument: %s [value] (standard input)(fd %d)invalid file type^\((%s[[:<:]]%s%.*s%s[[:>:]]%susage: %s [-abcEFGHhIiLlnoPqRSsUVvwx] [-A num] [-B num] [-C[num]] [-e pattern] [-f file] [--binary-files=value] [--context[=num]] [--line-buffered] [pattern] [file ...] 0123456789A:B:CEFGHILPSRUVabce:f:hilnoqrsuvwxybinary-filesmmapline-bufferedafter-contextbefore-contextextended-regexpfixed-stringsbasic-regexpbinaryversionbyte-offsetregexpno-filenameignore-casefiles-without-matchfiles-with-matchesline-numberquietsilentrecursiveno-messagesrevert-matchword-regexpline-regexpunix-byte-offsetscontext out of rangegrep version %u.%u without-matchUnknown binary-files optionBinary file %s matches [[:<:]][[:>:]]aFfh:t:v%s: not a directory or special deviceumountfsBad MNT RPC%s: unmount from %s %s: not currently mountedusage: %s %s umount [-fv] special | nodeumount -a [-fv] [-h host] [-t type]Xjdjgpjtj|jjjjjjjGsl9xu:g:m:o:not an MSDOS filesystemstat %sunknown group id: %sunknown user id: %sinvalid file mode: %susage: mount_msdos [-o options] [-u user] [-g group] [-m mask] bdev dir $OpenBSD: fsck.c,v 1.24 2006/03/20 19:50:09 dhill Exp $$OpenBSD: fsutil.c,v 1.15 2006/05/28 15:43:41 thib Exp $$OpenBSD: preen.c,v 1.16 2005/10/28 07:30:35 otto Exp $start %s %swait %scheckfs%s/fsck_%sexec %sCan't get resource limit for data sizeCan't get resource limit to max data sizedvpfnyb:l:T:t:-b %s%s: unknown special file or file system.fsck_%sInvalid option stringusage: %s [-dfnpvy] [-l maxparallel] [-T fstype:fsoptions] [-t fstype] [special | node ...] UNEXPECTED INCONSISTENCY:THE FOLLOWING FILE SYSTEM%s HAD AN %s %s: %s (%s)%sCan't open checklist file: %s/etc/fstabBAD DISK NAME %s pass %d, name %s Unknown pid %ld%s: %s (%s): EXITED WITH SIGNAL %d done %s: %s (%s) = %x disk %s: %s in fstab more than once!mkfifom:invalid file mode.non-numeric major number.non-numeric minor number.major or minor number too largenode must be type 'b' or 'c'.usage: %s [-m mode] fifoname ... usage: %s [-m mode] name [b | c] major minor usage: %s [-m mode] name p UGHRBD M@dmCXLS1@2 3cJ0123456789abcdefold usage of trailing 0assuming route to if entry in usenot in tablerouting table overflow: gateway %s (%s)netmask missingold usage of trailing digit, assuming route via gatewayblackholechangecloningdstencapgatewaygenmaskhopcountifaifpipxjumbolinkllinfolockrestmpathnetnojumbonostaticproto1proto2recvpiperejectrttrttvarsasendpipeshowssthreshstaticxresolvebotched keyword: %susage: %s [-dnqtv] command [[modifiers] args] commands: add, change, delete, flush, get, monitor, show dnqtT:v/dev/nullroute-sysctl-estimate%-20.20s donewrite to routing socketgot only %d for rlen Examining routing table from sysctl(address family %s) actual retrieval of routing tablemust be root to alter routing tableking bula sez: set_metric with invalid keyinet6_makenetandmask128%s: resolved to multiple values%s: bad address%s: not a network%d: bad address familyinternal errorprefixlen is not supported with af %dactual retrieval of interface tablegot message of size %d on %sread from routing socketwriting to routing socketso_labelso_ifaso_ifpso_genmaskso_maskso_gateso_dstRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics or flagsRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_RESOLVE: Route created by cloningRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_IFINFO: iface status changeRTM_IFANNOUNCE: iface arrival/departurerouting message version %d not understoodprint_rtmsg%s: len %d, table %u, if# %d, link: %s, flags:name: %s, pid: %ld, seq %d, errno %d, flags:metric %d, flags:if# %d, name %s, what: departurearrival route to: %s destination: %s mask: %s interface: %.*s if address: %s flags: label: %s use hopcount mtu expire%8lu %8lu%c %8ld%c sockaddrs: gateway: %s RTM_GET: %s (errno %d)message length mismatch, in packet %d, returned %d locks: inits: sockaddrs: %s: link %s; sodump%s: inet %s; %s: ipx %s; %s: inet6 %s; label too longinvalid table id: %ssysctl of routing tableRouting tables Encap:sysctl of spdspd-sysctl-estimateGatewayFlagsRefsUseMtuInterface%-*.*s %-*.*s %-6.6s %6.6s %8.8s %6.6s %s PortProtoSA(Address/Proto/Type/Direction)Source%-18s %-5s %-18s %-5s %-5s %-22s %-6.6s %6d %8ld %6ld %6s %.16sp_rtentryInternet Protocol Family %d: AppleTalkIPXInternet6Encap%-*s %-5u %-*.*s %-5u %-6u/esp/use/in/out///acquire/require/bypass/deny/dontacq/ah/ipip/ipcomp%-*.*s p_flagsroutename(%d) %s%u.%u.%u/%d%u.%u.%u.%u/%d%u.%u/%d%u/%d%s/%dnetname6illegal prefixlenaf %d: %s*.**.0x%XHany%XH.%s%s.%XH%02X%02X%02X%02X%02X%02XHlink#%d@(#) Copyright (c) 1985, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. KMGTPasciiimageebcdictenexusage: %s [ | Using %s mode to transfer files. %s: unknown mode. TYPE %s %sTYPE %sinternal error: unknown type %d.We only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. local-fileremote-fileusage: %s local-file [ remote-file ] APPESTORSTOUlocal-filesusage: %s local-files Continue withmput%s: not foundr+wusage: %s remote-file [ local-file ] local: %sRETRgetitremote-filesusage: %s remote-files can't get cwdSkipping non-relative filename `%s' mgetand logged inConnected %sto %s. Not connected. Connected for proxy commands to %s. No proxy connection. (none)Gate ftp: %s, server %s, port %s. Passive mode: %s. Mode: %s; Type: %s; Form: %s; Structure: %s. Verbose: %s; Bell: %s; Prompting: %s; Globbing: %s. Store unique: %s; Receive unique: %s. Preserve modification times: %s. Case: %s; CR stripping: %s. Ntrans: (in) %s (out) %s Ntrans: off. Nmap: (in) %s (out) %s Nmap: off. Hash mark printing: %s; Mark count: %d; Progress bar: %s. Use of PORT/LPRT cmds: %s. (disabled for this connection)Use of EPSV/EPRT cmds for IPv4: %s%s. Macros: usage: %s [ on | off ] %s %s. Bell modeEPSV/EPRT on IPv4Packet tracingusage: %s [ on | off | bytecount ] bytecount value is %s: %s Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeusage: %s [ on | off | gateserver [ port ] ] Disabling gate-ftp mode - no gate-ftp server defined. GlobbingPreserve modification timesusage: %s [ on | off | debuglevel ] debugging value is %s: %s Debugging %s (debug=%d). remote-directoryusage: %s remote-directory CWD %sCWD command not recognized, trying XCWD. XCWD %susage: %s local-directory Local directory now %s getcwd: %slcdDELE %susage: %s remote-file mdeletefrom-nameto-nameRNFR %susage: %s from-name to-name RNTO %susage: %s remote-directory local-file nlistLISTNLSToutput to local-file:usage: %s remote-files local-file Try again latershellusernameusage: %s username [password] [account] USER %sPassword: PASS %sAccount: ACCT %sLogin failed. PWDPWD command not recognized, trying XPWD. XPWDLocal directory %s getcwdlpwddirectory-nameMKD %susage: %s directory-name MKD command not recognized, trying XMKD. XMKD %sRMD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendusage: %s line-to-send arguments to SITE commandSITEquote1SITE CHMOD %s %susage: %s mode file-name SITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITusage: %s [password] Account:usage: %s command ?Ambiguous command. ?Invalid command. ?Invalid proxy command. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutusage: %s [mapin mapout] nmap: unbalanced brackets. Passive modeStore uniqueReceive uniqueCDUPCDUP command not recognized, trying XCUP. XCUPrestart: offset not specified. restart: invalid offset. Restarting at %lld. Execute get, put or append to initiate transfer SYSTLimit of 16 macros have already been defined. macro nameusage: %s macro_name Enter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4K buffer exceeded. usage: %s filename %s %lld %s %sSTAT %sSTATLocal file "%s" is newer than remote file "%s". |%sCan't allocate memory for $PAGERaccountbellbyecasecdupclosedisconnectepsv4formgateglobhashidlemacdefmdirmlsmodtimemsendnewernmapntranspassivepreserveprogresspromptpwdquoterecvregetresetrestartrhelprmdirrstatusruniquesendportsitestructsuniquetraceumaskverbose'%s' macro not found. domacroRetrieving %s/%s auto_fetchExtra `@' characters in usernames and passwords should be encoded as %%40Can't allocate memory to parse URLhttp://ftp://url_get: Invalid URL '%s'Invalid URL (no `/' after host): %sInvalid URL (no file after host): %sInvalid URL (no file after directory): %sCan't allocate memory for proxy URL.Malformed proxy URL: %sCan't open file %sReading from filehost %s, port %s, path %s, save as %s. (unknown)Trying %s... r+Requesting %s (via %s) User-Agent: OpenBSD ftpGET %s HTTP/1.0 %s GET /%s HTTP/1.0 Host: Can't allocate memory.[%s]:%s %s Writing HTTP requestreceived '%s' 301302Too many redirections requested200Error retrieving file: %sContent-Length: Location: Redirected to %s Can't open %sCan't allocate memory for transfer bufferReading from socketRead short file. Successfully retrieved file. Auto-login using ftp URLs isn't supported when using $ftp_proxyReceiving HTTP replyWriting %sImproper response from %surl_get http fetch aborted. file fetch aborted. ftp_proxyhttp_proxyCan't allocate memory for auto-fetch.Invalid URL: %suser %s:%s host %s port %s dir %s file %s Can't connect or login to host `%s'*?[]{}Can't allocate memory for URL decoding:/ftpgatehttp%s: bad port number `%s'connect to address %ssetsockopt TOS (ignored)fdopen failed.Connected to %s. hookup---> PASS PASS XXXXACCT ACCT XXXXNo control connection for command. %c%c%c421 Service not available, remote server has closed connection. getreply send aborted waiting for remote to finish abort. sentlocal: %s remote: %s %s: not a plain file. REST %lldnetoutsendrequest receive aborted waiting for remote to finish abort. receivednetin%s: short writeWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %suse of scoped address can be troublesomesetsockopt (ignored)EPSVwrong server: return code must be 229 disabling epsv4 for this connection PASVLPSVPassive mode refused. wrong server: return code must be 227 %u,%u,%u,%u,%u,%uwrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode AF mismatch. Shouldn't happen! %c%c%c%d%cparse error! setsockopt (reuse address)setsockopt IP_PORTRANGE (ignored)setsockopt IPV6_PORTRANGE (ignored)listenEPRT |%d|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dinitconnacceptdataconnproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s runique: can't find unique file name. Lost control connection for abort.%cABOR abort_remoteNeither $FTPSERVER nor $GATE_SERVER is defined; disabling gate-ftpdumbemacssu-r requires numeric argument46AadEegimno:pP:r:tvVRetrying... FTPSERVERPORTFTPMODEunknown FTPMODE: %s. Using defaultsgate-ftpFTPSERVERftp> sorry, input line too long. Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous help command %s ?Invalid help command %s %-*s %s usage: %s [-46AadEegimnptVv] [-P port] [-r seconds] [host [port]] %s [-o output] ftp://[user:password@]host[:port]/file[/] %s [-o output] http://host[:port]/file %s [-o output] host:[/path/]file[/] anonymous4K macro buffer exceeded. Unknown .netrc keyword %sError: .netrc file is readable by others.Remove account or make file unreadable by others.Missing macdef name argument. Macro definition missing null line terminator. Remove password or make file unreadable by others.ruserpasspasswordpasswdmachine%s/.netrc: %s%s/.netrcstringlist|%.*s%*s| %5lld %c%c %2d:%02d:%02d --:-- ETA - stalled -%02d:%02d ETAprogressmeterAlready connected to %s, use close first. usage: %s host-name [port] gateserver not defined (shouldn't happen)PASSERVE %sConnected via pass-through server %s non-printstreamRemote system type is %s. 215 UNIX Type: L8215 TOPS20Remember to set tenex mode when transferring binary files from this machine. %s@Name (%s): Name (%s:%s): Password:Login failed.$initftp_loginsorry, arguments too long. (%s) unable to create temporary file: %sftpXXXXXXXXXXunable to create temporary file %scan't find list of remote files, oops.can't find list of remote files, oops. remglob%s %s? n, y, p, a, are the only acceptable commands! Interactive mode: off. Prompting off for duration of %s. confirmSIZE %sMDTM %s191Y2K warning! Fixed incorrect time-val received from server. %*s %04d%02d%02d%02d%02d%02dCan't convert %s to a time. Unable to determine real path of `%s'fileindir %3d%% *************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************%lld byte%s %s in %.2f seconds (%.2f %sB/s) ETA: %02d:%02d:%02d ptransfer/etc/rcWARNING: some process(es) wouldn't die(can't restart init): SIGTERM processes/dev/consolesetsidrevokeSIGTSTP inithalted (with powerdown) by %shalted by %srebooted by %sdlnpq~usage: %s [-dn%sq] Xjdjgpjtj|jjjjjjn@djonreloadfilesystem must be mounted read-only; you may need to run fsckusage: mount_ffs [-o options] special node ["Xhpx%% LcW &Iؔ#TeԽ$   !$, d4,<_ (44w@4L4X,d4p4ttww,t@,Ttlt|t,tt(t@4LXdxT4, 4H,`|4w4xTxT xT4(84L4\t4xTxT xT,xT8xTDxTPxT\hxTxxTxTxTxTxTxTxTxTxTxTxTxTxTxT xT,xT8xTDxTPxT\xThxTtxTxTxTxTxTxTxTxTxTxTxTxTxTxTxT(xT4xT@xTLxTXxTdxTpxT|xTxTxTxTxTxTxTxTxTxTxTxT xTxT$xT0xT<xTHxTTxT`xTlxTxxTxTxTxTxTxTxTxTxTxTxTxTxTxT xT,xT8xTDxTPxT\xThxTtxTxTxTxTxTxTxTxTxTxTxTxTxTxTxT(xT4xT@xTLxTXxTdxTpxT|xTxTxTxTxTxTxTxTxTxTxTxT xTxT$xT0xT<xTHxTTxT`xTlxTxxTxTxTxTxTxTxTxTxTxTxTxTxTxT xT,xT8xTDxTPxT\xThxTtxTxTxTxTxTxTxTxTxTxTxTxTxTxTxT(xT4xT@xTLxTXfmediumreason/etc/dhclient.confFAILalias_routehandlerc:dl:quifi callocifi->client callocifi->client->config callocInterface name too long%s.