ELFa( 4?4 (   77((?__S_DO! "&@00Q_: 0/?\@/ XX@0 6QQO @@( @0 <  B00 R Р -L0 _4f_main() returned$$f   ),@@(LQ 0/$t_$f - 0LP@p``VZ -LM`P@p@D0D 00``@ -LM`p@P 0 0 0 000  }P@XP 0oi@TZaX 0P -LM@P`p? 0X0 S 0N 0I 0D 0?i( -L M0 ||!\, 40 p@M ,*0ST1  , *W8E0E@(1 0S:P`劀0S0 0 0PV*U@ PU*00 ,*00" 4 \+x0;*\ \0@D P g "p00 s P 7 7 7 7 7 -4!L01 M, P@0 00eS4 Z0p , 0 Z 1!R,00 )  BP,00  @0S0 0@` V *H0)P$ 0lP, 0 04? 7 7 7 7 - L 0$ 0 $ -LM  0@ 0 0T p-LMH$,$HP0`@ 0p p-QLM0@`  `pQP* 0 P(U:p p-QLM0@`  `pQP* 0PXU:p p-QLM0@`  `pQP* 0P\U:p p-QLM0@`  `ëpQP* 0 P,U:p -QLM@R0 M4}5@}5 -(L  -(L  0-" _  P0L @ 00hS p-LM@ tP` 0j00PY YR` cUpp p-LMP@`V0 pdDp0H@ 0S' 000K  c 0H@ 0?' p-LM@` P?XP 0s UP(0S{p(00PS 0U 0 0 0P 0UPp -LM0pS 0S 00 47 0P%PK% [)0S ) %0K ! 0@&@K& [)0S ) &0K xUUTT Z   Z8,0X12hZ(1,@0X 0KP0 0000S 00  000 [000 0`P`PDH$ ,0K$H ,K+K*@K12h1, VU00000M 7 p-LM@`Pp -2LM PR|2   Jh0S`2`h0 0SL200l0S 2 2  B^h 4$` ,p@dP,` 000S2022/`VOھ21  p,@`0,K  `VOZ`@0S2`VZ00,0K,pK!0(@ *pK+KV 0< ?P202202" ,P2$00$0h0 `` 000P wT_ 7 ( 7j70 X}5ud p-LM4@PU @$ `00  $ 0!2c1,0  0!2c16`,pXP $ p-LM@P`@p p-LM$ P0S 0 $p4 `  0DPT0T $0 0$0 0$0 0P$00$0p -LM8@6@ 00S<"Z -0@S0L00ph 0PP00P=WP`U LW    (M JG 7j`}5E6}5}5 0-L@LP 0( 0( 0h' -0LM@p q00 ` `00 PZpd3 <# RH00Wڀ0?3S -1LMp@+p`0((0) %0K%[R%0K P )U d0 S pW0++'0K 'K$0 a0((0) &0K&[R &0KP ) -`0VLpP@ 0DPT dT0`0 0V D0PT -PL4p`V 4hz$0( 00?<9$ 0  $00 $00 DPT$0 0$0k5X6}5}5}5}5}5 -#LM08 ,0 p0 P 4 )3RR 0 A= 0 0   h3 ,0S \,Z0S 00g 0S@0 ŕ0őSS000@0000&2R& $ ` @0S6`V@DZX 0@00  00 `~0S6V`VZ6 `0S61`VZ0S0 00S000 @0 00   p pR00B"0P0 00    ,  R00 0B$`000 0 @0S   60S0 ` 00`(1 =P0 0  0 S   50S0`00`0 w=P0 VE00@p x0 f=Pk40Sh@@j0H 00OK <,+P000/Td}5 7 -08`P@L p0 T P0 0@e0 -08`P@L p0 T P0  0@e0 p-LM`P@2PUOp 0 @|P00 `0 0T2 <201$2}5~5E6~5(~58~5 p-LM@8P@`4  00 00S p  0S > S 00p000 do`p 0 00  (000C0 L~5|~5~5 -0`10#0LP8pJP@/ 00 0000  0 0, 0 004 P``0 0@ 0  @N0$ E0  \$ & & ~5 -LM0p ` P_Z0ST  0 PE0 @ @00$00$0 00/A#bJi + i* $ 0 P(0 0S  0 Ph ,000i? YMb7 -LM0` @2c1RP,p 00 P 00 0 (0000  dW 0 p-LM(0 @ 0P<0(0`0@000+  00    0  0 ^0 0Sph:000000 00 00 -LMh0 80 PD1< p4 4PKR0 P8_P&0KP<@40K&l P, /K3K2K1`K.K 0 !0 0 08 0< 0 0'0 ,0S ,Td~5 M-L0M H0< $$H@@ @T ##(#̠H  $Č$$LL@ "D8@KH@[P T5@K@, P[3@K <@P4K@@2e80KD 0@K @2K1K7K6`K 0l0` 0P4[, 0 0 0@ 0< 0' ,0 pS ,Td~5 p-LMP0K`Pc @X_ "0  0'p0@- @ 0S  4000$0 0$0$@@ 0-L@&P(@T` 0ud p-LM @00P  $0`0$0 @R 0$ 0 00  0 Hph\ud -LM4@0S @440S -L M$X @R0  l0@ $@ h55 - L  -LM ㇢@ 0S@0 @ud -LM@ R000 h 0-LP,0@T 0U @T{0ud -L MPP@`x 4K2 KP4[S:0:z  ,<y $T6P2"#K <K#KP2[t2\# P6K 00 Q0N@0"02 0 0*  1 1 1 1 % i  - .tN:l!0:0\厸0T!' 0ײ 0Ҳ*   0Ʋ 0 0庲* 0峲*ꀖTd!@5d5p5|5@6t5+   X @ E6 *7!_eNa!'(j) 0q 0xl* d 0`^ 0Z* 0S* 0L 0G* ; $0;5 0<5* 0T.* 0' 0b"*  0 0* 0 *  0 0"* 0*2 H2@ \`0ð*:\2\:0ð:d2Qh22 P0ð*:Š2 P:0ð:Ŵ2 o2*2@ Q2}>ø:2* 2R 2R* * < :0:3#Q: ; -*8 L#8 $ʐ R2 d X -*8 L#8 $ʐ R4 h X -LM:`0 5Rʖ R2 d 0X JR4 h 2Xxrʐ R2 d 0X :R0 ` (ʖ 0R4 h  X2Xo_  :R" D ( ʖR@4 h 0XH:$HT@ 0  `1ʖ R4 h :X41ʖ R2 d $1X<1S0ʖ R4 h 0X0ʖ R4 h 0X ʖR4 h 0X  ʖR4 h 0Xp -40Lʐ 0R (  -LLME0 P5p 0Rp5 Rx P` ^1 0P@ D@0@ P <C4SL S  0@0 0S 6S dx<@0 S#($0 P@ @<P3 R3Q a  _Vx0SDl0KP6[5[ P`~ 1w  Y00C b b2 R 6[* R^  R[ $[QH "0. Pp 0 @`"0S 5[  H20S S $2 RlK |P|> 0@  D P 8x  0 @>  D0 h$[Q>K  8K { *K w 0 0D P x0P@ 8 Rx간[>0Sڼ6[  lKQ0 <0 < P ~8 P<00 0lK t! !5ȁ5 585`55@-05;505 @0 @0  p-0LM`az <0@|5K pL0,0P@@T  phS7!Ԃ5 -LMA0P 00K  "[D10R8 = R 3[pCX#ymW$`ʕ   20K#0ʕ R8 p (K#[0 R3K#[101pW z0 008@ L@H0[]= 0   !| -JL@DtpP ʗ (0  @D&tTeaʗ 8R  #8X JR8  #8X 0ZR8  #8Xʗ 8#8 XA ʗR0 ` (0P@DtT8< 0| :R  (ʗ 0R4 h  X0X  8 [5$5 p-0L M PR`0 PEu @0@0 0S PEuU:0:"d3`01K02K01K80 K p,p:P!L5 0-0L PR :*$@ʕ<<*0TQʕ@*0T0hF0 -2L M @RP 2R 2R 200!P 80Plr: R8 p (0 hVu :R8 p (0 Pe`\0  R L8 p ܚ0? SG 1 R 1R |1R 1R P P 0 00 001R 81R0ASO (O 0O 8O PO PO @O HO PO PO PO PO PO PO XO  0P 0S0S` (PK?2K02K]< <0(PK U !*D !#(( -L8MP`? Q 3\ 3P [2P7  80Pp.؂ʖ R8 p 0X JR08 p X0\  R L8 p SP2 Hp0P0""K0 2K"K 2 R 10S SK[,PK1 R\1P 1P0S2K?,PK2K "Kl!@0p2PTKPK&'U?G  K5K 0 Pp@W 0"K0C "K SR S S R S S (S R R R 0S 0[,PK2KX0000000S>L0,PK0K2K !!(  #! 6S-L@p6 8S `,Pʔ0S8 #8X0ʔS8  #8X|Pt0ʔ R (0  PEguU<  ``5 p-LM@80PP`0 ( R8 p &p -LMPp60 P a 0? R6 l 8 ʕR6 l 0X JR6 l 0X 60mP@ :R6 l (P0 S :R6 l ( 0 S4xV -|1LMp00  @PHQJDaʔ R0 ` (0PEuU4 :R" D (  ʔR4 h 0X 60Po?PPl0ʔ R6 l 0XP?U< ( !|5 -LdM⌐Kd 108K0p8K05 -8BTP @ 00`W 0S P Tp`@00X 8K0 5<5 dv 0 ! p-LM 2@RP`0 Oʔ2RH +ʈ2R ? R `ph2 `T2R L2RD2@@w vx@0 7  3 1R 1R 1R111R 1Rv -11w /1RM !ʄ1R x1R p1Rh1>\1R T1RL1@@1 @ 01 (1$1R" 1R 1R10 0R 0R} R0`y Q0u 4p 0 D 0v 0     -%* C  5  -LLM]p@\ $` :h l  0` \0?P`(=T =T=T* =T G=T <T h\ vlQ p`P \ hP\1S $ 㩖/h \0h0 hP5 <  ;T> ;T 2 = S! =@S <  8C8::  < R h; 2KK"K(<0K : ; R ;2K03KK@ 3 505\ 0S ;  z;  \zqhjPk \p t \צ4P`5@[ \2:T ':T :T=hCPD \0h *hP+ h0 &\ 9. @RE\0S\(|9T2 $p9TP9 R0\:!  $)000?K2K 9"K 0K8TP \ hP@ < 尕\0h ()h Ph \ H8P* Y8PP  P  P H 0hP hP5 0 h0 y7P7 Q7 P! |7R 7R l7R l7R P7R\:  :  :{ :@w :s hp7l6P 6P 66P 07P87 RX$7 R 7  h#7 @T&0BhGPH6 RD 52@ 6 R5  5h 0h)0 0 \6  hP5vM@U   0% ?A1c バბ 0v 2c0H%%0 % 5Ta 5TY*5TR "4T 4T \  0孔4h 0h,5  hP\0h kx4T$ p4T 厔\h $h P5@ x4 R hI P\ hH$ t. \0X \ \ U3T 3T^ (3T3 R\:   G,h h03  hPch2 R \ 101Z2TV5 2 R# !2h 0h,2  hP=h0 S9 ! hl  \ l! \w !  >h*P+ !\0l l! Pl  Q10Slw@% w]P  @X`K@&@V @d1@5KEK A%K RKM  5 0 lw@ ᦂPl0  0T C0T- %fi2i 1i iii i i i i i i i i8-%C7lp gfff̃5i i iiiB5i i i i i i Ai86i(i| 8171 !D0T`ኝPh0 R  TL0h 0h,t0  R |0  hPdh0Sa >\0 d  h00iZV\0|SR:Vp h  pPf @|0 p0  p0@R0S@00  %05<0 S0 S0 7S 0 nS00t0B20S 02 BB0 C 02 R0x0p Px00x0\d | ` P\ 000hd0 |0 iZd0  |0R*V ] |㰒`Bh0 ]  30h20k \ $嘒\0h 8#h Ph0 Sh3 RM  R 3R 3  hh 3 ᳠ᴠh y $T h0+4R% 4R ᑜP hD hD T4RT4 RlDh ] 0h04h 峠0㴠0h0$0h0S00 *4h 0h4,  hPh0\0C A; 0-M0LM PcR  0 R :AKA A 8v ͷ0  00 |0|@x0 Kp ̠0KPT0K v R<0< Ca׾0ԃ5!7gfff -LQM: `! 0d 5@R7য়0 3K?3K#K<K ?;'K4K DK$K 074K04KLKK `7 0%K5K?5KTK 474'5K K%K\K  7 '6K dK&K &K 6&6K 06K&KlK 6&7K 'KK 0tK: @texvPK@&@@wmT6@`@K KK;KK 0@T 5 R- 0S R' UAoK@@@&@@Kv  .@`m 04xK3K0O \0K X 4K84 R 5 pp4( K-K00QK3 :F+=PCP 0nK0  P+`!0*  P:`! *nd5z @05%p3+%<ay<b0^((3( K$S0BSKR/K00"2(K UK >K 0 2"#00  2P 0S P W_KVoK l2 0d0`2(K!0p<2<"Q1 "W_K(KVoK01( KOKN/K00 0JPK&@@,1@K@ =KMKKw 0`10K8KKK 0010!8K 0(K8K 0K:|10/K7K'K 0|K:l !   : 755 "  *! -  -LGMA0Sp!, 000Y 1 Rx10 S<0K 8K 18"0C#K "K4K1p0C8#8#$0$#K@QBK* 5[90K 5Ki <L$0 B@ $[H4[Q04KD 0  0000 <  L@ B0j  DPp 0 P0 0C0 0 c0 R 0 R 5[C  0!`4L5 Qh`5@6h55v'N$ -LM:`P(0Bp S?d ( 8 0 8 8 8 8 8 @ 0H S$ꘉ     000NP@x*&P }l0l 㳀pT0 R    p-LM@!0! 1P` 1 R |1  , RU CRT1   R p81 00S 0 < < < < ċ Ћ 0 8 0 \ 0 h@p0 ^0 V0 t0 h0 \0  R  R40  R: 0 0 ! 0-MLM@P800000|1 R:  & 0`!00SSS @1/K 4!0K(1AKA APA>K0C R00000000 K 0 K, 0AKA APA.K B00C S񟗽ȍ ؍ 000000000 !D -ML M:BKI0 I| 000CSu  D e 0T p0S^XPpڴ8! #  1  P`C P`=04H8( K81BNK0!@@D(0K 1  P`# qP`8 0(K 0$!  0  P`   XP` 8L0  @ T ;P`@ ! p-LM:̀@ ( 0 P `  0004 0S`V@PpR 0 S~P ppp %f -<0(,0L0  !0 0   p-QLMPC  R:`:: :-::`000 0P@ V p-0S`+s է 00b=C4`#ht0  1> 0P@8p-0 $m: `p!8ԅ5 0-LM:@+P"0 00> Ph0ʔ R  ( P 0,0B=C1: 0000-0! R-L  0 0C SEh 0 0 0 0 0 0 0 0   0 0 0 8 0 00 0 0 0 0 00 0 0 00 00 x0 0d 0\ 00 P00@ 00 40!!!!!!!!!!!!!! 0-LM0@PSh   L \ \ \ \ X ` h p x \ < D \  \ d h1 \1! 00,1 @ 1111 @P !1@P0 @ @0 000 000 000 000 | 00t0d0`0 @ T 0@P@0@ @P!!!!!!!!!!!!!!! p-LMP\` 0@S0\0S p  d B 0000 0-P@0@@L 00000 0-LMP0!0 }0@ 0K@{0 K0 K@t00@i00@0 0S H0Td5 0-8{MLP @Zt0 R 0s? X0  @0p  R0Z0x0 20h鷴  5 -8Ll(PᝏL@6`p"$`0     밠 Dx5 -8Ll(PᝏL@6`p"`0     밠 I,5 -LM8{mp `;s/000bo@T j8#@0SP·U@0H:i@@T h@ 2b@TZ괇 H5`<7h5 -LM{] P@T # 1  00p , W00$ 0 !0*0!00 @@Z00W00S@ 1 @T 1  oɳ00 1+ 8`   1R010000 0 !0*0!00 0@@" `S 8` 101! R00:`4 h755 p-LM0@{] PR0000 0` !*!0S00@@@P2 phl0 CaF7gfff p-LMC0IDP{m@Dg `D20u? @$ R00000   R 0 0 0 @P㺆10C1p鵆 -LM0@P! 0BS .> 40p20h" @X40 ƇƗP2YI H  @"@2#,38"820#$3P0RPU0XP)  3@  0@  0T  0@ <3S1<3;P?  dT30CS.@  0@  "0T  0@  0T 0 @ ˠ@ D0  w@ D0<@K P@ Pk/Y000PU0ڑ b T FTdT5p5\ 0 L  l!5 -$LmP T  Q 0T00 0 pTd'5`7 -LM0 r@ P0吒< PLÜ04 P 8 0   "0T  0P  @0T  0P < 0  T<L40  T0DD  @T0  T  0P  0T 0P  0d T3@ Sw X+K,K @TFXZ80 0 0 040&  $@@  @00S@0  $  $0 0 0 0 <o09<@\48 ,0K+K}P Z48,0K`0048 @D,0K TT"@@}PZ0@,0K@D+K}X 8\ X40d렋5̋5 -LM8#h2@T2Pጒ,0 LPXÕp  00 0 , 0p` *Ϡ@0@nH$Hp@p@dH $h@ -LMRLcBXsP3  p -L M@, 0 Pp 0 `  "0T 0 ` 0T&40 T0  TJ40 T 0  0T 0 0 R,0 `o|`,04 -LMP`p 0P@   "0T 0P  @0T 0P 0  T)40 T0DD @T0 T 0P  0T 0P 0P   0d@S 0  q|0 0 0  $0@@T F 0 dZ> 0-T3LS@ 0P” 0T)” 0T PUZ” 0T p-8 ML@oh 0?P 0 Cp”"\ 0 5"ph]  4!d!  -L 0-@LP;x20|" 0 -LM@Oh? -2L $ 0-L2@P $”0PP 0T0-TÐ0\0 t4X4 0-LMT(P@^ 0+0t4X4 -T3LS |260T p- ML80h2"0 o@2"Pd d0嗍 0 p”"\ 0 "ph鸍  4!d! " -Lv 0-@LPx20|" 0f -L3PL $ -LLÐ00P T0 G4 -LM@ 0@4 Q-L@0 ?-#@l?Zc?!NP  ARNN`PO_P`` ??CS0cS@  p-LM@ 0PT 0T` $8  `$VpVp p-LM0 00 PU`00S PU@ 0@ - 0-8P<VTTlpr_ __ -LP@4Tp` T +0@`(R 8S h - LMƟ0 0 P)((, @4 v0qWr 8PPg p5% 0 l[   0 0S00 p0 00 h 45 , 0S 0Sp) `p$4P@ p  0Sp0 p0  $0SJ  $  $0  0 00 T0 S]0 00 T $0 0 9S0p00 p00p00S0   0T$80 T $8 80 T} l @0hK

HQ@Q jp 0p0 R, 0 0 H0S H00 lK H @TP0 @TT000 T0   0T0Hp0HTd7$5 N -LM@4p0  0p0, p-L M@$0pPt`x0p0t0880V @U 0@@p6@65 -PLM@D 0R@ 8pP堀`U UJ +<W0  p0 o0 0& ۻU*嬠`0 x p0 0RTp0x 00 h `P"U:@0aᘡ0400 T7/77 -L M`84PP㈠ $8 ,    $g  $@\  p $0  ,pu@;0  , 0-  , p0 0p0| R,0H, h0@"20S  $ 0  `0`S  0Th0!20, h0!,2P0 000 Tlp @0 0SA 0  $ 0@.0T:x t0 0Rt0x  $@l0TaӠ0T, 0 0 000 TD0 R d000 0pp0Ѻ/77.7 -LP `ĺ0plP $  $ @$ᨺ@ 0Txvd -LMP`pᕺ}N $0 @T /P80 T00 0 }N $0 @T P|@ mZ $0@@T { 0T 0Txvd N -LMP `p@4 0T[@0DD @T0 T 0T 0T @0T0 T $i p-L M0 K `0  PP pP@ T \0\@PU HPH0 0Q S00 4 0vdr_vd__ p-LMt`t0lP P0P@HH D0 0S0b$0@p(vdpvdtvdvd 7vd05 -LM⌠@p` 0PU 0 =@@0@ <040@, ,0`ptvd7dvdpvd7vd7 0 vdtvd0 0 vdtvd(0 R 0 Rvdpvd 0-@L >04 00P0 T0h/ -0删S@04p@@00  LT5 Qh  $  0P T  0T0  T 0Td$ R* R  0 T R RB  $ , 夾0^ 0 S0 00 0 T  $0@  T@0  T0@ 80T(ğ($00 S Q0Q4 r eT k< g 7Pl 8S080m50$04 40\XTLQ002000( Q 00 #0@ 00 x0 002  R g0 00  $0`  T  $Z0P  T  $`0 @ TP@ZTU0  00  T  $0 0R0  T!0  T  $P  0T  0T $ 0  $ P P0 00  0P000 ׽0 @0 0 l.d+pvdL5r_ __d\5 , l5555̌555 5<5xvdE6T5|vd'\5x5 -LM0`4PY 0S@00 T 0T 0T 0T 0T 0T0S0'0 Tpp0 T}N $0 -@T bd_p}N $0 @T Q0S\ pT  $0PPpT W꜍5 Q0- L@P Q 08S0@  0-8PS@L L4QKS0iPP*7 p-L Mh@V PK 0QP ,0"  000(^ `08 00pp80 -L MX`U(pK 0aQP@)㎶P(,0 0@00(PU 0HZyxH 080$00a g p-LMP@\`_ 80HphQ -LM4 < @ 4!P< , 80 4p8  0<0CR76, 0 90>0P`*@G S : R#: , Jc0 @`p`B0 Xp0C$ 0P8 R <0 ,4 0 P@ 0P0NPP`  0 0B@$B -LMxPW$`K 0PP@)˵p$ ,0#  0@0(0(?^ Hᶵ㵵H 0p8040 0ᤵ p-LMP@ᙵ`8 0Hph鎵 p-LMPYh• lp2  h2l ,` B\0 @`0 D?T8V 80\2p0ꌣ65@65ԍ5 -LMh`plp2 p h2l , K T81SM h–lp2 p h2l ,hRlp2@ p h–@0l \@Rh–lp2 p h2l ,@cT\\hBlp2 p h–l 1\UDźhBlp2 p h–l 1\5 -LMp 0@@T $0Z 0@@T &0Z>o ($8 0OPP t2 |,%[03P P 090P P 090PP 0@900D?0P! 0T90"$@0>T 0ڔ@2|"@Th—lp2  h2l ,h—Plp2  h2l4 ,h—lp2  h2lH ,0 h—lp2  h2lL , \4 ,P ~d-QhBlp2  h— ,0l\dQhBlp2  h—l 0\@ ;h—lp2  h2l ,@ Ttʹ P@1@M>THEB Oh—lp2  t2 hB,0 0l \h—lp2  hB$0l \h—lp2  hB$0l( \hRlp2  h—l 4\hBlp2  h2l ,PhB, _Plp2 P h—0l \hBlp2  h2l8 , I$I00<#N>C 0ChR0l , Ȅlp2   h—4 l 0\2hbA$lp2  h—Ql0@ \hBlp2  h—0 :lH \hBlp2  h—P 8l\PhBlp2  h—lH 00\hBlp2  h—l40L \00#O@ `Oh—lp2 ` h2lH ,@ T P 1PT!0040TXPX0L8 ᥘh—lp2 ` hB3l1 \hBlp2  h—l ,0\p@TJQ@TPEZP785@%I$7 !*7!0 ^MM -LM HTe | H0S 8$T| Qk@ 8H SH0$(  0-LMhR@ lp2  h”l 0\0 -LMPpPUU U mFteh—0P00lp2 P h2l ,PHT hBlp2 P h—0l \2O00C0h—Plp2 P h2l ,h—Tlp2 P h2l4 , X4$h—0`00lp2 ` t2hB x—,0 0l \h—lp2 ` hB$0l \h—lp2 ` $hB0l( \T8SP(R hB`lp2 ` h—@0 l\NhBlp2 `倀 h—0l \hBlp2 ` h2l8 ,XHl"00N>C 0ChR0l lp2, ` H h—0l4 \hBlp2 ` X(!h—l36@ \hBlp2 ` h2lH ,hBlp2 ` h—l:H \hBlp2 ` h—P 8l\NhBlp2 ` h—0H l\2 N 0P(0C0X(T(h—lp2` h2l ,Ah—lp2 ` T(hB$00l \+=%I$P 40 R(0 R0 RT_= -PLMP |"RpW 0``00VhB lp2  h•a0l \3` T2X"0 T2X"RIC-@T2V0CT2hB lp2  h•l 0\303 E(ap1H@`T4hB lp2  h•l 0\ |gB`\80\8IGP`\( 0\8h lp2  h2 l,|"`hh lp2   h2l ,`X |"pSL57h555 0- LMQP hB@lp2 h•l @0\0#hB@ # lp2  h•l 0-@Lد(PM0hͯ -QpL@P`08S 0 R`,8S  0$ $Rp0S`@` TP$p@p$Ď5 -LMT2p0T2㍯0H0,08,8冯T $PU 0SSoX@Y 4P$U  R00R\ Y "0ST20CT200 3 `4 @0 0b@0 L @0 倠0 `#> 00Z 3Z 0L01`D+0S R000R0 A60S!0\@P R 00c0C20000#2w`kD$0S` 4 00hB lp2  h—0l \Z0 00ή`GDȮJ@`$0S  -LM`@(0 S4p8PP 0$01l00<@ ,0 00 00C 00$@202LP0080004 -LMlhBP p2`   h2lP ,V5 <0 @ ȕ10C S1 !@ T 0 0 mCTph• lp2  h2 l,?> 0D <@0 Tp -LM`0Vp0P K0 QhBlp2 h2 l,3 `VZ00hC70S  -LMh@ lp2  h2 l,3 h -L$MP%% 0 0 < pD8`2P, @ ,P@ $4D@08 8 <2 00 $0880, T4  ,K4 <0V,0P @, k4040<0<@   C140<0,  0 0 4 0 22$p<P!,\H10L`0,0,0, ,0 , 02,0, $ph08 08hBlp2`  h˜0l \0S 0 R IP@U` X0 P0 ,! ,(0=\"!7Mb0 0  Q-L 0S S 0SQ 0 0 啱5-0#1? $ˀR 4    R 0 0 0 !1?0 P 0SP-(0,#1? &̀R, 6 0 0, R000000 !1?0 P (0S,P0@-@D 0 hPR 0@0x p0t0@;"! 0-L@㡬P0h陬 -L Mp0,"`P0U@, > ,00P Ro PH Y4[ P0 ; 80 0$,S03( 00 0*   0S0000Y $!$!$!$!0!<00  GP H@A00S  X 000oz000*, 0r00  o* ?P 80(S"ˠ ʠ0S80 S0000 `777x707H7 -LM04p@P`H0 0004i= -LM@P0pl14 RO80 TXH1 R<Uǫ`Pӑ090 H㷫0 ` =0 ⨈ᨫ㧫L0$ `R 090Ao闫0 #>XS @ $0S Z00 カ`P⎑ %f505 p-QLM@`PpST 00 @DRT0  0 @DRTʃ0p -LM@BAP 0h -8L9R 8R8 RR 88R" 8R 8R 8RU 8U!0IPPS񟗳*!0+!)!)!)!)!)!l+!)!)!)!)!)!)!)!+!+! ,!\,!,!hB lp2  h—l 0\0ISh— lp2  h2l , ~hB lp2  h—l 0hB lp2  h—l P 0h0  0 R(  0-P L$0S0$000n@=0hg0 (( -LM@V>P 0h 0-0L L0@P R aP(0 R0=U 0-0L@P080h4 000 -LM@>P 0h -LM@!0Pp0Sl0 40< 3@0(K8``(P060( 060(202(  ( $L`( V0 $P( 0S00( 8090hBlp2 h—0l \0S 0 R ṧp0 R{P@Ὅ< ᄍ40 ,0 ,!ဍ =\"!7Mb 0-0L@P80h% -LM@}=P 0h -LMpP0 04Z0 08@, 塃`V # 0X6$0!<0@, , 00C  " 0`$PL@F008`090> ($0S0$0P -04@pLP<`@( 0R D1P 0S S 0S 0 0 Q 0/- 0b1|# BQ|#84mO -LMR, `4C PP0@ p|W@*Q*001|#Q: Pp11^P:æ1" 0 0 带Q *001|# Q|#:,0@p<@vd5 0-LP<@T0T0 -LM, 4 04 0<00 0,2P, <0s|",00<0<0@ 40D0 ,0@ ,D 8@^L@@0 zPP'z<0 << 00 < @0 S0>08 0 Sq`0V@ C00BK 0( <25(  `40@ ^000P@@0 <D0*Q@8p0!@ 0EP`$ @ 0A,(0"A 0 P `4@  D 00p(04 0,08`090o0  oǫ50 0P  -LMP@0ߥ0pSS 004`090LP40S ͥBɥpB;0( 90 i齥 P40S 귥i醫꜏5 - 0p`L<0@@p㧥P4{ᠥ 0-0L@P80h -`V`V` pP0UL`p` W^h @0~0S APP U 9h^7vdvdď5̏5 -LM@~0 00L h2(7 -LM (0("t0'Q0@K0 0Q0KU 00KR0@K j 8P@0KR0(p0tP@`%#7"00Kvdvd - 8h LM8#0!P @0 A0T S  -0S  vdvd -L M @ 6@Y`"8B! -L M@ 0@I`"8B! -LMD0P#((0"tL1'ATM \0SJ<`(?P 04000@`;00㦤@i韤0S  BP*0SSS <`00$0P$0S i482T3 ,2T 00S0 e]@ 0e/]01T 1T0S 0j0S e/0S00L1T/ @1T00 0"  10S0S  0  !P0T 0%4400 0 0S0S0S S mt mY0S 0 0ymdvdr @sd edArdAr hdk~gd8B! -LM`@ePp<(00p04S80,0d080 4pL00 L, 07><4wtOŒ&(0("4400$ 0 0 i-55WEV8B! 0-D0P @L 0ŝP 0000P0|K7 -LM0s@S* 00 0000 - qL`PU  04P6PU $00<0$0@X0 P:00 !@004;0000 `\ @1@!0 H P@00d@0 H k,75 p-LMPK@` KL10C T#J0QZ0V0T00S p -0LMSK"*K 0SB$: L -T LM@HT00  (0R t4707ād 5 0047 -Lp`P7@T@ h[ R(( `@ pp00 $54587 -l`L@PTp P 0S `@T$h20T0 h87L5 p-T0LM@PT` P 0S @Tpp87 -LM@h 0-pPL0S`0@T P@T00020#J<787 0-XPL0S H0@T P@T000 .<787 p-LMP60@`TL  (`0#p髧p45 -LM@ h- -LMx@0Slh鑧d叧@T BLP0 @@ 0 ,|@T87X5l550J65T#E6 -LM@$h 0-rL@P@ 0hP P0 ,  0PQ 0Q|K70|K7 -L P00@-SP@  0P PR  0S0P 0P 0 -LM@Q Y 0Sꘐ5 -LM$0p@$0 Z P`y Pq P ^ $0S $oT` PK PW PS  @T 8 P 0@ \  0K0  D1D! <1 R41(1 ! P!  @KKP00  00``  P 00 0ZKPPKdx Otp 0,0 `K Td55dЁd́d@7ȁdād55̐5ؐ5 fQT# fQT#R[T# fQ<T# fQܮT# fQ!T# fQT#0 R 75xe65 ኢT#Q0 ^ %fT#T#0 77 -0LP4M 0X 0T@K@_t0 Rh@J P`00TLL00 R 0X  Ёd؁d́dȁdԁd7E68577 P-L ڥE01 6؁d -LhMTa0lK 0 3P@<B lp# P, ThK01@ TX0T 0 P0L 0 H0D 0 hK@ <K0@ 垥 0S hKP@dPK P  T@P P8僥, PTd@56P5\5p55 - Lu -LuI -I Lu -Lu H -LuH -Lu X -`LQ 0R 0 PS00U@ h% p P 000T@"0@S 0U ea0 -LM2JT# -LM@, p    `GP4` 0S !1(S! 0#!!0 V000 8` <` <P0SI <000G0S`30  4 8<0(0 Q8 <0 ZY  !Y *040S R:  0 p ,0 d姤 <000FP0 `P 0 11` R0040  ꈒ555̒555 55(5T5 - ` 3p11#XLP@0XS (PFP 3X0011 5 -LpPPP T*0 S@T:t P p@-PP\`@ *0S \:T p0Q:0cS*S @V V 0#2 0S "" T @ 0#2 0#2 @ p-RLM@`P uP000U00p -L MP_P T*`0 S ` 000CS8]!x]!]!]!+00 <0 @ @T:`*0&0/0_ 0-L@\Px $t@ 0h_7 -L4M8#0Z,0 PL LJ0P0 L p@ TP`A HKP I0D1S3_!,_!,_!,_!,_!,_!,_!,_!,_!,_!,_!,_!,_!,_!,_!,_!,_!,_!,_!,_!,_!,_!,_!,_!_!$_!_!_!,_!,_!,_!`! `!,_!,_!`!,_!,_!$`!,_!,_!@`!`!,_!`!,_!,_!`!,_!`!pP@TZZ!0, PR ,廆OFP+ k 0@^S||P _ `Ppp  L  E 0 R 5 R 0BP ^S %   l  0D R <Ȣ80PCTd́dh5t5T6555555T#5ȁd 0-L(MdQ0\0 T1P10 a0CS$b!4b!\b!xb!4b!4b!4b!4b!4b!4b!4b!4b!4b!4b!b!4b!4b!b!4b!4b!b!4b!4b!b!4b!b!  兢 0S 0 0A^Sw s 4K0 @@TPL4K0@Td7T#E65T65ē5ȓ5 6̓5Г5 -LM @ Bh]ET#5R- R 0S0 \R000Sa@\ 0-LM|P* uP@KP~0@vP KqP00 cP \0 0  0%0 K]PhNP TPP+DPP 8<%DPP (DP ԓ5555d5|5Ժ6 -L@PT`p@Dt @ PP TP@Dt0Pȁd́d -LM@ P2 P0( P) P0" P0 P0 P P P  P p`f P 40,P ꄒdȁd́dād5Ёdd5 -LM@P P hPP  iP 00c0^5 -LMp KP0@ PS@6$`KzP. T $0   $PU! T T @ 0 s0@ PS@ P f 00    $P P55 p-L M`KPpF0@S@ PKPT T K 0 K 0C0 30@S@)005 p-L M`KPp0@S@ PKPh `RT002320 0@S@00 5,5 0-@QLPJ@TZ0 0-@QLPJ@TZ0 Q-LPp`@00eT : 0c00e00000eT:p00e0ꀑdd p-LM<@<`04Pc0c000p逑ddd 0@-L~Sm!|m!xs!m!n!`n!xs!t!xs!n!n!xs!n!p!xs!Dq!xs!|r!xs!r! s!xs!(s!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!xs!t!F&0S 00C0|V|f 0R 0 0CS0@6D&0Q3*V 0@R*0 0 0S0@:E5 Q* 005%0S*cUE 0Rtet# Qle deR00 PuP0 0 S0pP0  0 0 0dؤ^% 0S  0弄Rt00Q^ 0S 0^h4 0S00$T(d0 S D0 R 00Q300 S0QB ăs0 G0Qp3#0Qpcp dcd00 R 0 H P0 R 3 0c-Rs0b0CS5005@G200 050 ̂%@G"S 00CS0050005 0S RK0 dR 0 0DbR <p00 R 0  P0 R0a 0R С p A1Q`1 bp!hA0 0R:0RR0B B  0S 0S Qa 0R0R S  0R0R S0 Q 0@^S}P0Q0Q0A Q 0 00V 0c0c0 0QWuꀑddd777܁d7ہdD5|d -P@L@PpP`P0P @D@PPP P  000c鈑dd|dd -8@LMxP00  0@ ddd0 00 ddd8 04S00 0 0S4057dd0707 -$ L0S 00 7 -L 00077 -L!0@]S@t T !0@]S@00D SA Da0DSR\T_T3\TS( @SA @a0@SR@0@\T 3@Ut@t Tl_P Q:P00\P0S0p P@$V0?Sbx! y! y! y! y! y! y! y! y! y! y! y! y! y! y! y! y! y! y! y! y! y! y! y! y! y! y! y! y! y! y! y! y! y!x!x!x!x!x! y! y!x!x!x!x!x!x!x!y! y! y! y! y! y! y! y! y! y! y! y! y! y!@y!Hy!    .P@ -Ϝ:<P@  >P@0T,1pP, a00/TU# 9T0pD UA DA Da0DSR `TWpD@T7pD0s" @00DR Sa0D_TS7ToPOPP tPTP P xPXPP@(0P鐑dddH5\5h57dx5 -LM||`P0Ulp@J0T UPe PUP0U00 P777 0-@PLP u 0Sb cP  P h 00C0\@P b 0SU00h:0 qPPꬔ575 0-H1L0@S4!0CQF!0D]S& T T T T 00h1 00000P@00 0 0 0n p@x0 0 S 0CRL000  (00  y77777707 0 0 lQ 𠱨77E6 -LMS@ \00S SL L0L L0P 0^0?l 0ϛ 07ܔ555555 p-LMP@PLU` ph遛8`~0 ,$0|@uPp_ 505#@65 -L4M4q44A0 T, 3*LKH`KPKTKP K 0L   < Lx T @Q 0P \ L0\ 'P\ 0p0T:`0H<0 ,0S D,~ f( R_TdQ_L5 7T5E6#fX5h5 -PL`%HpP@ 00CS 0} @TR@0Sq Sf SZ 0S 0S 00 4 S 1!0S 2!8S  1Q- 2!8S( 1 RT T U h1Q 2\!8S UP!000@1@囚,1@@DT$@DⓚTB 博 00CS0 00CS0ڸ0 Rw(s00  0 00Sv h00S 0So P00S 0Sh Hpfꘒddddl5<6E6d577 -LMp0@SSHP S 0S iX 0  Pi/ dT`0 Q00 28 6S Q R000ꘒdd 0S00lꘒdP0pQr  8 80, ,0 0ᐒdddԁddddD0<08 pQ(0 0ᘒdddԁddd-L0H D0pQ, ,0 0䘒dddԁdddd 80cR   (0 0 0ᘒddԁddd p-LMHP@  D T h0\ `` T` T0V D0\ P00p >P 077 0-@@L08PS0S0000077 - 0L@TT xP\ lp`bXd0 4P 0S<00h9p h24f77d555 0-\L@P 2S P(0P2 0075 p-LM`P`@2S@T<ph+;PT0"2 000p7Е5 -LM@ K;40S0:00A0 R0   _ p-LM`@P:P  0S  p:P   -LM@ P0K  0 -0 SLP` :S0 `0SZ @ p2bS@TP t0`0`p0@2S @T:0T0 P0$:P7d5 -LMP`@V 0FS \oEP o@:p0S  S:P55 -L M0PS` :S0 `0SY @0P , 0`K p R2S@TP  xW0`p0@2S @T:0T0 P0( 0:P7$5!5 -0LM pR K >TP@`2S@PT P Wp 77 -0L Mt`, p0 @–R\ ,0K@T00 ,0 S1051P5ꤒd7 -PLPM`\p 0K@  0SV 000餒d -L1L`MD0 PP(0 `pl KpKt KpP 1l R*t0S@hK 0@@ (0S (zl RW xK| K0P x| P@hK0@@ 7Td 7 685D5h5 0-LM(P@ 0@?0餒d-00 Cꤒd -L\ 騒d - 0L0S 騒d -L\   騒d -L\ꨒd -LM$@T騒d -L\ 騒d -0L0Sꨒd -LAP MK!P 0Q)0SH0@080 R0 R`x3Pxstqlnd X0};LcHH0 @]#fd55ЁdT_xe55E6T#@6P5ddh5 p-LM`P _pP@0T:tPt@0T*du8P 0 @T:@p0h8P 0 @T:h5l7$7R_Q_d -LM@KP -LM KPK -0 SL 0  -L \   00 -L M6PhKP . P(@K3P &P,h55|5R0 0 0  -T LM@HT 00  (0R x7t7d5 0 0x7 P-PL` @T p P 0S @TP@ 0P0`0 000 $ma0Sꠗ5|7p75$5 -p`L@PTp P 0S0W: ` @Th< 00h|7L5 0-LMl@0S`0h*X(PU @P@D ,, @ PU0|7ė5ؗ550J65 -LM@h 0-LMPKfP@@ h0 0-pPL0S`00S @.0 . 0V @T0-X000p7|70 p7 -0LM@`TPp bP 0.S 0U:R0>0>0Up1 @TW 0@|7p7 -lL4M 0hR,0 0PP0 ` LRH bR` (`LKHKp 0S! @P   0 pf0L  p\L PP0S h0h fP <,0 S D,w8_`lRTd5T#5 5ȁd́d(585 p-L MQP@D00CS ܛ!!!!!!!0 cp-p0 R 0cp`0K0,0 cPU 0S0pD0 R< 0(`$p7777\d.7.77 -40LM @R 5 T_ 00Cs0 -@L`0 SpP 00L S0 @0V0 0S0 S@P 0 a0CSa0RS-P@哓a@0a S_R@ zTh釓44L5P5 -L4M0 sS, `@HKTK   a0@S0a SR0S 0S0S\ + a AL00lL0 V L0SZ00V00S 0S + a0BS aB0SVQ000 Qj1 'V@xq ˻0PS`LK0 PBTU@P !0001 ,0S ,v$pX T KT@ IT0cP T K0T0 >0X P U0:S000 S 0a0CS0000S _0a0B`F|00C ZSQTdddT57h50! -LMtpP ` PXu  0S %D@ @0  dd__ -LMP@0`p 0PS$ K~P $P0 %D@@@0 Œ000dd__ -L0L0P 800P 0$0Œ07d__ -P0LPl<00P  Ġ 0 2 07d__ 0-LM^P@ Plx0P 40`0Œ000,@0S XOP000bt7d__,0,P 0S07d -d0LPlP0P  404 02(,7d__ -$0L0Sd 0-HPL0@S P0 T 0 d 0-`0L @R LP0@0C000PS T0000d7 -@0LM\0 @T d -1LM1\@pP P  }DP`` 0!㣑 P?@0H0  0lKD h0 l` @P P@0\0 K@P@@\80S @wV D 0 SR@ @DP @\ 0K0 K@0 | x t pP 0\0K(P0@\0 D\ td %ft5 -LMO, ,0V !0V!hV4!d! -LMs@W41R3p U8`40< ?㳀Ϡ@4/00 000E 1>PPZ( Y01 S0 !$1|0 01t0 5@}S\屐<GS U? ? ꄿ!X!!!"5 -LD3S -0L#R"0 0H3S 0-L@㣊PJ0h隊 -LMRr@` @0 ..0"0T@ 0X@ "$0@T  3S 0-PL ,3 0@0h85 - $ML0b8,0 0㐢53 /003 @  0@ ..0"0 T  0@ 3   0""H0T" 0T" 0T #0 " 0T0" T2SB0" T0" T1.0" T" 0T@" 0T @ 0 ..0"A0 T @ 0 P@"0 PTU@4pK P@"0 PTU@ڐ!0@000" T.~  0@ 0"0 T  0@ 1   PP"0 T0" T3S  0@ 0"0 T% @ %5;5H0 ,0S P,r" 0TJTd5 -LM5=@S 2/0Q 4AT 0S8141000”PP"0`T2"$$0 0”"0Tp#00”"$@ 06 -8..P@0B``L"0T•"0T2"$ ?00S S•0"T2"$ 0•@0"TB"0T•"0T -LP0 T2 $2@ @$@T# T p• 0_Th h0ROd`@ 0@TOThzOT T$p0@#pp4!d!7# -LAMK_K0,0 b0IK qWp#嬄<  R p!ڎ ,e `/p Pl0` ` <善 ,0S 8,l \Td @40P000  p:#04 0qcp=<0 8p @? ?C4``@0 @0 P``p8@0S<0 0S x埂_0x0xgl@0D 菂 `P`P4 d\d77d0d\d0d \SO  Kr_ -L4M$|`0` D 4 @ 8` <` L` P` u P@ Pڴ5 Xf4040 (P@D PR 40{P@l0; p0S,0 0, pH /0K;P@%00HP P0S S 0PpcW,00PL0S L0 DD QPDp @0P<\ D R40 <V 9 .01 9Zn-Z`@LP P04 8@m0 S:![00b0![000![00b00S <m$_0  R*0 S`%* e -LM@ BZ -LM@ 6N0 @$0@ $ -L M@`d80p0CS?XP0XPPP p | 0 D040"mPm 0R 0 ?PXpH<lX@004;00lPlq67 5 - Lr$50@$00CS8""""""!" "",""8""8""0 X1S  0%00 ; < 0p@-P`Q@1!2n1[/73n1Q1Q0[/ Q@& 22a11U3a11U0S@0S` C0Q@ 0 0@C!0"b12cp0 QH4 -L4MPK@p0 Ӛ!!0CXa00/A!b2c2c!babSD[0^ l0 4 Pp ^PU \e*!l!P2@0P8 Y 400 00U \F*80!l!1@Ye0P 400 0 0 , 0 0 0>.0 N^@PT \*l81 @e00  0000  \*!l!0@0P8Y 4 00,00S0c,00, a08 c@$>"?"D@" p-L$M@P0`   K 0`XP0Sp -LsM, `Dܡ  ! 1 儀 |` KpPPȁ ́ @80S P10Z4 ,0S |,S0 0PPT0$ 0 0PP`@K 40PPgP  KPPC[B "D 0@uPP#[@P2S@ Tw С 0J0C p Dq@!TpAkK1$0 jK! . . R l>K! \33 5 Ƞ lP!>Kn kK1.0Q@ pb 00Cpp!@Dq1T#[@T; 20CS0."h/"h/"h/"h/"h/"ȑY; 01 bpnKoK  m?KP H\5!:0\*  b 0 0b$10#[1 @T%00 X "ܡ $ olP PXlpG0!>0kK1 ̑  c. . j?K!#[ ̑ ,Td@5 -L,M 0 D 0 ) K3S`@  ^P1D RBB!p  0@pP@01 1PP"0PS@ U3 414  h3@ 0 @/P HP) [R0 0S2 @ TD 00KP00T00ST)0[402PU52 0C4 < 8 @S%`2"2"2"2"4"D4"8K 40K0>01! 1s8 40 !1 4!Q80%000 0a00b 155 1%D R h!*@@@ )K@\0 S*dgD   D0P@( ) K zP `7P5X7 e -LLM@Q@D1U d0 ` 8d0K00pW !MhPp@ `K p!;h0`0 0<X0 \ 0P0 T 0H0 L :D0 @ 080 04p < 00 0$p (p ,0 7p e0S -L MBpBP ,0  ` 0@ P@"@2V*0S @T:@W !! 0 PP: c p  0P@0 S 0R , VP -LM (14 < @@ Pp 0St  P 0 @S@R*0 S  R:R*08 S S0  Q Q 0S4 `! S S `0S S SQ 00 Q Q Q Q Q 8 00S0 0!D0;D0  @  <00  @D 0R0 T0S .,K` P@{(1, 0(100,0, $,0, (00(0,,00C,0,(04 0   (1?0(1 @?  `4 80S 0 @?8 `? (10[+`I00 0P0<@4"(10(1 <@f(1! 0(1,D0 001@  D0 100 !(10(1 00(1 04fY ` P ?0S ?200 01$ `Fl,DkX547 e\5 p-LM@P0c0? Ad`A ቔ 0P?`p p-LMPU`% *@0 PR@ U: @0\0 ?00@p -LM0PUp*` @0 0000 P00X0#02SP` -LM PR@0:#:S(0:#:S#j&jV 㢓Pp $@ Ȍ qΌP00 ``fP@0  -LMp. .\@0  `P`$@ @fP@0`P 0  00(P 0R  $ . . l -LM@. .\ 0P p`@@ ȌqΌ$ Df p-1!LM1!0@ 00>0>0^`P 1.*!n!00`G/ 0B!0b0!P PPP0^*!n!00` 10G?  B0 P0PPpD@" -5襟LDM0J P0?j\Y>1ҟ5!`]M p  pp0tddş0P0S P0 0 40 < R0< @0 @ 0S00 0$0Dp0H  !0 ',0  !44 15 | ϒxl ?Jd ;JXXP `0@y'0 PN-$4 (0.6 00;N0`V000#3@p@A Q@Q0@0P K3PK@cFPFPp00 07``P@`*1HH@@@Pp0ß43$ > 0 ,0P  -L M`0  P@D   0S<0S90 V5*Y/ ,0(p0,0T0V, K PP ,0( 0C,0 U pc`,>,0V0  0P00` c 7L5 -L,M@ @PpL OP`s ,00,0 RJX"Y"Y"Z"K/K KT1 l < dQ 0P 8P XQ HP Ppb:LH0P @ D0PP R   R?' 0@SD0? H00H0 D"`Vp H0#K`P2 Pd7 42 uPp?K` 0"R? 4")P42p@ ?WpWKVH0*0Q$8PL" 0p` QP9P'}K?l 0  !0 0 ! Q0@ H0 D"0`T2 V 7  42 Pp?K`0"R T" T" 4"фP42p@P2Pd DX0 @R T"0<  P"0100b0P 0S42 p !P0 u]h0$P 0d0K>0#60`00\ 0. "&0 P0>0#60X  T00Pp~42OKcT2( 2 K P2<$Po = 9Pi & |1S0# 42 #42  0> Pp pzp @!0!!0 0)0 !!0 w QZ 0  !0 0 !2 0  !0 0 !0  0 000 v%P'JtPL"p 0Cz C<,0S KPD< H2 K( <P800 1?l 1S H R < S <H0 7  @0S@0[70@0S0  !0 0 !K < l?  0  !0 0 ! O@60 0000 0 0  0\Oj OPL 0 !0 ',0  ! L@2  0 202 0`  20082 0S/KK 82 4VPpH;% KxPpD 0Q @ Pp#H@"D00D082帀8"0082@"82$ 8(00(08",00C,08(0,`Vź.< 8n@y\!.}0Q8P ,OL"p 0!P'kI;O< 8H0Q 0Q0Q0!!0 0'0 !!0!!0 0 0 !!L-x-b00C 0d7T_ e)7J47 -LMp$K4 ,@P  `@^ PT4(  01 B10R,0 P@( ,K IQ'00K@8,噂P4( 0,0 B0RP,0 ( 4K  /P@"`V@J,K $Q'00K@,tP0 ,0`V0P,0 Z  @P  -LM40H0^Ã0WPŃ. B&, !0,  00 v@P@+ t!t0 0cC61 Up ,0Ų0 0 e R0 e Q @000F*10T00S u 0F@Ppp P P pp P p p P  P P p p PppPPppPppd(*75H5d*7ddh5 - @0 0cC61 `BL!bQjF`p T 0 S0``00`mXF 0&l@ ꨹ddd*7h0@-0`S\PX0 Q?#/0 IS0B!@R !R %50*7*7 *70t_ -LMp|`00 Kl !@6$ K@?LPP @ 4$@0@i@0|K7*7_*7ddd -L0à PP PP @P@ P P   P   P  P P   P  PPP -0L鐟5 -LM0@ ;Ph? -<0LM   @)0Sh, %f -LM0@ CPhp -LM @ Ph`0S00 00 -0L88!M11p *`@0 PP0S {#@ @ 0@ 8PK0R<0 " 0!"< P7"Y @0 #"P y"44 %f p-LM@P`@V0D  Ppph1# -LM00 3`0 P0Q&Q< , 40 0 iD00@00000_D0D`404x0, 80 Sl 08 a R` 00X 0@ D 0D$;D H 0S8<0 @  0 0 <$ p @ h2Ll p@000P<3Gp4Ȕ6 55"!545P5Ql55 -LM0 Sn0Lr0 R 0R  R RmPPx 2nP@h _aPU T 50LPS 18 T *F0nS& aS @0*T00S1@T<1$l FwSt0S! P((04!5U8`P000t R 0S΄ 0 fF 0^FwP 0d 0JF|GFxEFtCFpm@Fȣ5pd %fУ5tdأ5@65ԟ5555 5D5T5t5|555555555585d5080L800400 0-LQ@P 80Q P 441 R 0004 0-LQ@P 80Q xP 441  Q 0 0P 8000040000007000 000 0-0L0\0P   0@\!:GqP@0 p-LM418@ Q ` ,PU  p86800p p-LMP`U6P1 80P. P@ Pp441  Q p00  0 R U8P 80U phP 41  Q p4@p -L0P` Q@p ppT  p`X  pWV  -LMP0u@] 0UZ u 0U 0 U 0U BPHv 0V 0 V 0V 1P7w 0W 0 W 0W  P&u U =:Pv 0V :`w 0Wp0  !0 0 !v 0 Vw 0W -L0P`Q  @p 7ppT  /p`X  (pWV  -LMP0u@N 0UK u 0U 0 U 0U P9v 0V 0 V 0V P(w 0W 0 W 0W Pu Pv `wp0  !0 0 !v 0 Vw 0W 0-LMP0|@  0\   K0~P U00 0 U 0-LMP0|@  0\   K0~P U00 0 U p-LM0@P`0S 2 T 0T 0T P$0T P T @@0@  !0 0 !p R0Sp p-LM0P@` 0S 0U 0U P 0P  !0 0 !p p-LM0`P@0S + T 0T 0T P0T P @@0@  !0 0 !p R0Sp p-LM0P@` 0S 0U 0U OP x0P  !0 0 !p -0Lp`@/PPUU!nP P0!!0 0,0 !! 0 R*0SR:0 00S 000 JP -LM[<P@7k008d 00CS0=8d 0-0LSP P @dt000 0-L@P PUt000 0R0 41 n 0-LP@P0 04 7p?P00  0"R   0-L0QP)@3 Q 0P P0@ )T 0D000Q^0 000P 0 0S P 0T@P4 P ( 0DT@PP"pd -LM0SP`p7 S P@ T  >Z@S0S0 000@T 0 0S @TW pP4 @T   D@Tp8Ppd p-LM0P0@^ `V 0 0^ V0 p\0T@ T@@ TP 0$0 @;@&;0" p-LM0(@KP `}lP0  p0 -QLMpPI0 @ R  0R`0S  0RnP-` Qڐ0V 0GSH,","4"4"4"@"T"X10S0S0P 0R W   Q0 PQ0ba>0>0$ 0B0ab0P\0HL0 /<00A0@0 @0*78*77 7\ 0 Pl -L$M@ , 0 40 :0 @@0K:@K@0 0 @0@0 ,@4 00R000 001@K\1  0OH PKL 0S@#-Q QPn`3% . p0@R/ "M2 0S @##mSPU`!q p0奎 @K3'  {,@  |4X 8< @K@KP à ]C@TPa`~ pà &W@K( R4@@K S@Bȵd7 0-LP| 0\ @ IH 0hk0 0H@0@- @P0P=9@ =C 0 0P=9@ =C0 0 S  0 \00Z0?B p-L Mp`@PT 0X Li9@ Fh0 0 pP800_d5l.7 00CS0:d 0-P@LH@ L@0t" -LM8@L ,0,P000 0>_5"5 -0L@ p90P50#9`@0S n0S nn0S 90P50#y9L R <Q@0@0@0AL R0S %f|d -LP M@(Kb$   c(0=ɂ0aRC ͌(0 $ ( $  $0 (0=B`0`R L `L0LS<0L08,00 $ 0 0, |d|d@-> "Q@@00 00 0S0 >0|d|d 0-@L0S 0LQ0508 ? 80X0P@P R0000 0 R0 50|d %f|d 0-PL@ 80S  000@0000h8\0^  00lS R00@@*7D*7 p-LMP @8T0`SX 0 R0Z<00@4<0 R00T00T0pho8X R44 44^ Q4 ^<000 <0@40P<0< 0bS -LM@ F8T T00CQ000 0 S0  0S00h.8@*7D*7 0-PL @&8T0X0CQT00X0 0 S0  0S004 <00CQ 0h8,0 P 0SPD*7 0-L@PP XP 40S P0<0S -LpP` (@ T $0 `*0" -LM@ $0S :S0$0$ Rh60( $0S0$0$1<55 -LM@0 < L 0P0$00k4"7 -LM$0S@ 0$0$0 S 0$0,0 hL0$0hh70@-P@Q: P8 SO 00 5 ^.""""""""""""""""""""""""""""""""0 Q \ 0 Q \ 000 0Q Q \ \ 0 Q \ 04!4 0S -L M88 0@, (O 0@5@d#l.7l5d 0-LP g6(O/@n0810d(0(0( 81081 0-(0L8!PR @(@0( 810CS810(07d -L M@PD^`(P T T,pKX* !, 0 $ (0 1 $ 1$00$0 1$00$0  1$0@0$0 T  0000 0gPP \gP 0 $00$0 $0 0$0  -0P` AL r(@Q601 0!000X8<0F 0110010@ 1 100 1011001011001Q t1! Q0  !  !X10110 1m6101 R100, 0  !0 0 !80S 0 0S 0  !0 0 !0  !0 0  !0 H*7D- 1B#20R00S1 11RH*7 -@L(`P# pP @101 ! \1010!! 0  !! !1S0 10  !0 0 !PQPH*7 p-LM1@0P ^50`S S `T5p0!8< !S08<1 1000 -LM(@!1!0108<1 J0'P t5 0-LM(@P1 10 1Q#P0 K eP0 1101  !00 S 101 !01  ! 01 K 0 ! 1 0 VfP 0-LM(@P1 10 1Q"P0 PK eP0 1101  !0 S1%Fτ"0#1%( 3(F fP -@0QL`p% RPP @ 02PTr 0 R0 b0h -LMPS`p$ (1@T 80S@TX0 Ġ T\0P V R4@T 80SD@T0  0P V 500CSPpd P-Lp`P$ $` ~P @T U 00 V  V 00V U U U D@THP@ U 00 V V 00V U U Uhi -PLM@7 P h p-PLM`P @T U00 00  D@Tp@ -L M0A P`p(@10(,q$ai%0! <  < !@ !101! 1V01 0!10101H*7 -L M00p P4 rCp C00  0G4 a0 1`1000 10 4 0  \#0S00Ň 41 RG  0  ! 3 ! 0  !  !.!0 %0  !@0!! 0 !!00S 3, 50SN HS ,24 RLo0   (200Q00S#&100Q00S 0!! 0 !!R/p .02S200Ň0!! 0 !!S1  0   W Z& 0!!0 0%0 !!0 0R40  0Q t0S0500!! 0 !!Yt0S ~ {Z~ 50S{lH*7"pd -LM0`!30#P03\ Ip0@à@0!! 0 !!!0` 0` !> S> (0!1S S  t80`0  !   !80S  41 RR?Z8Z 2 2RZ %Z0`  P 0@!à 0!! 0 !! 1 1 H*7|5 0-50L`0 , !0 0, !@@$!0 "0  !  VhX0 @P10pS 1000 0@@01@dd 0-0L@T P00@T00!!0 0"0 !!L 00 L pd -|1LMP @0r`(@0 !    !1$!,0 0R00 ,1(40 0140 00 ,0S5 ;11011  !1 1V 01 0!101011 0<  < $ Q001$1(1,140000,0 0 o %fH*7 0-0LP@ , !0 0, !DD 0001 0h(0$QPPJH*7 -p#LMM0 ,0 00 @`$D 006:D R @0S ,0 S ,PPK~" 0p"p6!P 0` 00 K0- 0P 0 @ hPP 0MK<1   0:PP<80S P <呹0 <!@U,\8 016 (1S ᑘFK 0 <h!<0"00.^<7k |KP ~(P $1pKh0 (!`P d 06\0 <&X  Ơ0T PP< 0l]PP8 8[<P p`@۳PPPL 0 9 8 0S5 0S$1 @Td@6H5T5J*7`5 - LzN -LM@P`pD^T0EP@ST#\#\#\#T#\#T#T#\#\#\#\#\#\#\#\#\#\#\#\#\#\#p $ 1 014 10  %f4 1S0 1 Q0 0 0S00 0S 00 0 P -QLMp`0S @PU 0 0C W0SUP!P P 0 e00 0@epe0 S=aP D0  0S ` /`r %f 0-LM0PS- 0SC)@ 0R0 0S S 0 B0 0@0@ 00 K` v`P 00 P0-LP@T*@T:P 0S* !0S:0D00s3눤5 -L@`p PP0 Vp P  00 00S0@ R0000 0 9 p-LMP @T @Tpp@T ` R0000 0 V@T 0- L@P\P( 0 S600*7 $0R0000 0 *7 -PL a.Up ``@T @ThO.(`@T @T*7 -LDM0`SP\` p 0B S|!XK_P@MX00C Sj#<#D#L#d#T#\#d#l#t#T0尡 S PH\ "P@.X t1\ H  a R2: 0C%P@'\`0 \KA0TK 0 @Q XT  Q  F_@ )% \K ^P@d`\XT-HDP@v#+7e,%$<(#Щ.!% -LGM⼨\, P`p @# 0B9S9 ## ####################### ##### ##### ## #### ###### # # # # # ## # ## #,0 S ,0BFS񟗙L!#d!#l!#!#!#!#!#!#!#X"#"#"#"#&###&######### ##@######&#&############### $# $# $# $#l$#$#$#%#0%#H%#X%#t%#|%#%#%#%#%#&#&#&#D&#L&#h&#p&#x&#&#&#&#&#&#&#&#&#'#4'#P'#l'#t'#L6 8646  6Ɵ 0Ɵş 7䕟0 0K ~PPW 0S0\80Sro0|i`ş0 L@P00W00SP 5 E0MK 4 G41P0FFB =944 /ğ0 L@P00W00SP H4 0u 0p4cğqğoğm 4 ̠ße 0[ 0V0 S<0U KOK8 ]PP3Q p3R  04L 0@%8CZ,3S 1 01Q2 2 (2 z"0L 0Z"""`2^ P2R  0ZL 0/4BNK 08 zPPz8!0BSR pnL 0@e!!!1 Ϡ&-WL 0QL 0wJL 0,C  0>( 04PP_L 0$+L 0m $L 0F !Td5{5{5e{5De7 7\dldXdxda  dXdtd{5D27H27470d*7ea0̵d %f ede-707)7)7.7tde@ee$7p37 -LMP \Q`@ 0LS(#(#(#)#)#4)#T)#h)#)#)#)#*#H*#*#*#*#*#*#*#+#p2 -T2P"0 820"06"0 0b6 :XP@10S1MP@1!l0  |!A 0@`10S (KP@ (0- 0S 0 _P@0dSd00S@W00S0000h0@FP0 P<0< @ 0@cFP0T_%f70t_e+7@6d+7|ddd+7d`dpdhdld 0-LMPR@@ K P0 0R 000, p-LMP@`  0STRPPP  [0T0\00S p [p p -PLM0 @ 0 SR0 \K  0 ~[@0@-RM@P 0-P\ \Ѝ0Ѝ0@ p-LMP@`  0STRPPP  J[0T0\00S p Zp p M-PL0@ 0 SR0 \  0 [@ -LMP  -LMP -LPp` @U  0S*T S 0Z030#WQ$U T 0S: Z0W0P00S MZ0 00@SC Z00@C -L@`pPT 0 S:U T  Z p-LMP@`P  0S:T\P P Z 0T0R00Sp Y p p 0-PL@P 0 S:R 0\  WZP -LMP@p`& V00P ?ZP P`FU@ WVX X`F 0ZPX@PU0h00h 0  !/ xdtd -L$MR, 4 00 8 p04pS,H0 D Q ^0S`@0  Pc4 2< @T 50S Uf5#3#5#(5#D5#h5#|5#$4#80S$ @T< R < <2 ,0S D  0cR0  080S 4 R D00 O=0H0S @0 WSD0 0D0 4Z 1/#4 YP@   Bpj@ W*D /D 8M .YP8/YPG00 41 R41 0S80 00 41 0Sl00 00 Q~Q Q0SSPS ``@ 8 S0pdtd p-LMP41`  0 @P 0l_5 0BRS^@KA AAAV > 0K0 1 z_08 K10^, 84001! 0nO 0rϊO 0vO 0~oO Ί 0O  $0冏O !(0O ,0O 00O 40O 80O <0O @0O D0O HP00 L0T!P=9@ =C, 0 ,0 ,00  "$20 $ 41 !01@0 !<1@5  00 0 1.`0` X0Qt0V/@> 00"3J6?B1!2 -QLTMQ0DSP Y 500CS00   V$0 00 S 80K`0 \ H D T P0K =p`KX @P < $ XKP`T   40 T T4,0p p0 8 0px x t 1p  0APd l 0xSv*dKt VP`sxP K0@@ h0K `0 `0KH \ X0 T D <  $XKKP`[h0SS  PK:#:Zc0 `KX `p \P T HP D @ <0 $XK0P`@P@*0S @T:0l00S0*d ]VP`* d0 T h0d 0h0   `KVP` pd0A0 d0 p x0t0Qx0 t lR:0l S: `$1@0dKt d0 "V`,0  TT070- -LM@P|0S R `V `VPkPd2"@`@  @Il2  C`pV@E 08"S0 g,"`*@"0P  p<%$ (  0 08 $ @ ,0H 4 P <0X D `0L &%`TVW00`C00  T 0`V p 0 P@@$$ ( 00 08$0@ ,0H40P <0XD0`0L $`TpV +7dd+7+7d@65 -LMU -LMQQ`0p.Q ,  PU @  @R[$0 ,0(4 0 80 40<8@0<@P  ~PUT Y0@0 < ![TP 0TPP p-L M\@` Q 0 .ppQ0 \"\ 0 1PU P P 80K00,0 0080pp 0ppT7<7@-QMX@ ^@ L|\0( Ѝ@ Ѝ %f !0Q0d p-LMP^@ 0(`K^  "0@""pJc@0T0P00SpT_xed -LM0@KPp'sU  "#8j`U@   0V0T00S@# -Pl`L@ @ p">p00␀`t`00 @@ %fd 0- 0RQLP@Q t0 < c"0  !0 0 !0  5 @00@0 %f!Q0x$ %f -p LM00K0xB0  !!0 0+0  !!# %f 0-0Q@LP) 0  !0 0 ! R 00 10 P t0S0 50 0QtP0 %f 0-0 SL@P P  R 00 10 fP  ( @0000 %f 0-@L !t0PS 50S 0  !0 0 !0h!d t0S20 ?Q 00000 t d -LMp `! 2?@TV t0PS  UV@on!U000t0 0`F 5 R0S 050嘐60 D dpd$f -La  0_ -LM 040,0 @ p0 c`0E"0 $@ R:0S*000, R 40R-7 -LMp(K K P`5 (42@ ʚ; -LMp(K K P`5 (42@ @B 0-LPL0@ R:0S*000 0000_ -LMp(K K P`5 (42@ ʚ; -LMp(K K P`5 (42@ @B@-TpHP` 40 ^5 420@ 40^ʚ;-7@-TpHP` 40 ^5 420@ 40^@B-70-, 4,00Q0 40Q0-70-, 4$00Q0 40Q0-7 p-LM `0@Q 1QQ0 U 0 0@ RP0R 0S  0R@p00 0$%%7-7-7055 0 0-7 -L,M@KL L`0Op0K! (L04K @00S@,04 S00S0B40  0@80 aS :<0S*000K0Q@PP40`0#0 RX46QL@@P 0<`@H DP v$ K@Bʚ;_ d_85 -LMP84 40 80 4PD MD@D2p 0g^ Dp @@@ ` 0@ pp% "0 0S:0S*0004pK0 K0@, R:00S*40040 0  $04 @cT@T P@DD RTD4 $ 0pKQ_`5 42(0400K,0^`4542!000^O0$  BE!;!ᣎqpW!᧮ᇑY ! Q P)o `!nQPU`  D 8@D@@p @$08@ O8@04 40  @Bʚ;-7-7_-7-7 -L,M, LK@P`p   0P@ ,0 S , P h0@T  PP @T 0@Td-7d5-7 -L4Mp@0T,0 P ؀` @ `T C@0TP0 LpK 0   `$ k @`T 0 P@$0 ,0S ,-7Td@6Ĥ50J6Ф5$$ 00S000__ -X0LML0}/P@/88@A3b000 7Mb_-7@-QM@ 00CS d]#]#]#]#p 0 Ѝ@-@Ѝ 0H Ѝ@ 0 Ѝ@ 0 Ѝ@[__@-0 MR0000 0 `Rc =9 A = /02|@0 $ 0@Ѝ @0R 0r000 =9C =CS0 d-7xP0- 4 0$000Q  00$000-7 -L M@ p0pR K\0 R 0HRb A#f 0R~x5\d5 0-LM0@S S 0PK N0SPK60"c11PK 0 0-LM@CPKP  0NP0SP 0-LM0PSX@ S0 D0  S0QK 0 00oNPʚ;7 p-L,M `KP MP@ p H1(@K 0@a(0 $ PE0S?bP0]0 p@0@#T@S8K'4 ,08c00Pc0 A00 , 0 ,0  ,0 c00Pcd0 A@ 0@ < <0 @0@KS0@0 <0  NP@0KpMb_ԥ5ʚ; 0-LM0PK S@ 0@S  0M MP7 -LM@PP P0S0S Kl00(K"c1 1( $0 P K =MPK 7MP7 p-L M0@SP0SpAP @K MPP `KP MP 0-@LQP(0S0S =9C =CS x0S0 =9 =S B P( LP QMPd?B -LM0PS@9 0`S ,@KŒ 1M4pK8,@K$ R Q 4R $  0 `cQ$  =9 B =$ 0 00Q -L M0PSp`@T 4K xLP6\DT@ ,@KP4`KP 0S#P<K,0S(0S D( 80, <0P=9@ =C, ( , (0 | L @ B0$K $0 XP?B -LMP`^0S@$pK0  0=BR L0 00$ S ,K ( 0,cP=9l A =( (0 , , |00@Q   0R?BL0Q R 40RQ R 00R0 ?B70S0 0R070- R \b =9 = L 0 0 aS 00S 00S0S 0 000 aQ 0=)0C -0 p-LM@ KP  0 `0nRC(0 ( =$ (0 $ S` ^P 0K ` p $0S -LM@(KP`e$00`( S a,0 =90 = B0 ,0 U QP 00S K0000UQ000000!0 Q00dd00  0-PL@ 0  0|0  0 c0cR 0 0 PP$0h00 PP-7dd -LM@<00 0 00000h-7 0-L  01 0P Q Q0!01 P01   N`1`"0 0R  0!01 P 0 0 0@420&0K 0R  0!01 P0 0 0@8 <1 0R  0!01 P01   @a@T@0-7dddd -LMqB0SA ܁a 0 00cSZSO S1"001 000 0bS9 Sl1"001 0000cS$ S<1"00! 0 00cS  S1"00! 0SoS0&0"< Ѓ!S0&!<0 Ѓ!S0&р 0!< 0Ѓ1S`0&\ 0!< 0Ѓ10 P00$0@d-7ddd -LM@PT 0倐0c/a"|,K0K 㺆 ކ0H0\0  b,G$0h@Tdd55 0-L0LDY@W<84PK@TP0hd5 5-7dd -LMP@T0@ < 000M0 0-7ds#-7*7@5  D00D00h; %f!5 -LMq$PK`$ PY 0 b0aS$ 0=9 B =$ 0 $00!Q=9A =C 00 P/0S0S @0S0S 000sV050 000J] 0R 0R 0@ 0S$%f?Be -LM50@S꤀#### ####0500S0 S > <0S 000l00  R? R  B0 , !  !5 %fpd$fT h00 0S0#4 P,0 <0S0 "! %fpd$f 0-PL h0@0$S$0#h001S 0 Շ Ň0h!-000 00 00@-7ddd -LM0@S`p>0S,0S00S7  0PS0U 0S PPp0Si0h A0T<0S <643vp0-75055D5H5 -QLMp0 4 ( ,  0  Q0$ ` V P0S 0 S 0B8S$P0S`V0 R ,Q $0S PP0,`@08JC8 1!Q4K 08SVd-7t55 Q-Lp 0  Q0`V @0S 0 S 0B8S$@0S`VP08JC8 1 !Q 08SZ00d -LM|P04 H0( 0 `00 ,0 $0 JPp0CHAA0塻P4K 08S, 7l7 -@Pp L4`V 0 h$W  0G.7 p-LM @`PU 0 ph.p頧5 -PLMp 0 QP @@\P` Q0S00F 0@@00 PW5  Z  0P @0S S $@0SPc b 0R0 S0 0R,0 S00d5ḑ5 -LM0p@/P`N PPG 0 S0 (0 @00= 0P!P2$p@ \T00Sʃ0S0 Pp T p0 !R0,0(!@0T| 2S00S \0 !R Qا55$5,5L5T5\55 -LM @`P0pS[ 0S-RP WdA0S S2 $@0S R 0,10  0P ) 0Q " U1S RR 00000S Q0 0Q B 0 R00$P  l7d55 0- 0L 0PS-(@ 0 0(0P (@ 0- 0L 0PS-(@ 00(0P (@ 0-$0@SPL @ P4  0@ P0 0h'45d5 -xpL@`T 0P$ R U@U00000 d 000|d0  B Q$|d p-LM`` @0P R $0S0  P pP0 d p-p0LM PR` $0@S T pV V -P W;d -QLM@0Q 0AT (00@T,00,0,00CS,0@-$ R$ $@@0^"*$0S $@ @0S:$0S$$$X@@0^:\ 0RX X0R$P$0S$ X@@ @0R:^:\ 0RX X0R$P82P *0P ":p-(0 S<3(057<@@0 0<080Sp ( 0 P0Z;@@0 0< P `0;P(@0  ;0'ĩ5 -LM 7, R0  '0 0PU < 4( <"4')Q 0`<4<("4&<S4` x'48<#8S8p 2\ *0R :P,(4@<` P08PDp,Ll T \| ⴠ< < 嶠4D 尤 lh`KH@ o< @|r00 @00S, r  0S 0S  Zq r 0t@T 00 j00S0000,0S0?0,080S00, 8Pʐ0E/S  7<x' @0P` 0  0 QnZPڌ0Q00S Rmڀ0|@000\00S lH 0 P P  <@8S ^2"0"P# t0S t@0S0Ol@( t2< 00lp l/hP \lH ;@P@`$2> G?Q P' @0 0 p0XW}\{ P 0K 00   000S? ,S S    S @ 0 0 T000 0@ 0MS S x@K 0\x  K00 8S  0CSS S0 0& 0 0tP00$ 5@5U`5x5 -L$M80PS,  (0S KKT re 1R0S PZJ ᠴ,@@(208 40 R00 Dڸ`帀0p 0@Q6R40 4@ 8@ 0H0 0@@K H0@K@@ 0H@ 0@RQ 0S0@ R 0  0Z (,e/ De/DWEV -L,M, <,4 D ?08p ;"4 WLp 0 Pob , X8 0S ? < _008p@0 @K( #<0 0@$@p8 " P'! `VU@<0, @@K0@# "`P PU ` 4,p0@ V ,4<0(8L 00 @@0`pF80X,L %0,p0@, 004 ;0000`Y됪5 -LM`D 88#0| 40 , 0 a@̡ 00!1  0,0  X@<  R TUş d <  B?+$0O@ 0 W5 U44 20 @8 P0 0,0  8 0P,@P0 0 p` B@0@ X < (0R 0 #4#565Ԫ555550  0 ddd -LM@3  00 0 -LM 0@  e0SP0 L00@ @0 00$0@  ddd 5 -LM@l LR 0@00  0 $0 BR  `dddT5 0-P@L $0X0S$0 0h  -LM@ P $00Cs$0D 0KX,00 0aXS40  `=98 = B8 40 `408 0`Q=9A =C`` 000K Z U@H(0` p@0ʏ  y 80K*+80P@ 8?Bp5s -LgM 0,0 1 Ġ "88 #$$    $LdHA  0*pP;00-K0PP*0*KK "0 @@ & .K 2 S0 S 0h,0 S p,GS`000 0H0 040}_Td %f__edA!5l^*53+Ы55$5 - L P 0 00  _X## #@5O, R  00SSAπ " 0 R$0|$0\| -LMP@ PtLLqH0@T 0S$ @Tca`5t5 .7dE6 -QLM`P6 0 SaBQ00`R00SppPEqP@ 0@T 0S  @T龱P00SrP 02$04 40 .7 .7d5 -LM0 ,0  PtܔW00 `KW 0S   P&}D@ } ` P  0W0T00ST0 S*R PK0 EP p0S W 3P#  P| @||ҰP 0W0T00S 0Sw[ ((0"4400$04 ă\ #3C 0S x ,0S ,R2  a 0gb!((0"4q!$#@9 0" S!$ "^P@uP( ,B0U00p  "88 #$0a0""3p  "88 #$0a0"""AS   0KPM 0S \@DPK 0|Pp ,  ax@a 5PP 0 2$40 $`0ā T@L0 PFLdTd .7_55 .7L58K6l555@6L5___\55ث#555E6T6 p-` LM0`S@ P- 2P @1Sp1p`_@ 0S 0 S1S`_-  0_d|5 -LM`@pPP  5 pP0D 000 0  0@<.7_ R0 00  0 _ -LM`Pp ^H QDP?1@ T 0S2 @T0NS 4#T### 0 -T <090 PiT 0 T 0S 0\_d@@ R4 000 S00 __ -L M8@4^ 0 P00_d5 -(0LM@T @T_ -L MV, 0 XP. ,PG+5@0U 0(p$`,` 0 S0 0PE U `, 0 0 X0000  0000 0  #  pP@ 0-@LTP  @T000@RT R000   00h -SL`P@p0 0+ 00S00C 0pQ  0S W 00CQ 00@@hW 0R 0000 0Q 0 R  B 0S00@@P -LM Q @Pp`B: 0VP)  R 0S 0S * R 0  0000 0P  # 5 -L4M@`p`P, @jP@ ` P 00C0@ @P T4 : P< Q$  @0@0  c  Ba  @0BSH05 :P @ B Q0 : QHS0#03 LR0S4 L0d0f s  )<R0#03^0S< 8@ 0P L<0 0QP8@0P  000 0P' ,#,0 p0@4 L , 5 -L @`PBpF PI \*PB R?T+ 0T! T U *0DQ 00 pp000H0D 0W ` U*00 U R000 OPp  B Ȭ55 -0L@`p# PPp0U W OP  P @R000 >WP$@4T005d p-LM P@* 00  00 R 0  @000ph`h[0 p0 0S0 0  @` Dphd -PL M@ L 0@ @T  @T _545\5p5 Q0-L@0PA 0R $2x0 0 PR0 R P P0000 0S0SS RRea0ee-0x0 R0  0^0\\00 0RP00ea0 R00e0 ee -D1L P@p^ 0R`) T000\ 0 AQ 0 `\ @1@!T P` 0Q 0Q`0S@0T``` P` 0R  #ee5 - L@PA@`p 00( Sp ee 0-1LsDP@   0,0, 800<000@ e@.7e -LM@ H 0S00  Q0 0 0S00he<0 A P 0-0@ LRPD00u 0h00I000 j0eee p-0LMQ@. 0Q 0Q p0 p` r0 $PBlU0 PP0Q x0Q \ 0 0 000S$  00000}ff@wt@ee~fvt 0-0LS@P00 > 0R03:00S 00 0 0P000 0 0 p-LM0PS`  0R:0S00p@00@0@-$M@ 0P000^03:0S#\ 0^ *00  0S   @00 00 00 0000$Ѝ0\ 0^ : 00  0S   P0@-0 M @00 Q \ 00  0S  0000 00 0000 Ѝ \ 00  0S@0 p-LM0@S0`0C0@ H0P0bH0 R000 l  V 0S00PP`<0 0C <0 phl0t!e -LM p@WpP\`s V`UP@7080 $Pl 0 d0P  <04h(`XpHL000T0 RO 0$/">CXl05%03l05 5P% PB2P5t% ~7`,y7`70@0`~7P0`p0x |PPPPPPPP$0S P 0@`  0 P 40 0墨@:l.7eeP.755 p -LM@Q  $Q R0 00  0 P.7 -l0L 0e p-LM@`fPnU 0 SU000p0S KPS -LM`L P0Ru PUp+P@  PUT  M000T  h d0 h  pQ000@T^ R0000 0 H L0 B0H L0 R00C0 R000  R 0PP0 00 S  R000  R 0P0P0fH 00R:5"0S h  d0h  0S0&P d=65 0-0LS@P  0000 0-L MX0l @  0Pt0tS XP_ 0 0S0PPP 00C0L0 0CH L0h0Q H 0h0 R0000\08 0S0 R000  R 0000 @00C\ 0 R000  R000 4K/t0 S:dԭ5 -L`@ @P@@D55PP@OP@  vpWT  04U004PE804 R0"80%T C -LM0(,S00pP 0@`p`@l0) |x 0Q0||Z0@ 0j@@H00AqH0 0A0 q@@$0@ 0 S<0 p0S<00tY -H 00LR@p:PP  `VU  0H0 0Q0:U p0S 00 0 Q0-P0L @@@444MH 00R:0hS Q0-PL @@@4480 p-LMPL`Q`3:Qq 0P`` @@@448p0  0-LMP00 @T <40\ K@H0@00lS:TP @ R000 Pl0 @T06e 0-@LTP  @T05 -LM0PS`p pS0pS,l@$ (0d@X0P@H L0W" 0S0S|0S` P@05L5X5555505D5\5p5 -L* 0S $pTdȔ65 -p-LM P 0@``,0 \0 p`e -<1`@P,1Pp  U00SL 10S@Pp00U00S&$10V00S VV 0 RW 0V0Q00Sh+dT0|(PW  0U00xe7e.7 --L0LM0  4!0 \  %f --LM 0w --00LM Q0f7 --LMH 0V(0@ R b.7xe 0-LM@HP 0P;(0@ R 0G.7xe --0 L M@T@ K ( T0   -L M@@T ( 0 K T0   -LdMϟt  Y  0R p h P l , 0 h p H X H0 %PP p H0W0H0 X0 0  X0 u pX00Y00S 2 H0 0%SSRS HT \  pH d ` H L H L  0BZS5#h$h$#h$h$h$h$h$h$#0#h$#D#h$##########h$h$h$h$h$h$h$h$h$h$,#h$h$h$h$h$h$h$h$h$h$h#h$h$h$h$h$#h$h$#h$h$h$h$h$h$h$h$h$#p#8#h$h$h$#8#h$h$#h$#t###h$#h$#h$h$\$h$$T0  0` 0 0 x0 0S S S  h`d `0V`S`T`T \ @fT@Dp PX0W0  X0 p X00Y00SP } T@D`Q X  X p X00Y00S` e \r dh @bT@Dp 0PX0W00  X0 ` p X00Y00SP F T@DhAqh  p P0W P0 X0 0X0 > pX00Y00S & h  Brh T0 \ @fT@Dp PX0W0  X0  p X00Y00SP  T@Dʭ9X ,0S ,\@fT@Dp 0PX0W00  X0  p X00Y00SP  T@Dml`  gcT ` X0p 0W@0X0  p X00Y00S  XTX p X00Y00SL009L  :8D@Kd(0`xD0[Sx  p X0W0  @X0 pX00Y00S v 0S  x0@| Tx0  @ T@D 70@0` |X Qp <, W@X Q p X00Y00S F x !0B^SX00T  X0 4 pX00Y00S + x0 x0 !0B^S| x@Tx |Q X  >X p X00Y00S    x !0B^Sx0 x0 !0B^SwD@K%RD@K%OT0 00 T T @ 0 P` 0  P``QH0 H0 HT0 0T0 00S H\0 ܥ0c\0 HT0 0H+ ` H 0*SH L0  L@00A S HL 100 A RH L 0@C0Tppr0@ 0Tpp bH0T T \@H L10H 0 L0@C RL \@ ST  T T0 n 0` Vc WTdp ̣T d00\0-KSP  R1 :R D3P0 h l% >P &B`PbP P(K 0a0Ch0 1!P0`P0c P0 T 00SP000aP V0 P 0bP 0 t`PV PP000lP  U- Pu`` T0 00 T T @ 0 Po0  PozT  T T0  0` 0`0 oT0 00 T T @ 0 P`0  P`TT T   0`00  T0  T  T@ 0 P`0 0 P`\l T   0`00 T000S T Tdȱ5б55ر55555T0  T  T@ 0 P`0 0 P`0DK P 00 h ` D KHT0 @0H lR H  T00T T T0  0X /00 T T@ 0 X0 0T  0 X0 00X  0 T1P` l0 x0 T L0 0H 00P0 P1QW P  P P0cPh hp ` ?P嘝h \l NL R D0KD KP0 h ` -t0Y00SH0T ̌Hd -L6 -@LMT6 -LM @pT0T0 P  @ 0` 0  00妓0p@- `0Q c: 1P#(80S$H*   0!!0 0)0 !!0 ppd -LM00P20#0R0Sp ` 0Qc : <"K#80S $H:@@%0S 2[02K%P {E-Ƞ@0Sp0 p `P@ 0@s  0R0 s$0@S$P10 R$0 @$0@S 00C0l7.7.77.7 p-LMh`@qP T0T Q 0QUqU@@0p 'h0@P.7.7x55,0, 0$ Q 0÷.7.7.7e -LM0(h h`l\@\ 0 0S<:a80 j"Y000ꨝ6e.7.7e000 Q 00.7.7e.7 0 S-L< 800( S $S hȔ6.765 -t0@LMA \0S$$$$$,h$h{l7 6Ȕ6555 -LMA0@Q!ڀ!0Qx @ ^d!00^G@HTHiSP  0 P  ,00,0 -LlMpW`Ak Wg P 0 00 4 HP Dp , P9P8 08 8 0PSD^BQ80H K P0 8 ^ pP+ #P) Z" 080nP0 @0 Po` 0 R 8,0( 0C,0 ,] 58W㌠ PK -LMp#@0,0 垈PP 0 `43V ,3V &8yy W9,0W0,000 嬐KV&?0W00S 002Vd E2V/  0 @T&?0W00S,0( 0C,0 R ġ2 ,0S ,|,  @0S$ @<00 0 0@0c01V 1V00 S00000 K 00L0 S00@0@0 0S 0R0cҰ0 DP@ 41 $@< 0 @0 0D0 >rWn   P@i  㥠 T 000 00 wTdf f |f{f@L5wt@}f~fvt -L\M0`Y!0rYt A P r2  @P 0H D@ XP T0 P L PP PP\ ` 0x0 C0p  !0 @0 !tLX  0P@Mt 0SI0S# hPKh`0\w >`@KpKl 0pcPl=9 A =p p l p l0 2R]ڠ"002c2c3x0 500P@ dŸ0S +0  !0 @0 !$"Fx0@T 0  !0 @0 !t@#T@TQQ QL@ KPuP ZP@T TP@X N@ax \ d0S`K P@`KP@hKB\ d0` h0P=9@ =C` \ ` \0 =D P@2 H P@( L P@ @K<0K8 KH0 D 40K0 KX0 T ,0K@ KP0 L eQ7X5e?B -L$M, ,@ p8 0 4 < H H 040ZD 6D2ab0S0CP8c% U#wP@,  ,<0,0 R,  1@ 1 @ 1,0( 0C,0  Z<0H0S<0 H 0@  4E 0-08PLS@ SP0sP t 0R0000e 0-@LP, 0*]0PP0# t 0@R 00@0h0  !0 @0 !50S E0(0  ee -LpMW,0 P`*0 S0!҅P@  ,00,0 ,0( 0C,,0 0Sp`VP:,0pUp 00 -LLM0@d d0p S 0!HKp h W! Rl d0pl oPP *p0 R0:z 3 PKBa2a11J"c11L0 P yPrXKL T0PX0"PP L =9@ =CP L0 0`  !0 @0 ! h0pdh 0SGz" XPKXP0\o =PK`K\ 0`cPl=9 A =` ` \ ` \0 1RUڴ!002c2c 00P@ |!0S 0  !0 @0 !W0SD00CSD0@0 (0+Q @0$Q0S WpW Q @@  81Pt ͎@0@0U@(0@0<@0e Ųp@ < @0l <@0g<@04!0BPt@ m(0#p@@ 80PRt ㄎ@00@0 0Pp@0} p~@0@0@0@0<@0"<@0, 0P@ eh5p50Q$ 0Q |0Q 8000T0Q L0Q0800S@0@000@0}ff@ s@~fs -LM$@pA`|0 Q>x  0,0CS0 p||[7d -LM`lP\0 p@"  0@D  D \@0訠 $☀ ";p05 + R @J 0SU 0S = )U}P ^U~P\U; A0ES P  @ P P  PUpU p 0UZm0 "0p" NU Wg x nU WX 0xU U U|Uu 05 0=  (0r05i UZ   ^;8p09` (0S.@ 20U0S 6    y0PD 0@$  $ ee4__e - Lp0ß 0@d 0 d H P X X X X D a0HS H@ > 0; `0HSc$c$c$c$c$c$c$c$c$c$c$c$c$c$c$c$c$c$c$c$c$c$c$c$c$c$c$d$d$d$d$'A0H\XS X X"@0`HP``d0\0d0 P "30 X00S =S  0@d 0 d Hb P!0?0Sd$d$d$d$d$d$d$QA0 0(!)^  so 0@d 0 d  0=`H ! PPT JO  L-0c Z0 =PH @} 0`0Od  d -e4 6 -P$LlMUp` r:U9k9U95g:4| 0S 0 x0\ 11F0S ҧ)9@ P@ `9U8 T9U l09Uc 89U 09U }p0;p0xup0;8U 8Ujp   5,0p   4 0S 0S||^ ^^ 00CS0 4 0004! 0|04!x 41 0 !0 0 0  !|uP@ 7U; 7U 7Uh00d7U! X7U41| R PxPy006Uh  k<dH0pzm0&0p" o6U9 et6UK / 6U \6U<0Sp0p000p0V0 Q U 0 Q 41| R00 h 52D5U' 5U 5P lU*h0U heh02 P@hP h0  kQ4U 4U 4U店41| Q]00Z P 0SxO|4U :p40S8\40Sn0S_p 0   P (0$0( R|P P?3U ,<R R 20 0 0;; 0 0 2  Z`(p@C PKK020 b 0<p0 P@WP@P|2U@  㖁P7  Yx ۥ.t08t0 @8t0  t07t00@t08t00 t07t0P/ q0S S p0(0(S# @0H0 1P pKl p0 LP D` =P@\ `^0`0 a@ `b`zCT  0X , U0U 0U 000St{t rtzt ^t td/7t,@ot t t at nt dst@f@t@[t@wt@ht@__bt~f}f/7t17Ztetvtgtt,7P5 4-0L0Œ@P Ap`@ .H0S`VW T  P`0 p0__ p- 40t 0LM"@`1Ps sP<0 p80<`00@0__/7/7 0-=0p 0"L@<P0S00  Q0 0 0S000h__ p-LM= x0 2`<P@J 0 p0191p 0Sp__ 0-=0p 0"L@<Pe0S00  Q0 0 0S000hQ__ -LM= 40 @2< H >P__ -LM0@  (0 P0SM0 p-LM@P`H0Spp% 0  0S H0Spp 0  0S p, ,0HPP p/7 0-L@PP 0 p-LM@P` (Q,Q&p0 >;-p0.(php0m h< p0ŒHQHP[HP(__ /7 0-0(  SL@P* Up0@0  (0Sژ0  P HP 0 0S0Pp0@0p0p0@0p0p0@0p0 0-@LWp0P0p00hM -0LS0 -L _N -LMp@  0 Q   m0 ̌0p"%p(Km = P@ ( P@0p 5*0p -=`b0V``V=J `VZ0@   p0  X:p0\45 Q0-L@PA  UPE0 -LMPP2 (`$pKP@ $! uP@`P@ $ dP@p0:p0k0>0= 0-p0@ 0L50 "20#0 P0S @P 0P0PU00S P ^zU?@0htU0 -LM@p0 ۱t h~xS0s S0s-t0 A!`?̠0 S S \h\ !h3 3#2 11>gfffON -LM`}P,"0$"111;/"b111A|0St xQo @TPi zPPD@T50S8 S1 1R0 0l_$K0, K× HAN=0S 0 $00!0 $0 q?B6c$ D(N=0S(0 ,0 0 ,0 ( (0?B6c, 0p05c1 @R  1P2;P$0 <0/0"bT uDfQĹ5Թ5555$5,5?BHh@5L5X5d5P0@-0 5@5P0 SR0C BSRP 2P# 0DS00 ER  R R 0R0S0  000 8 80R000 R8 80R0Ph h0RS p-LMP@p0`(0(S U  pp 0-L@  0^ʮP>U00  ee 0->L B㑊@ \P( H  800 @00 0@v0eew$ -d LM0@0C0 R0 <00  0 (H>hee -0  LG0 Q l00  (00H >1>1=1p00|  x0S0 0h0$0(Qeee -LMQP`/00CS ꈐ$$$Đ$̐$000 Pi_-p0l0h0PpT0T@ 0  p告eeeeee-R Rt0t0\ \t0t088Q 6 p-LM@`P >㹉0E/V> 0` 0 0P0  p颉 -LM0@S0S000A?>/>) p-LM@0`SC  ^P` 00c!R!l0PU00\ p -LP`yVp&0S 0\@l0% @l T@ 00S 00`d d0Vp 0SS 0 0Oh0 -L@PE`\p U, 0 ` \L 0 1S>0`Q%\L0 Q` \L0 0H`F V0`b 0-@LP U000 0 UR 0 S cc Q0S00 aPa 0U  RR  0h p-LMP@ `R2 R0S$ 0 0 0P 0  B\   00  110 0 0Q00  0p,u P0 p鄺5Rp@-@) 0/. PaCPN  10C00& 0b 0 R 000 Rp0a # B 0!0 0p1 ! p -QLM`PpFW R- R0S1 0 0V$ R! 0 @cR@cT@ `dPp  00S 00 0V  R" 0 A( +P0霺5-0S0| x 00QSCT0P0Q R 00c!0R#<0_@- T0R   \ 0L0c!R!@ _ 0-@L PR 0S0 0 0 0 Bn \P 1S>\0S0 00 -L Mp0S# 0S 0R p @@`KP@K v -`00p41P LP@U @ S 0U @yW -LM`00p41P HP@U }S 0V @XW -LM`00p41P HP@U \S 0 V @7W 0-LM0@41P P" 0\ 0\  0PU041 Q 0  !0 0 !000at qt @-00@41 00S   @U@ 0-1!LPS 0 0S-@ T* 04@S!T:PU R0 0Ո0@0@d@ sll oLqP0hm e?717,B7\N_ e e_e|$ e_$,0 P 0SPe -LM@P  P*0S S 4P: p-PLMP@` P P* R T 4P:p0SRV`0Sp -LMQP@!P P P U \*0S 4\:*00S E 00*Am -h0LPpU` @ T*0S4@  T:PUe p-t0LMP`U @ T*(04@S T:PU(0ph露 e7 p-|0LMP`U @ T*$04@S T:PU00(0aphw e7gfff p-t` M@Lh 0\P@EL 0@=,0 0ph e5 e5(7,7 -,0LM$@ <0h @17$7 e e p-LMPl0`PU @ T*,04@S T:PU; 000p ee p-LM@`)T@@PLH0@P  1 0a1p ee p-LM@`T@@Pt l0@P4 10#3 a    $ ( , 12 p ee4 03  #   $ ( , 2  -LMP@  , p-LM`@T@@PH5440S !0 ;@0<H`8L`!p e 0-@L P 10C1( HPL0L0L H 0 1@ x@y0 80S 4@< 4D4e e e P-L P Q-PL`%@0fT 1*4p)  !!0 0!p0P0 `0 5 -LM -LM -L M`pP00 JQ1V U0 0V:`cVP0W,0 ,K9Uv 0P@g YP 0!0fS0! 0C 0S+04004H0!H01H@ H0LP1L@ W   0`pbVP`W,P !00000 0W1 0 fR ! F 1:)01o W400p,0 000 W  5ʚ; e45X5 Q-LP`p%R!Q U 0\: c\PVU @@lV@1  `dVpPt555Ļ5 -PLM`pP, @Q R`d/ @PVW 00fW@1@!pd xW@` R WPʲ1 0 SP W010# 0"P0 S0# 0 0-0LS@P @0SU 1  H0S 0S 0 - 00 0"PP0P0P@-@ Q 0Sa0 0c 0\Qʲ1 0 a0b0a0 SR:1 a 00a1a^࠳\ 0S %*c\\ 0 0\ -1LPF0,0SA* R> 0S 5`1P1l0:L 00c|0 S01W01R@1@!  00 0 d dR0 0pd0 UX XP 000PXP` 1p  p :)014@p1 01@e e Q-LpPa1; 0+0S6* R3 0S 5`1P1pl0: 0S@1@! C 00 0 pd dR0 00 UW WP&d 000P WP` 1 1@  @ :)0 01@1 01h$ eQ 0S cP QQ 0 -LQRQp`P[@PW 0\@ cTP 0\TK 0 S?P+&PP 1 p000 0X0j 0  0 S  0S0S  0S00PX_P! 00 000000g0  0P -LM@PpP 0Q@PcTx 0UTs 1 e8Z` P`  0j0    D 0 P044H0!H01H` H01L@L`000 P` 1:)010000h004  ,0 Z0j0Ó00<0 P@,00 -LRM(K@0`0*0ppA`dPPM 0W@ 0p(,0S7 0fS1!P@% P@! *,0S0 R0 00 0S  ` Vpd`WP, v1 @  TK# @PP 0 0, e -PLM@ 1 4@ 04  t@T -RL@`P0p%Q" T S:0bS@UT  cU 1PbP0U@` ^ܻ55 5 5!  H0S 4 0b000`0`4CC!  H0S  40@  0a 00c -PL M`,0  RQP QP`aUVU QPU Q U 1 0   H0S 000 , 0R0V0S  0  0" fZ00SLpfZ@ gT  0@ T0 Sr, 0R0V0SV, 0R0V0S kP00S 0 S5*PZ@%T   p 00g 0 0 0 0 0 W0`0@P,0S`B1_ @0g 0 Y 00`0g 0P2 P00S 00 q 0 0 0 w 0P@ 0 S  0S0 `0`^D45 - RLM`Pp:Q1s @TV T 0 , `1@yP@ 1:)01p`40 0 0-@0TLPo>~PP@ 0000 S00  Q0 0 0S00o~ -LM@P 0o0~PRP 0SP 0-PL @T0 00 -@LpP`U P@ V0000P`U00 -@ ML 0@X5 e -SL Mph1@S {P` 0S+0SD, EP 0 0 @0  Q00 0 0  @ @@@8 `P@ 000W,,P) %f e p-LMP@r  0`@dp -LM`P[0 p 0P@ 0S000U H 0UP80 UPS; 5D27H27 -LM@Q0 0S hl P e -LMP0p` @T Q@T @T F @T R 0 0 0 B?BS  6@ FؠP`0 R 0000  0V`{P` @74`5 -LM0  0  -LM@`0pP  0   0 5PP 0P t5 -LMP0- p r0` 0 8@e #P @ 0@ p-LMP@M  0`@?p p-LM@70`9P  0%P P#p -L$M0 00 , 04 0P0D0 R< 00`p`W~00Sw 0@  0000@0 Y 0S 40040Q < 0;0 0; #P00:00P C03S; 0 0  < 00R0S9 00 B0cR D0 SH  0@W V <^<0O/R QDQ0 <0XX<,K8 aY ,@Tr̠P@@W00 X00SDZ 00X@@^d ,  T00R00S 0d0   Œ @8ZP, `p000;W8P ZD0X00S@ R0000:WPAH 00R  , 400&@ P0000,0KZ , < 80 00X00S60; 0;;* ,P R 0;᧠V00:0V, 101 1i D0S ,0S <1+`R@@do V@KNVLJ젠PA p` 0;0;; 0 00:0Z 0;0O#(40S'0#    e -L`,M, H Q @ , 0P L0 0 PP0S0040 4 0 44 4R0  0St707 4jLPZH8 d@T 4L R*`0R:4 @ T0Q 0S@03S  T 0S 80080@04p 4pL  , R 0 ,0@T~ 1SZW  R 0 0@0SL Te 1SZ T_ WXl@Q4 H  4 1 4̌4  4 4 T< D  Z00R00S 1S6 H0S 0H @00PRp <0lUP! 0D0P 0`UP!QR  0e0 D0`U 4 pD00D0 0\  0s0 0 e00 L0P 0e eL0P H0S W0eSH00@00> 40#s:0T00SL( 0S% 00#0X00S 3S0 PPd@T70778O07|Ti  Z00R00SuT^ @04 p< 4p4 5 L 0P0P00S 40  707780|7ƞP 0RS04 0070778 0|7᭞LWT @0 0S 40Xdlh 0Sl4p<  R< V14  4 40p@D @L  aL 1SS P00bP0X0,CX 1@00cX00P @0@ @d@0pT Xl@Xdhld@8囿D0 P 㓿P8 \ H R KWXdhl L00bL0!RR P00bP0X0,CX 1@00cX0\ @0 Q 0 R  @0d0 d@c@ 0Q 0 R d@P L00bL0!RR P00bP0X0,CX 1@00cX0,\ @0d0Ld@@d4C  T T 1S, 1)@T 0 90 SR  407077L#8Z 0|7᚝#@# 0@@4 0   @Pp Q! . pZ00W00S@ PT O p-LMQ@P ` Q p T  0pQ -L4MLP3 p@033@033~`3033#TK@0402[03,0(0^0 00S<003 -LMX`p,0 P \ 0 S*U ,0K0 0R ,R "R RU 0S0 R00000 \ 0S ,0K0 0 P R R@R1R8 R R  R RU 0S :G@0CT@S$$$@$T$P 7jPT|PL0T@0T0T`@`00RU 0S@000 00Y04  ` RQ!k401#8S#00Sd0W  H0WS 0S 0S S d77 -LM^P@p \ 0S*p 0,0 T` 0 &T T T 0 00`T@T  TT  T 0 0000T8 0T  T0T 0T 0 T 0T 0T 0T0xP 0@T0 3 003` 77 -LM@@ D0<㸈p@h 0-!40r@L$ r 00LP<0<080Ƽ(  3(@03ᾼ 0P27$27427 0-40@$PL㯼t0S0t0  Q0 0 0S00t0S7070h閼40$ L 0  191# 3S,000`0Q 0-40@$PLt0S00  Q0 0 0S000S;0;0h[-40$ 0@N cQ  Ŷ  191# 3S 0 ,0 0 0S 0R40$# P0 00   0-0P; 00  UL@  0S 6⶚LZ0S 0hQLI0S 60hZ -LM0@00 68 ሚ,L)0S  -LM0@00 6. kL 0S  -L MP0L 2cC0Q0^, 00 m3#0 SfʤPD A0 @0 0 @0 @D@刀   -LM @40 0Q 000!RR 000 0, 1@00 0 0S 0Q0 ! !101 Q-Q 1S/ S' 000!RR 000 0, 1@00 000 0R 0Q ! !101 0Q -LRP`p  10Z @W 0R@0@ N0aR P\\P= 0 0 Tp`Wp @ 0  1SS 000 0, 1@00 0@0S 000!RR 000 0, 1@00 0 0S@ ֽ눼5 p-RLM@P 0RP^ 0Q0`D F0aR \p0S 0  1SS 000 0, 1@00 00S 000!RR 000 0, 1@00 0 0S@@ @px똼5 Q-L@`Pp 1 0QpW 0S0 06@TW U 101Ph闾0SJ !1R U# 1 Q U@ @ 0P00!RR 000 0, 1@00 01010@0@ \!1R0   00 0 0  1SS0 00U0꨼5 -LM 0@S 0S p-LMP\` `U@\ W 0SE Pc c 1SS 00b0 0,C 1@00c 0U\* 0S  c 1SS 00b0 0,C 1@00c 0P 0S \` \ 0S p p` 0e  000e0!RR00e0V`傼5 -LM0@S 00 0  c 1SS 00b0 0,C 1@00c 07P0S  00 -L @M Tp`PP0 T1@ @  0 0 000n0ȼ5 -LMp`(Par(K, K[P@0K (0 ( 00(0 @T0 (0$ ((00(0( ,00C,0((0,,00[r,Y(f]/7 0-LM@ K(PUK0 0PP  ,00C,0(0, 0$P 0-LMP KP@ 00$ @,00C,0(0, ŕ -LM0`Sp  ,KP@0K P@ 08 00< $P @S   3S 3S0@3G  PD 00 ( @ q 4 KB[P@V40tu0 tc@ 00 0 00! 00$P P@ Q% ,  0R,0  P@ 41Y0\;(q<哶8,0( 0C,0 ,<,K @T0 (00(00,00C,00(0 ,&PD 3 0R3( D (00(0,006 , Д #@5@3Sn3Sl 0T 6F JP@3S_3S [5 50#WȺ/745 -LM0P K$0 P@E $`0A?AST $K0P@'$P@!0A?AS4 0p 3S6P!F0P@ 0 3S T0C3000 ,00C,0 (0$Pt,⑔ 0,  B, (0$w$,ₔ,00C,0 (0%,v4 -LM `P ,KpP@  0KP@t( 8K{p4K ZP@d804 D0 0040 4 弑<K, 40$  ZP@G<0 < 00<0DK<00 $ 80,0@0 &P@+0SF  P@!4 (00(04,00C,04(0< (00(0<,00C,0<(0 Lp,,W<R[000 DW4J[0,0 0P /p,P~0,P@ /7 -L(M 0@` @Kp8 0 8 K4@ , ( @P <` p9 -LdM0DK`p  P@8 P#PPKP !<P@0 0c0Q P0SX0   X RX PP)X0X0 XK PPQ `V T0S*``UL 00@L H /L0,  B, L(0 PPTP, @ V05@1 0305 0 S@`V00PU0SX0 `cPP 0-LMP KP@ 00$d @,00C,0(0, p-LMP KP@`*0 S@ 0S 0`S$V  P@ 0 00 $0`@Vw0,  B, (0p,z7@1 0-LM0P K 0 P@) 0S 20$ 0K+P@ Q  R 0S R P@ 0,  B, (0 P0,3K @K eP@ p-LM K`P@T(K  p 0(0 $ P@ (*m(U$ U(Fm -L M`$ KPPp (K (PP$0$@ep  P0PP (  0R(0  PP $0,  B, $(0W ,⾐ tP -L M`$ KP@p2$!$P0 R5 (K P@p  @0P@ (  0R(0  @P@ $0,  B, $(0i,t *@,00C,0$(09,b -LM` K~P@  0$P1 0S4Pp7@  @0P@  0S-@@TP P@ 0,  B, (0, @ 0,  B, (0-, -SLMpP`$  RV@1  ` (PPW@0`7R -LM@1QP  0& S,0 0,0 -LMpX5 Q@`P) QX 0S%0Q0U00S3Q4%% %4%H%\%%%%H%H%P%X%%%% %@%P%%P%P%X%U8 X{Z x !M |0S  0S 0S  _  0h0S S' P `, X0 a00,L(0 0` (X P0S= S9W2 0S8 XY  P `QL@ 0P7W 0S   P90p  P X`& L0 ,0 P X,0 0c c 0,,( L0 b0b0 (l0S L0 ,0 5" H 0S 00 R1  0 (0    P`L00H0--0S 0  0 0S 0S0b8"00   %fP27555l e5 -LM0@S T0S0Sp0p Sd0d P 8 lhP0 00@7`27d27h27l275 0-0LSP% 0SP 00t0 R h0hk0hh6Q0S@|@g@p e -LgM`pV0,0 ` 0BSPB[FOK W`0qK1 A 堡 嘁 _P`AT8_OKX 0|1  ˠˠmK.K0x z6P` 0 ,0S ,LA0 |0 0@ 0P 0P 0@P$@ 8K7P 0Td(5ʚ; -LTM @T`PD0 H0 l p LP D` P\ pKP@`P80S&@ 0 0W6P@|pW? 0R)@ 0 ) 03 P- t P0  p0 0 0 0$  t t0$ 00 $@4 0x Fx=@0TS (ʚ; -LM@ 0)R  0S S00+ &̲45 0- @LT P P0S S 00S00 @S 0S00  0000S P0hO塲D50 R P0S$ 0-@LP0S0000hvg -LM0  4 0 0C#q180 1 `f4  < (hZKZ<@ P,K  6!CQP@(0 P,0U1W<@ P0PU,0   B A8 <X8  04 00  0(h"g PUJ,PPUZZ( (hQPU<@P0,0 ,cPU %fp e -L M`P0S 1R 0 S 0B#140 @b @0Tpڲ 1 ` 70p40 Y 00@ (,K , FM0PK\` 0 @D2 0s 0s 0  0pG0 00000 40 Y  @Y``0PK q0 I 0Y0C 00p00C0  B  @p e -LM ROqa@0T0  0:0@T@T  ` * 00C0 0*S E @TPUh1 &e@`TP R Q@@@TPp  0S @TZ@WPR@TZ&!f00$0S 0R0 @, 0 0 0, $Q \0 R0 d < Q  0Qh exdt etd17$%P $% P-L@p T 1S Q@T 0 S\0 R0S0` 0C#1V P`X`VPP   0 S0*00 * t eP-,, 0 0C0, 00C0Rp e -0 0CSL0S R B02P0P  {yT5l5 0-LM0PS@ P0U* 0S PU:U% 8 0B6C00  8 0B6C0 R0000 0 080K0 88 00B6C08 1B6C19 e e e e e5 -LM$PK`%|@0 000 K? 0D `0x0XPXpX@XFf 10\ 1 !Ce-7 e e e e e -LMp`j@PbU|0+ 0P @K/X0 0 @00D x@8H`4@<lhtpAD @0SP0 P/30 e-7!Cep27 p->0L>0MK0 1!0`CQ6囪0 @0mPP$ a :\000008 HP0 @R0 0 X 0S@@0 @p4pp eT_ e| e e ep27 -LM @R0`00 H R  R 0 0 0 8 (0A&B H8 Ӥh e| e e -LM@804| @k00Q* Q:0`00 K !@6$ K@@@y0p_%Qe @0Pp@w{0P/"?CAx0p l0Q 0X 0 H0R @ 阽5 e e|K7T_gfff| e e e e ex e e e e 0-LMP00@  U0&00060030 ,00,0 %f -LM@h -LM p P@`U @P PU@ o1 p-LML@`PP 00 00 ;00P1Sjc0H0ph -L,M@@8 >0>0X    00K84@K@2PP400 @r4@ Tb\  < bPp < `U0 @_@P 820S 8P <` V<@< 0 APP <0`TD@@ O8",1D` !H` !006000"P000!R !|2|BP000! !T2LŸP000!,BP0( 00! 0KH /XH08@8 0 00000-7,U_r_ %f0000010000 0000#0 0-70000000 -LM@00p" 00:0000 U x0S H20SJ0000000d0S?H0S80K0 P8 0Ba 18RA610 S0 00000@00 10000S00 00500p0C 0+8 0$KB608 $ 00P,8 0B81`A6 10R000 0S0 000 0@00 00  0L @0K?88 0B60 e e e e e e e-7 e0@-0 Lt0P@h0  P P0P S P00Sd0S00  e e - \L MPP`P , 0 p""#10AT P0P S= @TWT 00:00 R 0 0p p ,0K ~Pp,0sSW 0@0S0 0 00X0P @`` 4 40Sd0Sצ4 00 00  Φ0000004ƦW 00:00 R 0 0p p00L 50000婃04,0 姦,0Sx  e e e5 -LM@ 0P 00(:00 R 0 0  e -LM0 4 8 <0 y\2\"0@ QH2H"0Q800,K,0 Y@,5PPQ Q@TU UI`pA0!R&̡凁 PU! @\x0@DS` 10SZ0000000d0SOY`1!0R PU tpWVU$4@80@!@ @<0S P @ 00d 0R00@000^@0PX 0D 0@ 0 0<@p`4@lht ex e e e e e e e e e5 - 2LM 2 ˥qaP0K@K R 0R!0S !0㲂 *@T 0R0S 00000堥00 Ix0S 00D!\ 9P`8K 408b00Pc=9@ = A@ 0}@0PS@T00300p8 0B6 P08 0B0  0@00000  :PP %f e e e ex e e e5 e e 0-@L=00P  600 00  40S000;0000 00  괽5 -LM00@ +00x <R00 00S00 00@ 00 h00500h骃00@000`00d400s e5 -h4L MpT4PQ`  0SP A2q 4 $00 AT 0S @T#000 P0R(0)Q ~LPT    YA0S X#000\ 0<0 00 @#000\0 20 0 R000 R 0S  0 ᳤"000$, P0QT" 00 0Yy *0 b  i-0 60 P@0"0 R? Z8P0, R .! 00 00Z0Y0S0!0 R  X)P060L!000\  0 0   0@  000 0)P060   Z P0 0 R 0 ,06 @0   090 %ft27 e e e e e e -LP\` 0P 0 Q 0S Q $00$000$0S@T T  P0R\ \ 00 0 p( pb W)-p@0"0t27 e e e -@2LP`P^ 0S[r"0Su@TQ  R0000 0 0S R00 00 0S  R 0 0 0 0 `VP0$0P0)0 ( ( 00  0P@ @2p1!00 R 0@0VV@0 0 80S ( RR*0.S 0P 00S0 0 0@ R )0.S@nH@J000t27 e7 e e e e e e p-L MP@ @t0s``? `P0sDPP<< 8H0@vp e7 e e e e̽5l.7 e-000P0 R`` 0Q :0S $  0S0AQ*000P0 e e e -pLPQ `0@S TT0ST000 ``0 0 0S R00 ` 0S  R 0 0 `堢 00C0 e e e -LTM0 P0K 0 d < ` X  0`0 0 @X X ` RD 0 X0<d0  X`P0@W0@X<d  <T04D @R0, \0   0OS a &80 nU@ V 0\0 0 @<0P0<`PP 0O`"8@#!P7 d,K< 0+P0X0s ,0S 0@00\@0Xd` \0Ld0s00 0d `@ \0`X@4 Q4@VX0@WXD@ Q 0 < 0 `!<PB*P @T : +\ Z\000< ZT:@T +ZXd `@ TX0X<d B`0p K<0pKX$0OPK0^Xd -0S*P KPKD 0OW{Xy T0<0P@@@00@ ] M-LM0000K0 p` \  0. 0@U( W00@0P`pG@0P`pGY  W 0 00, VW @0P`pG -L M@0, 0a + Y 0@0 Rp`0  @<0A ,@r@0Pp` W p-LM@ 18 `R3 <0   &< <0<0 | 0P | 0S P<0 <<0 p88 T00Q0S <<0P 0[}|P PU  P0  %fԽ5 - L0; S 加 e 10S080\37 00@Q1 0 ! 0- -LM0@^ Q \h0 \ !0S<0 X0 彥v47 e5 55 -\ 0L!R @0Q1S0!!0QV47 e85 0-`P@0LS HP@0S0@1S@1S 37@-0S 1 1SL 0DS  @  0!0R0 3767 e 0-LM@hhh 0P;D0D T@@P@.@T(P0p5l.7 e3737 -L M$$@ 4 0@x5l.7e 0-L@PB\UT T 80 Q0(0帞0P0 0 Q0p37e -LM@0 \00C0hle -L M00 1\ 0, 40 \X\ `P`V 0 =p,PY 010Y 0P@% 0`0 ,0Y000 0 400 Y 2PYo  @0ppVʹU` %f -L M0SPIJpP`] V @ 0@  tQ 0CS,  @T! `(p 0 (, #P0y{@Q ( R,0,0,0$0( ,0 pT ?00@0W 0@  0R tQ 0S0^ #(pK'`@0K 0GP0`P \%\% ]%]%d^%^%T,0P0  0 S 0 00S/ 0 0S  0R 0 0R,0 P@00 0S0+ \ ( R,0,0,0$0( ,0( P(0,0 00 \T00,  ,0P00@ ,  000S0 @0 P0  00,0 @mT,0 P0 @0 0 t37l37 -LM0P@T`K0&$pK  0pP@ $0DS l_%_%_%`%D`%$0 $I$ 0S B $0  0R 0P@ $0 $0@'@0$ $0 0 @ @0$  -Lp(P@A 0@1A 0 Ps `@0PU`P``0@008 0 0 s@0 p-L M0PK0%@ `K 0`P 0S 0 Sp p -L M , P0 ^  0R 00P,0  0R r0 S R :t Xʄ0S00 t0 0 0S0Su00Sb X00S rV tQ 0SR:X00S :t> r07 SRX 00S*0S$R"*r X00St0 0 0SRr sus0suu0sXR0S0 uq000 0scgꀾ5 -LM 0R ) 0 `R 0 4 Pp`0@  ( P0S@ 0R 0@ 0 R@0  0-L @\ P( ^,0,0,00(, 00@z \0 -L,M,0$p 0  0 `P 0S 0+_P@P@@T  000 0CX:0S/S X0h 0c #0% %0 0 R2  0 /R @@KT0S @P@x k D20<"Sa 0S0 0Z0SQP0K P@KH0 @00HK00 4 ,P P L D 8 $P@880[s@"  0 S?@#*R0@×0003@0/SI @vP o500d㓚>@ $$ ;0 pLdHPDHX_:0/S U0+2 g% e e -LM$P$ 0 0#40 @ Rp8  Q R 4 00  ( @0 < , 0 /S I  , 5R  /R  2R0 /R, KR, ,0 lR ?Ò00b0 /R07 00S09940S009900900S 0:00  0T 4 T <0 0  0@ T0@Y'P 00@060 !P R R0 j7ã000b0 0 j00 0 R090@8 Rd RR R  008l00CS<<0S;T0$ 78 R2 T0$  3#0S @0S00 #P  80S   #\20S 0 0 j 0 ( |`V   0S  8 R|`V   "00K  X0@@ @ p< RT0$   <Q@@LX 0.S0.S0:, 0/S  0b0j007, 0/S 0 b0b080SW0S8 0Q0R00SI@090& e @ -LM80@0 p,0  g `0SlX 0 T w PP p 00ZT0$  P0  0`0CS ZT0$ ,0S T0$ 0 ,0S 0  "0@ < RP  ! Z55 0-h0MLP\@PTT 0L@{8808 @0 @ 0h 7DeȾ5l.7xepe8ehe p-LM 0PS`@<P @ @@@SPpSо5S -0LM`@Vp t@P $`VV  v@QP@P ` 0$0 P0 00$0$(0$0p @/Y 0@37 -|0LM0Sh0@T 0S$@TP0 $ _37ؾ5H- P L0S PP 0Rhe p-L M 0@004L0P0 S000t ` 044 P 0  PK P 0 0 0 0L0pr_4_he0S  0"S  L00 \ @0D0<0804000,0(0H0$0000 00 -L MaqQ1@0\00 .00, 喗 0@S Hq R! | 0S; QV4 Q<0;<0<@;<0N0|0@0 S8 H0pyL0S0S X R\0\0\00\0X  RX d0X0X \0 P\ph[D@8 80RV`<5D58eT5h5@-2@H?0\ | 0T \80Q\e -QLMp@`P$K40 P@T$F -LM@<0  | 0P |0  R Q8 80R@ 0P0R00S @ -L MQp@@ PI R @1@T 0S $@T-T A@@P 0,0S/ S+Q'0@T 0S $@TT (LP( @($@ 0@ @j@M- 0 i\i3737 -PL M0 `L 0 0H!X P@ 1T0 0j04` \,  T0S ,KP! U`pP@ ` ,P@W,p @0 0j0 D0 R4`0(0 00 !_. he37x5@e-|0S<0  0 R | 0 S  R8 80R0S -LM\0PS@p$0  0`004P  4 $0 <$0Sid RfSdRb01 K`ᄀX\ P@( \0R\0ń0d R>!P@A0\ 0   0V0P@@T@ 0004P U0401$L0 R 0S  R0\7@ \ $ \` pP@d0 Rd0 0Dze -LM@0  01K p-LMP!`@4T  K00`VPZp|% p-LM0`@P  0p50P$0<$0$0<$00 0-$0L @P R  01 R P 0\ 0$0  0-LP@P P 0S  TP @  0S 0@ 0S 0 @  -LM`@pT P& R0 U@W L受X @勗0 <P  p~he55 %fȿ5 -L⣑@q<0< R  0S hdx5xed5 5 -1LM 1R  cp 0`PU 0 00S00`PUV Y⎗'Z@t*W@h00000NW`pGY %fd'p27 550@-QMP0 @-PT \ ,P^Ѝ0Ѝ0@f\d37 -LMA\-P   -LM@pPp `pPH00H0 0mPp0S P- L p00Csp0 H Sp Hhoc$5 -LMPp@`e`ȐhP 8 V T0SQR1 @R VP T0S00000000  X00:00U@ ᛐ,00500D!0mP@ ዐlQ  V T0S RVQP  t R T0S R T0Sc0p Rl0S W0 P@Np0Sl0S  Bv<5H5`5 -L`p8l@PT 00  @RW 0| l0S !h00 -00000d0WS T唔x55 0-d0LSP@4d@800CS|00 D0D h0h S0h0hP 0t5 -Ld\8  R R000 H  l0St0QH0x0x0x00d0L H0 BL  R@0SXPP\0\ D0\0 X\ 0X0 X\ 0 2!Ce8epe5 p-LMd`@VP0 P00S  R000   pp00p0!Ce 0- @RLd R000 00H hP l0St0QH0x0x0x00S0 00@P0H0lP80SP 0? S 40|0 R 0 C!CeT47VUUU p- LM@`T P,7P$  $@TL0@Q$@`0(0Spp3737 -pL@`T P7P $`$@TT  R$00@T 0$@R T0 37378@P -LMP0@`XD,p400 `xd` p\ HLPx``p88PP `p h 5P555 -LMP8P1p ^0T|@10` @Lp@@ D0@Wh@T  @T\l@T < @T4753755H5X5`5 -L M`$Q @p0!P 0PP<@@0@DH t`L`X\ Lp 080@PT YP !`\#100E SP`@TX@T `\#10l0E SppP`@T<p555D555555$5(505E685H5P5 0-0P0@ 0L^0 000P47H_L_ 0-0 L0@L Q@ @P@H0pt t Rx0x0x0 H00H0 1t0S0!x Q01x00h邍P47`47H_L_ -<1LM 0100 p(!p1 P0 S000@`T  0S 0S@O0S0C0ʄ0 S(| 0x?j>0 0z140PS(  %fLe`47X47-7P47L_X5tdT47 -LM h0@P t T0R D0D `5 -5LKM⤕ R, `p gO P@PKZ 0P@ ,0 S <,uD0 QK A 1 @! DQ q rP@ 4 <0 TP$  T0 P 0OP@0 Q   0000jP@0$ 8 $ 0$00$0$4$04$0$0 0$0 Q?KpP3@ $0` h! $0$07T8$0$$0 0S G~@P00|PT-H!00000 R0PPP $0 , 0 P@ 0|` E}1y--u)0K0 ,P@0 0S qNP@0 Q  00T $0000 0pP@80SAPP  0 (00(0 ,00C,0(0~ , f{ 47 -LlMp0`$0 @XJPUK $0 S $p D0P dP `0 \@ jP@KUx@吵T0L0T 8K0$PU 儸Td5 -LMC0,0 0 P`pP JP@ 00  \( AK Ka+P@P HPK ҷP@`PF@ 0@K K P@` 80S-@ 20S 80S@ N P@{ 0cP@s  @KKP@ 00tP@b 0(P@Z D0P0D000 P0! 0$%  X0K`PK0 $K4K DK @0@0 @P0@0 )  090 ~ @ (00(0 ,00C,0(0  FAP,0 S ,o,d0S 4A(@,P , 0 P@] Td475 -LMԀ0p$0 `#IP@ $0 S $Oo@PK P@PF 08K K P@PK q @Tp STd5 -L$Mp0`$0 PHP $0 S $o@@K 㸶PP@F 08KD K PDT@,0 P$048,0 Td5 -LM`PHP@0 RC 0K@ 0 夀 P P@pW@ KbP xWK 20:#: Q0 <   Q @TK K0K @00  Q㄀ 0 p-LM0P@0  0K 0  @ sP0|`KSKl0|0 " ʠ,ʠK K0x p 0R 3p0 -LHMd@K` p@0<0 ` d @ 8p ;PUT@80Q0 `P @ <0 d 8p *PPT0S@ KPN P@KP P T0R TP -LMPpQ`+0s@TK0 @  p 0 P@0@KSK0K K ˠ0ˠ| `L @H| 0R @ e -LLM040 0XK0 T0 X , P H@4K<0DH4 K DN D0S b`z -L|M0`P pd$PW 0SR$80SN  S0R0D 6R pYX0@@ 0@ K0 P 0(P@`@ 5K01#5#S0 0SRK 0 Pp0Kp0 hd -LLM 0 p`P000 0pK D0 H0 l p L Dp P@`Q `l`@` TP@0 i @ -LM` PD0K0  P pKP@ 0 @T0F0S<@ p 0 -LM` P0K0  P pKP@ 0 @hT0uF0S<@ p ʹ0 p-LLMD0``K@80 \ ` 4 < PP  pP PP= -LtMp0Kh0  l dp ePP `HK80SP 08 0b00K @@KH0 D 0 4P 0P ,p 8 0 P -LM` P@0K0  P -P@ p 'T0$ @0s# EP㄀K0 @0  0 @0儀K 0 P@00CS@ -LlMP` KP@ 0$p T0S $0@0s/ EP㄀K0 @0  0[ @  0,  B, (0 ,1a0儀K 02 P@00CS@ -LM0P#Q`0K  @00   ` P@ 0 p儀KT0@$  ?0x0 :#:0  0 @ -LhM0P#88S`4 K6P@ 0$p ST0S $0@@KG0 :#:|0  0 @  0,  B, (0,` -LM` P@0K0  P P@ p T0$ @)0s, DP0 R 0儀K 0x P@0KT@ 0@ x0 t 0 0t @@㄀K0s37 -LM 0PK`0 0 0 P P@ p T0$ @)0s, DP0 R 0儀K 0$ P@0KT@ 0@ x0 t 0 0 @L@㄀K0s37 -LlMP` KOP@ 0 $pkT0$ @)0s8 4DP0 R, 0儀K 0P@0KT@G 0@ x0 t 0 0@  0,  B, (0 ,_@㄀K0s37 -LMpKP`P;,@K{` 0K40040  @0K0  ` P@ P T0$ @ (0 "c1, ah $ 1\ d0 ` 0 0q@,K ㎱P@,0s0,0 $0s0$0  -LxMpKP`PC,@K#` 0K40040  KP@ 0$P T0S $0@(0 "c1, ah $ 1\ d0 ` 0 0@ l 0,  B, (0 ,^,K .P@,0s0,0 $0s0$0  -LMp P@0K  0 P XP@  `@Q80S @T0  匀K @T7 p0K0 @ -LlM`P KP@&0  X "00  @$P  80S@ ZP@  ,00C,0(0,k^@Kh0K0 0z@ -LM` KPPx p  0$@ 0  P ,00C,0 (0, 2^ -LM0!P`@0 dK0< `0 d 8` P@ATp18!Q K0@ 0 ` P@LP`U 80S> 80S@% W@W@TU ܲPKT@ K0@Mx\P0|t?KV U@KPP/-*80S@@KPP,, e p-LM0 `P0 K0 0  P $P@@T|@K0|0 "0ˠˠK Kx `P@ pKP p 0-LHM080 0\K4 X0 \ 0 P@ LP80SH@ 8KHP 0HP@ <0@@T8 K'@ -LPP0Sp@K7$ 0ሀ 匐 _PPk 80S-P? SP<  L 80SP2 mPP-  0PP%  80S$  0SPP<0 D00D0@;<0  00 26@K pKP@ 00kPP   0@PP $p0P  00Pl 0D0$ (0PP -T0L$  80 S%%%%%%%%%<0 P <00<0 -`@p D0L0CD0P(w0 @1 -L,MpP`@3 @0K0D0 0P KUH P` 8@ 40 L@ 0P , HK 0 @R800 Y   "8 P00R00S@HK 0 ( -LM$`Pp @08 R 0,    , l P` `, -LM$`@8 R , P) PT0S $0 P,  p 0  ,  000c P$ -LtM0 K @.P@x0t 0 800C S6%%%%%%% ) @ K@$;DL  p@K8P|`DphHd K \0K(T K0@ P@`pHL P  090 @J@   *09@J -LpM$`@8PApQH%H%%%l%l%%0T 00S00 KP l00b0 0 pL0PT4! 0P 0`4!f@at $ p-LMP@`@P< < 0 ;T!52c~HaȀ2ca10 0\რ+ <@4TP *[O[O @@R: 0``( AP*0 P@:00@C "b"b0#l00X d2111H"c#b1 `130$sQpele4475@-0PSpU0 0 000@ S  p`U 0 0R0@0 Sb0 S .000@ S  LpL`U 0 0R0@0 S0044E-` M@p 0 0 \0 0.\T.0V0 Ѝ.\ D\ 0 S.S\Z\RP J0 S .S RP \ZUv R0`@e@c\ 0  0S Wpp0S 00Np ^\\pPEP*0  0S Wpp0S 00Np^00P0#02SPp3^_000S00W V @V^P 6!10F000nR^`VL 0 S 0n0 lS0d~0^ 0*0^ 0:bP0u S .S PR y0.STWVM40@-P| U@B .U@ 01 c0 C  0 R0Z  0  01 PJ0 R0Z PJ0 R0Z P J0 R0ZP0@0000  0@000|@ S .S A-@pP@  0Xx= ?0 1 C@nT0 7#30 T00SP-@T`,J 0P$0S!^Z@TJ 0P0S^Z@TJ 0P0S^Z0S0S 4p@-@?\00\0AS`P?@01 P0 0RPu2 0?0 1#0C0 R0; /R0 0S"QZ0 R0( /R" ^ 0SQZ@0 R0 /R 0SQZpp@Np00a0C0p00Np00a0C00a 0C 03  QZQ p R .RAQQ 0Ғ?AcON -,0L;0 <07xete -0LM0吐pP`,0 ࢂx 0  AT 0U @$0V0W00S , P %ftexe@- @ $ 0 201 R 0\ R R $0^0T00S xete0S R00  -LMpxP3Qp`@` PU,0K m@T= #0P"<@",0P, @ @8@00 `$ ,5P@ ,T 4p 0V 00q x0sk 4K 00K P@ \4 ?40 h 40 i 4 0464 0464 0464 0474 0474 0t4 04 8  hP7x0 qD0 4Ht0T$p T q! (0i$T (0K$p -Pp( $\ W (0SQD$d 8@0T$p@0R55 -L MQ@p`d%X` 0D 30nR\050@ 70 0 `PP X 0\ H 00`X H a0N 0-LM$P 4@0  @0 -LM00(P0C4`p00 P,K0KX PE5 0P@600K4@K00@姳P@-4\0H0 R (0U  P 0 PE A\0 0S 4P@ 0\ 00U00S鐵4卵 -L$M40@0 < D <0 D0PJ 4K 0 K0APp<@00K408@K@JPp+84H@ `0T*PU  0 @ H0 `0T: HWD00D0  ;P 848p682PD\ -LM4p`0K4K 0PP-00K408@K@P84H 0R *@T T 0S H0 0R:` 8 -LM⤐Kp  | PލP@$  ԁ0S   @T:$0@-@T4PQ @0(0$ ,P@z`80S|0" 0Q{0 0S $0 LM0 0MP@  $0Q 0V@ Tԁ40 08  0,0005x0s/ KP@  Q0@'P000\@KY 0Za⺊0Y ZaⰊ M| 㯊00 05@RN K\ 0 0S10S`` X0 0P@  /q *r_ -L,M|0`p PP P07 V$ '0@ 0@@ P U $0000  0ZPP(KP!4 4 :呱PP, ;00i000,0 H@  0P410 $8 !8 0 UP42 0 $" 04800 $" 042 4$ 2@S\P 048<,0 0$(,0 2S<0 \80S0 4S2 x0  048<80 0400020U 0E8  R:0B0Q 8\ 4@ ,0@0!@ x PrH 0,8<@D < 2B!?04 H @D0H00c಑D80 4Qt0LP 3R3 H0 x0l3H tR880l0啑0P R*l0 4p04 C@`\ d0d @0RX OP|0@@,P0 R0 jZ P ;KA<Fꪲ,姲0,0 |Q-P00B PPP< P ` PP$00100P0010h0 0ԡL P |04 "!;42 PPP,0\H@ [P 0|0,Z0,0 y$ NP HP BP{/0  4 8<0@C`P@V0  x0H0 ?"!0 #L,4$ 8<@0H&%0@ 4| 0 04,0td554500 -@L pP`0 A|`PQ`<{;x$0 :$0! -LM0K"@P0   p-LM@d0P0d ` L0 0T T T0Z 0,0T` (Z $MB|  D &p p-LM80@SP0 0<l0S 0S `V p 00S0  -LMQ`0(  $0 ,` h0@Sph, K 0STL  0P$  $]n&@5 -LM0@ 0KP0 00  00 00$   0-@P L@P00 4 0 0 -LM䑟0 ,0 @`t0 pS( x0RP#N*K u\ KiPPC04 K0 !P0 PK  DP @P 80  < 0 0/&00  K0PP0  0  ,0 S ,BYpYLKN KO0KJK00FKH KP0[ 0P0KTdl5 e -LM 0@X e p-L M@0@SpPP `K80 004 0  0 00lj i000n00rp h0 0h0 -LM 0hh4`0  0 $  10 !   0.m -L M00PKp470 004 0 00000h t` Px0s@h0($240 h0 0 !1@00#!  "  004 ` 004 0PH` x0 @0~40 (8 Dh0@ 8D040Ld $ 4x0\ 00@ 800(0 Zi 80Ux0S 1\X `H@0L aP` 1$E,$P`T lj i00r0n0j0rp h0 0h0Zm -LMP@0S` p0s 0s0s$0sH0sL0L s0s@0s 0s0s80St 0ql  0P(0s] 4 0R RP \00 P 40 (0s (n0A00s 0rp 09h0 0 h0 p 40 Q !Ph0h000h00 00Dp 40 Q  PDh0h0 0 0h00 00h00s0s -LTM@P 0ST 4` X 0ST h0ҥ0D0 TpXx0 R0S*XX 8*P@0K0\0d 0L0 TpLx0 hDQ!0`Q!\H zp`0pX `K c *@pKT00\ p S; X`  b)8@Kd0 P@>@0K\ 8d0@ HP0bSP1TL H &@8@T0SUD0SPpT0$  T000,,0STXx0`K p)XʵW`  b)dd0 @pK8KPp 4K00 K0P@00K8@K40@ث@ -L P.\ K P'@ PK K 0@ PKD @ P pP0  养0  0 ,0S ,:Q Qj;[0 [ 740w 5 @0QLKN KO0K0N0 JKy0E0FKH KrP0[ 0P0K5Td:7$5 e -LMP` V$ "P 0@ B`T+)/P`{ 0 w@`n,  -LM@ - -dL[ML 0 ,0 d! dA P! h0`! 4l! p! >K @h |A  KKGh ! P 0@ 0 6 ,0S ,:h1 `LA0X Sd1t 2R\1 2 x0s, h`V# `>K/>KX X5$`P@ld\d0x a0`V`!\T KOK\ `1QKd =KJPP >D1ROK@UPP HD1@ H0bT!S0!P1 0U*0S S0|1  Q > | >KH T1  @ 0 PU:KPP  lAT p 0Lp \0lA H}HǧHħx1s KtAtA?(K K?K 0 48<S@1\SX `H@ a0C`p  1HF,`$`h2 (K 0<|!MKg| 0@ HNK0Hz]`/>K<@0R@@0@ T`! SbV~KA_x0 s@0041 81(@KV 3 V) (K00000h!0S:MKPP @ 0l1S pA@DpA Tl1 `Vڒ @0@ NK 0(@KpKK,0|\0(KKK,020P!p1 l 0 pcTd459660 <0< 0< 0-LM0 PR 040@0T  R00`0X @ c"  0 00 -LMPpd 80@0CSBXP0X`\P | | 0 D0400sN@ᤩN 0R40`X  l="0  eP0  X|0sH<}X@%S67D5 0-0L@Pt $0@]T 0"P  0 0.$OT0\55@6X5 0-LM 0Px @ 80K00  B40R8&0&0&&&0&8&D&0     ;0 0 0-預@0 @$0 @ M! "Y lpb"`0%&&/@&0O% & "!! @!0P @`! ЍCCX8^n좙N - QLM`pb VQQ :QK Q 00@ T0iTP0,17. @P OP% 0P: 0 S:Y  ^P `j  (| 0 0i 0 Y00Q  Q iQ Q00  0-80LS@P0 S0  0S S00Q0 000,R8EP PP 550 e 8 8-#LP $0X  0X H0 0<7 8 80-#L@HM0PS2T:@2 82@T @/0S0+ 0) 2T 2T1T0S 0S 1 0R R   Q  0P P 0T 0T 0T 00T 0T :00S0T|0T*`0Tl0|0T 0T|0T |0kB @sB@vB hB iB jB@fB@qB@f@xB@tB@|B@nB@wt@oB@77~fyBrBpBuB}BzB}fwBgBvtmBfBlB {B4<7 -LMP0R,(Sp@TJZP,@(NJY ` VA P _{P]PcJZP,( -0L@pTP`/ 0S( OPV 0R`@TV 0SP7J0@V S)Je( x -APL` 88#NP@  J pR:0S 0S  0Ps $0S(0 $ \cId p- 88LM@#P!1`s  p 0<@80I`00`PI 8<7 0-@<L 88#PI`0S0`0  Q0 0 0S000hI -LM@< 88# :0S00 0 P -LM@pTP` 0=  00 @T(\0 y<0S4 R-L`Pp U @V@1 w`VPpM5 -QLM`p P 0 PR@T 0=00 0 @T(d\0 1<0S101ꔯ& -LM@0 0 $K01K $@ 1[!0 ! -L@M 0(K( 0 $K01K $@ 1[!0 ! -L M Y pp0Wp`XP4  R400400@0 @ @5`0K@(000,0 j0  尡 4:0S$P X 00S* P0  $  d -LM@ vP 70  n0P00  70 -LMX0@0CSX0P(P,PhP P  -LP`p @+00P, d 0 `0Le5 -L@T 0` S V@0<00`PU 00S PUQ dp0S S l0SQ h 0Գer_&__e 0-LMQP-P P@K00, 0P0S000-0T@K00, 0xPQ0 Q04<70<7,0 P h0SlPe -LM@\t  ~P( h@0lSl00pp el \p0p0p0 -0 @LT`P p 0S @T p0 S 2! 0W*xPp e p-LM ` 0S 0 PU 0S PUp 0SU HG@=Gppe@-00 Q:bP, Q*@0R : 08 <4P 000aS a00R R 08< 408 08 -00 Q:lP Q*0\:00 0P00 0 -PLTM@`P p@@ @0S񟗱$&,&4&D&T&`&l&t&&&&&|&&&&&&&&&&&&&&&&&Ľ&&&ܽ&&&&D&P&&&`&&&&&&&&&&&&&(&&&&&&&8&P&&&\&&&&&&&&&&&&&&&&&&&&<&&&&&&&&H&&&&P&`&&&p&&&&&&&&|&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&DpB `0K> `0Kq:070A4 p0.0 c+0\ 0@$0  g\ 000S 08< 4 Ud Kd0S 0 0\0S0 āUh Kh0 \P*U 0 P: cR 0P*0 *|0\*W \*0 RUhl K9l000| 0 RUTp Kjp0v w0P:UC 0 P: cR 0P:0 } { `0Kw `0Kqs0àpǠn0<àk<ǠigpelcaP07*0qZU 0 P: cR 0P* 00A S@-@**\ *!00S |&|&&&&&&&00@S S S\!0S * R:!0R0SS `S0SS 0@S S S S 0SP`S PSpS S0  P P P00S*00S:00*S:0P @P4<7 - @LM e*h!P_& -rL Q0P0 졟 0 R1S 1 R d 0R0!R0a50S 0S 0R%L\ 000R00R00  @P.0  0@ @P0@0@0@0Q@!R0 0@! Rm% ur  nr 0\0 H\<7P<7T<7X<75H<7e5 -x1LSp>(@AY0X0H0P  (`00(@0 (9r0Y%X00P a l0R0 000 p 0xAU@@@ ` PE0U X<7& p-P0LM`%QU C@ t0x1phCpX<7 0-LC,0P@T @T0h}Ce -L`wCp_qH0PU ,0SPUhdC@A|e p-0LM0`PS@ 00P  `"0S 0 0`0S  0 0`PP $ 0`S00@ ph GP<7ee$5 p-0LM0`PS@ 00P  `0S 0 0`0S  0 0`0SD$0 `0`00 @phZ jGP<7ee<5 p-LMPB5T";5L2 !$1D"D2(!01`$ lgʼn R0 10  0 PA A R0000 0 0SP 5 P 0R 00B 0B PQ Q0  0 0S0C 0% %01 $0@T 0 R 01|Q@T#phLB~|< R@0@ <0@0 < @0 &&&&?7eL"feX<7ee -PLQp` 0@S` TV@0@S0 0C0` v000 p-LMK`L@T 0S PU  pP  p-LM@*P`% PP 0S 5P@pA@A-ppp -0LSp` 00C S `0gS0S0 C RV> PgU; 0S8 U0S6 0@T 0S  @TPT UP\ x 1`?Bc00L` S g0 U R0PC\XP0S L<7gfff, ,00S0 000L<7e Q00 00C0e -LM܀`0 V$0  % P"0 @PPPTU 4pKo [ rP`PU@00T00S$0 S $F*TdeL<7P5 -LM0@S  P, & 00ah&&7Q 00[ p-0LM`PV @T 0  R @T`Vp P 5 0S 0 S Ppe p-0LM`PV 5 @T 0 R @T`Vp0S jPpe -LMX- 0pW @T 0S @TpW PU 0`\ *0 0#\:Z  P  P 00 P$0  Q 0 eT<7\<7X<7H0Q P 0 RPQe -pL W`4 @T 0S @T XR 5 P Q P0PP*0 0#P:P P-L`Pp @@T Q P P@ 00 0@ 0S0C 0 @@\ $0\   & 0-5P0L5 @T r@T4Q 0 S4181 <10C<16t0h -LM5@05~ h, -LM@u h 0-@PTL @tT00000 p-LM`^?p0P@T %5R0C @TN?80ph*%(501S e7 0-@0L@PT (4P @T00e -LM PU, `@ 7U 7U 70SP7U ,0 S ,@(Pp t7U p X`7Ul T7Uw cH7U- @7U \ p  0  0,5 >@n>-P0`0 P%   T&q<$ 00\5   >@>>@> 50SPr$1S  xPcd%5ATO PUL 0SI0FX0S ;S SK@ l ln @>5L@K05 P3K$5 05x3K$)> @TR 0S 0S @TF3aS SS 4Ua 43U 3U&PPK0K@ qP"@@ ]l@ -\@P$1S"  \0S ᄻ03U (3$3UP $P U<P $PPK0K LqPFO!02U(2U* 2U 2U 2U1U1x Xn`001U" 1U 1U@K@ 0K@ 'q\01U x1Ux`1UqF?PvP @K 0K 1U 0U:,0U42&#2P?%Tdi$ii$zi `5FixIi i i i qϖX<7i i i i$Fi@i$Hi Gi i Jii i 5i i ~i i 6i(i$KiŠi$xi i$ -L,M!P P0U,0  1 X 0S P @0@ 0RPCT PXP0Pl1 ,0S `, &P0pD1XU.LK(  #k 0S7 U@` 0S<Kc$ PU nZ 00pZ@ PETUXUP0 0eP  0 m4t pm<Kj mP PE p Tdeh5 -LM@4Q 0 S4181 <10C<1q 0-@ L,*PP 0 80 $000 $0(0P0e -LM0`SMPU *P7 PU  PP5  Pp+ 0@T P& $@TP@ 000@00 pp  0P kh T70P/S10P9Se p-LM@`TP P @TpT  R0000 0 P 0S P00CS00$ R( (0l0(0  $(0pP R000 0 0  e -LMȀ 0R$0 0@T 00@T$0 S |$$@`TP 4pKV`Fi  lPP@TTdp5 -1LM@ T$ P 8P $@T$0 S $m$T  R0 @T 00@T@`TP 4pKV`Fpi (F olPP@TeTd|5 0-P0L@PT P $@T0T 000e p-0LM@`T P $@TpT  0 RP U 8$1 SPUp"pei$ -LM0@S SL PT(  |P h0S5 0-T1L0MLQ@ T  8P< $@T(@Kh0 (0K'K(P@ <P$_ P@D@K h P@ <P J P@0 S X#0 T @T @gTeTd555 -L$M@0Q0  %2 800S80 0 S hZ#<55P2K4 K $800CS80ʴ5<55 Td5i -QM 0P P -Ѝ0 ЍP0  Ѝ㎷ -L$M`APAUD` H` @ p2` Xbn@S 40 40 d0S @40  \Q 3 R*TA`@`@0 R񟗸l&&`&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&4PK  @0PYP 1  5  3Qj H0S02K H@ 0  r PV 0 B0 0 XL 1000@*K  g gD0 S<K gaP;9/`@0<K0D0 @0 @#!^ ",!1 #: x4h4 0-0LSP@/ S /0 %e !e0S0S 0S0S0S 3000  00 00l dd0ST dL 0^ 0 000  0 <7<7y<7<7 -LM@pr6@,`K4K P@Q,0[ 40[B ]6T  90S  @0PP0 00D67 P@"  d d00 p20S"00?B0 " " P2 0264 67 6 -LM@ 6@,`K4pK 1P@B6T - 0S  @PP00CS0 5 R0700 [ 20C 2 P20C25455 -@LMh\<7 - LP` @T( 0 ;0 \0%0 $1!0 UppX0Z Y@0S< 0( d5X'&e -40LM @P0 0e -LMp`P@ <P 5T` 4 20So 0@/ 0S\ SAQP75 0R@000Sp0 00pph0 .!  !41 @P50S  5p 0@P 0O4000 @@4000i 47 (t:i/`@~i40 3A0 vW9L"f@1f<1f5e5Q0X0ḁ0Qx0Q *p0Q  5RA05L00R  R R / 0Q0\02i 1i i D'i -  0@  -@L`p  P\P @  0` pP0 85 p-RLM`@PPU@p 0-L P@\p 0  !:0P \ 0 P85@5 -QPLMpP` J WH 1RI 1RD 0S?0@S000000@ PU P@U 0S @T1!  P UR*01P UR:$ Xe0U0P00S c@ P ` `T @P` P5i 6i( \ 00S \P p-LM0 PP `@u  0#U TpT0000 0  H 0S  0 Q  0S<70S 0  0S -0S 0 00Sp@-0 PbUe Q@ * 0`R@ Q:Q*0SQ:?T00S eP*0SP:Tppp p-QLM`P@ 0 P @4PT P 0S P 0Sp0@- @0PS1!^d0 0S1\@ *0 0#@\:00_ -LMPp0 S,P 0  0PP0S 0 0 ^0 R*0P  R: 0 0SP0 0S0SA^@PgU 0 9 0YPUPP`V 0 0Y`V,0U 0 Z 1!P@ 0 S @T 0ST  ]P XP @-0S<@ 00  @ 0 -pL` P@ 0\* 0S\:0000Q0\ f03 0@@ 0  P@@0P  0   P 0@@  -L MP@`0UPR` U0 V|Ք fH` p@T0TS@DT0TS $P`U"0WP 2 AWkPP0DUpZZW ! 0Pp8 |10@0` `d1, K0X,0pS0@ T*0S! T 0 0P0P0P 00P Q 0`0^00 00 00LT@ T*0S |66  <Ppg_ 00 F_ae|_?7e?7T5_ 0R P* 0R P: p-LM0P@S0` 0 T\ }_00 00 0P0`@p5p@e5 -LM0 @ pQ8 F.5 -LTMpp `+@Pt@ P3@# 0 t0 '&30#0P00Sl 8 0 0R* @\  T00R00S T !000hK@WphK\  t0d `p L A Z000 c HPll@0SPl9Tl\ 0S 0S40+  \hK@W 0l p`l KhK\ 8` 4P d `p lT\4`@ '40 040l0 l `A@ e$e(e -LPM\`Kp@` tW`@` K 0X0 0P 0T 4, W@-0 @ 0Q!0P*0 00P:P:`@T -L`lM"0,0 唀 ppZP{ K@qT0 0`0 p \P F?PY K 0 ZP` @T 0  80S>ZV"@T 80@ 0CR80 +@0S$ 0S0C 0 @P 0<0 0 S  0 P1 ,0S D,  @080P` P@K"T"0NK P0KOKd@ Y0S P@w 80@ 0CR80q XYY3AGYP7 @ 1pTd05T5 0-LM`P@\ T 0L@ $@@0 <@1 40$2 000)4?74e\5_eD'7d5 0-0L PR  P@0 SH 0QP  00@04?7e p-L M@PT`"  R 0 0 0 R000 0 0V  \  pH%0S0C0 @T R000 p0*0  0J4e5 0-l@LTP  tR 0 0 0 R 000 0 0  0S0C0 %l@T0*54e -P1pLMD!P0l@0T\0` 0S& @T$P@ Rp`Pl00Sl 0 0l0l@ 00@@0007 R 0 0 0 R 000 0 0  0S0C0 $)*-7-74e5-00! ee 0-L@P0P   0 -<1L M`+$$1pPU0 @T* 0 0S% R 0 0 0 R000 0 0 \  U$0S0C0 @T 0 0SPU#L0i <)0  0O-7e4e75 -LM0`SPp@T P8 @T0S `2S$ 0W0 P@  ,0V0r,0  ` 0@@`00 @@`08V#x 2S ,00,0,?7P40 R  2S R,?7 -L lP 2 S R,00CS,0R00000,?7 p-LMP`P@ $ #P `!VphH' -L M<0S 0 0 4L PT# -LMQP@` V 0R0U00S PL00C0 P4000C000C0"Up21 R `( 0R0U00S V1S000 S0000 0   f0@00"Nq` 0  e %fH?7 --|LM 0,  `PSp` `  K 0SB1G  R 0RF p00 0@8 R3ڤ0X0S 8 V 0 >X0QU ll(l8SX@AD,0 S D, aXVPV V0S S+pWR P`  0W7 Q80X@@00XS0p0  P@0S p@ V W0 p@00Y <PK@mP 00 K 0R`0 % 0 S"0S 0 SPuP &P p0@S񟗕M'pN'0P'0P'(P'(P'(P'0P'0SpK K0Pp R L ($} 800C800D <0500 KKP㘐p80080 00 0 00 D 7SF x | 00 <0S0  0@ | @0x 50@0p0  p  0 K 0P  TP@ O` K040(00 L0 0@7p>P@K"O"0P0KP NK d@ -p,0P /p$  P@ 0 p(P 0S 7P 80080Q 0 S00R0#S0Sg SKPp R|PixPa RUZ @ P P 0SD 0S0C 0= @ 00 0<20S 4 0 0 4 $(L <050@0S 0S0SD0d@T $0T  T $000 T @F K   K@4 P @@ PP 0S0 xP0S Ph 0 PEpw dSbQS M {P@  0 S:NP 00 u7p` FKRKP`#VPP7 $TdeX?7H?78?705 %f05 0 000 0-@PL0N00 00 0 p-0LM@`,PNT*\0 T0#03 P00Sp@ 0B00R@@ -LM 0@`SFlU'lU'V'V'pSPWP1U- @ pp@KN1P 0$ 0A0Q0  pU@ T0S0pᴠ0fTS1@TPXppp -L Mp 4 , P Y YmYf ,0SX`L`U0` P@1P 0$ 0AQ0U ` PM@ T0X0U00S 4 R 00S 00S 0S P, >P`0SP040 0UX, UR 00000`, R00U00S00` 0M, R`T`,0S`` -L`^@PP@ Z p帀04 0尥U 0 0P  0meX?7H?78?7 p-0LDM X@KRP@pP`Xx @505,P0V  0eX?7H?78?7 -LPDMh@l \p P `hK@+MWV WVWP 0   hKT \ H P@2 $00  h0 0WV WVZ!  00hK\ `0 d P@ %0 4 l0 0h  X4 0,0  0i`VeX?7H?78?7 -0L@M \@KR`p@LZPP( @e `$p  0<eX?7H?78?7 -LlM80 SP, @ K@L< 00 D\0  @0|0 x 50p0 7SU0 Pj0pS `V 0S.0 PZ0pS \ 0S,0 S ,=40 0T $X0(0<0 0VOP000040L(080<0< 0 0?OP0000P`K",L"0P0K<P NK d` 4 0 xTd@5 -LDMhKP @L3pW  R 5R pW @T 0 T P0`S X 0S0 P0`S Q 0S^0T0 @T Y  0Y @T0P0 H0 \0 P 0 \0 0 H P0`S P 0S"0  P0`S P 0S  00$h00NP000  00$h0 0NP~0005050X  Y00Z  [00\  `00l Rh000h0 0iNP]0005X05x 0Th0 0 UNPI000[e -L$M@PPp 0AS^DK`0K 0`U80 D @ 0 < Q D0P0CSb'b'Tc'hc'@]P0 VD K# V! @!T,P80K  X8  000hS0:  10 ?A1c0 P DKD0  op  pP(\'gfff e -LM0p @@ LC3P`X0 JP00@ X00 0000 X0   L$$0(@4@Q0 -`LM  S2 i 10Kj J!O0p00P@0S2PU@ڐA1 1R!   7<'(L!L0Sd00d0c41 @*0S2 ?2`"5hU 0 (P!00j0 00 = S000 0S000 0S000 "=" S000 >S0 00(LN?7\5d5 -LM@5M""vR222 hp 0P 0P>@0C !p @#2  N=@0C40P ,0P(0PN=@ 0C! ̇ -?0LMj.S@ 0`?C0CQCD0T T(0(0 0 !!55 P P111< 1N P PP1N  -LLM ğ0vP@`,0 !0 h bdKh aI뒯hP#0S5WPUd0[pWTK8~h R h5h0A0D,0 S 8,dK0  @T@p0d0[W,Hǖ 0  0 0  B0 Hǖ Hǖ HǖL2 1l0 0Hǖ|rh _U 0pWp p 00  t0 }P@pp0W}l0 @0Hǖ5,# d[t Qd K0 R QQdK0 d K0 h Ð R h B0 0Hǖ 0Hǖ 0Hǖl B0l 0Hǖl0 0Hǖl 0zHǖz@BTdL54 Q00S Q -LMpP8S ySp S p  Wp!0S7 B `<` ` ``VW x1@ R4p@TT1 R P47 ST7吗4S TgV o'o' o'o' o' o'o' o'o'D7S "=" S NRu'u'u'u'u'u'T 1S1 RP P7S x40 1 SRP4 Q-L' QQ[$P P  P  P HP 0P `P lP  0@*Sv'v'w'v'v'v'v'v'v'w'v'v'v'v'v'v'v'v'v'v'w'v'v'v'v'v'v'v'v'v'v'v'v'v'v'v'v'v'v'v'v'v'w'7n5 Q-L QQ20@S Dx'Lx'Tx'4x'\x'dx'lx'tx' `0lH$7P  P PnP P, 50 0000  p@-1 @^PT * ^0 0S0:W0!0CR  101 ^00S0 00p00d0bT00!R 0S00 000S10C1 ̫ -LM@*N @ h -LM 9@S;0 900S93  -0L0CS {'0{' {'0{'0{'0{'({'0{'0{'0{'0{'0{'0{'0{' {' B)K p-LM@`0P*0 S& 00CS{'|'{'|'|'|'{'|'|'|'|'|'|'|'{' YPpYPJd000+ -LM`PTplOP 80 0C 0 U`- 1`000 D 0@  #$<0 `#  #(80!