%s/var/db/dhclient.leasesasprintf%s: no link ... giving up got link cannot open %s: %m_dhcpno such user: _dhcp, falling back to "nobody"no such user: nobodycan't open and lock %s: %mPREINITAF_ROUTE/var/empty/chrootchdir("/")setresgidsetgroupsusage: %s [-dqu] [-c conffile] [-l leasefile] interface ARPCHECKcheck_DHCPACK from %spacket_to_lease failed.BOUNDRENEWREBINDREBOOTold_new_bound to %s -- renewal in %d seconds.BOOTREPLY from %s rejected.DHCPOFFERDHCPNACKDHCPACK%s from %s rejected.BOOTREPLY%s from %s%s isn't satisfactory.%s already seen.ARPSENDdhcpoffer: no memory to record lease.dhcpoffer: no memory for server name.Bogus server name %sdhcpoffer: no memory for filename.dhcpoffer: no memory for option %dInvalid lease option - ignoring offerDHCPNAK from %sDHCPNAK with no active lease. Trying medium "%s" %dMEDIUMDHCPDISCOVER on %s to %s port %d interval %dNo DHCPOFFERS received.Trying recorded lease %sTIMEOUTbound: renewal in %d seconds.bound: immediate renewal.No working leases in persistent database - sleeping. EXPIREDHCPREQUEST on %s to %s port %dsend_requestDHCPDECLINE on %s to %s port %doptions do not fit in DHCPDISCOVER packet.options do not fit in DHCPREQUEST packet.options do not fit in DHCPDECLINE packet.can't create %s: %mlease { bootp; interface "%s"; fixed-address %s; filename "%s"; server-name "%s"; medium "%s"; option %s %s; renew %d %d/%d/%d %02d:%02d:%02d; rebind %d %d/%d/%d %02d:%02d:%02d; expire %d %d/%d/%d %02d:%02d:%02d; } script_init: no memory for environmentPATH=/usr/bin:/usr/sbin:/bin:/sbinip_addressnetwork_numberbroadcast_addressserver_nameprepend optionappend optionno space to %s %sexpirypriv_script_write_paramsunexpected msg type %ureceived corrupted messagefork: %mwait: %mexecve (%s, ...): %mscript_set_env: no memory for variablescript_set_env: no memory for variable assignmentillegal character (%c) in value '%s'%s%s=%sdaemonInvalid IP address in option: %sBogus Host Name option %d: %s (%s)unknown dhcp option value 0x%xwarning: hostname %s contains an underscore which violates RFC 952option_as_string: bad code %ddhcp option too largecannot fork%s [priv]poll errorCorrupt lease file - possible data loss!expecting a statement.semicolon expected.expecting string or hexadecimal datastring constant too long.expecting hexadecimal constant.hexadecimal constant too long.expected option name.expecting semicolon.%s: unexpected option name.%s: too many options.expecting interface name (in quotes).expecting left brace.unterminated interface declaration.no memory for lease.unterminated lease declaration.wrong interface name. Expecting '%s'.expecting lease declaration.expecting identifier after option keyword.no option named %sexpecting number.expecting identifier.truefalseexpecting boolean.Bad format %c in parse_option_param.expecting string.option data buffer %soption data buffer overflowout of memory allocating option data.parse_option_declExpecting media options.no memory for string list entry.no memory for reject list!parse_reject_statementexpecting IP address.getifaddrs failedno space to remember ifpCan't allocate poll structures.No live interfaces to poll on - exiting.poll: %mreceive_packet failed on %s: %sInterface %s no longer appears valid.got_oneCan't create socketinterface_link_forceupinterface_link_forcedownioctl(SIOCGIFFLAGS) on %s: %mioctl(SIOCGIFMEDIA) on %s: %mCan't allocate timeout structure!can't allocate protocol struct for %sinterface_link_status/dev/bpf%dCan't find free bpf: %mCan't attach interface %s to bpf device %s: %mif_register_bpfCan't get BPF version: %mKernel BPF version out of range - recompile dhcpd!Can't set immediate mode on bpf device: %mCan't set filter-drop mode on bpf device: %mCan't get bpf buffer length: %mCan't allocate %lu bytes for bpf input buffer.Can't install packet filter program: %mCan't install write filter program: %mCannot lock bpfsend_packet: %msend_packetcSclarger than bufferoption %s (%d) %s.Many bogus options seen in offers. Taking this offer in spite of bogus options - hope for the best!rejecting bogus offer.Can't allocate storage for option %s.Can't expand storage for option %s.pretty_print_option: bad code %d%s: Excess information in format string: %s%s: garbage in format string: %s%s: expecting at least %d bytes; got %d%s: %d extra bytes%s: %d extra bytes at end of arrayUnexpected format code %cpretty_print_optionDiscarding packet with invalid hlen.do_packeteof in string constantstring constant larger than internal buffernumeric token larger than internal bufferbackoff-cutoffbootpdenyethernetfddifixed-addresshardwareinitial-intervallink-timeoutprependrebindrenewrequireretryscriptselect-timeoutserver-namesupersedetimeouttoken-ringexiting. %s line %d: %s%s^subnet_numberbroadcast_addraddr_eqpiaddr%d bad IP checksums seen in %d packetsip length %d disagrees with bytes received %d.%d udp packets in %d too long - droppedaccepting packet with data after udp payload.%d bad udp checksums in %d packetssubnet-masktime-offsetIAtime-serversien116-name-serversdomain-name-serverslog-serverscookie-serverslpr-serversimpress-serversresource-location-servershost-nameboot-sizemerit-dumpdomain-nameswap-serverroot-pathextensions-pathip-forwardingnon-local-source-routingpolicy-filterIIAmax-dgram-reassemblydefault-ip-ttlpath-mtu-aging-timeoutpath-mtu-plateau-tableSAinterface-mtuall-subnets-localbroadcast-addressperform-mask-discoverymask-supplierrouter-discoveryrouter-solicitation-addressstatic-routestrailer-encapsulationarp-cache-timeoutieee802-3-encapsulationdefault-tcp-ttltcp-keepalive-intervaltcp-keepalive-garbagenis-domainnis-serversntp-serversvendor-encapsulated-optionsnetbios-name-serversnetbios-dd-servernetbios-node-typenetbios-scopefont-serversx-display-managerdhcp-requested-addressdhcp-lease-timedhcp-option-overloaddhcp-message-typedhcp-server-identifierdhcp-parameter-request-listBAdhcp-messagedhcp-max-message-sizedhcp-renewal-timedhcp-rebinding-timedhcp-class-identifierdhcp-client-identifieroption-62option-63nisplus-domainnisplus-serverstftp-server-namebootfile-namemobile-ip-home-agentsmtp-serverpop-servernntp-serverwww-serverfinger-serverirc-serverstreettalk-serverstreettalk-directory-assistance-serveruser-classoption-78option-79option-80option-81option-82option-83option-84nds-serversnds-tree-namends-contextoption-88option-89option-90option-91option-92option-93option-94option-95option-96option-97option-98option-99option-100option-101option-102option-103option-104option-105option-106option-107option-108option-109option-110option-111option-112option-113option-114option-115option-116option-117option-118option-119option-120option-121option-122option-123option-124option-125option-126option-127option-128option-129option-130option-131option-132option-133option-134option-135option-136option-137option-138option-139option-140option-141option-142option-143option-144option-145option-146option-147option-148option-149option-150option-151option-152option-153option-154option-155option-156option-157option-158option-159option-160option-161option-162option-163option-164option-165option-166option-167option-168option-169option-170option-171option-172option-173option-174option-175option-176option-177option-178option-179option-180option-181option-182option-183option-184option-185option-186option-187option-188option-189option-190option-191option-192option-193option-194option-195option-196option-197option-198option-199option-200option-201option-202option-203option-204option-205option-206option-207option-208option-209option-210option-211option-212option-213option-214option-215option-216option-217option-218option-219option-220option-221option-222option-223option-224option-225option-226option-227option-228option-229option-230option-231option-232option-233option-234option-235option-236option-237option-238option-239option-240option-241option-242option-243option-244option-245option-246option-247option-248option-249option-250option-251option-252option-253option-254option-endpadvalue %s%o exceeds max (%d) for precision.value %s%x exceeds max (%d) for precision.value %s%u exceeds max (%d) for precision.Unexpected integer size: %dfilename must be a stringno memory for string %s.expecting a network hardware typeExpecting numeric lease timeno space for numeric aggregatenumeric aggregate too short.Bogus number: %s: digit %d not in base %dBogus number: %s.numeric day of week expected.numeric year expected.expected slash separating year from month.numeric month expected.expected slash separating month from day.numeric day of month expected.numeric hour expected.expected colon separating hour from minute.numeric minute expected.buf_open: %mbuf_add: %mbuf_close (connection closed)buf_close (short write): %mbuf_close: %mbuf_read (connection closed)buf_read (short read): %mbuf_read: %mcorrupted message receivedreceived unknown message, code %ddispatch_imsgcannot read temp filecannot seek temp fileline too longcannot write temp fileinvalid address/tmp/ed.XXXXXXXXXXw+cannot open temp filecannot close temp fileEnter key: get_keywordbad hex digit in keybad binary digit in keydes_setkeydes_ciphercbc_decodedecryption failed (block corrupted)decryption failed (incomplete block)cannot read fileinvalid pattern delimiter& no previous commandunexpected end-of-filecannot close input filecannot open input file%lu newline inserted newline appended cannot read input filecannot close output filecannot open output filecannot write filecannot read stdin \abfnrtv\\ warning: file modifiedinvalid filename@(#) Copyright (c) 1993 Andrew Moore, Talke Studio. All rights reserved. usage: %s [-] [-sx] [-p string] [name] p:sx ? interrupt? script, line %d: %s number out of rangeinvalid redirectioninvalid destinationno previous substitutiondestination expectedcannot nest global commandsno current filenameunexpected command suffixinvalid command suffixunexpected addressno matchfilename too longshell access restrictedinvalid mark charactered.hup/ed.hupno previous patterntrailing backslash (\)unbalanced brackets ([])infinite substitution loopnothing to undoHLPRfiprthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s%s: name too long (not copied)cannot overwrite directory %s with non-directory %s%s is a directory (not copied).%s and %s are identical (not copied).overwrite %s? readlink: %sunlink: %scopy_linksymlink: %smkfifo: %smknod: %schown: %schflags: %sutimes: %slchown: %susage: %s [-fip] [-R [-H | -L | -P]] source_file target_file %s [-fip] [-R [-H | -L | -P]] source_file ... target_directory 444W^X`Y `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @      inflate 1.2.3 Copyright 1995-2005 Mark Adler  #+3;CScs !1Aa  0@`@@88448@8P8\8p884%s not a regular file%s%s already has %s suffix -- unchanged%s: unknown suffix: ignored%s%s: name too long%s: input: %sdeflate.gzzcatzipunknown program nameGZIPGZIP is too longoption -a is ignored on this systemillegal bit count -- %s-o argument is too long123456789ab:cdfghlLnNOo:qrS:tvV-o option may only be used with a single input filemay not mix -o, -c, or -t options%s is a directory: ignored: unchangedcompression not supported%s: won't read compressed data from terminal%s: unrecognized file formatcrc errordodecompressfchown: %sfchmod: %sfchflags: %sfutimes: %sZgzztgztaz.-_method crc date time compressed uncompressed ratio uncompressed_name%-7.7s %08x %s %10lld %10lld %4.1f%% %s %10lld %10lld %4.1f%% (totals) OK %4.1f%% -- replaced with %s %lld bytes in, %lld bytes out usage: %s [-123456789cdfghLlNnOqrtVv] [-b bits] [-o filename] [-S suffix] [file ...] 1.2.3put_headerfile errorstream errordata errorinsufficient memorybuffer errorincompatible versionneed dictionarystream end@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: chmod.c,v 1.23 2006/04/25 15:41:07 deraadt Exp $HLPRXfghorstuwxinvalid flags: %sinvalid flag: %sthe -R and -h options may not be specified together.user is %s: %sgroup is %s: %susage: %s [-R [-H | -L | -P]] %s file ... [owner][:group]usage: %s [-fh] [-R [-H | -L | -P]] %s file ... $OpenBSD: dir.c,v 1.17 2004/07/05 02:31:54 pvalchev Exp $$OpenBSD: inode.c,v 1.26 2003/10/11 01:43:45 tedu Exp $@(#) Copyright (c) 1980, 1986, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: main.c,v 1.27 2006/04/17 09:34:16 moritz Exp $$OpenBSD: pass1.c,v 1.20 2006/03/22 20:24:32 deraadt Exp $$OpenBSD: pass1b.c,v 1.13 2006/03/22 20:24:32 deraadt Exp $$OpenBSD: pass2.c,v 1.25 2006/03/22 20:24:32 deraadt Exp $$OpenBSD: pass3.c,v 1.12 2006/03/22 20:24:32 deraadt Exp $$OpenBSD: pass4.c,v 1.15 2006/03/22 20:24:32 deraadt Exp $$OpenBSD: pass5.c,v 1.24 2006/04/27 02:40:03 pedro Exp $$OpenBSD: fsutil.c,v 1.15 2006/05/28 15:43:41 thib Exp $$OpenBSD: setup.c,v 1.24 2006/04/17 19:18:08 deraadt Exp $$OpenBSD: utilities.c,v 1.30 2006/04/17 19:33:54 deraadt Exp $?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@dirscanexpanddir blk + cnt %d > sblock.fs_fpg %d cannot allocate memory for inode cache cannot increase directory listCG %d: BAD MAGIC NUMBER dfpnNyYb:c:m:conversion levelusage: %s [-fnpy] [-b block#] [-c level] [-m mode] filesystem ... %d files, %d used, %d free (%d frags, %d blocks, %d.%d%% fragmentation) phase 1, inode %d/%dcheckinodeconvert symlink %d(%s) of size %llu cannot read symlink phase 1b, inode %d/%dphase 2, directory %d/%dphase 2, parent directory %d/%d%s %s: LENGTH %ld NOT MULTIPLE of %d%s %s: LENGTH %ld NOT MULTIPLE OF %d (REMOVED)phase 3, directory %d/%ldphase 4, inode %d/%dphase 5, cg %d/%dCREATCANNOT %s CLUSTER MAPS SUMMARY INFORMATION BADBLK(S) MISSING IN BIT MAPSALLOCATED FRAG %ld MARKED FREE ALLOCATED INODE %ld MARKED FREE FREE BLK COUNT(S) WRONG IN SUPERBLKCREATE CLUSTER MAPS%sING CLUSTER MAPS DELETING CLUSTERING MAPS DELETE CLUSTERING MAPSUNKNOWN ROTATIONAL TABLE FORMAT %d INFORMATION; SEE fsck_ffs(8).IMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED)IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=%x IN SUPERBLOCKINCORRECT FMASK=%x IN SUPERBLOCKINCORRECT MAXFILESIZE=%llu IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%lx IN SUPERBLOCKINCORRECT QFMASK=%lx IN SUPERBLOCKcannot alloc %u bytes for cylinder group summary area cannot alloc %lu bytes for lncntp cannot alloc %lu bytes for inphead CONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATIMPOSSIBLE MINFREE=%d IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKclean = %d CPG OUT OF RANGENCYL LESS THAN NCG*CPGSIZE PREPOSTEROUSLY LARGEoffset %d, original %ld, alternate %ld NCG OUT OF RANGE%s: NOT LABELED AS A BSD FILE SYSTEM (%s) UPDATE STANDARD SUPERBLOCKcatchinfo   init: %s init: already running initial setsid() failed: %mrootsetlogin() failed: %munrecognized flag '-%c'ignoring excess argumentsfatal signal: %scannot get kernel security level: %scannot change kernel security level from %d to %d: %scan't open %s: %mcan't get %s for controlling terminal: %m/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bincan't exec %s for single user: %mcan't fork single-user shell, trying againwait for single-user shell failed: %m; restartinginit: shell stopped, restarting single user shell terminated, restartingsingle user shell terminated.single_userautobootcan't exec %s for %s: %mcan't fork for %s on %s: %mwait for %s on %s failed: %m; going to single user modeinit: %s on %s stopped, restarting %s on %s terminated abnormally, going to single user modesession database close: %ssession database open: %sinsert %d: %sdelete %d: %scan't parse getty for port %scan't allocate windowcan't parse window for port %scan't fork for window system on port %s: %msetsid failed (window) %mcan't exec window system '%s' for port %s: %mcan't fork for getty on port %s: %mgetty repeating too quickly on port %s, sleepingcan't exec getty '%s' for port %s: %mport %s changed utmp index from %d to %dcan't exec %s for %s %s: %msome processes would not die; ps axl advisedNOS:T:a:b:c:d:e:f:g:h:i:k:l:m:o:p:qr:s:t:u:x:z:P:T:a:b:c:d:e:f:i:m:o:s:%s: can't figure out file system partitiondisagrees with disk label%s (%d) %s (%lu) Warning: calculated sectors per cylindermfs:%dNumber of cylinders restricts cylinders per group to %d. Warning: changing optimization to space because minfree is less than %d%% %s: no default sector size%s: no default #sectors/track%s: no default #tracks%s: maximum file system size on the `%c' partition is %d%s: `%c' partition overlaps boot program%s: `%c' partition is unavailable%s: %s: not a character-special device %s: getmntinfo: %s%sr%snewfs_%s%s/newfs_%s%s not found%s: bad sector size%s: bad maximum contiguous blocks %s: bad block size%s: bad cylinders/group%s: bad rotational delay %s: bad blocks per file in a cylinder group %s: bad fragment size%s: bad average file size%s: bad average files per dir%s: bad bytes per inode %s: bad track skew%s: bad interleave%s: bad free space %% %s: unknown optimization preference: use `space' or `time'.%s: bad spare sectors per track%s: bad revolutions/minute %s: bad file system size%s: bad sectors/track%s: bad spare sectors per cylinder%s: bad total tracksinsane maxpartitions value %d%s: mount: %sabnormal terminationioctl (WDINFO)%s: can't rewrite disk label-N do not create file system, just print out parameters-O create a 4.3BSD format filesystem-P src populate mfs filesystem-S sector size-T disktype-a maximum contiguous blocks-b block size-c cylinders/group-d rotational delay between contiguous blocks-e maximum blocks per file in a cylinder group-f frag size-g average file size-h average files per directory-i number of bytes per inode-k sector 0 skew, per track-l hardware sector interleave-m minimum free space %%-n number of distinguished rotational positions-o optimization preference (`space' or `time')-p spare sectors per track-r revolutions/minute-s file system size (sectors)-t file system type-u sectors/track-x spare sectors per cylinder-z tracks/cylinderusage: %s [ -fsoptions ] special-device mount-point usage: %s [ -fsoptions ] special-device where fsoptions are: %s: exitedchdircannot stat %s%s: not a dir or a block device-rw-pe/bin/pax%s: mount (update, rdonly)unmount %scopy %s to %s failedrmdir %smount %s %s/mnttmp mountpoint %s busygettmpmnttmp mountpoint %s too longmntXXXXXXXXXXmkdtemp %stmp mount point too long%s: initializing cg %ld/%d siginfopreposterous size %u, max is %upreposterous ntrak %dpreposterous nsect %dillegal expected average file size %dillegal expected number of files per directory %dblock size must be a power of 2, not %dfragment size must be a power of 2, not %dfragment size %d is too small, minimum is %dblock size %d is too small, minimum is %dblock size %d is too large, maximum is %dno block size to support this diskminimum bytes per inode isWith a block size of %d %s %ld With %d sectors per cylinder, minimum cylinders per group is %ld CylinderWarning: cylinder%s groups must have a multiple of %ld cylinders panic (fs_cpg * fs_spc) %% NSPF != 0cylinder groups must have at least %ld cylinders!mapcramped && !inodecrampedBlock size and bytes per inode restrictBlock size restrictsBytes per inode restrict cylinders per group to %d. file systems must have at least one cylinder (not %d)and ntrak File system performance may be impaired. rotational layout tables with nsectWarning: insufficient space in super block for %s %s %d %s %d.%sWarning: inode blocks/cyl group (%ld) >= data blocks (%ld) in last cylinder group. This implies %ld sector(s) cannot be allocated. mkfsfsinit failedsuper-block backups (for fsck -b #) at:%s: %d sectors in %d %s of %d tracks, %d sectors %.1fMB in %d cyl groups (%d c/g, %.2fMB/g, %d i/g) cg summaryWarning: %d sector(s) in last cylinder unallocated filesystem must have at least %d sectorsinode blocks/cyl group (%ld) >= data blocks (%d) number of cylinders per cylinder group (%d) %s. must be increased%s to be changed from %d to %d This requires the block size %s to be changed from %d to %d and the fragment sizeWith %d bytes per inode, Minimum bytes per inode is %ld block size (%d) cannot be smaller than fragment size (%d)fragment size %d is too small, minimum with block size %d is %dpanic: cylinder group too bigcg 0: bad magic numberinternal error: can't find block in cyl 0first cylinder group ran out of spacecg 0: bad magic number (0x%06x != 0x%06x)fsinit: inode value %d out of rangerdfs: read error on block %dwtfs: write error on block %disblock bad fs_frag %d clrblock bad fs_frag %d setblock bad fs_frag %d dfiPRr%s: is a directoryrm_overwrite%s (inode %u): not overwritten due to multiple links%s: malloccheckoverride %s%s%s/%s for %s? remove %s? "." and ".." may not be removedusage: %s [-dfiPRr] file ... bsfbsrdensityeomfsffsrofflinerewindrewofflretensionweof%s: illegal count%s: unknown commandf:ioctl MTIOCGETWriteProtectMounted76543210%s tape drive, residual=%d erblocksize: %d (%d) density: %d (%d) %d: unknown tape drive type usage: %s [-t] device usage: %s [-f device] command [count] Lost connection to remote host.shell/tcp: unknown service/etc/rmtwho are you?invalid user name: %sO%s %d rmtopenC S I%d %d ioctlrmtioctlProtocol to remote tape server botched (code "%s").rmtreplyProtocol to remote tape server botched.(rmtgets got "%s").m:pusage: %s [-p] [-m mode] dirname ... $OpenBSD: compile.c,v 1.21 2005/04/11 07:11:44 deraadt Exp $0123456789/\$invalid command code %cextra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandunexpected }branchempty labelread commandw commandfilename expectedunterminated substitute patternsubstitute pattern can not be delimited by newline or backslashextra text at the end of a transform commandcommand %c expects up to %d address(es), found %dcommand expectedunexpected EOF (pending }'s)\ can not be used as a string delimiternewline can not be used as a string delimitercompile_reRE error: %sunterminated substitute in regular expression123456789\%c not defined in the REunescaped newline inside substitute patternnumber in substitute flags out of rangemore than one number or 'g' in substitute flagsbad flag in substitute command: '%c'compile_flagsno wfile specifiedunterminated transform source stringcompile_trtransform strings are not the same lengthunterminated transform target stringtransform pattern can not be delimited by newline or backslashcompile_textexpected context addressunterminated regular expressionwhitespace after %sundefined label '%s'duplicate label '%s'unused label '%s'$OpenBSD: main.c,v 1.9 2003/06/10 22:20:50 deraadt Exp $ae:f:nusage: sed script [-an] [file ...] sed [-an] [-e script] ... [-f script_file] ... [file ...] stdout: %s ..."$OpenBSD: misc.c,v 1.6 2004/07/20 03:50:26 deraadt Exp $sed: %lu: %s: $OpenBSD: process.c,v 1.12 2003/11/07 02:58:23 tedu Exp $\%d not defined in the REflush_appends\ \abfnrtv%03ofirst RE may not be empty`{h{P}| X} \} ,4 h}  t} x}( }" }`$ }! 4  }  }  } } }" }" |+ 8g1 d, G ; G ; 8 E : d, : 0= |, @ p9 2 3 G d, $@W ,L- 44> LeDF -a-b-c-d -e-f-G-g-h -H -k-L -n-O-o-p -r-s-S -t-u-w-x-z===!=<>-eq-ne-gt-ge-lt -le!-ef"-nt#-ot$ r0ptf c4dDsTlhmxnp T L d xȚ (y { y Ă{ ؂   T  h  T6< Lw 0v @ LȘ X d( tȍ    Ԁ ĉ { ȃ ؃4 {     0ԃ 8 D T` p,     Ą 8 Ԅ4 lH h    ( 4Р <hb fd'(! ! %"#)< >g  0y7#-1 1= ?2*?* /&.&_606162636465666768695U5u4L4l3C3c[O%A"BCDD++--==!== *= /= %= += -= <<= >>= &= ^= |= <<>><=>=<>&& || */%+-&^|? , ~!():P`lxIFS= ${PS2=> } ${PS3=#? } ${PS4=+ }0@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mknod.c,v 1.1 2005/10/06 06:39:36 otto Exp $ac$eē̓ؓi"klXWmCnnf bu(0prh$s<hv(HP\l|xletf4<DL P  S X `hؾ|l{p}0tx| ||&&!()P\ 4HP  `  l |t@(#)PD KSH v5.2.14 99/07/13.2 AAA  Q AA A QBunable to allocate memoryLPrestricted shell - can't cdOLDPWDdon't know current directoryCDPATH%s: bad directorytoo many argumentsno OLDPWDno home directory (HOME not set)can't get current directory - %sRnprsu,-p: %s-u: %s: %spvVpv is a reserved word special is a%s shell builtin is a function undefined (autoload from %s) tracedn exported%s is *GOK*exported is an %salias for alias %s= is a tracked %salias for not foundL#R#UZ#fi#lprtuxfunction %s %T %s() %T %s: not identifierexportreadonly%s[%d]typeset -U -u -l -Z -R%d -L%d -t -r -x -i only -t, -u and -x options may be used with -funalias-tadprtUxalias: -r flag can only be used with -t and without arguments alias %s alias not found adtno argumentslpnzjob control not enabled%%%*d %*s %s%*d %*d %sls:bad signal `%s'Usage: kill [ -s signame | -signum | -signame ] {pid|job}... kill -l [exit_status] %s: arguments must be jobs or process IDsmissing name argument%s: is not an identifierarguments changed since last callOPTARGc_getopts: no argvmissing options argumentlm+alias+cd+command*=export+fc+getopts+jobs+killlet*=readonly=typeset+unaliaswhence+bg+fg%s%*ldm%ld.%02lds%snothing to shift%s: bad numberc_umask=+-rwxugoXsbad maskaugo%#3.3o ugorwxprsu,%s is read onlytrap -- bad signal %s%s: can only %s %d level(s)%s: cannot %sfv%s%*ld.%02ld%sreal user sys system user real :ptime: -%s requires an argumenttime: -%s unknown optioninvalid file modeusage: mknod [-m mode] name [b | c] major minorusage: mknod [-m mode] name p*=.*=:[*=break=builtin*=continue*=eval*=exec*=exit+false*=return*=set*=shift=times*=trap+=wait+readtest+trueulimit+umask*=unset-tmissing ]internal error: unknown opunexpected operator/operandmissing closing parenmissing argumentmissing expression operatormissing second argumentexpression expected-atime(cpu-seconds)file(blocks)coredump(blocks)data(kbytes)stack(kbytes)lockedmem(kbytes)memory(kbytes)nofiles(descriptors)ulimit: %cunlimited%-20s unlimited bad limit: %sexceeds allowable limitinvalid limit: %sx_modefileglob: substitute errorFPATH;|&()`*+?@!IFS\$(){}*&;#|<>"'`beginning-of-historycomplete-commandcomplete-filecompletedelete-char-backwarddelete-word-backwarddelete-char-forwarddelete-word-forwardkill-lineredrawend-of-historyeot-or-deletegoto-historymacro-stringauto-insertkill-to-eolkill-regionlist-commandlist-fileprefix-1prefix-2yank-popbackward-charbeginning-of-linebackward-wordend-of-lineforward-charforward-wordnewlinedown-historynewline-and-nextno-opup-historyprev-hist-wordsearch-character-forwardsearch-character-backwardsearch-historyset-mark-commandstuffstuff-resettranspose-charsexchange-point-and-markcomplete-listexpand-filecapitalize-worddowncase-wordupcase-wordset-argcommentx_search_hist I-search: nothing to yank yank something first%s = '%s' %s: no such functioncannot bind, not a ttyPOSIXparameter null or not setexpand(NULL)%S%s: bad substitutionsubstitute%s: parameter not set%s: cannot open $() input%Rfunny $() command: %s*+?