<4>0@"JP -L M, P0 0  4 0, `> 0@ P`p$#LȠ4 P`̠0@'@| 4P`0pdP0`SP:,0 0S:[J,0D,K,K4`,JJ -LMP`pNP 90 0C 0 V. 1P0 00C#$<0    00 #  #(80!<00" 0@J` -L M, P0 e0  4 0, `> 0@pP`$#LȠ4 P`̠0@'@| 4P`0pdP0`SP:,0 0S:I,0xC,SK,PK4`,I -LKP)`*< `KJK @JLB -K@LB @0@L28BS@ :P^P ZD,0 S 8,Td485 -LM@"`P 4K, @2 gJ0@1 @QX2 A K*%.K000T2 @X"00C\P D2 p*4K KCJ%K%K@8Kp`\L0\@o_`%KL$  @i_` 0'0| P`^? )p !4 P `"$' =t%K M_`" p(@ p K$< =KP)`*D `KIKKD K֏DK 4KI<K DI%.K@0P0P \DLD :TPT Z` 4KL,0 PS 8,[Td4P5 -LMp0@W,0 0`0 儠KJPK@Z@ Y@@060#0@?T@@ ᎏ @㛏 T' Ώ@?@ >@@0\0#0@?T @@s  ၏ } ᲏|,0 S l,1  @j TꄠK R@K _ ᔏpTdl5 -LM K  -LMp0@W,0 0`0 删KJPK@? ?@060#0@?T@@ ᒘ @㣘 T' Θ@? ?@0\0#0@?T @@w  ቘ 兘 Ი|,0 S l,1  @r TꈠK V@K g ᔘpTd5 -LM K  -L$Mؐ`pA0K@0  0V,@ A0K@PpV ,0S t,: @@K 0@] H 0 PRA0[`F0VA0KPTd5 -L8MP@0 T0 P 垸P0@ L@ D @0 H0 吸P4  @` T K0<` 0@ P8@ 5 -L8M†|`p 0TK@ $0 PS $WTd5 -LKM0圑@ab0^, dpc. ^ ,0S T,9VPf  Pb08#h"00 EP>00C8#h1  Z08#h_ #<" a0b`1@  vG 0P00PU J000 ^K aGNK  K \G g̗ 0ᄗTd45 -LKM0쀟a b0\$ d@cp \ $0 S $VF Ƞɠ 0R_K1 G JOKNKG #㈗ 0@TdP5@P0'H'8'H'H'H'@'H'H'H'H'H'H'H'P'   p-PLM@`@ =00@T 0     phFF0 0F88 -LM `p@P@ u=0T000PpW 0     oFF 0F8 0S R  -LMRP`p 1ST7SL  R @909;0R0,0 X7S X 1(#20010Q00S 90 9$18"R 0 t0S50t08"R 0000 t0SXl \X x0P@ W PoC ,0S$90$9T'R909 X0Q. 5 @X' X" 7@l86(!0(pP 1 0 QRXPX@90@9 XT7S''T''T'T'<'T'p',0S $90$9X7S #  ݵP5  00P@ D7 09009z  P89p089i Py AP<9p0<9\ p0 Tǖ\ Wa <Z00P00S o  fD70@< 0 ,$BP1<1, Z ,K 㱮P0S@P T90T9S4 -LMT7@S @90@9X7S 0p`P0eS 0刧8 P 5Z101p90p9;000S"0 (f ' 0S< P4 0 s 00S0 S4P  lS0P RY_ 0SP90P9 00 xK4 1 <  803 4 0R9 4?P X3 DP.-000t1 R 3 D77 D77D7D1 R 3  !1 R D76D7  (s0D76-00909L90L92S0P  SRT90T9l ,K=,K ѭPP{0Sx0StT90T9t5@6l5jN4 p-LM 00CSP@ $ڄ9T 0^d9 ^ p7U 5ph\( 00 p  (pT90T9p5 p-LM 00CSP@ $ڈ9T 0^d9 ^ p7U 5phJ&( 00X p  (pT90T9p5p@-@SMP@`@ S S 0Ѝp@909Ѝp S 0S 0Ѝp@S PS S 0Ѝp@`S S 0Ѝp@S 0Ѝp@+ 0Ѝp@ 0Ѝp@ -LTMRT T7S, X 0S; `K  0@ p,H` P`0  ,dp`0@\.d (P)$ p#L4`X0 P`  P:H0SE*XPⵐ h <hpa b0cP4`e RP@K 00S0S@ 0P RW 0S L`K 㫁XX0TSTPΌ\ ?J @\  `T 5 TX YP,0 S ,(T0t(l 0U  ^H)< NP0Sp Td5 5(54 -L\M@T  BR, `P ,0S ,0p0 00/lpKp0@Pp i PJ ;Q  0R  0  P005Lp((  0 Td\5 5(5 -LTM4 T78 S< I8PK P` 0@ p  `, P`H08p  `PLpP,\(d (P) 0@ p<`$ؐ #LP`T  4 P: <0S*< 8 ㎫P 80 -LM82PS@ pP`\  &K6"[9 S 5 2[ (L/D0R 5 [ 0(xX+ 0Sx0|000  B @R0 00 5 00(7S,7$0(,7 ( l85  8(5  5j555H5 -LM%@: 0S' $ 00ZP 4 -LM`4@Kp)0 , 80 5`XW@#0# <0 堥Pa T {P ,0 S , 8KP7D7 0D7  W@T 8K P<:( Hm8K P01  4#$( W<RM<(@ E0 `? 98K ^P t t0T (@P@TP0PP%pWP@@yTdt5555555$5@646<5 -`LMPp @4# 460 07+ll0X0C4W B  +0R )TS  w+353576r0b0s c t0 d0 [?&0p 6 &1l0!n?p  o?t 0 7x  ΤPx00x07Wx00x0jn 0-@PL 4 #}40760 2+B0 W0CX,+%#53&'b0r0c s d0D t060&[? 6( 0l01p !t01'!0jn -LiM:\, @P` :\ :\ i:\7 :\ `,0 S | ,p:凿P`@T GPD7;D7T7S X7S D7   # 4P 4`D7 ;D7 49\P`1p ȠDž \9=0  R! 1?077X7ST7S7 l R09Q7`9\ 9\ 0B`8 P`H7@ 108%S84`}8 P`u8 R H7 D7 ;h4`D7eD7 b ;48\ A(8\ 8\U7P`OT7!S D74`207ԾP`<T7S9 52`5 <' 0<7 X7 S<'  (P's0 2c0<'07\4 #$7\6夾P` T7Sj Pp x0  Pp`6\X7S7lT7S 6sP`Pp 7P` 1S S S 0 0  1t5HP`H70S K,)Kp0MKS 3 @S ,P`ZpV0CZ-M/K 3S) s# PD7<D7K P@MK 3S  S00M/K0 3 0 2Z@@@Pڊ 3$(RP 04 @R\ 4\ ,4\ 4\ 4\CH7@3PQ>D7#500#0053\ 3\.T7DS >1(v.  0rt3\ %h3\ `3\ ,PpK! (X7S 3} P KP [OK52! +j607P0K2\T *2\D7傎 00`9p00P0SZP@p@1j`V$80$(+P` (2\{`?Pp 0|S:sK | +`V0|00Pp| 0S*{Pp  0&P`PK! +P`P0[ S}N @ q(P ['OK1X7ST'R D7  Z(f 1c#Tdii iiiT5 %f4i i i8i i 7d5i|i|ii !i ii5i i 6i(i i i|i8i| p-0@LM 70'7 0'7 0v' Q'0 0Q0vn xPP\ H7 p8  iPP0P4 82@@W8Zp4,RP '4'\''?7(p545 -LM'7@R'7RP707 0-LP@T 00l0Q000L0d G 05 -LM7@S\P4:Sh鰲꯲07 -@LMn  0ǔ\ l 0jRl -LM<7@ 'T7<'SD79)00 D7)95(` D7X T0 ip'0(40 ,0 = h556N -7j~lPL`pPU_Pu1n>0@nT@ D7 0  7l UhZAVnN@0'00lP ( -5L`@WFD70D7l@z OW40#p /0 +0T7SD7 #00#0!0} 6 6 70) &p00303D7  03P7Sr007( /( 5 p-LM`lP1=0l@T@'0@@R l0S@T7S+#D7@ " @ 7@S 6 R @D7 p # P @} 7ٟP  # -L$ML5 `$  D70#,3( $= {NRD70D7T7PSu PpB 1@S ^ S!YTPW0  lx2>01T'R  7W R (<' 0<7 $0S $s FT7SD7  7SIP <'0S -000s0 <7&$PWp 0 RpVPP DpKllA 0   PPDK0=0  R! 0S1 \\ s1=0  R! @p \Td565N57'sX X7S1q  -LM@h逰 0-LP@q/0h. p-0LM@P .01T7`S{ 7S07lph p-LM`@XPUd90 d9p p-LM`@GPUd9 0d9  ##Z.7l l p p-LsML`^K0@ {N G.U 0S pTd(5 -T7LSP` 0 G000{x@ppW m000hT7SSPp WW .,2S   -LM K`@GP9 A p@P8U 50000T7S" ePP 0Q #-WW -,2S000 G0004 -LpN@PT` l0S 0S`3`#0S60S`VP p-LM7`QP1 \G0 92C{70C7 R xQ 0 Sx0|0 00C0Y*8–\7S7p0  .j<5 p-LMP`@@D@T1S p@ph p-LM@~{^`o0S oQ ph`p -LMgP07_{QP@ ('7pR 0S 0`S W@iCT7S ]9097 0 0 -L@`P#{NpP@ P@h0@-\PW@W Q 00S  Q Q @T00$4 0-3LP@0  Q  P-000Xd'0R00D76D73 D77D700H7 z -@1LMP@Q`'v>0S8\gp9"Ƞ2C3 ,^v> R&) 0\ǔ9!2C#0! `R ,2S0  01  0 i,jN 0-3L  P@ 00C0H7 T7S= D 00C(0D7H'6 D7D0 -T7LSlp@P 9RbC \ǐ 16100,0 R 01jNP50@-R9)Q4:4:  @$,  0 ܛp@-@^P 0S 0 0p`0^; S 0S1 0S  0 `\ 00S0  0Q   ^ 0S 0S0\@ 0^@@ @@@ ` ` 0 R 0S 0S 0\ ` 00 S0  0Q  0S0\@ 0^@@ @@p@-@`PR 0SN0RK \ ` RG R 0S 0S 0S  PP 0S 0R `S00 PS0  0^   0R 00 S00S0  0Q R0 0p0 `S00 S0  0Q  R@ R 0S7 R 0S R 0S0\ `S00 PS0  0^  0R 00 S00S0  0Q 0 `S00 S0  0Q -LM @Rp` 0S`V^ ` 0S``X  P0S P0S@@V^ ` 0S`` \RP 0SPP 0RPP^ 00S p-LM0@S`P @OP00S T0 0P PPP>pp 0-@LTP ,P@@T000S 0S0SQ  0PR 0P  R 0P P0 Q0P p-LMPT7ǐP@ S`` 0SF S p 0PQ Q T7S # 㮙PP 㦙PS00SH(((( T7SS# PPP00T'R# 00T'RPPV 0Sp`<7 -LM`PAAP@p Q2/& Q,P 0iSS  0i馷y ` e$(?(@(4@( Bv=q8l0 2 Q, e0@%Tt!t1 dXWTSPQV@T4hI(  @BT>:7 #2 ,' \ ۭ, ֭\ ѭL|5555@6<5@5H5E60J6T6P5X545`5h5p5x5|5 -L$M@0 ,  7s 0 l, W0< , W` 㒏R8 4 p[0 00 0D0 @ 000 0 H0 L @0Ss 0 \oP@  0R\D 0R ,0' 0< 0P < H0S 0\  00 P0 \\3 L R- Y' 0J0 W 0 \ 00 W4 0R08 R0S0 0< 0R00S 80@8@ pY, T7S 0S40040 @ -LM D76 D700|0 \@  \ L0 R H7 D77 D77D7T7SH7 N -QD7D7 88D702LS -LMXW`U@pX切K T8D(F(G(pH(H(U0E(E(E(F(D(T7Sj SK SB S) 07 Q 0 S 77 70C7$Q 0 S$7(7 ,70C,7 Plp0 9@{P  0 P 0 @{P 3 P0PT7  0 D7,0D7 N #Jl WA2  U񟗛0G(dG(G(G(G(T7S r2Q D7@ 0  P1015#( ,UdE((H( H( H(@T:DdH @4Hp,.555555555545 -LM@,T$$  ~<5T5f( 000_e 0-P@LP  0R P 8 P  0 0 000S  _ 0-lP@LP 0S P8 P 00@ 0 00_< P0S  P 008k_ --L MlP000, @"48<#hdV000Aڲ1 0S*TP0P00 0p0d 00 V P0000! 0`d0 0`0S S $ 0,0 0%Du@ RT 00S 000,5ppY t0@<TYT 0 ,0R Z @ TY t0@<TY4S  X4R R00CS l(,l(,l(Pl(,l( 0SV4 00!P 0 3R3Y t0@<TYT `0 ,0R Z @ TuY t0@<TY 0S04S `V##211@2 `SU000,0%M 0S 000Z0R 0Sh` R 0,S < R 0,SR00 0 R( 0,S < R! 0,SR t@T  0S @T 0ST 0 0   00CSn(n(j(j(n(000,00%< 0S0R 0S R 0,S < R 0,SR00 0 R 0,S < R 0,SR t@T  0S @T 0ST 0000S :S00 ReeeQ -@L;0 4S`   5P 0 0h(0sp pU$ #211@0 pQe00CS@q(@q(q(q(q(04S0 0 \i -LMq0P@S0 @TP  t0`<@VPTV R BQ0 00S U` PViT t0`<@VT0 R  00ee -LH0 R <0S Rh00S0_ -LMp@s P`: 0 0   0; 0T0@0 0P@0C@ 0P00P0 0C 00  0,K0K0 +PKP @ 00 0 ee -LMQ@P`p 0S T 0*@@@p@^ 0 @$Ph4@7e|0 R p0Q ,0( 0S <Q00Q 400 0S <Q<@7e0S  S  0 S   0 R010`0 BS RA* 0S RR0Q 0Sڂ 0-@LP>1P P .  b T 0@ T@d @T 00 0 "4 40i8#8#$ 0$  0!0i 00 0i0  BDi1 <1.X[0 ,0S ,40 S 00 0P  0 0@מ, T00T0wTz\TdeT5e -L M 0@p@A`0d` 0p0#!dPX0 0d0  0ppH  -LMKX? B8c0@ 2c2c@2`ϠAl  8 #, E.Mb -L MQ@P`90S S S 0 @`]*^  0[Pi,|p0 pd`P PU/P(PB7texB7|B7 0-LM PḝP@" 40P00 KPP吟0SLL@808 `P000DC7P( 0- L"48<P#HP1 T X"48<#HTQ00ADT@Q<0\@| 00 T@ RT 0hϝJT:<0\ T0T0X0SSX@0B7B7 -L$MȀp0P4`K$0 * 4P0S T00X0 $0S $ 0@P  0ppD0<0. 10 S Tdd5eX@7|5 - 0L PlB7pB7le - LMR 40 S 0 0 ͞5 - LMPP0P0@0@@ T@]D 0@Tlp`K.D1[ 880cH$H 0 \ __B7 0-LM0P [[@[0[ P@0a5 -L(M(`KD 4pK4 @$Ÿ$ 0@ Px Q eB!2b2c621b1c \ڼ0P*0 RP 04P:1!1!@P @@8hQ$2[S@ ` B1 2P13[@S `,@"!@00Q@0 n n n0B0\ eB!2b2c621b1c1\ 0T`4l45eX@7e,B78C7C7eee(e5|e5e5e,e5e5DeD7D7ee eq)5 -LMx`PV|pV tP6 P # 0 0s 0 0 P p1 00 00@,  l0P:0`0#$##   0 PE0(@Q@ w0+ 0 8 "8((<"8 8!("(!0QA"@A"P` t1S S 0\ 0 00(0S"1?0 0S(0 e -L !| <t1S  | 8|( KB0 : 0P!0\ d 允|,| -(  00eTdelee 50@-dd0`@S =0RHP00Q=0P(0$0/ b 0e eee7gfff 0-@Lt0P  0ht  -LM4@440 (0!nj hߗeD7 ee 0-L@P}PU@Z0 -L4MP0`,0 Ǘtv |P h 0bS700cS60(R6rN/(00(00O/"9C1 S 01&6 SƱֱS0ü6l"0@?0g}L2 R |PU 6S6S@0 R mP 40 T0tY0 8S ʰ0 G P!P 0QPV$1 A@10@1#J ,0S P,净|Z(N0 8)0 0<@K0;K<0K( 8 P@ T0 m0T0a 06$0 0$0Q<0P [ [/ 5t0%K>`PKdK(0D@XK0808( Tde:D778C75FrB74r)e -@Lt0`0p hږ, N? , O?Ɍ LQUP1 Q 0r00r0P0,H0l <^*40  ^:00000We:D7eD7 p-L M@㠖t0`V140040P,|0@ . P,ʼ0^ڰ0 ,0`0Q*80 080x0LP` `0 ?08K|phg<00<<0  eeD7e7 e 0-@LRt0P6 S \0P\ L0,  a R 8 80 ?0|0h2eD77 eMЍ -LM` QpPo \ 0Sc, @0W0T00S c V`U W W TD0@ 0 WY}))T~)~)~)P))Ȁ)) ) ))0)H))$)P)|)T8` Y 0,ڕ00A 0QP`0 0Sx000Dh0   }` Qh0< oP`0SF S) ?Px7`0T:0 f#08000#60 ?0\{ 0 0010IP 0S PQlP`} WP`w`t0 S0S0S 0S 0S 0SQ0s QP`S  0S 0S AP =@0=4 SP:02 / 50,H0H0S0@ 0 QϠ 0#` 0 0\1  00# 00 B0aR  r~E 0 0 0r 0`r0h0   . h0   = -` TUQ 0 Q  0o 0`o&'exD77E,5 -L M`@pP勔, 0 S_ UD 0 R R/ ,x  0 0EV, V ,a W W *P P 0S0 Rڰ7R'P 0S0 Rt0t000t0 0W 0 W* 70t0 0$V 6 P  p-LM0PS T0S0 P@|qP@ p`EP Fh0 00t1@00w0@070pD7E7e 0-6| SL@@Pڲ0 0S La P@0v@ -LM6@S p)p)p)܆)܆))06@T 6S|0@6P S000 0όy0607e -LM⬒X`, P P0SR9 Q㍯K"!: /iP@/D2(K0S S| K 0P@t 0KMKP@l_1X ( K0SZ SM X W DP @0  @XH,0 S x,|5W @ 0  000 @ 040 X// 040 00 0(K 0 S S WP@X , 8 嶽0KZ  `0>(0S9@\E78eMЍ -LM QP`@p 0Q0T00SQ<))))0))Ԟ)\))d))P)))))))))))T pZ X`p W2 dPph0 22  s t ؍h0  p ͍ӻh0  0S 0S$0S(0S 8p㶍p ᮍW(0S㥍᛼h0  0S  0S$0S(0S9p ㎍h0<<,80 ၍000zxh0   0o, 0o-h0  \ Xh0  Q(M-pKh0   0 po 0 o鞵ˑle`E7dE7N_4C75`5 0-LP2@ᶼ0h+ p-L MQPP%0S S S 0tPPcp*pT pL 04phc( 0@phE78ehe -X0L \<1  %( 00 0E7e --H0L Q 1(   00 0eE7e -L M줟@+@K0 0 PA+ ["2S& S (00(0E( 0S:"2`S0 S0 $(,<4<#: *0K0S0000 + ["2S S( 0S:"2S S0 $(,<4<#:*K) K)0KP 0 $(,:0# # #8 0)[ 048!,!$ <0# #$# 00S 52 R 2pW @T Vo 0Sg @TpWd +[ i0, O\`?0@0c80 !<\ P!TP 8PtU"\@P P<?!0@?PP@ ei@Pn ?0S:@P?0S: -Lp M0`,0 @4K  b!_L@T  ~0 S@( `P 0  RS  Z @$1  b!1@T(,0 S ,aTTd555 -LMPp`@0@@T@000` 0@0ᵮT000@-@T`pP*000  000000 !@T:p@-@T`P*000  000000  @T:pQ0@-P @00 PU@  0 000&p@-^@P%*`0 13R0   "7! 4<4 4! >! b1! `` ^:p p-L M``0@P$K 0 Z0$ $0K  00 Q `pTd5  0 00 M-LM , , 00 00Y P4  0?00` J0-<0`O+, !0d J @ 00S@Tg D/,0..P 80<4S84S0 0E,0崭 D ,Gp`W, 0 R h00h0 ,00ğ P@0, 000P/,0-4 0 |@4 p0{`q| 0 ?xJSψ 0Sk4 $*555 M-L8M000@KS@0 0@ K,0 0P0PXP U<  ?` J<-<0`O+, !0d 5J @ 00S@Tn0 0 Rb 0 8@01p0 PO P <0 0@K00,@K@<P@,0 P 0 0 R h0 0h0 0@K  0@0 @0T00 'PQX <l@0X \=zPz@,P D@[@0K00U,:0,0 PPXP 0P<0{,p`0 0` F p`<0 H 卩H0, !,?/#?"/C1@B!LH40 8 A40\!$尔4D 8HQ\4 V8 @ 0@ 0@0`o0UPhP@1@#Y@ `P@1<T@Z L2D`"S 04 S08 SH3 R6<0P PL2D`"S 04 S08 SH3 R P<0 Z L "0,@ S<`P PL#0, S PH,@0PH0 PL"‘\0,`S00`S ࠡPP PL ‘\0,@S00`S ࠡP P  -LM p`P\ ᲨP  1PJt0 0OT S娨8 0# X 1P0嚨 ?@E@,Pᇨ?@ ?ETL3"0 S\\L#0 S\8 0‡z@80 -L MPp  0,P ,@`VPUPa0  0` ,@V,05`VP0  0P`,0UPV p-L MP O> d  `D@0 @K@:P@H H 0 S 3 SpC?U -LM PL`8 @ TdQ P^@08/@ 0O ?S0 4 R P, ,@H2HP 0O  ?ETp`0< P̠\ 0!O>P `0/0 00R#Ac 0 \84@00d\ 0t!O>P `0/0 004@R#d \<0@P!L!40\0C40 d!40040T00Pà\' 0 O>Q `000 0$00C$0@0 L8 0@ 0\0C 000,,  ,y-7U -LM , p,L< 0KP P00Uq , P8 j 8 H`\00Ua "0O00U T08 UY P !40 SPUUJ 0K  PpX; ^0,"O>Q `0000  ^$0ˊ0i$0L 0QO< 00i 0 40Y i0C40!400400, 8r8\ 0K 8J p?C0 K8 Y0K 0O>Q `004 00 8 ^$0i0ˊ$0L0O<0 00 0 408040T0K 8p8-7U -L$MH , \P@`0 , 0`0 =C 0 ?P (0@_,0 8 0 K00S4@(@,00K` CP@0 ,0 ,  ,@ B  0@, L#"00C0\\2Qc dP0 K B,0@ ?B 28 R^ ,2PŜ0H H <0 R:00K B ?"C,@@K 0O @@K B,p`@ _ᖄ@K 蕖,) C, @@K` FP,% BHp` @_,0, !?B<@@<@ <00C0 08RT000T00C0, 00,@0K 0,8 PH X000QH,080 a@_B0K ,00K` SB0 ,P3 AU T -LM Pp `PP  !P0 0H@, h$%0W 0S@T, @G0 0TC0S@DTP3 A0mTʼ0 K 0O0@K B 0OPX `P/,>0l,0@@p0!,@<0 N<1PU`^0 0   R 0S<0^<@^0,0O`0 b s@#T**0Po 00 uPQ80@T0 Q80Kl  A` A`Pr-7h5 -L M L 0 `PP  gP, , Hp 0S 02 0O帐  ?AX"`PΠ^0 \000?00S1B 02 a^ Ϡ\0.aQ00/ IP  1PR\0/ `<PX 1 ^\0`00 /1Po0 0PΠ P`PTs r!0^ \000/ 010   B  0@0L0 : B S  ,0  ?   0@L# 2 0 20 0  s)H-7U p5555 -LLM 0PSp` 0O0  0rq8T0 LU#0O  0ORQ ?@<Ě 0@@K\ 4 84S 0r 0ȟ R00p  0q 4 ]P0  7H 0O,  ?@00p`U( 8, 0L080 ?`0 X78@`Q.,@,`0!08`00?.8@l, 04S1 bP0 d T0USY2 p K@00,@&>^ /, `00 0 S2p K0@!>,0 06^,@ `00 0Y10,k$0` 0$0L 0O4r 0 0 080`@ 5R,8`0`@00088?.a 0 bS1Pd  0Y ,80` S"05@_Q,`0 0  P000o,0 $8,@`$08LÚT  n ,j,    0@L# 000\H4Q 8d@P᧢,0 4R4 ,2P0p ppP8|@Pᐢ0 r0` np p0 00,0 p3R ,@0T000,T00P, p X0 ,00pK0@ 0zq` /?P@,2 R,`0 0 P ,0 2R,,`00 N 0 ,,    0@40L#"000\1Q; d@ >P ? ?,1 R2P0p N pD0 P; > ?9?P K PK0O P@K >@p`_$PK`K PK X,,P@KX ?` FP,%`K?pp` @_ ,?!>D  D D@ 000,0 R0D,T00HP, p X0 ,000 0p,5545L55-7U TX5|55 -L M p`,, Vc*w0 0 LP> x1HP 0OVP1 AR\000?0`0S94 1R\000 /0900 V 0`5 L#0 @,000 Q"000 ) ? B L0S @00" B"0 8Op=S 0 on-7U 555 -L M, p ?J>O^P``!>@ .2Qd, Q8`0/00. 0 b  B@b020!P,2 8R`0/.P @0 b  B020!P] 00`1Po pǏX,PN,0840  j0S200 OX40  S> `000/>0@@!N1 Q 0 @c00\0^  !0S  ^ PoXW, 0polSnW,0 <o8,0,/>pAYU E75545H5h55G-M$`PPjl0h (Qpdڥ!> 0! 0@$p ?> 1^ࠡD T! 0  S \ d@E? >i1^࠱D T!@  LP \l 0 \ 1( Q0 110b1Z 1(0l 1$5S!0SL\0 P3Ѝ!> 0! -LM d= P@0P 0 < K`85堐00Ȁ Zᰐ = \00^4PP@0 <p`W "ڤ0S0X0 Wڬ0X00X00S@TڠKKx0KPP0p 0C0 X0K`` _   Px@K000`K`偾PP\HpK 2 ^` `   P0`K@K 0 @"PP: 20 ` xK 00PP;0 d @;X@0<HӖ0@P屿PP@P ?ḀU00SaL  圿8K\Pq\ 0@K 0 0`T *00/묐00 T`:^00 V 0 0 _D/0렐h00dh0   P xK00@K@˽P-@ p0KH   4偿@K0PɯAƿ K P@K2P`ɯ0PK 0@KP @SPPk Y` K00PPo d @$; X@0 @0P帐2a ޾*0<H0@Ps \  @K00@K@JPP%0 0P堀K00* @d :X@0K P1ɯ0PK`@K 0` @PP謀` h0K00PP d @:X@0K <H喕0@PtPPp 01X` X0 0  ]P U>`娀@1( `j K P : 0S:0S: \g  P@K00PżP `PX ؾ`D 08%@0L 0`V YE K00夼PP 0<6 0K(0@_ 堐K0 K `PP P`01(   `K`0P : 0S:@0S=*@5L 0`K(0a렀K@_0pK` pPPa \ @K00PP2 嬐00V<` d @9 X@ @0<H0@P꬐0`( 0%0@_ K0 P ~PPP @9@0001(  Q >   `8 04 V& 9렐 0S+ 0S:0S* S>0R-LK ?@K  0 K0ؐ00 0АK000  0S:0  P XjUj %f55- M Ѝ -L$MP< Tp$ 80  000 8 00R00S 0K/E0 0 R 0U 000O 0 R U0D0 0 R 0W( 000O 0 R W0  @ \0P@ 0 0 R 00 0 000 O 0 R00  $ H 00 0\%1RR 0帀0P@0 ߛo0@%,p"0@ Po࿛x˛`0d 0@84@K00 @@P@@0Qix堛40 H 㶜8@T <T0$ @ 4喼Z4B4,5Sʰ0G@ W0   uW 0000fU0RU 0000CT5 -LgMNKTQ`UP|a *p\q 8 0BRS p 0S XA0S R P@ >K\fp`,0<4 D@ 0 pSpq  0K0 TPLX!1RHpATa45S:05XqS*NK `PPS?K 0`P 0P@ 0 R 0~K0K\\ L圻000  0L0K0>K\pAXa85 0 R 0^K000p^K000P `P7~K@ 00@.K@`Kpq8Kt 0KPSo`t0尀 p0UOp0 t $x! t!t1 僑R00X0p@K /0SutLQt PC@KBZ 0S1( ? 0p0 `aQ  d!P 0S!0(0 0p0p`P U pհ000  0PRoK p 0S㰀1( ? 0p0 0 S0p (0P UP@K p 0S㰀1X ? 00 p0K 0 SpA 0 X0PU 0 R 0]K000TaVT+0\ @ 0PK  p`PtS/ PKpA pt00QO0@H KP㰀tQ 0S tAKℑ00``lhh@K 0 RXtPt Z`@ 0T PT 0SJ 1p0.Kl1hA0PE`0O TdS`Q5 0S da.K1p0l1hA0( `QUpQ0 0S ^K000`aVDpQ0QZ @aT pհpq^KT0`Q3/nK 0| p尀Č| 0S" ^K000 0 R |qg /0|00 / 0 |ah00fh0K0dq WNKpP !6 p 0 S# 0S:0S*pa LS>R-0` .K a0000Q가 0S:0 }K0uda VhNKpP 5 0S" 0S:X0SU*pa LS>R-`0 .K a00B00Q; 0S:0 3d!^K1( 0O$ 0S!0(0 1p0p` U pp P01R/1 0S:0S :p0@>K 0|a pdఀ|a pKS>0 pALR-NK ?  K00@가 0S:0 1( nK0Od!Sp1X@KnKd 00F5@K Kp` 000tQ p P%|qP1 aP`pa R|q @ pp 0 R 000pNK00 b|Qxa p尀P|Q Y0t 1X ta1X 冑>KFXqW0K0 tQR000X0p` p尀x0K03pa~KP 4NKp` PPS?K 0! 0P@ 0 RW 0K0Wpa0@\Ӕ\80S L1iH L1<@ LpL Vp1P 4 p 0 S# 0S:0S*pq LS>R-0 .K q00@00a@가 0S:0 0.K00-K0K\q 0TS( /& 0S :0S:(0Sh0S 0S 0(pS  , 0 R 0 0`00Z 0S:0 0TaS鰀X0S0TS#e %f5 M-L`M`@0 00 Tp`0 K00X@ \@ 0P@0 D@ P t0PXP 0KP KHQ P0`KO P@K  4PK@00@0D  T@ < 00 M3 ,00,0<00P@KL R-@0K@ KPKD 0@K0 0S:0 A-P8@T`p T ?>00c0Q3@T TX0X  0S  R1 018ĠE755p@-8`PL\ Z* [*Z*l[*Z*Z*Z*Z*0 Rp!>0  ARp" @0O0 \p @0#O1A-8pL\ [*\*[*H\*[*[*[*[* 00!> ,A "`P?HA0?`P@0A-8pL\ \*\*\*]*\*\*\*\* 00!> ,A "`P?HA0?`P@0-8Lp\ ]*]*]*^*]*]*]*]*0 R!>0 R! "A"!?`P0HA01 ?0`P@0 -LPb@5 -h1LM`Q`!00pP@<10 Q ? 0` Kp O4 `KP05S`KX R 0 0 $0005<I  \0,PP LkHh, HL|^OPl^PH\009004h 尰h 4 |tdhd05T5L55E-0 LS03R %5p00P5,5S ڬ4S9Ӭ4հ4S@0Ӱ400tA/SpPo5@"p%$\ZH0L0SO/͎G-HMO<@C@C80@?K4,$@( @@\ 0Q: `$ ?(Pp 0O/ 0 @? 0O@<0o 8@Ǐ 4ɯ`0 ,0 (0  $@ 0 =0 5\#HЍT-80\%R0$Ğ4 0T -L M$0Qp `@ 4P@ҭ Z 00#00A PP@Ѡ Hg|0  00Q h@LKHE$0ԑ:$0  -$0L Ppԁ  TP@`@0 S@`V AP@P D 0 0 @  -LM, \0d Po740@ 8@_<@_,!+`, ,0T0C0,Ě,0YZ  ,0Z 㫅,BMl 㦅,D  [T5 p-LM80@SP0 0l0S  `V p  0X0S0 -% -LMq@@ -RP` =S=T8 K8 4P , 0@  J8` $0 #=0T00S<K !<0P`ST    00S  ` @ =SP`\ C[x*p55 -LM4 ԑp`8 C8 PU4,0KP(ß @TV0"h0 U,0 ᄠ,002 0`pBP@ ,T P0@o%,"0@ Pox`0d 0@)0@K00 @P@ ,B0-8@U@xnj00 H ݍ00xt1 4,0KP@A 0S@@l0P0S 0S1 P 0S@@l0P0S 0Sl0P0s ,0T $000\%0R ,08 0,5Sʰ 0p00t0 0S0l0P0}l,ٿ80080Phee 5E7eledeT@-@1T0, T:F@ 0000 0S00l0P00 -LM, p0 40@M4 QL+- 808 0 S408 h0`,Pd ) 0> PH 0 RI E80 X4`V,dT ? l(,4` h0`` `0COPHh ẃL5HsP5,5S,pS.>,$0pW 4Ⴌ4P4 SHŐ 021HXo40P040 -7 p-L Mp@P0Td``  pH@`S< 80`@SBph8 al.7e55e@-QM@ 00CS ꬁ*܁*** P0 Ѝ@*-@Ѝ $  TH7XH7E7E7 -L4M0 8 04 H0 <  45R805 R8 P 08D0 ,0 \ 4H0 L L 0S404000@TPU<0H P0 P0 T (<885 0p T`b V `!@  ? SR`P 'L  0SZ 0S 0S4 $0 S$0? ,@K0 0@%D DQ04 $0,@0pcWW `H@08 $PD ,$D8, 0SP0 T0$  40 40 4 00D ,0S,K0 01 0S0 Tt -LdM0 0PL UT p 80S S ~XT t  0@t@ R0000  0SH6d @6X 0S 0tS00S 0St@ 04 S$4%R:05S:8 0P0R00S T 0t@0 S:0S*(  X 0@ KS0000T00\0 0^P0 ` t@4P '@K4850 aX!RH P P t00@P P P0,K00P`t0 Po 0 S 0S:0S* 0S t 0@ 0 R0000L φ, 80` S@0P`400` eHH0X #P`t\\n4H0 0SU ,婪X00V0SJ000PUXQ0 0S 0S 0;0PX0Sy L@TGV T0@0K@\0@t@X t b0P@0XP\Q  0`P1 R 0, $R0000 g,~,,0H@H<@ Tp@@K4P & 0S) 0S:^0S[*4 LS> 0@KR-`0Kp KK0`K@0@pK0@; 0S:0 2t  0S :0 S^ t TX 0t0 5XH75 -LMp80S 0S 5R`lP@ 00300@TlP@ 0 1P0S+ U@Xl 0S!0R PP Rl0`S YIQ 0S00 00@ X T0S 0S x0S 00 00SP00300003000QYឩQlP` 0S P  |00Sz $0w s :V5 e5 p-LMP`P@0$SQ@pQee -LM@h -L M@P0  00 0R@@ -LlMp T`P| |  @t0 p!Tㄠx  0|4@ ThK@  XlKp 0 Pp\l [x0 ( 0SO 0 1p0$t@ 0St0  @T @0P`V U  @T x ,0Rp 1h0 0S 1p p0R0S @0P` 1( ?R 1$ 0 1( 0 R @0 100LSl0 @ Z   W{ T@0 0|40 px00@ M l0H 0 1 ɯ 00R00S% 0S" 0Popx $0 0SR 0S Hx0!,0 0Q P`0@Sl0  T[x0  ( #@t x(  #00X 600|0 ,00,0Pp 6Xp ިPx0 1Xɯc %f -L,MT,0 P0@ @K0ZZ@ 0 pD D0S~ @@$0@' "p X QDYLD 8Pc@KD 0S @ S/@00S@D0K ,0` 00 K,@ P 0@H0 ,@ ;D@4< @\D@ 8 @H $@ PH 0 |#p0  u#0 #P0KP@0KPo7, E",'$`PP0 K00K0D@ 0PT, QH  008@S@K0s@ Ypyi -,0 L 0 0 0 7xetepe-X0X  00P0\ P0^Pxete -0LMxxpP@`0 0P 0T P0U  ᴸP  %fxete -hp@L `P0 0!R 0U R00 R 0@@0V xete0S R00  -LMP@`Q 0SN 0S 0S0 Q 0S 0T $0pP! 0 00 0 R0(p 0 p00 00000  0S 0-PL@ 0P0飸 -LLM p\ 0&l  ` d  ,0 h \ 00X0 P8 T 0: S 0@`  P@lp  T0$  00CS\ iP@d 0RR<0 4 D0 @0 pQ 0 004 D0 Td0S1 4A^ / 0S 0Sc0S_`H ` 0SL 0@; DP \ 0\ @,P=,0K /00P@|`40S;;S48 @ ,0H @0S 2 R 4 R P  T0( R00000cCQD0Q 8 < 4 P T0( 0R  R 0L0 0L00 PRP ` \ 0HQ0㐠AH 0,Pid RRp0S 0S0d#70P00S\  0` $P@+4P+ 0C R    0@$;D0P 0P ?0/;?00 T0+S  Th j060dQ 8 <P0QP 8 ;;S 8L@0a0\H7 585 ePi H0 S04 0000T (0 S000000 0S 0 S:0 S* c 0 RT0T0((    Q00Ŕ0000@000,ʤld70Q00S0?00d R X d0R0P00S pQ\l ,0S# T0 K0P@ T R p0Sh 06000\00 V\  'e\h 00 K60T0P@TQ p R h P0@6 0qh P0600` P@0S T0 K0P@ T \0R0  0;0h g06p0Sm 0` P@ ;;SL0`00S6 T0 K0P@ 0 ' `0^# 0Sp00^ 0 0 R00p  R T\P Th 0600῵\ 0 S:0 40S#@08 0r@0 @ D08 R08  00b4 <0  KP x%/; ;L@DK 0 `@WP*D0S'\ P P`XW0T (Q  R 0.SR 0.SH0P 0PW -L8M0`\@ p@: \@7 P@0< K8\08 pPPP@@T0( R)0[*0[S""[0R0 0R@ R @00T@ K0P@ @P T @PN@..5- -LM@ KP 0 0 0-@DP L@᣶P00 4 0 0 -( L0S 00*a 0-LMP@ KP  0S 0Sl0P0S F0000 0- D0@L \ PP0s037 p-LMP0 @B 0  B P 0s 000Hp @_ 0S0( 0p00O0@8@v@p370 0S00D d< X R  0S 000 p-L M0@ `Rp K'0 R= 0 00 0 R  00 0 O0 0 R  00 0( O\0P@ 0 0 R 0  00O0000 00 0 00 \  0@0 0 -7 -LM`P@2 80SĶ***Ķ*Ķ**Ķ*Ķ*Ķ*T0$ $PV 0Sh0d `0X 0S  0S 0pSt   0|  -LMp0P$K`'0 R 0 00 0 R $00 $0 O\ 0 R $00 $0( O\@0  0 R"0  "00O0000  0 * 00 0S00p00 0 0 R00t000 0 R00(0p0H0 0S0000 0 R000 0(0 0 R000D0,0 0 R000(000 0 R000@040 0 R00 00080 0 R00$0H0<0 0 R00d0X0D0 0 R00l0P0@080S; ST04 $  L 0S 00[D080T 00h/4[8$0\l0 00 $00\ $0\0@0  0 KK-7 -LM@P0S` p0s 0s0s$0sH0sL0s@0sD0s3 T0$   0Sp00R g P R 0Sd0X0 3 R 0SD0D0d0X00h00D Q  0 R000#d(#X R q T0$  0P|0s4 00K R000080Sx uSn 40p0P\4,0S:00 S*(0sQ T0$ K  0S00p  Q P \0  0jP00s000(0s T0$  0 0 00(0 0Pq T0$   0Bu  00sT0$  S0st0s_j 0Sd0X07D 8#8S2 0Sd0X0#8#888d0X0  0S  d0X000d0X0#\d -@P 0` R00p  LQp \P,Q 80S  % 0 R00t+P   0!:0 000000<  0  x O -LM`p q4 @   w 0Sp00Q PP  0St000 0  0Sp0,0 ,  0Sh0ɯ0,004 S \4  4 PP 40 4  0 R00tpp 0 R00p@@PP64 0PP,4 PPPi00, SR000,\ 0S 0;00 R 0S 0;04 0v 0 R0000 t  0 R0,0, p \P 40 J0@R RJ 0Sp00TO 0St00WQ <PJC 0Stpp7 0S  p@@-H5E p-LM080S 0 R00 d X R  0 R00 d X R `T p 0  0u` Et @ -$"LEM0`,0 8 Rpy T T0RpW  PcP1 RW 0Sd X 10S W  ᨭT1 ,0S H,,000000000 0P 0 0C000C0000Cv w MOK $ 0:P GB>9Td 5 e -TLMM`0 P,0 8<; ,0S ,^,. R T0Q\  0 R00@+d8+X R< 0 R00+d+X R/ P @!(P@8L D! 0SD1: R| 0Sd X :0S L 0 RL!00\*dT*X R @!@0: S w <1L H S0D!H1 0 00 RD1D  000DD!000D 0P@X 0 88X@!@8LP!0TRQ  RT # TXH1S<r@ LDP@0  OK &P@Gy<1HA SL > 0H1 HQ9 H1L 0RD0R `FDH!0SH L 0S L10   R 0S 0R H!  0SH1  p00S@( HPL1YD!000@!8IPD0 0C0 RD  00C0D!000080: S Y@D 0 RD00L H"6T!R \  P@Y6 T1SL00C0HT!0R0C0 L 0 RL  00C0L!000H 0 RH  00C0H!H0 00<1 0P@~u ᕫKPpP1P 0S 0 0  p   0 R  0S00t000Pp Pp 4@ 0 Pש թ2 ,0S ,)0000@P1800 00000000 0PpdT0( 2RSOK0L1  0@! U/K  < PpE 0 R0000 0 00 PR00009sT1H m 0Pp3TPpMOK TP 0(pW y  P10?o0 0C000C00000000P4T  0S00t00t07Td e5xH7`H7 -LMPp@` Vv |0S 00S Bu ^ JP 0 R00D!dp 0P@' T0 Pp0@Q !R"g0 0S00505 0d0 L D?(@0ˆ -?=*|e-7,5<55 5 0-FLPo\ ,0Sq 0 S R 00 -LM^ @ 00Q0 \ R1S  RZ(@o #00 -LMPp  P,P F`VPUPa 0 P` FV,0zo`VP 0 PP`6UPV -L M P,r0`P 0ƕ6 ,@K@僎P,60 R,哐$@,0iH?oP`VC i*o1 S2`@ P7 io!0bR0S) PP0S P  VP@ 0# 0,0C 004 0C0,$0"A  -LM `,劂PBP00  0Ɩ6 ,@K@ PZ,0UH(@ (@n0 S2P  e?> Aq P- 0lQ0  PP=<020 , B 00*  R0C 0,& 101,刏(0Z"p @P;  $= ,ďp5<5d55 -L M Pp``$gn0V: = , 6 $@K@P$0$`H@7n`0 S2  0,0 00D 00$($w; Z=<5L5X55 -L M P`A \00\0SE( n,6倢0 0 6,@K@.0S-,0(H`mAp Q ;  ' 0,&0 00 00 Q,& 10C1X0,̎=< R,; ; ;55 5 -RLp`$P@ $P`mA0Qd P 0l1 P0PLP<L 8@ 6#1@CT b`Q@DU6@T`4 RP@mgQpU< R PH0L00 :00嬈80&L0,K"0XPL,0HL H  0R08&",K@H ,0LZ  L H H0D 00H0 t0 P5 %fl5 0-@PLB/^  0000 000000 -LUM0 ,0 80Q p h! 0l t t&@0 B0PTkUK @eW?K T1 @ P XA DA d 0Sgd 0  \ P` -D1dQ0c0Ux1 $*@MKT0 P`1  >K0 \  }P` l`P tAt Q`l x!U:h1d{0@hP0S:0S:PP R `Ppt0l0 `x,0 S h,0T 0$ l!t l 0tlp Td5 -LlM0 ` 06t0  h 0` d0 @l@ , p @4 0d `Hh@h0@ PP<0 X@ \ h x  4T0$  00CS4` ᝊPPl 0@RR@0 8@ H0 D0 x\ 0 008 H0 4 l0TS1 4A0S*p@L@ pP it t0 BOK|  @K U KYP@`Q0 0R@`pd0S0@ 0Pp@d ` pc0V`0MKS >K>Kp @Pl!cd屵0P0@00S &0`P/VUh1 0#@ J H F D B @ > A?(K T0$ 8 0R P \0 0ቨP00s000(0s T0$  0 0 00(0 0`Pq T0$  000sT0$  S0s0s -@P0 LRp` P$ R 80S   P    0:0000   <0 0   TO -Pq@p@`0  v`SL pP  QR0`00R@ 0S 0;0Q 0S 0;0TV ,P -@L80SpP` 0 00   U   # Pp0! B! -P p80LS`P T T0RGV  "P:@1!R/ 00' !000 0nP 0! B! V  ߨẉ P ᓨᎨቨᅨဨ e -L\MP@H D `T T0RpX \ `  bH0T wHP W ጉD劉jᄉ \ T0R0 0"0   P X 吤PD L 0T0 8!R 00T0 0 0d0  X \0: S NH0 T P S0LP0 0L! !L L0 0Ph 0 DhX D/T` 0\Q ` R  R XEP RH TLPA0 H HK ᰅP6H0P ST  0P0 P R P T0RL0R b#P0L 0R T 0  . 0 R* T0R& P0S! P0ST@屈YL000X DP L 0! B!L0D囈D崈P0 0: S YTL P` R00 S T0! B!T uP0Y 10C1 P@ 10C10 P 0P 000HX00 0 0y DK  DPYd pL@P 0PT0 YTQ 6P RD2`Q00 S APP 0! B!P0P@000T 1@@K0C1T0    0 0 D 0̡P.0[S L d#\"[X3R`  04  0 D 0嬡 5{T P bP P0!RBY {4T0L 0R` R00 S T0P2!R !T000P0 CPL P? ` R00 S T@0! B! 0%DX 夦0 +H0P0X00S*X"0S TL Q 0 0 0 X D〦TL 0\ 00 .RdDX m 0X b80S 5H3 NDL00 0 0P 0DK 0 D w 5D5X5@5\5|5..5 -L0 e 0-HPML@<< 0P$0/"A0he5l.7e -L PP00 e 0-@LTP 40S%T 0S 40 0C 40l0h(0 0  !(  ( !0c1@e -LM0@S.A0 S p00Cp0e-\ 4^ 0S(0 0!!( 0&( !! N4  p-LMP P` P p@@`0  !( ( !%D+ -(0AL0$1@TPop 0S @TP \0@S000@`p@ qC0Se p-LM0P@ R*p0@S 0a!p R P 01U`P V000V00C00S R000  Ne55 -LM @R)(0 Z$$ aV p@P0S@PUZ0`V$ Zc|o<@p00Cp0@T  *W V  W V 000^V  ,  0(P@ 0V,0  v000 [:0 nV h0H00/c @>0 <41041.e %fd5p5|5 -LLMD R * < @ 0   DKP 0@8P0SD0Q  S 40R0 0  (0S  8DKX000( L Q00RP b0SYP @ $0  0l ` #6P`1`!0CS00Lp Q   0Ka0  H 0 0@P 0V0R00S0 P PUPP U R 0 0,0cp @_0 P0Q  0! 0 fp XP@ĐKT D0 KsP0 1@ TZ0(^00S  0S 0(R00S0 8 0@000̠ ,00 @0K40 b 000P0@ ĐK 0 0 0 S  \ @P`1sS@ TZD0kX aDK PP P04 0R0 p 0p  0S W 0SEl000 0R0  D08 0 Œ@0P 8p h0R  - P r#8D0"0  ! (( !]T@101P` 0& RVV8V 8p h0R000 000#0  ! (A( !0@ 0 cH000C0x 0&P : g#]@P 400C400P0 !( 0&(  !"`0!!0( &( !! , !(0 A0(0!!#8=E U P`  ` 004 ``@Tg 6 <01001V&1010 40 000 40S  jD00 8 Œ@0P (00  ! (C( !8p h0R|Q ]"(00  ! (C( !8D0l! (0 0  ! ((, ! !6f (0 0```%P 6 }"@0!!0( H ( !!e(00!!( 0 ( !! 00 z&0 u& V '(00  !( ( !!8D # 000H P` @| 0@@G% Q00V@@T+ | (0! !0 , !( (, !8V[ 2Bp h0RU S000 p 10 1 !101!0 (00  !( ( !@ S!0@ 0 cH0 0 <410418 0000 ,00 P0K0@0@4 0lp000P0 0 0K PP PN, 0(HTK7555 %f5555tde 8000L840 4S000 f0@( 40PS(T;(0(0  0 00 $ 0 , !( (, ! 0@ 0HcVP T@8$T0  x0 00040 D08 0Q 000 !( 0 (  !@0ĐK p 0DK PP*^ 1S0ST01O aP 40S(0! D0@Q "000D0 00DR\8 00@T (040S00S`@ p88Y Q-Lp@`: 01PPJT: T    -pL@P`F he -LM` KP@ P3 T *$pK 7PJT: $0T: $0T*D0S d$0#&R :0R *0a !b(0 P 6 f5 -LM0 P 0 pWP @`4  P 0$  cR 540 W(@ 0 @w  00U W 0 a P 0  P000 t5 -P`p@N@RN^``LP@ 0@|K7- ^$  0>0>0 S  $ -L MRP`0>0Sp1x#  n0X< `80  40,K<  P8   W00 P00S 0~p Wz3XP8@e,T@!  8 Pd0` @000 m0 |P0000,d0 00Kw H0 0P8 R  |K7t5 -LM1` 0 P.p@  @0o `@^ K0 n @`P `@@@P0p dade'f'|K705 -LM>\0ǠȠŇ@`P'0 ` p P`P000U 0 0 $00 0P(e  PP `555 -P`LMY'p  1P@ (0%Ơ  0!!( 0 ( !!@:P`YXJ"X -PLM`@ * pKt SPdJT: 0 #Q:b 0QQc05$ 50P ! 'ff5 -.L$M 80 0 8 0(0K#̌4 @# 40`P `@@oPZ8` ,4\T \1,0  bp 0^`/ P  043 @T( 0!!( 0 ( !!40 S0 08 @:pj,0 0Vx,8R8 \0 h p0S &,0 0I,p|K75'fe 0.  07 -L M0@p` P000 0 P0000 . .$0K PP `0 $P[  t5 -L$M0(K!Ÿ@00 P0 p`@ PPl1, X004  c`p P P@0 ! (0 V 0!!( 0 ( !!4!0YXn00S,,4` `3@@@K@T 0!!( 0 ( !!8 044@:ʌ`4 pH\0@0D Q %,4p  a0q de'|K7 5,5 %f85 p-LM΁T00K! 0@`P `@Ppde' -LMPN4A@Tp`0l,K, T0   \ 0,0de'\50 -L`@PT@@0p*<@ p-LM@P`*ph -`L{0S 0 !,B$ R; 00S000@T dpdP 00@0 T00  S,<@0h鰻ee0t_|K7ee+0 Z +h5 -LMp@T 0R 0;@ 0TP`P @TPPU L @ 0P00#0S eee|K7t5e -LMP|`|p@lT l0dU @6@H 0S 0 0C 0eee 6e 0-8@PL((  0P000heee -LMP` p᣼ 0@ 0-@PL0p4 0x P(,hPlPP 幾|PtP0|5 -LM@p`0 P000| 0 㜾P000(0K 0 (P*ھt5p00p0 -LMp 0 BR@p 04 hټ -LMPU 0S 0 0`0UpU @S 0SK 0S' @0 R 0` 0S0@  0V@@@`vPUPU 0S i0SP0a0S0  0UPR@T@PH 0@T 0S 0S  0R ` 0 /0@S0@  0V@@p`@T 0SP00S0  0UP@T@pP -LpR 0Sc0R` @T` PRd R 0S 0S 0S p0 0Q 0S!@ T0 0R0 0P 0S0@  0U@@@PPU*@ P 0R 00  Sp00S0@  0W@@@pPU R0 0}0Q 0p r0S0@  0W@@p`c@T@P{ZP `R[ R 0SR@Tu 0Sr T 0S  X0 0R0 0P 60S0  0UP'@T%P@` 0 00T Sp00S0`  0W```p@Tx t@0Q 0p 0S0P  0WPPpP@TP` -LM `R 0SPXPU  0SY   @pT p@TPXPU  0S@\PTp 0Spp 0RppU @~@T p-LM`@PP  0@Q : RP T0 0P \PPRpP  0 Q: RP0S 0S0SQ  0PR 0P  R 0P P0 Q0P 0R4 $0 $0cc0S  0R 1P 0R 1 0-LP@@T0 0-L@P 0Z0PS 0h0 p-LMP@ `0QV php p-LM00PU* Q`Ph@T P10P1hC0T0p'P  X0,P0 0tt? @P `X0 P L@TP80@$T_deeRcK75|K7ef5 -LM@T0<<hL((h  P1h@0CP1hfedee0T 7 $ 0D0 b-$0  CHL0"& a-$0  CHL0"& { -HH!LM@ -L$  0P   `,t5 -SLM@p`O0 P000!0 㲲P0000004 Wp1V`!Wp!( K!P(0P (P 0WpU 0S *$0V :@PU 0S:0 ԲI t5 -LM@p`0 P0000!G0 VP000004 Wp1V`!Wp!( KP(0P (P 0W&pU 0S*$0V :ZPPU 0S:0 v0 n t5 -L MPp`0 @000$0 P00004 00V`!Wp1Wp!, K_P Z,@S 0WKpT 0S*D0S6 $Q %* R/ 0S,R@ 0S:,@T 0S*$0V :D0S@T 0S:0 c0  T3 Q0*D0S40  80(0S0p` W$0V:D08 0RD0 $Q %* Rz 0SwR@ 0S:0p00G,@TC Q@*D0SW @T Q:Y4 000(T 0S*D00CD0@T 0S:,@ T D00CSD0 @ T0 [ 000ɰ°ᬰ000 $ 80P T $0SD00CD0@T $0S08 a PY00 t5 -LM0`pP @000`#0 㛰P0000W,P@U D0S PU000 ԰000@0 İ,PpU 80S D0S$  0CPUD2 H &RX 46S|\ P 80S\PU000>,P@U D0SD PT00U00ST 000ۯ000!U 80SD00CD0PU,P U 80SP U0D00CSD0 $ 80+@D^4   0(\ $@@1D0D00  t5e -L,M@@ 00 j4 00Z!Y1 Y !, K 1P ,P 0 S*40$Z  R 0Q 0P S:  Q P< ]*L080 ( S4 - 00 * 1 R& $0 a Spi piW 0H 00CD0 H HpP` @T D R_,,x,x,,,40S1 zW $04, Spi pi 0`Q 0  , <0 40400@ @4<P< P  Q:@<0Q(0 % 80S00SHm00CS0=@@߮K7|5 -LMp KP`@|PT  *R 0T :800S$@ T: -L Mp(@PK 0`0e -LpP @`"00S0 W 0p0Rp$0$0$ 000 0-$P@0LS $`0hj0 -LM$@P0Sp  0$HiR `0 P000 !a0 pP 0 0000- 4 00 `0 P000x <0 KP 000(0Q04p0 i鍮`ኮt5 p-L M0@0CS0#0` P000 0 P0000h0Si00<Bp04 P0KPP t5e -L M P` @008#0  ۭP 0 004 00( d*,` V0 4 p 0S @0S? "S 2C@L0DpS$(P 00Sh0(0h0(0  @0@` V0l l   0pp@uL0SU(P 00SK40p 040Dph0(0h0(0  @0@L R 0D0S  0ppL D0S R 8R 4 <004080$ 0/4 <0 80 $ 0 $t555 -LM`0p40 P@h@$U, ,@PT( ( $0,L H8040<  @0FT0D  PF T F0T0(@T 5$5X5p55 -LM@0`p Pq+ W@T   ?C00cSP @TP ?C00cS <$55545VUUU05E6D5 -LEM,0,0 pK Ÿ(0"KoKT(0!M8@0P,0 0 004 0P  X' (04? Q  Q5 P (0&! 4!0B@@T  R R R 0 ,0S ,>R'0 ( 0"2@@ @T   R R  RXRPTdT55`55d5555e,5D5p55tede5555 -X0X L1?0c1Q< 8 80 ?RhW-7gffffK7d0@-0@Q 500CS ,,(,4,4,4,,0SQXP  +a51"% !\00S0L Q pdK7 -L R0ԑ00đ00 R010201000pdeK7NN -L$M0 0 4 S@P` 0QT, KbqP`>,0 $@0\A $0 S:2\7*Z`!>20K0  0 @BP $00 >2Q2^:40`, R ,00C,0,(0,Z ``0K 0 0,0 @p` -L$M`4 :#:S$@>0. Q< "&0@ PD  H 唩0 KcP 0D0 8 0@PL@  1 0<S-*$<0Q*0 S^ 0S[$04 <S1$ (0 $Q0V)0K*)K j Vp:00L00 S  0<S:Hw4@ DL V8 (*80S0)0K 00 HaP 0S)KZ )0[ S  )KjpV:0 , 000c P ) K D  -LM 0  S 0` p @ 40S0@0S0 (X 0WPU`pW >0~pW  0h:#:S 0Q0S:SQ::K q   `PS8 6 $0 0&P 0SR  R ,0( 0C,0  ,  0 ` 0`K ?P000$ύP r ,0 0R,0 $ 80SS SPT P: QS@@S. 0   000  : 0K 0 8uPH 10S     0@ |0 P80 J,0( 0C,0 : M, VʥU]  R  /$0R+* ? & -LM`P @75 0S2 *S"*`R 0T)@PbT >0N@T 0UT$p  00 Q ç( KP(0 $ @D PܧX -LM` P  0RL ``R >0. RB 0V?X<:SV8:$@0p P000 0 ͧP0000 0P (0K 0 (PS0 t5 -LM0S *"*R 0Q bQ >0Q 0\ $ 0@-@ *"*R  P b.P  P \ $@ -L *"*R 0Q& bQ >0Q 0\^ $,$,$,$,$,$,%, 0 $$ 0 a$ 0 0-LM*"*R 0\.@b\ >0\$ 0T!0 H,&R$P 4d 6R:`0S*#0  0P 00e -LM ʠ,ʠ\ 0R lR >0. R 0^ $ 0P  -0LS    $0` P P #  -L $ -L,M00 R0, P4 8 0@00 0S ,0>0>000  #20#0 Y030"8S8 p`004 $&80! 0 0, < ]P@<R0Q6 `0 @000d"#0 2P000@, $2 H)&R R 46S  @ ,  0Wc,0 0P@,N\ 0 80S 0 @ T 0 < c<\ Trp 80S   |0@ 0  P 4 00 T|0 0 , :#:S 0*t5e -p| '6J`0@@X`LA{@HVT 0 S @Tn 0S0Sde@-00S@(0 A R0  10  0  !( ( !@00C0(0 " R 0 000 0 !( ((  !  B 00 000000 R  0ete|ee-00x0CSp00000 000   !!(0 7(0 !! 00C 0tee 0-(0LP R0  10  0  !( ( !00C0(0(.00  @ PP0!!( 0(( !!` 000噱(0 D0 0!!( 0 ( !!0tee|ee-(0 H R $1@ 000 0  !( ( !00C000S(0 R0000 0 00  00  !( ( !44000 R  0|eetee@-0 .!( (@.!@^0@-0 @@$!( (P@@$!0@蒳0f -LM P, 0 "X0P0 ZY2  P(PP""Q0\0 dP`PX P U hY0  a0D"6!@AdA4  8 40YDQ< <0 b40Zj801cT0@8 04j Xf4 "*p@0&08`  0>00 00>0 0 0P  P00( ,0d 0 @\00`T@80 0R^PA0 pW 0gS*@`0S:>0 N@ T *$PK0S J $BT:|ᓲPh5*DD@ဲ0>0>0 0K7RcRc5e'f56 -LM␢0^@xRxŸ80ShD 0pnS`nL> 0^ 0 ^@ 0R:0^@60 0 R   0S 0C^P0@P0UT 0R( 0R0S*0B60 0 B0CR0  R  B0^P @P0U 0R*60 0 0R0  R  B@0^P @P0UK7def86d6 -LKP -LM@P\# ^/T%*p`V ^ 0S\\ 1`1 @0 0XlT 0@P<04m(\e66K7ff66D6x66 -2L M0Z ! 0CZ pWpWa\1Ό 00 XPP00 T Z !0Z00G Z, XP`0\p3qPU,  Q 0 0 00   #&`:X !0 0` X01 P#&:`X P!UDF Z,H<0X ,00 oXo K7fde|K7Sc6 - LM 0\ , 0` @,pP 000 p8 00\,($0$\oK76f,6P6\6ded6 -L MSp,0 `@ <0R0 @0R D0RTZ 0s , 0 Q00S(0QP 22D Q 2 Q  T T; 0!` V `Q00000  B (0 $00C$0Y (0 00 000 00 0,,0 0I^(,0$ `0  !( ( !Y 0  !( ( !0^ቯZ '&:` XP00P%H,HF  0`=,0 0 000`  !( ( !0001` VtTY@1`V ka VgM4eee %fdeLe|6 -LMp\`P7X4 , 0` , %&:` XP00P%FF``  0p ` 000p  !( ( !000 #&:` X00$ R 0 0 00 0   R0 00 0 0  !( ( !00C0, 0 0, de -(0LP4` V 0  !( ( ! |s #:` X $f R 0 0 00 0  [ R0 00 0 0  !( ( !V00C0, 0 0, (0 b R0 20  0  !( ( !4b00C0(0 h R  2` 000 0 !( ((  !  B 00@S 0  00C 0 R000!!( 0,( !!X00000PP0!!( 0(( !! , !(0 8(0!!0$ 0R00 < h R t0V @T 0  !( ( !pWdeete|eeK7e -pWL `At00TPPU pW(0&  0S 0$0!!( 0 ( !!0!!( 0 ( !!(0 -lalqLh1$0 PS0HH<0L@T,<@G $R0000 0   B #jP# 0  !!( 0,(  !!0 0S0@@@ 0$ 0 p0$ d0 R L0@0S0@@@P 0 00 hedee|d -LM KH天D0 #Q :b 0Qc*0 'ff p-L MP`@ 5@@@t0l l0@@X0X ET`@@1@0STpe|K7fffSc ScK7 -L$Mp0 0 4 00 P$,P Ǡ,K 0 PP\`0 ܠ @D T 0  Y\x0  , X,@ 0P4D 04 8 00PjVJ0Q,f6Sc Sc %fde6f -4!LM0pP? @0` P000 0 #P0000 (0K@@ 0S|0  t (PXT@(0@@(@ Scft5f'f Sc -L4MD0 0H0 8K@ < P @00K@,0S00S*0K40 S80S0K0K0KP KPK 0S@pǏDf#VZU@D 0 0HPK0S@#&:@ D@A H1Y:`P Kp@YW,0S00SY< PP (0   0S) 0!!( 0 ( !!(0 0!!( 0 ( !!Y0P(QPK0`0p0D0 0!!( 0 ( !!40Sʪ80S -LM@p 0PP`  0S0P0hV^ 0PP@> U00R0S 0̠ W0U0V00S (0T 0 TV U0P0UA k V Z 0!6 P0 U00R0S  0 0b  0 0 -LMp0PU`% \ \ XJ (0C(0   0  !( ( !+10PU0  $@0!!( 0C ( !! -0 !( 0 (  ! ݾ(0  0   0!6 000 `0 0$A0 0 0庾8U,e -LDM008 ;pBf 4Z00P#:0#UhKhKH PUHPU@0Z00 0!!( 0 ( !!PU AX 00 dPN(0 @ Z00S 璧0 !( 0 (  !0 !( 0@ (  ! e$P,W,W,W,W,W,W,W,W,W,W,W,W,W,W,W,W,W,W,W,W,W,W,W,W,W,W,W,W,W,W,W,W,W,W,W,W,W, -L`YXPX0D pQH@ @ 0,FhE0 Ade %f6 e7pp 0@-d@0/C2b,S03S0#S<0<<0bQ/BR@ H@0eVUUU p-0LM 0`PD  `@ 01 0V1`0 t @ ?CSD00D SD0\ ,00R0S %fdee6eVUUU e -ܐLMp 0`S' PS00U 008 0B6C0@``TP,0X@`84[($J 堻0ee eee 5 -LM pW     M W̠  |yxVt6l@0@0S  \  R  Q 1 pW V 10 1 D0u(6 RcS 400C40   !!(0 6(0 !!(01001 PpURT%$10$1( 0şp00p0  1R0100T0@ 0S h p0S  4l h0R 0  !!( 0 (  !!`Tʥ0X00 \ P0S P0KU q 00 PPP X W \0KQ0  @|SX41 `041P0P@ 0 K0KPXPP`P Q Wp  (0H@0!!( 0 ( !!(  R 00g  RM (0J@ F0K$ V  VkhX0!!( 0 ( !!08! W8!  (0  0a} th0K @0 u 0@0!6 AX K vP 0  !!( 0 (  !!@@ 7  . 0 !6' 0P  0!6(0@@(l  H@010010P(10(1Y,10,1ee -RLM101@@0T1A d0Sl0P1d0S@D 0 ^c@dlh0Pk 2@T YX `(  Z @ YX0S400C40 !!(0 6(0!!( pY 0P& XK<1H0<1 0!6 qP 0!!( 0 ( !!I p0!!( 0 ( !!( Ip T00R00 S n<x0Pti101]eeete|e -LM̡,Ơ@00 4 ( 0 S8 * TP'*0%Q :c 01cQq*`, @(0Z U:8Q0 < R@0RD 0S基80S80(0#40 0Q!0000 00C0(  $00C$00(000004, Q 4 , 0 0000 @@4 8 eefede -`LM Vj3PP >0^P%&@8 8 08S V# R 0SS:~( 0Sa 4 0 { PxP$&R:0Ra03, 5:| 0 &R:0R03:0 S @,8 10lp1Q01c1(  P8 0*R0#  R 4 Q, Q\ , 1`@AdAP(0#40!Q0!0000 00C0(  $00C$0, 0 (0```, 00 P,0P0S ,0 0 0 < R@0RD 0S@妹,0 0eefdee -LM@T> aqPQ0000 0!!( 0(( !! , !(0 8(0!!00000@0$ 0R@0(0 < @TiedeeK7 -@0LM@T 0( T  S@K76 p-LB MLP@  , `  0`\TP`PXL `0`0<La`Pa 0`xp\` 0`8$ a`($a! 1`<0!,148!t0dx |0htld0dpe6686t6666T66666X6666$6L666de6 0- LM0PS0P 0PdP0BP!\0PPPx@Tp 0@ \ PiP L0 Pa0h(0%deScer_66Scf$6,6f46 p-LM@`TP 0U- @T0P\@00 0S 0  00 00 @0D4P H$l Q0`Dd`d00d0p0<S 0  00@T 0S\ʒSce@-0\ P p@@4S DP \Q DQH4H40H4H4DSDd00Cd0Sce -X0LM\  0R \ @ TT000@兒Sc p-d0ML` @P0 K@ @P0,d(4ppScX6-X0^ P ($\,40\DP ^Sc -EMLPM0,0 |$ tp匓0S S 㿛P@,P `V FK@0D @P4 L$ p t H <P@dd00C@S񟗑|s,t,Tu,Tu,u,Tu,(s,80S|0# @}Bw|3 ,0S p,p,PP@ @\ 4B P\=00@d80S|00 0080S+  x\ 'BK@$@0 PP@ 80S \㵑\㲑^@0 sPP@ 0 K@\ pPP@  xT} @yB~KpGpGG>K0C+ P@I mT1` \AP@d0SLBKAG>KA0C+w P@ 1` Y( PU! WpG 4 O#J6; 0+ P@An7$# P`@/DTU WpG Y|@"<0@d |4 TdK7_h6t6td066Sce -L|Mܒ@0XpP 0 0_P@80S S @0X 00 _%$ H2!b10S pP 0OP$K8 4#RZ 0`E` 0 VP @QCN@ 0 !E0P C@\0PP@X 0R20X @ %0H!000dh00h0$!T0,0 $4>0CFT0 0P`d0 P 0K0 ^P@rp KT$;, PP@dT0 4P$Lxtd,U_K76e e6666<6 p-LM0@( +($00`sP P000p(0; ("P $$4RPU@80S# @0@ P 00 .^t$h00bh0@GP mL0(,$00\p嬙@ tdeScP6 -L M @ 6@"|, -L M@ 0@Ց"|, -LMXp$K4#&:@aP`! ($@Đ@b0O&#J86$;\ @ \-@PF0O#i_0 0+400 P0i p6 -L,M< @@ `dD @D< 0RL 0 @_<00H@ 夛H 億 <L$@D? 8 冩4K 8K,0K_P40s Z<Ld  ?Ჩ80P@f"pd`TAP@ 0K0 @Dl`,X0L 2Wp`0"H0V@0, x$ 0^P0l$ R(: 0S$:06>0. U$ & @0 b$Kp @@P$0 0c#& $ a8x  e$0 0e#&B8 6p@-$0Q:0!a61c"QPo * 000"F!V:Up -L K`PL P >4K40[S2 Kd@KxK 1P 0 1\@0[d 0@0K@["tp0  K@ KT0 P z[P 0S \00\0]K K[PpQ|tL5T <5T5` (K`` P K0[ pS (K@K K 1 0 1\K%[Pp 0P WY [\00CS\0H4T? !<4T 44T8 r 10aR001#0p 10bP001#0003T 3TU @1.mUy @y1 q8#0000q#0000O|g!2R/W2TO 2TX1X2T p2Tx2T d2TW X p L2  R): p (2  R*0S + 00SP 5#$0$  R 5R00%"48<#P g|1T @1D1^L1T\1T* 1VL1T T:@10SPW  0dn 1T3Ge MHaWu 0Q0 T 0Q0Q*00Q 0TdliHLi0UiViiileiHgildiHfiHii"i !i i ixFixi %i i @ 6L 6Ri Ii Qi Si Ti -7i Gi Mi >ix 6Ni0WiHPi Oi Ji(Ki -9LAMpWP0, ` 1 $ 5 -0S S/cH0SVE Q> HP`PP ,蜠K E 0[S -0S h@ 0 SR8 RV5 H0S |0SH|0[Sk q0(0000q(00 00 0PP  Ld00d 7P 0 0Y0  ǟ,0 S ,jP0005S Y _P d0 RK5$#Ġ0Č7K7K4x@Kl p0 lK0.KK0KtP P 0S0 0F0$ dK\K0HKd0KcKtƟ@K.44HKHK GK3K0P љP@  lP 80S0C80ž@T 80S0C80ŝ .K[PL 00S 00$105 H0KZ Ph ~tşP.DD0HK CKH0KGK0P 厙P@7  kP 80S0C80A@T( 80S0C80 .K P 0S0 00$10Cp4 R() c(0  `əGOK@-HK dK  $ğ(P0Q Q 匛P  ᰙ .KP 00S 00$|3 R )  (0xlxᏙ^@K@Pß HK( dK0 RP  I v=2 R (0 Y hK IkP 000 ` 1P0 02 R 0D Pa 1 R0 1 0   CVD  |P`7q 00( 0 )0 X1(  5 0`00|00 R` 0S  0S`00 0`E U 0 R 0 R 0[S0[0S[Q5#$0$)K%"48<#Q #PSTd,Q_-7 6T5$5ldXd5 6 6H 6 6d"f 66 p-LM@ PgQ0 `0S R Q0000S ph iP0`00 0(0 `S`6 p-LM@Pt R0000 0P @`U00 0S S @0S SS00#0S0@ R \00C\0 0@ 0 X 0S0C 0 ph7k d"f66 0- LQP 0 @R T0h c -LMM$0YZ,0 0P X1  4Q x4Q -`4 ,0S X,80S^0S[F/0SSV0SSRQO3XS O3X0P p@/`Kx5  4 K0U00  3  R0TK\0KhP 0@ X: !xK U0h0  d  P` 0@QP@0pS0S 12XKOK0)v2Xq  SK 0T1 `V OK0 S `VT\ T< PU p ` 0S0C 0 00 R 0PV PpP0ST PU p ` 0S0C 0 00 0@0S00PVPpP]Tc@6@-|0\ 0S \ Q @ 0 0R 0 0^@0 0Tc 0-hP@LP 0S P 6x0 0@0 S00 0Tc -p0LM@T 0S @T P P R0600 hCyTc -LIMp`0,0 ᴿ00 P 0SvP,6 ~xP`g 0 0 PU 0SPU6y ጿ100,0 S ,Ũ0SU P 0 0 0R 0OK`0`0MK$A0K<0A1T (K 000Si: V R0600 x 0S0C 0 DvS/K 6700SP` V gP 00 0 `Tdd61i -LJMp0P 0  0`0CS 0  0S FE: R000  R 0CS  NKRJK00<0 K 0-K $6]xTdt62i -pL@P 6 w`V70 0 @T6@ 8x -LM@P6+x P RP0S0S 00S0 0- @LTP 0S@T00S ZfP@-`p000 @0:P^0) S^0S \PP\00A000P0#" 00  0#" 00  P0S\L_ScK_ -LM0@S S  fPP P 0P P P0P P5 -LM@PPP  0-P0L@T P0 eP0@T00d"f-P* 003P: 00 ? >-RALQBp`L ePUe 0 ST  xa 0S d Ȧ?>\D@ @\P0 S Td566 -L M`4 X, 0 2PU8 S@OT1 PU0 R) 0 P@ 0X0Ÿ,Ÿ 0 0>> Y 0 0>>P@ 0 0 0>P@ 01 @T p0S @T00 R YDJ P?J8 $1 R 0 0 \ P00Q00Si"QPW,p 0@ 000, PʿP, p0bSʳX0 0 R PZ0effN_6 -LM{, @pT`P 0S$ @TW  @T 0 R @TU0 0 R`0 h0 RP:,0SW y  Pp0N_ -LM@ @0T0  0 R @T0K aJ%X0SA  AR 0 RQ R\0500S\ \S:00S S* S00S S:00S S* PeL_ 0- LP t @ t 0 0t00d90 -LM@~9 Su Pu hLu -LpMpxPK0@X 0 "b9x0 p`Kn99 0 00   00#0 Q  TdXdld46 p-LM P\ 0S \pQ  R X00G\`@M \K GP @P ;PTT LcP  FcP T# T 00#0  p  2cP00 0  00  0 00   %PP ʐPPT@#L_L_ -LM@pPPT T ~PD P1@T T sP, @T:Pa0S( ο0S 0 @ `( PpP@ P`p广(0 h`0S h(0( ⧿@`0S(0( < `0S(   e,Q_D6|6666,6 -LMtP0夀K@(x,0   c5%#000K$2 8K4 KK 0 n qT`K@@0  \0K[ K@ 0@ 4@  QPI@<P 5X0S0 000AK`Q @K@KKKK 1 !0 1\ڸ0[00K [ K  OP ,0 S ,} OP/P t0 R0 T KP ,0 R Tdd5X6,Q_p66 -L|MPK0`x@(p$0 d nbLKhKK8@0 @P 0KKT0KSKp0KoK,P (P 8@ P $0S D$80 0\0꠾Td556,Q_6 -LM⸁QR Q$ p`]\ 0 l R .R Q 0ll RL .RJ Q?QDKPK [ b [000[S  A0BS 000S |@KX#7K 17 [PK,7a700l0 0 %"4 4  0 $0 S $嘢lTdH6 p-LM(aX 0R@0 P 0BS \0 S*0 R(  0S op'X0S 58J0 R (  x0 R kPSH,KvPPTd,Q_T666 L_5 -L0MԢ0p(0 8 PU 0` RP U PU `0S6 VPDPKXBq81PE( 90 0@8 @ D 0SLhI[Y0S( 5TYP2Wb208 HQ 1 0@80zHP10  0? "YP E,0K8 P<080  , 0R0% *0峵TcTcfTcN_ffN_f,ffh5 -PLUp `2X !@@( 0 {jZ P$4D 00b0nj 00C0ff0 0   00 80<808 8<<80808 < -LMð㿰0aS008PU U p00C08P<0 R% Up 0R`<0S P<@0 z 0XR<0S㋰00凰 o鄰 0@<bTcfffN_f -造Lp0S k`P00f80S Hp`80@@80SV00mQTcff -L?+(0 0 0N_N_O_O_Q0-4 $Q Q(0 `0P@ 0R----- 0@000 0Q QX0RH0 R@0RP0R00 R80 0-pP@LP 0S P  hP @0 S00 0i O_d6 -L M0p`@A P0p`P 0'S1@ 0S 0S 0S0S0S 0S (0K  #) P,0:S @0 40 RP0MSy0Po:0 00C0 0 XX 10000 00SZ:XN 4 ) % R= R1  R) R <4(<"4'<(#,(` ## 0P `@0P`(`? 00S S00000S 00S S0 0 0 00S`1 RLL!00 Mc`1P@  0R0% :P 0 SR0]0P@ 00K XP 0 0R0% * V' UV$ (pPff,Q_6yff fh5 -L$M8 4 8 p0Qg ! 0@40X@0  0 S@@%` :V :4 0sPP0,!!-0@0S ʀS S cS( ; R4 0P804K~h @@ @40 08S0=4P 1  0@Y -<-|---4:P@ 40S 1 0@4 444 S S4P 1 ( 0@Y YY4P 1 0@Y Y4x4u40S 1 0 0@4eS>ʂS400S 1 @0@YX X(S 40S 1 x 0@4(0P<  ();4$)<4 Y840S1 p <8^400S 1 0@X400S 1 8 0@Y> 0'4dP4< 4 < P 0X < 1 0 SQ*<0gP< D 1<:)01<@<14@0D@ 1\@D( @ <0 0 0g(00 <(P<0~ S00  ƟA.L` BP`0@<`4Pt4@4 <@ 0<  S D  :00K< ~P<  0 0R0% *hS ʇSi FS" St400S 1 h 0@Y'XDL%4 0P<   f4 )400S 1 ` 0@YX#$4 0P<   7D4 7400S 1 P 0@YcX@$4 0P<   h="4 c=400S 1 X 0@YAX#4 0eP<   g44 b4S 0CSd30S X X8#40EP< < < R ß `LP`0@<(`> Y40:P< < < 2 D ( 4P@@ U P D00D@ 484 <1@:)0144P4<<400P PDs0(0YXh400S 1 H 0@YXGX!4 0P<   ;h4 ;1 R!4`P0@0S 1  0@4@U 0嘰0P@ <,0K P`4  , 0R0%` *H `P8/f,Q_6 fʚ; f fN_Xdld f6 fh5 -LM/R, 0 p^ 00 S0% I:X 0 ` P0 3V <+V V2 0R0% :P 3V0000`QQ@0 4 ,0S ,哔 0KPp  0R0% * 0 S0% :X dK0\ d0Kc K\@Kl # dK0L UPS@@KHK|0 H0KGK HK 00 <P@: 048 <:R0D0 00 H K\p 倠 |P p x 儀 h`K ,3 (3!10S dK K0 $(,<4<!4"< K0 l 2 Rdf咯\@K  c 0K0 Ppr  00R0% k*,Vc 0@S0% :P9 0!4 R`P Q 0KPp  0R0% *_ 0R0%@ /:T 0 0Ra% 0S" 0S0% :P 00020C0 `P 0KPp  0R0% *+ 0KPp@  0R0%@ *<V0K0 Pp  00R0% *$0P@ \ 嫮Td f6f L_,Q_ 6h5 -L M@0(  $( ,<4<,4"|P@U110SPHDPKR0 C0KD K<`K0SG  P, 40" T0X0SS<1 R \0R:1  R' \0R$*W*0P@ XpP 80S0C80ڔ0@T @T (0S `(\0W00S0%" KTdO_O_O_f O_86 -%LDM0PTP ,0 0 S80\0 `P dP @`p K:X HK@h@ 0@K hG0KHKHKhP@0[S U4 ,0S ,哒?0[0S 0D0gCT#\0-\0-4-4-0SY 0S ST Y @0K@ [R R h@K QH0KPd0 T T Tz1-1-3- 3-<0\0 PP5 1:)0100\ 40R0 R21 \00 0( O0(p IT1-2-<2-2-0000s00ux00004XK X0 .00 00880"000` PU 0S0 00 M8 00 T 0 8 `0< 0@\ `0 < \ T Kd08 P\ u;r1 f!1 ?0[0S SO1L 0S5#$0$#KD?0[0S>Y ` C . 1  HPP 0S 0S 0 0R0%0 0":d0 d R  0 dP P P0K P`d  P 0R0%0 *0L0K P` L 0R0% *奬TdP6XdldN_h5 -RL M@pKPPTX 0U0 0 @p  [ P`60W0,0  Y pz*0.Sp Q:W000 p,  VP* YN* Qp *0S .S  Yp*0S .S0, 0SN*0G>SKpA @a0@RSD0SA La0LRS00L S:W@A @a0@RS PA@0@ \-P+^pGPĔĄ``W Y *0.S,0V* Q:0 0, S*00S0C00  00 S000C00 00c 0X  0 1^ -QLMP`pd V00UPT0 SRJ00SSFPES`FLSH0SBj0S>0S:0 S6?Q3 ?R0Q0E\) R0FP$ Q$ @R" Q 00S00S NP0pi0\0jS\ 0jSg NP -L Mp, 0p  4p 0SAR0 > 0`V @ T 0 R @T40S` pV,0 `Y0P P P  0   P  000P ~NP040 e -LPRM40 020 pP 0$< 0 W8 `x U @T 0 R @TWPU0X0`P`80#2   X0#00 &PK EP<  0 <  4 R- R0' 0R0"00c,$,!$#,,  ,K  00S 48 A 4 8 100S00,0 08 04<#$ 0P<0 <  <0 e-7 -#L4M0P,0 0pT0 Pp 0R0% :Z. HKJ0H0KT0 0G Kc HKX0 l@T9 h0 @@TW1 h 20S' @HKLP0 P_PP x2 ,0S p,Q@L@0S  P K; =2P@ r0:S,0S00S40S80S T , bMP0S 0S$0S(0S X PMPQ 0"0 # W $!06P h 00S! @P0LHK P  PP0P0 pi@L@0S   P K L0K PP7 L 0R0% 0*妩Td#f\6fʚ;h5 -((LM0'Q,0   (\ 00S:p:00(L00 (( 0@℠K 0  KIP` K`KPK Kk 0K@K 4K`KPK  Y 0 6@T 0  LP0 @T0[Sq RF  T` 0: 0000@S1`6   0:( @@Y 401K<1 0@}P Q 1 0@Q 1 0C0@\ 񟗗E-F-F-F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-,F-F-F-F-G-,G-DG-\G-tG-G-G-0S 1 0@\ 3 ,0S ,0S1  0@0S10S10S10S10S10S10S1 0S1B0S10S10S10S10S 1t@K KK0  tP 80S0C80 R01 R|K0 9y0[0S1@  TȠ |0P*^TPK(@L0( f 00@S*PL ( z@0 R 4@40(0@ڧTdd"fN_p6,Q_666Y -LM@P~`{px @0 Tc6 -&LAM0p,0 `@0PK yZ - L6 R @6 R 0R0%P s:Ui  KbK ^0[SU 0[SI 0[S 5 Rş@0 >5 ,0S ,׋K| b0[0S0S @5 R K 0 0OH@K0@K KG0KHK wP` 0P 0S 4 R80S0C80űPxK KKU !@K )JP80S0C80ž0[`S 0[@S KK JP00  3 R K KK)NK(H( / Pz!R0 ! 僑Q Y0 00 S T3 R` KK@ KKY0PI 0P˦O !@! 0K@h& !R3삟! }20SPAdPK@K=`K960KxK c0KdK0K0KKK-\KK )KK %FK !0@wP@KKK0 0KK |w1 R K KK f0[0S@@RT1 R K KKdyw= 1 R K@ KKw 0 B0 R K KKi0[0S5#$0$.K0[0S5#$0$-K0P@ E?K P p P  0R0%P {*L¥TdN_N_,Q_f(6@6666X6O_ O_Y-666d6 fh5 -&L0R@!0 0P` a 000 kPU0Sn 0Sd 0SZ 0SP !@( B("("48