@! coprocess already existsPS4%s: can't find function definition file%s: can't find function definition file - %s%s: function not defined by %sCFUNC %d%s: can't open function definition file %s - %s%s: cannot execute - %s%s: restrictedcommand -p: restrictedbuiltin: %s: not a builtinEXECSHELL%s: %s: %sshcomexec: %scould not finish (dup) redirection %s: %sdupcannot %s %s: %s%s%s herein: yylexerror writing %s: %scan't %s temporary file %s: %shere document missing-rPS3%*d) %sdbteste_isadbteste_error: %s (offset %d)%s: unexpected `%s'end of expression%s: bad number `%s'%s: expression recurses on parameter `%s'%s: %s requires lvalue%s: %s applied to read only variablemissing )missing :zero divisorhistory functions not availablee:glnrs0,1,2,3,4,5,6,7,8,9,-%c%scan't use -e, -l, -n, -r with -s (-e -)can't use -l, -n with -e%.*s ${FCEDIT:-/bin/ed} $_error reading temp file %s - %scannot open temp file %serror writing temporary file - %scannot create temp file %s - %s-16substitution failed%s: not in history%s: invalid rangeno history (yet)HISTFILE%s.%dhist_shrinkinternal error: %s[%d]: shl_stdout not validtoo many files open in shellcan't create pipe - try againillegal file descriptor namefd not open for readingfd not open for writingbad file descriptorno coprocess/tmp%s/shXXXXXXXXstoppedrunning and You have %s%s%s jobs no such jobambiguousargument must be %job or process idwarning: won't have full job controlj_init: tcsetpgrp() failed: %sj_init: setpgid() failed: %sj_init: tcgetpgrp() failed: %sj_init: getpgrp() failed: %s[%d]jw:last procchildexchild: execute() returnedexchild: XPIPEI and no last_job - pid %dcannot fork - try againwaitlast: no last jobjw:waitlastwaitlast: not startedjw:waitfor| jw:resumecannot continue job %s: %sfg: 2nd tcsetpgrp(%d, %d) failed: %s1st tcsetpgrp(%d, %d) failed: %s[%d] job not job-controlledjobsnotifyzombiej_async: bad nzombie (%d)j_async: job not startedj_waitj: tcsetpgrp(%d, %d) failed: %scheckjobcheck_job: job started (flags 0x%x) Running (core dumped)%-20s %s%s%sj_print%s%5d %-20s %s%s %s%s%s%s %5d [%d] %c DoneDone (%d)remove_job: job not found (%s)no closing quote here document `%s' unclosed \$PS1PS2dopprompt\%c%r%l:%M:%S%a %b %d~/%smissing ] MAILyou have mail in $_typesetKSH_VERSION-xPPIDOPTIND=1evaltypeset -i RANDOM MAILCHECK="${MAILCHECK-600}" SECONDS="${SECONDS-0}" TMOUT="${TMOUT-0}"hash=alias -ttype=whence -vstop=kill -STOPsuspend=kill -STOP $$autoload=typeset -fufunctions=typeset -fhistory=fc -linteger=typeset -inohup=nohup local=typesetr=fc -e -login=exec login-tUccdatemailmakeprviwhoENVSH_VERSION$ /etc/suid_profile/etc/profile$HOME/.profileCannot determine current working directory-c requires an argumentUSERinclude: %dUse `exit' to leave ksh shell: %d%s%s-`%c' requires argument%s%s-%c: unknown option |&;<>()*@#!$-? =-+?#% "#$&'()*;<>?[\`|0123456789ABCDEFallexportbraceexpandbgnicecsh-historyemacs-usemetaerrexitgmacsignoreeofinteractivemarkdirsnoclobbernoglobnohupnolognounsetphysicalposixprivilegedtrackallvirawvi-show8vi-tabcompletevi-esccompletextrace%-*s %sCurrent option settings -o %sgetoptionsparse_args: `%c'%s: bad optionA:o;sgmatch'\'%-*s%*sdo_phys_pathshf_fdopen: missing read/writeshf_reopen: bad shf/buf/bsizeshf_reopen: missing read/writeshf_sopen: flags 0x%xshf_flush: no fdshf_emptybuf: no fdshf_fillbuf: no fdshf_read: bsize %dshf_read: flags %xshf_getse: flags %xshf_getchar: flags %xshf_ungetc: flags %xshf_putchar: no fdshf_putchar: flags %xshf_write: nbytes %dshf_write: flags %xshf_snprintf: buf %lx, bsize %dshf_vfprintf0123456789abcdef(null %s)too many <<'s for%s: bad identifier too many redirections %s: invalid function name thenelseeliffiesacwhileuntildo{}[[&&||;;((|&unexpectedunmatchedsyntax error: `%s' %s ?%dsyntax error: unexpected EOF ERRError handlerEXITSIGtimed out waiting for inputsetexecsig: unset signal %d(%s)%S #no-args# #no-vars# ( %T) %T| %T%;%T%s %T ]] %Sdo%N%T%;done in %;for %s select %s case %S in%N(%S%c%;%T%N;;%Nesac %s %T%;doif %Telif %Telse%;%T%;fi then%N%T{%;%T%;} %T& function %s %T%s() %Ttime %T%T|& < >| <> <<- << >> <&>&wdscan: unknown char 0x%x (carrying on)j_ttyinit: can't set close-on-exec flag: %sj_ttyinit: dup of tty fd failed: %sNo controlling tty (open /dev/tty: %s)Can't find tty file descriptorOPTINDPOSIXLY_CORRECTHISTSIZEVISUALMAILCHECKMAILPATHRANDOMSECONDSTMOUTLINENO%s: subscript %ld out of range0123456789abcdefghijklmnopqrstuvwxyz0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZstr_valsetstr: %s=%s: assigning to self%s: is read only%0*s%.*s%*s%.*sy$%s %dfc -e ${VISUAL:-${EDITOR:-vi}} --grabhist: bad history arrayM-%s: destination pathname too longdo_moverename %s to %scan't remove %scannot resolve %scannot rename a mount point%s: remove%s: set times%s: set flags%s: set mode%s: set owner/group%s: set owner/group; not setting setuid/setgid%s: waitpid/bin/cp%s: terminated with %d (non-zero) status%s: did not terminate normally/bin/rm-rf-PRpusage: %s [-fi] source target %s [-fi] source ... directory |&=<>+-*/%:()syntax erroreval5division by zeronon-numeric argument_msgbufpM:N:sysctl: KERN_MSGBUFSIZEcouldn't allocate space for buffer datasysctl: KERN_MSGBUFusage: %s [-M core] [-N system] sethostnamegethostnameusage: %s [-s] [name-of-host] /var/run/utmplogout%s: not a device nodereadlabelfs%s: bad filesystem type in label%s: couldn't read disklabel%s%s%s%c/etc/fbtab(null)%s: bad entry: %s%o%s: %s: %mlogin_protect/*%s: chown(%s): %m%s: chmod(%s): %m%s: opendir(%s): %m%lld.%1lld%c%lld%c0B/var/log/wtmplogwtmp\\#TERMPATHtgetent.termcap /usr/share/misc/termcap/usr/share/misc/termcapTERMCAPOOPS?Ynacosacosfacos: DOMAIN error asinasinfasin: DOMAIN error atan2atan2fatan2: DOMAIN error hypothypotfcoshcoshfexpfy0y0fy0: DOMAIN error y1y1fy1: DOMAIN error yn: DOMAIN error ynynflgammalgammaflgamma: SING error loglogflog: SING error log: DOMAIN error log10: SING error log10log10flog10: DOMAIN error pow(0,0): DOMAIN error powfpowpow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sinhsinhfsqrtsqrtfsqrt: DOMAIN error fmodfmodffmod: DOMAIN error remainderremainderfremainder: DOMAIN error acoshacoshfacosh: DOMAIN error atanh: DOMAIN error atanhatanhfatanh: SING error scalbscalbfj0j0f: TLOSS error j1j1fjnjnfgammagammafgamma: SING error 0C0longjmp botch. no errorunknown/invalid errorresolved protocol is unknowninvalid value for hintsmemory allocation failureaddress family for name not supportedservice not supported for ai_socktypeai_socktype not supportedai_family not supportedno address associated with namenon-recoverable failure in name resolutiontemporary failure in name resolutionname or service is not knowninvalid value for ai_flagsxxswfstabscanfstab: rcmd: socket: %s rcmd: socket: All ports in use RSH%s: %s rcmd_afconnect to address %s: rcmd: %s: %s socket: protocol failure in circuit setup. rcmd: accept: %s rcmd: select (setting up stderr): %s select: protocol failure in circuit setup rcmd: write (setting up stderr): %s iruserok%s/.rhosts.rhosts lstat failed.rhosts not regular fileiruserok_sa.rhosts fstat failedbad .rhosts owner.rhosts writable by other than owner/etc/hosts.equiv__ivaliduser__ivaliduser_sa__icheckhostrcmd: address %s not listed for host %s__gethostloopgetnameinfoip6_parsenumeric/usr/bin/rshlocalhostrcmdsh: socketpairrcmdsh: dup2 failedrcmdsh: fork to lose parent failedrcmdsh: execvp %s failed: %s -lrcmdshrcmdsh: setuid(%u): %s rcmdsh: fork failedrcmdsh: unknown user: %s  0LdResolver Error 0 (no error)Unknown hostHost name lookup failureUnknown server errorNo address associated with nameResolver internal errorUnknown resolver errorrresvport_af%u.%u.%u.%u%u.%u.%u.%uinet_ntop4inet_ntop6%8xH.%02x:%02x:%02x:%02x:%02x:%02x.%uLīȫ̫ԫث xl $,4<DȮLTSignal 0HUPINTILLTRAPABRTEMTFPEKILLBUSSEGVSYSPIPEALRMURGTSTPCONTCHLDTTINTTOUIOXCPUXFSZVTALRMPROFWINCHUSR1USR2h ,4@HTdp|nosappndnosappendnoarchnoarchivednoschgnoschangenosimmutablenouappndnouappendnouchgnouchangenouimmutablenodumpnoopaque ,%ld%s-blocks%s: unknown blocksize%s: minimum blocksize is 512maximum blocksize is %dGBLOCKSIZE%02x:%02x:%02x:%02x:%02x:%02x%x:%x:%x:%x:%x:%x/etc/ethers+ ethers.byaddrether_ntohostethers.bynameether_hostton*** unknown regexp error code ***REG_NOMATCHregexec() failed to matchREG_BADPATinvalid regular expressionREG_ECOLLATEinvalid collating elementREG_ECTYPEinvalid character classREG_EESCAPEREG_ESUBREGinvalid backreference numberREG_EBRACKbrackets ([ ]) not balancedREG_EPARENparentheses not balancedREG_EBRACEbraces not balancedREG_BADBRinvalid repetition count(s)REG_ERANGEinvalid character rangeREG_ESPACEREG_BADRPTrepetition-operator operand invalidREG_EMPTYempty (sub)expressionREG_ASSERT"can't happen" -- you found a bugREG_INVARGinvalid argument to regex routineregerrorREG_0x%xsecurertsctssoftcarwindow/etc/ttys/var/run/dev.db__ttyname_r_basic/etc/protocolsgetnetanswerIN-ADDR.ARPAgetnetbyaddr0.0.0.%u.in-addr.arpa%u.%u.%u.%u.in-addr.arpa0.%u.%u.%u.in-addr.arpa0.0.%u.%u.in-addr.arpagetnetbyname/etc/networks/etc/groupgrscangroup.bynamegroup.bygidreadpassphraseglob3g_opendirg_lstatg_statmaster.passwd.bynamepasswd.byname__YP!__has_yppwgetpwnamgetpwuidmaster.passwd.byuidpasswd.byuid/etc/spwd.db/etc/pwd.db*netgroup: %m(%s,%s,%s)netgroup.byusernetgroupnetgroup.byhostnetgroup: db getnetgroup: Syntax error `%s'netgroup: Cycle in group `%s' ,/etc/netgroup.dbyp_first: clnt_callalphaABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzblankcntrl digitgraphABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~lowerabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ punct!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ upperABCDEFGHIJKLMNOPQRSTUVWXYZxdigit0123456789ABCDEFabcdefalnumABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789NULSOHSTXETXEOTENQBELalertBSbackspaceHTtabLFVTvertical-tabFFform-feedCRcarriage-returnSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBIS4IS3GSIS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfivesixseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDEL[:<:]][:>:]]authunix_createauthunix_create: out of memory authunix_create_defaultauth_none.c - Fatal marshalling problem$08L\htȻԻ$0@Tl|ļܼ$08L\htȻԻ$0@Tl|ļܼHangupInterruptQuitIllegal instructionTrace/BPT trapAbort trapEMT trapFloating point exceptionKilledBus errorSegmentation faultBad system callBroken pipeAlarm clockTerminatedUrgent I/O conditionSuspended (signal)SuspendedContinuedChild exitedStopped (tty input)Stopped (tty output)I/O possibleCputime limit exceededFilesize limit exceededVirtual timer expiredProfiling timer expiredWindow size changesInformation requestUser defined signal 1User defined signal 2option requires an argument -- %coption requires an argument -- %sambiguous option -- %.*soption doesn't take an argument -- %.*sunknown option -- %cunknown option -- %sinet_net_pton_ipv40123456789abcdef0123456789/usr/src/lib/libc/net/inet_net_pton.cn >= 0 && n <= 9n >= 0 && n <= 15assertion "%s" failed: file "%s", line %d assertion "%s" failed: file "%s", line %d, function "%s" ipx_addr%d-%d-%d-%d-%d%x.%x.%x.%x.%x.%x%x,%x,%x%3x%3o%3dsscanfԻb0b1ncdtscilcshssbpxbxfxoxtxdxsimulatedgetenttc%s.db:\|:cgetnextexeclexecleexeclpexecvpexecvp: : path too long xdr_array: out of memory   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~realpathvfscanfgethostby*.getanswer: asked for "%s", got "%s"-_/getanswergethostby*.getanswer: asked for "%s %s %s", got type "%s"gethostbyaddr%x.%x.ip6.arpa/etc/hostshosts.byaddr_yp_gethtbyaddrhosts.byname:2*" <4,$ >6.&@80( 91)! ;3+# =5-% ?7/'91)! :2*" ;3+# <4,$?7/'>6.&=5-%      )4%/7(3-!0,1'8"5.*2$                                                                                                                                  @ @ @ @ @ ./ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz01234567896789:;<=>?  !"#$%&'()*+,-./012345%2.2u$bcrypt_gensaltOrpheanBeholderScryDoubtbcrypt 1Ѭߘr/Ḗ~&jE|,G$l iciNWqX~=t XrX͋qJT{YZ90`*#`(yA8۸y:`l>w'K1/x`\`U%U攫UbHW@cj9U*4\̴ATr|*oc]ũ+1t>\3֯\$lS2zw(H;Kkē!(f a!`|H2]]]u#&܈e>#Ŭom9BD . Ji^Bh!la gӫҠQjh/T(3Ql n;zP;*~ev9>YfCoEå}^;uos D@jVbNw?6r=B$7H ۛIrS{y%P;LylO`@ž\^c$johSl>9oR;Qm,0DE ^J3(fK.WtE9_ ӹyU 2`yr,@%g̣饎"2u<kaP/R=2`#H{1S>W\o.ViB~(2gsUO'[iXʻ]=!lJ[-ySeEIҐK3~ˤAb Lw6~д+MەqՓkю%ǯ/[{AI~-%^q h"W6d$ cUYCxSZ٢[} Źv&ϕbhAJsN-GJ{RQ)S?Wƛv`+t恵oWk *!ec.4dV]-SGjnpzKD). u#&İn}ߧI`fqilRdVឱ¥6)L u@Y>:䚘T?eB[k?ҡ08-M]% L&pc^?kh >\D}W7: P tAu8/;21>8TNmO Bo ,y|$ryVw.?rU$qk.P̈́GXzt}K:zfC cdG27;C$CMQe*P:qUN1w_V5kǣ;< $Y,n<pEㆱo ^*>Zw=Ne)։>%fRxL.jxS<- N=+6&9`y#RnfE{7(2åZl!Xeh;/ۭ}*/n[(!pa)uGa0a4c\s9pL ު˼,b`\ndi#PZe2Zh@*<1! T_~}=b7w-_h)5ǡޖXxWcr"ÃF T0.SHُ(1mX4a(s<|J]d]B> EꫪOlOBBǵj;Oe!AyMjGKPb=bF&[$ti GV[ Htb#*BXU >ap?#r3A~_;"lY7|`t˧@n2w΄PU5ai Z .zD4Egɞs͈Uy_g@Cge48>q(= m!>J=+hZ=@&L4)i Av.khq$j 3ԷCaP.9FE$tO!@MpE/f m1'A9UG%ښ ʫ%xP()Sچ, mbhiHפh'?Oz|Ϊ_7әxB*k@5 ٫9N;VmK1f&tn:2C[Ah xN جV@E'H::SU kKмgUXc)3VJ*%1?