 @ 0T  # 0@05S1#=#=`uf\flfLfp"f<"ft"f|"fl"fN_fN_ L_ffff,Q_$64"ftffeh5 -LM p04`(0@S1!(P3T /+T T `V 0S,0K <3T+0[+0[11,@[PZ0S (0K )&0[S'0[(@[1P <T -L MPp 0)S0`(4P 0 0A( Q0%(":P `@D 02P`P @0 00K( PP 0 0R0% *,0K( PP , 0R0% *fh5 -RL M`p40 @0S SP V g* }pP P`eV@1P@ SN SVZAP 0/0K W00(<4<"4!<^00 S: 00g0 @P,0  00g0 @P,0  0g0 @P*0  0g+0 V R*K"[P"48<4 #8V0PˆʎfLf -0L0@Sp S /S S 0@ 0S 1  0 @0`P``0Lf -L$Mh0L ,0 @ /  DK)0D }L PhhL  0Q^ 7 0(@3T TT +T-  PPA p3T0000aa 0V43T !T +Th0 3  )0@L PL @(2 ,0S ,<<Th0 2  )0 L0P1P@ <T (eP@  00Qh0 1  )00LS0L  L `h 048<,Ơ0ŒHK)0= H L0PhhL b@PK @ [R! R Z 0Sh0.  )00 L0PhhL .?0[0S S #K?0[0STdT6f -LM$0K@ p3T#0[#0[00QQ,PU@T ` `U*0  P1`@(Q( R0,S  3S00! 00!R0 -L8MqP@ `PY 1 \ 3RC @,R/ )R R 0 S  @0\:L0K VL0[0K0[ 0QR+R(@\:H0K( tVB0[ 0@\:T0K h%[h00SV T0[<R0\:L0K WVL0[0K0[ 0Q FTdd6p6 p-SLPMPK0`@0%0PP@ ppp p-L MQ@`; 0BS'{-{-{-{-{-{-{-{-{-{-{-{-{-{-t{-{-{-{-{-0  ph"mU p h2 0Pph4m-p,R 04pLlp( 0 ph'lp6f8P_5 -LM1p 0S 0 S- 0 S*0 S'0 S$X8儨h@0  Po00@0( 0S 0o*0C0 MRM.0'Z`, 0S 40 G0S 7P 80S0C80Śdǟ00PP hh00<'\0@0 V  0P6000 0@<TT h  0 @0 <0S 1 8  0 @D&DƟD0 0SV 0 36 R 6P 40 80S0C80ş00wk00@ (  0 <0( ;00<!0 R \0R:1  R \0R*P&\ 1 0@V 0<!0 R \0R:1  R \0R*0 \00 400,0 0\Z \4 R 0@55 R R  R R 0 0<,0 Pi 0 <0S 1 X0@x3P@ VV A\ IȂ----------------------------------------Ђ---------------Ђ-----------Y  0y   040 0@<0S 1 H 0@Y  0@V00S Sh000d00S^ 00S ST0 0 0P 00SJ (P0<; 0 \0PDjb@W,00S00 , ,@ <P, m P 80S0C80ڌ00x, 00,0   lP Df8 \N=j@fN_N_-76t"fl"fp"fTfN_6N_f|"f -LM\ϟ , `0 0  xK0 봠KKX p̠ P ` ,Q0Q 4QXQ0@S @0S 0@0S 0@|0(S 0@0fT0S0`0(@CT00:U KPppP0K` P| R U 00|  |0 <000S U 0 0   000S U 0< 0   00P$ U 0+ 0 0  P P0S@  " BxK B@D 0S 0S0S0S/ 0S, 4 @00 S X  40S8 X  \\0 $(;0S00 0S 0 :#,8#$ " "4"0 X 0s0 0h@KU0  `Kg0KhKKK 0P0S L0P@ 0 0S 1 P0@ R \! X 0S 400  \1<1  QKx0K@K@PE \ X `0S \ 5@   R R R R @ R R R R RpX j d0g Q !0 RN \0RK*^"(LKP L0KR ȟ,0 S ,{LP 80S0C805hLP0SQ  ^  0 \: 04 P<4(<"4\  0b0C0 S 0 ڀ0S   0S   0S ,0 0   ,0000 S/0S 1 `0@p00 xW Z0 JpYZkx6P@ cZPp 1 :)0 1 6 (@PP K @  0K_P n 0b8#8 #00S!$ 00l0  04<#$ 0 @ 0D8#8#$(,""(  0AP4 0 S  0S000 0" ##<0 p 0@R 1 p 0@KP wF8@07 I4P@ A0(S 1h 0@1  R \0R*0S\0\1@0100 K! 0KP1 @01 v00S Sm000i00Sc 00S SY0 0 0U 00SO00S SD0"410 0S;900S3 00S S) 0 00S X `0S ̠  1<<1P 1 0@5S!`P0@P 1 X 0@3 P 0SP0S 5 0S00S0SP@ T  48P@P 0S  Z 0S_e1P AP 0S1X@0P@ Tdf64f e<f$f\<7TfN_lf60S R(0   0LKLK  lT@0- |8#8#$(,""( I KF PppP" |K ! P  K !P  K !P  K !P xG  R-LPp`~P@ U V P  @17 -LMPpU!ZP` @0 0P<4(<"4!< (K= 0 ܽ 0007P 0 @0` 0 @ Z)PP 1 U   峽0@`P0 0 000P p-(RLMP`'0@S @0S1kP  00 0 0 0pP  0 0 7p( B(0P -LMP@Pp ,  ` P 40V80S0C80O00PC0 0 HdP& UD@ %f -LMh@Ᾱ0`00\0 -LM@0pS`Ph{ P@ @D0 -L$MP0#A$ @0 pP436T0 S\7TQ 0Sd00d00d0T<7\<7 0-0LP@ 㻺P8 1 0'S(dP-  P$ P P P  00hYP00S S00000S 00S S0 0 0 00S0ʚ; - 0@(SpL@鄹PU`( 1:)0100`0 (0( B0 @ @ֳ7P,0 S00!00S00!40XS00!P00! p-LM`@ 0PR $:P 0S0 0! p0e0 @P00 Nhd@0P 0K P`  0R0% * 囉Lffh5 p-T0T@LMK`` 00P`\ 0,@p8YcXcXc p-LMP @5`#Ġ0Č ,P 00S qjD #211@,0($ph$(P_Q8Yc 0-0|%L"4 40`P%@"4 40$0S 0,P 00S 0h7P_P_ -LM 0R @`P :U  0S # 00S0S9 S1@0S 00S$ P 0S P0S 00S0 0 00SP` V 1,P`$(5#$(,""( 50S 0S0S0Sn 0S 00S^ P 0SP0SP  ā,448!#8?As\5#$0$ `V pp +P`V 00S0S 0S0S0S  +PX (0S Stg0 (  n0$0(5#$(,""( 0Sd0P@ $0K P@P$ $ 0R0%P *1QP_8Yc fh5 -pL0P@S㔃0 @TP  0`@VPTV ( R  BR(  U` PV moT 0`@VT$8Ycd"f -LMP8 P`z 0`=Ppq P @@0( 0 @ V  0: `000  ѺXm  ˺0 0@8PPPPPPPP 㹺0SN ( :04PK 40 b80@!! 4 0@Y0K 1 0@8Q" ʂQ V00  Y1   0@80SY 1 B/Y1 , 00S P P \5fXc -LMP 0 0 0 RT@00 DDgh<00aahdh hUtQ_DYc"f"f|-7h6 0-|LP 8K;00X0@  0@0?040: "# ? 0 00uMb|;! -LMX0@S\00 `Q( \H 0@0 \h\ 0R 06L_v p-LM`@(Pၰ0V00@ 0`p -PLM \ Q @T0 S *01 0 S00@ 0(Xx66 p-PLM@PdW 0SS 0SLapP: 0BS(,-,--,-,- 1S 0S0P U 0S p@0 \ ~|0S |  1S$0SL `@0P`(`p 6,Q_86$Q_f`6|6f6 p-LM@Pw0U`$L0@ $0 00 Dgph` 00ng7-7 -LM@T 0 S  iGPUq <`Vm H1Q p QgWh 1S-<-l---1 Q Q 0 0<   B0041 ,1Ba  0 0S 01 00 0S \ 00001 0 x0Baa0 L0 Q000] (Z W6Q_7Mb Q_Q_6606 p-LM㼀P `HfD1D!00 f01@T Q 1 Q::@T0Q P@| 0 0b S&p 0 0bS00000T0@T 8| `0H  a R@Tphm@귽@L-"f Q_7"f-7d"flQ_ p-LMxaPP $0@SQ TP $0@SBT$1 R `0S@2 T  5Q' 0 R0 R@0S S P 0 R 0S \ 0 \p 5R\`1 0S# 0S"flQ_"fN_N_0Q_ -L0M졟0D`KPp(0 J0@15SQ CSd0PUhz@0  %00 ?0#3 0|-"f7epQ_Mb -L M0`S, P@ pF PC V 40 40T 40 }PqTZ!1  ,  0  0ɻ 0 @@ pY ֮5G 1!S:R+ 8C8Sڴs 01P0 S @T 00!1 1 Ba  0@꠮00@!@10 r!01 !1 0 g! P@ H0pkPAp@Ppd0S @40bO@0 COd@PZ ;O P@` 80< 0CR80E67MbQ_ Q_X0GS S S5SS ʇSS S p-LM@!`\ XP P p3000  00  00pQ 0 0S X6pPU( () ḧp6D6 -SLMpP@` R00Q00S3R`U-  2P$ W W *`X 2 c0X0P00S` U |`   -L Mp, x0W00 4 `0`00PU @W(0 S(PV(`(@U(W ,0X 000 4x040 0D D W001100 %!"f -LM, 4 0 x, 0R0 80 < ,080@0 2pW , R < Z%T@PT @08T#X1e1<@0X0@0 pW, R@00 0 @04 S0 0 080 <ux8<զ @ P?L00X 80$0< ( 0538 r0 H10aR001#,0\040P !0 T@PT 1e 0( S`"X@TS0 0  08#X᭹ |lQ_t6 -LM\0@,0 `p XK巯 hK⳯ 0R60帐 0 弐 Đ 0% P@ i:T_ `xK 㞯0S@ u0S.0Sş@0 聬,0 S |,aXK_h |0S hKVH |(50S xKL$ |EPB @(0|X0ST0SP0SL0S&[4R t0S l|d0S`0S\0[Sx0[S S pG@K ZP R010 0S  0S 0S 0Y0R00Sh0[ xKSppҸP`z K0P@BY Y0 00 S 8s0S[ xKи Y0@4|PXK PL T;X0ST0SP0SL0S 0XK@ @002Q0@0 XKx K-hŸXK%P"Ġ0 0Č2 XKx KKX0ST0SP0SL0SXKr {H@KBxK@K0 H0KGKXLP@ 40  00 R TLVe P` 0  p0S 0 R |{w0[0S5#$0$'Kp0S0P@ 0K PĀ@  0R0%@ *H {TdN_,Q_f66666(6X6$5666(6 fh5 -LMPK 0 , 0S Y0 00@@DP d00S#X U 0S @00 0 pp    0@00 :0` d`K0HK@勤㈤ 0U H0Kc KG Kd0K\PK  0S^ R 0(S@@K h 0KKHP @@K ❭(` x0(0     0 ᐭ Ru Ri  RI 0@#$(,""( :( @@ᗽ $ 0^0K K@@Z 1`P 0@ 0@@@0 \ 80S0C801 ,0S ,^ K P Y@ 0 @@ 0P 01 0 Y @ @ ݣ 00S S0 0 0 00S,1 R P 80S0C80QK޶0 #zTD  ẶPM=@@@K㢣G5 #$0$<5K4P XP %KT0 P@K\PK1 <1 KK吠 d1@ၩTd e,fT6,Q_d6 -LplM0@,0 `P<K 岬0S㈠ # d6 RXƟ@0 薩,6 ,0S $,/^t@q P(0 y 0R0%@ ]:TS LPK | 048L[<# #3 0P| 0  5 P' \ Q <0[S  `Ft@K Pl  R010 P 0# iyZ Y0  00S 4 R  Y0@lOy{ P` HPU 0@T 1SBY Z00RX Y Q' 0 S!|P40040 @R@ 0 ` @ 40 <0T# 0 01(#(30Z  0SgQJZ\T\00Z00S?Z |!0 R00S| @t@<P  sX2 R<@ 0S 0 S  1" 0 \Z\ 1!0Z Y00Y  -1S, !x1p!0 8"Y  P1 R ${x0 R sx0 R " hxK0[0S S5#$0$$KK0[0S0P@ x0K جP p @ x 0R0%@ *8wTd,Q_f666 67 Q_N_T 6 6 6 fh5 -LM  PK ,  嬡Y0 00@@30P0 d00SX 0S  @00 0d@Kpp0\`K00 :0` 0 HKzwHKdKP cKGKQRS 5,#04%KKT P0 X @ ✪PK RK 0K 2P @K  ㆪ(`w0(0P 0~ R R  R 0Sx 0Sl  ^R N0@#$(,"̠*"(** :( @@q 40K K0@@Y 1`P 0@ 0@@0 \ 80S0C80ڜ1 ,0S ,[ jHY@ 0 @@ 0P 0Š1 0 Y @@ 徠Y0 R0000  @ 00S Sv0 0 0r 00Sl0 R P 80S0C80Ϧ&Hᳳ0 `v1 <1 K吐 KX1u렀Td e4f 6,Q_ 6X0GS S S 5SS ʇSS,0 P 0SP`Yc 0- @ PLW0hW. W -LMŸP@Q2  0 l ܁0S00 0Sj 5Pp8| *P`F  hl1 p ` `R0 0U0 0 p @ppp 0S) 1i 003 0 0 0Ba0 0( x;v0 `P\0(0i/v0 <P00(0(uQ_`YcN_,Q_7Mb,!6H!6|!6!6!6 0-|0L PR0BP@ Z R 0<00  0| * 0 CS 0hUGQ_`Yc p-LMPqU`r P@k bU !0SF 0R20 S0 S R&0`!00S R0 <10  0| e* 0S0C 0 phpG0a 0( u; 0 0 0Ba|0 R ( tu0; \PX0(0}u00 84su!6Q_,Q_`Yc "67Mb<"6d"6|!6"6"6 p-L MP0`@T6  0( Lu0000 0( |>u ( l9u R 0T00  0| ) 0S C pphFph!u#60#6x#6#6`Yc -LM00 0 0 @0@ @@ -PLM@ /|0 0R h0 R饱 0P (0htQ 0Shy000 tQ_,Q_#6$6 -PLM@  R000h_{t($6 -LpLM0P,0 `@ <K剧T2 l Rl@2 Rh 0S# (2 RŸ@0 e1 ,0S ,XCP@ @(0t<0S80S40S00S5 0R0% A:P7 d@KH jP%` R 0 l 僡 Y0 00 S 0 R <KY0 JIt@ <Kl  0@0 R 6t0P@ h0K ᷨPp h 0R0% *(sTdN_N_,Q_fH$6X$6$6$6 fh5 -LpM0@,0 `1PK զ6 R 0 0S# 6 RƟ@0 责dƟ,0 S `,MX ᒰP⏰ @(0,s0[S 6 R K} s0[0S 0R0%` Y:VO @KPE P= 0 4 TPK8( L0KLK0T<0K0 43K[T 8 4  <4(<"4%$Q0S !EE0$?0D@$#3 000  04 8 <4<("4!<0PPP @ P,d0Si A TQ 0S& @Q  0 A Y0 00S 3 RF KY0 D.s<0K@ @90 $(,<4<!4"L T:0S\  \ SP1:PT0@S 2 R Ჯ 0Pr2 R ᥯ 0r R 0S r R0S\ 0SX SR 0 SB K`W0 K0KK嗥0h [0  /h K0h [2 00h0K1\K 0$(,<4r0S TS,0S00S40S80S , h Pz0S 0S$0S(0S X V Ph0s T0@P 0 0a (P  0@KU& !0)P@ h 00S)P 军@L0LHK ძPٙLP 0P@ 0L0 P ʙ@L|@0S  L Kᶙ,"fTd#f"f4,6"ff"fʚ; -LM0PS`@p 0SP0@S6P4 P 0 R T p # V00R00S@ 0xPn0\ iP rP Pᬺ p @ P_`(#f5 --'LM0` ,0 00 0 P \p 0@K 0P @ a 0 :R ẝ'P0 (0C( 0 V 10(00 @   @0K  ᢯P:@H ,K 0孭P|  H0S <0T&0 l  000 !̠` !4! 0r00d 0 :RT q- 0\*00 V̘ R KzĘ5 ,0S t,\M0K( wP700  P@ 0 ( Ыh000 Kp 0 :R4 P@ 0S 1 B 0@\ 񟗗H.H.H.H.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.LH.H.H. I.$I."D@" -p`q @ !0>0>010  ^!0L$1]*!nx!00P10!R J 0 0 p0^=*!n!00P10!R +0 00p0!0>0^ P`eV0^*!n!00p`P pp mK42-+&?"D@" -LM`0@ 1 ! 01 0^$!I*(1n  00  P 10!R 4 00!00>0^ PpeW0^*!n!00pP  >0>0  cR !o?"D@" -LYM   0p0`S0  0S00g\Kc  a?K zPP0/SP E0S< 10 S@C/R 0t/S0@ L0 H l D pK0pp P/0P0\0p 10@gnP?P  P0P `\pK@@LP H@ l pp D PP0KP @ 0 帀 匠 PP0` 0 GKPP0 0 KPP!l1R!h1RPc`a a?K ޑt@-@\  0S0  0ST 0Aq00 -LM  0 @ $ 80S0Ÿ K0P  T018#R 1   (Px2 0@40 , D0 K@0KP  H 0@ 8  KHKK0KPu80pcWn`PP Q0@ T^ 0ApcW `P6Q0 0 SRW*U 0S" @W$0S U0 03  P&U!  00C0 pdW`Wʸ0S ZP 0  fğ P ?S@ v  %f 0-LMP@0 (0 (K0 $0   0$K 0 E@P 0 00\0 7 0xd 0-LM@P@ K0K  0@b/0 -L$M0pSPl V > V) V - @<K@0K< 8 4@ @`>/P@00Q@K D V <K@0K@ < @ ` @NP<K@0K< 4 0P ,` 8@ @劏 VY  V <K@0K< ;l VA e Vtt \\PhP@P h0L 0` f0($0`@f0 0`Q0@0  @@ T@ @0 ٍP\T\ D\Ѝ <K@0K@ @ <K@0K< @ <K@0K@{@K 5PhG #f|#f{5{5T_ -LM@EP 0 xd p-LMP`4 PK0 p .@`@s. -L M0@S K0q1 0 00q1 0 g p-LM0@ P0Kی(KP0  p0P,0oO` KW 0 p-LM@ `P[! 0!8< ![p p-LM` P@[! 08<1[p p-L M(@1P 0 1 `K0P 0 0S  p里P1 01 !00 P -L M@` T00D^\P(:T8 p,KW" 1!,0 $ ( 1.$ 1$00$0 1$00$0 00$00$0 (00 (0 庌PP 2P00# 0$ R0 & p-LMP0@0 P0,`KS   0S DVDp0S +0[2KtPTd|,6 p-LMP0@0 ,`KP  0 S D.Dp֋0S +0[2KJTd,6 p-LMP0@0 储,`KP  0 S DDp宋0S +0[2K"Td,6 -L,M@DK< K04 0 DP @` $p <@ 8@ ,@ 廦 -L(M` 0@p @K8 K0 , @P <` @ p8@ 4@ (@ 宥00000000101011<0S8000 00( 00(0H 0 @040L 8 P0<0 -LM` PD0FK0 !  P 冾pKP@ 0 @>TЀK0J0S@@ @ 㟋0 -LM` P0FK0 !  P VpKP@ 0 @TЀK00S@@ @ o0 -LM`p딀KP@  0 ,00,0,0( 0CPԠK,,0U 00S DP Q @ =P8 -LM0O K K  -LM0O K K  p-LM(O`$K,K4 K, P B400p -LM0 0K 0 nN -LlM0pS l KP`l0 ` $80S` ,00C,0l(0,8Pt0KP t H0 8 0` 4` p DP , l0HK0@0K hK@T1# |0K h0 TP x l0|  hK0K@ ``l0` K`P0X0 cPT *0^0 \:H K)`  5Vl  K|08 `l0b0\`::0 0-L M0 @P0000 0(0 :(0  (04 0(0 (0(000(0  (0, 0(0  (04K0(0 0O$ Kxj05 -LM`p P@! P P @T00PU0S ^^p@W ly^`FpGP  PHo^00PW d^pW`F,6T6,6E6``0 B`3`1`1c11c!0"b2c3c0acP@Q__ N0Q_0S S0S0S  S 0SQQQQQ1Q!Q1Q!R @0S RR  0R P0Qc\R 0R\ 8#8S  0   5-0 R 0Q cP 0 S 0-LBP|@ 0S L| 0SPeT 0S \00LS `0000R- R 0S0 \R000Sa@\0S  0SbR0P0QcP  RR-0^0  R R0 R0Q- *0 Q*0  aR*0S b R*0S R0@-P@0 A@P `R00\00Sa@ 0zR @R00Q00S ZR 0 PP ^0b0 ) iT#0 5 -RLM@ z -RLM@ m -RLM@ ` p-L`Pp P 0 RL t华 V0@0000C0V L w餶R_؁dL-6#f -\0L0TS $0S p00R0S vP %f'f -LpP`P@U U UPEP PE0R0@hD\pp00l-6 -LMp8 Q@ 4 < ; P,, K00K!P4 , X3 X-4%j6+Fcj 8ؠT@!08 T d8  0@T0X00< X,008 R4@8@[0 :#:RJc0n<0 0`0'f$$f-6 -0LMPp`:0P:X@PH BP PE 0R08@8iw 6$$fl-6 -SLM@2~s H00H0( (0 -L0 hcpYc}.R_ -LP/~.~.~.~.~.~.~.~.~.~.~.~.~.. ..  $(,04@DHZ-6 0- <LM00CP@ SN...........1? ?0 0 01 K"0 0 ,1  ,x; ,$0 Sp.`.|..0 L  K20C0 10 YUU33-6 -LM\@  t\ u\\Q10` R``J@`z, 0 V. @ H  0~n0`pfNPP 0f0V@0*` VT( K,0K JTZ:0 P, 0L00 |K7'f -LWl/6 -LW/600-@P 6 0 -0LHP7 -LM`pEPQ 0 0S @QP|%> p02SN H%%>!D @A0AS= R ;%4 0 , %00 #0BWS P...............................`..x............... ....,.<.P........d.x....Ȍ.Ԍ.܌.....$.,.4.@...P.\..t....؍. 0ts0A0CS Q X@@0S $% , R|2xl2D PL4 8<40$ 1?3?3  0  0x0!pn x ell%10?30 @U0P%  0?200  024P5 5,26826@26D5?6E6H2656L266666Ժ6(5 6 5@6 55.626P2605T266X26,6`26h26x26262626 0-@PL> `Sl h0 $$ à 0 < 0 $00262652626 -pL`@Pu$ T 4 Z DU pP@TXD4(4P2626262626?6 -L0 Z\@`%Z' !00St 0t  rW\PD  e/26@6\26/6/646 -O8@LMpOSP!b$ $00S 0 hdX@@  f26@@6\26/6262646 -@$40$&S !PL$pdxl dVH262626\26@6/646/6@6AV.6 )p5 -LMp<`@PL ~8P$1( <0D $00H P dKk~P8\00S 0@00LMn<`p4 CP@B 40 R08 &8 P00U* Vؠ 0. D   0Z UJjF:804 0S80 dw@X00K@, KP00L00  L|K7$$f'fT56>0 >0 VB|K7M0@- 0@^0 0@T 0 P^0@ЍS0@P ! -LM8 \p$0 0 0c@0 < 唒W`D h 0x"Y, K00K /, 0S 00 Rr .: #:L4  0808@0S @4^ P>0. U:00R ^ RG 0 0c4 :#: cQ!P4 4@ 000lQ0S@@ < \ D 0 RD ,040pW0<0 `D@0W@< 00 ^P @,0<@0 S0h (8(#8Q4 "*4*64 00S 4 K)y'f  0-LMP 0 .@K PP@ PkP*80 0\ @8:Q0 : @0 \0 0 0@-P@P`p. ^  R00\:\*R:^ >00 0 bS0!>0>00>000 0S0l0l -L@㬀TPp`  (0@T -L@, TPp` ,@ T -L@㬀TPp` 0  @XT -L@, TPp`1 @\ T@-^@>0.  Q:00R^  -LM@`TSp R a :@TVPbUP!W W `e L 0D@WH$$f$f -LM`0VPp R a :VP@bT@!W W `d L 0D@WH$$f$f 0-h@Ld0TP 0\0X `\ ,0R 0`0S0hK %f$$fDp56 -LMX`PV r @0S  2S @2S2S lphKdK0JS |.|.|.|......d0  Kd0}Kd0@xKd0 PsK1`VAA0S 1 R$ 1 ?#+0AB%@UK Z 11@T !mIKtFK hBK81\ ?# $1H1@Q1@!+B%0@ P%K"Kd0Kd0 0X HKu" 0|  9KcmJ|5%f6:6:6:6:6:6:6;6E6$f$f$f$f$f5$f ;6l54;6{5`;6;6$f$f;6<6$<64<6@<6P<6\<6t<6<6 -L$MCp< #@ 000 0, !@ x3t#Pl3UPQ\6l>6>6>6 p-LM( \@SP`8 0 I I (IIII$I4I00S8@< D IHxIhLHdIH TI LI?6?65?68?6?6.6X?6?6?6?6?6?6@6@6 @6,@6T@6 -LM \@P`p  0 P`0<1 0-LM6$f p-LM@0P`XT" T GKWu0V0P00S 0[0ppTKgu0V0P00S 00pKJu0V0P00S 1[0p$$fp@6 88#4S S - xxLM'4P`0S@xt"0P`(0S00V00\00S @Q0 0CS yV00\00S'TA0SP4!'4 SJ..p...........@\. 0 <00x 0 :#:cQ! `*Af  @Q`1h#R& i9P  `0S000S \`P  Q#  00F&f@6&f'f&f p- 88LM#ĐT0`P @0  &R%&:FFpP %f0t_-@-0  <0@0D h0 TD < L0H000L0H0 0404550055'f-<<P0S P0S00 40C4H0 Q L0H00C0CL0H0550C0C55'f0@-<P @+ 0Q P00RP D0 0D0 P0 "  4400C4 0Q  L H0 0CH0L 0H L0 0CL0H  %5 0C5%%5 0C5%'f -@ LM0|@  hS $f,f0@-x@PQ0000  00 0  0 Q 00  0P0ic- 0S  R0000 0 0  0 B 0S 0S0 <00 0 00  0ic -!!:APLU!x# 00A`Q T@ xX 000p0S '21,A8@PP Dhc'fgc -0L0b0^@0TP 0 x$0'g 20PU@'9? 000CS0 0h@'fDhcgc p-L,*(0MP"1"(  P! 0 S: @#P0 0D`L L0S   0+np'f&f$$f -L n -L n( -LM<@PTp`  0S 0` @TL 0P\R S @Q Q Q \ 0h0hS 5S  0h @T\  ipP -LM<@TP, h` 0U Z 0`@TQP U00P00So Vm \j @R U Z @Tb ``` *(": 1Q"( 001 0R  0*"%,`VLp7 W 0S  10#R0 S 1D0Sp10a@ 0S0S |a d1P U P@R `@TU VZ`(*(": 1"(Q 001 0R  ! 0L0p 0S  0SpP000S 00 0P `1'f$$f&f -LMD <0 QD e @ 00 8 40  `0 :8p#*  ! #8R 001 0R  :#58PQ ,  0`w  T"`0 0PPP 04S`  L0H 0C L0H 4 R 0` 80S 4 0S(  0SP U 0,SP  0S@Tt100S T! @!@ 0S P 0S  0S D 0S 0P 5%0C 5% 0S  0 S  R H0@z0H 0S  P&f'f$$f -P@LM`pg 10S$0QPP 0SK SI \W- 0S! 10#VR0 Q S 1D0@S0H 0S 0PT 0S 0S|0< p 0S \0Lp `V  Tp@p %f'f$$f -LM<@TN p1P H L 0S$0L`ppT0 4W PE PC P%*(":1"(Q 001 R40C4 :#%40C4 00 `0@=T@W<@ 0S 0SPP@P,@0S P@p %f'ffc$$f -LMT<0 @$ 00 4$ B0S$ 4$$@ecfc -L$MPDP ,ȟ"&R:0R*0`,0  01c 0````UpH   "4 4 R 4: #5 < QD @ D@ >0S@ Xǟ#&R:0R*0a00  01c@W2 0D0 HQ`  D0 `6W  T  8 5S55SSH0 SL0L0S S L6!XD0`0ó D0` &U  D0`00D080@ 0`D0 00Q00S D 0S D0 10#R0 S 5D8 0`~TU X5 Y @ R4000$ $@ ZW 5Uh 5 Rd 0R0` <S 4 YZ  4$0 ) 2Q D 0S? D0 0S4W+ 5S55SSH0 SL0L0S S 4!ATD0`0ó D0` U  D0`00D0  300S p3 0 P3@q 0Sn ,3Ph ?\;P8 ]  "U 48  R@0 `"D 0SK `I@0F HQC h2H=H0HSU @2 Y(2 T.  8 5S55SSH0 SL0L0S S 1!aVD0`0ó D0` x!U:  D0`00D080@ 0`D0 00Q00S D 0S D0 10#R0 S 0D8; 0@ 0S 0P O0 |eg)*(":1"(Q 001 0R&ff'f&f5$$f$f&ffc@6@6 -L0@ >#& R7:0R4*0l$0  01c!R <\ 0P \0T\ 0 D00D0   $0 2R @ ` #& R :0R*0l(0  01c!R <\ 0P \0T\ D00D0  f$$f -,0L ^  08 %f$$f -!*(L":M1Q"( 001 0R  0d* " !Q:0Q*0b !b0 P 0f -LM$0"*01\06S0:0@<,'5&f(ic'f$$f 0-0 L"*("1"(P  \@! 0 SP!0!;   @00$f'f$$f@- 0 0 0 21 0 0s#0@$ ! 0#:8#*!#800Q! 0 S@ 020000$f@-`Pp !:H$$X 00S | $:1P 001P:#50 000!S$010 0-0@P$L 00 0S0ڀ0 R pDP ` `000@0  0@0$0)$l8&f'f(icic@6 -3唓LMp00P 0, 0 p0S P U:YZ @:(s(C<, c 00"R 0"  "0"0"00a3C?6C#Z!|"00#Rea!P"0H2@D"@@2  @@Z(Ÿ( 0  P2 0 5RŸP 0$T D@2 0@2 050 @2 05< ePtJT:n{9o`}P@) E1? P 0 01  @`P 1 000R 8P@ R9<W 0pĀ 87Yc'f$$f&f ic&ficicic&f%f&fic@hc(icic$icA6l.7ec(`.fcT_ A6fcA6gc<. A6Dhcp.(A6lA6YcA6A6 -!: P0@S`LPp P@: #Ŵp0L L \  P0p@:8 0 0 U07 &f$$f&fA6 p-LMS@P` ,:8l#* #800R 0 SP*  ^0"5060p u7'f B6 -Ls4 0 fc&f -d0L \R00#P00*0 $X,0h$7&f U_|K7U_00 R 0  \050557&fU_ U_ -L$M44(141"0^P`0Pl Sc SW 0 4 U,  @4U 3 #6SppW 0&*000 00^>>fVE1U,&: R,IP% 8#8US#&6?N00^ U.Q !hXE&14 0 0!1jZEP5H0H 000 <0040 000 000 $0 5B6C6&f&f&f&f&f&fDC60&f -``LM0pS P0  @P@^00 R&fP0P0S  \:00Q0S&f0@-l0@P 0S P  T :00U0S000&f@-0@ @0L 0  0 000 00 0| |0t t0@l l00?00?X0 &f &f&f&f&f&f&f&f&f&f<.&f(.&f&f&f&f&f&f&f -0L0Όn`VPp@0?0?0000?%:E%6;PK #;J jV!Z4U_U_lC6 -LMPP̠%/*Ȑ%:8#*!% vWp!R#8 001 0R  :U#E*`L0HS @000ZU@:U:$$f'f 0-80L@T (PT 5 DT0fc'fE6 -X2LMP, @ @,85, 00$ 5080 00 8 ,1 R 0S 0040 < R< 40 6R< 40 80 $Q8 0 X 0@S@T1S ?@4 Tf?p P@0C $501!R.P I P ////p////x/////DP  0PP0!?#=?00c?S Z5@TjڣhR5,@Y@ BP@CPmPFP$@5'fC6C6C6C6,icT6C6C6 -LMp`P1SP>U#&R!:0R*0a !bA 0 T L8%5HL5<@T V 0 *$5@T@,icf@D6lD6 -!LM!:1`PV!& 0 01 pRPJ$JT 000P帠00 0+; 00帐 .P p@:#:S `@*:#:"*S:*21@`P0 P ,0 P icic&f@hc&f -0LM@8pPP% KGPU$: 8 #! R#8 001 R00*"5*] `  0@HP8 de'f p-0LMp4 40 1c!P+ Q)ڬ0 \0јP00l1  R0C0p`1AC\0^*PP06 @^:p_,U_$U_0t_ U_00f,f -`3LM T, cLL3< r 8C0S ,CP "88 #$033 0pǏ42 2CP0  0S",0S ,PP@3t oKc\|2~Ϡx KP@,2 ( e< p000PPC$0P=*!a06V,*46!SAW  4*1 0 42P4F|!Uj1 !@0p&V:@U00 Z0#02S0ES@/H/$/X/X/X/X/X/X/X/P/X/X/X/X/X/X/X/`/[3Y33oK3H3` "88 #$x?3W0SS 7Td(+f_$$f U_$U_D6&fD6D68,f00f5'fD6D6@BD6D6D6E6E6$E68E6 0-LMPK 4^P@ 008@$$f -LM0@X$$f -0LS S  -<@L<`P. pd0L ^| P(U@`H@ $@K,0$ $ 00ZUzjL1T_'f\E6 p-LM`00l H0N@0d0>0^P 0,0 &L 0L0H p&1'fT_dE60-P@P !200-P@P@0R0-P@ 0bR03 B0R0@-P@ 0bàR? B0QQ00QP:  p-QLM`P@S 0 V pp@rP`&p`0-P@P@0R0-P@ 0bR03 B0R0-P@ 0bR3 B1 010 p-QL MP@`S K0 V Ks 0K Kp@rPp` -QLM2p`S)P@WU (W # 3f g0T0e 0d0 "2R0c0 0 Z  p @rP*`ppp@-(Ƞ !8"(,ȠP@p^`b `n0 # 3\ c l0 "2R(#ȃ 0(BR00.8 c0(R0#03 8 " P@p0(R0#03.8@- a0`S@@B@-@0 -LDM@PKP@ 4aT QP 0P KSR0S0PK0 P@[[TK$P@KK ,PT@,83K#[$8KK[[R3KL K0KKK4pK@KX d0 d@@DTd@ 0S 0d@S@d`@ p0`SL` `` \JX0@\@ZXp3QPX h h P Uh R `0d@Dh \ l l偀 0 RPh H ra ``a\ 8R \0`FP(*SdP\l 00 L cPe%88cP\X%X@ʷ0Pe%8P d`F\P l@00 L P\P%X@ʷ000l`X\l ` R" h0S d@\ c0 Sh0`@.L0#\ ʌ0#[[[2[P T PK $[[[4[P T P KP@`8#`0H`8#`0H`8#`0H`\ h `  P T P0K(U_p@-^`@ Pb 0 2%$^ 040p0-P@cbP L0Q3:P:  -LM -LMK{0K0-P@P%@ 040 ( 40(S"4Sr_40 ( 40(S"4Sr_ 0r_ - 1LM @R)% )B? S 0  "!   g/e/b//k]/Z/|/k?L\00 S 4I/0G/a(D/$/k?/T_*7pE6E6E6[E6E6@ -pLM0`S" @0  2 Bl /0PU *   0-0VU:`2 0S@t_F6 -LM`T^@PƄ ?p 0p 0,`e0@@t_$$f-??!0S0q1!1 R  P 000$0$ P 000d@d -LMSP< 8 E' ?x$ , 9ɟ 9+9 R)9* t*8( f Kh`800 0 .X~.I)à@ȟ刨ȟ bx@ 3`h`f.`d.@P a,Ơ 0 @0>0 3 at2"& Ÿ P 0,0,p% !01 $|2x"<p,`,N]!I]1D] ,"2 2"2 ,B,>4! 0 @?,1,5#e1h  00)0@0 pJ0C ^:00C0U0 0b10 @,F6@$$f$fLdAi` ,fxvdp@u_0/w_0F600fPF60-f,0f-f 0t_-ftF6F6-fF6@.fF6,f$-f4-f<0f %f-fG6/x>/>/>/>/>/>/>/>/>/>/>/>/>/>/>/>/>/>/>/>/>/>/>/>/>/>/>/>/>/>/>/>/>/>/>/>/>/>/>/>/>/>/>/>/>/>/>/>/H>/>/>/>/>/>/>/>/>/>/>/>/>/>/>/>/>/>/>/@0000Sl00d0`0K@@H}+@0 S DSBOLd@-f,t_(t_H6H6t_H6H6H6H6 p- LM0@S p00PP@` 8xk0SphtPHP`D mP4P `qt_t_H6@H68t_S  800S Y00 R  048 @00 R 08< 40@Y00 R  048 @00 R  0480@P  0@P@RP0 N -L M,`K@PxP0p0(0K([pZ,K0 +KP pP -L$MP @4KD@` pQP``$U-Kz4K 0 3KP `p,@K -L M0pK@` 1P.P$P_0K*K[0$t$h .K)`K(pK@ P'@K -0L@ p60S hTPu,0P# P 0`V U004P< (0;4P00@ @0$0 0SV h^|P 0,0h -0$ `L@(X `, ,0P+P/P/P/P/P/PU N!0p G!U 00SXp 08 40 0,0P#%J6J6 -Lp` PP Y@  |O` 0$0  00 @0 000P 0ҕ20•U@ pP  #U`3   -LM,0@S$Q/\R/R/R/ R/Q   ??P 01d5U<\5U"*T5U H5U$Pn5U Q QY00 "  d 0@ P0 00 000u x4U l4UJ d4U P0ES@C 0 P90S 0" 0#$0$   BR ! F%0 0bJ10000 2 0,$,!$#, \@Z@T WP 0@@@P02 <4(<"4!<002 0#$0$ 0 S0S000l2U d2UY a ]@0D,S| 0\PKP@aP#Z0[Y [$ R !EDDP@ 0P@3`@K P 0 dP0"  6[#$0$&K gB0U 010SU0U 0U 00U00U 00U 0TdDu_ Q@c Q 6c@c c c c c c c c c c c c c pd sd ccedA c@rdAc c cmdqdgdfdhdcmc ccddQQ` -LM`ePB y0d (08 , 0l!p2 040 1 K D 004 $ 07K? 40<47O P%0 0bP 0 PZ ((0("4400$ 0 D 0 oc$ 㯻Q65WEVpv/ 6 -L,M` 0 Ȁ"4pKP@ .A%4K@(0K P P@P# [$['0[(["[(,&[!P[8<%@[$ 40 RQ  0cP  N -L$M@4 ` ,@ pPP ,0K ) 0K@@@ pP@,0S@@T,4 ,0 , 0^ @@20 N -LMP`p $P rP@ $0K   pPPPPP $\00S 00  00   -L$M@`p 0@ @PPb 0KN 0@@@@ pP@0\@@T  0,0K 0+ K  *K)K4K@@@ pwP@0Q@@T, [00 0+0[ 0  * [000 0)0[ 0  40S T 0 @ 0  N -L$M,`KP @pU@Y0,K0 (K$pKP @@@  -L$MP $ 1`L  Pp8 (K$0K @@@ `P@$ R@@T00$000$ 0S (0S T0 @  0 t  N -L M0pK@` ?$PE.KD$h$t*0K0 -`K,pK+@K)K(K P PPG@  -SL M@`< Q8 8p PP0 0@T@b@b`V!J! @0L\ 0 @P0N^J0D@T;P -L M0`KP p}?G0KP*K @(K8)K0 -K,pK+K@ @@ N -L M(`KPp Z?@K}(K0 pKP @@ -LM@}̠ 0@ @ -L M0@KP `p+?BU0K/[@/K&.K)K4 Π0 -pK*K`(`K -L Mp0@KP` ?>CV0K/['Ġ/K)K8'KP 0 *Kp (pKY - ML`0 PpPP@0nT `:PP` -L"P -L>0 S񟗬꜔/,//(// / /(/ؗ/H//,/[ 0P<K@ P@00[2K[2K@@0J<K @ lP@00w@[2K< .P@/  T T  0P`  ous p:C@` 0= @0 Ppx`\P0  z@0P .2u_u_&5E6h/,u_5*7/`666 Q-L Q 0@00 -܀L0 PUb p@0SP 0@! 0UP0U lpt@0SP 00@ 0U`Q0:(ewwr_ܤ/,U_r___*7 - 8L8#Č M R00 `,(Y, P@ 0@|0 0 ĀPppPU7 1'Zp ,0 S0 90  S0 90 0P0U0!1 010u-cY 8Y 2 RPp0! Z-.m1Z0-.1Pp ZpP101"P1p01 0-!1rou_ - 0!4LM#4`pCP@E 0@A0PP7 V0 70  V0 700(PUP0 11 011 YY.  1<1-Su_ -LMD@!88# !P`@ p@=013 `00l0 $@Th@ $0l$0徑' `hPX0(p$0Qp Kh0D < RP0 @@P`p@K  0@ 0A x d`2 pK?0S@ pK?0S@ pK?0S@ <K8ht 00`uyKwpyK"<"1vT!0xp@ py[$L@ "Ġ.<K[ 0 ,p00 ,P@ ~00 ,T 0 !!g -LMPp`0 1 1\ 6//D/D/\ \ %1C 0 0c30 00C = 2  1\ \ \ %9 K  ?댞6 p-T0LMP`00@8 ,T00 8\pD1f p-0LM@ P0`<0 \00< ,T0000 0<< \phoD1f - 0L 0<,D1f - 0L 0<,D1f -00L M@K0<0 \D1f -X0L M@ 00<,0P0 $0K0 (@ D1f6 -LMQ@0>0~n0`pfPP 0f0V@0*` RVT( K,0K JTZ:0 - P, 0L00 |K7'fQ0|K70 -Lc6 -L]6 0Q 0Rkc@ -0L@Mt@l0d@ \@ A!0\@0 0  "!kcD61flckc01f -1LM ?ops)J`0Y10  "!QU PP  0@PU 00#!?o0cSp 008 401o1f1flckcH1f1f -LM@X0DS 00#!40 0$ !!\61fG-0M  "!āġđ!R  80 QPR Q R  101 R R1<1 R\ p0x 0P `0P @4`$0 0  @(09)0 40 ( pP` @$!R 80 QR \@0@ 0 0!!ЍkclcH1f1f1f -@@LM8 /( 8 0 H1f -LM0,"0S{ 0`  "!r@P0   080 Rn0  "!`00#! 0    090 RR0  "!`00#! 0   000 R60  "!`00#! 0   000 R0  "!`00#!  1 L0 0!!|yvsv_1f1fH1fx -LMP@Pp*  0 0#!0,  R <㽸0@Ta4 t0 Yp 84P@@),0 0!!MKT_kcdp66 -LM4 0@!!H0\!00000%v 0!!kcM  0Ѝ0 0H1f1f1f -LM0@  "!@0!!$ $0 1h1f1fH1f 0-L0LP 0P0@  "!@0  "!1f 0-< L0P@!!@0  "!01fH- P00 01 0 00!1f1fH1f0 S- L( ( 40   6tkc600  -LM0@S000 S  P- L 004,0P oX0pPpTX0 p |4! 0P\ oP0TX XP0) ?P` [\P0TX XPTP04 0004 d80*0x0 0PbUP#U@U0 PT0,PE\U@U5SP0T,,P0T0,\PT0,TPU0x0h -0L`P^0 0  ^Of Pq0T @,000SNP0T,,@C 0`S0 P 0T,\0@00P:P  ,P 1 P0LT ,P0T0 \P0,TT0 P: PT \ +Pp0S00m1 P1LT ,@ P0T ,P0T0 \p6 -LM@0S 5 -P0PLT ,P0@T ,P0`T ,00pPT0 \P@T0 \PT0 \|0 0 |0  -`D0@0V|pLPD0@@|@ @0 T736"  @TD00CD02 Tx@P0T ,P0T0 \P T,0   P0T,"5 0 0 0-0LS@P P10S 00h0h0/$610S0S 0-P0T@,L,Ps0S  x0S  R Q 0hI0S00#0Q00S 0h -P0L0@`V%pP 0000x0V00 ?s 0 1 P/@ 0xx_86x_0 x -LMh@Te Th $0Sh0TT6"马@h0$ $0Sh0 h -LM@P 0h -0P ,@L0`@$@T@p@| 0-L@00P8P0h -LM@P 0h -LM0P 0`@kLOTp_00 P$fAi -LMPh0d8p2/ p P` \hh•p0p2@ l@  vh•l 1\ @0@P \h2lp"pb Ap=P>Pp d8hPbPH < 0S H6!|686X6 02t6 0-LP;P@H8S8S p2 S0h2lpBH@HH p-LMP@| 0U0`0  UD 00C0ph<@ 2@= -LMh2@ld ,P1h” 0l0d \,h2ld ,h” 1 l0d \h2ld ,0 h”0l0d \h”ld ,0 th2ld ,h”d0 l0d \h2ld ,h”,0 0ld \' -LMh2@ld ,h0h” 0l0d \D8h2ld ,h”$0 0ld \' -P1AL@`@ \@@`E0 p\0  B0C5AL8  <\0A 0 8/0C(  0B5 8< \0 $*;#30 \0x0 -PLp @`,0. 1 \JUKRLOML0@ P P@@@Dt :@D<t hu@0 \ ,0; \8 , x0 -LAMPD@Xp00`".(1 ) ( 0`0@48@40PIK L0 X 0 0 00PB0C@0 0`0 0R 0,0  @  0B0  00 00X,P0 p D0D 0SD0@D@ @00@0b 00 # 0c$0, X =T_1f|56 -`,0L(0(@dϠ>1 0(P\ p 0S n@  D00 $  0/00-.p10,p0p -LM`00p@0".PP0   pi ( PD@U40 0(0K00  ($ 0Bu_1fv_D0, S0D0D D @00H @01f 0-PH0LS@ S 04G04 HP0 -LMp\ ᔧPU  ( i@T4` - P$0< 0:000 `@0@T_ 0-@P LR000 @ H0 BT@  $Q  R8000h80 8004H00QH % 0Q 0Q0 Q 0000Q t0QD00\0QT0Q#!H0<0 <0 0 AW@\W@@W@DW@FW@_W@CWBWEW -@0p`LM @H ^ W@ D0/RQ80 0@p0 < -H0LS40jh= -LMH 00R@4< 07H 04h/P0 S 0- LRP@ @0S #S0S S S l~h0h{`yXS SD@<S46 6(6,646@6P6E6L6`6 96h6t66 -0L00t0 S -LM@ H0 R x04Sh[T_ -LM@dh @0\ -p0LS0 -L M@P` Q 0 0T!0 0 0 0 0 0ӂ?00 L+7tz_ -LM,@0D 0  $ -LM?@00,D 0 T -0LaP 0-DL@P&0000 4 0h1 0`1l!0h黴E6@H0 0-XAPPPTL 0S@T0$0S U6M -L MP00 4X1,n0040 U? VR 1 R?XaV' @Vp 0 P$0(0T0X0@TXAT 8`,KΠK 0$@ K(` Y$@PpTWd 㸛P 0  `0```0 Xa fTxz_RpK0 K06 p-LMXA`TP 0S@Tp$0S A0S $0 $00s6 -LMXAT 0S@T$0S 0- 0L@t P0T 00P -LM0Q p8P9 @1@S  xaT0!l@d1!T01STJF04aS ,0S T<Q 0S Q  T%0W 1@S  0!p0T@`1T 01ST (PDx5?6826 6@666L56Ĥ6Ԥ60J6X!R0S`0(0S0S -`0L(k$6 -LM(0@S d10Sd1 `0_Y `Xp\ `0 D 0`R:@P0Qw\,P400 P] 0D40H0 P0P `H(0X P?@ 0S 0 T0S  (0     0X1S 0S`00`0L  M  N O P0  C 040  d10CSd1  040 000, H0n\, 0@PD0H} 040 ,\P6 0-(0LS@: `0- 0 `0# 0`0XPP `0 0D  bQ:@00\P4H00 ,400 d10CSd1 0 040 0PrP6 p-L M @0@P4@P p 0X1S3 0S0 0 -  0PP0C P0L L QL5 1SP0  8M  4N 0O ,P0  C& p -L M `XPQpK 0SH  T0S Q\ \0^࠱ RQ3 V+v `400$ @TXp\`400  ` _ 0`AT   JTXp\`D40 0 @U0 -L M pX!RD 0SA `@V T0S T\ \0X@`VT \0S P`400$ @040 P `X`T`i`400$e p 0T@X@`A400$U0 - 0L40 ( 0-XAPTL T0S 0@T08 XTU00P00 SP' 2 -LpM`K@p p08GF/V_ 8 PX( $ p$ 000$e0 -LM 4`0p " @ KP @KL K~?K";P< @0D "H0 0 P0 P " L0P R0X0 TH0D$PL0X L PE PK "D$X0NT S񟗶Y0\[0\[0\[0\[0\[0\[0\[0\[0\[0[0X0X0\[0L]0T\L 0PK 0D^PP$PK 0@D$PK 0 D@ D$PK 0 D H$LT T\&L#11@QPK 0D$1T0\$ T B  R{K(B (L0H0P0D$ 2P.K(PK 00D$(L0H0P0@D$("L0P00H0 D@ D$L0(P00H H0D H$L A("$ P  (" XK2PLTQ  @KT\APK 0D$PK 0@D$@D0S; 0hP$ 0@$@DF?@ 0hP$ 0@$@;D@ S 0Sh P @~Th 0 1h .  l0 00Sl@T 0s0@l0Td 㷓Pl h0 0 @@$!l0h 0$1l@ 0$0S 0$d?PQp〠@@ 0UT \ |PV d\ H0X0l TXl0PdZ 000$ 00 `p4 80 < @  R, :0Q4 R 0Sn 000$0 00000@0p 00 00 80S! 0SJ 000$0=0@00@0p00 0<00 23j<Q  0S% QB < @R 000$00S80phG/000 `02 H0 0!L0 D hG/00080Q, D <0d h0 DQD<: h QP  D0S DQ  00$*00@$*00 @ D$*00H $D P0p<0ShG/000H RH @ : @0RT0 4 HQ H R  00$*00@$*00 @ D$*00H $H0TpL0SL0D0: dSX L R L0Sn  00$*00@$*00 @ D$*00H $LX p,80h Qd0 0, h d0 +@Q 0S 000$0 <0<00p;00;00T0 000$p 00$ 00@$*00@D $D  00$ 00@$@D 00$w 00$ 00@$*00@D $D  00$ 00@$@D 00$ 00$ 00@$*00@D $D  00$ 00@$@Do 00$dz_Ĩ6 8  00$ 00@$@DD<@ 0p00$ 000@$@DDpD@@@ 8  00$ 000@$@D0Dp<@D0@0 00$ 000@$@DpCz 000$00S 0pQ, A 0` \ \0 S S,p `QR @Q 0 , ,  , R# 000$p 0` R 00$*00@$*00 @ D$ 00P0  H$ 0L@p 00$ 000@$@D 0p@ 000$,⁡ 0p}\ 0R,0x 00$*00@$*00 @ D$ 00P0  H$,0Lს 0@pD 00$ 000@$, @₡D 0p@' 000$0Sp0pS0pSp$ 000$pP@54@T,00 S,0 : 000$p 0$00000@0p00 00000000T@\ d@@ -V/L Mr` , 0 4 >d2 Q  Xp@2 0S0"Qv St , R2 RVXZ PU X@㔏PT@ ㎏T0X140 0, 00 R( d ֎P d @ 00@\ ȎPP \   X 0X P0 04 0 40  0 \ 㭎PP \ y 0X00X P ,P@@Q UPU@t@P1sw@Pt }PpDPm }Pix_Rxz_6?6 6E6 -쐟LM`ࠟ @pF? R 0R$ Q PU P 1S`SV$p$@o}P0 i}P0 RT  0 R 0R+5 -LM `x#0PU 0S; S XPU 0t30 0 S04 40@40PU \Ö`†LÆ 5>00 P(1P ?φ40 40P7Ά 40P@d PSU&11@F? R 0R Q pW P 1SpW Q0 K:P TU Y 0R P 0R 0R 0 P@2"D32H#"32 #"<30@#T3– 0T2 $PP> T30CS D2D"D3H#<2<"3 #424"<3@#0x "|x0S J P0 x3p 400x3t 4000x#4 040 !2 $pPT1T!D3H#L1L!3<#@ PSU$$@Mn0Ki/|PZ0 )|PT0 RpNN0 R= 0R:4 4 0| S t66+5 , \ d H | l !6!!!!6̬666 6@6 0-t3Ls@   PP 0x#p 040 x3t 400x# 00 4 p-LMP@T`8  T@ p5@E |3Sxwxg|CIxx 0|;Iꤵ! -QL,M@P`p?x38K 400 P0x3 <0K40@ K0  0P@80<  4$@Tx3@ p400 x# 040 h66 -@LPp`L3 P$@T`V@L3 P$@TL3P $PP00T3 -L0Mx34pK P00 4\ 0`2x8K 40@h5 4005Pph`XS~p   40@P?ꀮ66 E66666 66 0-@\5Lst )  PP%5S#h%\ 040 h5S 400`%r h5 400h% 400 0v -LMP@Tp` T dhh`ht\@hh 0 `h@)0S8d5h` ,6 T6 -`LGNF@DTPp *0P 0S@T:W@ * R 0R @T:Q 0QxP0 P 0S |xPT;565 -LP -L Mp0("p`u~P} 0M@ ,@40@0Pn "̆ @0`P`1 *Q1,* @0Rʆʆ:2 d 0X JR4 h 01X !@0@{QP* 0*0\ P  "<400Y 4,00Yo\TLD"!!6!= ?6@66766į66 p-LM:t`@0Pp0: "< 400  0,40 ᓘʌ" -LM@PU`p0  U 5@ :0Q:l0U\0D5< 0$0,0 "= ! 0-P@L 0 0 0-0>0LM>0@lP0 l @0ŒQΌÌ QÌ  0P  0 006 -0L* -LM@P`p {0 ` p 0 @ @0 -0L MЍ p-LMP $0$00. $0$0  $0  $0|x`@$ @0S}Tp$0$  N' -LM@$0 $0 -L -L$MX1PT!@  H=00 0P@ .0S00 \0pS1J1 Q`0@4p0@@0à, < 0<K8 4@ 0 塺8  X0 L0H08qpW`F(PEZ@6666ؤ6H0_P0 0<0 -LM$0@ Ṭ -LM$0P@Plpl`@ \0 D0S0  R  hO5<60L6 0-PL0S!@  0ɪ0 !?C1 $00 0R0#S 0S @ @^7x66 -LM$0@P 0h#0h 0-0L P@0,00 \0hH됲6 -LM0 @Q@ 0( Q0 ,00 \0000 P$fAi -LMP@ @0<0P 0P`p%@ 1  PHb p!0pPLR <( 0@\X p\mno(@KF M 0( $ P LPD HILPHP@Q 

0( @\400 D0H P0<0P0@@0 \_<0@( ,<0@?( x`\@Xp0d  㝨X0 S@DRX0S0X0< <0 < 0H0D0ꈳ676 0-<0@LP , 0<0@( ,<@0@0( \<@ 0\<0@ ,   0 U긳6 0-52f 0-PL@0@T@S00@P@P0S 00 R000%f2fL0Q @0Q 00 0Q0 W@W@ W -TP@0Lpl0p`t(t r 0l0 p002f'00 R 0S0S,f 0-LM0@00q< 040,R, 300PP+ 0 S  j G0S ᤗP< 0 0S 0 S  J @0h 00RB,f6 02f0 6@ 6 -LM400HA$ ($H  8-1@L #hP00p4$ (0 (U004$ Xh -L0P481@`  #x(@T 80 T004 X 0-T@L0PS0 R0\  0 0h_0 0S0 R\  _ p-LMh@`\P 0P  \ p0ph|{_ 0-@L0PS0 \00 U  0\0 0hV0 Q0 _P -0p LP`00 4( H V@ V@ + 0084#8 Xh:V@ V@H$H`04 0X& h_@-80@S 0\0@_$0S0 \_ 0-P@L0PS0 \00U  0h_$0S0 \_ 0-PL0S 0S0@004( ,d0 0 @04( ,4004X04X_ 0-QL0S0$ @T(0S0$ @T0004(0#004$ X004$ (008 84#8$ X004(#0 004$ X_ -LM|@0S0$ Q0S0$ Q034X034X_ p-PLM0`S0 R @ 0S" 0S0@0S0   0S d$0 0S0S 0V<0<80aph鸩kPLmcdD6_72fQ P0-L@ P0S 00@00h<PU@P0 0 RR,f` l00d S S P$0i 0^0 0j ]0 000 0 0,f` ,0 -LM Rp@B R࡟t^(0KP0*0P`c( 0e(  0X( <X( 0X( 0X( 0X( 0X( 0X( 0X0S( 0 X( 0X 0(X0 S0 0(0p 0$ ( X0X( 0X($0 $ @_H6p6 p-LM0 @P` (V  V (ppi눴6 -LM0 @P `pT TU00Xi (08U#80 U0 9먴6 -LM0@ P` Up $ UL!0S i(085#8$ X̴6 0-0 P@L 0X 0X 0X004080 00 -LM@ Q( 6 -LtM@4000\0@ 0SD h80坓P$ hu_pA(6E6t0@6 0-t0L @_04P0 \0P 04\00500h\_ -0LMS @h p-0LM P@0`40\TT5TT" T pphT p04 X0\040 \004 , p5\_ -0LM P@PP @5004 , 004 ,@\_ P-L P 4FhPh`6 -2L M P `]0 04\0@4 1\5sq|r040 \004 , a004 , 004 ,P(pK04 0\004 , @004 , 004 ,APU5&$"0 04\( 0? 0(0 (!C3 0 ( \_ -$1L R`P>U< 0 04p\0@4 0\5040 \004 , 004 , 004 ,@e\_6 -h1LM \1+R pW`Vp`@Pz, 0 4 08 0-* '5 @ { ~w z v@TPZy5j 04 8,o3f$fAi 0-LM@seZ 0s0 Z0 p0t 0 Px0| P ޥ.0S j:9H0H H D0008ꤵ60600$000T0ddHD0F0|d -L -L -sLPB -2aLMqP@4`KT01@T4 @1R@ T$ @1R @TZ@TT1@T0(@VUUU -P0 0S  0S 0S01䄃_ 0-0L 0S 0 S 0SQ0@A0@ c c PD00l/"b0鄃_Q0 0`ᄃ_Q -LM@vZh -LM0@S eRR0P0 00S 009 Rڰ0: -LMP Z 0PS @@^p`V@@ Th W^ PpUZ 0V 0pS0`崀0V o̾VP0Ӹ09P000W0X0A"P 0S W rmD0 V QW 0000BaoQJUPpW@:p@@p崀X>5:7gfff p-LM@Pa0`S 0S 00TPpN00 -@LpE`P@@PUPV0P0  0-@PLP7000!0h -Lpa,0`@S@'P`PPD0S d@ VdT_@D 0Sd T`  -H0LM @}0ZP hpx_ - LM0S0 @T0Y\hd0l,@ 8 #8~4P6 dl\x_@B 0-LMP @0z @0@0 P Wh0 K$ 0X00`>5E6_`1 0-LM@PP0Uzێ0StL0  $H\0\  @H 0P0T 0  060 -LM@0LL0S0P00L0 -0LMS@  S00P00H 0hHH~0P0P>0 -L@Pp` P  PTU=@ p-LM`\PYP P@0dS:ph0dS: p-LM`6@ TPPU $   00 00 @ Td 0; 0PPPp:A-,rM@`TR"00c@L0l01@Ѝ؁A0~0Ll1p@ A0c!10bS c 1 !\0 !R 0\ , 2q@?C0c ` 1 p0?00B0c !00aS c 1 !\0 !R 0\ \ q?C@0c ` !00?00̃_3fPmcVUUU 0-LP@0h -LMPPP ڻp P@@TV,K T`@ )ǻV!P10SV ``VT0\ `S, ( X, (0@@x), (0T``0\ d0Sh,0| l0llDp(0 t0l@l,@ :( H`00X0aBa^<0@H 00 0aQ2f7Mb̃_Qp1@-QF X1Q00 <1Q R 0SQ @T`VpWPRS Q TVW0SS0SSh 0l0 p 0t0 x 0|0 0d0h00l  p00t x00|  00d  %W A W@$W R R | 0\q 0 Q  -LdM3x0 | t5| , c t0WN40t%0 03 @  P[.XK  P0S S PP0'\00<tqt$3$0S0@1@!|z3  |70|72  |7@0|7|7@v 2"@ H_50%0PZb> @x@KLb> 3 H"t 0/x0Kl KP <|?4200|0L0J0D1" 0zP y 41 ,0S ,唣| x1t0x0K ?r Kl0 KP | x@K  !0tU x0K?r Kl0 KP |( ! 0`!͊_0@@%0߿P0`@#Hh P 8`p@5͊P%00b|t弿Td 7е6ص6(66_*71046`6@6p6~6JHFDض66 -@LĹ`$P P00$ ;004P$ $P؀ᱹ0 PUb p@0SP 0@! 0UP0U lpt@0SP 00@ 0UQ0⓮(徊P%N%r_0,U_r___*7 -LMD@!88#,!7Pp0Q  t <tP@0 |@s7S07 \ X0y<00 ,p(p$pTd@6H6̵6d67E6p6,66 p-LMpU@0 `&0Oph -L M @ 6@zs"x0 -L M@ 0@js"x0 -!LP!(ᩦP@C 0pqP`)0S* |7` Q 8Q2 R  Z0 10  Z0 10 00Nᗦ`Gᐦ|70W. |7| 0_ - 0!4LM#PRP@ 0pP` U0 80  U0 800 Q P_ -LMe <(0-070