~^|1)p/'\,(H"m?H܆AyG@n]Q_2Տd5A4x{%`*`lc´2Of#k>3b $;" r(-Exb}doITH}'>AcG t.no:7`L knU{7,gm;e' )̒9 i{f} ϑ^و/$[Qy{;v.97yY̗&-1.Bh;+jLu.x7BjQ满PcKkؽ%=YBD n *Ngd_ڈ鿾dW{x`M``FѰ8Ew63kBqA_^;Z4ٷ,Q+:Ֆ}}>(-}|%rZLZq)GW;()f(.y_xU`uD^mm%adâW<'*:m?!cf&(3uU4V<wQ( gQ̫_QM08bX7 z{>d!Q2Ow~㶨F=)iSHd$m-if! FEdlX [@X̻k~jEY:D 5>ʹrdfGof,ҏ"W##v215VbuZ6ns҈bIPLVq z2E{Sb%ҽ5iq"|˶+v>S@`8G% 8vFšw``u N˅؍芰z~L\HjiԐ\-% ?2aN[wߏWr:j?$.Dsp"8 1).lN!(Ew8fTl 4)P|ɵՄ? Gy$1$%s%.*s$md5cryptMD5Pad__sbprintfbug in vfprintf: bad baseInfNaN__find_argumentsexponent?$@Y@@@@j@.AcAחAeA _BvH7BmB@0BļB4&k C7yAC؅W4vCNgmC=`XC@xDPKDMD7yACnF?O8M20HwZ?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~/&/etc/resolv.conf;#lookupsearchnameserversortlist_res_initRES_OPTIONSenvLOCALDOMAINndots:insecure1insecure2edns001234567890123456789abcdef0123456789ABCDEFinet_pton6  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@DLPXQ\\hl   $ DH \dxh (H4O$#@DX`n !"(0LTp`xdef #$,XDINCHAOSHSHESIODANYname serverMDmail destination (deprecated)MFmail forwarder (deprecated)CNAMEcanonical nameSOAstart of authorityMBmailboxMGmail group memberMRmail renameNULLnullWKSwell-known service (deprecated)PTRdomain name pointerHINFOhost informationMINFOmailbox informationMXmail exchangerTXTRPresponsible personAFSDBDCE or AFS serverX25X25 addressISDNISDN addressrouterNSAPnsap addressNSAP_PTRsignaturePXmapping informationGPOSgeographical position (withdrawn)AAAALOClocationNXTnext valid name (unimplemented)EIDendpoint identifier (unimplemented)NIMLOCNIMROD locator (unimplemented)SRVserver selectionATMAATM address (unimplemented)IXFRincremental zone transferAXFRMAILBmailbox-related data (deprecated)MAILAmail agent (deprecated)UINFOuser information (nonstandard)UIDuser ID (nonstandard)GIDgroup ID (nonstandard)NAPTRURN Naming Authority"any"/etc/services,/ذ""too smallsyslog_r: unknown facility/priority: %xvsyslog_r<%d>Error %d[%ld]%h %e %T syslog: unknown facility/priority: %xconnectlog_r/dev/log  (08@HT\htx|JanFebMarAprMayJunJulAugSepOctNovDecJanuaryFebruaryMarchAprilJuneJulyAugustSeptemberOctoberNovemberDecemberSunMonTueWedThuFriSatSundayMondayTuesdayWednesdayThursdayFridaySaturday%H:%M:%S%m/%d/%y%a %b %e %T %YAMPM%a %b %e %H:%M:%S %Z %Y_fmt%Y-%m-%d%H:%M%2d%03d%I:%M:%S %p%e-%b-%Y%04d_conv-0GMTmnabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789 :+-._Local time zone must be set--see zic manual page/usr/share/zoneinfotzload/etc/localtimeposixrules,M4.1.0,M10.5.0TZvsnprintfyp_match: clnt_callyp_next: clnt_call/var/run/ypbind.lock_yp_dobindclntudp_createfcntl: F_SETFDYP server for domain %s not responding, still trying clnttcp_create%s/%s.%d/var/yp/bindinghx,Hh0t(; errno = %s ; s1 = %u, s2 = %u ; why = (unknown authentication error - %d) ; low version = %u, high version = %u RPC: SuccessRPC: Can't encode argumentsRPC: Can't decode resultRPC: Unable to sendRPC: Unable to receiveRPC: Timed outRPC: Incompatible versions of RPCRPC: Authentication errorRPC: Program unavailableRPC: Program/version mismatchRPC: Procedure unavailableRPC: Server can't decode argumentsRPC: Remote system errorRPC: Unknown hostRPC: Port mapper failureRPC: Program not registeredRPC: Failed (unspecified error)RPC: Unknown protocolRPC: (unknown error code)%s: %s - %s Authentication OKInvalid client credentialServer rejected credentialInvalid client verifierServer rejected verifierClient credential too weakInvalid server verifierFailed (unspecified error)clnttcp_create: out of memory bindresvport_saxdrrec_create: out of memory perrorlibcUnknown error: Unknown signal: _catopen/usr/share/nls/%L/%N.cat:/usr/share/nls/%N/%LLANGNLSPATHp $8L`tw|$8XlȻ 4Xt 8Tl@d,@dx$8L`x0D\lUndefined error: 0Operation not permittedNo such file or directoryNo such processInterrupted system callInput/output errorDevice not configuredArgument list too longExec format errorBad file descriptorNo child processesResource deadlock avoidedPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkOperation not supported by deviceNot a directoryIs a directoryInvalid argumentToo many open files in systemToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksNumerical argument out of domainResult too largeResource temporarily unavailableOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not availableProtocol not supportedSocket type not supportedOperation not supportedProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceOperation timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downNo route to hostDirectory not emptyToo many processesToo many usersDisk quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticatorIPsec processing failureAttribute not foundIllegal byte sequenceNo medium foundWrong medium type$08L\htȻԻ$0@Tl|ļܼxdr_bytes: out of memory xdr_string: out of memory %$sniglet^&isatty ((((( AAAAAABBBBBB arc4_stirsnprintfHASH: Out of overflow pages. Increase page size %s/_hash.XXXXXXopen_temp4\dpldpdPxdd0dLdddHdXdXdXxLdddGddPر$ddd0d6d6eL+e<ei ei(ei0e<8eHDeLLetP| Te\edepep|e,eh>eh>eh>e؅e؅e؅eP4 e$P e e e e n e h e eL e0 e e d$OpenBSD: args.c,v 1.16 2006/03/22 18:08:04 dhill Exp $$OpenBSD: conv.c,v 1.10 2003/06/11 23:42:12 deraadt Exp $unblock and -DNO_CONV?@(#) Copyright (c) 1991, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: dd.c,v 1.14 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: misc.c,v 1.15 2006/03/22 18:08:04 dhill Exp $$OpenBSD: position.c,v 1.7 2003/06/11 23:42:12 deraadt Exp $@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount_cd9660.c,v 1.17 2005/04/08 20:09:36 jaredy Exp $$OpenBSD: getmntopts.c,v 1.9 2004/07/05 18:33:38 otto Exp $@(#) Copyright (c) 1980, 1990, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: df.c,v 1.44 2006/05/11 15:06:51 deraadt Exp $@(#) Copyright (c) 1980, 1990, 1993, 1994 The Regents of the University of California. All rights reserved. @(#) Copyright (c) 1980, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount.c,v 1.42 2006/04/08 01:41:32 ray Exp $@nnn4n4,n4> P30123456789=:f/?/*?*n+n,N-N.m'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !+ Hh VqQ:q:QZZ    l h b  w  i x X      0  $  k  j  is a directory is not a regular file (use -f to see it)  ab@ @BЦ`cȦdA(De\xfāF g0P|ĥHAئi @XjJ!ԃlH<LԦ mܦ$4Dn"ĦPh|pHP qЄr"4Xs!S!Ѕu"8V w"Ptx(XA y̦@Xz|"~!?# .A8H  (press RETURN)... (interrupt to abort)dvvw381@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. $NetBSD: mount_nfs.c,v 1.12.4.1 1996/05/25 22:48:05 fvdl Exp $ $OpenBSD: getmntopts.c,v 1.9 2004/07/05 18:33:38 otto Exp $Ȏмظ11"t €u6Uu|agPtPS[X!Using drive X, partition YMBR on floppy or old BIOS Read error No O/S No active partition OxU~8g8SiLt]|$dܨ^اt` gjg8Se\@l_f `fȨ0g<g Tg\|<|4 )@d~A̳B|CXhDܳEFG UVhabac(e#f0h<iHL\lpn|qqrsvwx̴u@(#) Copyright (c) 1980, 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: umount.c,v 1.17 2006/06/29 12:51:26 jmc Exp $$OpenBSD: mount_msdos.c,v 1.19 2005/04/08 20:09:37 jaredy Exp $$OpenBSD: getmntopts.c,v 1.9 2004/07/05 18:33:38 otto Exp $oo@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mknod.c,v 1.14 2006/04/08 23:51:33 dhill Exp $$08H@Dl L T d _ \Lchl4J, <6<=9dTH- J<48OpI, $9,xMT @IkJL #v  8<`p4$QS\ 0@(#) Copyright (c) 1980, 1986, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: reboot.c,v 1.28 2006/06/01 17:22:14 dhill Exp $@(#) Copyright (c) 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount_ffs.c,v 1.19 2006/08/11 11:47:39 pedro Exp $$OpenBSD: getmntopts.c,v 1.9 2004/07/05 18:33:38 otto Exp $$/sbin/dhclient-script( 0(EHC P E(  0(EHDHC ;Zx0N$OpenBSD: buf.c,v 1.17 2006/04/25 15:41:07 deraadt Exp $#$OpenBSD: cbc.c,v 1.14 2006/04/25 15:41:07 deraadt Exp $@ $OpenBSD: glbl.c,v 1.10 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: io.c,v 1.11 2003/06/11 23:42:12 deraadt Exp $%$OpenBSD: main.c,v 1.30 2006/04/25 15:41:07 deraadt Exp $ `%H$OpenBSD: re.c,v 1.10 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: sub.c,v 1.10 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: undo.c,v 1.8 2003/06/11 23:42:12 deraadt Exp $@(#) Copyright (c) 1988, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: cp.c,v 1.32 2006/04/25 15:41:07 deraadt Exp $D4$OpenBSD: utils.c,v 1.26 2004/12/10 10:23:30 jmc Exp $66666p( ... ...̩ԩة $(08@HT`hp̩(J n 0Ī4444444nqȞ44j444 n44ȩQ===>@(#) Copyright (c) 1991, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: init.c,v 1.39 2006/06/22 00:25:22 deraadt Exp $L; $OpenBSD: dkcksum.c,v 1.7 2004/09/28 17:57:46 otto Exp $$OpenBSD: getmntopts.c,v 1.9 2004/07/05 18:33:38 otto Exp $@(#) Copyright (c) 1983, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: newfs.c,v 1.52 2006/03/09 13:35:02 pedro Exp $Xjdjgpjtj|jjjjjjn@j@@ @%s: can't read disk label; disk type must be specifiedRRRS$S0SPS`StSSSSST?@[ĸ\и\]^^_$_0`@{L{`|p}|}~  <  ?4̩ԩة $(08@HT`hp̩(J n 0Ī4444444nqȞ44j444 n44ȩ  ./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz:./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789abcdef 0000000000000000},P@4@333E4@4@333F @4@333G@ D ll t<`dltH\\X\X<HW&K$NetBSD: ffs.S,v 1.5 2003/04/05 23:08:52 bjh21 Exp $$NetBSD: memcmp.S,v 1.2 2003/04/05 23:08:52 bjh21 Exp $.shstrtab.init.text.fini.rodata.data.eh_frame.gotpad0.got.ctors.dtors.gotpad1.bss.stack.arm.atpcs.note.openbsd.ident PP$ttbb$d%`+\\5`c>`c`Cpcp J|c|QcZl _fq44~ma  on}of!NI u p + & d _afs*QQafs Daemon/var/empty/sbin/nologin2_syslogd*IISyslog Daemon/var/empty/sbin/nologin2_kdc*;;Kerberos Server/var/empty/sbin/nologin2popa3d*POP3 Server/var/empty/sbin/nologin2_ospfd*UUOSPF Daemon/var/empty/sbin/nologin3U_dhcp*MMDHCP programs/var/empty/sbin/nologin3M_identd*identd/var/empty/sbin/nologin3_ppp*RRPPP utilities/var/empty/sbin/nologin1_ppp_mopd*NNMOP Daemon/var/empty/sbin/nologin1_mopd_rusersd* rpc.rusersd/var/empty/sbin/nologin1_rusersd_identd*identd/var/empty/sbin/nologin1_identdpopa3d*POP3 Server/var/empty/sbin/nologin1popa3dLGhc" ? : X " X _ppp*RRPPP utilities/var/empty/sbin/nologin2_pflogd*JJpflogd privsep/var/empty/sbin/nologin2_kadmin*<<Kerberos Admin Server/var/empty/sbin/nologin2sshd*sshd privsep/var/empty/sbin/nologin2nobody*Unprivileged user/nonexistent/sbin/nologin3_hostapd*VVHostAP Daemon/var/empty/sbin/nologin3V_mopd*NNMOP Daemon/var/empty/sbin/nologin3Nnamed*FFBIND Name Service Daemon/var/named/sbin/nologin3F_spamd*>>Spam Daemon/var/empty/sbin/nologin3>_rstatd*rpc.rstatd/var/empty/sbin/nologin3_isakmpd*DDisakmpd privsep/var/empty/sbin/nologin1_isakmpdsmmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin1smmsp fa#A< r m & ! N I   { 5 { _ntp*SSNTP Daemon/var/empty/sbin/nologin2 _bgpd*KKBGP Daemon/var/empty/sbin/nologin2_spamd*>>Spam Daemon/var/empty/sbin/nologin2_portmap*portmap/var/empty/sbin/nologin2_dvmrpd*WWDVMRP Daemon/var/empty/sbin/nologin3W_tftpd*OOTFTP Daemon/var/empty/sbin/nologin3Oproxy*GGProxy Services/nonexistent/sbin/nologin3G_ftp*TTFTP Daemon/var/empty/sbin/nologin1_ftp_ntp*SSNTP Daemon/var/empty/sbin/nologin1_ntp_afs*QQafs Daemon/var/empty/sbin/nologin1_afs_rbootd*PPrbootd Daemon/var/empty/sbin/nologin1_rbootd_tftpd*OOTFTP Daemon/var/empty/sbin/nologin1_tftpd_kdc*;;Kerberos Server/var/empty/sbin/nologin1_kdc_x11*##X Server/var/empty/sbin/nologin1_x11_rstatd*rpc.rstatd/var/empty/sbin/nologin1_rstatdbin*Binaries Commands and Source,,,//sbin/nologin1binoi"ID { v   P _ftp*TTFTP Daemon/var/empty/sbin/nologin2!_tcpdump*LLtcpdump privsep/var/empty/sbin/nologin2uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2_identd*identd/var/empty/sbin/nologin2 rootdaemonCharlie &/root/bin/ksh2_rbootd*PPrbootd Daemon/var/empty/sbin/nologin3P_rusersd* rpc.rusersd/var/empty/sbin/nologin3 rootdaemonCharlie &/root/bin/ksh3_hostapd*VVHostAP Daemon/var/empty/sbin/nologin1_hostapdproxy*GGProxy Services/nonexistent/sbin/nologin1proxy_portmap*portmap/var/empty/sbin/nologin1_portmapsshd*sshd privsep/var/empty/sbin/nologin1sshd[T vq ~ > 9 j e !  _ospfd*UUOSPF Daemon/var/empty/sbin/nologin2"_dhcp*MMDHCP programs/var/empty/sbin/nologin2www*CCHTTP Server/var/www/sbin/nologin2_rstatd*rpc.rstatd/var/empty/sbin/nologin2 daemon*The devil himself/root/sbin/nologin2_afs*QQafs Daemon/var/empty/sbin/nologin3Q_syslogd*IISyslog Daemon/var/empty/sbin/nologin3I_fingerd*!!fingerd/var/empty/sbin/nologin3!smmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin3daemon*The devil himself/root/sbin/nologin3nobody*Unprivileged user/nonexistent/sbin/nologin1nobody_ospfd*UUOSPF Daemon/var/empty/sbin/nologin1_ospfd_pflogd*JJpflogd privsep/var/empty/sbin/nologin1_pflogd_kadmin*<<Kerberos Admin Server/var/empty/sbin/nologin1_kadmin$vm,%KB f a   p k ( # J E  j _hostapd*VVHostAP Daemon/var/empty/sbin/nologin2#_mopd*NNMOP Daemon/var/empty/sbin/nologin2_isakmpd*DDisakmpd privsep/var/empty/sbin/nologin2_rusersd* rpc.rusersd/var/empty/sbin/nologin2 operator*System &/operator/sbin/nologin2_ppp*RRPPP utilities/var/empty/sbin/nologin3R_pflogd*JJpflogd privsep/var/empty/sbin/nologin3Juucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Bpopa3d*POP3 Server/var/empty/sbin/nologin3operator*System &/operator/sbin/nologin3_dvmrpd*WWDVMRP Daemon/var/empty/sbin/nologin1_dvmrpd_tcpdump*LLtcpdump privsep/var/empty/sbin/nologin1_tcpdump_bgpd*KKBGP Daemon/var/empty/sbin/nologin1_bgpd_syslogd*IISyslog Daemon/var/empty/sbin/nologin1_syslogd_spamd*>>Spam Daemon/var/empty/sbin/nologin1_spamdoperator*System &/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonrootdaemonCharlie &/root/bin/ksh1root\Vpk-( Z U    z + & W _dvmrpd*WWDVMRP Daemon/var/empty/sbin/nologin2$_tftpd*OOTFTP Daemon/var/empty/sbin/nologin2named*FFBIND Name Service Daemon/var/named/sbin/nologin2_fingerd*!!fingerd/var/empty/sbin/nologin2 bin*Binaries Commands and Source,,,//sbin/nologin2_ntp*SSNTP Daemon/var/empty/sbin/nologin3S_bgpd*KKBGP Daemon/var/empty/sbin/nologin3Kwww*CCHTTP Server/var/www/sbin/nologin3C_kdc*;;Kerberos Server/var/empty/sbin/nologin3;_x11*##X Server/var/empty/sbin/nologin3#sshd*sshd privsep/var/empty/sbin/nologin3bin*Binaries Commands and Source,,,//sbin/nologin3named*FFBIND Name Service Daemon/var/named/sbin/nologin1namedwww*CCHTTP Server/var/www/sbin/nologin1wwwuucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucplg&!72 N I  g 1 g nobody*Unprivileged user/nonexistent/sbin/nologin2%_rbootd*PPrbootd Daemon/var/empty/sbin/nologin2proxy*GGProxy Services/nonexistent/sbin/nologin2_x11*##X Server/var/empty/sbin/nologin2 smmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin2_ftp*TTFTP Daemon/var/empty/sbin/nologin3T_tcpdump*LLtcpdump privsep/var/empty/sbin/nologin3L_isakmpd*DDisakmpd privsep/var/empty/sbin/nologin3D_kadmin*<<Kerberos Admin Server/var/empty/sbin/nologin3<_portmap*portmap/var/empty/sbin/nologin3_dhcp*MMDHCP programs/var/empty/sbin/nologin1_dhcp_fingerd*!!fingerd/var/empty/sbin/nologin1_fingerd . install.md set_term() { local _tables TERM=${TERM:-${MDTERM:-vt220}} ask "Terminal type?" $TERM export TERM=$resp [[ -x /sbin/kbd ]] || return _tables=$(bsort $(kbd -l | egrep -v "^(user|tables|encoding)")) while :; do ask "kbd(8) mapping? ('L' for list)" "none" case $resp in [Ll?]) echo "Major tables: $_tables" ;; none) return ;; *) kbd $resp && { echo $resp >/tmp/kbdtype ; return ; } ;; esac done } welcome() { local _q cat <<__EOT Welcome to the $OBSD $MODE program. This program will help you $MODE OpenBSD in a simple and rational way. At any prompt except password prompts you can run a shell command by typing '!foo', or escape to a shell by typing '!'. Default answers are shown in []'s and are selected by pressing RETURN. At any time you can exit this program by pressing Control-C and then RETURN, but quitting during an $MODE can leave your system in an inconsistent state. __EOT set_term cat <<__EOT IS YOUR DATA BACKED UP? As with anything that modifies disk contents, this program can cause SIGNIFICANT data loss. __EOT case $MODE in upgrade) cat <<__EOT NOTE: once your system has been upgraded, you must manually merge any changes to files in the 'etc' set into the files already on your system. __EOT _q="Proceed with upgrade?" ;; install) cat <<__EOT It is often helpful to have the installation notes handy. For complex disk configurations, relevant disk hardware manuals and a calculator are useful. __EOT if [ -f /etc/fstab ]; then cat <<__EOT You seem to be trying to restart an interrupted installation! You can skip the disk preparation steps and continue, or you can reboot and start over. __EOT _q="Skip disk initialization?" else _q="Proceed with install?" fi ;; esac ask_yn "$_q" if [[ $resp == n ]]; then cat <<__EOT Enter 'halt' at the prompt to gracefully exit OpenBSD. You can then power cycle the machine and boot your original OS. __EOT exit fi echo "Cool! Let's get to it." } stripcom () { local _l [[ -f $1 ]] || return while read _l; do [[ -n ${_l%%#*} ]] && echo $_l done <$1 } scan_dmesg() { bsort $(sed -ne "$1" /var/run/dmesg.boot) } get_ifdevs() { ifconfig -a \ | egrep -v '^[[:space:]]|(bridge|enc|gif|gre|lo|pflog|pfsync|ppp|sl|tun|vlan)[[:digit:]]+:' \ | sed -ne 's/^\(.*\):.*/\1/p' } get_serialdev() { local _d _bd _td [[ -n $MDSERIAL ]] || exit set -- $MDSERIAL _d=$1 _bd=$2 _td=$3 set -- $(scan_dmesg "/^${_d}\([0-9]\) .*/s//\1/p") echo "$_bd$1 $_td$1" } get_drive() { ask_which "$1" "contains the $MODE media" "$2" [[ $resp == done ]] && return 1 makedev $resp || return 1 return 0 } get_partition() { local _drive=$1 _fstypes=$2 _part _fst disklabel $_drive 2>/dev/null \ | grep '^ [a-p]: ' \ | egrep -v "swap|unused" \ | sed -e 's/^ \(.\): *[^ ]* *[^ ]* *\([^ ]*\) .*/\1 \2/' \ >/tmp/parts.$_drive disklabel $_drive 2>/dev/null | grep '^ .:' ask_which "$_drive partition" "has the $MODE sets" \ "$(sed -e 's/^\(.\).*/\1/' /tmp/parts.$_drive)" [[ $resp == done ]] && return 1 _part=$resp _fst=$(sed -ne "/^$_part /s///p" /tmp/parts.$_drive) ask_which "filesystem type" "should be used to mount $_drive$_part" "$_fst $_fstypes ffs" case $resp in done) return 1 ;; $_fst) resp="$_part" ;; *) resp="$_part $resp" ;; esac return 0 } askpass() { set -o noglob stty -echo read resp?"$1 " stty echo set +o noglob echo } ask() { local _question=$1 _default=$2 set -o noglob while :; do echo -n "$_question " [[ -z $_default ]] || echo -n "[$_default] " read resp case $resp in !) echo "Type 'exit' to return to install." sh ;; !*) eval ${resp#?} ;; *) : ${resp:=$_default} break ;; esac done set +o noglob } ask_until() { resp= while [[ -z $resp ]] ; do ask "$1" "$2" done } ask_yn() { local _q=$1 _a=${2:-no} _resp typeset -l _resp while :; do ask "$_q" "$_a" _resp=$resp case $_resp in y|yes) resp=y ; return ;; n|no) resp=n ; return ;; esac done } ask_which() { local _name=$1 _query=$2 _list=$3 _def=$4 _err=$5 set -- $_list if (( $# < 1 )); then echo "${_err:=No ${_name}s found}." resp=done return fi : ${_def:=$1} _list="$*" while :; do ask "Available ${_name}s are: $_list.\nWhich one $_query? (or 'done')" "$_def" isin "$resp" $_list done && break echo "'$resp' is not a valid choice." done } isin() { local _a=$1 _b shift for _b; do [[ $_a == $_b ]] && return 0 done return 1 } addel() { local _a=$1 shift echo -n "$*" isin "$_a" $* || echo -n " $_a" } rmel() { local _a=$1 _b shift for _b; do [[ $_a != $_b ]] && echo -n "$_b " done } bsort() { local _l _a=$1 _b [[ $# -gt 0 ]] || return shift for _b; do if [[ $_a != $_b ]] ; then if [[ $_a > $_b ]] ; then _l="$_a $_l"; _a=$_b else _l="$_b $_l" fi fi done echo -n "$_a " bsort $_l } save_comments() { local _file=$1 if [[ -f /mnt/etc/$_file ]]; then grep "^#" /mnt/etc/$_file >/tmp/$_file.new [[ -f /tmp/$_file ]] && cat /tmp/$_file >>/tmp/$_file.new mv /tmp/$_file.new /tmp/$_file fi } edit_tmp_file() { local _file=$1 ask_yn "Edit $_file with $EDITOR?" [[ $resp == y ]] && $EDITOR /tmp/$_file } manual_net_cfg() { ask_yn "Do you want to do any manual network configuration?" [[ $resp == y ]] && { echo "Type 'exit' to return to $MODE." ; sh ; } } ftp_list_files() { ftp ${_ftp_active} -V -n "$1" <<__EOT user "$2" "$3" cd "$4" ls quit __EOT } makedev() { local _dev=$1 if [[ ! -r /dev/MAKEDEV ]] ; then echo "MAKEDEV not found. Can't create device nodes." return 1 fi cd /dev ; sh MAKEDEV $_dev || return 1 ; cd - >/dev/null } addhostent() { local _addr=$1 _name=$2 _delim="." [[ $_addr == *:* ]] && _delim=":" sed "/^[0-9a-fA-F]*[$_delim].* $_name\$/d" /tmp/hosts >/tmp/hosts.new mv /tmp/hosts.new /tmp/hosts echo "$_addr $_name" >>/tmp/hosts } select_sets() { local _avail=$1 _selected=$2 _next _f _action cat <<__EOT Select sets by entering a set name, a file name pattern or 'all'. De-select sets by prepending a '-' to the set name, file name pattern or 'all'. Selected sets are labelled '[X]'. __EOT while :; do _action= _next= echo for _f in $_avail; do if isin $_f $_selected; then echo " [X] $_f" else echo " [ ] $_f" : ${_next:=$_f} fi done : ${_next:=done} ask "Set name? (or 'done')" "$_next" case $resp in done) break ;; -*) _action=rmel ;; esac : ${_action:=addel} resp=${resp#+|-} case $resp in "") continue ;; all) resp=* ;; esac for _f in $_avail; do eval "case $_f in @($resp)) _selected=\`$_action $_f \$_selected\` ;; esac" done done resp=$_selected } configure_ifs() { local _IFDEVS=$IFDEVS _ifs _name _media _hn while :; do ask_which "interface" "do you wish to initialize" "$_IFDEVS" \ "" "No more interfaces to initialize" [[ $resp == done ]] && break _ifs=$resp _hn=/tmp/hostname.$_ifs ask "Symbolic (host) name for $_ifs?" "$(hostname -s)" _name=$resp _media=$(ifconfig -m $_ifs | grep "media ") if [[ -n $_media ]]; then cat <<__EOT The media options for $_ifs are currently $(ifconfig -m $_ifs | sed -n '/supported/D;/media:/p') __EOT ask_yn "Do you want to change the media options?" case $resp in y) cat <<__EOT Supported media options for $_ifs are: $_media __EOT ask "Media options for $_ifs?" _media=$resp ifconfig $_ifs $_media || return 1 ;; n) _media= ;; esac fi rm -f $_hn v4_config "$_ifs" "$_media" "$_name" "$_hn" v6_config "$_ifs" "$_media" "$_name" "$_hn" [[ -f $_hn ]] && _IFDEVS=$(rmel "$_ifs" $_IFDEVS) done } v4_info() { ifconfig $1 inet | sed -n ' 1s/.*/etc/resolv.conf.tail if [[ -n $_hn ]]; then _hn="send host-name \"$_hn\";" echo "Issuing hostname-associated DHCP request for $_ifs." else echo "Issuing free-roaming DHCP request for $_ifs." fi cat >/etc/dhclient.conf <<__EOT initial-interval 1; $_hn request subnet-mask, broadcast-address, routers, domain-name, domain-name-servers, host-name; __EOT ifconfig $_ifs group dhcp >/dev/null 2>&1 dhclient $_ifs set -- $(v4_info $_ifs) if [[ $1 == UP && -n $2 ]]; then mv /etc/dhclient.conf /tmp/dhclient.conf mv /etc/resolv.conf.tail /tmp/resolv.conf.tail return 0 fi ifconfig $_ifs delete down rm /etc/dhclient.conf /etc/resolv.conf.tail return 1 } v4_config() { local _ifs=$1 _media=$2 _name=$3 _hn=$4 _prompt _addr _mask if ifconfig $_ifs | grep 'groups:.* dhcp' >/dev/null 2>&1; then _addr=dhcp else set -- $(v4_info $_ifs) if [[ -n $2 ]]; then _addr=$2; _mask=$3 ifconfig $_ifs inet $_addr delete fi fi [[ -x /sbin/dhclient ]] && _prompt=" or 'dhcp'" _prompt="IPv4 address for $_ifs? (or 'none'$_prompt)" ask_until "$_prompt" "$_addr" case $resp in none) ;; dhcp) if [[ ! -x /sbin/dhclient ]]; then echo "DHCP not possible - no /sbin/dhclient." elif dhcp_request $_ifs "$_name" || dhcp_request $_ifs ; then addhostent "127.0.0.1" "$_name" echo "dhcp NONE NONE NONE $_media" >>$_hn fi ;; *) _addr=$resp ask_until "Netmask?" "${_mask:=255.255.255.0}" ifconfig $_ifs -group dhcp >/dev/null 2>&1 if ifconfig $_ifs inet $_addr netmask $resp up ; then addhostent "$_addr" "$_name" echo "inet $_addr $resp NONE $_media" >$_hn fi ;; esac } v6_config() { local _ifs=$1 _media=$2 _name=$3 _hn=$4 _addr _prefixlen _prompt ifconfig lo0 inet6 >/dev/null 2>&1 || return set -- $(v6_info $_ifs) [[ -n $2 ]] && { _addr=$2; _prefixlen=$3; } [[ -x /sbin/rtsol ]] && _prompt="or 'rtsol' " _prompt="IPv6 address for $_ifs? (${_prompt}or 'none')" ask_until "$_prompt" "${_addr:-none}" case $resp in none) return ;; rtsol) [[ ! -x /sbin/rtsol ]] && { echo "No /sbin/rtsol." ; return ; } ifconfig $_ifs up rtsol -F $_ifs addhostent "::1" "$_name" echo "up\nrtsol $media" >>$_hn return ;; esac _addr=$resp ask_until "IPv6 prefix length for $_ifs?" "${_prefixlen:=64}" ifconfig $_ifs inet6 $_addr prefixlen $resp up || return echo "inet6 $_addr $resp $media" >>$_hn addhostent "$_addr" "$_name" v6_defroute $_ifs [[ $resp == none ]] && return route -n add -inet6 -host default "$resp" || return echo "$resp" >>/tmp/mygate } v4_defroute() { local _dr _prompt=" or 'none'" [[ -x /sbin/dhclient ]] && _prompt=", 'dhcp'$_prompt" _prompt="Default IPv4 route? (IPv4 address$_prompt)" _dr=$(route -n show -inet | sed -ne '/^default */{s///; s/ .*//; p;}') [[ -f /tmp/dhclient.conf ]] && _dr=dhcp while :; do ask_until "$_prompt" "$_dr" [[ $resp == @(none|dhcp) ]] && break route delete -inet default >/dev/null 2>&1 route -n add -inet -host default "$resp" && { echo "$resp" >/tmp/mygate ; break ; } route -n add -inet -host default $_dr >/dev/null 2>&1 done } v6_defroute() { local _if=$1 _routers _oifs if [[ -z $(route -n show -inet6 | sed -ne '/^default */{s///; s/ .*//; p;}') ]]; then resp=none return fi if [[ -x /sbin/ping6 ]]; then _routers=$(ping6 -n -c 2 ff02::2%$_if 2>&1 | sed -n \ -e '/bytes from/{s/^.*from //;s/,.*$//;p;}') fi _oifs=$IFS IFS= PS3="IPv6 default router? (list #, IPv6 address or 'none'): " select i in $_routers; do case $i in "") resp=$REPLY [[ -n $resp ]] && break ;; *) resp=$i break ;; esac done IFS=$_oifs } enable_network() { local _netfile _gw for _netfile in hosts dhclient.conf resolv.conf resolv.conf.tail protocols services; do if [ -f /mnt/etc/${_netfile} ]; then cp /mnt/etc/${_netfile} /etc/${_netfile} fi done ifconfig lo0 inet 127.0.0.1 for hn in /mnt/etc/hostname.*; do if=${hn#/mnt/etc/hostname.} ifconfig $if >/dev/null 2>&1 || continue while :; do if [ "$cmd2" ]; then set -- $cmd2 af=$1 name=$2 mask=$3 bcaddr=$4 ext1=$5 cmd2= i=1; while [ i -lt 6 -a -n "$1" ]; do shift; let i=i+1; done ext2="$@" else read af name mask bcaddr ext1 ext2 || break fi case $af in "#"*|"!"*|"bridge"|"") continue ;; "dhcp") [ "$name" = "NONE" ] && name= [ "$mask" = "NONE" ] && mask= [ "$bcaddr" = "NONE" ] && bcaddr= dhcpif="$dhcpif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 down" cmd="$cmd; dhclient $if" ;; "rtsol") rtsolif="$rtsolif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 up" ;; "up") cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 up" ;; *) read dt dtaddr if [ "$name" = "alias" ]; then alias=$name name=$mask mask=$bcaddr bcaddr=$ext1 ext1=$ext2 ext2= else alias= fi cmd="ifconfig $if $af $alias $name " case $dt in dest) cmd="$cmd $dtaddr" ;; [a-z!]