40 47 U66WEV -p@LP`$(t(0"4 40\0$L0@ D0 t 0S000x0 - HH$tL M' `0 Dᦥ PP, |ǐ0{ 2Vu 22V* 1V t 0, ᤥ,, eo@ ,0e/*p|1V 0e/ FH1V6 :<10S  0p&P, |70|7 , 嫩P, t% 0S0000V |70|70  $44000 |@, 00 "   0,0 0S00|7_mdedAsd rdAhdk~gdx0 - 88@L#D M$`P, " , 0*0  0 ,00ŽI(`唠PPd@ pFQX,*0% ,vPP@PP@ _ -LEM0C0S\, p01  8 8#D0$0岤P` t%P 0 S 4 (@fP n$0rpX4! 0 0O]K  @P0 8QU <^  2 ,0S ,4 0@@0 p\@1!0 t5 YERO_OO|'00000@0`004!0( S 0!01th1d!leP< P l1S 0H1|1101/@4!0( S 1 ! b0 S 0!.pY0 h000LK,0D.tK/K<KKTLHD}{_Td_6__6̷6E6666$686 -L`tPP@ P 嚹P0pW W U ,e]( 6Hg]@00;00000Evvt%00`6~6 p-L$Mt%@0PSp8`K 7|7 @0 U00K10K002K8 KT0t,0 >P <厺2[2[  兺偺0u6ȸ66 p-LMP@8`sP+ 00 00000 0 (0 S0$0@00 @ ,00( 40 ,0, ,00 40/0pp1t 10 1 0- 0@ JLP 0h087 -L,M`12l1,0,0 p ^<` 6^y6 00@ 5 +P  ,  0$00$0T  oO 0(+@|xş@,tP000 o0@ ,@0S000 20<0 0<0 0@ 0S 0 00(8 0 0` %4% 4!@4 0 0@h 8@ 0O 0$0Y 0 5`%`@$ 0D<0HP0 400  M@ 3 P0* 080Ƞ,Ƞ0 D L$0 0$00f 㾹$0   0  #$0 0$08 4@00 P=0 ``8@ Q ! 0(P\`5$0Sڰ0K 0 9`)` @ P2 CP+0.8@400 0S\0#1 00 0 1  $P ,P 0$ , 0(+@ 08 0Ƞ,Ƞ0 80 ``0S0 0 4`$`0 0` `` P,@0040 0P@z0 0 @@T0(w8 Tʚ0S@ 0$00S  0 咸K1'6D6h66й6 -LMp12l1,` ^P 0@~RH20 Ph 00 ` 0@@B 0T R P000@(0 T2 0 L000@T$  `0@ $000$ bQڰ0 000czT 0  (00 00$ dU @ 0p@0@000/E  0 圶'D66646h66 p-LMPJ `@0 000 0 4 p0phY p-LM`J@ P0(0000  ph0? -LM02ct$Y1 pP,` 0 S 1111<11H111X11=0$00$0@ 0PCt00 k(0!L00 0@ 0S 000@  @M @0 000C000,   0S\0#10 10 00S  0  0" 0 00 0 @(0  p0000 0L+D+ 0004 dY 0  0@@000 @*z@ 0PA00 (0! 0} 00   0000@d@ 0P@00 (0!T d@ 0P@00 (0!] d@ 0 P\@00 (0!Y d'6к6t 1غ66666$6̩56-0800"R(00  000+ 4  34 S0<04 0@00000 -LMđ0勯Kp _K,0 @ 0S @ ?(K ?Kd1 @2 Xa0( K\0< 8R P(K0m ,0 S ,~  09 S 0#" 'P0!" P0"" P3XX SS  ?K^  ?( K @" Td 6NEFX' -L M<`Kp@ PO0<0K0 60K@?4 K7@KSK00 5 KXP3[= -LM 00 0 @R 0S 0 0 0S -LMp\W`pP @WĠeT 0@T8垵WP 喵_<_@6826?66 0-LMP@T W0K d0@S0T0T L@))000,0aB0\_6,t_6@672fQ -Lⱪݛ 0 hLd/6T_ -LMPpᅞP@ (0D `pɠ@T  ;P@V 00:00  -L M(0 @KP00$pt0DP `壠0SX @$00Ox0( 00<  P@e/ H000 @V 00:00 -L Mp$ `gP@  W Q0 00 P0  00 0 gPP 0S0 !P U "hh 0 0 @ 0P `L3f -L M0@S K K 0 gg邔 Q-LpP 0S00@T 0a VP@ 0T p-PLM@` <TA,!<0 phh6x6|6 - QL MpPH<0SB8P@; 00K4 K400 ,0K( KP` (04@KP  @"P@ <p0S  04`0 0lpp@4(00  0- PRL R1<@T  0:V0  5V0p0Sl0 0 0-0LS@P0Pxx 00 S P <0 T  \0 0hfh 02r_$1__/7 - QLM`P6q0<@T/ 0R 0 lp0S0p00pRp 10Hp0  0 p0W 0  0 0;  鐄_7 -LM@p0  0p0 0$ (0  -PLM 0 0 P6W P-L`@ 0PU R@B $ph02T@D/7 p-LMpP!/ PU,  \ h 0 \2pd0,R 0 K P@@ ,`0h "0 T@Dp/7 -LM2"0!Q2@< 07 -LM2@p( R U)1<`V W 2s 20 2ih62 02p  lPp`i,%p! ׫@6`666 -LM2@Pp5 q+ Q41<`V! U 2022 S04 0 R0|0@ #PP  hDP0U2pP֬卫h3f@71ؽ66(6 q-LP@p QR1< RL p R l0U Ruߦ2602R֦p`V) l02 1<   1<  ht1< Q    0 2ꢦ -p0LS Q R h0 $  Q 1<0 S 00  p0 Sl  -qLMP` Qq<@T ap0T 0 0 00R<0`T 0`0 0KFp0S?8 06p P00R00S`P6Qp 00 0-4PL0@S\00P00`3f -dLM \L@0KK <P <P  H3fL3f`3f 0-d0L \0R@P 00$\ 800S04 `3fh3fd3f0 Ḅ_d3f0  Ḅ_d3f=1 -H0LMQ <\ 0 40@`3f Q-0L  pS0  A b00\p40 -LM0@ 00 R 0tS0S00U 0-00L 0@S0 4d PR0t0R0000hU002 0-LM@P$KT 0 P  0@SQP 0@SP  0 0@S  0>0 XW 0Ra R R P-L P ?#?00cShA1xA1A1A1hP Q hQ h P-L@`P? T7 T# $q0@<\ 0 ?01 <0!! <0 <0 <0 <0 <0 02O 0(㫁"P00R00S0P 0200 RpP0 b_X6<3f -LM0Pp 0崁p@`%@D0S0ץ0CS`` p0  00CP0ҥ0CP0p 0l"!0pP 0 od (0 p 00 0o_ -\1LM p0 04`@0pP 0K  05 -X!LMpp0  @JXq 0`8#8440 `e00K 000[ 1< 80 J0p 4`0p @dPH 00K0I8< #P 00[@!80R4X< < R0B0<0 <_l>5 -!L MPHp0$H Ƞ0`,-4p0P0K 00S 0 x0[0p 4`d 0p  @ P 0 P000[!0X0_l>5 -H!LM00p 0 @8#x P1: p0A!0@p A! p0!!  p0!!_ -LMp @ 0p 00 0 -LMA0p 00 00p 1S0a0c8#0p 1S0a0c8#8P * p101 p0!!p0 p0 @p0"Rh(e00 p0!! p0!_ -LMp @ 0 p p 00 0p 00 0 -h1LM p0 !4  币40X#8#8B0CZ80 >1 p04`0p0@P 00KPȠ% 00 [ 0 P 0 S0(p"0, @@D0P8# 0 0 (40" X8 Z0 0 0_83f -h0h LQ@^F X _0X0 -T0LM (("!X@ T  00X_ -0@LM0X@ -t0LM Ƞ Ƞ,A04S 0000 0CS0 x _@-$ @.MЍ@_ 0-LMP@@ 0@0CS00x -LM\. 0\ 02pXP 41` Q 80P d0\ \0\XP 41 PXQ 00S00}f|f~fvt -4L M^P@`p 4^ 44^ 3^ ?3^: 3^ 3^00 tpp 0 tp p3^ x3^p 00 P3^H  00  2^w G2^B )2^0S!1p 'R 6P` R c l kH2^6\P`0 00  000 1^# 1^y0       0 0 p1^d0 S0 ! [a[P`,0      00 000tpA@< S l0 K  $@ P`l@10< S< 0S   $L0^ :L00SW WW WW @W@WW@ W @_W@ _ W WW W-00 Ƞ Ƞ,1X0S_D0P  0(1S \0SP_ -40LM@ T0 \ 0\mc p-LM|0@SPQ \`V0U\0P\P \`pU 0 (pp\`Vp<6T6PP 0P 0!R `0SX0S  _ -0LMP' 00S P @`Pp0 KS0C$ K00 0,A(oR0: S,>   P`0R P 0$ $ G00Xmc\mc@_`mcTmc -@0L R 000 0S 0S 0Xmc\mc`mc -4L,\ \ Xmc`mc 0- 0P @@ @  @ @RL x0T tp  0x@0R  Q 00# 0Q 0 000 -L M; S, # Rr Re R n T PPM P `@0`0VA` Ƞ ;,HnP; S) 0 @0D T  8:S00S@ 2T@ 30D8S0D8#H8T@ 008#HA0A12,R0V0 R00T2T; 00 2R 2R R;00A Rx!t Ha[00{80 0-0 0(0 0#0 00 00 @00 00 < 0 <T 0 ; sT 0S 0 R R0V&0V#0 9,pK T 0S 0<0 0 ✀6{  -p!LM04 S\q1Tq080 0K  8P`@`V@DPEAJ3[ S"[00b0cS  0KX8@ @08@ 040`၀?000 R # 3 R?H0`?À 4@ 0R # 3L_D_ 4S @08#<@8oS: S>; S P 0 R0,RlB5 -LM@Q 1(1L1l11<0000000000000000000000 -<00000@ L `+ p\&0S \\ 0PP*; Sh!,\1R 0P: R: S:#:A >; S= ^; x   Sp , d0R P0 R:U  hK P0S k p6 p-LM0`PP@ SKMP L0\  00  00  0 \p -L,M@  `^Q 0S `^ \ ^PK aQLXPpPKa @0T*<@8oS: S >; S|p2Q} @ T:XZ WePKa @p0T[* ; S1QO: Sʠ,ʠ >; S<@8oS: S <= S= 1P: 1P7 |1P4 TP*00@ ;   S 1Q P0 R:U 1 c0 @0Tp:XZ  10 p@: S:#: >; S Pw: SZ%Zr >; SPPm0S[ 660Q 0`c Q- L∘6 0-0@l0P0 p00 LPU 0Sj0hgx_66E6Q p-LM`0PSKX@T 0S1P!00 S P0 ?pk0`0CS0000 R00D0S0S|| 02c1KoPIL04 r^00pr_1__76 6 -L$M ,0 0 0, 40 0(0 @0#4 p0#0# 080 XZ 8@ |0t@0|08 @0,008  D 00008  H 04x00P@  0R"<0 ` 0S P?#<0<0cS 00L pqLU` ` P㌀T 0,S P?#<0< 0cS 00,00UqU`, `PD0S 00S P?#<0< 0cSt 000009qU`0 `PHPf 04 S P?#<0<0cSX 004  qU`40 `P0t@ 4 P?#<0< 0cS> g9@ 0000)L pU`P ` 4L80 P?#<0<0cS @0p UP\xP30S0S 04 oq]00 oPE0S P?#<0<0cS 00  pH U`HP ` 0Sy P?#<0< 0cS 00  pD0U`DP `0c0SD P?#<0< 0cS 00  pU`P `@/|0S P?#<0<0cS 00|  L lpL@ U` P `| - (L(" P` 0AT P0S XpW4P[`+P`XpaP_ -\0LM (("QX@ T 0pl X0@P_ -0! LXl p -p0LM Ƞ Ƞ,A0S 0X00(0 0CS0 o P_@-$ @.MЍ@P_ 0-LMP@@ 0@0CS00n -LMPI(1Q: 1Q?1Q< 1Q0 0Q 0pl00pXP 41` Q 80P 0Q p0QXP 41 PXQ 00S00 |f}fvt~f-00 Ƞ Ƞ,1X0SP_X R> -LMp @l0X@PP 0P 0!R `0SX0S  P_ -LMp0PP쀟0AT P@ 0 AUᔀ `VHP@ V !ٽ0 S0SV @ H/騈__}5D6d6 ( (-"L@pPP@0 T0 `04@S X`V0p 0 -L p-LMp@p`TPX 00d@Tp 0-D0 (("ALXPU 0X00鬈_ -LM@X@ p-LMp@pPT `00X`d@Tp-00 Ƞ Ƞ,1X0S꬈_@-$ @.MЍ@꬈_ -L M`0V,0 :3V3V x3V Ll3V@ ;`3V% X0S\0S p@ppTP ,000 0 d@PPTU 2V 0x0 X@T 41` Q 80P x2VX@T 00S00,2Vf 2V0S SoSoo1V 1Vp@pT ^ 00  00d@TX@T. ,P 0 P?#<00cS`  OmUPP0S 0S 04 :Z00lp@pT 00 R d@Ty 0RZX@Tn 41 P#QaWbW`Wvt}f|fW~fcW-00 Ƞ Ƞ,1X0S꬈_ -LM@P `0SX0S T0 S `0Sh$ p-LM@ `|rFPU0p4  p`咓0 `00x p$5_ -PLM`@@ pPdP`0ph0p R0pd@\Q 000SXQW d 0R`0h0h00h0hd Pp d 00pPppWx0S px 00 W 0-`PL\0@S 000Sd pRh0h00h0h0d Sd 0p `00X0S 00 -LMp@p`Tp 0P \ 0d@TWPpQ \0 S\0 S -p@QpPpp TL\` 000Sd@TV \P ` P0-L@ 0SH00 -L(M0 4,8 mQ`( G QMQLQCQ _AQN -@Q (0S (o 0TPR35 nQ@1@!pg\ Š%5 TP45%D 0 0aRP 0CS00P0 0S 0 0CR0T00T0 D0R 0cS0!PcP0HQ DQ0S, 0Q01 c, JQ KQD,( 0HSD 0Q   B P R 0 R 0 BS T 0T S0>"R ! B0,0 `0T00 S0R !0 TS2 a0 BRDpHP0S 0 l gR@1@!aL^HD HPDp34fQ @XQ- "PQ(0TPpS>0 gR@1@! b\ Š%5 TP>%d45%.cQ0S$ T 0Q3 0/S51t111|111111111111111111111111111111111111111111110@TPp @T@K 0D@K@IPs@0D @p004 8PJ?66i?h?l?p$? -LM@P`p 0@0 00P+ 0@`@ 0@@`@ 0@ 00@p@`00 0 0-PLU@ U'LP000  ^0 /R 19R00C P^L0 0 C^L00C<6AQ$1111111111111111111!R,00 ,R ,0,00,0 p-LM,@AP0CQK,1T1\1\1\1d11L1L1L1L1L1L1L1L1L1L1L1L1L1L1L1L1L11L1L1L1L1L1L1L1L1L1L1L1L1L1L1L1L11L1L1L1L1L1L1L1L1L1L1L1L1L1L1L1L1L1L1L1L1L1L1L1L1L1L1!R@ ,R@,@p!R@ ,R@!R @ ,R @ !R@@ ,R@@T@` @` 0V!R@ ,R@ p-LMp0PS@ !0@Tp0t R`@ 0!0@Tt x RD`@ 0!0@Tx phC5D5 -|0LS@` QP!0PU|0PPPp01| 0 !0P U"E5E5 4S!3=8S>08S, >8 ST3T#1 $t2Q h2Q `2Q L2L2H2@2Q 82Q,2,2$2$2222Q 2Q 2Q111Q 1Q1111Q 1Q ʼ1Q 1Q1Q 1Q1Q ʈ1Q 1Qx18 h1Q `1QX1T1<1< @1}<1{81y41w01u,1s1k n1!10 101;C H_@7<6@6D6H6L6T6X6\6`6d6h6l6t6|666_66666666mc8_53 -LM@PTp`U 0 S  0s P(0  0 P 00  P@ < Kj  0K P 66 -L M` P@, p 00CS0(S0  \00 0T@ U P4$0Q44P8 8@  T8 @  0hB 4P00  g@$cD1c!HL <0$ 001T0$ X0($0P @0\`0d0 <0 1c80@ a00 2 PlAd%:` Z<2<"082 4"002 ,"0$2 "0Q0 0(02 0 1 00A S-1p1p1p1d1p1p1p1p1p1p111;(  0t!0p1 0h1h!0d1( 0<(0,=(0,<(03e \0  c㔭8@PU  \0$!0" aㆭ<0 05  a}8@PU t(0 0(0W ឵D$ᚵ@5<元111111P1l1411111`116 0-L@0PS  0Rc0Q 000 0 R@-@0P 10RS<8 00I5 000<8  0 E-<p$@RL1P̂+X 0`5%7,@Dt" X P P 00  0 0  00  0 0 Z 0P0@DtA A"0pBP@%,`c -LMX$`$pT`FvC%B$  ᢬`F0v@P -L(@pP`0S P$` W(00(0(00(0G-@MT> T2 ,P E-./0p1` U0ޕ0ޅ  eS22 R0ޕ0ޅ b BS22 R0ޕ0ޅ b BS22T T 1\hЍ 4 8 <\h0 48<\h0F5-! !^p@-C7@<00RP`h@$ 0<$ XL1H!!0"PEu R ^@@@ @@@@@ S ^@PEup(0  \B1 P0"A-(0@ @0 $00bT0C$ X>" P00c R b00$AL| 0 ^P 0 R00L|L| p`0VP0 00X000 ^ 0 R00Q0 00W0L00|G-T`p@X 2,0 1 TPh$4L|DA 0TP PL|L|@ 0TP PL|L| 0TP PL| b0c 0@cLD1|b@  X0YVP P  T PRLZ| p-LM`@PT 0S @T  o5P@ p  00@p00pp_ -LMX@$p@% bT0 apGL Bw &R$  ΪpG0w`@T0 -LM@p aPL `@  @0T0d0CX # $ ';<0A0q& 0Aq -LMpR@P`  0@T -QL M, `XD0@T , Pp0 @D0@T XSJD0@T ,0Pp0 @gD0@TXZ -LMRp`P@T0  @IT@XJ0  =@TZ -LMQ`PpD0@T`V 0pD0@Tp@-a0Sq@0!0 0!#1 0"#2 0$#44(< 0@#8 T0P@0,,!0 0!#1 0"#2 0$#44(< 0@#8 T0P@0 0 0 #1 0ll"#2 0$#44(< 0@#8T000p|_t_UUUU3333_|_ -LM@v 0 ST0 S D@00 0 000 0,0 0S01068111$1(1@-A;A'<0<  0hh0@|  4 4006 600 0000@2 2T0 mcmc -LHM`\@p oT X !4.0 X@$P嬐 W& 0P 8PEpbu ( 0PE#200u0   @ \0 AD! 1000C0PE00u0 PEu00@mcmcmc -LhM`\@p oeT X $!4.0 X@$P嬐W W- 0P 8PEpbu ( 0PE#200u0   0#2000 @ h0 AD! ! 1000C0PE40u0 PEu000 @mcmcmc -L∡M`\@p oT X D!4.0 X@$P嬐 W4 0P 8PEpbu ( 0PE#200u0   0#2000   @ t0 AD! ! ! 1000C0PE80u0 PEu0000 @mcmcmcA-` p!PX0!1, 1!0 P@$h 2L|` 0 0L0|0 0 Q0!L 0@RR|` 0Q@00000U0CSR0L000||__t_p@-@P$0 X0a<.1 0 R$@@D0"t 0 @D0#t0pph0h  @D1t 0p 00#0q0@D0#0t|__t_G-0M, 0P@,P00X0PPP` U$p@,!0pG0 wP( 0b@U0S T eR0 APd 1Z * 0! j\8%1^<,pG0w0Ѝ%0Z:$P 00Q( 0e 0 0 0A22V$00S,P`00`  `VpG! a `Bw  02 0,Z0 @ V0S 0 S fR0 J\Vڬ3 00003 !@@D\ V0S Q fR0\@D(\% U0 S0 S eR0 0 @CTŸ 1Q !2 0 c\ 1^<  pGw] "0A\<X"0  000, 0pG!0 w> 020,P(0\ @ P* Z 0`S V jR0 P 0 PCUT| 1\ ,d1 0 c\ H1^<  VP@ PF\ U0S Q eR0\@$ R U0S 0 S eR0 A\ڈ0P 0000 !pGwT 0  000 , 0Q0 S3_t_|_0 0 S$0 S000S 0(1111E-M pTJ<h@J+X< ,$P ` @h0 P- 08 PPEcu $(  04 8V@   ? R0PEu 0`FvL0 `Fv0ЍPEu 0V    RPEu@-A;A'<00<  |hx0h@  0011 @01 (01 0 Rmcmc -L<M@\`Pp mj1 WT0X(# U$% 08 P@Pcp!!( P0@#1<0 p 01<0  0 \ 0<L00C0@p (P0@00 pmcmcmc -LXM@\`Pp m 1 WgT0X(# U$+ 0P8 @Pcp!!(P 0@#1<0 p 01<0  0#1<0  0 d 0<L00C0@p ,0@000 pmcmcmc -LlM@\`Pp m41 W T0X(# U$1 0P8 @Pcp!!(P 0@#1<0 p 01<0  0#1<0  01<0 0 d 0<L 00C0@p (0@p0 000mcmcmc0 0 Sh0 S\0\00,0S R/0,0R.000 0 0-10S 0`2212G-M(T) <h@pX)'< ,$P ` @h0 P@ / 0P8 PEcu .  04( 8V  @ ?10 R0PEup 0`Fv @D `Fv ЍPEu 0V @  RPEuA-!;!'<0< 0 P0h x@ 0011D  00!0000P0@mcxnc -L`MP\p@` md(1 XT0X'#@v$, 0P8 N`c~& (p @`0N0x0~  01x0  0 0  p 0L 00C0N80~   0N~|ncxncmcnc -L⌡M`\p@P mT1 XZT0X'#@u$5 0P8 NPc~% (p P@0N0x0~  01x0   00x0  00  0L 00C0N@0~     0N~|ncxncmcnc -L⸡M`\p@P m1 XT0X'#@u$> 0P8 NPc~% (p# $Q@0N0x0~  01x0   00x0  01x0  00  0L00000 00000C0NH0~       0N~|ncxncmcnc(0$8 Q!0  Q:I50@-P(P  $08@Dt @\ 0 0 A\(@Dt0 p-LMP s80`@T  @Tphsnc -L4M, <e,P4 z ,4< ,@$0 0⣡ , 0 404@O,P8 n ,0@ T,0D $0P0 K, ,0$ ,P (0H0 8T@ L X@ P pX0LW#,*,  T08 @0 < P*?< >1G0c @ @P`?>1 1@V3 0Q00AP :P pH0W:0D QX0T 0 H 0X0 T P 4 ,4  0($080804P48,4,4 4,8 0-L@ rP%@r[P 0h(0-LQ@0 0R, 0 S ncx_nc,0 P 0SPnc -Lp `Pr0@T U 0$ R @T rV 0 RX 0( RW P rnc -LMp Pr $ (0 0S 1P+U0@0`00 <@开p1 `^r6+< $0( @(+8088 밁Drnc_ -LM@ P`7rpdP@& U ,0U 0SL0,PV 00V 0S P00`00("X0r rP -LP p`r@-PU10  qU 0-@L qPP@ 0C(S"H q0dv`6@-0S4 S/0!0@Ġ\@(00\$ 0nQ T00T 0@bS 0 S00T0P00SS0_ -LcMq0P@$0 40@@R00}/#\B1VwTTT Mw0P0 $0S h$ZX@wTa0S0D!0000iK1 ;0@00  m`0`2S%w@4 0P$@X0S 008 R 0  0S0 00C0_t(00X 80P0Hv 8v0P0Tdd_666E6T_=6 266 p-LM0P\^ @L p0p@(Q```P`` `0 ^ pP'P (tu$ruL_ 62_d4f2P_(606X6 0-L@p0PS0000 0@@0yO0hpd4f -LM@p0S R 0 00  0  hpd4f 0-P0L8 X0  0\2S @0S" ? _00\"R P0S"@002c1  }MP0S ` 00C0'O 0<D mM0\2S 0S@L@O'L_7|66 -LYp`Pp@ 0Tl  R0000 0  Bp >pP8M@Td4f6 Q- Lv6 88#$R\\ 0R01SP0SQ 00`_x_x4f - 8LbMР8#P( `P0 So@jKo0Sttt 0#@LP@ oT (0 S 0(Y ?@@TdT_66 88#P0 `_x4f -L Ƞ Ƞ,4MP@p <2 QPPy(2Q 2Q 0ό1Q 0B~S001<P  E 0 d0T N  VS00< R V P0KH0 @0KP T TD 0 ,p L` 8` 4 8(00S 00<1 P0T0 V 00S X (TH K?T H K?PT H0Q @0QQ(0$0px_UU@Ut}f~fx4f0 0 4 S-L@P oA`p <0 RpnQ Lj\_l4f -LM@nH 0S00  Q0 0 0S00hnp4f0 R=  0\_ p-LM1@s 88 #4 pS0P`$0<`80n00@n p4f_ 0-0 _0LS@ P0S 0000 8X00 0S P0S ?  :M0 ?1M p-LMX`0SLP-@ f1S0P'00C0p\_T_ 0-LbM`P0PP@0  cK T fK' 0S W0 Td6 0-LbMPP0 @ bK0 fK 0S lW0Td6 -LcM䀟0k_K`$0 @NM fa&-pᾥ` n @0iK0cS0x 0͇1pLXT0P m $0S ,$/Ww:gTd\_T_l4fx4f6 p-x0LM R 00p`B Pm0`S phm000 0@@0m= p-LMQ@@P Q pTP P0S \ R 0`S [\ `1PS 0-LbMP@0 @S0 4P0+L0SA00`"R 0fK1 Y0 S lV0Pi0 0`20 L@@ 02c 1dJP 3sTd6766 -LM(@0$S  00Z(0_|4f6 00C0_ -LM  -LMPp^@`   0S & 0S ^ 0S K0K P  0R 0 0 0 0 0 00  -LMp $0K`PP@0 PP @ @` $ $0 $P$0( 4$ P@0 $$0($0 0- 0 0CSL@ 0P U R 0 0 0 00C00  $Pe& 0 -LM0p$0 @R (B(0P3,1P # 3?0@CP  R0 I_KPE00 $("8  00Z00",S ?00^0#03^00SV000JKKK 0jP,1S QK% Q&0Q41!P0 S0 S0 0 SR 000 S -LM0PP,0 @`0<p7 S'V W 0S 04  iZ U 0S 0,4| oi,  o   0;p ,04PPP66 -LMB4 , @ipT0 P0D016 -LEMh@PKp `K?K0 ,@ 0$! KKli 01V h 

LP\0@01eH\0` d0e|4fZ2Z2 6 -LM, @00 0P4 `e PP 00$00 1020 P 4 T0C @2356 P 0S \ 0S\z X 0Q~ <0S00 0 Q p@$ 0 0@P@p<` 0p@T` jW `0 R4 0S,0S) 04 50<P@4P@  C  C4d 1 -`LPVp $@Th dQqHdq<dV  vdsd566d56 -LM@\ 0 0s S | 0s S| 0s S | 0s S| 0s S| 0s S | 0\ 000| 0\p 0P0 0 -L M0p@0`00 @NI0H A$E D040G0F $ I H040@ E? A1B x1 p1 R001 F? \0SP PR ,@I l00\P!U00R00S@U2I? PePU X0S # 0PUYχ 0 0S 00 4 PUX X 0U 0 13 p-LMPP!8P P0@`Te"PP \Pephee@T8 p-LM @`\ R 0PS 0 1< phJ\01\ P1Sp@-|` @P  0 Č$ L0#Q `P8Sp0 S0S SXK5 -LM@ 0 S0 S  -LLMP#@0`0P ,0 P 0S  b3 ,0S ,OF_0\KTK \0K[K)0  Y0KVKU@KZ@KX@KW@K Rp[W00P00SQ@T@TW 0f P@ 2XH 0S00S 0Sl ` KPL `OP8 00S$ bT f,0X0840` `PU M00B0S Sf `P P010  P 0S}?d0000 B0S0 S@\ X @ 0T4 0 R090Au jP@T 0tbl` b01 0CĠ  UKV0KW>Td66d26<6X6t6h2666 -L MX p, 90S 0S,`0Vʆ0AP P , `0VX 0 DXZ  P X0S  0S<  3 K P  Ta P 0  0 00  `PP   |a  sa    d 0SS00D Ta4 Oa0 6 646d666 -00QLX0 Q S R 1 e!\:0> 0C0 n>S -LhM ` PPpK $P@ < R RXp0 SD0Sl -LM 0@S r P 0S0  0S   -BMLM P0004P`pT 0@0X0 @T@0s 3@R CKC.K A Bf08D P s^0p08<\`4p Pp:@0 a^Wڐ2W" X^pU^f ZPhJ 0@0dpH0 2TC^KPE08< P@H0PHTH0@W0TH00` P 0<8P 08<P0  !14K,@ Dh0C.KP B180@T8<P 4^0S SxA}0T<4 s f< P8 v <$ŏxSf 0  @0eP 0 S 00SX 0@T?`P00S@  <Fj666@646E6Hv2v2H6__a_X6|66 p-LlM0 d0 @P`KP d0T@p -QLM@ ]0S]66 -LM 0@~  ^ 0 S 0000 p-QLMP` Q pd@V*h0!@RT:0p0Ed` -P80PLp0p\Pd` V@*h 1S@ T:0 Dh 01d`f 0-LM@P0K  T TdD P00C0 Q *h0\ 500  <\0806\00` -LM5 `0P\ 5 l00Sl0 H0S f@D4PD $ H@80 @ P@p"0P< p X0s  4XL0P@p0PP 0PT L p8 DfJ50@050Pl@P8@L@TPT@P@ x2 0-50L0@ 050l PBUlPPPTPLP8PDP0fDP,88P'LLP -LM4p^@` 00 4`C40P 0004 40@ -LlM 4@T`pK$ P 0 04P $0S $$z?@KPߍ4@KTd06 -LM4@04 0 -LML P @0 @TK@@H6P p-0L M<00@00 P4 K K` 0 \0  @0U  0D ND 0H@[p~2\6Q Q 0-50 L@ 0Ppp 00 S P0 0U0P0CS0P[4Ur_42__ 0-PP@L 6|0 lzox0S00h"| :4 0- 88 #PL!*0AT 0SZPP 0P ၄p Df @|0L0|0xP 00_ 0-D0 (("ALP⅄PLfxP0_ -LM⤑|0P, @p 4 @0@R@`K0 P@ %,0 S 0,`>UP0S@P`0T!7||20pSpW)P0S TP R@W00T00S KP`T@!T@#  h  S%PpP R@T|00|0 T#Td66 0-X0L Ƞ Ƞ,A000}0P0CS00_ 0-0PSL@D0 TL% R0 0L P   0-X0L Ƞ Ƞ,A0000P0CS00_ -LMx0S`P(  aX2Q 9L2Q( @2Q (0 S $(=4002Q0S|00|04 @0R0 KPp-|00K K00 S;#0 0 ܋t1QA h1Q\1Q% T1QQ Q@00 4@0@T@0 TpW  屋QH0D0Q Q@00  0qpQH0D0xP 41 QPx x0Svx ~Td}fUDU@6Uvt~fUU 0-LM\ @.Q@@?0@0CS00_ -0LM Ƞ Ƞ,Q0S@p SA ` P0lS`S _ 0- m7> 0FBa7Q -L(M0PS`Z LpX @ W*0@ 0SLK S <00p0 T:!PP @T*0P\?@T:@T*0\%@T:L0W 1S c LKnq@QTP LK0|  @ETQQ*0P \ Q:0LKpQ*0 \ Q:0,LK p -LMm? R`1S  K` T!R\13 0K <\ 0[D!2 0K HQ 0[P!2 0K K0 0 Q-L h0Q 00H0Q @0Q 0 `1 W@W@ WW -LM<@T 04f4f 0S 04f4f -0PLPp@0S' p+0\1c?@L`c a奈 00@W0@m004\V00ncnc6 0-LM00P@K4U P4 0000P 00Cnc 0} 0 4f -L|M`K0 K pK@XPP< @0S<6[S4 t0S 8\X 80Kp[Ƞ 80S4^00 1S80KḀg@40Oφh P40RφL P40Uφ0 Ph666666 0- LP@0 PP 0 P 0S 000CSPPP 00 -LMp @0 040 8 PPXY\` 0X0 Y 0\0 ` 0S4}P` X0S0S S0 X0Y R 00CS񟗡|2222220 Y0X0S S0BS񟗼P2X2`2h2h2l#0dUU 0S0PUy<0Su =Qr X Rl R00c 4D0 XP i 4<@0 NPX0SG 00`PP` PUZX 0S- 4S* 0S% SP2Y T00BS 22222$4U0 i +UP #U1-P X S4>H0 P =>0S4P 0 S00S=  X0S 0PUo 00S> 00S<  iTPS j F D B @ >S00Y0 %0!0S PS 0066 9666h5,6L6x66|h5666666 -L`p@P@P7PU@ZN0P0CS00S QNAT P)0X1 *0 X *<@ @0@*@p -QL1  Q S 0S < -L`p@PPPU@Z@P`@PPU@Z@`~p -LM0@S  1S01 1SP P1 010C1P1 R6 -LM`pP @ 0TP@@ Ƞ,Ƞ C0000 R P@@b= -LM@PP`  h0!T` 0-0040 R Pࠁࠓ7=Y0S 0r0Ss 0Rr0 R0S0w00ZR0S 0{ z0 0$S$0 -LMP@U`1p @0<0L00MQ0PNPOPRPSP L0 -L ML0Xp 0 8@8P`DD!LMNORPPQ@S`j -L MP0pN=U``GGGL0 0 10S U0d0e B0C f0g 0S0)0K h 0C4i0 j k000nmo@lp)PK)0[s@p0qr{  τ 0P00p000 0 0PPEDd 0 P@00 0S Ax_= p-L M0PS@- 0BS2<22D22D2X22ĥ2T 0R0P RA R*R# T00CS000@  0PPpph90\# R \ 0 (T T 0Q0ph BD 0@@@ 0@ T R 0\`@ `@48" <S^  hi0jk 48M딲2h6 S00-1LP0RR00,0000H@&0hH 0-LM1>@0TA KPK0K 0?00K00K0K0K@K@KK@KPPP[ -L M1>@TA K0K ?00K00K00KK@K@KK@KP0 [0[4 p-L M1>PUAd0 K! K p!0K@0!@[ 0K00K0K`K0KPKK@KZP p-L M1>@TAT0$ KLd K p@0 0K00K00KK`KPK@K$K#`KK6P00 p-LM P # H`@#b@TT !phyM6 -L`pP@P@U@ 3/0 3 -LM@ 30CS 3h -1>pLWP@`  %\@ (X\`@(@TT &'H$HeM6 -@Lp`P &U P %, ((DP@(@TT h;M6 0-@L_ 000S5  006S$   e1>PU? 0h87 #80h  0@-HP@ 0, Q ^?0 -05L P <5^ mW @ @T8bVp `5<5 0SA@20!pVp`5 -LM@ a{ ] hX p-LMP  M`@ @TT ? ~$ ~ 7& ~3? $phL KL'6 -LM 0S4F 0 0nP 00(n5 -LMP`p P@?/@@2",3@#0cDcP, K9P@  L0F :,?R!x2 p/p0PTg2S 2S 2S,F(@K` P K# ft1!0p5$!1! 10!X 0`01_!4018  @<0 !1pI 0PN$ R "0C"ly $+ 1!0TE t,HP 0 S00S" 0@T00S"00S"  \aK62266(n5,6D62H22P2222L22\2*7T6 -LMp@0So0Py+aE5@ iN?vT0QL0  30CS 3TBE y*7Q Q1> p-LM@R40+P`  0 d{ @p yP@ Uy1+(  Jy7pJ6 ?0-LP $@7P  0S 0P7  P7  -LMO0 S   P7  P7  p-LM1>`@Q00/ 5@ R R00RPPU p303PTphi#0\jJS0S 0P@ 0` 0P@ 6 -LM`1>pQ@0P 5@ R- R00RPPU 303hPT ̠A0  @#0@JS00K 00 {00S ,KA {*0[0*0K*[Z 0P@ 00 0C00 0 00@PD4 7P <P  L 4D  0@P26 -P1>@LT`0p C5X;E5 XXmC 0@ \IX  0@ ]x <1S q6P1> R -1> LR@0` _ CpM  R T0r)hC,0 00 0S  <1S =7 p-AMLAO0P `0y P 0 C400\\  P303p Ikp'2 6 -LM@1> R# = R 5+4Q P 5;54Q 0S418<10C<1<P5 ;%5 -1> LRP0p⑏5@@ CQ#n @Tڴ5 A X 7P2 7P, H A : z6L2S % @ %5;5BP0m(P mB$H $67@6 p-LM@? ?\PP? 3SPP? /΄%+d @oPP ̠ ` Pp 4 LR_ = ( R $@T M0@TK0 0-@LOPK000,  0 -P1>pLP@`w'B1TZ1TD*1T4 1T ` B%# = S =@S @ 8C8`2%2  b 2 W @ s5050 R0d 0\ 4P`5@`0 l0T `0TT0P\բڠD0T/0{ `2i 1i i i 5i i 6i( -L M `@0Pp```hGA0 $KP $ <1SA<6 -LM@h -00%P-@%LU  p'PSP:P!`PpPP`PpP P = erub_rubP qP02s Fm FP [P02] xFW dFP EPRH ,FB F66646T6t6 3/0 3 -LM@ 30CS 3h 0-LM1\P @0?00K:EDLKK CʠKC6PKK@K0KKP0 -LM1>`pPP 00S S @ @K@K 0@ K l0 PT0@U0[ [0pLFK 6 -LM1Π P`UCĠp@ K 0Kuh 0P K L0~ @40PweT F! 6 -LMt2). 6S00@ RA?< R 0, O0ShE6 0- 0D3_(0LS $@T J0@TtI0 0-@LOPI000,  0 -LM1>D 0Rp( 00 ,0  (0S (() 04K4 [30[ d18R`hU&h@ P0K< 50 0 0S0KΠ =0!U @P`Td6 01.QE 0-@MLP 0@Kl 0X 0@0@ @(1[#4S4  <0@ 0@K <0@@y 0@xp H0@og 0@f0 04@_W  0   0-LMP@ 0PH(@Ϡ  ^0  0P7 / H0P.& 0 %0P"  0P< H0P 0P (0" -LM 0S0 0P 00o5 -LMp0P`2 P@0 ph#?)@#H S@3@/034SP@ aDr!3 `/`0`< " 0S;9X30@T P 0 S00S" 0@Ta>L.D υ04|)>0j  D).0@  ,`K,`K0`c υ0\!?@@C# l X0Pb10p|!5x1$!t! 1p1o0!h!40d18  <0 L!L1ps  0zF$ R "0m "  #0  = K00S"u00S"p f pCo52626:6 6 6``0K522x222D224226$6 -LM00PS0`# 1> P9P4P/= 3p0CS 35@O F h 3 0CS 3o= )ZQ Q1> 0-LFqP@0 q1P+  s00q0 p-LMO0 SP$ , ` p<P7  XP E7 0-_0 @SL   0P7  XP'7 -LM1>4 Q@0`p5@ R' RR5PT X#IkX04  46 PB00Kp?).00s[ 00S=  ,K_t[2[0 0 AS0 /Pp,08#x0g00 DPP! p 0@  ` pp:t<@<P  <00S #x0P@ T2<6 -LM`1>@PQ0p `<U UUiW< 0@ pBU 5U;5 p P<1S0P@ X6P1> RH P-L@$ 1> 0`R_ <pED#R T0!h<,0 00 0S D#<1S Y7 -LMp)00P$K1 o< 2 @1T2K2[@@02KLs0 0gq0@drP  P   @$0S2020K2KWs@ 0 8q@'2 -LM@D3S 5+4Q P 5;54Q 0S418<10C<1<P5 ;%5  -LMPm;p)7P0} B7Pw ).0@^ 1/0 4v)>  2 R95  0`;?*> P` v (@i%;?? P` e O0X `Cp%@ %5;5;0i /0` @D \0 @, 0E@(@t6IJ66T276 -X2LMQP@`pr42Q\*,2QH $2Q p%9 = S# =@S @ 8C82:%2  0 K [ 0[40 2 X 0 K [ 0[40 p@ p505%@ 0 R0] 04Pp5@pc0Ix0Q l0Q-P0P\0S\<0Q/ 0 p{2i 1i i i  5i i 6i( p-L M` 0@Pd?%:_0 K@ <1S:pn6 -@Li00%P-%U PRP9P `PpPP`PpPP0D3rnbr{nbuP P02 ? ?_P P02 x? d}?IP PR ,n? h?6,6P6t666 0-LM<@0TA KPK0K 0?0\0K00K0K0K@K@KK@KPPP[ -L M<@TA K0K ?0\0K00K00KK@K@KK@KyP0 [0[4 p-L M<@\AdBT0 K  p@0\ 0K00KPK`KK@KKKVP00 0-LMQP@ ?0@00K\AĠ0EKK@KPK0KKK0K9P0 0-LM?0@P \K0K 00KK@K@K@K@K@K!0PS0>06 -LM0p5`, = <5 =?\ ! =@?\ 8RU@ P5<5% =@;;1"  0S ;;!0U@P5`<7 -L M<@ \K @0\0K 00KKKKKKKP\F>6 -LM 0S4 0 0kP 00_ -LMPp@ P\R!1 @1/@32.1/,3s0s( K3P >(``0@V(PM 0 SA00Sl" 50`V$@K8`P =# jf0 0@5$!0 10!X 0p4 0  7\ 00Sp"00Sh"  4=6f2l36D63232$6 -@L`\1\0S0P75p@ 007\ [!Q Q< p-LM@R40+P`  0 m @pokP@ k1+(  ?=l7p9=6 ?0-LP $@7P  0S 0\`P7  ,Pi7 -LMO0 S   \BP7  PK7 -LM`0p,0 0PS0 5@ R- R00R@@T 303 PU ̠|At0  @*Wt3#0$<C,0K ^ 0, n  04 S,0 0P@  0@ m,00 06 !7P <P 6  N 0@26 -P<@LT`0p 65X;E5 XXm6 0@ \E<X x7 0@ k <1S r6P< 1R\v -LM< iRp  Pok``m0O 0OoP @0  p-AMLAO0P `0k P  0 C40 x\\  9fP202p@ ;\p'26 -LM@< R5+4Q P 5;54Q 0S418<10C<1<P5 ;%5 f -LM< PR0p5@@ 5" Y#n gd@STڴ5`   JR7P. (7P( $ :# 6" 2 .t2S %@ %5;5o5<0iK P ic52;$67@6 p-LM@? ?`PP? `oPP ̠t L Prp~ ;pw 2|66 -P<LP@p`k51T\1TF*1T6 1T ` 5%% = S =@S @ 8C8`27%2  `\ `2 `O @ _5050 R0W 0M4P`5@`040T(0P\դڢ2i 1i i i i  -LM0,pWⲯ `@0P``c:40(K P ( <1S}46 -00%P-@%LU` ytPPxP7|P`PpPP`PpPPqrhbkrhbP |}P0|2 :y 9P xgP0x2i x9c d9P tQPtRT ,9N 966646T6t6 0-LMDP"D@0K 0KK@KPKKKKK 0 0-LM8QP#@0?00KD@!Ġ0%K K@KPKK0KK0K0 -L(Mp8KDCP@~,0[+ [4S9<K@ KP` !0x9< q90 Ġ(̌"Č!̌  P`T0 Ġ(̌L"ČD#̌L8#D !L 0 @P`6@<P Ġ4(̌<"Č!4L.< ̌DL8#D 0%L @qP` < DoDUq L 9< (  66H6x6666 -LM05P <5 ͠000  m -8B0T00p` @  &>0488W p" P ` jT@5 M<5  8  #8 5_ -LM @DP/DP 8D h6 -LM 0S4! 0 0P 00p5 -LMpDBP KP  d8 `H0@VMd2S h2S %0P!&>f  CPP b2%N@`P $)8# `1!0@5$!1! 10!X 0p(0  <2 P 0 S00Sh" 0`V00Sl"00Sd"  4766,686_`6D63d33$6 p-LM`@P L0SdDbXX PϠLP0\<D ph9ph76N 3td*7 -@L12`Shpf0P0S 5@ 001:02Q Q = p-LM@R40+P`  0 @peP@ e1+(  \7+f7pV76 ?0-LP $@7P  0S 0D}P7  IP7  -LMO0 S   DaP7  -P7  -LM`0p,0 0PS0 5@ R- R00R@@T 202+PU ̠Ap0  @KxpT"046B,0K , R h 0 4,0 6g,0 S0P@ 00K@0 ,  0 $7P <P  0  k 0@@36 -P =@LT`0p 05X;E5 XXm0 0@ \b6X tT 0@ #e <1S >6 p-AMLAO0P `0e P  0/"-C4? 0@ t\X  P202p 6]pt36 -LM@ = R5+4Q P 5;54Q 0S418<10C<1<P5 ;%5 -L M0p5P@` 0@#΅ 0@ - 005  00 @ 7Pp ]7P p2S %@ %5;5i/ P  5$6@6 p-LM@? '>HxPP? HooPP ̠p L Pp j5p @3|66 -P =LP@p`j/1T[1TE*1T5 1T ` q/%$ = S =@S @ 8C8`|2N%|2  =  U|2  =  @ _505.0 R0OR 04P`5@`040T(0P\եڣ2i 1i i i i  -LM0 -pW⢯ `@0P``4.0(K Pp ( 4<1S.6 -0 5P=5U@pLPPtP7xP`PpPP`PpPPr[cbrUcbOP xP0x2 s4 m49P tP0t2 x]4 dW4#P pPpR ,H4 B466646T6t6 0-LM @P0PP 0@  `PP 0S 0P->MOKNYP -0$S OPz ,@P(0!R@Tp2S0 H0L2 @TPHP 0@S 0TL2s pPD}"pWt"qrl |2se -Yp J_KNKD 0/PIK@L5 838ß(KJK#N@ +\# &\?#SP 32"0@5$!2" 10!X 0`Q2  -D V0 0 00A SA ARa0A7ASWA? 02@0 T0#NJ3pP 2p@ t"|"0PT t"r |2s~pWspP 0 S00S|"0@T00St" 0 3  00S0L"l27PP 0 S ,(0!0p"(1H2p2 0S SY 2200S0 0S  P  ||  0S2020K# p Z'(-3 -0 5P=5U@xLPPP7PP`PpPP`PpPPcr`b]r`bP PoP0P2q 1k 1P YP02[ x1U d1P xCPxRF ,1@ 166646T6t6 -P?`LP@pD+ 1T51T&*0T 0T p + @ pC@ X50580 R0N014Pp040T(0P\2i 1i i i i p@-0? R( p`@0P``p@Q16 -LM0`5P@ s+L2s P2SC 7P< 7P@4 ?p? Pp %1iP+?p = Pp O0x  po圾%@ %5;50pl?υHP%> P Pp ^ @66|6*3$6.36 p-LM@R40+P`  0 =a @p^P@ ._1+(  0_7p06 0-0_@ L07P  0S 0DؾP 7  P7  0-O0 SL$ , P 0D廾P 7  P7  -LM`0,0 O0pSP0,5@) R2 RR$ 2S% U 2`02 S02F000Ax0  @坾ʽx) 4*0",0K Ҿ-> ,00C,0 , R a,0 S0P@ 00K@0 ,  ,* 7P <P g *  0@ 6*3@6 -LMP?@pT`0 )5V;E5 VV  0@2 /V )姾(K 0U P(0S00P@ <1S )a^ `6Q Q? -RLM R0K R Pn !Aq- $0A0 0!q "_ -LM 0S4 0 0P 00q5 -LMp@8`>/ PP#?P #$Ck2/P438C0 KOPP000400 Q4 =ҽ080@0<0 `Uk80se <0sb @0s_ .),`K 0PPJ. W t@S1tp!51 !!$11o0!!4018  <0 !1pd  0Pj1$ R "0]" P<0 3( 㕺. (03.4_P  0S 0S 0PU0S@0S80S0S<dw.P꘰56`H3d6E3q56=38C3 S7P6 o} u m 0H0S D0SP %@ %5;5Q'L0P. I'- C @67$6 p-LMCPT p3 F, >4`#0@  F-TphA-'Q Q -LM┡3 S`( tp5 U  <5    (0S (&0K IU)[ 0)K|RU@ P5<5  0 0S ?0 00U@P5 Tdl6 p-LM3`SP4#8 #4D0 MP&4<H0 FPOD0|  `屺޹30CS3p ,9,` p@3|66 p-LM@R40+P`  0 \ @p8ZP@ Z1+(  ,Z7p,6 ?0-LP $@7P  0S 00)P(7  P27  -LMO0 S   0 P(7  ֹP7  -LM@3S"2S 5+4Q P 5;54Q 0S418<10C<1<P5 ;%5 d p-!L!M_0@ `0?[ @;\< l1L0 H   ͹3033@0CS3T30 3p 8L+0⛴ ꜿ S`0!5X0p 1 PZY1XP=0P,"H (庶P 0 S00SX" 0PU00S\"00ST"  0'6R6,6V3xS3W3\Z3$6 -@L!`p`00PS 5@ 00!H 㘳!Q Q0 p-LM@R40+P`  0 @pUP@ U1+(  {'JV7pu'6 ?0-LP $@7P  0S 0H圵P7  hP奵7 -LMO0 S  l H~P7  JP凵7 -LMP0,0 0`S0p 5@ R- R00R@@T 202FPV ˠLDzPP? 3L徲pPP? τ$L @p mPP ˠ` ` PD# 4%  8V3O3\6|66 p-0LM@PQ00 5@ R R00R``V p202尶0SU`phi"0 k%b6 -0`@LQPp+0T 0T p |505-h0T  R\  @ p@ 'i i i -LMp\0 TR `P0@% <1S i6 -0 5P=5U@`LPPdP7hP`PpPPx`PpPpP5prSxb/rSbꣳP hAP0h2C $= $ꍳP d+P0d2- x$' d$wP `P`R ,$ $66646T6t6 -PL@` j j%H0S D0SP %@ %5;5h0P!<+ & /@6.7$6 p-LMCPT pLD <`(00@  !T ph!.'Q Q -LM3`Sp`t5 X  <5   o$  |RU@ P  K0S- P  0@pU@P5<5 Y   H@ o 5 &* p-LM3`SP4#8 #4D0 P&4<H0 PO̠D0x  `Kx30CS3p/O ( `H p,n3|66 p-LM@R40+P`  0 *Q @pNP@ O1+(   rO7p 6 ?0-LP $@7P  0S 00ĮP7  Pͮ7 -LMO0 S   0妮P7  rP寮7 -LM@3S"2S 5+4Q P 5;54Q 0S418<10C<1<P5 ;%5  p-!!LM_@ `0O @@;T<d+ H  @r303圭3@0CS3T30 3pm 40@ AzH<@ m36 -PLC`Ttp 5X;E5" XXm 0@9 X 3H03嬮30CS3 0@ tN <1S C6 -LM`p3SPt RA R00R@@T h0l0h0嵰P(U ̠AD0  @խ3 0330CS3ḳ3D03T30CS3᫳ʴh 04Mh@00K 00 Q00S,KA Q+0[0P@  0@00 @0C00 0 0M P7P <P < 0@,n36 -`L3PS@pj!1TM1T9*1T) 1T p 5 - R @R @ pL vD @ k5050 Rt; ta4Pp5@ *tl0T `0TT0P\կڭD0T/0p2i 1i i i 5i i 6i( -L M `@0Pp```o0 $KP$ |<1S6t -5@=P5LUPDP9HP `PpPP`PpPP02~rLbxrLbP H劫P0H0ꌳ pꆳ \ ֬P DtPDPw $q 646T6t6 0-L3_S2(0S0hz!$@T "0@T0 0-0L#RPO 5@00"000!000,  0P3S0 P-L@# 3t`S_ pV!"R T0Ph,0 00 0S "<1S 373/03 -LM@30CS3hʱ p-PLM@`P Q pV pU UPpU] U 0ll NP`P`0U  XU Q_0UP68r5B7F p-PLM@P` 3SQ pUUphU] U 0h h`P`0U   U Q_0UPPr56B7F -LM 0S4' 0 0P 00hr5 -LMP`p KP@ KP@  1!P!1 pt1t!pp1`@h!h1@@f0PT cP> 0 S200S1+ $0@T 00PPP0  h0 Z00S|0 00Sh0  PZ66""" "!D)H)\)")@6$6@6]"3""T6 -LŸ2 RP0p  0  0SXb0SW:(! M@ABJ3j!@00CS0L 0S A ` 00C! 0Pa0 S AP?AP#xAP d1 ҧ겪X PP00Q J ꚪX 8P009 2 ꂪP  P00! h TN{iX)\"]"X6X")),"$"(""T6t664666 -0L"lMSp  !0`B!@%=?ZDP U@@T,0 @ C eCC0    岩ߨP0黰0, L>097p6hs5)()6))$"'36 -LM?pH0 \`,0 H \(A0S Q00C!00 S1 @>"\00P p0pᴠᶐ,0@000C0@ )|@  p @I CD0P@@>oE!))) )$"3' -2LM 2Rp` l2R `2R "\0PH")<p 0 00@04C2@ BŸ   @), 0@? SO 1 R 1R" ʌ1R 1R Tx1 @l1 p p 0 00 0 1R 01R0ASh3t3|3333333333333 0P 0S0S? 2K"K,pKsD0 ,pK2K"Kk! )$"3'*D !( -L@M`83? Q@ (3\ 3Q d3QA  "\ C0?p0P% W@-00 00 RhvB2  )lŸ ` p< 6l2P@ @    BXB%-( 0""K0 2K"K 1 R 10S SK,`K1 R\1Q 1Q0S2K?,`K2K "Kd!P0p2`TKPK&BV?G K5KB]PpPW 0"K0C "K SH3X3`3t3h3p3x3t3t3t330,`K2KT0000000S:T0,`K@KBK! $"'3)6(  ! -t0tPL @`T0 0 q @ 40P 0(00C ` 0@ !))() p-QLMd@ P L0L 0 S `ʂA`p0` \!())) p-LM\@`P+  \$ \ 0 \0 P 0S|0 \p0 d 0 S EApp=P 0P!))()<) p-LM 0@0 0`$Px Pl0P 000)-0 ,B$)< ) 0-0@P00L,000<) p-LMP@ST` 0) S0  QphCn0  )) -@LP3mpP*00h(0 *Ȗ3 p-LM p0@P`0SH  0000Sph0 !X)7 0-(P@L00h)!7 0-L0 L@8P 0000S0h!X) 0-L0 L@8P 0000S0ho!X) -LM :  0P71H7TG XgE EON>X0@|1|!5x1(!$1p!p1 01 !( pE D1(",2<1x* (200!  X0@0!T<< 1 1!|0, \K e0!#R0P UE 8!  0P@ ?P@n  @1\ @0 00U 4 8<#8:#:0 0A <PS^80 @ <1S 5   @T0 >0+Z 0 @~#@fb  -LKMğ0p,0 08 @1 0ʠ@0! 0< @#80P0  0!XXp4 U@ D7 X Xd7S@ @S@ @! f  Dg@ VP Q@1PPXS%X   C  X 8PP lKBn`4 00000!0* 0U>@0\p '.40PV= 0Ÿ  P P@l;h0/. 0b < hl;l;028n `4  iD'8 004PP=   P吜彛P@ l;h0/. 0bl;h8,0 S 4,@@ 7KKl  .4 0 ǚl0$ .4 00 \  V 0-0 @L$8P0 $  0$0h   0-0 @L$8P0 $  0$0h 0-8L@0P 5 ( "(  0hDPp3x3333333333333333840,($ x666666 966 p-LMPK 0@#![>  01[8#Y#h #͠##: 0P`/̄<\ l0.  0/- <0p -L`@0@ cTdTDP@p  @~TP 8t56 p-LM`PV@ V@@|0 L\R@ ZT@  8 , @ ph  0-L@PUT T 00CS 0h) -LMPc0@1 @T@0>S @ cTdT  "bP7l0'OlV.0 NH px 0:~pm@ !0@T`@pZ| &P S 1 > 0 ǕPU1 >0 㽕PEPX8P@1. 4A 0 @ FPT Q 5QN n   >5;5%@ %T7 S(   ` LDzs5"VS6 663D46X6x66 0-@P[5L=05U (  t P:S :Sc0h 嫕Z 妕ZꇖZD01 .0-0@L PN+ -W0CQ  T 00HSAQ B00HS0. 0h7 -LM`+?| (K$K(K^T@L0p 'KP#K @&@K%@K"pK!@K\ t 43 -RL+-΁Mp∀   o`0h @ 0T0@> @@ ʇJ 0. o 6 7 0-LM0 @00P<@0TT@T@ 0L00D0000D02P h{0 40P40h fLv566E66386 p-LM00@@P0`SD00D0 0@@0'phr 0-00@L@Pk0S R000H0 0  0hZ -@ML40@ @,@U0S hh 6H3X6 -`L=L0PS"DpD@ 0T  R0000 0  $  PL0S D@TK6 -LM@0<@0D0 -0P0CLpS?3303l3l3t33v 0 S00 0` S0C40dP`  0$0R  0 4P  0 S00 0;@` / 00 0 0  00  00  @ 0 S00 0 S0C4P` 0 @ $.0@0ncncD p-LMH@PT0`Q4& U 000SHPp@T 0 R @Tp000SH@ pPp p-LM0PR `@$0 $R Z RR 9R3 4P 00 K`V 8C@8Ÿ<8N0 @@<p0$  ^``00 @8Č0`` `@u1R 1RH 0\$  ; 04 <Z(1R0  R 1R KL   R # 00S0##400R R   R  00S0C4H\0`H 0\$q  jD3 x6 ___ P-0L 0 }Ȕ6nd`v5 -PUp`L e ?P@ U 1R@P-0SPPθ p-LMPK`@- 0` P4p 0-@4PPL 80S0e00h駸6 -LM@e pP`? <08SP 00@Ps s0l0ML@P \00l m0n@o@P80X q@r@pPP@'N0<0J0<@0P SV8eT 8N0@@<P@ <@@>8e< -` cP@oD3 -L MP `0 Ƞ(,@0 , @P`p0Z ,)( < 0R)< 0 Q0  "< 00S RP K R D -LhMؠ0@(0 PPK` (0xK(0 ᨦ@ᥦ@ @e !Pp0T  @@= (0 S (pTd66Pe -QLM@p* 0S' 0S$ m`P~U~P#0 P 0f0  0 SR*000 0SR: 00 Q 0S3 : AQ0A Q0A <0<  $0 0 odnd 0-LP@T 0P 0T0C?0D RR1*00 RR1:000 -LM , Pem@T e % e\ᔀ `ep 00 ?0`0 ``p @0, 0R0@  -Lp` PU030#\Z0 @pT0 +%4X0P 0p -L M P 0U`e , 00 ,@T e $ \ ep 0 0 @P P 00,0000P0P@000 @ z -LM00 `00 0 80 V(8Pe , 40 )@Te ! \ p(e 80 000 ,00000400 `@000 @ 3 -LM 0`Sp(PU! $K <P`e @$0T0  -P`e $00@TPU0 0sP 0AQP0000 p-L M`@P{P 0 KP  0R 0  0$0  $00 p -LM0`P4 ep P@0 0P 0,p` ( 0  0 00PU0e@0鉵 0-@LP0 P(0  00P000h -LM@00  0e0C 0h] P 0 RP\ P 0 RP\ -LM("HP0 T 00 -LM("HP0 T 00 0-P0L00@T80  (P^00 -LM,0@0(00 001 0-L'M@PL@ K @ 10 PS 0Td6} 0-(0@00P L00P,00 0,0 00 -,0 0(,00 L000 -00, 0 0 0 0  , 0-00 00, 0 0  , 0Q0-0R00\00^00 0-0L0 @PP,00,00,0 0-@PL0$00$ @  @R00@0 -LM0@S 00P 60006 p-LMP@(`V $0S00S 0R*1 00 0S00 V 0S 0Sph`pp  -LM00@ "P00H p-LMH@ Pe0`S ph]000 0@@0V -L$M4p̠` ß 0 @@@2\00 4PP 408 PP 8< @0"P PUp(@Ks(08$ (0K0' K&0K 04$0KPP4KPP`L]L0PP0TT0XS P@u8H vPD PU|PHX0͠ pP pPPP@O01P*K 2K( ()> 1 Fz0 x@5$!0 10! x`ڡ}F02<'8D (P 8@ @0Ph f66X6_3606P6l666636*d}6033|3 - L4 6 -LM5@+-4Q* 2S 0 S 0S418! <10C<1h-}P 5;54Q 0S418<10C<1<P5 ;%5 ί -LMx`Pp5@;5EtPW̅ @0 <1\Si@0 -t@ 0-Lx@P0h -0LMRP`,0 xp, RR2S S02͠AHX0  @ PPTH1 022"S02,0KP,0S S0P@ 5@ *P ,00 0X, &p@0< \  0P@ 36 6@6 0-LQ,P@0 ,1P+  .00,0 -PL@p@1T`50T&*0T 0T ` . @ `K@ 505@0 Rx+x4P`x,0T 0P\2i 1i i i i  -LM `@0P`p`45 ;%5@Di6 - LMx@5@ 5@05%+%h 0-LM@ T0PL- T0LDHH  }L0S(tP0s0'386 0-x0%P-%Ut @RL0-,tP -LMpzsP`Us 0 0$  0Q< $P< <800S`P 40PP<00S<0   Zz ` <4<8  4  @h h0@K4@ , @P 0 P $000S$ 0040$0$40D`(00(0 P33H6 sr-LP`p  0 $@T uv u 80U 0@Tv D0VW WP  }p666 p-rqLMP`  0 $ R uv0@ u 80U T pv D0VT404040@XN6 -QLM@8 0C?. B"0 }6,6 - 0L0\ s0 00 0-$@0 TLP,00 L0 P0@T0 0-$@LTP L0 0@T0 0-$@0 TLP,00  L0 0@T0 0-$@LTP L0 0@T0 -PPL0@& 00 1 ` ^{'i$8 80$8P 8T0@8$0P 8$8 4  T0  hv546 0-T L0P@K \  0 @0  P=$8P 8$8P <8T @ $8P@40 }T00T0 00h@T0 00 T00T0 )X <#3  \0 + ;8#(0$8P 8T0@ \0  ,  R,,$8P0 @37\6 0-P(0L0{T0@08T0$P0 4PL0 0hg p-LMPP 5* 0` p8 $48@P0$ 4@@ pd R0d0 `00S`0 L0`@0ppp p-LMT0@![Y$80 P8}J`$8P0 4P ` =cVH0S T0  p8$;P8 T0hT -LL  -PP 00LR`p @$<0 T ,00@Th, \00Q0S p-LMP`,0@0P 0P 0PPP%[0h Uh0[P`S `p0S 0-T0L @PP X0  v k _ U\0   B 1   X00H  00hT 0@ T d00<0H 00ٿT 0@ T d00<0H0 0ɿ\0HT  0d0T 0+ 㺿\0T H 0d0T 0+ 㬿\0H( 0㣿H0& 㚿X0H0& 㑿X0H0# ㇿX0~H0# ~X0sH0"viHPTQ- -LMT0@h0S 0 ?C5A0P 0S0Q  0-T0@ L08P0 $4P0P8$ 4T0Q0    ; S 0@0 40+0   P00@@@T  (RL#R!&R$0RA0R#& -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 000- 000008P0 $4P0@8$ 4T0@@ \0 3P   006    0060000 0S  < 0060 006 0060@006 000 00608P0$ 48PP0$ 4 -LP w5 p-LM@P`  |(0tH0 L8 P`0 T0d  $8P4 00 X0pphw56w5 0-(0PL@ F 0ES 4 4 4 4 H0"S 00 H0"S+p H0"S 8P0 $408$;P 80% 8P0 $4V>8$0P 8#f0 -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 0 00000$8P0 4& 8P0 $4P0@8$ 4@ 0060 006 0060@006  0060P08$ 4@00000000006 0-@L8P0$ 48P0P $4$0 S8P0 80 -LP 4w5 p-LM@P`  t(0lH0 L8 P`0T0 $8P4 00 X0pph4w56(w5 0-(0PL@ 7 0ES `44,44 H0"S 00 H0"Sp H0"S 8P0 $408$;P 80% Y0 -LMPp@ 0`,@00 8P0$4 P8P0$4P08 $ P4,0 0,0P0@8$4 00 0,   00300 0 0000000000000000066 -LP pw5 p-LM@P`  t(0lH0 L8 P`0T0 $8P4 00 X0pph6pw56dw5 0-(0PL@ 7 0ES x44D44 H0"S 00 H0"SIp H0"S 8P0 $408$;P 80% P0 -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 0 000008P0 $48@P0$ 4@@@DT444444444444444444444006000600060006006 -LM@8$P 08 -L P w5 p-LM@P`  t(0lH0 L8 P`0T0 $8P4 00 X0pphC2<0 S T <0 SQ P0$8 40 X>8 $P04<+Q0  T0` `  Q' (Q$ P$80 88P0$ 4 p P$80 88P0$ 4*98$P 8p, Q$8P0 4\T0  8P0 $4P@8$0 88P0 $4 -0$8 P8$08P 8L0 | $40 S t)0$8P 8L0g x56x5 0-@L8P0 $408$9P 8P$8P0 4 P }U0 p-LM(0@`PH 0BS d4404, 4 H0"S pp H0"Sp H0"S 8P0 $408$;P 80% 0 8P0$ 408$9P 8Gp p-LMP`0 P0 ,08P0 $4P0@8$ 4 ,00,0 00300 00000pT000 0 000 00000000 00600000S p8P0 $4P0@8$ 4@ 00<000006 -LM 0T@P  @%#,00R0S ? <6Z p-LM@P`(0H0 L8 P@00T0( `R ph $8P4 00 X0pph@6x5d6 0-(0L@P0  H0"S0ESX#4$#44#4l#40%09p0w06 -LM@<8$P 1<8 0- 0@ L|PmP  0?.C5BBT@ 0J0S$ DPx5t56 p-LM@P`C0S  ( |H 0LP`8000T0 $8P4 00 X0pphjx56x56 -(0L@pPA H0 S?0BSH&4%4%4\&40% ` V K80P$ 8 0$8P 88$P0 4  5B6 -$0Pp @0 `0 ,@L8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 0 000008P0 $48@P0$ 4@  0060 006 0060@006  0060 RP x MP8$P0X 4000000060008$P0 4 6t5 -L:P ,y5 p-LM PL5 3S@`* L5 3S?   (0H0 P`8 0L T0 $8P4 00 X0pphJ\,0L0? 0L0 ,y56 y5y5 0-(0PL@ 7 0ES \*4|*4(*4*4 H0"S 00 H0"SPp H0"S 8P0 $408$;P 80% W0 -LMP` 0P00,P08 $@4 ,0 0,0P0p8$4 00 0,  00300 0008P0 $48@P0$ 4@ 000 00000000 000066 -LM@8P0$ 408$0P 8 -LFP \y5 p-LM@P`7  t(0lH0 L8 P`0T0 $8P4 00 X0pphb\y56Py5 0-(0PL@ 7 0ES -4-4-4L.4 H0"S 00 H0"Sup H0"S 8P0 $408$;P 80% |0 -LP y5 p-LM@P`  tu(0lH0 L8 P`0T0 $8P4 00 X0pphy56ty5 0-(0PL@ 7 0ES /4/4/4<04 H0"S 0rv0 H0"Sp H0"S 8P0 $408$;P 80% C0 -PP0 @0 ,0L8 P0$p4P08 $4,0 0,0P0`8$4 00 0,   00300 0 00000 00000000 000066 -LM@$8P 088$P 1<8 -LP y5 p-LM@P`  t(0lH0 L8 P`0T0 $8P4 00 X0pphy56y5 0-(0PL@ 7 0ES 24342434 H0"S 00 H0"S(p H0"S 8P0 $408$;P 80% /r0 -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 0 00000P08$ 400000000@000066 -L5P y5 p-LM@P`&  x(0pH0 L8 P`00T0 $8P4 00 X0pphPy56y5 0-(0PL@ 7 0ES 640645464 H0"S 00 H0"Scp H0"S 8P0 $408$;P 80% j0 -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 0 00000P08$ 4 00000000 000066 p-LM 0`0@P' 0?.AB"(0H0 L8 PP00T0P0 $840  X X0 \0  ph,ph$8P04\,6\6z5x6 0-(0PL@ 7 0ES X94x94$9494 H0"S 0 0 H0"Sp H0"S 8P0 $408$;P 80% 0 -LP (z5 p-LM@P`   0?>C2<0( H 0L80P` 0d0T  $8P4 00 X0pph(z56z5 0-(0PL@ 7 0ES `;4;4,;4;4 H0"S 00 H0"Sp H0"S 8P0 $408$;P 80% Y0 -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 0 00000P08$ 400000000000066 -LM@<0 S 8P0$485P$8#8 88P0 $486P$8#8 88P0 $487P$8#8 88P0 $4 0 08$P 8 -LP z5 p-LM@P`  x(0pH0 L8 P`00T0 $8P4 00 X0pphz56z5 0-0BPL@ S ?4?4T?4@4 H0"S 0~ H0"Sp H0"S 8P0 $408$;P 80% P -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 000D 00000$8P0 4( 8P0 $4P0@8$ 4@ 0060  @  006000600600068$P0 4     -LP z5 p-LMP@`  (0H0 L8 P`0 T0d 8P0 $4T   0XX0 pphH' H' 0z56z5 0-0BPL@ S C4C4`C4D4 H0"S 0{ H0"Sp H0"S 8P0 $408$;P 80% M -LMPp@ 0`,@00 8P0$4 P8P0$4$08PP 4,0 0,0P0@8$4 00 0,   00300 0 00000 00000000 000066 -LP 0{5 p-LMP`@  (0H0 L8 P@0 T0d P0 $840  XP0 8$4 0X ; X @0X : X X0 \0  php$8P04\0{56${5 0-(0PL@ 7 0ES (G4HG4F4G4 H0"S 00 H0"Sp H0"S 8P0 $408$;P 80% $g0 -LMPp@ 0`,@00 8P0$4 P8P0$4P08 $ P4,0@0,0$8P0 4  00300 0 000000S S000 00 0, 00000066S00 000P08$4 00<000 - LN5 Ó0 ?0 0 P 006 p-LM`@P0 R %( H 0L80PP0 0d T0( Rp ph $8P4 00 X0pphX6_l6`{5T{5d6 -1`LQPp@V(0Q 0GS K4K4J4L4 H0"S H0,S 5 `8 P0$48@P0$ 4@@ `0d 0S`0L0`@]p H0"S0% P _7p{5l6 -LMT0P`SPJ 000,8(!P0$4P0@8$!4p,00,00S ,0 00 P0$8 4 0008P0 $4P0@8$ 4@ 000 00000000000066 _7T6|66{5l6 -0LމP p-LMP@0H00`0X4`H0\\X00`xd@h0l0|@00@ @phE6Q4 n4O4 0-T0 SL@P XPP0  嗾T0S06 -@MLT ,0@(@厘0ShQ 6`O4X6 -L`_vP0PSXpX@T k9eX@PT0 H YP0S V80@T@ᇘ6 p-LMP@A00`X  0@0 P0ph/ 0-@ PLU ' 0R0 0000\0 0 0h0h0S` -LM@004 P 80 8 h80 8 h> p-LMP@ ᖘ80 080TP PP`x80  0 80pht 80} 80 66L5 0-80L P  080VHP @T H00H D < 0 8080 0-@L004004PP(400PPPP80 U 0400<PP80'6a6 -LM@W004400 -L 00 RQ400P -LM@   @ !!㖙 -LM80@ H0 S(  806 0-H@LTP 80  @TH@T 0 @T0j 0S4 0S80$6<6 -P0LM@@jW\0  h魼h7@BT6P<80080p400 40 ` JPP @Up Pp Gl66 -L@F0P0P 3000DPHp 0 P aP<0`V$0 00`00  <0`V  66 0-@0PSL  0u0S< 0000L0 R 6(_ -LM0 S@0D0P0 -P@PLDp`@ 㕔0 !  ㆔\0(,, V`F˹V<tdt5 p-LM0 `S@DPpaM 0 !T phQ -LMxpH@0T` 0  PK0Sx D D0$@  @T 0S  Tdc4Xc46 p-LM0`@@ PtP0 p00H6 -tpQ0LD0P< P? 1@S  `aT0!T@L!T01STD0 aS 0S T Q 0 S Q0T X 1@S  0!X0T|@H1T 01ST x5?6826@60J6`666L5d6Ĥ6Ԥ6 0-H@LT PP @T0oP -LTM␠p@ Pv `DV Hx` W0tK0^0LTP ;tK80 405KXP 7T0[`0x  Q -LLM␐`@ pP@X0D0^H++LtKTP ;40 80 505KD XP @p W0U<0 80tK@080 @ 0040 -L M@0K @c @~[ -LM K [ 0K c m -L M0K Cc @[ -L M!K [0K!Cc @~ -L M0K C # @m -L M0K!C # @\ -@SL M`pP0@@ @HP@`F@P@V 0@; -@SL M`pP0@ A@'P@`F@P@V 0@ -LM"à -LLM␠`  TPtpKL 080 05KX` &@TPd T0V  ?cU<@0Y0T00ST0 0 ,0' p-LM0@`DP 0 !  ph p-LM0@`DP  0 ! ph -LM0`^p ) @T#  PUP# } `  `0崀SP 0  0@ D400ꄓ p-LMP@00  Rp `R0000 0 R cph_400Dt00 R0xS p-LM` @PT   @PT400 ph p-LM80@080PKH QP 8 0S8  080pp004` IPP& /Pp -LLM`plKLt100 05K<P' P%80PH@T @08T#X1 @PLKP3D0pSD@H0  cW@ H@T L 05K0,8P0 0 0S LK 000 @T0S  P 0 6 -80L0`~Pv@~ Pv@?>11LcQ aR#^T@ R \aP6 @?>11LcQ aR#^T@:#:P'@?>11LcQ aR#^T@003P0H@?>11LcQ aR#^T@00400@PDT 0Q A0 400X?>11LcQ aR#^T@ 0BSP rࠓ@U?>11LcQ aR#^T@0P06 @?>11LcQ aR#^T@:#:P'@?>11LcQ aR#^T@003P0H@?>11LcQ aR#^T@n$6P6 -80L`Q Pp@?>11LcQ aR#^T@0P0`@?>11LcQ aR#^T@8#8P0X@?>11LcQ aR#^T@pPP@?>11LcQ aR#^t@P pH@?>11LcQ aR#^T@p P@@?>11LcQ aR#^t@ p8@?>11LcQ aR#^@0P 00@?>11LcQ aR#^T@0p0 @?>11LcQ aR#^t@ Pp @?>11Lc QR#a^T:@#:04!Rx4x4|4|4|4P`@?>11LcQ aR#^T@4P0X@?>11LcQ aR#^T@pPP@?>11LcQ aR#^t@P pH@?>11LcQ aR#^T@p P@@?>11LcQ aR#^t@P p8@?>11LcQ aR#^T@p P0@?>11LcQ aR#^t@ p(@?>11LcQ aR#^@0P0 @?>11LcQ aR#^T@0P0@?>11LcQ aR#^T@40 P @?>11LcQ aR#^T@0Pp@?>11LcQ aR#^T@0P0`@?>11LcQ aR#^T@8#8P0X@?>11LcQ aR#^T@pPP@?>11LcQ aR#^t@P pH@?>11LcQ aR#^T@p P@@?>11LcQ aR#^t@P p8@?>11LcQ aR#^T@p P0@?>11LcQ aR#^t@0P p0 @?>11L cQaR#T^@P?|6 -`p@PL  m0S ` CP -LLM␠P  `tpKL8 080 X  )05K@T` T0X  ?acV<@0Y0T00ST0 0 Ì05K0' p-LLMdPK`@LiZJJJJJJJJJJJJJJJJJJ }J xJ sJ nJ iJ dJ _J ZJ UJ PJKJFJAJ=Q:Q:Q:Q:Q:Q:Q}:Qx:Qs:Qn:Qi:Qd:Q_:QZ:QU:QP:QK:QF: QA: Q<: Q7: Q2: Q-: Q(: Q#: Q: Q: Q:Q:Q :Q:QA ? QA ? QA > QA > QA = QA = QA < QA < QA ; QA ; QA : QA : QA 9 QA 9 QA 8 QA 8 QA 7 QA 7 QA 6 QA 6 QA 5 QA 5 QA 4 QA 4 QA 3 QA 3 QA 2 QA 2 QA 1 QA 1 QA 0 QA 0 \aBC`B0QA 0 Q@-: R (2 R R -PPPP RrPP B PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R- RP1P P1P RrP1P  B P1P B  R010 1  B R0q0`0q0`0q0`\0q0`0q0`0q0` R 0\6 R B0-81, Ġ%̌T$\D#L0P  R0 Ġ01#̌  R R B0-81, Ƞ%ȌX$XH#H0P  R0 Ƞ01#Ȍ  R R B0-81, ̠%Č\$TL#D0P  R0 ̠01#Č  RpdpdN  0O   ! -- -ijm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z- $ @ $ @ l  88888 9 7 6 97 5 9 423 9 2 9 1 0 9 9 \/|\/O|/-| n;AvXaM ְdx \! " " " " " " " "P"!)$t"Copyright (c) 1982, 1986, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. Copyright (c) 1995-2008 OpenBSD. All rights reserved. http://www.OpenBSD.org  $$5V6إ55555@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@netconnetclsnetionetlck!#$%&'()-0123456789@ABCDEFGHIJKLMNOPQRSTUVWXYZ^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{}~Ͼ󨷵ǎԐѥ噞᷵ǎԐѥ???????????????????????????????? !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?Ѫ?????????????????????????????յݯ????  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~U`a&l&l&m&)$m&4o&)$o&@p&&&)$dp&d n;0&AvQkkXaMq//^SShѹ,` @ȱy[[jjFˍپgK99rJJLLXXJυkл*媪OCCMMU33fEEPPD<KKܽa ppB>>|ĵqffHHaa_55jWWйiX':'8볘+3"iip٩3-"< I·UUx((PzߥY  ڿe1BBhhAA)w--Z˰{TTֻm:,ccƥ||ww{{ kkֽooޱőT00`PggΩ++V}׵bMvvʏEɉ@}}YYGG AԳg_Eꜜ#Srr[u=&&Lj66lZ??~ÃO44h\Q4qqثs11bS*? ǕR##FeÝ^0(7 / $6=&''Niuu ,,Xt4.6-nnܲZZ[RR;;vMַa}))R{>//^qSSѹh, @`y[[jjԾˍFg99rKJJLLXXυJлk*OCCMM33fUEEPP<!KKݽa܋ pp>>|Bqff̪HHaa£55j_WWiІX:''8+"3iiһ٩p3-<" ·IUU((PxߥzY e1BBhhиAAÙ)--Zw{TTm,:cƥc||ww{{ kֽkoޱoőT0`P0gΩg+V}+׵b׫MvvʏEʂɉ@}}YYGG AԳgԢ_Eꯜ#Srr[u·=&Lj&6lZ6?~A?̃O4h\4Q4qqثs1bS1*? ǕR#Fe#Ý^0(7 / $6=&'Ni'Ͳuu  ,Xt,4.6-nܲnZZ[RR;vM;ַaֳ}γ)R{)>/^q/SSѹh, @` yȱ[[jԾjˍF˾gپ9rK9JJLLXXυJлk*OCCMM3fU3EEPP!KKaܽ pp>|B>qĵf̪fHHa£a5j_5WWiйX:''8+"3iһi٩pَ3-<" ·IUU(Px(ߥzߌY  eڿ1BBhиhAA)-Zw-{˰TTmֻ,:ƥcc||ww{{ ֽkkޱooT`P00ΩggV}++bM櫫vvE@}}YYGG A쭭g_E꯯#Srr[u·=Lj&&lZ66~A??Oh\44Q4qqsbS11*? RFe##^0(7 / $6=&Ni''Ͳuu Xt,,4.6-ܲnnZZ[RRvM;;a}γR{))>^q//SSh,@` yȱ[[ԾjjFgپrK99JJLLXXJϻk*O媪CCMMfU33EEPPxD<<%K㨨QQ]@@?!pH88c߼wuBc!! 0mҁL &5/__5DD.9WU~~zG==Ȭdd]]2+ss``OODf""T~**; FF)kӸ(<y޼^^ v;dV22tN:: II Hl$$\\]½nCשּׁĦbb917yy2CnY77ڷmmd՜NNI੩شllVV%ʯeezzG鮮oպxxJo%%\r..8$WsǴQ#|tt>!KKaܽ pp|B>>qĵ̪ffHH£aaj_55WWiйX:''8+"3һiip3-<" IΪUUPx((zY  eڿ1BBиhhAA)Zw--{˰TTmֻ,:cccc||||wwww{{{{kkkkoooo0000gggg++++׫vvvvʂ}}}}YYYYGGGG𭭭Ԣrrrr&&&&6666????4444qqqq1111####''''uuuu ,,,,nnnnZZZZRRRR;;;;ֳ))))////SSSS [[[[jjjj˾9999JJJJLLLLXXXX着CCCCMMMM3333EEEEPPPP<<<>>>ffffHHHHaaaa5555WWWWiiiiَUUUU((((ߌ BBBBhhhhAAAA----TTTTPQSeA~ä^':k;EXKU0 mvv̈%LO*ŀD5&bIZg%E]u/LFk_zmYR-!tX)iIDɎjuxyk>Xq'Of ɴ:}Jc1`3QESbwdk+XhHpElޔ{R#sKrW*Uf(µ/{ņ7(0#j\+ϊyiNeվb4ъĝS.4U2u9 `@q^Qn!>=ݖ>FMT]qoP`$C@wgB谈8[yG |B| H+2pNrZlV8ծ='9-6d !\hT[:.6$g WҖO aiKwZ *C"< Nj򹨶-ȩWLuݙ`&r\;fD4~[v)C#hc1cB@" Ƅ}$J=2m)K/0R wl+pH"dGČ?,}V3"NI8ʌ6 Ԙρ(z&ڤ?:, xP_jbF~Tؐ^9.Â]|i-o%;ȧ}nc{; x&Yn쨚Oen~ϼ!ٛ6oJ |)11#?*0f57NtʂАا3JAP/MvMCTMўjL,QeF^]5st.A ZgRے3VGmaךz 7Y<'5ah,4$8_@r %⼋I<(A q9޳ ؐVda{p2t\lHBWЧQPeA~S^':k;EXK0 Umvv̈L%O*D5&bZI%gE]u/LFk_眒zmYRڃ-!tXiI)ɎDujyx>Xkq'Oᾶ f:}Jc13Q`SbEwdk+hHpXElޔ{Rs#KrWUf*(µ/{ņ7ӥ(0#j\ϊ+yiNe;b4ĊS.4U2u 9`@q^nQ!>ݖ=>ݮMFT]qoP`$֗C@̞gwB谽[8y |GB| +2HprZlN8Vծ=9-6' d\h!T[.6$:g WґO aKwZi *"4$8,@_r% I<( A9q ؜Vd{a2p\lHtWBQPA~Seä':^;kEXK0 Uvm̈v%LO*5&DbIZ%gE]/uLFk_mzRY-tX!I)iɎDujxyXk>'qᾶO f}:cJ1Q`3SbEdwk+HpXhEޔl{Rs#KrWUf*(/ņ{7ӥ(0#j\ϊ+yiNeվ4bĊ.4SU2u 9`@q^nQ!>ݖ=>ݮMFTq]oP`$֗@Cgw谽B8[y|G B| +2HpZlNrV8=-6'9 d\h![T6$:. gWҖOa wZiK *"$8,4_@r %<(I A9q ޳؜Vd{a2plHt\BWQP~SeAä:^';kEXK U0mvv%LO*&D5bIZ%gE]u/LFk_zmYR-X!tI)iDujxyk>X'qOf }:cJ1`3QbESwdk+pXhHElR{#srKWf*U(/µ{ӥ70(#j\+ϧyNieվb4Ċ4S.U2ኤu 9@`^qQn>!=ݮ>MF摵Tq]o`P$֗齉C@gwٰB8[yȡG ||B 2H+plNrZV8=ծ6'9- dh!