*) cmd2="$dt $dtaddr" ;; esac if [ ! -n "$name" ]; then echo "/mnt/etc/hostname.$if: invalid network configuration file" return fi case $af in inet) [ "$mask" ] && cmd="$cmd netmask $mask" if [ "$bcaddr" -a "$bcaddr" != "NONE" ]; then cmd="$cmd broadcast $bcaddr" fi [ "$alias" ] && rtcmd="; route -qn add -host $name 127.0.0.1" ;; inet6) [ "$mask" ] && cmd="$cmd prefixlen $mask" cmd="$cmd $bcaddr" ;; *) cmd="$cmd $mask $bcaddr" esac cmd="$cmd $ext1 $ext2$rtcmd" rtcmd= ;; esac eval "$cmd" done /dev/null 2>&1 route -qn add -host default $_gw && break done [[ -z $rtsolif ]] && stripcom /mnt/etc/mygate | while read _gw; do [[ $_gw == !(*:*) ]] && continue route -qn delete -inet6 default >/dev/null 2>&1 route -qn add -host -inet6 default $_gw && break done route -qn add -host `hostname` 127.0.0.1 >/dev/null route -qn add -net 127 127.0.0.1 -reject >/dev/null echo "Network interface configuration:" ifconfig -am route -n show if [ -f /etc/resolv.conf ]; then echo "\nResolver enabled." else echo "\nResolver not enabled." fi } install_files() { local _src=$1 _files=$2 _f _sets _get_sets for _f in $THESETS; do isin $_f $_files || continue; _sets=$(addel $_f $_sets) isin $_f $DEFAULTSETS "site$VERSION-$(hostname -s).tgz" && \ _get_sets=$(addel $_f $_get_sets) done if [[ -z $_sets ]]; then cat <<__EOT No $OBSD sets were found at $(echo $_src | sed -e 's/\(^ftp:\/\/[^/]*\)\(:[^/]*\)\(@.*\)/\1\3/') Set names are: $THESETS __EOT return fi select_sets "$_sets" "$_get_sets" [[ -n $resp ]] || return _get_sets=$resp ask_yn "Ready to $MODE sets?" yes [[ $resp = n ]] && return for _f in $THESETS ; do isin $_f $_get_sets || continue echo "Getting $_f ..." case $_f in *.tgz) ftp $_ftp_active -o - -V -m "$_src/$_f" | tar zxphf - -C /mnt ;; *) ftp $_ftp_active -o "/mnt/$_f" -V -m "$_src/$_f" ;; esac if [ $? -ne 0 ]; then echo "'$_f' did not install correctly." else DEFAULTSETS=$(rmel $_f $DEFAULTSETS) fi done } encode_for_url() { echo "$1" | sed -e " s/%/%25/g s/ /%20/g s/!/%21/g s/\"/%22/g s/#/%23/g s/\\\$/%24/g s/&/%26/g s/'/%27/g s/(/%28/g s/)/%29/g s/\*/%2a/g s/+/%2b/g s/,/%2c/g s/-/%2d/g s/\./%2e/g s/\//%2f/g s/:/%3a/g s/;/%3b/g s//%3e/g s/?/%3f/g s/@/%40/g s/\[/%5b/g s/\\\\/%5c/g s/]/%5d/g s/\^/%5e/g s/_/%5f/g s/\`/%60/g s/{/%7b/g s/|/%7c/g s/}/%7d/g s/~/%7e/g " } ftp_error() { if [[ -n $(echo "$2" | grep "$1") ]]; then echo $1 return 0 fi return 1 } install_url() { local _url_type=$1 _file_list _url_base _oifs _prompt _passwd ask "HTTP/FTP proxy URL? (e.g. 'http://proxy:8080', or 'none')" \ "${ftp_proxy:-none}" unset ftp_proxy http_proxy [[ $resp == none ]] || export ftp_proxy=$resp http_proxy=$resp rm -f $SERVERLIST ask_yn "Display the list of known $_url_type servers?" if [[ $resp == y ]]; then echo -n "Getting the list from 129.128.5.191 (ftp.openbsd.org)..." ftp $_ftp_active -V -a -o - \ ftp://129.128.5.191/$FTPDIR/ftplist 2>/tmp/ftplisterr \ | sed -ne "/^${_url_type}:\/\//s///p" >$SERVERLIST if [[ -s $SERVERLIST ]]; then echo "done." _prompt="Server? (IP address, hostname, list#, 'done' or '?')" cat -n $SERVERLIST | less -XE else echo "FAILED." cat /tmp/ftplisterr fi fi : ${_prompt:="Server? (IP address, hostname or 'done')"} while :; do eval resp=\$_${_url_type}_server_ip ask_until "$_prompt" "$resp" case $resp in done) return ;; "?") [[ -s $SERVERLIST ]] || continue cat -n $SERVERLIST | less -XE ;; +([0-9])) [[ -s $SERVERLIST ]] || continue set -- $(sed -ne "${resp}p" $SERVERLIST) [[ $# -lt 1 ]] && { echo "There is no line $resp." ; continue ; } echo "Using $*" eval _${_url_type}_server_ip=${1%%/*} eval _${_url_type}_server_dir=${1#*/}/$SETDIR ;; *) eval _${_url_type}_server_ip=$resp break ;; esac done if [[ $_url_type == ftp && -z $ftp_proxy ]]; then case $_ftp_active in -A) resp=no ;; *) resp=yes ;; esac unset _ftp_active ask_yn "Does the server support passive mode ftp?" $resp [[ $resp == n ]] && _ftp_active=-A fi eval resp=\$_${_url_type}_server_dir ask_until "Server directory?" "${resp:-pub/OpenBSD/$SETDIR}" eval _${_url_type}_server_dir=$resp if [[ $_url_type == ftp ]]; then _oifs=$IFS IFS= ask_until "Login?" "${_ftp_server_login:=anonymous}" _ftp_server_login=$resp if [[ $_ftp_server_login == @(anonymous|ftp) ]]; then _passwd=root@`hostname` else resp= while [[ -z $resp ]] ; do askpass "Password? (will not echo)" done _passwd=$resp fi IFS=$_oifs fi _url_base=$_url_type:// if [[ $_url_type == ftp && $_ftp_server_login != anonymous ]]; then _url_base=$_url_base$(encode_for_url "$_ftp_server_login"):$(encode_for_url "$_passwd")@ fi eval _url_base=$_url_base\$_${_url_type}_server_ip/\$_${_url_type}_server_dir ifconfig lo0 127.0.0.1 if [[ $_url_type == ftp && -z $ftp_proxy ]] ; then _file_list=$(ftp_list_files "$_ftp_server_ip" "$_ftp_server_login" "$_passwd" "$_ftp_server_dir") ftp_error "Login failed." "$_file_list" && return ftp_error "No such file or directory." "$_file_list" && return else _file_list=$(ftp -o - -V "$_url_base/index.txt" | sed 's/ //') fi install_files "$_url_base" "$_file_list" } install_mounted_fs() { local _dir while :; do ask_until "Pathname to the sets? (or 'done')" "$SETDIR" [[ $resp == done ]] && return [[ -d /mnt2/$resp ]] && { _dir=/mnt2/$resp ; break ; } [[ -d /mnt/$resp ]] && { _dir=/mnt/$resp ; break ; } [[ -d /$resp ]] && { _dir=/$resp ; break ; } echo "The directory '$resp' does not exist." done install_files "file://$_dir" "$(ls -l $_dir)" } install_cdrom() { local _drive _part=c _fstype get_drive "CD-ROM" "$CDDEVS" || return _drive=$resp set -- $(disklabel $_drive 2>&1 | grep '^ c: ') case $4 in ISO9660) _fstype=cd9660 ;; UDF) _fstype=udf ;; *) get_partition $_drive "cd9660" || return set -- $resp _part=$1 [[ -n $2 ]] && _fstype=$2 ;; esac mount -t $_fstype -o ro /dev/$_drive$_part /mnt2 || return install_mounted_fs } install_disk() { local _drive _dev _fstype _fsopts ask_yn "Is the disk partition already mounted?" if [[ $resp == n ]]; then get_drive "disk" "$DKDEVS" || return _drive=$resp get_partition $_drive "$MDFSTYPE" || return set -- $resp _dev=/dev/$_drive$1 [[ -n $2 ]] && _fstype="-t $2" [[ $_fstype == $MDFSTYPE ]] && _fsopts=$MDFSOPTS if [[ -z $(mount | grep "^$_dev") ]]; then mount $_fstype -o ro,$_fsopts $_dev /mnt2 || return fi fi install_mounted_fs } install_nfs() { local _tcp ask_until "Server IP address or hostname?" "$NFS_ADDR" NFS_ADDR=$resp ask_until "Filesystem on server to mount?" "$NFS_PATH" NFS_PATH=$resp ask_yn "Use TCP transport? (requires TCP-capable NFS server)" [[ $resp == y ]] && _tcp=-T mount_nfs $_tcp -o ro $NFS_ADDR:$NFS_PATH /mnt2 || return install_mounted_fs } install_tape() { local _z _bs get_drive "tape drive" "$MTDEVS" || return export TAPE=/dev/nr$resp if [[ ! -c $TAPE ]]; then echo "$TAPE is not a character special file." return fi echo -n "Rewinding $TAPE (mt rewind)..." mt rewind || return echo "done." while :; do ask_until "Skip how many files? (or 'done')" 0 [[ $resp == done ]] && return [[ $resp == +([0-9]) ]] || continue (($resp < 0)) && continue if (($resp > 0)); then echo -n "Skipping $resp file(s)..." mt fsf $resp || return echo "done." elif [[ -n $_bs ]]; then mt bsf ; mt fsf fi unset _z ask_yn "Is the file gzipped?" yes [[ $resp == y ]] && _z=z [[ $_z == z ]] || _bs=10240 ask_until "Blocksize for this file?" "${_bs:-8k}" [[ $resp == done ]] && return _bs=$resp dd if=$TAPE bs=$_bs | tar ${_z}xvphf - -C /mnt || return done } set_timezone() { local _zoneroot=/mnt/usr/share/zoneinfo/ _zonepath [[ ! -d $_zoneroot ]] && return if [[ -L /mnt/etc/localtime ]]; then TZ=$(ls -l /mnt/etc/localtime 2>/dev/null) TZ=${TZ#*${_zoneroot#/mnt}} fi : ${TZ:=GMT} while :; do _zonepath=$_zoneroot ask "What timezone are you in? ('?' for list)" "$TZ" if [[ $resp == ? ]]; then ls -F ${_zonepath} continue; fi _zonepath=${_zonepath}${resp} while [[ -d $_zonepath ]]; do ask "What sub-timezone of '${_zonepath#$_zoneroot}' are you in? ('?' for list)" case $resp in "") ;; ?) ls -F $_zonepath ;; *) _zonepath=$_zonepath/$resp ;; esac done if [[ -f $_zonepath ]]; then TZ=${_zonepath#$_zoneroot} echo -n "Setting local timezone to '$TZ'..." ln -sf /usr/share/zoneinfo/$TZ /mnt/etc/localtime echo "done." return fi echo -n "'${_zonepath#$_zoneroot}'" echo " is not a valid timezone on this system." done } sane_install() { local _s _m for _s in $SANESETS; do isin $_s $DEFAULTSETS || continue ask_yn "'$_s' was not installed.\nAre you *SURE* your $MODE is complete without '$_s'?" [[ $resp == n ]] && _m="$_m $_s" done [[ -n $_m ]] && return 1 return 0 } install_sets() { local _d=disk _locs="disk ftp http" [[ -n $CDDEVS ]] && { _locs="cd $_locs" ; _d=cd ; } [[ -x /sbin/mount_nfs ]] && _locs="$_locs nfs" [[ -n $MTDEVS && -x /bin/mt ]] && _locs="$_locs tape" echo "\nLet's $MODE the sets!" while :; do umount -f /mnt2 >/dev/null 2>&1 [[ -z $DEFAULTSETS ]] && _d=done ask "Location of sets? ($_locs or 'done')" "$_d" case $resp in done) sane_install && return ;; c*|C*) isin "cd" $_locs && install_cdrom ;; d*|D*) install_disk ;; f*|F*) isin "ftp" $_locs && install_url ftp ;; h*|H*) isin "http" $_locs && install_url http ;; n*|N*) isin "nfs" $_locs && install_nfs ;; t*|T*) isin "tape" $_locs && install_tape ;; esac done } munge_fstab() { local _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do [[ $_dev == \#* || \ $_fstype == nfs || \ ! -f /sbin/mount_$_fstype || \ $_opt == *noauto* || \ $_opt == *xx* ]] && continue _opt=$(echo $_opt | sed -e 's/softdep//') [[ $_fstype == ffs ]] || _opt=$(echo $_opt | sed -e 's/rw/ro/') echo $_dev /mnt${_mp%/} $_fstype $_opt done /etc/fstab if [ ! -s /etc/fstab ]; then echo "Unable to create valid /etc/fstab." exit fi } mount_fs() { local _async=$1 _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do [ "$_mp" = "/mnt" ] || mkdir -p $_mp if ! mount -v -t $_fstype $_async -o $_opt $_dev $_mp ; then cat <<__EOT FATAL ERROR: Cannot mount filesystems. Double-check your configuration and restart the $MODE. __EOT exit fi done /dev/null 2>&1; then echo "FAILED. You must fsck $_dev manually." _fail=y else echo "OK." fi done /tmp/resolv.conf for _ns in $resp; do echo "nameserver $_ns" >>/tmp/resolv.conf done ask_yn "Use the nameserver now?" yes [[ $resp == y ]] && cp /tmp/resolv.conf /tmp/resolv.conf.shadow fi [[ -n $(ifconfig -a | sed -ne '/[ ]inet .* broadcast /p') ]] && v4_defroute edit_tmp_file hosts manual_net_cfg } populateusrlocal() { if [ -f /mnt/etc/mtree/BSD.local.dist ]; then /mnt/usr/sbin/chroot /mnt /usr/sbin/mtree -Uedqn -p /usr/local -f /etc/mtree/BSD.local.dist >/dev/null fi } questions() { local _bd _td ask_yn "Start sshd(8) by default?" yes if [[ $resp == n ]]; then echo "sshd_flags=NO # disabled during install" \ >>/mnt/etc/rc.conf.local fi ask_yn "Start ntpd(8) by default?" if [[ $resp == y ]]; then echo "ntpd_flags= # enabled during install" \ >>/mnt/etc/rc.conf.local fi if [[ -n $MDXAPERTURE ]]; then ask_yn "Do you expect to run the X Window System?" if [[ $resp == y ]]; then sed -e "/^#\(machdep\.allowaperture=${MDXAPERTURE}\)/s//\1 /" \ /mnt/etc/sysctl.conf >/tmp/sysctl.conf cp /tmp/sysctl.conf /mnt/etc/sysctl.conf fi fi [[ -z $SERIALDEV ]] && return set -- $SERIALDEV _bd=$1 _td=$2 ask_yn "Change the default console to $_bd?" [[ $resp == n ]] && return ask_which "speed" "should $_bd use" "9600 19200 38400 57600 115200" [[ $resp == done ]] && return echo "stty $_bd $resp\nset tty $_bd" >>/mnt/etc/boot.conf sed -e "/^${_td}/s/std.9600/std.${resp}/" \ -e "/^${_td}/s/unknown/vt220 /" \ -e "/${_td}/s/off/on secure/" /mnt/etc/ttys >/tmp/ttys } finish_up() { local _dev _mp _fstype _rest if [[ -x /mnt/sbin/swapctl ]]; then /mnt/sbin/swapctl -a /dev/$SWAPDEV >/dev/null 2>&1 while read _dev _mp _fstype _rest; do [[ $_fstype == swap ]] && \ /mnt/sbin/swapctl -a $_dev >/dev/null 2>&1 done /tmp/sysctl.conf cp /tmp/sysctl.conf /mnt/etc/sysctl.conf fi echo -n "Making all device nodes..." cd /mnt/dev sh MAKEDEV all for _dev in $DKDEVS $CDDEVS $MTDEVS; do sh MAKEDEV $_dev done echo "done." cd / md_installboot $ROOTDISK populateusrlocal [ -x /mnt/$MODE.site ] && /mnt/usr/sbin/chroot /mnt /$MODE.site cat <<__EOT CONGRATULATIONS! Your OpenBSD $MODE has been successfully completed! To boot the new system, enter halt at the command prompt. Once the system has halted, reset the machine and boot from the disk. __EOT md_congrats } ROOTDISK= ROOTDEV= VERSION=40 VNAME="$(( $VERSION / 10 )).$(( $VERSION % 10 ))" SETDIR="$VNAME/$ARCH" FTPDIR="pub/OpenBSD/$VNAME" OBSD="OpenBSD/$ARCH $VNAME" SERVERLIST=/tmp/serverlist for _opt in d f l m n p s; do ulimit -$_opt unlimited done dmesg | sed -ne '/^OpenBSD /h;/^OpenBSD /!H;${g;p;}' >/var/run/dmesg.boot DKDEVS=$(scan_dmesg "${MDDKDEVS:-/^[sw]d[0-9][0-9]* /s/ .*//p}") CDDEVS=$(scan_dmesg "${MDCDDEVS:-/^cd[0-9][0-9]* /s/ .*//p}") MTDEVS=$(scan_dmesg "${MDMTDEVS:-/^[cmsw]t[0-9][0-9]* /s/ .