\T[$:.6 g WҖOa ZiKw *h8,4$_@r %(I>>>KKKKyyyy xxxxZZZZݨ33331111YYYY''''____````QQQQJJJJ ----zzzzɜ;;;;MMMM****뻻<<<~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@`**u***Xw*$y*z*(~*d~*Ȁ*h** t5+*A+**HC+dE+pF+pI+HJ+<3+pJ+*vmmapbsyBUSYWANTEDTABLEDCLEANCLEANCHKRELEASEDFAKERDONLY ZERO PAGER1FREEINACTIVEACTIVELAUNDRYANONAOBJx.x.T#/66/66/66/6X5 55 /65/6/6 /6/6/6/6/6/606/6 06/6p 0606p 0 0606p `(0606p p00606P 80606P <0606P @@0606P PH0606 P06T06\06T06P06`06\06`06H06`6@06`6h06`6p06`6x06`606`6  4R664R660606@06060606 0606 0606/06xo6o06060//6xo6p 065 K606 0606 @0606 `0606 ,506 0606 0606 0606 0606 00606 @0606 `0606 0606 0606 1606 160616 1616 16 16 16016 16@ 16 16P$16 16`(16 16p,16 16016 16416 16816 16<16 16@16 16D16 16L16P16X16P16 \16P160`16P16@d16P16Pd5P16`h16P16pl16P16p16P16t16P16x16P16|16P1616P1616P1616P16 1616 161616161616 162601626@1626P1626161616161616161616161616161616162626 26262626 2626 2626 (2626eqnecsccmiplvsvchilsgeltgtlenvdaiadbibedeafdfalsllsrasrrorpmzsdep0.01.02.03.04.05.00.510.0..#5656565656565656565656565666 66665666$66,66466565656565656565666 666656<66D665656565656L66T66\665666 6666l66565656x66666666666656565666 6666666656666676(76<76565656565666 6666l66P76x66\76h76565656565656565666 6666l66x66565656565656565656565666 6666l6656565656565656565656565666 6666l66P76x666666\765656565656565666 6666565656l6656x66l6656565656565666 6666l66P76x6666\76t76t76|76565656565666 66667656565656565656565656565666 6666VA,96|5PVA@96|5VAL96|5VA76|5VA76|5 VA76|5pA76|5qA76|5qA76|5qA76|5qA76|5qA76|5rA76|5tA76|5tA76|5A86|5A86|5 A$86|5A,86|5`A 486|5`A @86|5`A @86|5PTL86|5A X86|5 A d86|5D p865D x865i 86<5 i 86|5 i 865 $i 8650$i 865 ,i 8650,i 865 .i 86<50.i 86<5!i 86|5 !i 86|5)i 86|5 )i 86|5-i 86|5Ai 865 -i 86|5Ai 86<5Ai 96<5Ai 96<5 96,96(96496<96L96H96X96T96d96`96p96l9696|9696969696969696969696969696 :6:6,:6<:6L:6\:6l:6|:6:6:6:6@.<6.<6@.<6.<60.<6=60.0=6P=60.h=6=60.=6=60.=6=60.>60>6@````` ```,L6LL6`L6L6L6L6L6L6M60M6\M6M6LP6M6M6M6M6N6@N6`N6xN6N6N6N6N6O68O6pO6O6O6P64P6dP6 P6 P6 Q6 @Q6Q6Q6Q6R68R6`R6R6R6R6S6 S6 4S6 LS6 `S6 xS6 S6 S6 S6 S6 S6 T6 0T6 XT6 T6 T6 T6 T6 U6 (U6 HU6 lU6 U6 U6 U6 V6 4V6 XV6 |V6 V6V6V6V6W6(W6@W6XW6tW6W6W6W6W6X6 (X6 8X6 LX6 |X6 X6X6X6Y64Y6TY6pY6Y6Y6Y6Z6Z68Z6PZ6hZ6Z6Z6Z6Z6[6H[6h[6[6[6[6\64\6P\6|\6\6\6]64]6h]6 ]6]6]6,^6T^6p^6^6^6^6_6 _64_6P_6t_6_6_6_6_6_6 `60`6H`6 h`6 `6 `6 `6 `6 ,a6 8a6 ha6 a6 a6 a6 b6!,b6!Pb6!hb6"b6$b6$b6$,a6$,a6$b6$c6$ c6$4c6%Tc6&pc6&c6&c6&c6&c6&d6&(d6&Dd6&ld6& d6& d6& d6& d6& $e6&He6'K6'pe6'e6'e6'e6'e6'f6( f6(Xf6)|f6)f6)f6)f6)f6)g6)@g6)`g6*g6*xg6*g6*g6*g6*g6*g6*h6+Dh6,xh6,h6,h6,h6,h6,i6,lq6>q6>q6>q6>q6?r6?@r6?Xr6?xr6?r6?r6?r6?r6?s6? ,s6? 680~9o:k;lL|=>@ApD FPQSTXY] ;5 ["$&'X4gklrdK2>5<00H0   !"#$%&'()*+,-./0000000000:;<=>?@00000000000000000000000000[\]^0`00000000000000000000000000{|}~00000000000000000000000000000000000000000000000000000000000000ABCDEFGHIJKLMNOPQRSTUVWXYZvt10011D111@1  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^%% $ $ $ $ $%% %%<%%$%4%,%%d"e"`"  " %" #!#%# # # # ""*#d"`"e"+"4"""""<"C"!!a"""")"*"'"(""!!!!#@[\]^_`{|}~@[\]^_`{|}~|^_`#@_^_`#_#^_`^_#@^_`~#@^_`~^_``#_888@ `P0pH(hX8xD$dT4t L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}C#cS3s K+k[;{G'gW7wO/o_?T222\2 6 6,6@6L6T6\6h6t6|66666666666XBBp@m@m@m@m@m@ f(  pt""(4I@@@@1` #U3UCU4QFb '               >@X@0@@ Q@c@c@@@@<``2`2,h2g2tq2r2pw2v28}2H}2~2}2      22X22$2ȏ2T22`22abcde f g h i jklmnopqrstuvwxyz1!2@ 3#!4$"5%#6^$7&%8*&9('0)( ) *!+ , --_.=+/[{0]}1\|2\|3;:4'"5`~6,<7.>8/?9:;<=>?@ABC D E FG HIJK,L!MN-OPQRS T/U*V-W+X Y1Z2[3\4]5^6_7`8a9b0c.e mMqQ@zy2" 3#6&$7/{%8([&9)]'0=}-?\./0+*1#'2#'345 6,;7.:8-_d<>| .'`0+*~5^2"@ 3#!4$#6&$7/{%8([&9)]'0=}-+?.|/01'*2'*3456,;7.:8-_d<>\ .'`|0^~-+?\0345d<>| .'`|0^~.\0345|d<>.\`0^~q,?azw&12~ "3#!'4{"(5[#-6|$7`%_8\&9^'0@-)].=+}/0$1*2*3m4%56;.7:/8!d<> bBeE hH iI jJkKlL|,?nN~aArR,sSzZyY2 "3!'4"(5{[#6$7%!8&9%!8'0-)}].-_/0$*2`@#3mM4%5@#7:/\8=+g= 2" 3"5%#6&$7/%8(&9)'0=-'?.^/{[0+*}]123@4#5\|6,;7.:8-_d<> 1!2" 3!4$"5%#6^$7&%8*&9('0)--_.=+1#~2#~4'@5``d\|2"#6&$7'%8(&9)'0--=.^~/@`0[{1]}2]}3;+4:*5\_\|1!|2"@ 3#!4$~#6&$7/%8(&9)'0=-'?./[0+*]1}2}34{5\6,;7.:8-_d<> eE !1@-2_ /3#!;4$":5#,6^$.7&%=8*&[9(']0), -?+'.xX%/{0wW}1qQ|2qQ|34"5`~67fF8\ q,?azw&1|2@ "3#!'4"(5#6^$7%!8&9{'0}-).-_/[0$*]1`2`3m4%56;.7:/8=+~d<>\ xje.> u i d c htnbrl'"poygk,<qf;:-[{.]}//?0=+3s4-_6w7v8z9: ;<=>?@ABCD E aAbBcCdDeE fF gG hH iI jJkKlLmMnNoOpPqQrRsStTuUvVwWxXyYzZ#6^6,$7&7./[{0]}3;:4'"6,<7.>8/? aAbBcCdDeE fF gG hH iI jJkKlLmMnNoOpPqQrRsStTuUvVwWxXyYzZ#6^6,$7&7.--_.=+/[{0]}1\|2\|3;:4'"5`~6,<7.>8/? eEzy1+|2"@ 3*#!4#6&$7/%8(&9)'0=-'?./[0!]1$}2$}34{5 6,;7.:8-_d<>\ -'?.^`~0!]/[34{2"@ 3##6&$7/{%8([&9)]'0=}-'?.<>/+*012345\|6,;7.:8-_d<> .+*/2\|4qQ@1!2" 3##6&$7/%8(&9)'0=-'?\./0+*~1}]2}]34{[5|6,;7.:8-_d<> 1!2@ 3#!4$"5%#6.=+/0[{1]}2]}345'"8;:c.d\|/? IqQ@2' 3^#!4+$"5%#6&$7/{%8([&9)]'0=}-*?\.-_/0~1,;2,;34i5"678.:d<>| /1,;`2,;`3'aAcCeElLnNoOsSxXzZ bB{cC& fF[ gG] iI jJnN}qQ\vV@wW|xX#zZyY>1'~2" 3+^!4!"5%#6/$7=`%8(&9)'-./QP01qp2qp3$4506,?;7.:8-_*d< bB{ fF[ gG]kKlLmMnN}qQ\vV@wW|zZyY1!~2" 3#^!4$"5%#6&$7/`%8(&9)'0=-'?.+*/0123456,;7.:8-_d<> mMoOpP1!2"@ 3/!4$"5%#6?$7&%8*&9('0)--_.=+/[0']1<>}2<>}3;:~4{5#|\6,'7..8d /^^[0]4``{8aAcCeE gG iIkKlLnNoOsSuUzZ cCmMrRsSxXzZ1!2" 3#!4$"5%#6&$7_%8({&9)}'0'-/?\.'/0*|1<>2<>3+45@6,;7.:8-=d][ .~/"^4'` O5RQ5 RR5]xS52T5IfR5R5JhU5RU57V5 S5 4S5 DS5 hS5KBY5Y5@#Y5Y5Y5Y5 Y5Y5H@Y5 NW5 _X5(Z5[5\"]5 ]5 ]5 ]5E^5 ^5mW5K^5A@_5[_5x`50`5 `5b5jc5c5?d5nd5 be5x22202ȟ2<2d22Ȧ22(  v      W 1 Q `  2@  0 2 A@ A   @  @ @   P0 P  A   h }  } } } @  85   (2  L+ L 2L2 D   O  {2o  A F  @@@ @ @AA@:F:FP 43W  !      @ @ @ @ A n@n n@n @nn@0Df @  Q k k"k"k"k"k @^z BF |9 X|2ػ2t2t2 B  w W UP  <1b0 0{&"79=F@W wn a- \2H222822D22@ 'W W@ @EEE }WQ  k"BFFeeeZZ Z 0X 34 3 332V{%1" `"'`~%ZP `343!3d.3D/3t/3$3393hF F hF fF J38K3M3N3D\3\3`3f3@@9WP P Q@url_int_miibus_readregurl_int_miibus_writereg:5g hahh! !(3P@3vK #(-2>'()*+,-./@ABCF'()*+,-./@ABCF'()*+,-./@ABCF/@ABCDEFGHIJKNMNO`abcdefghik*++,,--../-@@A&''(())**++,,- 3333 966666 6 6@6L6T6\6h66666!A  !@@@@x 4 4 4l64446664 44Q`64446263$6186444T65T64< 4d4CPp6CP6CP6CP6CP6CP6CP ,6CP H6CP!d6CP"6CP 6CP6 6 6 6 ,6"4X4#4@%4&44 6Ð6)4*4,4)4X4,406D6P-4X44`6@/4L04L14}|6}6}624344666546449684X44:4;4=46666!6(63 6462L6?4@44n`l6@`6n`6n` 66(C4D44!666F4G44 686J4 Bad function db_fncallArgument missing Too many arguments ELF[ %s symbol table has bad start address %p ] ELFbad magic[ %s ELF symbol table not valid: %s ] bad e_machine.strtab.symtabsymtab unaligned[ using %lu bytes of %s ELF symbol table ] symtab corrupteddb_examine= 0x%lx \%03o%-*ld%-*lo%-*s%-*lu%-*lx: db_print_cmd%*d%*o%*u%*xAddress missing Value missing Syntax error Symbol not found Divide by 0 Negative shift amount ^R String too long Bad escape Bad character Bad character in number End of stack trace. --db_more-- -%*lo-%#*lo-%*lu-%#*lu-%*lx-%#*lxFaulted in traceback, aborting... Starting stack trace... %-12s%s %sdb_show_regs+%s[after %6d] bsd[ no symbol table formats found ] No slots left for %s symbol tableUnable to find symbol table slot for %s.invalid symbol table name%s %s%s Sifting table %s: db_printsym [%s:%d]After %d instructions (%d loads, %d stores), Breakpoint at Stopped at RUN AT LEAST 'trace' AND 'ps' AND INCLUDE OUTPUT WHEN REPORTING THIS PANIC! DO NOT EVEN BOTHER REPORTING THIS WITHOUT INCLUDING THAT INFORMATION! radixmaxoffmaxwidthtabstopslineslogUnknown variable No value All watchpoints used. No map. Too many watchpoints. No watchpoints set Map Address Size %s%p %8lx %lx Unknown size %s = %s db_write_cmdNothing written. () Score: %lu/%lu db_hangman/etc/firmware/%s, address %s dp8390_initdp8390_start: no header mbuf%s: NIC memory corrupt - invalid packet length %d : failed to clear NIC buffer at offset %x - check configuration %s: device enable failed arc4_stirarc4random_bytes_largeextract_entropyrndrdRRIP without PX field? RRIP with incorrect flags?RRIP with incorrect NM flags? IEEE_P1282RRIP_1991AIEEE_1282SPcd9660_mountroot: can't setup bdevvp'scd9660root_deviceCD001%/@%/C%/Eisoinodefhtovp: directory crosses block boundary %d[off=%d/len=%d] fhtovp: bread error %d fhtovp: crosses block boundary %d fhtovp: lbn exceed volume space %d cd9660_strategy: spectag VT_ISOFS, isofs vnode elf32_load_fileOpenBSD#!/dev/fd/%dswapperfork initcfpendcannot mount rootcannot find root vnodepagedaemonfork pagedaemonreaperfork reapercleanerfork cleanerupdatefork updateaiodonedfork aiodoned/sbin/init/sbin/oinit/sbin/init.bak/dev/consolewarning: /dev/console does not exist warning: /dev/console error %d initexecinit: couldn't allocate argument spaceexec %s: error %d init: not found no initinitclocks: unable to register softclock intrfileplfdescpldup2: fdallocfdlockclosefkqueueplknoteplkqreadinit died (signal %d, exit %d)waitppwaitWARNING: thread `%s' (%d) exits with status %d unable to allocate kthread_qlockmgr: make up your mindlockmgr: not holding exclusive locklockmgr: non-zero exclusive countlockmgr: locking against myselflockmgr: draining against myselflockmgr: pid %d, not exclusive lock holder %d unlockinglockmgr: unknown locktype request %dmalloc(): allocation too large, type = %d, size = %lu malloc: allocation too largemalloc: out of space in kmem_map%d,No KMEMSTATS compiled in physiophysbuf%-16s %-8s %18p %s %5d %5d %5d %d %#10x %-12.12s %-16s COMMANDSTRUCT PROC *UAREA * PID %-10s %18s %18s %18s VMSPACE/VM_MAP PID %-16s %-8s %18s %s EMULWAIT-CHANNELWAIT-MSGFLAGSWAITPPIDPGRPUID PID %5s %5s %5s S %10s %-12s %-16s usage: show all procs [/a] [/n] [/w] /a == show process address info /n == show normal process info [default] /w == show process wait/emul info procinit: mallocprocplprocessplzombieplucredplpgrpplsessionplpcredplchgproccnt: procs < 0idlestopzombiedeadonprocADVLOCKCTTYNOCLDSTOPPPWAITPROFILSELECTSINTR SUGID SYSTEM TIMEOUT TRACED WAITEDWEXITEXECPWEUPCSSTEPSUGIDEXECNOCLDWAITNOZOMBIEINEXECSYSTRACECONTINUEDBIGLOCKTHREADIGNEXITRVSOFTDEPSTOPPEDPROC (%s) pid=%d stat=%s flags=%b pri=%u, usrpri=%u, nice=%d forw=%p, list=%p,%p user=%p, vmspace=%p estcpu=%u, cpticks=%d, pctcpu=%u.%u%, swtime=%u user=%llu, sys=%llu, intr=%llu mawn%c%5d %-10.10s %18p %18p %18p plimitplidle%dfork idlestunrsensor_task_unregister: unexpected state %dcoredump%s%s.core/var/crash/sigaplpauseissignal hashinit: bad cntsysctllksysctldlkkern_sysctl%s,%s%s(%d)sysctl_tc_choicedummyTimecounter "%s" frequency %lu Hz -- Insufficient hz, needs at least %u Time stepped from %ld.%09ld to %ld.%09ld sysctl_tc_hardwaredenied attempt to set clock forward to %ld denied attempt to set clock back %ld seconds nanosleep?%9d %2d/%-4d %8x %s ticks now: %d ticks wheel arg func syswqwqtasksunable to create system work queue threadwqdestroyunable to create "%s" workq thread boredsmashed stack in %spreempt: cpu_preempt not yet implementedsetrunnable not configured unsupported >>> %s probe returned %d >>> probing for %s* mapply: no match function for '%s' device>>> %s probe won >>> no winning probe root device %s not configured %s at %s%s at rootconfig_make_softcconfig_make_softc: allocation for device softc failed%s%dconfig_make_softc: duplicate %sexpandcreatconfig_make_softc: %sing dev arrayconfig_make_softc: device name too long%s detached config_detach: forced detach of %s failed (%d)config_defer: can't defer config of a root deviceconfig_defer: can't allocate defer structure (default %s%s)can't figure root, hope your kernel is right setrootroot on %s%c swap on %s%d%c dump on %s%d%cinvalid geometryno disk labelunreasonable partition countdisk label corruptedinvalid label, d_secpercyl == 0invalid label, d_secsize == 0disk label I/O errordos partition I/O errorbounds_check_with_label %lld %lld writ%s%d%c: %s %sing fsbn %lld of %lld-%lld (%s%d bn %lld; cn %lld tn %lld sn %lld)%llddisk_attach: can't allocate storage for disklabeldisk_detach: disk_count < 0disk_unbusy: %s: dk_busy < 0 filesystem type %d not known.. assuming ffs dk_mountrootcannot read disk label, 0x%x/0x%x, error %dcannot open disk, 0x%x/0x%x, error %droot filesystem has size 0bufq_default_alloc: no memoryuse one of: exit %s[a-p]parsediskroot device (default %sswap deviceextentplextntextent_free: start 0x%lx, end 0x%lx extent_free: region not foundFLWANTEDWANTEDNOCOALESCEFIXEDextent `%s' (0x%lx - 0x%lx), flags=%b 0x%lx - 0x%lx extent_print: NULL extentklogphpoolpool_init: too much uptimepool_do_get: %s: page emptypool_do_put: %s: page header missing page %p, nmissing %d POOL %s: size %u, align %u, ioff %u, roflags 0x%08x alloc %p minitems %u, minpages %u, maxpages %u, npages %u itemsperpage %u, nitems %u, nout %u, hardlimit %u nget %lu, nfail %lu, nput %lu npagealloc %lu, npagefree %lu, hiwat %u, nidle %lu empty page list: full page list: partial-page list: no current page curpage %p FailReleasesPgreqPgrelNpageHiwatMinpgMaxpgIdleSizeRequests%-10s%4s%9s%5s%9s%6s%6s%6s%6s%6s%6s%5s db_show_all_pools %*u %*lu %*d %*s %*lu inf%-10s %18p %18p %-10s %18s %18s Allocatorusage: show all pools [/a] %s: pool(%p:%s): page inconsistency: page %p; at page head addr %p (p %p) pool(%p:%s): page inconsistency: page %p; item ordinal %d; addr %p (p %p) kernel %sassertion "%s" failed: file "%s", line %d%s: table is full panic: splassert: %s: want %d have %d spl assertion failure in %slogprikprintf%llx%llobug in kprintf: bad base0123456789ABCDEF(null)0123456789abcdefaddchangeddbdisableenablefindlistquittimezoneverbose--- more --- 0%o*UNKNOWN**FOUND*%3d free slot (for add) Unknown devno (max is %d) %3d at disable %s flags 0x%x ???%3d %s count %d (pseudo device) %s [] ? Unknown argument %3d can't change free slot change (y/n) ?%3d %s changed flags changed out of memory. already disabled Error unknown state %3d can't disable free slot %3d %s can't disable pseudo device %3d can't enable free slot %3d %s can't enable pseudo device command args description [count] number of lines before more enter ddbdev add a device8|10|16 base on large numbersdevno|dev change devicesattr val|devno|dev disable devicesattr val|devno|dev enable devicesdevno|dev find devices this message list configuration leave UKC[attr [val]] show attributes (or devices with an attribute)[mins [dst]] set timezone/dst don't know toggle verbose bootingUnknown routine /%c/ Unknown attribute Unknown pseudo routine /%c/ Value missing for attribute %s ? Not same device type No more space for new devices. No device of this type exists. Clone Device (DevNo, 'q' or '?')Insert before Device (DevNo, 'q' or '?')Device not complete number or * is missing Argument expected Dev expected 8|10|16 expected DevNo or Dev expected Attr, DevNo or Dev expected timezone = %d, dst = %d Unknown command disautoconf verbose %sabled Unknown command, try help User Kernel Config UKC> Continuing... sys_ioctlselectpiperdpipelkpipewrpipeclpipeplttckoutqttwritettyrub: would panic c = %d, val = %d load: %d.%02d not a controlling terminal no foreground process group runningrunnableiowait cmd: %s %d [%s] %ld.%02ldu %ld.%02lds %d%% %ldk empty foreground process group putc: required clalloc b_to_q: required clalloc WARNING: mclpool limit reached; increase kern.maxclustersmbplmclplmbuf prepend length too bigm_copym0: null mbufm_copym0: m == NULL and not COPYALLm_copym0: off %d, len %dm_copydata: off %d < 0m_copydata: null mbuf in skipm_copydata: null mbufm_copydata: len %d < 0m_apply: len %d < 0m_apply: null mbuf in skipm_apply: null mbufm_apply: off %d < 0m == NULL in m_pulldown()unixsockplsoclose: NOFDREFsoaccept: !NOFDREFsbappendaddrsbappendcontrolsemi-panic: sbcompresssbdropsbcreatecontrol: message too large %d acceptuipc 1uipc 2uipc 4piusrrequnp_attachunp_bindunp_connect2unp_disconnectqueue %d > BQUEUES %dcan't return dirty qbremfree: lost tailbufplgetblkgetnewbufbiowaitbiodone alreadynchplvop_generic_revokealloperation %s not listed in %s. vfs_op_descsvfs_opv_init: bad operationvfs_opv_init: operation vector without default routine.nameilockfpllf_findoverlap: defaultrelookup: null namerelookup: lookup on dot-dotvnodesvfslock%s_mountroot failed: %d vgetvclean: deadlockvclean: cannot reclaimvclean: not cleanvgonemissing bdevvgonel: not cleanmissing aliaskinfo: vp changed WARNING: some file systems would not unmount retrying unmount of %s failed with error %d syncing disks... giving up done %d softdep vwakeup: neg numoutputvinvalbufvinvalbuf: flush failedvinvalbuf: dirty bufsvflushbufvflushbuf: not dirtybgetvp: not freebrelvp: NULLAGENEEDCOMMITASYNCBADBUSYCACHECALLDELWRI DONE EINTR ERRORINVALNOCACHEPHYSRAWREADWANTEDWRITEINPROGXXXDEFERREDSCANNEDPDAEMON vp %p lblkno 0x%llx blkno 0x%llx dev 0x%x proc %p error %d flags %b bufsize 0x%lx bcount 0x%lx resid 0x%lx sync 0x%x data %p saveaddr %p dep %p iodone %p dirty {off 0x%x end 0x%x} valid {off 0x%x end 0x%x} VNONVREGVDIRVBLKVCHRVLNKVSOCKVFIFOVBADNONUFSNFSMFSMSDOSFSPORTALPROCFSAFSISOFSADOSFSEXT2FSVFSXFSNTFSUDFtag %s(%d) type %s(%d) mount %p typedata %p data %p usecount %d writecount %ld holdcnt %ld numoutput %d clean bufs: bp %p dirty bufs: RDONLYSYNCHRONOUSNOEXECNOSUIDNODEVASYNCEXRDONLY EXPORTED DEFEXPORTED EXPORTANON EXKERB LOCALQUOTAROOTFSflags %b vnodecovered %p syncer %p data %p vfsconf: ops %p name "%s" num %d ref %d flags 0x%x statvfs cache: bsize %x iosize %x blocks %u free %u avail %u files %u ffiles %u f_fsidx {0x%x, 0x%x} owner %u ctime 0x%x syncwrites %lu asyncwrites = %lu fstype "%s" mnton "%s" mntfrom "%s" locked vnodes: %p %p, %pall vnodes: %p, %p,syncersyncer vnode sys_mountmount: lost mountunmount: dangling vnodesys_getfhsys_fhopensys_fhstatsys_fhstatfsvn_lockvop_islockedvop_lookupvop_createvop_mknodvop_openvop_closevop_accessvop_getattrvop_setattrvop_readvop_writevop_ioctlvop_pollvop_kqfiltervop_revokevop_fsyncvop_removevop_linkvop_renamevop_mkdirvop_rmdirvop_symlinkvop_readdirvop_readlinkvop_abortopvop_inactivevop_reclaimvop_lockvop_unlockvop_bmapvop_printvop_pathconfvop_advlockvop_reallocblksvop_strategyvop_bwritedead_read: lockdead_write: locktag VT_NON, dead vnode dead_badop calledchkvnlockfifowfifortag VT_NON, fifo with %ld readers and %ld writersfifo_badop calledspec_read typespec_write typespec_ioctlspec_fsyncspec_fsync: not dirtyspec_close: not specialtag VT_NON, dev %d, %d spec_badop calledspec_open_clone(): cloning device (%d, %d) for pid %u spec_open_clone(): new minor for cloned device is %d spec_close_clone(): freeing minor %d of dev %d for pid %u dos2unixtime(): month value out of range (%ld) denodedeget(): pcbmap returned %d detrunc(): can't truncate root directory, clust %ld, offset %ld deextend: file too largeextendfile(): attempt to extend root directory extendfile: pcbmapmsdosfs_lookup. .. doscheckpath(): .. not a directory? RRaArrAamsdosfs: reducing max cluster to %d from %d due to FAT size msdosfs_sync: rofs mod dev %d, %d, %s msdosfs_createmsdosfs_write(): bad file typemsdosfs_renamemsdosfs_rename: lost to startdirmsdosfs_rename: lost from startdirmsdosfs_rename: updating .. in root directory?msdosfs_mkdirmsdosfs_readdirmsdosfs_strategy: spectag VT_MSDOSFS, startcluster %ld, dircluster %ld, diroffset %ld (LOCKED)bpf_detachd: descriptor not in listbpf: ifpromisc failedbpfbpfwritebpf_mcopybpfattachtoo many interfacesif_attachhead: mallocif_attach: mallocif_clone_listifioctlifconfif_getgroupif_getgroupmembersegressif_group_egress_buildifpromisc%s: can't handle af%d lo%dlooutput: no header mbufifmedia_add: can't malloc entryifmedia_set: no match for 0x%x/0x%x ifmedia_set failedrn_addmask: mask impossibly already in tree Mask for route not entered Non-unique normal route, mask not entered rn_delete: inconsistent annotation rn_delete: couldn't find our annotation rn_delete: couldn't find us %s %p at %p rn_delete: Orphaned Maskrn_init: radix functions require max_keylen be set rn_initrn_init 2raw_usrreqrtentplroute_init rtable_addrtfreertfree: %p not freed (neg refs) rtfree 2ifafreertrequest deletertinit: wrong ifa (%p) was (%p) rtinitrttmrplrt_timer_init: already initializedrt_timer_queue_destroy: rtq_count reached 0 rt_timer_remove_all: rtq_count reached 0 rt_timer_add: rtq_count reached 0 rt_timer_timer: rtq_count reached 0 route_outputsysctl_dumpentryroutewlan%s: bad channel ignored; freq %u flags %x number %u %s: invalid channel freq %u flags %x %s: invalid channel (NULL) ieee80211_media_initUnexpected mode %uBad IBSS channel %u ieee80211_wep_cryptieee80211_aes_key_wrapieee80211_aes_key_unwrapieee80211_hmac_md5_vieee80211_hmac_sha1_vieee80211_prfPairwise key expansionPMK Nameieee80211_derive_pmkidGroup key expansionieee80211_eapol_key_micieee80211_eapol_key_check_micieee80211_eapol_key_encryptieee80211_eapol_key_decrypt%s: %sassociation failed (reason %d) for %s %s: received %s from %s rssi %d mode %s %s: got power save probe from %s %s: power save mode off for %s %s: power save mode on for %s null mode%s: open authentication failed (reason %d) for %s newly%s: station %s %s authenticated (open) %s: station %s deauthenticated by peer (reason %d) %s: station %s disassociated by peer (reason %d) ieee80211_recv_4way_msg14-way%s: received msg %d/%d of the %s handshake from %s ieee80211_recv_4way_msg2group key%s: station %s sent bogus aid %x %s: station %s aid %x doesn't match pspoll aid %x %s: enqueued power saving packet for station %s %s: station %s sent pspoll, but no packets are saved %s: station %s sent bogus power save poll ieee80211_ibss_merge%s: rates mismatch, BSSID %s %s: sync BSSID %s -> (from %s) %s: ieee80211_ibss_merge: bssid mismatch %s %s: my tsft %llu beacon tsft %llu %s: sync TSF with %s %s: tsft offset %s%llu ieee80211_ioctl80211scan%s: no memory for TIM bitmap! %s: no memory for AID bitmap! unable to setup inital BSS node%s: begin %s scan passive%s: creating ibss %s: end %s scan ieee80211_end_scanieee80211_find_nodefreeing bss nodenot in ap mode, mode %u%s: failed to queue raw tx frame %s: sending %s to %s on channel %u mode %s null node%s: no node for dst %s, discard raw tx frame invalid group cipher!802.11 packet too large: %u%s: station %s deauthenticate (reason %d) %s: station %s disassociate (reason %d) EAPOL-Key frame too large: %u%s: sending msg %d/%d of the %s handshake to %s %s: sending EAPOL-Key request to %s %s: station %s power save queue overflow of size %d drops %d .5 %d%sM +%d WEP dataTODS %sFRDS %sDSDS %s(%s->%s)assoc_reqassoc_respreassoc_reqreassoc_respprobe_reqprobe_respreserved#6reserved#7beaconatimdisassocdeauthactionaction_noackreserved#15INITSCANAUTHASSOCRUNauto11a11b11gfhturbo0x"NODS %s->%s(%s) type#%d%s: no recent beacons from %s; rescanning associatedsynchronized%s: %s with %s ssid channel %d start %u%sMbshortlong protection enabled %s preamble %s slot time%s %s: bogus xmit rate %u setup %s: set STA link state UNKNOWN %s: set STA link state DOWN %s: set STA link state UP %s: set IBSS link state UNKNOWN %s: set HOSTAP link state UNKNOWN %s: can't set link state (unknown mediaopt)! %s: set MONITOR link state DOWN APL1APL1AAPL1_ETSICAPL1_FCCAAPL1WAPL2APL2CAPL2DAPL2_ETSICAPL2WAPL3APL3WAPL4APL4WAPL5APL5WAPLDAPLDEBUGETSI1ETSI1WETSI2ETSI2WETSI3ETSI3AETSI3W,ETSI4ETSI4CETSI4WETSI5ETSI5WETSI6ETSI6WETSIAETSIBETSICETSIEU1WFCC1FCC1AFCC1WFCC2FCC2CFCC2AFCC2WFCC3FCC3AFCCAFRANCEMKK1MKK1_FCCAMKK1AMKK1A1MKK1A2MKK1BMKK2MKK2AMKKANONEWOR01WWOR02WWOR0WWOR1WWOR2WWOR3WWOR4WWOR5_ETSICWOR9WWORAWWORLDaeamarauazbebgbhbnbobrbybzcacncocrcyczdkdodzegf2fifrgrgthkhnhrhuiliniqisj1j2j3j4j5jmjojpk2kpkrkwkzlbliltlvmamkmomxmyninlnzpaphpkprpyqarorusasgsisvtntttwuaukuyuzvnyezazwarp_rtrequest: bad gateway value arp_rtrequest: malloc failed arprequestarpresolve: %s: route without link local address arpresolve: %s: can't allocate llinfo arp: attempt to add entry for %s on %s by %s on %s in_arpinputarp: attempt to overwrite entry for %s on %s by %s on %s arp info overwritten for %s by %s on %s arp: attempt to overwrite permanent entry for %s by %s on %s duplicate IP address %s sent from ethernet address %s arp: ether address is broadcast for IP address %s! arptfreerevarprequestrevarp[NULL][ ifa_addr= ifa_dsta= ifa_mask= flags=0x%x, refcnt=%d, metric=%d la_rt=%p la_hold=%p, la_asked=0x%lx rtentry=%p flags=0x%x refcnt=%d use=%ld expire=%ld key= mask= gw= ifp=%p ifa=%p genmask= gwroute=%p llinfo=%p (NULL)Route tree for AF_INET (not initialized) in_controlinvalid argument to in_lifaddr_ioctlin_ifinitin_addmultiin_delmultiin_pcbinit: hashinit failedin_pcbinit: hashinit failed for lportinpcbplIPv6 pcb passed into in_pcbconnectinterneticmp_erroricmp lenicmp_reflecticmp_mtudisc_timeouticmp_mtudisc_timeout: bad route to timeouticmp_redirect_timeout: bad route to timeout%d.%d.%d.%dipqeplaeshmac-sha1deflateip_initip_savecontrolip_outputip_setmoptionsrip_attachrip_detachrip_usrreqtcp_inputm_pulldown malfunctiontcp_pulloutofbandsynpltcp_outputtcp_output REXMTtcpcbpltcpqepltcp_inittcp_respondtcp_ctlinputtcp6_mtudisc_callbacktcp_set_iss_tsmtcp_timer_rexmttcp_usrreqtcp_identudp_inputudp6_ctlinputudp_usrreqipip_input: should never reach hereetherip_inputMD5FinalSHA1TransformSHA1Finalmichael_finalfile system fulluid %u on %s: %s %s: write failed, file system is full ffs_realloccg: bad blocknodev = 0x%x, optim = %d, fs = %s ffs_realloccg: bad optimdev = 0x%x, bsize = %d, bprev = %d, fs = %s ffs_realloccg: bad bprevmode = 0%o, inum = %d, fs = %s ffs_valloc: dup allocfree inode %s/%d had %d blocks out of inodes %s: create/symlink failed, no inodes free ffs_clusteralloc: lost blockffs_nodealloccg: block not in mapcg = %d, irotor = %d, fs = %s ffs_nodealloccg: map corrupteddev = 0x%x, bsize = %d, size = %ld, fs = %s ffs_blkfree: bad sizebad block %d, ino %u bad blockdev = 0x%x, block = %d, fs = %s ffs_blkfree: freeing free fragffs_blkfree: freeing free blockdev = 0x%x, ino = %u, fs = %s ffs_freefile: range: dev = 0x%x, ino = %d, fs = %sffs_freefile: freeing free inodebno = %d, fs = %s ffs_alloccg: block not in mapstart = %d, len = %d, fs = %s ffs_alloccg: map corruptedffs1_balloc: blk too bigCould not unwind indirect block, error %dffs_update: bad link cntffs_truncate: newspaceffs_indirtrunc: bad buffer sizesoftdep_flushfiles calledffs_mountroot: can't setup bdevvp's ffsWARNING: %s was not properly unmounted WARNING: R/W mount of %s denied. Filesystem is not clean - run fsck WARNING: soft updates isn't compiled in ffs_reload: dirty2ffs_reload: dirty1ffs_mountfs(): obsolete rotational table format, please use fsck_ffs(8) -c 1 ffs_statfsupdate: rofs modffsinodino1plffs_write: typeffs_write: nonsync dir writeffs_fsyncffs_fsync: not dirtyi_ffs_size too smallmangled entry%s: bad dir ino %d at offset %d: %s bad dirFirst bad Second bad ufs_direnter: newblkufs_direnter: compact1ufs_direnter: compact2checkpath: .. not a directory chown: lost quotaufs_linkufs_renameufs_rename: lost to startdirrename: EXDEVufs_rename: same fileufs_rename: lost dir entryufs_rename: lost from startdirufs_mkdirufs_readdir: lost in spaceufs_strategy: specufs_makeinodemode = 0%o, nlinks %d, inum = %d, fs = %s ext2fs_valloc: dup allocext2fs_nodealloccg: block not in mapcg = %d, ipref = %d, fs = %s ext2fs_nodealloccg: map corruptedbad block %d, ino %d dev = 0x%x, ino = %d, fs = %s ifree: range: dev = 0x%x, ino = %d, fs = %sifree: freeing free inodeext2fs_mapsearch: block not in mapext2fs_alloccg: map corruptedext2fs_indirtrunc: bad buffer sizeext2fs_readdiri_size too smallrec_len is smaller than minimalrec_len % 4 != 0reclen is too small for name_lendirectory entry across blocksinode out of boundsbad directory entry: %s offset=%d, inode=%lu, rec_len=%d, name_len=%d ext2fs_dirbadentryext2fs_direnter: newblkext2fs_direnterext2fs_direnter: frag sizecheckpath%s: typeext2fs_write%s: nonsync dir writeext2inoplext2dinoplext2fs_mountroot: can't setup bdevvp'sext2fs%s: file system not clean; please fsck(8) ext2fs_reload: dirty2ext2fs_reload: dirty1ext2fs_statfsExt2 fs: unsupported inode size Ext2 fs: unsupported optional feature ext2fs_rename: lost to startdirrename: linked directoryext2fs_rename: lost dir entryext2fs_rename: mangled dirext2fs_rename: lost from startdirext2fs_mkdir: blksizeamap_lookup: offset out of rangeamap_lookups: offset out of rangeamap_add: offset out of rangeamap_add: replacing null anonamap_add: slot in useamap_unadd: offset out of rangeamap_unadd: nothing thereamapplamap_wipeout: corrupt amapcownowpagecownowamap_cow_now: non-resident wired page in anon %pamap_splitref: split at zero offsetamap_splitref: map size check failedamap_pp_adjref: overshot targetamap_pp_adjref: negative reference countanonpluao_set_swslot: uobj = %p uao_set_swslot: attempt to set a slot on a NOSWAP objectuao_create: kernel object already allocateduao_create: hashinit swhash faileduao_create: malloc swslots faileduao_create: asked to enable swap on kernel objectuaoeltplaobjpluao_flush: strange, got an out of range flush (fixed) uao_flush: weird flagsuao_getuao_getpageudv_attachudv_detachudv_faultfltamapcopyanonget1anonget2flt_noram1flt_pmfail1flt_noram3flt_noram2flt_pmfail2flt_noram4flt_noram5fltagain2uvm_fault_unwire_locked: address not in mapscheduleruvm_init: page size not setuvm_km_init: could not reserve space for kerneluvm_km_suballoc: unable to allocate space in parent mapuvm_km_suballoc: submap allocation faileduvm_km_suballoc: unable to create submapuvm_km_pgremove_intrsafe: no pagekm_getwait2km_allockm_alloc1wuvm_km_alloc1: non-released pagevallocwaitkmthreadkmallocvmmaplkuvm_mapent_alloc: out of static map entries uvm_mapent_alloc: cannot allocate map entry# uvm_map() successful calls# uvm_map() back merges# uvm_map() missed forward# map lookup calls# map lookup hint hitsvmspplvmmpeplvmmpekpluvm_map_clean: weird flagsfork: encountered a submap during fork (illegal)fork: non-copy_on_write map entry marked needs_copy (illegal)MAP %p: [0x%lx->0x%lx] #ent=%d, sz=%u, ref=%d, version=%u, flags=0x%x pmap=%p(resident=%d) - %p: 0x%lx->0x%lx: obj=%p/0x%llx, amap=%p/%d submap=%c, cow=%c, nc=%c, prot(max)=%d/%d, inh=%d, wc=%d, adv=%d OBJECT %p: locked=%d, pgops=%p, npages=%d, refs=%d PAGES : <%p,0x%llx> refs= PAGE %p: %b flags=%s, pg_flags=%s, vers=%d, wire_count=%d, pa=0x%llx uobject=%p, uanon=%p, offset=0x%llx loan_count=%d [page ownership tracking disabled] >>> ANON DOES NOT POINT HERE <<< (%p) checking pageq list >>> PAGE NOT FOUND ON PAGEQ LIST! <<< uvm_page_printit page found on pageq list anon backpointer is OK checking object list >>> PAGE NOT FOUND ON OBJECT LIST! <<< page found on object list uvm_page_bootstrap: no memory pre-allocateduvm_page_init: lost %ld page(s) in init uvm_page_inituvm_setpagesize: page size not a power of twouvm_pageboot_alloc: out of virtual spaceuvm_pageboot_alloc: out of memoryuvm_pageboot_alloc: pmap_growkernel() faileduvm_page_physget: called _after_ bootstrapuvm_page_physget: out of memory!uvm_page_physload: page size not set!uvm_page_physload: start >= enduvm_page_physload: tried to add RAM after vm_mem_inituvm_page_physload: unable to load physical memory segment %d segments allocated, ignoring 0x%llx -> 0x%llx increase VM_PHYSSEG_MAX uvm_page_physload: bad free list %duvm_page_physrehash: WARNING: could not grow page hash table rehash: physical memory config [segs=%d of %d]: 0x%llx->0x%llx [0x%llx->0x%llx] STRATEGY = RANDOM number of buckets = %d uvm_pagealloc_strat: bad strat %demergvapager_mappagedaemon: deadlock detected! pgdaemon%s = %d Current UVM status: pagesize=%d (0x%x), pagemask=0x%x, pageshift=%d %d VM pages: %d active, %d inactive, %d wired, %d free min %d%% (%d) anon, %d%% (%d) vnode, %d%% (%d) vtext pages %d anon, %d vnode, %d vtext freemin=%d, free-target=%d, inactive-target=%d, wired-max=%d faults=%d, traps=%d, intrs=%d, ctxswitch=%d fpuswitch=%d softint=%d, syscalls=%d, swapins=%d, swapouts=%d, kmapent=%d fault counts: noram=%d, noanon=%d, pgwait=%d, pgrele=%d ok relocks(total)=%d(%d), anget(retries)=%d(%d), amapcopy=%d neighbor anon/obj pg=%d/%d, gets(lock/unlock)=%d/%d cases: anon=%d, anoncow=%d, obj=%d, prcopy=%d, przero=%d daemon and swap counts: woke=%d, revs=%d, scans=%d, obscans=%d, anscans=%d busy=%d, freed=%d, reactivate=%d, deactivate=%d pageouts=%d, pending=%d, nswget=%d nswapdev=%d, nanon=%d, nanonneeded=%d nfreeanon=%d swpages=%d, swpginuse=%d, swpgonly=%d paging=%d kernel pointers: objs(kern)=%p swplkuvm_swap_init: can't get vnode for swap deviceswapmapswp vnxswp vnduvm_swap_init: extent_create failedswapdrum_addsys_swapctlswapctl: copystrswapctl: miniroot copy failedswap0x%04xswap_on: miniroot larger than swap?Preserved %d pages of miniroot leaving %d pages of swap swap_on: unable to preserve minirootdisklabel regionswap_off: swapdev not in listswstrategy: vnode type 0x%xsw_reg_strategy: swap to sparse filewarning: resource shortage: %d pages of swap lost swapmount: no device swapmount: no device 2 swap_deviceswapmount: copystrsbrk: grow %ld failed, error = %d uvm_coredump: user process with submap?uvm_deallocate with null mapuvnsyncuvn_attach: blocked at %p flags 0x%x uvn_attachuvn_termuvm_vnp_terminate: io sync wanted bit setuvn_releasepg: kill flag set on referenced object!uvn_flush: obj=%p, offset=0x%llx. error during pageout. uvn_flush: WARNING: changes to page may be lost! uvn_flushuvn_cluster: offset out of rangeuvn_getuvn_getpageuvn_iosyncrd%d: fixed, %d blocks NULL pointer passed to ip_ecn_ingressNULL pointer passed to ip_ecn_egressNULL pointer passed to ip6_ecn_ingressNULL pointer passed to ip6_ecn_egressin6_pcbconnectin6_pcbnotifyin6_ifloop_requestADDDELETEin6_ifloop_request: %s operation failed for %s (errno=%d) in6_controlnd6_prelist_add succeeded but no prefix prefix ioctls are now invalidated. please use ifconfig. in6_update_ifain6_update_ifa: addmulti failed for %s on %s (errno=%d) in6_update_ifa: failed to remove a route to the old destination: %s in6_update_ifa: the prefix length of an existing (%s) address should not be changed in6_update_ifa: valid lifetime is 0 for %s in6_update_ifa: prefixlen should be 128 when dstaddr is specified in6_update_ifa: a destination can be specified for a p2p or a loopback IF only in6_purgeaddr: failed to remove a route to the p2p destination: %s on %s, errno=%d Couldn't unlink in6_ifaddr from in6_ifaddr in6_unlink_ifa: autoconf'ed address %p has no prefix invalid argument to in6_lifaddr_ioctlin6_savemkludge: no kludge spacein6_addmultiin6_delmultiin6_are_prefix_equal: invalid prefix length(%d) in6_prefixlen2mask: invalid prefix length(%d) in6_prefixlen2maskin6_ifawithscope: output interface is not specified get_rand_ifid%s: interface identifier generated by random number %s: ifid: %02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x %s: failed to get interface identifier %s: borrow interface identifier from %s %s: got interface identifier from %s %s: got interface identifier from itself in6_ifattach_linklocalin6_ifattach_linklocal: failed to configure a link-local address on %s (errno=%d) %s: no ifid available in6_ifattach_loopbackin6_ifattach_loopback: failed to configure the loopback address on %s (errno=%d) in6_nigroupin6_ifattach: %s has too small MTU, IPv6 not enabled in6_ifattachin6_ifattach: %s is not multicast capable, IPv6 not enabled in6_ifdetach%s: didn't unlink in6ifaddr from list in6_cksum: mbuf len (%d) < off+len (%d+%d)in6_cksum: out of datainternet6icmp6_mtudisc_callback_registerENOBUFS in icmp6_error %d icmp6_input: unknown type %d(src=%s, dst=%s, ifid=%d) ICMP6 checksum error(%d|%x) %s icmp6_notify_erroricmp6_notify_error: in6_embedscope failed icmp6_mtudisc_updateni6_inputicmp6_rip6_inputicmp6_reflecticmp6_reflect: source can't be determined: dst=%s, error=%d /usr/src/sys/netinet6/icmp6.csanity fail: off=%lx, sizeof(ip6)=%lx in %s:%d (src=%s dst=%s tgt=%s)icmp6_redirect_inputICMP6 redirect sent from %s rejected; must be from linklocal ICMP6 redirect sent from %s rejected; hlim=%d (must be 255) ICMP6 redirect rejected; no route with inet6 gateway found for redirect dst: %s ICMP6 redirect rejected; neither router case nor onlink case: %s icmp6_redirect_input: lladdrlen mismatch for %s (if %d, icmp6 packet %d): %s icmp6_redirect_input: invalid ND option, rejected: %s ICMP6 redirect rejected; redirect dst must be unicast: %s ICMP6 redirect rejected; not equal to gw-for-src=%s (must be same): %s ICMP6 redirect rejected; no route found for redirect dst: %s icmp6_redirect_outputicmp6_mtudisc_timeout: bad route to timeouticmp6_redirect_timeout: bad route to timeoutip6_initip6_input: packet to an unready address %s->%s ip6_savecontrolip6_nexthdrip6_nexthdr: m == NULLOpenBSD-currentcannot forward from %s to %s nxt %d received on %s cannot forward src %s, dst %s, nxt %d, rcvif %s, outif %s ip6_outputassumption failed: hdr not splitip6_ctloutputip6_getpcboptip6_setmoptionsnd6_init called more than once(ignored) nd6_setmtu0: new link MTU on %s (%lu) is too small for IPv6 ndopts == NULL in nd6_optionuninitialized ndopts in nd6_optionndopts == NULL in nd6_optionsduplicated ND6 option found (type=%d) too many loop in nd opt nd6_options: unsupported option %d - option ignored uninitialized ndopts in nd6_optionsln->ln_rt == NULLln->ln_rt->rt_ifp == NULLrt_llinfo(%p) is not equal to ln(%p)dst=0 in nd6_timer(ln=%p)nd6_lookupunspecnd6_lookup: failed to lookup %s (if = %s) nd6_freend6_rtrequestnd6_rtrequest: bad gateway value: %s %s: failed to join %s (errno=%d) nd6_rtrequest: malloc failed nd6_ioctla router(%s) advertises a prefix with non-link local address default router list contains a non-linklocal address(%s) ifp == NULL in nd6_cache_lladdrfrom == NULL in nd6_cache_lladdrnd6_output: can't allocate llinfo for %s (ln=%p, rt=%p) nd6_storelladdr: something odd happens nd6_storelladdr: sdl_alen == 0, dst=%s, if=%s scope error in prefix list (%s) nd6_ns_inputnd6_ns_input: src=%s nd6_ns_input: dst=%s nd6_ns_input: tgt=%s nd6_ns_input: invalid hlim (%d) from %s to %s on %s nd6_ns_input: bad DAD packet (wrong ip6 dst) nd6_ns_input: lladdrlen mismatch for %s (if %d, NS packet %d) nd6_ns_input: duplicate IP6 address %s nd6_ns_input: bad DAD packet (link-layer address option) nd6_ns_input: invalid ND option, ignored nd6_ns_input: bad NS target (multicast) nd6_ns_outputnd6_ns_output: source can't be determined: dst=%s, error=%d nd6_na_inputnd6_na_input: invalid hlim (%d) from %s to %s on %s nd6_na_input: duplicate IP6 address %s nd6_na_input: lladdrlen mismatch for %s (if %d, NA packet %d) nd6_na_input: invalid ND option, ignored nd6_na_input: a solicited adv is multicasted nd6_na_input: invalid target address %s nd6_na_outputnd6_na_output: source can't be determined: dst=%s, error=%d %s: starting DAD for %s nd6_dad_start: memory allocation failed for %s(%s) ???nd6_dad_start: called with non-tentative address %s(%s) nd6_dad_start: ifa->ifa_ifp == NULLnd6_dad_timer: called with null parameter %s: DAD complete for %s - no duplicates found %s: could not run DAD, driver problem? nd6_dad_timer: called with non-tentative address %s(%s) nd6_dad_timer: called with duplicated address %s(%s) nd6_dad_timer: DAD structure not found nd6_dad_duplicated: DAD structure not found %s: DAD detected duplicate IPv6 address %s: NS in/out=%d/%d, NA in=%d %s: DAD complete for %s - duplicate found %s: manual intervention required nd6_dad_ns_input: ignoring DAD NS packet for address %s(%s) ifa == NULL in nd6_dad_ns_inputifa == NULL in nd6_dad_na_inputnd6_rs_inputnd6_rs_input: invalid hlim (%d) from %s to %s on %s nd6_rs_input: lladdrlen mismatch for %s (if %d, RS packet %d) nd6_rs_input: invalid ND option, ignored nd6_ra_inputnd6_ra_input: invalid hlim (%d) from %s to %s on %s nd6_ra_input: src %s is not link-local nd6_ra_input: lladdrlen mismatch for %s (if %d, RA packet %d) nd6_ra_input: bogus mtu mtu=%lu sent from %s; exceeds maxmtu %lu, ignoring nd6_ra_input: bogus mtu option mtu=%lu sent from %s, ignoring nd6_ra_input: invalid option len %d for prefix information option, ignored nd6_ra_input: invalid prefix len %d for prefix information option, ignored nd6_ra_input: invalid prefixlen %d for rfc2374 prefix %s, ignored nd6_ra_input: invalid prefix %s, ignored nd6_ra_input: invalid ND option, ignored defrouter_addreqdefrouter_delreqdefrouter_select: called unexpectedly (forwarding=%d, accept_rtadv=%d) defrouter_select: more than one router is installed nd6_prelist_add: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_remove: failed to make %s/%d offlink on %s, errno=%d prelist_update: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_update: nd6_prelist_add failed for %s/%d on %s errno=%d, returnpr=%p pfxlist_onlink_check: failed to make %s/%d offlink, errno=%d nd6_prefix_onlinknd6_prefix_onlink: failed to add route for a prefix (%s/%d) on %s, gw=%s, mask=%s, flags=%lx errno = %d nd6_prefix_onlink: failed to find any ifaddr to add route for a prefix(%s/%d) on %s nd6_prefix_onlink: %s/%d is already on-link nd6_prefix_offlinknd6_prefix_offlink: failed to recover a prefix %s/%d from %s to %s (errno = %d) nd6_prefix_offlink: failed to delete route: %s/%d on %s (errno = %d) nd6_prefix_offlink: %s/%d is already off-link in6_ifaddin6_ifadd: failed to make ifaddr %s on %s (errno=%d) in6_ifadd: wrong prefixlen for %s (prefix=%d ifid=%d) in6_init_prefix_ltimes: preferred lifetime(%d) is greater than valid lifetime(%d) rip6_inputrip6_outputrip6_attachrip6_usrreqrip6_detachudp6_outputcompat_43_sys_acceptcompat_43_sys_getpeernamecompat_43_sys_getsockname spsrr0r1r2r3r4r5r6r7r8r9r10r11r12usr_spusr_lrsvc_spsvc_lrpcund_spabt_spirq_spFaulted in DDB; continuing... address %p is invalid address 0x%08lx not a valid page framedb_fetch_reg: botchbranch_taken: botchscp=0x%08x rlv=0x%08x ( rsp=0x%08x rfp=0x%08xBad frame pointer: %p Bad user frame pointer: %p %sr%d=0x%08xtrace: pid %d at %p not found frame address = %08x frame address must be specified spsr=%08x r0 =%08x r1 =%08x r2 =%08x r3 =%08x r4 =%08x r5 =%08x r6 =%08x r7 =%08x r8 =%08x r9 =%08x r10=%08x r11=%08x r12=%08x r13=%08x r14=%08x r15=%08x slr=%08x mainbusmainbus_bs_alloc(): Help!mainbus_bs_free(): Help!cpu%s, #0x%03ximbimbrangeswiblxblmulSnmsmlaSnmsdumullSdnmssmullumlalsmlalstrtdaWldrtstrbtldrbtstrldrstrbldrbstmYnWlldmXnWlldrsbldrhstrhldrshswpdmoswpbmrsdpmsrpFmpF2bxclzdmbkptSdn2eorsubrsbadcsbcrsctstDn2teqcmpcmnorrmovSd2bicmvnadfPRfghmufsufrsfdvfrdfpowrpwrmffmlfdvfrdpolfpbopmvfPRfhmnfabsrndsqtlgnexpsincostanasnacsatnfpuopstfQLvldffltPRgdfixPRdhwfsrfswfcrfccmfPRghcnfcmfecnfemcr2#zmcrmrc2mrccdp2#ycdpldc2L#vldcstc2stcund%s %08x %s%s#0x%08xp%d_f%d#%s[r%d]cpsr[%c - unknown]%d, c%d, c%d, c%d, %dr%d, c%d, c%d, %d, rrx, %s r%d, %s #%d{r%d-r%d}^[r%d#0x%02xf%d, c%d, No support for this CPU type (%08x) in kernelcpu.branchpredictcpu.cachecpu.nocachexscale.branchpredictxscale.cachexscale.icachexscale.dcacheUndefined instruction in kernel WARNING: not updating battery clock Warning IRQ's disabled during boot() real mem = %u (%uMB) avail mem = %lu (%uMB) cpu_startup: no room for system tables; %d bytes requiredcpu_startup: system table size inconsistency_bus_dmamap_load_raw: not implemented_bus_dmamap_sync: mix PRE and POSTunknown buffer type %d _bus_dmamap_sync_bus_dmamap_sync: ARM32_BUFTYPE_INVALID_bus_dmamem_map: size botch%s: SA-110 with bugged STM^ instruction rev 0rev 1rev 2rev 3rev 4rev 5rev 6rev 7rev 8rev 9rev 10rev 11rev 12rev 13rev 14rev 15step Jstep Kstep Sstep Tstep Bstep Cstep Dstep Erev 10step Gstep A-0step B-0step B-1step B-2step B-3step B-4step B-5(IXP1200 step A)(IXP1200 step B)(IXP1200 step C)(IXP1200 step D)(IXP1240/1250 step A)(IXP1240 step B)(IXP1250 step B)step A-1step C-0step D-0step ?step C-5step 0ARM600ARM610ARM620ARM700ARM710ARM7500ARM710aARM7500FEARM710TARM720TARM740T (8 KB cache)ARM740T (4 KB cache)ARM810ARM920TARM922TARM940TARM946E-SARM966E-STI ARM925TARM1020EARM1022E-SSA-110SA-1100SA-1110IXP1200i80200i80321 400MHzi80321 600MHzi80219 400MHzi80219 600MHzPXA250PXA210PXA27xIXP425 533MHzIXP425 400MHzIXP425 266MHzunknownCPU_ARM2ARM2asCPU_ARM250CPU_ARM3CPU_ARM6CPU_ARM7CPU_ARM7TDMICPU_ARM8ARM9TDMIARM9E-SARM10ECPU_ARM10SA-1CPU_SA110XScaleCPU_XSCALE_...wr-thruwr-back**unknown 3****unknown 4**wr-back-lockwr-back-lock-Awr-back-lock-B**unknown 8****unknown 9****unknown 10****unknown 11****unknown 12****unknown 13****unknown 14****unknown 15**%s: IDC disabled IDC enabled WB disabled WB enabled LABT EABT%s: %dKB/%dB %d-way %s unified cache %s: %s does not fully support this CPU. %s: This kernel does not fully support this CPU. %s: Recompile with "options %s" to correct this. %s: %dKB(%db/l,%dway) I-cache, %dKB(%db/l,%dway) %s D-cache branch prediction enabled DC disabled DC enabled IC disabled IC enabledunknown CPU (ID = 0x%x)%s %s (%s core)Processor failed probe - no CPU ID Vector ExceptionAlignment Fault 1Terminal ExceptionAlignment Fault 3External Linefetch Abort (S)Translation Fault (S)External Linefetch Abort (P)Translation Fault (P)External Non-Linefetch Abort (S)Domain Fault (S)External Non-Linefetch Abort (P)Domain Fault (P)External Translation Abort (L1)Permission Fault (S)External Translation Abort (L2)Permission Fault (P) uvm_fault(%p, %lx, %x, 0) -> %x UVM: pid %d (%s), uid %d killed: out of swap Non-emulated page fault with intr_depth > 0 data_abort_fault: Misaligned Kernel-mode Program Counter kerneluserFatal %s mode data abort: '%s' trapframe: %p FSR=%08x, FAR=r0 =%08x, r1 =%08x, r2 =%08x, r3 =%08x r4 =%08x, r5 =%08x, r6 =%08x, r7 =%08x r8 =%08x, r9 =%08x, r10=%08x, r11=%08x r12=%08x, usp=%08x, ulr=%08xssp=%08x, slr=%08x, pc =%08x Fatal abortInvalid, Fatal %s mode prefetch abort at 0x%08x trapframe: %p, spsr=%08x badaddr: invalid size (%lu)mmrwpmap_enter: no pv entriespmap_enter: failed to allocate L2 bucketpmap_init_l1: can't get PA of L1 at %ppmapplpvepll2dtblpll2ptpplpmap_bootstrap: WARNING! wrong cache mode for primary L1 @ 0x%lx pmap_bootstrap: WARNING! wrong cache mode for L2 pte @ %p pmap_bootstrap: No L2 for va 0x%x, pa 0x%lxpmap_bootstrap: out of static L2spmap_bootstrap: No L2 for L2 @ va %ppmap_alloc_specials: no l2b for 0x%lxCannot allocate L1 KVMCannot allocate L1 physical pagespmap_map_entry: no L2 table for VA 0x%08lxpmap_map_entry: can't find L2 table for VA 0x%08lxpmap_map_chunk: no L2 table for VA 0x%08lxpmap_map_chunk: can't find L2 table for VA0x%08lxpmap_map_chunk: no L1 table providedxscale_setup_minidata: can't find L2 table for VA 0x%08lxuser pmap (%p): pmap_kernel (%p): domain %d, l1 at %p %08lx: %c |0000 |8000 |10000 |18000 |20000 |28000 |30000 |38000 pa 0x%08lx: krw %d kro %d urw %d uro %d %c va 0x%08lx, flags 0x%x dumping to dev %u,%u offset %ld dumpsysdump device bad aborted from console i/o error device not ready succeeded area improper area unavailable dump to dev %u,%u not possible vmapbufvunmapbufThe operating system has halted. Please press any key to reboot. rebooting... reboot failed; spinning Attempting to power down... %08lx -> %08lx @ %08lx cpu not recognized! OpenBSD/zaurus booting ... initarm: Configuring system ... physmemory: %d pages at 0x%08lx -> 0x%08lx Allocating page tables freestart = 0x%08lx, free_pages = %d (0x%08x) initarm: Failed to align the kernel page directoryIRQ stack: p0x%08lx v0x%08lx ABT stack: p0x%08lx v0x%08lx UND stack: p0x%08lx v0x%08lx SVC stack: p0x%08lx v0x%08lx Creating L1 page table at 0x%08lx Mapping kernel Constructing L2 page tables freestart = 0x%08lx, free_pages = %d (0x%x) switching to new L1 page table @%#lx...bootstrap done. init subsystems: stacks vectors undefined page pmap initarm: out of memoryglassbootfile: %s bootargs: %s ffuartbtuartstuartunknown option `%c' attempting to switch console to lcd screen %sCheck Condition (error %#x) on opcode 0x%x AT BLOCK #: %d (decimal) SENSE KEY: %s off INFO: 0x%x (VALID flag %s) SKSV: %s FRU CODE: 0x%x ASC/ASCQ: %s COMMAND INFO: 0x%x %c Incorrect Length Indicator Set%c EOM Detected%c Filemark Detectedscxsplgetxscannot allocate scsi xs scsi_sizescsicmdscsi_execute_xs: invalid return code (%#x)unknown error category (0x%x) from scsi driver scbusyprobe%s(%s:%d:%d): No Additional SenseSoft ErrorNot ReadyMedia ErrorHardware ErrorIllegal RequestUnit AttentionWrite ProtectedBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare ErrorReservedNo Additional Sense InformationFilemark DetectedEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnCleaning RequestedErase Operation In ProgressLocate Operation In ProgressRewind Operation In ProgressSet Capacity Operation In ProgressVerify Operation In ProgressNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Not Ready, Rebuild In ProgressLogical Unit Not Ready, Recalculation In ProgressLogical Unit Not Ready, Operation In ProgressLogical Unit Not Ready, Long Write In ProgressLogical Unit Not Ready, Self-Test In ProgressLogical Unit Not Accessible, Asymmetric Access State TransitionLogical Unit Not Accessible, Target Port In Standby StateLogical Unit Not Accessible, Target Port In Unavailable StateLogical Unit Not Ready, Auxiliary Memory Not AccessibleLogical Unit Not Ready, Notify (Enable Spinup) RequiredLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorLogical Unit Communication CRC Error (ULTRA-DMA/32)Unreachable Copy TargetTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureHead Select FaultError Log OverflowWarningWarning - Specified Temperature ExceededWarning - Enclosure DegradedWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedWrite Error - Recommend ReassignmentCompression Check Miscompare ErrorData Expansion Occurred During CompressionBlock Not CompressibleWrite Error - Recovery NeededWrite Error - Recovery FailedWrite Error - Loss Of StreamingWrite Error - Padding Blocks AddedAuxiliary Memory Write ErrorWrite Error - Unexpected Unsolicited DataWrite Error - Not Enough Unsolicited DataError Detected By Third Party Temporary InitiatorThird Party Device FailureCopy Target Device Not ReachableIncorrect Copy Target Device TypeCopy Target Device Data UnderrunCopy Target Device Data OverrunInvalid Information UnitInformation Unit Too ShortInformation Unit Too LongID CRC Or ECC ErrorUnrecovered Read ErrorRead Retries ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block ReadNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite The DataDe-Compression CRC ErrorCannot Decompress Using Declared AlgorithmError Reading UPC/EAN NumberError Reading ISRC NumberRead Error - Loss Of StreamingAuxiliary Memory Read ErrorRead Error - Failed Retransmission RequestAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRecord Not Found - Recommend ReassignmentRecord Not Found - Data Auto-ReallocatedLocate Operation FailureRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorData Sync Error - Data RewrittenData Sync Error - Recommend RewriteData Sync Error - Data Auto-ReallocatedData Sync Error - Recommend ReassignmentRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data Without ECC - Data RewrittenRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With L-ECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteRecovered Data With ECC - Data RewrittenRecovered Data With LinkingDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationRecovered ID with ECCPartial Defect List TransferInvalid Command Operation CodeAccess Denied - Initiator Pending-EnrolledAccess Denied - No Access rightsAccess Denied - Invalid Mgmt ID KeyIllegal Command While In Write Capable StateObsoleteIllegal Command While In Explicit Address ModeIllegal Command While In Implicit Address ModeAccess Denied - Enrollment ConflictAccess Denied - Invalid LU IdentifierAccess Denied - Invalid Proxy TokenAccess Denied - ACL LUN ConflictLogical Block Address Out of RangeInvalid Element AddressInvalid Address For WriteIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBCDB Decryption ErrorSecurity Audit Value FrozenSecurity Working Key FrozenNonce Not UniqueNonce Timestamp Out Of RangeLogical Unit Not SupportedInvalid Field In Parameter ListParameter Not SupportedParameter Value InvalidThreshold Parameters Not SupportedInvalid Release Of Persistent ReservationData Decryption ErrorToo Many Target DescriptorsUnsupported Target Descriptor Type CodeToo Many Segment DescriptorsUnsupported Segment Descriptor Type CodeUnexpected Inexact SegmentInline Data Length ExceededInvalid Operation For Copy Source Or DestinationCopy Segment Granularity ViolationInvalid Parameter While Port Is EnabledHardware Write ProtectedLogical Unit Software Write ProtectedAssociated Write ProtectPersistent Write ProtectPermanent Write ProtectConditional Write ProtectNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedPower On, Reset, or Bus Device Reset OccurredPower On OccurredSCSI Bus Reset OccurredBus Device Reset Function OccurredDevice Internal ResetTransceiver Mode Changed to Single EndedTransceiver Mode Changed to LVDI_T Nexus Loss OccurredMode Parameters ChangedLog Parameters ChangedReservations PreemptedReservations ReleasedRegistrations PreemptedAsymmetric Access State ChangedImplicit Asymmetric Access State Transition FailedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedCurrent Program Area Is Not EmptyCurrent Program Area Is EmptyIllegal Power Condition RequestPersistent Prevent ConflictPrevious Busy StatusPrevious Task Set Full StatusPrevious Reservation Conflict StatusPartition Or Collection Contains User ObjectsOverwrite Error On Update In PlaceInsufficient Time For OperationCommands Cleared By Another InitiatorIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledCannot Write Medium - Unknown FormatCannot Write Medium - Incompatible FormatCannot Format Medium - Incompatible MediumCleaning FailureCannot Write - Application Code MismatchCurrent Session Not Fixated For AppendCleaning Request RejectedMedium Not FormattedMedium Format CorruptedFormat Command FailedNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorEnclosure FailureEnclosure Services FailureUnsupported Enclosure FunctionEnclosure Services UnavailableEnclosure Services Transfer FailureEnclosure Services Transfer RefusedRibbon, Ink, or Toner FailureRounded ParameterEvent Status NotificationESN - Power Management Class EventESN - Media Class EventESN - Device Busy Class EventSaving Parameters Not SupportedMedium Not PresentMedium Not Present - Tray ClosedMedium Not Present - Tray OpenMedium Not Present - LoadableMedium Not Present - Medium Auxiliary Memory AccessibleSequential Positioning ErrorTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyEnd Of Medium ReachedMedium Magazine Not AccessibleMedium Magazine RemovedMedium Magazine InsertedMedium Magazine LockedMedium Magazine UnlockedMechanical Positioning Or Changer ErrorInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetLogical Unit FailureTimeout On Logical UnitLogical Unit Failed Self-TestLogical Unit Unable To Update Self-Test LogTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has Changedcomponent Device AttachedDevice Identifier ChangedRedundancy Group Created Or ModifiedRedundancy Group DeletedSpare Created Or ModifiedSpare DeletedVolume Set Created Or ModifiedVolume Set DeletedVolume Set DeassignedVolume Set ReassignedReported LUNs Data Has ChangedEcho Buffer OverwrittenMedium LoadableMedium Auxiliary Memory AccessibleRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorData Phase CRC Error DetectedSCSI Parity Error Detected During ST Data PhaseInformation Unit iuCRC Error DetectedAsynchronous Information Protection Error DetectedProtocol Service CRC ErrorSome Commands Cleared By iSCSI Protocol EventInitiator Detected Error Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorInvalid Target Port Transfer Tag ReceivedToo Much Write DataACK/NAK TimeoutNAK ReceivedData Offset ErrorInitiator Response TimeoutLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureErase Failure - Incomplete Erase Operation DetectedCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedSCSI To Host System Interface FailureSystem Resource FailureSystem Buffer FullInsufficient Reservation ResourcesInsufficient ResourcesInsufficient Registration ResourcesInsufficient Access Control ResourcesAuxiliary Memory Out Of SpaceUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change InputOperator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedFailure Prediction Threshold ExceededMedia Failure Prediction Threshold ExceededLogical Unit Failure Prediction Threshold ExceededSpare Area Exhaustion Prediction Threshold ExceededHardware Impending Failure General Hard Drive FailureHardware Impending Failure Drive Error Rate Too HighHardware Impending Failure Data Error Rate Too HighHardware Impending Failure Seek Error Rate Too HighHardware Impending Failure Too Many Block ReassignsHardware Impending Failure Access Times Too HighHardware Impending Failure Start Unit Times Too HighHardware Impending Failure Channel ParametricsHardware Impending Failure Controller DetectedHardware Impending Failure Throughput PerformanceHardware Impending Failure Seek Time PerformanceHardware Impending Failure Spin-Up Retry CountHardware Impending Failure Drive Calibration Retry CountController Impending Failure General Hard Drive FailureController Impending Failure Drive Error Rate Too HighController Impending Failure Data Error Rate Too HighController Impending Failure Seek Error Rate Too HighController Impending Failure Too Many Block ReassignsController Impending Failure Access Times Too HighController Impending Failure Start Unit Times Too HighController Impending Failure Channel ParametricsController Impending Failure Controller DetectedController Impending Failure Throughput PerformanceController Impending Failure Seek Time PerformanceController Impending Failure Spin-Up Retry CountController Impending Failure Drive Calibration Retry CountData Channel Impending Failure General Hard Drive FailureData Channel Impending Failure Drive Error Rate Too HighData Channel Impending Failure Data Error Rate Too HighData Channel Impending Failure Seek Error Rate Too HighData Channel Impending Failure Too Many Block ReassignsData Channel Impending Failure Access Times Too HighData Channel Impending Failure Start Unit Times Too HighData Channel Impending Failure Channel ParametricsData Channel Impending Failure Controller DetectedData Channel Impending Failure Throughput PerformanceData Channel Impending Failure Seek Time PerformanceData Channel Impending Failure Spin-Up Retry CountData Channel Impending Failure Drive Calibration Retry CountServo Impending Failure General Hard Drive FailureServo Impending Failure Drive Error Rate Too HighServo Impending Failure Data Error Rate Too HighServo Impending Failure Seek Error Rate Too HighServo Impending Failure Too Many Block ReassignsServo Impending Failure Access Times Too HighServo Impending Failure Start Unit Times Too HighServo Impending Failure Channel ParametricsServo Impending Failure Controller DetectedServo Impending Failure Throughput PerformanceServo Impending Failure Seek Time PerformanceServo Impending Failure Spin-Up Retry CountServo Impending Failure Drive Calibration Retry CountSpindle Impending Failure General Hard Drive FailureSpindle Impending Failure Drive Error Rate Too HighSpindle Impending Failure Data Error Rate Too HighSpindle Impending Failure Seek Error Rate Too HighSpindle Impending Failure Too Many Block ReassignsSpindle Impending Failure Access Times Too HighSpindle Impending Failure Start Unit Times Too HighSpindle Impending Failure Channel ParametricsSpindle Impending Failure Controller DetectedSpindle Impending Failure Throughput PerformanceSpindle Impending Failure Seek Time PerformanceSpindle Impending Failure Spin-Up Retry CountSpindle Impending Failure Drive Calibration Retry CountFirmware Impending Failure General Hard Drive FailureFirmware Impending Failure Drive Error Rate Too HighFirmware Impending Failure Data Error Rate Too HighFirmware Impending Failure Seek Error Rate Too HighFirmware Impending Failure Too Many Block ReassignsFirmware Impending Failure Access Times Too HighFirmware Impending Failure Start Unit Times Too HighFirmware Impending Failure Channel ParametricsFirmware Impending Failure Controller DetectedFirmware Impending Failure Throughput PerformanceFirmware Impending Failure Seek Time PerformanceFirmware Impending Failure Spin-Up Retry CountFirmware Impending Failure Drive Calibration Retry CountFailure Prediction Threshold Exceeded (false)Low Power Condition OnIdle Condition Activated By TimerStandby Condition Activated By TimerIdle Condition Activated By CommandStandby Condition Activated By CommandPower State Change To ActivePower State Change To IdlePower State Change To StandbyPower State Change To SleepPower State Change To Device ControlLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackPacket Does Not Fit In Available SpaceIllegal Mode For This TrackInvalid Packet SizeVoltage FaultAutomatic Document Feeder Cover UpAutomatic Document Feeder Lift UpDocument Jam In Automatic Document FeederDocument Miss Feed Automatic In Document FeederConfiguration FailureConfiguration Of Incapable Logical Units FailedAdd Logical Unit FailedModification Of Logical Unit FailedExchange Of Logical Unit FailedRemove Of Logical Unit FailedAttachment Of Logical Unit FailedCreation Of Logical Unit FailedAssign Failure OccurredMultiply Assigned Logical UnitSet Target Port Groups Command FailedLogical Unit Not ConfiguredData Loss On Logical UnitMultiple Logical Unit FailuresParity/Data MismatchInformational, Refer To LogState Change Has OccurredRedundancy Level Got BetterRedundancy Level Got WorseRebuild Failure OccurredRecalculate Failure OccurredCommand To Logical Unit FailedCopy Protection Key Exchange Failure - Authentication FailureCopy Protection Key Exchange Failure - Key Not PresentCopy Protection Key Exchange Failure - Key Not EstablishedRead Of Scrambled Sector Without AuthenticationMedia Region Code Is Mismatched To Logical Unit RegionDrive Region Must Be Permanent/Region Reset Count ErrorDecompression Exception Long Algorithm IDSession Fixation ErrorSession Fixation Error Writing Lead-InSession Fixation Error Writing Lead-OutSession Fixation Error - Incomplete Track In SessionEmpty Or Partially Written Reserved TrackNo More Track Reservations AllowedCD Control ErrorPower Calibration Area Almost FullPower Calibration Area Is FullPower Calibration Area ErrorProgram Memory Area Update FailureProgram Memory Area Is FullRMA/PMA Is Almost FullDEFERRED CDBParametersError in %s, Offset %d, bit %dProgress Indicator: %dActual Retry Count: %dASC 0x%02x ASCQ 0x%02xDiagnostic Failure on Component 0x%02xDecompression Exception Short Algorithm ID OF 0x%02xTagged Overlapped Commands (0x%02x = TASK TAG)host adapter code inconsistency unknown error category (0x%x) from host adapter code User command with no ioctl User command with no buf scistrcmdlen too big physio split the request.. cannot proceed DEC RZ55 (C) DECEMULEX MD21/S2 ESDIA00IBMRAID 0662SIBM 0663HIBM0664H3171-S2KZ-CDFRSS2FQUANTUM ELS85S iomegajaz 1GBMICROP4421-07SEAGATEST150176LW0002HPC3725SDCASSONY SDT-5000 3.WangDAT Model 1300 02.4Model 2600 01.7Model 3200 02.2ALPS ELECTRIC CO.,LTD. DC544CSW03DCR-2801TE1.07CREATIVECD3630EAC101FX320Sq01GCD-R580B1.00MATSHITA CR-5741.021.06Memorex CRW-26421.0gNEC CD-ROM DRIVE:2734.21SANYO CRD-256PSANYO CRD-254PSANYO CRD-S54P1.08CD-ROM CDR-S11.70CD-ROM CDR-N161.25UJDCD87301.14scsibusscsibus at %s: %d targets scsibusattach: can't allocate target linksscsibusattach: can't allocate lun linksPLEXTORCD-ROM PX-40TS1.01MICROP 1588-15MBSUN0669vendor-uniqueremovablefixed targ %d lun %d: <%s, %s, %s> SCSI%d %d/%s %s%sscsibusprintdirectsequentialprinterprocessorwormcdromscanneropticalchangercommunicationenclosure servicessimplified directscsibusprint: device type T_NODEVICE offlinescsibusprint: qualifier == SID_QUAL_BAD_LUscsibusprint: qualifier == SID_QUAL_RSVDNEC CD-ROM DRIVE:260cd%s: WARNING: unable to establish power hook %s: not queued, error %d cdioctlATAPI CD-ROMSCSI CD-ROMdvd_authdvd_read_physicaldvd_read_copyrightdvd_read_bcasd%s: WARNING: unable to establish shutdown hook drive offline%lldMB, %lu cyl, %lu head, %lu sec, %lu bytes/sec, %lld sec totalsdstartsd_ioctl_inquiry(unknown)SCSI opticalSCSI disk%s %ssdgetdisklabel/usr/src/sys/arch/arm/arm/softintr.csoftnet_intrhand != NULLsoftintr_establish: unknown soft IPL %dpxaippxaip_attach: failed to map CLKMAN: CPU clock = %d.%03d MHz pxaip_attach: failed to map RTCpxaip_attach_critical: failed to attach INTC!pxaip_attach_critical: failed to attach GPIO! addr 0x%lx intr %dpxa2x0_probe_sdram: impossibleWARNING: using filesystem date -- CHECK AND RESET THE DATE! pxa2x0_io_bs_alloc(): not implementedpxa2x0_io_bs_free(): not implementedpxaintc: Interrupt Controller stray interrupt %d intr_establish: bogus irq number %dintr_establish: can't malloc handler infocouldn't establish interruptirq %ldpxagpiopxagpio_reg_read: not bootstrappedpxagpio_reg_write: not bootstrapped: GPIO Controller %s: Can't map registers! pxa2x0_gpio_intr_establish: Pin %d not GPIO_IN%s: failed to hook main GPIO interrupt %s: unhandled GPIO interrupt. GPIO#%d pxa2x0_gpio_set_intr_level: bad level: %dpxaost%s: Cannot map registersclockpxaudc: cannot map mem space : USB Device Controller : unable to establish interrupt usbc: unable to establish connect interrupt pxaudc_read_epN: ep %d, no xfer fifo full when trying to set short packet ep%d: fifo error endpoint %d already used by %c%s: init failed, error=%d %s: cannot establish powerhook %s: unable to establish interrupt at irq %d: failed to map registers %d%s: Unknown depth (%d) apm%s: battery life expectancy %d%% %s: AC on,off,unknown, battery is undecoded (%x)highchargingCRITICALbackup power,%s: failed to create kernel thread, disabledapmevpxa2x0_apm_attach_sub: failed to map POWMAN apmlk%s: failed to map CLKMAN %s: failed to map MEMCTL %s: can't map GPIO pxa2x0_apm_sleep: can't map OST bogus new frequency 0 for rate %d maxclock %d manufacturer 0x%x%sproduct 0x%x function %d "pcmciapcmcia_card_attach%s: error %d detaching %s (function %d) (pcmcia_function_init: function is enabledpcmcia_function_enable: function not initialized@ %lx%s%lx%s%lx; iomask %lx, iospace %lx%s%lxunknown (%d)multi-functionserial portparallel portfixed diskvideo adapternetwork adapterauto incrementing mass storageSCSI bridgeSecurity servicesInstrumentSerial I/O Bus AdapterPCMCIA 1.0 PCMCIA 2.0 or 2.1 %s: CIS checksum failed %s: CIS version PC Card Standard %d.%d unknown (major=%d, minor=%d) %s: CIS info: %s: Manufacturer code 0x%x, product 0x%x %s: function %d: unspecified, ccr addr %lx mask %lx %s: function %d, config table entry %d: memory cardI/O cardcard type unknown; irq mask %x;%s: %d errors found while parsing CIS audio readonly powerdown irqlevel irqpulse irqshare io16 io8 bvd_active wp_active rdybsy_active mwait_required; maxtwins %d; memspacepcmcia_parse_cis_tupleSVECFD605 PCMCIA EtherNet CardV1-1%s: using CIS quirks for AmbiCom IncAMB8002TPMX PE-200DIGITALDEPCM-XXPCMCIAUE2212D-LinkDE-660DE-660+RPTI LTD.EP400CISV100RPTIEP401 Ethernet NE2000 CompatibleACCTONEN2212ETHERNETW89C926Seiko Epson Corp.P/N: EEN10B Rev. 00CNetCN40BC EthernetNE2000FastEthernetLNT-10TNNDC004743118001TAMARACKGVCNIC-2000pR01Ethernet CardiPort10/100 Ethernet CardFast-EthernetETHER-C16Fast EthernetPCMCIA LANCF10Base-EthernetLinksysEtherFast 10/100 Integrated PC Card (PCM100)Ver 1.0DE-650DFE-670TXDLINKSYSE-CARDI-O DATAPCLAcorega K.K.corega Ether PCC-Tcorega Ether PCC-TDcorega EtherII PCC-Tcorega EtherII PCC-TDcorega FastEther PCC-TXcoregaFEther PCC-TXFcorega FEther PCC-TXDSMC8041TX-10/100-PC-Card-V2XircomCompactCard EthernetCFE-10: no suitable config entry port 0x%lx/%d, %s: can't match ethernet vendor code : can't map ASIC I/O space : can't map NIC I/O space : function enable failed : can't get subregion for asic : unexpected I/O space configuration %s: can't map mem for enet addr %s: can't alloc mem for enet addr %s: can't alloc mem for LAN iobase %s: can't map mem for LAN iobase Digital Mobile Media CD-ROMPortable CD-ROM DriveNinjaATA-EXP PnPIDEF1SHUTTLE TECHNOLOGY LTD.PCCARD-IDE/ATAPI Adapter: can't handle card info port 0x%lx/%lu: %scan't allocate memory for command queue ,0x%lx/%lu: can't map second I/O space : can't map first I/O space %s: couldn't enable PCMCIA function %s: couldn't establish interrupt handler %s%s %s: couldn't establish interrupt : can't map io space : can't alloc i/o space Wireless LAN PCC-11Wireless LAN PCCA-11corega_K.K.Wireless_LAN_PCCB-11WL PCCL-11ISL37300PWLCFL-11INTERSILHFA384x/IEEEVersion 01.02SMC2632WNANOSPEEDNECWireless Card CMZ-RT-WPVersion 01.01NTT-ME11Mbps Wireless LAN PC CardAddtronAWP-100 Wireless PCMCIACabletronRoamAbout 802.11 DSIntersilPRISM 2_5 PCMCIA ADAPTEREval-RevASymbol TechnologiesLA4111 Spectrum24 Wireless LAN PC CardPLANEXGW-NS11H Wireless LAN PC CardD-Link CorporationD-Link DWL-650H 11Mbps WLAN AdapterAllied Telesis K.K.WR211PCM: %d slot%s pxapcicpxapcic_mem_map: bogus kind%s: unable to create event thread for %s pxapcicevpxapcicsspcic_attach_card: already attachedpxammc: can't map regs mmccd: MMC/SD/SDIO controller sdmmc%s: can't attach bus : can't establish MMC interrupt : can't establish card interrupt %s: unsupported bus frequency of %d KHz %s: data not a multiple of %d bytes mmcmdmmclklcdzkbd: unable to establish powerhook : PCMCIA/GPIO controller : failed to map %s Unable to establish %s powerhookwd0%s: failed to map memory %x for scoop%s: invalid CF slot %dscoop_pcic_read: bogus registerscoop_pcic_write: bogus registerscoop_pcic_set_power: bogus power statescoop_mmc_set_power: unsupported OCR (%#x) zssp: can't map bus space %s: can't establish power hook zssp_ic_send: invalid IC %d zssp_read_ads7846: not configured apm_acapm_bczts%s: enable failed wd: <%s> %s: %d-sector PIO, LBA, %lluMB, %llu sectors %s: freeze lock command didn't complete wdattach%s: enable write cache command didn't complete %s: enable look ahead command didn't complete CHS, %lluMB, %d cyl, %d head, %d sec, %llu sectors LBA48, %lluMB, %llu sectors %s: IDENTIFY failed __wdstart: bad return code from wdc_ata_bio()wddone%s: soft error (corrected) , retrying device faultdevice timeoutST506/MFM/RLLESDI/IDE diskwddumpwddump: try againwddump: device timed outwddump: unknown error typewddump: %swddump: drive faultwddump: DMA errorwddump: polled command has been queuedwd_get_params: bad return code from ata_get_paramsST506%s: flush cache command didn't complete %s: flush cache command: drive fault %s: flush cache command timeout wdc%s:%d:%d: not ready, st=0x%b, err=0x%02x BSYDRDYDWFDSCDRQCORRIDXERR%s:%d:%d: timeout waiting for DRQ, st=0x%b, err=0x%02x %s:%d:%d: bad state %d in _wdc_ata_bio_start _wdc_ata_bio_start: bad state%s:%d:%d: intr with DRQ (st=0x%b) %s:%d:%d: read intr before drq %s:%d:%d: device timeout, c_bcount=%d, c_skip%d %s:%d:%d: bad state %d in wdc_ata_bio_intr wdc_ata_bio_intr: bad statewdc_ata_ctrl_intr: state==RECALrecal%s:%d:%d: %s drive fault error (%x) %s:%d:%d: %s timed out piomodedmamodeno media/write protectedinterface CRC erroraddress mark not foundtrack 0 not foundaborted commandmedia change requestedid not foundmedia changeduncorrectable data errorbad block detectederror not notifiedwd0aboot device: lookup '%s' failed. boot device: %s raidwsdisplay%s: screen %d-%d added (%s, %s emulation) %s: screen %d deleted wsdisplay at %s mux %d: console (%s, %s emulation), using %sdmuxwsdisplay_common_attach: no memorywsdisplaytty() on ctl devicewsdisplay_switch2: giving up wsdisplay_switch2: screen %d disappeared wsdisplay_switch2: not switching wsdisplay_switch2: invalid screen %dwsdisplay_switch1: screen %d disappeared wsdisplay_switch1: not switching wsdisplay_switch1: invalid screen %dwswaitwsmoused_sleepwscons: copybuffer memory malloc failed wsevent_readwskbdwskbd at %s%s: attach error=%d : console keyboardcannot load keymapwskdetwskbd_detach: %s didn't detach %s: event queue overflow %s: connecting to %s %s: disconnecting from %s wskbd_get_mapentry: %d(%d): bad entrywskbd_load_keymap: %d(%d): bad entrywskbd_load_keymap: %d: recursion too deepwsmousewsmouse at %s attach error=%dwsmdetwsmouse_detach: %s didn't detach wsmux: attach out of memory wsmux_getmux: no memory for mux %d wsemul_vt100_output_c0c1: ESC in kernel output ignored \[>24;20;0cP0!u%5\wsemul_vt100_handle_csi[?62;6c[%d;%dR[?13n[?21n[?27;1nP2$u/wsemul_vt100_handle_dcs: bad type %d[11~[12~[13~[14~[15~[17~[18~[19~[20~[21~[23~[24~[25~[26~[28~[29~[31~[32~[33~[34~OPOQOROSOpOqOrOsOtOuOvOwOxOyOIOMOD[7~OBOCOA[8~[6~[3~[2~[5~[4~[1~OjOkOlOmOnOorasops_init: couldn't lock font rasops_init: font table is empty rasops_init: fontwidth assumptions botched!fontwidth not 8/12/16 or RASOPS_SMALL - fixme!wsfont_unlock: font not lockedpre 1.01.12.0usb: USB revision %s, not supported usb_attach%s: can't register softintr %s: root device is not a hub %s: root hub problem, error=%d usbtaskunable to create event thread for %sunable to create usb task threadusbevtconfigusbtskusb at %susbreausbreadusbd_add_dev_eventusbd_add_drv_eventusb_add_eventusb_detachusbdet%s: event thread didn't die usbpalockusbsynusbd_transfer: not doneusbd_start_next: error=%d usb_desc_iter_next: descriptor length = 0 usb_desc_iter_next: descriptor length too large usb_desc_iter_next: bad descriptor usb_detach_wait: %s didn't detach NORMAL_COMPLETIONIN_PROGRESSPENDING_REQUESTSNOT_STARTEDINVALNOMEMCANCELLEDBAD_ADDRESSIN_USENO_ADDRSET_ADDR_FAILEDNO_POWERTOO_DEEPIOERRORNOT_CONFIGUREDTIMEOUTSHORT_XFERSTALLEDINTERRUPTEDXXXvendor 0x%04xproduct 0x%04x%x.