*//p}") IFDEVS=$(get_ifdevs) SERIALDEV=$(get_serialdev) THESETS="bsd bsd.rd bsd.mp $MDSETS" DEFAULTSETS="bsd bsd.rd" for _set in base etc misc comp man game xbase xetc xshare xfont xserv site ; do [[ $MODE == upgrade && ( $_set == etc || $_set == xetc ) ]] && continue THESETS="$THESETS ${_set}${VERSION}.tgz" isin $_set xbase xetc xshare xfont xserv site && continue DEFAULTSETS="$DEFAULTSETS ${_set}${VERSION}.tgz" done SANESETS="0123456789abcdefL_) 3L_  ZL L_,  L_P @PL_:@P`L_<L_+qL_,L_) P\ L_ PL_P P@ @_L_, @,@2X Xd$`_____________ ʚ;5ym8@ E82(@AAA==(A*________________Q __ dcLclcpctcxc|ccccccccįcȯc̯cЯcԯca%ța%Лa$&_4(1_044<4456556<6$$$()%X**+++,,$$$)%8%(+\+`,,,,0-d---.4.h.../8/l/0@6l6@t;p;;;<;;;<<;;;<x<L=|<==<x<<p;<p;p;p;`I`I|=IVAPVAVA@VA@qA qAqA qAD@ @ D @ i @ i@ @ ġСܡ(cats8ʏH0\@(\4dl(H%P%X%(x%%%*+&&,,`%h%p%)%&@&\+`,'0',0-d---.|'h...'8/l/ (h4``^^__`aabcd(fggat  0!!0!L!!4!(`!P((X%()$*X**+++,, )T)p%)**(+\+`,,,,0-d---.4.h.../8/l/d!!|%t%'< d`|<PPP$4@P`p|<||}}0Xpx$h,T\@TXKKKKKKK(KKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKh/0'37H6KKKKK22 3P5d1l1KKKKKKKKKKKKKKKKKKKKKKKKKTLT8xpKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKTKHKDKlKОl}}}}(K_KKKKKKKKKKKKK(KОKKKKKKKKKK4XxKKKdKKKKKKKKKKKKK_KKKKKKK_KKKKKKK_KKKKKKK_K8FNPRRS\R(KОKKKKKKKKKKKKKK_KKKKKKK_Kh/0.(/3K_KKKKKKK_K2222P5K_KKKKKKK_KKKKKKK_KKKKKKK_KpS S U [ ] Ki Klj KKKKKK_KTK_KLTh8K_KK_KKKKKKKKKKKKKKKKKKKKKKK_KKKKKKK_KKKKKKK_KKKKKKK_KKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK_KKKKKKK_KLl<KK,KKKKKK_KKKKKKK_KKKKKKK_KKKKKKK_KKKKKKK_KKKKKKKKKKKKKKKKKKKKKKK_KKKKKKK_KKKKKKKKKKKKKKK_KKKKKKK_KKKKKKK_K$ p(KОKKKKKK_KKKKKKK_KKKKKKKKKKKKKKKKKKKKKKK_KV4XPZZ[i`[(cd\KKKKKKKKKKKKKLK|?AKKBKDKKKKKKKKKKKKKKKK_KKKKKKKKKKKKKKKK(KОKKKKKKKKKKKKKKKKKKKKKKKK_KKKKKKK_KKKKKKK_KKKKKKK_KKKKKKK_KKKKKKK_KKKKKKK_KKKKKKK_KKKKKKK_KKKKKKK_KKKKKKK_KKKKKKK_KKKKKKK_KKKKKKK_KKKKKKK_KKKKKKK_KKKKKKK_KKKKKKK_KKKKKKK_KKKKKKK_KKKKKKK_KKKKKKK_KKKKKKK_KKKKKKK_KKKKKKK_KKKKKKK_KKKKKKKKKKKKKKKKKKKKKKK_KadG\bA@KBP |0yz{@??????(@HHPHXH(`HHH*HI(I,,PIXI`I)hIII\+IJ0J,0-d---.XJh.../8/l/??????(@HHPHXH(`HHH*HI(I,,PIXI`I)hIII\+IJ0J,0-d---.XJh.../8/l/8KK(_D_[[ lcc[[ Hgtg[[ pjj[[!ll[[!\n4o0pPxxPLi8`8u`xax!8`xq4xrlxsxt4xulxvx xx xx̣x x xx !ddbd bD dbdddxxxxxxxxPPQQS  xPLxUL`8x`xp4x dxPx|x|TPx WD2?2?f$g7d778H8   XD31  Яh7d778H8SB1 B 1 11111NeN3NQ"NQ!NQNQ&3NQ&!NQ&1NQ1NM1NI1Nm1NE1NE^ & b .,f,b,b܂bܚbܑb܎b܍bmb܁ e T C B ꂀ"T"B"TB BBBB    eB" @d778H8@0@0PȪ d040083@5D@JEHFLH,JPQTRXU\X`ad0h3l5p@AtExF|HPDQHFRXEUlF`b c 8,x8LDX  6.1.40$'    [129  X | h""&''d(,),-T---2 45p5055`xEG.<tԡ  % 3u Du u <u 8u 2u 0&'u 1&u 0&u     )%uu 0 1 8%u   3 D D%uu < 8 2u 0&'u 1&u 0&u  L0 p12*d6# # P99:R4RSv>>$>,>4><>D>L>T>\>d>l>t>|>>>>>>>>>>>>>>>>>>>>t?$P@d2d,++#aa@(([//\))](-{/-|)-}!!c/l-y-soxoco<<>>??  ` ~ ^ "' AAA AA'CEEEEIIIINOOOOOUUUUYaaaa aa'ceeeeiiiinooooouuuuyy"A"E"I"O"U"a"e"i"o"u"yA^A`A*A~ACE^E`EI^I`I~NO^O`O~OU^U`UYa^a`a*a~ace^e`ei^i`i~no^o`o~ou^u`uyH(`Boldface.iso1 \`wfllllllll||| 0 `F8ll8vv0 000000 0 0f<0p000x6 0>p00p>p|`08l 8llF`0| 0|``f`?8`DDE9  2 2 a>wc`aaa?`  0  0f`vvf`    ` 00`000000006??a@ 0  @````@``@? !? ?1```@```0 00`gop``````p@??`@@000  000 ``````p?```<     `xx``88`9  ?0```g ollg`0? ? @@`@`````a``````````` `````` 0 @a``````````````````@a0@0@000?00000 0 0@0@000?000000x` ````a`` `0````````````````````````80acflxx|ngca`px00000000000 0 p`pppY`Y`Y`M`N`N`D`D`p` p x X L F G C A@@@`0 ````````````` @0@00`0`0`07000000x `````````````0@8@#a````|ngca`p0`` ` p<@`@``F p` ` ` ` ` ` ` ` ` ` p@?`@000 f f f v w@3@7@;;p` 0@8   @`p` 0@ ?   ?``00 || ||1`0009 ```gop````````p`xO1 ````p@0`````1 ````````p9`p0``````0`   1```1?`? `@ @ ?0p00790000000y 08````acf|x|ngcnf`f`f`f`f`f`f`p'y0000000y ````````p@8q``````````@p````  ````````p`8````s48000000x00@8 0?  @y00000009`p` 0@0@ pf f f 7@;@;@p@8  ` 0@0@  xp`A8 p`8    8 >`6gC0000~|V`s@ o`?0000?o`@ ``00`0?a00`0`00/@)@(@(@)@/@0``0`0`?` 6ll6 `??0/@)@/@*@*@+@0 33 ???<f0`~<ff< y00000009>`0000x?```?````````` 8<0`0`0`?l6 `` 6l08@@@@08 8D8D8@@@@ 000@9  ? @@` ? @@` ? @@`  ? @@` ? @@` ? @@`   # ##CCC` `````` 0 @  0@0@00?000 0 0@0@00?000 0 0@0@00?000 0 0@0@00?000 0  100`0`0``0`0`0`0`0@1 p` p X L F C A@@`0  ``````` @0@ ``````` @0@ ``````` @0@  ``````` @0@ ``````` @0@ 0`  0` `!!c`c`f`f`l`l`8@8@8o p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` 0@ ``````````8```acc````````ac 000900090009 0009000900096@&``?fff v@;1 ````p@0  0``````0`0``````0`0``````0`0``````0` Dl88lF ````p@8 'y0000000y  ````````p@8 ````````p@8 ````````p@8  ````````p@8 ````````p@8``#c`f`f`l`|@8?`` y00000009`y00000009`y00000009`y00000009`` 0@0@  xp````aaaaa`` 0@0@  xp `\)`  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ͳɿپ̴ްXP`XQ`2YQ`)Q`aQ`R`'R`R`R`R`R`S`S`(S`  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~S`oT`T`U`U`(U`8S`&8U`!@ADtEXFh$NetBSD: blockio.S,v 1.4 2001/06/02 11:15:56 bjh21 Exp $.symtab.strtab.shstrtab.text.start.data.sbss.bss.arm.atpcs.identA !`6`(``@.`V``6`4`V``6`g9`6`D`6`96`K8`~  HLO(et4lpF\ < p|ԛ D b  1dX)Н08<HP_Rtx\p/ecr`{H4v\px_L <| 8? &lh1,,XCo\V$g7sp`~c< 8$$}yXOb, t2,\#<,G<>LR,DbPhx@x |<< $&  <xPD2$"1<*\;|P`HQPa @ T W 8 /h 4  0P DP( ;bEVaHh <y A!@_ `@8$fT ($y )@4 =pDNdadkO(t(|\ 4 `؉$ LPDF  zbLd*Ht l54 lDX0Pxf8^bj9Xx`  XW@ xlb 4L4|c h 4ct$,5C,RdpY]Pg3m\}VGHH +0@ tSFb̠XI$0"&3r=},E$ R\p2dh cqc8|x$S ,hR\8"$ $.X8CtLPU|B 0]\ l b| Dr0?hxTX{HL  d3r =lK Vxb<tjxbw L| 8m\_c l @2PYcl/)?b4GjUjavL` DH1,0HZܯc 5+=u$UH2lh\xxb|L@b(%bDtb@<p $P H)$#+:TIXtf\4z ܝ@XbDbPzb(24DdUhGd_uP@bX,LLT h 6tb3  < $ /$l;XH8U4c ]43 | i0 DrdmbWh@X4 TX|' <I\dc0Fb(h3=4CE~xQch( t<@LTtbxh"8$&4\`\_,P'x 5(`@KعTк`j x(qhJ_vxP~ X*H(Fbtk x\  /uD>nb(N^S@t4L\ "c<p L*0 24@tcPxRT]o@Yp c+pRc_a H\ ($ ,' 0HML W8hJ y(l ,({ $l^d$(#heL7 HH8T  ^\n g!w l0X<= \:=U Xx  l  [# X4 X? @$ DH [|X |4c Hgm bv \ 4=X Fb$  8  ( $E  ȒP d!I !!t7!pmHC!eLZ!~bi!`r!Hy!!_!y`!l! `!N!h! !!<b!_!  "0`"āb!"_7"xSF"DDc"Pq"P~"tp"x x"g("d("zl"h "",#^ #T4+#L?#ԷF#I#<Y#i#P{#@ # #D#\#X#$c#5#0 #XL$`p $Їc$ ,.$_8$:I$,\`W$TL_$8s$($$@$$؄$ $$O,$(c$ T% %ȝ %0%H =%ppN% \% d%v%`%p%8% l%(%4 T%I %Psb%%_& &@\'&4.< 3& pB&R L&t \V& h&l \u&&&Lkp&p $&:&W&Ȱc &s&H0'd' ' -'(:'$J'(Z'BLk'|S'd'@'$$''D`'('cx'мc' `'l (|(ԇc,(<(ELX(4i( ~bx( (P((c(T3((c(b((((  ($ )7")-.)_<)F)xQ)g),Xu))U`) ))g8)hD))DD) )( * *D$*Ȓ,*(tb6*n,?*L N*xi* ~*mH**Q*@*5 *2*$ p **$(++D (+\?+pP++`+l+D{+_+s+ +_+t+ +D\+`<+ +l`,h,0>`),p`:,|H,8V,܁\`, j,,y,b, ,x,x ,,4.,h,(,, X, -Tt  -&-t5- c@-vO-8Ea-pf(o- `-[`-~c-L 8-̎-L-H-_--|.U .(+ . 3.T@., K.`S.a.*t.NLz. .d.Fd.t ..\<x..<.[.". /`/*/:/D[8F/,0U/U _/ s/P</Z`/ /]$/d/ /M /( L/ $/$ P/ /@`0 00v$0@D20x J0lY0o`0j0cu0b00R0b0;(0hp00$6h000Jh0m\ 1` 1t 10+0,1~c51F1XhV1f1$u1(1<$10h1?1t1111Q 1${b1 | 202P*2 _52p=2L(M2 W2l Xa2Lt2}2XP2e$2$2hH2,2xb 2 |202c(3$  3G$3J&3p 03@3pTJ3P3hQ<`3h.s33Z3Ԥ 3T x3lr3L3b3t3\Op330A 3Wh4\ p4e@&4034,,F4}bP4ob(a4@|4Z'4^4Я4< <4h4~44XJ4p58d 5pT5r,535PB5t`M5(BR5p`5cxn5s5(5`5X5X'5dv55$s5 b5\~5L5 5dc66L%6m;6<M6_\6(_k6,x6K~66 6<`66dLH6w\6_6 6f70V`7 '7c 67aK7|]7Lj7ܫ|7L`7 l78_7l$7 77 7X7p$7 H7gc8 88x$8478$X\A8L HQ8x_84j8Hv8UL8 8tH8_8x|8a8-<8(8yP8PI8pD8H9d 9D<*9 |59pj@9_I9@Y9 k9,cv9d9a9,H9Tj 9 9La9L%99h/\990J: h:8:3%:hj  0:@A:$ hc:Py::R :=:T:t :: : :&:H;X< ;;TH/;X:; D;\7pT;Tf;H;;(a;d;؇c;L ;D; 4;( <;LX;|;h#<! P<X!<Xsb*<=<H` F<hS<c  ^<|Jc<`p<pG<<|<<tX<M<,L<:p<<=<x==Xtb=!=)=f06=t G=M=a@Z=n=py=4Ix=hH=t=$==b=c=|@= x=>|lb>h>X>a,>`=>@ O>0]>nbk>\z>tjD>Pzx>F >c> 2l>Dt>X(> p>(>t>T?0%?=? G?V?Zf?` u?D4? ,?^?<?9$?x\?X??`?lr,?D@  @\0@ &@ 1@E(A@$ L@dZ@tz@@L@w @8@$k8@@@԰c@`@~c@aA| Aص%A!A4C0A tBA|PUAncAdsAlbAd1AhP0AFbA AlA `AA$AA(B B(BBt&Bd7BDIxGBd7pdBD/TpBBX B0'B,B_BpLB`P8B\<B,eBCFhCc&CP>>C` <OC( HYC@bfCl{CPC~C(ePCp0C8CLC_CL_CC4 HCi DxD$0DL>D P<HDVD0|`jDpyD$DTDt DD4DDD=DDc$EqlEPP*E95E0_CEL METEH _E\wEHEE4\( EPEEЇEh,hE E|t F`F3F2>F bFF5WFT_FtF FtxF$;FcF\FؕF`F F F dF` G G_(G|"$-GNG8c8WG(Qc`G<gG4_mG`z zG=G̺cGPG;G @GTGHGȁbG GaG-TH(H C$H(3H<GHbUHl&_H$tHXHH HHTZhH3\HDHHPH H3lI ,IXc1I$xtEI,OI($ZIh4eI4- sI}I )ID I4wIL TI`WI_`IlI\I I\J|JJ@fJ5JxCJ8KJ(YJԫ4lJ0 JtvbJJ̙ ,JJ JbJ| J_ JcK8K` Ki(Kgc7KlIKT VKmK(xK60KHKd 4KcK KhKK;KLdGL$L~c-L3=L KLcPWL< eLLXoLdHL L<LLt L<Lt8LpjxL4L@LT LbxMEM$M %M/p4Ms>Mx GM\M @eMnnM yMDVM`M MMMHM,%bMM|MlNCN,c%N87N(DNTN_fN~N0Nl NMLN1NIN\LNtaN N8\N|NL @O<O'X%O P 4O& COTddQOh]OgOpO7PO( O~OO@ OOcO$PHE P0H!Ph3P=PcVPX! , cPS HnPl$PPXPPcPPhPxPę X Qp# 8Q("Q\ b2Q_CQNQ8]QhHrQ` Q\Q\QK Q$ QS$QQ$\QdQ Qx<R L R $2RVtJR$aR\pRSt{R&DRK@RDTcR$7Rt,R\RTRSvSb(SԼc4S|FSdT YScbS<mSzSS XS S\-0StS|@S("DSxbS8 TjT4E1TP d9T wXNT_T_jT sT TTp[TTTTt T XTT<XT0U<U$$UT@b,UhCUDOU^U\0iU P{UnbUpGUU UZU~dU\cUU PU xU`V`V8V8 VV,V`H8V]AV DMVp( YV%<jV܇c|VVd DV2xV VVДVaV<V`VV lWP`W$w d'WHTc6WhIBWx_PW4\WcWNrW_W(lWFbW0 W@_WWWW+Wa W0`X-XhH'X(at9X BX,QcLXb_X`cpXh~X̟@X`Xt |XDXXLX`<XY_ YoYԪ"Yb.Y`GY 8QY'b]Y gYmbsYԡYzLYYtY8 <Y$5Y`\Y@Y tY Y< Z<|Zd!Zdc2Z ;ZP@JZؼcaZ_pZP$|Z.Z $Z*ZxZxaZ\Z7ZpZ* ZZ@v [XI[[d$3[|4?[TlQ[e[X[@[пd[L[`l8[d [Tup[p[ @[}h\,3\dP\,\|H<\Y K\l[\|_ 8e\s\| \8 \_\8(\d \ \d\v\h-(\]$0]3`']xt|6] C]HbL]\]`n]`%}]]D]0] ]m(]T]~c]S]^ xh^pp ^M ,^(`3^_B^O^Ddb^$ i^t^*l{^{t^tg^x^0Y^<^^to X^x ^W^__ $_l[x/_́b4_\e =_(obN_]_ m_,tbu_@__p_8 _ 0_&_\_` b_`H_T ` p`T(`l4`@$B`xI`HU`pTDc`yp`$Ft` |``` `dh`X(`|P`t@`xb`GbaP aH)av\;akLNaxfa,`racXyaa|/\a 4asTam ag8aa|a`aTaܱb,bK bmb*bl?b(XLbZbecb$ sb1b 1b,b0$@b`bDb Db8cbbԮcbcHb ccرP)c`pqNHq`PUqؗ\`qt|mq\\\|qtq6Hq,9DqܼcqqP qqcqZ xqhqALr/rD8r ,r5rbCr Zr 3fr\ (rrprxlr,r\`r\r0 rrLrI$rryr r @s,s̿P's,:slSs ^spcts{ss s|0s`s\ ss| s sTc|s00 tL_t>#tx+tle 84tnb=t(8JtUt|et}tbt0 t t,t܅btp t |t_t$tt uX(u\u<#u8c3u43l?uQu0,hu`uuD uq@u@Duu,u1 u|u$`u(u9xv|lv2@.v6v(Gv(RUvd]vTdv rv4v<`vdv$8vv DvP\vcv lvrpv$w wX8"wgc0wa>w 8Gww Qwĺc]wvwPwx%ww dwHr xw wxwp9w pw` `xtdxD2xتp=xt 8MxVx(tfxcqxT}x2@xXbx<xxLrxTXx|x\xx$q xxF y\ ,ynb#yl&7yCAyt@LypSy(~dyT<qyzy<yjy`zy$h8y@yyT yl 4yD yKydz \z(#z+zL D4zP>zcXz(bcz TtzT@zDkz8|zCzbz|azHKX Tlh}4u,x o T4@Lb< TdP$Ll\$x |$\('/L: PJ X$o ~'0$XcH<̛ T Āc ̀Հހ̾<Pp T"L/X ;u F`@0X(eqr+ t}Ul<  ht|ԁP@lT Ȗ g(&ԛ6?AI R@wb^|Xk7w[F6 `@ Ƃ'H؂\DX @t4 1x*̟L;H6B3M<S\`j= Wx%:ĂJ Q] mzPKd@T i @D_gͅ4Rp܌ T $ hdAH'L45@A lRp ^( nԟ @xt<HK† ΆdpH4l b^$94Fq4QHhs s Lz 8$T: XL ‡`ȇ 3DӇphF ę <` /(I\hcX?i <t ,3 4 <dX hL_4Ȉt `ӈ k$tp&t:PEh P6$[Glaw\sbh$  ‰ľ \Љۉ8 DXc h!,4/$nA#LL $YbX|iPuT<:(~b<Ċ.`ΊۊxL\ س$ yb$V`# $.L<8K{LWa`nر 0x \ 8lƋhcϋHA؋t D ?# (0(8E$U|9]t0hPx? Yp`T3 HČlcHȌیa0XX4-hLp; #4FdTO Wtb&n\ tsHbE/LXVV_$8qpK}H"08hT̐ Ր-Xc ?d b<",3`@0cJcPtSY0aj r_JdܠqPbdĻc0t ,;Tǚr pњ,ޚ,T( l0'2t=(OI\ \U.h tH~DdcDwb țӛH|ck  <.xv?|Oa@r}Hx _\ ,|ʜ_ќP ߜ$K$9< $G,% 0*C L\:$Yj?~HJ;^p]Dh({PTx`T_ơ4 ϡ0 Dסt <Td P p t(n8gDL|Ukckx|z@ $  P($d¢ТD4\)hXH%bX$\,O(;8FmbNZ7$aT hoM4aT[$lƣΣ8bأ\P(4 __r)|b4з 0>$R 4_Lhh<{ `ȁPhdФ m\0$@02  y$\ H2 L;DLbEԁ0Qq ZldsDdc4{* llYX8˥ݥ,4$ |$H@ 8.(dc7]$@L, XX?]h^ 0k u8 P  ķ$ΦT\b8 Lg( c x-c5DcD2DMc _ j\ Dv?@,8%@\`<ӧh hhALt(0 6GaRl$cԝk,|PX,)` ̨^0֨( $t@\"# H3Lva_p1\z Ab\g 4P ͩ̇$,uxbT,4T;dF8M$`a<y̫,DA0%4H8tѪ۪dXL-d/L DDXi l`$ybmw\D(hL{X#bXԮ7ڮ]lH c \b%L 8 tC(L^$U Tcw`KEb4*``IԯL` 0x̗d~ H-.d<O%4`wmHhzLlc,ȰL װdd߰00||LP$2$ApZdRؒ 0b<ptc8v`kL^Dx,{bͱ& <ڱ8L8/Db db _<*g,9HX@TDH4Sk`Rw ^qklz {b,hrXH½@&ҽH`p.@(b'2>|| GLc^mbt\Gؘ`ƾu\ؾ,`R< 4 P%L 1h0I$U aPctf( t 4\d:0ÿl xп%߿lx <f* ^*/:EXSeh} 0r j}* |D?x 8F@SLsg0HpLe8wh!  HY$@O84n4  +Pg`5S@D 0M]TjHqb~ 0c@l jtY,40T,yb xb\ $dh<DEtP tRDtbZh/\ad?@lpMxrdP`I_x`\bD$% D.`EEOجD\,bfpwd H0 T=T\H[\f\@2L( c-h=`< XLVg`g(u ~ $`H$\48V(0^}yb 8<850@ |RHb<kyPf8DBt[ p$R (<-L d*xm5$F Zh@c8@nc|(| PuX0 \Tct( b(>44 @$_R԰Ztskbz\ āHY|h$L,ЛX 4 (%@8gL` HY$a`oKvKHt]P((xhd!dȀ4l @h8&hrL.$=lL@[L~h*Xx\\@\V` |X  \ pp8FJ$ L <"62PGWtTkybx\  D}#bD4 @.4t'(5 <EԘVS d |tpS l|l }|D)bcSx$}bhh c "R@+ؔx@< TK STU h^\ imbs(b}_hD0TЁb^$ _<4@_xhE )Զ5T@E0\k0bw`lbrT* x8z, ( 54xc. :4XHNU $e|T8zP cl>p,O $$0JT_$T̉!\+(Y5O9\cM<a`Xj shbhTcHhbs )p P- B,Q<S(}bc4box@FHhd A( Th<_<`]in @LT\_ cL(`05T[DmY>dcu̒ @fP$c(h@XĻ$`2`_H $!A(PW 5ئC` L,ZxcqPppl#@ EX,XD}x% 70CV \amlJ v<<bR `8D~b$T) L,h #<x3L5F'Qx ldܔj 4t=|Ld R5P8XHY, hc #Y/(_\?< JآTZas0$$@tR \Yx, <|c"h88 N HV>_lbbm`~ܰc,4L|<H$`|@ _\&'_$CWWi; w0r8hxc _}dPm$Pd l .L07<C LN̾$[Igcu_}_ `,,Hbx4ok`> @t jd$9a*9 ?`Udh$vp+@XhxH R$`awR| lOIt\P<(I d,b ,,X 7t (DȎ4R,b| <l0bw 4[` XXH `E i D$z-T%b3d;;$K_# m( | |f  0 dx@d,7tDx(=KeV$e sX%b}\ L\$L p502| p8H pt TtG0`@8EKp$bTX)duH~ L8D,0hkX$?  D`!Х/cAaGcTfXhx\4;t 8,0aL_TH< D|@ ((742`H0}bWLNb8sbN00 xx> TD&p@0p8Ab@_G DV@6dD\q\)`<~hܰtNg$P@o d0{b@ (9 `F4 4.l&04@"KpLZxb Dh|\yz$d\\c؂X_pTl^ $h.`4 BP(NW`ptnmP_l},Ԭx"4<T -l`%b`PT |#0,%BL8ULB `d_ Tq}L HFlpHT u(E|p);P: 8S@xd({Ъ@TD0  8jpSL$$"p -%=XF4s`\r<.dAtT`e HX'N fLcP   T'  5  > bL DS b k d `| K Q b 0Hb  DU< p  ( d D | L s& b D2 ĂcE X PM @Z J n 4 , H L N p H h[ T m  # \( \6 X,E P W  g , u  ~ - 80 _   _ T-0 T4 F4 {b + @- (T< 0!E 4P tQDY Kd  r 4}b dp   d%b  pc  lP  t` t( + " zb0 h%b8 -XR |=g P r 8l0  t `<  ,  8d at 8VH D  d/|p?`JH\X` HqBpWTU ( a,_P%*dQ0x ~ ,$`3X p>J@C|PbV 4n$_{q)$tB@1 phnt_N t &(b+d=PPLeNwxc@0H,,4@x"'x4`)AU,'\axi@xcX0$dcd @0@~\ ܌'-1>(<F` Q\īf8y H Dd|H_KXLttE  %L6?PS@(gcs,d`}dc $`cc$ L8Q,|\l[\ b'|h* 5|4 0BIN.`w܁b$= L 8 \i@_0Ll%b l &Df/\$6(HZ,U^Dsc%84L0`V`О`"$$ PY b Gd`SHc`_mD>x8i8 <8g(4dt6Lxb,U L$ao@.`6?_E`[XR?[phq$w T`;cT  <T@@SDP,(c4RH,4Tԋdbp`x8 Hl <zb4WbdD= 2x ,D! ): 9@J 0Uc`f@v<R|`hc$X<|_TJLt `H  P$0`6< @;TT<xd4m9`x4`\@.0x$PZ\DeLX  d S {$$ 2 \G [ `d ~bn PR@v h  0H t l Ⱥc Xx 'p M| P !!=h!$'!8 6!`E!Tj$O! W!@w b!`p!_,!\4! ! !p$!!lc!tK|>s$>؍;>@|K>T>8 `]>hHr> >T><> 8> ,> @>l T>d>>8p?x ?_(? D2?XL>?x |O?7a?p?!?L?4c?L?4T??\ ?D?$\?? 0@@ @,@P t8@NK@whX@+Tc@Pp@,@H @4@hc @`@@8d@d|@(A$? A}@*A XEnbGEl$SEx`]E0vEEdE@E\*`EE EE{bE<@El XF,dXF<$!F4FCF pPF0ucF dpF yFPdFd:,Fh FTblF FFxFȺ$F,GX.G{@G4 )GD 5G07@GhOG 8]GdtG\ LGdGx$G6 GGx dGGZ8G4 ,G$GdwH/H()HT?HaRH TaH,tH& H$ hH\@H,`HLHK`HHcH$HKH,RcI<8Iؕ'IX b:I dDIP h'NI2 _IL0gIVzI`II_Ix I I`_IЪ I( dI I`GIJbP!J .JO9J|KJX$dJ mJԗzJ6TJJ0JJJJԲJ@JtJK KKxm<#Kh8KCK