%02x"%s %s", class %d/%d rev addr %dusbd_devinfousbdly0 lengthout of datausbd_fill_iface_data: bad descriptor(s): %s iface descusbd_set_config_index%s: device addr %d (config %d) exceeds power budget, %d mA > %d mA %s: port %d, set config at addr %d failed %s: No free USB addresses, new device ignored. usbd_new_device: cannot find HS port configuration %d interface %d port %duhub%s: hub depth (%d) exceeded, hub ignored uhub_attach%s: bus powered hub connected to bus powered hub, ignored %s: no interface handle %s: no endpoint descriptor %s: bad interrupt endpoint %s: port %d power on failed, %s %s: cannot open interrupt pipe %s: no ports, hub ignored %s: port %d reset failed %s: device problem, disabling port %d %s: strange, connected port %d has no power %s: illegal enable change, port %d %s: port error, giving up port %d %s: port error, restarting port %d hid_start_parsedefault bType=%d Local bTag=%d Main bTag=%d Global bTag=%d BAD LENGTH %d , %d report id%s%s: no memory %s: no input interrupt endpoint %s: unexpected endpoint %s: could not read endpoint descriptor uhidev%s: no report descriptor %s: iclass %d/%duhid at %s reportid %duhidev_intr: bad repid %d uhidev_set_report_asyncuhidevwiuhid: input=%d, output=%d, feature=%d uhid_do_readuhidreauhid_do_ioctlukbd %s: attach failed, %s %s: was console keyboard This port is broken, it does not call cnpollc() before calling cngetc(). This should be fixed, but it will work anyway (for now). too many modifier keysbad modifier sizemultiple key code arrays key codes not on byte boundarytoo many key codeskey code size != 8umassCBIBulk-OnlyRBC%s: using %s over %s %s: atapiscsi not configured %s: command protocol=0x%x not supported %s: bus attach failed %s: isdata not configured SCSIATAPIUFIISD-ATACBI with CCI%s: got polled xfer %p, but %p already pending %s: BBB bulk-%s stall clear failed, %s %s: Invalid CSW: sig 0x%08x should be 0x%08x %s: Invalid CSW: tag %d should be %d %s: Invalid CSW: status %d > %d %s: Phase Error, residue = %d %s: BBB reset failed, %s %s: BBB bulk-in clear stall failed, %s %s: BBB bulk-out clear stall failed, %s %s: transferred %d bytes instead of %d bytes%s: Unknown state %d%s: CBI bulk-in/out stall clear failed, %s %s: CBI intr-in stall clear failed, %s %s: CBI reset failed, %s %s: CBI bulk-in stall clear failed, %s %s: CBI bulk-out stall clear failed, %s umass_cmd: large datalen, %d %s: Unknown status %d in umass_scsi_cbaue%s: EEPROM read timed out %s: MII read timed out %s: reset failed %s: setting config no failed auemii%s: getting interface handle failed %s: missing endpoint %s: address %s %s: couldn't get endpoint descriptor %d %s: no memory for rx list -- packet dropped! %s: %u usb errors on intr: %s %s: %u usb errors on rx: %s %s: usb error on tx: %s %s: aue_send error=%s %s: tx list init failed %s: rx list init failed %s: open intr pipe failed: %s %s: open tx pipe failed: %s %s: open rx pipe failed: %s %s: watchdog timeout %s: close intr pipe failed: %s %s: abort intr pipe failed: %s %s: close tx pipe failed: %s %s: abort tx pipe failed: %s %s: close rx pipe failed: %s %s: abort rx pipe failed: %s axeaxe%d: read PHY failed axe%d: write PHY failed %s: media change failed axe_setmultiaxemii AX88172 AX88772 AX88178%s: couldn't get ep %d %s: usb errors on rx: %s axe%d: usb error on tx: %s axe%d: rx list init failed axe%d: open rx pipe failed: %s axe%d: open tx pipe failed: %s axe%d: tx list init failed axe%d: watchdog timeout axe%d: close intr pipe failed: %s axe%d: abort intr pipe failed: %s axe%d: close tx pipe failed: %s axe%d: abort tx pipe failed: %s axe%d: close rx pipe failed: %s axe%d: abort rx pipe failed: %s cue%s: read MAC address failed %s: cue_send error=%s kue%s: warm boot, no firmware download %s: failed loadfirmware of file %s: errno %d %s: cold boot, downloading firmware %s: failed to load trigger segment: %s %s: failed to load fixup segment: %s %s: failed to load code segment: %s %s: loading firmware failed %s: could not read Ethernet descriptor %s: no memory for multicast filter buffer %s: kue_send error=%s cdce%s: no data interface %s: could not find data bulk out %s: could not find data bulk in %s: no descriptor for bulk endpoint %d %s: interface alternate setting %d failed %s: no descriptor for interrupt endpoint %d extra ethernet descriptor %s: close interrupt pipe failed: %s %s: abort interrupt pipe failed: %s %s: open interrupt pipe failed: %s %s: too many errors, disabling %s: usb error on rx: %s udavudavmiiudav_setmulti%s: udav_send error=%s upl%s: upl_send error=%s urlurlmii%s: couldn't get endpoint %d %s: failed to get interface, err=%s %s: url_send error=%s %s: %s: bad register %04x wi_usb%s: open pipes failed %s: already detached %s:%s: invalid packet id sent %x invalid packet len: %x memsz %x max %x %s: %s: error=%s write_record buf size err %x %x wiTXsync%s: %s error=%s UGH RX UGH TX wi_usb: received USB_BUFAVAIL packet wi_usb: received USB_ERROR packet wiIDLwitxlwiusbthrural%s: could not set configuration no %s: could not get interface handle %s: MAC/BBP RT%04x (rev 0x%02x), RF %s, address %s %s: no endpoint descriptor for iface %d %s: could not allocate tx buffer %s: could not allocate tx xfer %s: could not allocate rx mbuf cluster %s: could not allocate rx mbuf %s: could not allocate rx buffer %s: could not allocate rx xfer %s: could not allocate beacon %s: could not transmit beacon %s: could not transmit buffer: %s ural_rxeofural_tx_data%s: could not allocate protection frame %s: could not read EEPROM: %s %s: could not read MAC register: %s %s: could not write MAC register: %s %s: could not write to BBP %s: could not read BBP %s: could not write to RF RT2522RT2523RT2524RT2525RT2525eRT2526RT5222%s: timeout waiting for BBP %s: could not allocate AMRR xfer %s: could not allocate Tx list %s: could not allocate Rx list %s: could not queue Rx transfer %s: could not open Rx pipe: %s %s: could not open Tx pipe: %s %s: timeout waiting for BBP/RF to wakeup %s: could not retrieve Tx statistics - cancelling automatic rate control usbf%s: can't establish softintr %s: usbf_new_device failed, %s %s: can't create task thread set config activated %s %s, rev %d.%02d/%d.%02dusbf_devinfo_allocusbf_allocmemusbf_start_next: %s cdcefOpenBSD.orgCDC Ethernet Emulation: usbf_add_config failed : usbf_add_interface failed : usbf_add_endpoint failed : usbf_add_config_desc failed : usbf_end_config failed : usbf_alloc_buffer failed : usbf_open_pipe failed : usbf_transfer failed : address %s cdcef_do_request %s: usbf_transfer failed encap error mii_attach: phyloc and offloc specifiedmii_activate: phyloc and offloc specifiedmii_activate: DVACT_ACTIVATE%s: config_activate(%d) failedmii_detach: phyloc and offloc specifiedOUI 0x%06x model 0x%04x rev %d at %s phy %dmii_phy_setmedia: MASTER on wrong mediamiiautnsphyDP83840 10/100 PHY: %s, rev. %d nsphyterDP83815 10/100 PHYDP83843 10/100 PHYDP83847 10/100 PHYqsphyQS6612 10/100 PHYinphyi82555 10/100 PHYi82562EM 10/100 PHYi82562ET 10/100 PHYi82562G 10/100 PHYiophyi82553 10/100 PHYeephyMarvell 88E1000 1 Gigabit PHYMarvell 88E1000 2 Gigabit PHYMarvell 88E1000 3 Gigabit PHYMarvell 88E1000 4 Gigabit PHYMarvell 88E1000S Gigabit PHYMarvell 88E1011 Gigabit PHYMarvell 88E1111 Gigabit PHYMarvell 88E1112 Gigabit PHYMarvell 88E1116 Gigabit PHYMarvell 88E1118 Gigabit PHYMarvell 88E1149 Gigabit PHYMarvell 88E3082 10/100 PHYMarvell 88E1000 5 Gigabit PHYMarvell 88E1000 6 Gigabit PHYMarvell 88E1000 7 Gigabit PHYexphyxl: 3Com internal media interface %s: ignoring this PHY, non-zero instance exphy_service: can't isolate 3Com PHYrlphyRTL8201L 10/100 PHYIP101 10/100 PHYrl: RTL internal PHY rlphy_service: attempt to isolate phylxtphyLXT970 10/100 PHYLXT971 10/100 PHYmtdphyMTD972 10/100 PHYicsphyICS1890 10/100 PHYICS1892 10/100 PHYICS1893 10/100 PHYsqphySeeq 80220 10/100 PHYSeeq 80225 10/100 PHYSeeq 84220 10/100 PHYtqphy78Q2120 10/100 PHYukphy: Generic IEEE 802.3u media interface, rev. %d: OUI 0x%06x, model 0x%04x %s: no media present bmtphyBroadcom 3C905B internal PHYBroadcom 3C905C internal PHYBCM4401 10/100baseTX PHYBCM5201 10/100 PHYBCM5214 Quad 10/100 PHYBCM5220 10/100 PHYBCM5221 100baseTX PHYBCM5222 Dual 10/100 PHYamphyAm79C873 10/100 PHYDM9101 10/100 PHYDM9102 10/100 PHYDM9601 10/100 PHYAm79C875 quad PHYacphyAC101 10/100 PHYAC101L 10/100 PHYAC_UNKNOWN 10/100 PHYnsgphyDP83861 10/100/1000 PHYDP83891 10/100/1000 PHYurlphy: RTL internal phy %s: %s: enter down%s: %s: link %s mmcdiemmctsk%s: can't enable card %s: no functions %s: can't supply bus power %s: can't supply clock %s: can't identify card %s: mem init failed %s: i/o init failed mmcdlySpectecSDIO WLAN CardSDW-820%s: bad CIS ptr %#x %s: CISTPL_VERS_1 too short %s: bad CISTPL_FUNCID length %s: bad CISTPL_MANFID length %s: CIS parse error at %d, tuple code %#x, length %d %s: CIS version %d.%d wireless network adapter%s(%sat %s%s: can't supply voltage requested by card %s: can't send I/O OCR %s: can't set I/O RCA %s: can't select I/O RCA %d %s: can't read CIS sdmmc_io_attach%s: can't set mem RCA %s: unknown SD CSD structure version 0x%x %s: unknown MMC CSD structure version 0x%x %s: unknown MMC version %d %s: can't attach scsibus %s: can't allocate ccbs getccbsdmmc_scsi_cmdSD/MMC Drive #%02d%s: out of ccbs 4fd'(T p@@ @ @ 5p|5x|5||5|55|5|56|5|5|5|5|5|5|56|5|5|5|5}5}5}5  +-+'& !$%E " 0R_R_<77S_S_H7N7u_u_<7,70u_Du_|727lu_u_|727u_u_H7N7v_v_T7R7v_w_T7R7w_0w_t7R7pw_77R7pw_77R7pw_7d7R78x_Lx_T7R7x_7T7R7z_|z_|767 _L7|7:7Ȁ__|7:7_7|7:7P_d_T7R7__T7R7؂__T7R7؂__T7R7__T7R74__T7R7H_\_T7R7p_x_T7R7__T7R7Ѓ__|7>7__7B7__7&7d_P_7V7J5x_<7Z7 ,N5_<7b7 __<7 7!@N5_<7 7!TN5_7J7/O5X_7J7/hh5l_<7 7!o5_<7 7!|p5_<7 7!p5_<7 7!(q5_<7 7!q5_<7 7!q5_<7 7!q5$_<7 7!q58_<7 7!Ts57<7 7!8v5_<7 7!__<7F70__<7f70__771,_@_771T_h_771|__771__771__771__771_0_771D_X_771l__771__771__771__771 _ _7714_H_771\_p_771__771__771__771__<7^7:}5 }5(}56Ж1L&&?!l   h L @|5I L P tV T U $@ q <~ \ Є F 7np5THIS is A memory TEST pattern5%%K  5     "!!H! ! ! ! !(!L(!2!3!4!|!3!83!h3!3!4!x!3!3!l4!t4!4!X!,7!`7!l8!8!4!\!4!4!6!6!4!8!:!=!=!>!4!>! @ @   )68B! vd5"5r#5#5D75N!05R!$5S!,5R!5R!5R!45S!T5$S!<5\S!D5S!L5S!T5~!`5S!h5@S!p5!6V!x5V!L5V!5V!5V!5V!5`5ta!5]!6]!5c!,5ܔ!5!5!5N!26N!5N!đ5!̑5$D" %" ,### x%̮%% %%#Ľ%%%x"y"&,', %####### p" " " "# ,0s"###x%a"(%м%###$P######%@d#" "("0"8t"""pt"t"t"u"v"t"tw"Dx"x")7)7)7)7*7)7 *7  0 `###*7*7*7*7*7d55**)*<>*W*47T%47,*57* 57X*57(*$57*057L*<57T*H57P*T57*`57,*l57*x57*57*57R%57@*57*57*57*57*57*57*57*57d*678T%67X* 67*,67*867(*D678*67T*P67*47D*\67*h67*t67*670T%heF747&$57@*057L*<57T*H57P*T57*`57*57@*67X* 67*,67*867(*P67*47D*deLG747h%$57*057L*<57T*H57P*T57*`57`*57@*67X* 67*,67*867(*P67*47D*670T%leG7 ... ...(*t*(* *(*4*I7pJ7J747T%47`+57L+ 57L+57LM+$57*057M+<57M+H57O+T57)+`57,+l57*x57*57T%57h+57T+57`U+57V+57`+57c+57e+57+57 f+678T%67+ 67h+,67*867(*D67+67T*P67*47D*\67*h67f+670T%eH747&$57@*057M+<57M+H57O+T57*`57*57h+67+ 67h+,67*867(*P67*47D*eI747h%$57*057M+<57M+H57O+T57*`57`*57h+67+ 67hi+,67*867(*P67*47D*670T%exJ7+؅+܆+x+++++p+\+ \K7,K7K76,ԏ,,,0,,P,M,ȑ,(WEVrdroot2.5M@WEV  08`)G<  (G` /mnt38  )G`@@<@T 08`(G<  (G`[~ [~(G`@@<@TU )G` b )G y4ǎA (G )G9 )G9hdcA(G* (G* (G ^aaclqA(GG(GG(GGbG[> (G2(GM6 )G9px o  )GN )G  )G cٓ )GQ )GTCH )GTCHi( )GIE )G )G8e#.Rr )G" )G.) )G8 x~S7q )G+ )GK6 )GK6`hpx9õFiUMBZH =D'fnGOhE&d`#|Li?P9_M]!Mʆ^%EgTg+"n!f 7iL FuJiLK/'1a$IVlt -#ޟ s]7 |)$lE-kyɢu_iD:~:b,68~7x=gz_$4FtU/JK 6QZ[c9j4j)THV;;Tָn .@.. ... export PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ umask 022 set -o emacs rootdisk=`dmesg|sed -n '/^root on /!d;${s#^root on \([^ ]*\).*#/dev/\1#;p;}'` if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES mount -u ${rootdisk:-/dev/rd0a} / echo 'erase ^?, werase ^W, kill ^U, intr ^C, status ^T' stty newcrt werase ^W intr ^C kill ^U erase ^? status ^T _forceloop="" while [ "X$_forceloop" = "X" ]; do echo -n '(I)nstall' [ -f upgrade ] && echo -n ', (U)pgrade' echo -n ' or (S)hell? ' read _forceloop case "$_forceloop" in i*|I*) /install ;; u*|U*) /upgrade ;; s*|S*) ;; *) _forceloop="" ;; esac done fi #!/bin/ksh MODE=upgrade . install.sub while :; do ask "Root filesystem?" "$ROOTDEV" resp=${resp##*/} [[ -b /dev/$resp ]] && break echo "Sorry, $resp is not a block device." done ROOTDEV=$resp echo -n "Checking root filesystem (fsck -fp /dev/${ROOTDEV}) ... " if ! fsck -fp /dev/$ROOTDEV >/dev/null 2>&1; then echo "FAILED.\nYou must fsck ${ROOTDEV} manually." exit fi echo "OK." echo -n "Mounting root filesystem..." if ! mount -o ro /dev/$ROOTDEV /mnt; then echo "ERROR: can't mount root filesystem!" exit fi echo "done." for _file in fstab hosts myname; do if [ ! -f /mnt/etc/$_file ]; then echo "ERROR: no /mnt/etc/${_file}!" exit fi cp /mnt/etc/$_file /tmp/$_file done hostname $(stripcom /tmp/myname) THESETS="$THESETS site$VERSION-$(hostname -s).tgz" ask_yn "Enable network using configuration stored on root filesystem?" yes [[ $resp == y ]] && enable_network manual_net_cfg cat <<__EOT The fstab is configured as follows: $( is found, and the fstype is not nfs. Non-ffs filesystems will be mounted read-only. You can edit the fstab now, before it is used, but the edited fstab will only be used during the upgrade. It will not be copied back to disk. __EOT edit_tmp_file fstab munge_fstab check_fs if ! umount /mnt; then echo "ERROR: can't unmount previously mounted root!" exit fi mount_fs install_sets finish_up  . .. bin dev@ etc mntmnt2EƢsbinE tmpB usrvarinstbin.profile install.mdupgrade install  install.sub ARCH=zaurus md_installboot() { } md_checkfordisklabel() { local rval=0 disklabel -r $1 >/dev/null 2>/tmp/checkfordisklabel if grep "disk label corrupted" /tmp/checkfordisklabel; then rval=2 fi >/dev/null 2>&1 rm -f /tmp/checkfordisklabel return $rval } md_prep_fdisk() { local _disk=$1 ask_yn "Do you want to use *all* of $_disk for OpenBSD?" if [[ $resp == y ]]; then echo -n "Putting all of $_disk into an active OpenBSD MBR partition (type 'A6')..." fdisk -e ${_disk} <<__EOT >/dev/null reinit update write quit __EOT echo "done." return fi cat <<__EOT You will now create a single MBR partition to contain your OpenBSD data. This partition must have an id of 'A6'; must *NOT* overlap other partitions; and must be marked as the only active partition. The 'manual' command describes all the fdisk commands in detail. $(fdisk ${_disk}) __EOT fdisk -e ${_disk} cat <<__EOT Here is the partition information you chose: $(fdisk ${_disk}) __EOT } md_prep_disklabel() { local _disk=$1 md_prep_fdisk $_disk cat <<__EOT You will now create an OpenBSD disklabel inside the OpenBSD MBR partition. The disklabel defines how OpenBSD splits up the MBR partition into OpenBSD partitions in which filesystems and swap space are created. The offsets used in the disklabel are ABSOLUTE, i.e. relative to the start of the disk, NOT the start of the OpenBSD MBR partition. __EOT md_checkfordisklabel $_disk case $? in 2) echo "WARNING: Label on disk $_disk is corrupted. You will be repairing it.\n" ;; esac disklabel -W $_disk >/dev/null 2>&1 disklabel -f /tmp/fstab.$_disk -E $_disk } md_congrats() { val=`ztsscale` case $? in 0) grep -v '^mouse\.scale.*$' /mnt/etc/wsconsctl.conf \ >/tmp/wsconsctl.conf echo $val " # see ztsscale(8)" >> /tmp/wsconsctl.conf cp /tmp/wsconsctl.conf /mnt/etc/wsconsctl.conf grep -v '^machdep\.ztsscale.*$' /mnt/etc/sysctl.conf \ >/tmp/sysctl.conf cp /tmp/sysctl.conf /mnt/etc/sysctl.conf ;; esac } md_consoleinfo() { local _u _d=com for _u in $(scan_dmesg "/^$_d\([0-9]\) .*/s//\1/p"); do if [[ $_d$_u == $CONSOLE || -z $CONSOLE ]]; then CDEV=$_d$_u CPROM=com$_u CTTY=tty0$_u return fi done } ELFa(t4P4 (@b@b888$$\\\T444OpenBSD -LTP@0! MP@ -0LM 0PS`@p0 x/ P000`P`0 R ^ *0 0 Q P:00(, 0S SX 00-SL@  @1S@DQ@Dt @Dt0T -LM$@0S0SL -< L04S0 00 h&4\ 0S00 -LM`pQ 0S5/p@PPPQ P Q088 8mQ  ̥4 p-PLM@@P` ph 0-@L FPP \Vc2> 0OSP8  (010SPAc4ԥ̥$` -䢟䒟<LMP000ȂS09 pP=v F@T` 8K0  \ Xn TŸ8 n+ R<Ÿ8 0a 08 Z0000S0A  10S000 B b 10S0 S+ 10S 1!0!0Sx!p1  !h 7000D81810(10S0 `R PpU G00SRU!G0pF$ @0S 0S  0<9$ @0S 0Sp G|RЧĨب $̎ЍDt̩ -LZ 00 -LO0 -LG P00 -L<0< -0L0000 -0L000 -Lp0 -Lh0 -LHG 0-LMK P%bp@81 0L  R@ 0b0CS$ \\\\\\\\,\8\\\\\\\\\D0D0E0J0AS00 0xS S *S 0S ", 0 $F0 F0| Ⱦ  p-LM KP qr1 L PY 0b0CS5ꤌ$$$$$$$$$Ԍ$$$$$$$$$`P$K4`P%%K5 `P*%F:`P!%O1 VU00 0xS S *S`P0E" $ VU "I0 0 (zF0 uFp| Ⱦ  0-x0LP h0   aAq 0A0q08@0P 0R0 : 00 R0  - L :F  - L 1F  - L (F  - L F  -LMd)\)T#P00s D@00Cs0 00Cs0c㕱0X< -8rLP,20  8,P ,10S0q QP1000 A0! 1,P0 1!,0P00 ttKLQPa` \10S 0@g6P4 $A0P 0Y6P 0R6PKK0  Rp: P 0 0; S0`@%,"]K@0h0Q XgEPhplb<(T \l|( 0-LM@KNP tK0: S\4 KPX'P0000 0:pq@0S0000 m @ 0-L1 R 1 0Su*Q  1Q   :A P 0!0  tJ l`0 098S0 0 0 0  P0    00 00000 0000 @0  W00 \D L000 2J0 0 00(00  -0LM 0RE0RQ0R_ x00 l@ R R*T bQ O:00,00S hЍ̎ -`1LMP``p@Q `P@  . `0S@ J0/T0V000 0T0 0 0 0S00^ 0pd  tDP@0 fR `!* 00 0Rb380 00 ̪ -pLuM0d yK,0 Bo 1b1 P a!  B=9! = 1 U. uP@N0 Dr/ p`Pno JP PoOK 0!dPPA 9 R  x1 RtVOKd0`!A 9  R ,1,R@Kd0!w?KA9v?K!00/C#b10  0 2됀K p`0d wKP^뉁9 @v?K ,00 ,0SD,-.A?L($<MbP -LMe@Nb@ -LG' -0L0!P0 `@%,"08p7q / 30p`0-  !P 0 pWp@0P`p 0S0C0X CT00  Z <i  H0<  -L Mȡ00 `@%,"07pbq`C 2[ 8c8d0 K00 , $PQ4 `0pSI 0SF 弬PQ4"`0 K03K,` $p  @0 pR' 0S$ ^0`PP  lPH@0 pR<0 0S@0p R 0Sm  -MLM2 P` p( 堤 h"mp?@Y 4PD(((((((((((((((((((((((((((((((((((((((((((((((0ppppI.KL1 BH BbT(JK L@1k$Rp *0 PbUa=B^KPEPE@ߍP 4 04 04 I>K0C 0CD $ 0t , FP0-S  TA0HA <G0$,GfLd  -L0B LR4 -LM`PP( @(K,pK 0  (0@S2WG -L M0@p00 0Si PP 0S nSZ =]P0`0@Q P QLQJ  0V0P 1 0* Y0  0000V 0`0^00 ,Kn, ?R0S@p @L0"Sl 00AY000 LPH00D 0oSP A@\t| -霣圃LxMP@`p#0lpA P0@$S30```````````````````````$<`DP`X`````h`p2`2`p22y2 R2l2|"0QAPc<2 R 82 RpK+9P`,r 0Sp j'P g `P? pKPᚪPX0: S SK IPB1 R 0 5 DP) `j_0SV pW P@6Wp@Tj_ W p0 R  6V   D ZZ嬋P!PE`LZy<'@x`90SdPP@&T6?L,r`OTA$$PA,Ⱦ8DT|d -L4M䗟য়T `D0,  0DSpH  TW' R  0|St7pW h߃ @TP 0S T ,7p DW 7' 0ǃ0VSPBO0fVpW& 6 P 6Qp& x6Wtd塃  pP6PW@h& @ (6pW D& 勃  5pW&倃  p5W%u0S   R 5pW0%e0S$ $  R T5pWL|0x%U0S( (  R 5pW <0<%E0S, , R 4pW0%50S0 0 R 4pW0$%0S4 4 R T4pWL|0$0S8 8 R 4pW <0L$0S #pWH0 $L P T 3W ,0S ,0SG pL3W@#@=l8P% pW )"PTKPK{.p2PTxWB@*0D#DP嶂8 PT0BOSl Ml RJp^ p2pWŸd0"P蚂0St t 2R $2pW0"剂x0 1pW"~x0 1pWX"sx0 1pW0"hx0w pl1lW"TnpPBOl0 $1pW!Jl0 0pW!?l0N p0W!xPC0BOS 0< p0Wt<4 -LM@p`PC Tp KP  0S -SH0=1@ !@!@P 0@0@@< -L0 @4 p-LM@BPPPP'oPP 1Pp*Px%P` `PLP @ 0Ppp$Pp錱ȴ8̴ p-GML`1 M Xa T!P0@4 8!ap ?P -K BoP B I1Q0@cTQ?ANK@D0@D4 嵁P# $04 04 =K 0C:P|Px Pl ||0$L5-P@ 4d;=Lhĵ(d<ȵܵ  -L0. !'@4 -LM`PP( @(K,pK 0  (0@Sm&,; -L M0@p00 0Si PP 0S nSZ =2P0`0@Q P QLQJ  0V0P 1 0* Y0  0000V 0`03|00 ,KC, ?R0S@p @!|0"Sl 05Y000 LPH00D 0oSP 4@\t| -L | -ML M.0~`P,0 ._p B0@3S񟗦<H,,Hd0Xt44= D>LP PB<P  .< = =`LP l =4Lx*P D d=4<-$< < < < ; ;; ; ;;,; ;;,;;,;;,x;t; d; \;vX; H;D; x4; ,;e(;,n;q; g;j;+`:c: `b0FSQ0:M>KQ0C0C `p  I~KpGpG=P@ $p9Y0S 4: S L WNMKHHؙ@ $ )Pz9艟@9Tx9D 9^ P\ R$ U9 PT ^ \ R U$0 ܤ0J   X3Z H0380S5 0S  8 R 8 R8 R % 5 Sl8 x8 Rp8 R U Ue  H8 Rk i e V80|A3 X00R00S7 P 0@ ,P 10135:3P % h7 R 0B$ 70S4 l7 R R0$ 70S4 ,7 R 7 Rl$ 60S4 60S4 6 0 S4 0  Se4%S04 RPؔ6Y> Ak% Д0AP(  `%6X@JP U%dV000TU 3 5#:(P8 A%0;%V00X@6h1h ? -%6``U 0#5 %* % U UU 4S X0 4  \ P  @ %ؔ  YRJ^   %$X T \% P ؔ PY, <U U%1 ATE Uc cc$Xe 00S.K,5 \px \ IC6<0S@#/Q 0SKoP\0@  TS,50P5 P  P$L%  QL #%*LUdUP4 射 05 0@R8 Q1.8 q0nJ  0 C% RP L 5S3 p0# U Ugg Ug gg i$L\0@.L   %8b Z$L5`J 0P@V`!LUU: X X V ^ ^42 v Pb 2Pb`$"#00C4 .L4R 00UV `P'|4SQ004 e$ V04 0S03$ 54 5 X4 $4 $ t<Qp ,0 S ,LdAU@UlAVиtAxA $|AAAhA$A,AA0AADATAAķAdAxA ع<(Lxк Dh,rĶ)LTX\dhltxApAgfff`A8@\AdAH0|Tط 8DNK@8\NK4@@4  !P  4$S440 $ 5    ^ % Ue0Vf*0U U00R00SU $0R eVU:PU L U0#03RQ $埚p ܤ P%0S^  Pd \0#03\030"S3  `Q #P,<"(PK0d1P ^ U * X  PQ ܤ Lp 4P  5$ UP2Q 4( Td0 25P%$P ܤ0 0 P B24P%40P$(3R ^3  X4LS \ R 0\J>Kܤ0C@R0 00aAU0!|rP!d0B!U0PBBBB@B`BBpB0BPBBBB|4(KM.KP B4`( Kp$(0K4(K4(K-K0 B$<5 (K 4@% 0K.KD5 4 B#4 `5 4H% $D PT"$`lK``V! ` pK  0Xp6BNKx6Q%̠%4%(@D@D0 P5&6 0S66TQ$0 N0o00  e T #ܤU0 U 0A AH7(KJ.KP BX7(K`'(0K$"$d% $$PT0!l |! D! `0 @ p lKd`V,Ġ@ `000 q%0$$]  0#> 40Q4V>d8 \ \ʠ 5. V:%V#gIU8'L40S@.ccR!T5h L!P0!01S03,S345)*Q$H9U! $UT  h9Q eVPR 9U  T 9R UP9R R/5 XPBNK@D@D*5Q P p  e 7Pa4: S ܤEnK`F `F @P0 #   %G.`\d4S: 8j\d4S0  P$Z44 D D zc -LM@(K&P`5  uPpp0W0* R00S 0rS`Fv (P@ \P@Z`F (00T P P (0vj?(0 3(0 T0-뜻| -PL`p@PDP @T:T @2 - -LPgM/, `zPBp  Q q00  R P\ 8Ÿ q00  RP 0`SpSapCP 0S.S  m-00Y00S ,0S 0S 0S $0S5MK  spI w8pW0SH00Y00S(0 0(0,0S0,00S' 0S $0S ?P $0 ?c02 $00 ,0S ,0 {$, u (l oX mP@ <4ex0LԻedAA$x$<L -LMpwQ5Q/wQ& ~w,Q0S h(I4 0qwow`8|@|PPfwhdw<Q@_wL\wDYw<Vw4Swꄼļؼ! Q-0L $ Q*  ,$ -LM`@ps $K_GPs0S0S 0 k,$0 UR#U4 p-LM`PU@ T<5PP UTUpT@- 0\ \8 0000ӑS^ 0 ^00 Br0 BS 0r0 -0L 㯗4T -LM00`Kq@ 00 pPPS 00@TH 0uS> <S2  0BS^Q 0( 0 0 0 ?R(0  -R   4K P@ 40 R0 0(@bF \FP0 0( dP 0LFF< 0pPPDxp\ P-L ++ 0-LMt@ 0Pd#vQ s@ks 80hv0(0 v 0Sx(Tl -LM0:(0 5P0( 0S(0 0 (K  uPP) 0S& =!P`u 00,pK 0cSb iSI lS> oS& A0S 0S 0S(0SP0AS, [0 0S0 TP,00 0oSP ?,0(0P,0 0 0P,00 0iSP0 T,0$0XP,00 00.(0pꌿtxx -LM `P0p-S000P(K 0(P P@  0S 0 Q ("E{Ev h$ D0h0S $ "-,0 0$  -LM@00$0 C 0+ 0 -00 $0 0 0+ -0 D0- -L M0KS0@0,0  K 0 B 0 0`t -LM@ؼ-r0 00S 0 $: 00 $ 00 $: 0S00  <<  00 0 -LM@妼q0 0 -LM0@S  hE 0 << 0 -LM@兼00$08  0 0(0-K 00 $ 0g@+$Ut< -LqhKt -LM K00" PO/tD - L PA/nt P - L P3/ot \ -A0 LR`P pfPJ RDA R pYP3 RA R pLP R@ R p?P 0S 0   0 p  0$  $ 0 p $ 0   0 p  0  0 p 鐿  -LMx \, P`p 0LSE    0 sp@pT 1  sW%X  @}W $8W8}W $8tWp8kW P8bW $08YW00 QW $7HW@ $7?W  76W  7-/W00SW $ \7W <7W 7 W 6W  6W $ 6@W  6W $t6W@ $T6W 46W  $6W 5W  $5W 5W 5W00 tWX5W $85W $5zW 4q@\W00fW4]W $4TW@ $t4KW T4BW  449W$40W 3'@W 3< S S 3$W  3W $d3W  D3W  $$3W $3W $ 2W: b0S Q KdeW " @ ^ 0K0 X" XK 0SXT1 ,0S ,庒KnKnnKna0S @K00!d 0Sqi S  SetplhrI C Haq<\q0 Xq$ Ll\Td0$HL\l|T4tdD(<x'htpl|$<LXdp 0-0P@0LS 0@0B00AA 0-|PL0@S d0dp0U0 0HS@p4p$p0000AAȾ $ -0L0CSQ tM00-  Q^00?  Q^00@  ,00 0 Axa -LTM\ X3XSp`| , xp p <R|0m |0@0T #|Qpa@ Pdlllp0| `Kx| MPxt KPJ4K|x P}W |0S0t  | l h 0S |`KxPKP& |0 | Ql0Sh0S,0 S ,Bx Pp x/Pl(+WPP|0 |(1  0P @Mmam0l0  她P|0|0?.t  p~pA|@v Px :p7 P*H%Lt@ht@)gtd  -0L 㗐4 -qLpM@P`!PpF@9 -PR88888888888888888888888888888888888888888`1`00 00Q @` 0T Q" T 1@KណP0: S 0`S  0`ST 8  (6*AAAA IAd  -NMLMDD0S( `Ppu $2$" 2Q0UOINK@D@DP4: SB /P0S 1 R pP1P o(0 S l(8k0SKAAP0%4R%4R >0 RP@ B^KPEPE0 @ PINK2@D2`1@D2:k?00 SoINK@D@DPX0 R~4: Szj00ALAO AA A -0L 0cV4  -鐥LMP`0 4 t%Np ?0@8S񟗅,Hp 0SX$00,  0S (4 v 0S o 0S#00e #000#0S W 3000 #C0P 0 R D 0040 s\#X#; mL#0S 2 ,#0S0Pa0Ua 2 R 2 0 R @ЂŸQ 0@Pp ]0"0CS @l`U BP  nU 5P 00Q U *P@ 1\ ~ `P 40`V0ES @ PP PbP  8K( 0 R, KP+0Q0ESU 7 @e/ 0 P h P00SZ 0 RUUP(kkd  jdik\ihi k  md p-LM@P`c0Se/ 0U $000 0 ph$>p "( -7LS 0707Pp `0 Xm @@UmA0pW 00PZ -$3L MPU0 ` C<<<<200XW 2 R \2 0@@  0S (0s& 0S! dBdflXpDK00CS0X0ӤX0r PpP $B00CS00Ӥ0b PpyUYUmp0SE 1 R20S 0 S,   , KP#  fQ( K@@"X P 0 =0P 0 _+ 00TK 0Pk  kP^h0S Zh0S *NK`0 Rt  QP`nj`ik@WEV \idimdLT\fdgd -LM@$h00CS####################0h;$ Ul d p-L M 0@QP,Ԋ P p@ 0@@dX 2 0R @ ^ 0S  R@X0V@   PR@p(C;pPCAU4 -d2LM Ro L2p R 0S 0S <s2 RL  0bQq *q P 1 )&"1\R) ;!Q0yM,@0W0 1R PUh:0S8SP g<:"0S8S /;0@@`\P$`0`j0 R0 R P  0P xP  %Pl%dPX \idi k WEV0`iP`xkkhirdAedAsd  -LM( R,@:( 0e/eT *0 SR: -L M0Ss0S 0% F R|3|!x P( h L, \ H0 P D4 D @8 8 <G<PP@ 0 24S "+r4S  #r4S4SP0ST0S{ @\0 S@ oXں Xp 0@@0   Xp  : oa  0, 0 @@0P`0,  `0 @@0P`0,  ` 0S S! 1,  x 0S S 0 S1 0 38,  0P 00C   0,   ~ pu tpl \pc0  ~0 ly$LT\dlt,r -LM0 pPd(`pVP@R0 -B0JP@SA--D.D.D..D.D.D.,.D.8.D.D.D.D.D.D.P.V0 "8@pT`P0  `P   | H P@ `P?@0 A>P?>p= -L 8: 00 X00,<ThtDPTh -LjML0pD(0  pP ,&P@ 0`P` 0!0|pD {P@\ o_Ke/!P P`D e/\ PP3 DA@fX`Dh00CS0X0ӤX0 PpP A00CS00Ӥ0 PpNUnUg(0 S (vsTgpXck4gT gM!<fL7  k`|  -LM@8PKt'P  0ST R 0S8!8<K05p6 <000 \XTpP`y7p@ P@PK'  epWb0S Sb0@8 52/<* Bb@ @0#4 9b00do ? -LM@b0S@ -LM@@ b000S 00b0S M-L M0hp`P@ \ |0 0  RP 00 0 2@@ -CML 8 MD$ BKL, :L < 8 \ 0'0\8$<P1 \ƳP00\P` :Pp` 00LpP5W4w ,(7Pp G<`T *0S P0hC1 @T:BKH@7H ~044 PSB>K0C 0C0<0  5t`P#W4 ` 0S44<X0D0pMP44 0 44 `W 0SD40D4 47P0W`u 0Sr BKHH0 -04P@St  4D <44 !\0P`T Z00R00SJ4BKJ J GP 4WpP<$ 51P<4 (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x   ` h p x    PBKH0H 044 S;;S<$(  00 a4DD PBKH0H 044 S<,  0 B4D40D4 PBKH 0H044 S<$8  08 #4DD (PBKH0H }044 S<0jPBKH 0Hg044 S<$4TPO0BKH0H  Q04S<0O7< ;PBKH 2H8044 S㰠<$$PBKH1H !044 S㰠<cp PBKH d1H 044 S㰠<$kPBKH1H 044 S㰠<5P;BKH 0H044 S<$P>t $0L,r$\xp,LP`DP> a0BS50S2<$8a AR:R<`0A8̑"<W @$  sB>K0CH4 H@O0`L0p H z04S@$0O0W WLO0`H 0p c04S@$00W@4 p1 ?A`XPTp *0S P0h@C1 0 @T:q10  00S044 04S44S ( 2044 0@$ 0@4 @TM TZW> `H p@0E.KXXG W2 `H0 p@0X44 ` K0C(@Kⴠ0S04@@  \(K0G.KS B0(K@P@`p p4T p 徐\4T,S:\4 X4(@KS:X4 00 S(PK\NK KAe/ < K@+sP 00CS00  ä0+(K00q+KBK@P@ P 0@pS񟗸SH_H_H_H_H_H_H_H_H_H_H_H_H_H_H_H_H_H_H_H_H_H_H_H_H_H_H_H_H_H_H_H_H_H_H_H_H_H_H_H_H_H_H_H_H_H_H_H_H_H_H_H_(VH_H_H_H_\P` 8 0\ u_ȟ8 R@@R@^OKe/KNK KAe/9S     NK @NK@Ke/ P IT    P   q  Ke/OKKe/~NK KAe/yNK@ NKK@e/ P KOKKe/gNK KAe/bNK@OKe/KXNK KAe/S\  5  2 NK @^NK@Ke/ P  P Ke/7OKKe/1NK KAe/,NK@OKe/K#NKAe/ KNK0(@!OKe/KNKA Ke/ Q     NK @NK@Ke/g P )Rb Ke/9S     NK@ HO7 (5(/NK@ Up`NK0A)4 RUIT NK(9@ h4 R> D$PP  R0000ӑ yS0 R000ӑnSU P$$00ӑyP ,0 S ,~N.K BP@ j-NKAe/{NKAe/PqZNK@K (0 S+    0@P00`VpI= 2 0 P(0SNK@> 0 ) 0 SU LP` NK A 0P@04qT]m HHPP0Sc NK@Ke/vPYU  POKNKe/ANKKe/@ Ke/\  Y:L1 R P NK@(9 N.K, B$P ,"NK0Ae/ KKe/NK KAe/NK@J ,t.LRp2A ,rrdAk<DT7tdXI|4 k0Dl@ -LMP0 v . D3D U a LR004 Rp P40" 0S 0@@ 848#P #6( (84 8#R@ 0@0@@@  0 @KSpU 0`0S@"TSp@0K` 0  0S840S00p<04 O0 00 000 4 P @000 4Y P 4 P0 4 a P 4 P 4H P  0S g+PK,PK唠4P  0@ 400Q00S4a0,PK,0KQ4  88PP70$ ~4l8 R-0LP5 aN\00?((\` mq  p`V 0@@   0 SS S S0\0L!T  m <<5P0, 0 m,4Lpl8 -RLM0pE aPLU00?((U` "` Q0@@ % 0@K P  P. P P Pp P < 44P0 04L8 p-RLM0@`5 *\/ aPLU00?((U` ph黵 R0@@  @0@0@V@@ PpADH ph; 44P0$ 0 phx4L08 -QLM4 aLX00o((X` omr , 0@@   00K,@ PP00PK0T0QZ o 881P( 0 o(4Lh8@-0@@0`p P@ `p0 S RUT -a0L0p@TP  Z ߤP iP0 S R @000?S T S 0?S h`+" VX0 ` BR X0  äX0 +C,r M-CMLM4 8@`}K`샟KP, 08$ 0 0mK0L }KKKLPT3E.K(@KBKPHtP H `Y l R8S0(@K 3@T80 0S S@D00(K0?S (K0*S 2(PK RTA ` 0SQ"0000ӑcS &S %S 0@-S+S@L4 0D UBK0A0AmP@U0"S 04 RuP^g0 ENK Lp`+XS L-QL @v00 C  5 PTU2 4K8  0 % 0 `PP8`E"<($K0S@ T@S`P 0@%,"=K`Qp X@,0 S ,yw `Rp`pPdE~Kf0  2Up`00p`?L$0LTY@P@DP( O E>K4d7< @P@d `0`@bS>4@D( bP$ 0060@D0 O <E~K@4 kS gS4$(eP @DmS4(4( Q0a#5P4  4t8pPt h1(K R-K,aU(K0?S X0 ` BR X0  äX0X  * -AML Ml0 0,0 4 P6 4$P0S0 04<4 84 Y$ 88 0@ @P0  0@`p` 0@TS8$41SR p-LM`P@PQ@TpP Q 'P pQ -LIM MJ~KpGpGP @ , 1JnKS`F1A@TP,0 S ,r SP0rSJ /TP@ PrU B>K0C0C4 000 !帺P@0@@ p9 DPP 4S JnKⴀ`F10 "\a0@|$OTʄ1SnBKAA  0zL!7! -ML─, ` Ƞ,8@p@00@ 0,@ @ P\"0PJpp`w vn !0Sh0Sd0S 0S0 0@ P @, P(0SD  0@S 00 0S( 1# P0S0S0S000  @` @`0 0@PU`TS0OP0 0SDw 80<w 0$!HIPI!4@"8 -L$MBp500K0`K`蔀`0@@0P` ` 0 @PSSpp!0Pp`PK uB : 0. 0@   0 S:0S*.0 0 R00*,V00U0PK |0OP0X0\ v 40<v 0$d"PI"4d##8 -1L$M Rᔐ 0S  @P\ 00C W  pǏTJ   B020 K`0 K @`P!0` `Pu 0 uv 0, 00B","0@ LP @@0IPA0 0\LvL 40{@00PKpXI##4#8 -2L,M R, 8  0S 8 @P 00C   dɯTy   B02/0@K400c @x(<@ 嚃(<@0P@P0P@,0!wpP@L tC QPT P( 0 *; $1$  0 QP0< 0@K 4P0 54B"`P,"0@ O @@4OA08 0u \0duT 800 K{XI $$L$4$$8 -ML─ 0S ' @P$!0p` 0P`Pu 0 uv Pv 0頠!Pp `PXP @0P`VUVU4N 0 0 P%P%48pd%l%% Q-Lp`( P% P# P! P !@R BPP @T! 0 /\ 2PP P A4 $0%%D&48RP0S  0 S p p-LtM`KP 0seh @T P u0S8 @plP F4&rdAedAR S-Lpo UP* %DP " 1Z 7<@@0 (`,048PR3O<(`,048P7\ L1mdP uPW 7<@@0 (`,048PZR3O<(`,048P7 ( (0R, ,0R0 00R4 40R8 80R7<@@<0P  `  UV@2 44 4WP0$ H&4l&&&;@'8p-0  R0Z7<@P@`Pp -RLMP` p `+0 p @p@RP@+  0`S  00 0S00Kp0S0S0S00Kp0KpW0S>2 -L M0U@p 55 u  % 5P꼞\T$4@  $xPp 4Q 0SDP PpdH P(D0: S  S  S0 0p{ 00 R000Sg R РР؟Р?;#003 <0S c#?;0P@ ?LD T@ ;00S  ?+83 0S,3@T c ?2"@@ 0S H2 AR;;S" ":00S 0S 2Ql2l"d2T"H2D2qH0S0||D K1Ps1 @ 00 ~uH!0!@ 00 ofH0!@g0*\H0d!@T P!P00p 0Q  AH0!v@0 0T jP+H0 `@0P 0<0  H0(<,|+$H4\m @+++++,$,D, -LMc0Ss0S 3 R S0S3 Rt3 R hCPHyP,K dK0S 3 R| 0 0R  R B 0 S "000 R2 R0S㼂 00CS00  ä0N00`V xx20 0hP! @2`DBHuP(@ 0S 0+0 a000+VP !1aA0 @@AP| @ 0X$1 v@e0A^ PR0: SN8 @TI0K@D0 R㬀 00CS00  ä00 妥( s808 $0(,<L@0HL,lt,h,,$, -?MLMt0t` R   0S P kDp0S?KK@D0P@D?+iP,L,4( p- LMP|Ut`0   p@0T PࠡF >,8(- -\0L RL H0 @R0,0, 0>0>,$-X- 0-QLP) 0S-@0  MiP@ڸ0 T ;;S0@0T@|0 tT>0DF\ 0T x>00  $iP@0 04,(0-- -b0LP@@xr APP PX"000SQ괫LLLUڅ;;SNU8U0011 U00R@@T U 1 Q cP=E!0|!>l1 h=\=,E0S E0S E0ES U0P0 0 R0Q/PUE0 S E0S E0S E0S00PX=00 0004(,8-.0L.-p.. -1LM R*ʔa0S& !00CSYxx0Sp1  0SK0S0 0  0SP=M=[0ȌlȠ@$ K$ @ =P@0 HP U0S \p0 @0T@_0 0@TP 0Q00000 4,./(m$8/ -P@LM0 U 5ࠟP.0 R  0p`W 80 S80S*0S@0QD@ <000P4,($h/ -L M䁟P@P!0S갱\pUT<0000U$ha 0X RQ R 0MQtD!< 1 R eD T:P0U$`0 [0 njlȠ( `0P@( Kd$@ HP;D$0H p<<T4,/(/0/0mD0h0 -?ML M804S?KK (@D, r@Dz r"(K0?[K<(PE0 PE00 PAb0 0PV?KK(@D@D?+fP`G?+fP;@@ HP+X@ QP00d0 P ,0 S ,mhC0 ;;C ;C Cp  C` C ?+fP}4L(m00h0001D1 -LMdNK@D0 @Dp (0 Pw P  0 y,NPi,K-F,9,K'@,@ )P, K>0h 7+P9T +PXPtH $ 5 -bML$M 0,0 @bmK(`FP$`F T T 06 ,0S ,\c0DP0 P!0SZx1 ZQt!0SCb}b]pP0S(P ,!0S,Z -PP0(P@+~P 0S @0Sy 0 002,P\0` Xٜ@0 W-P+PL<5l5PH,t5 -bML$Mx0x@ R  +P P L0 Db=K0C$0CP0 0S bPL9 -%ML,M%K0(J⒍K JE(H,0 (H %ɦb}K(pG P`$pG; S/R P58,0 S 4,b KH%0R/S /00H5 0H5` %,K( B:KBP`:KP fL%$(K0: S 4 o*PsPQ.P|4 R %,PsP00'P@40S(40S- :KL5*KP/QH ^KLP 5*KP:KH5P@0S 30S #a=(K0Q|3|#׸4*P#P* $P$C0S3 R *KPxP0S 2 R{ "a=(K0Q2հ"mڰR0Sa2  Q V dP|20 S SQ$ 0CS+P0Sh 4B0Sd ("00CS00  ä000V ^D*A +%K(JPJuP@ "   {<0P! 5t,11 0Qڍ0S0  (Ka=  -0QBa=l (KX00SX0X <0l 4Ld 555XP85H(@H 5 6 -LM⬡0P,P @1`pD3P P00SP` PUD1 R 4`4P 1@ Y40$P$ 0S U0 R A4P B @0| ,0K8P P/0ST 000 08P<6d6666 -!LM0S|@ a1@11 WpQPpA\PX@T PZ\A1 R 33@0S`P111P 1 110@1SZX0 R H3HX,@\ӯ \h @707 0-@0PQ00L ? Q ?;#ʁ P!~ Q ~<Üʘ0 0P 0x 0t0p0 0P0X3 8<\77H7 -0LM @0R0 0P 0 0 0 P`0 R ? RL?;ʂ;;S 4<38D80 0? ᘋH -02LM R"0S "00A0009P_䡟 A00b@_ß 0 dp#4'YX`pPB`V pWC`QP0 H S0 @ *$!&P-0 0S0A:00cP@0 000  0S @ @0P0 pz2V8@ 0, 000i2DHt88 -q@0LS" 1 R8 P-`PP0S@T ʻP @P0 @-2pd0/X0@P00 $2LH89 00b0ꠋ -Lp` M0 0@K  !夡0 0bO TS0`V p00P1@_0 0 d0 Kp#4'P50 K`Vp Y*ڴ@ 00b`W  W V 0X0Y0XVt`WX꜋ 0-H0H@L 3T,r -LM\q0`SN H!3#c1c0cAT R$0S8 Q0S. T P T $`P 00T 0$`00  ١XPl0(&PC3dAd@d@C000XRP`X,r -LpPP 0S ,0SP!&0aV 0S ᰝP0S$0 0@0S# V ℝP00 0$ 0 T %P(@E`PP0000d=T -LpPP 0S ,0SP %0aV 0S TP0S$0 0@0S# V (P00 0$ 0  %P(@`PP0000hX -LM@(aMP@ 0S ; -1LM 0 bM@ ^0 - ! ^  ^ a0 :#:900 P \0  ^  ^ ^  ^    0-LbM(MPbMK@D$@D0p 0 d0 KX0P  0 劜@0 0 0S ZX0L\; ; 0A0- SPL@ 0]0S8  R0S+ 0+;; -a- `L0Q!0p@[ P20P d 0p QL f+4 $]+ PP ;<,<0 KS- L0P 0T< -PL@LPgb=0  G|1  @d1  9Lq0 241  +1$  $1*  00   0A0a-  mam` ;P0@09P0: S `0  ,h 0S HP (,$0H8 W! -LTMr0 $0 @"P2b- 0LS`P2`  0L`pPKS񟗞a=0A 0bPP2 HD 0 P,2 0 P 2  y*$0 S $W1  0 P1 0 P1 0 P1 0 Pp1$ 0 P$1* 0 Pa=0 0 P; 0 PLPP00S S S S  Pd0 *@0l A 0Z Pv AL0\<q<< (,$<<0 mS- L'0P 0=0 mS- L0P 0=0 yt -2LM pR@ nPb0   2  l"0 T2  <2.  $262a-  am` & 1>  P F $04 4!N0 P V $04 4`!f0 s L1^  l P@:0@0P3n000cBP) 0: S `@0 0S@P0 ` `,o 0S P `@0 0S@ Pn#Rt (,H8$0 |0  t -H$L|M0 ,0 X P $00CS 4   4圐K R 0  1 P3=6K 0) P7#00CS000a=0p`P@00S@b-P ``06  P03 ($3 0 P3 0 P 2 (2 ,0S ,2U2 0 P2 0 Pa=. 0 P`2& 0 PDR>0 0 PF 88# 0 PQN0 0 PV 88# 0 P^ 0 Pp nP/P*Pn000cP@P00S S S S  P<00cPy0  (sq0b= 0P@60 0N PL [b=0P@06\  0> P L0tq= @=p=(,$|==qQ-H0 4S Q 0 S  q -LMPpPb@03 R 0#400"400"40 0"40  0"40  0"400"40 a͠$ 0 `48 0`  !H8 0Da=$"$2T:0D0P300cPP*!0: S `@0 0S@P1 ` `,o!00 P `@0 0S@ %P0 400 400 40 0 40  0 40  0 400 40 a͠$ 0 `48 0`  !H8 0yꤋ (,$08H P& -%L0M0 (0 H .P4H@ AR4  0AS< 0    < < HPa`%<%8.K-0K.[- [%<$,0KP0K+K(,0[+[pPPČ%H8 0P`KPH0`P@P`b- 0^ H3 z&S(0 S (S0LS#H@4B0KAKB [A0[4Pq 80D KC0K 83H@@ 4#H0 4@0K?K@ [?0[4P#H@ 4>0K=K> [=0[4P" 4<0K;K< [;0[4P" 4:0K9K: [90[4P" 480K7K8 [70[4P8"@460K5K6 [50[4Pa=@,@8@4 K30K2K1K4[3 [2[10[ $4(PpPE400K/PK0 [/0[4UDKP2P-000cP@P#D1H`0S S S S\H  ePH<00cPLH0 %EC0HP H 0 @@,@8. K-0K,K+K, [.[-[+0[ 4H0P@b- P0@/HP b=0+ K. K- K, K#L0==> (,$0>X> -0` LK$KP P0`P| PU-d 0QpL0L {P0, |% (,|> 0-QLM@P&0 R00P0 R0S 0;0 R0 R0 R a= 0P0-\ 00h8%40 |000 0 x 8>(, p-LKtM @`KPP   \L0  Fp$p,0 00$>>- 0P ) -LpM`@KPP X0PpWH0P 0R ,0 ^$P,? -LtMpPK@P1 R* 0R5 0: S, :1P P d, 0Q` P X 0x @$XG,0L |$P 0R A$,8?X?l? -MLP4M H4p , t * $00C S$@H\p3P3 RIKII 4S+P) +#0@P \ `3 RT3T P00#$3 ,0S ,P3P 2 Ro 2 BQ R0P0 R0Sx"0;0 RQQ B0S|2 R p2a  02L儔P yP0SBB0S1 R  <IKAAP!0S$\1  $d+4t!#11  ~BnKP`F`FU!B4: S>tp@ Pp6+ 0i#00 @,  f%x (#B YX Lhp(,??x8l??0?0@ p-LtM`KP(P 0@T0: S /Pp*L 0#pPVp* p,X@l@ -LtM0@/SP @//㊓`@pKT/ `0Se0S ĵx0\0S0S! Gx x -@LpMS` Pp0S 0 R KP0Sl00d0 Rd00HP[*00 "T* 0"|@@ -LtMp@W0 P`0S 0 R KVP0Sp00d0 Rh00HP *00 U"* 0N"@@ -LM@0Sl`0P )0S )04 -"$0 RPd@ -LM@ 0Sl`0P )0S )04 "$0 RPd@ -LM@p0Sl`0嗒P )0S )04 !$0 RPd@ -LM!@P) 0h!@ -*0LM"*@7=Pm) 0h!@ -LMRp, `1 0S00000SPP0e0 peR  V@*0S@T*0S T00- x@ x@@T TP`W,0c$) 0 Y!pWP  0p\!x/0Q`( 0 눌A4ADATA p-RLM`0 Pp@0T<  P( 0ph!( AA 0-0@SLPh 4 0R0a 0h2$8 -ML4M!0QP,0 pG`1 KK`(@D@D V k#  KP p R0 RPa- 0S0S 0  0 ,0S ,&MK(A4A P a=(K0Q p0| 03QX0PV(4 0@  N( 0$ L`AAAA+ -0 0R00000L R0000 R0@00x0 Rlh0P PP0 R P$ p|l $B p-PLM@` 0S pPP @P0/S00H 0 S8 @`0 0 PPPPp 0BLBd0 R00T0T QH0  \80 R,0 P0L4 0-0P LRl0@T 0S @T00SU0 ((P$tB4 -QLP=aq R1 0S  0S0! @0S00 0 : P 0P 0PP' 0` G'P }P 00 TB4 -L#L M0PS44s P 30C S8P('P((P(' (P(P(8(8(P(P(2 R 0, K@00KtP0,0 0y0  0l")0X"# 0@"bMb=0@`l `0 @p q1؁ * RY 7 R$00  +P0 `ç 0!劏 P;0\1 x1& 0\!  R8a- 00 R0 !0 R  R00 R0 00S  0a @0@00m&0SPAd&h 00P2괋$BBBC  $C8@C -P1LMP`U; pP@5*(P00CS00Ӥ0(p  T:0P0D@00CS00Ӥ0 P p   T pPH rtP  ǎP@P0  P <LClC -2LtMxŸ@0pŸT S, Pp$T l0 CR 00F2 ,0S ,rJ0R Y @K_1 R@(08&B`P0 \*L-S0!^ *\ ^ *\^0305 -$$q0LS`P P: 0-S00 00 0S&0@T0  x:TP 0 0:S l R1 0 LP0#?0C0 h鸋d4DD p-LM0@P/w)|P00l0Y0SP`ph8<N0Sph00phꀌhld -LTMptp % Zp 00@JS񟗈8 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9,8 988 9909 9 9 9<9 9 9H9P9 9 9 9`9x9 9 9999 9 9 9 9 9 98999 9: 9 9: 9 :,: 98:D:\: 9@;H;`;l;x;;; 94<p(4qDTR0S`0@0w,0S 3wC屋Pv  4 uen4Po\j43d Pvd43u,3u$33t 2 Pt2 Ps2s2r2rBp2P: 2p2pH2p 2|2 pt2@p}l2pzd2|w2|P1@ 0S `Pa0CS":;;;:;;;;;;;;;0;8;1` 0S{1P1P1P1P1 97t1p1{1lPzqT1z-L1y*D1y'xP0a,AH0pK @p <1P@x   0wP@ P⃀UH@ 0h5 0'XD<dDD8%D|p܋l(D04X,@LxE$POE4E4$tDn9DLdPE 0 BXL0@0t0 X X0 t0SI0S| |0 0S====L> 0S@0tP0 0S0 0S @0nP 0$!0S0<1 pP1 RH!d1 pdb$^ Q ! R 1R B Q QA1A0t0 001A0t0 01A0t0 02B0t0 0 - 0PᄨLM@, 0 4 8 0\(Bp 00@JS AABB A(AB0A8ABBBBBBBBBt?@ABBBBdApABBABBAABBBBBBBABBBBBBBBB@BBB(BBABBBBdBBlBxBBBBBBBBBBB w g+P040 6066666&0&00640Y8 P6 l6   s4 8P8 @E46 0 b5^6&6 X0T6  0-S 0 , 0S,  5000 >5%95@5P2d0h ,X0(d%000$T5045@%, 85R Q@b% % 5 00CSTY 0ShChCxExEYpP. Ym 80I`0< 80 VL PD;P< PpXP(L4 RYPW 3 , RC0S 0S uP 0S\30 ၳ1pP@ 婈P P 2 P 2Pp(咈P `P 2`0P<0 20H CQ0"Q0~ `2PtYPN Ya 8 I`0 @0 8 V; @Q rP1<^P0B LP dP}NP1 RY0  ^ioP@ OY*PP 1 K/PP 000B"PP `P`P@  P*/P|$z `0S xEdDEEEEEE|EplsLxLXDFF 4FXF\FD`F4 -LpM`@pK@ 00RPPAP0: SU/00 0D 00S]P  `O  -4L$LM4$䄟P4 $4p $p 60@DSp KKKKKKKKKKK0KX!tp@0S GP@0S =P@0S 3P@0S )P@P P 0K   0K  w 0K  k 0K  _PP\ i$P -x0LM @R`0 R P0 RP PaP p-PLM@3 R0 (a0S= 0#S4 \S. PP$ T0"C12d1@cP 0S P?P P0! 0px  ` 0#S@ HP,嚵P  />3DPhP=PX0X P#3!"c1 0c!R 0S R(/>3 p-PLM@3 R0 (a0S= 0#S4 \S. PP$ 0"C12d1@cP 0S PȾP P0! 0px  ` 0#S@ P,#P  />3PP=QX0X P#3!"c1 0c!R 0S R,/>3 -PpL`@ 0Sd /PPp0 S 00C S0u 0SYP@j U 0SE00 o0S1W 0S !0 0P!10@ @@P000 RH 0 ], ~ Vy P 00000 0S MS CS000 0S 0T cS mS00dv,QW0p0@ .QT@}  (: C111v>C 0C0 !0!>CP00 1 !.BR00 R0S P&0B00 1 !.BR00R0S P0 1 !.BR P 0 1 !.B;R Cp010!.CDR Pk?C@.PT @} 0-LPL@DT  0b0S0 >  `R -LM⬁PPe 1 R 1 R|1|!11a11acAT pP0 S @T0 0RT 00e0hb0$qv -dpL0S ` AT@0`V01P@PCAU p-LMP@T0 pp0Sx`t 0 h0hܿ%~X0P0000 e 05 G`RhRR -ML0M (R04 ,0  2 ,0S ,64! L!8 0AT ~KpGR0pG8 @T㛻P@, Q0 弿0Q  P D! T4a=  8,1008 A  荿0`PS 0S040S  ^PT 4a=0 S0ń8  $ L SGS8SXS|SS 0-LPL@DT  0韱0S0 { S -8L@T`j !0pAT ?zPP! @T P@ |eP weP 0! 0Ah; T  zP   YeP & S T4T -@L0`SpP` N0AT yP @T yP:0G0 0-LPL@DT  00S0  =PT -0LP -p`LP% 0Ƃ"S12e1PcAT 0S @T 0ST Q NP@ 0`0 10 A/>3T -1L M@\, `p? ̡1 0, @R@\`0 PPI P 0S: Pda00S0@P! 00S00S P 00 0 0   FC0, PhPP 0p p00  ` WPP 0X0@ P 00  TT 0-LPL@DT  0!0S0  =U p-LML`0S P0AT  0V@TPOUp -LM䀟pPP, / 0"c12f1`cAT 0S @T]P@ cP pP ,000! 0Aჹ(o0ST />3LU 0-LPP 0A"#12b1 cAT 0S @T00 ST 00 00KI0/>3 0-XP@ @LT0 000 w0S00S0ċU -MLM,Q,0S, p`* 1 R 0/S BKAAP % `Ѐ@0Q P@OcBP 00(00 徠 000 ,0S `,3T IP 0 LUċUU -`L0S$ PPUJp0"S@0S > 0RH Q A婸PUZ奸000 p-@Q0@LM@C!1`@P  KP*0P0:0 R@U K0P0,*0P0:0@p w -P 0S\ \P00S0 BSꨊĊT00L\:0000L \*P\:000L\*00L  L 0 00L 0@- 0P@CRt 00L\ :1!P@00L \*0\:000L\*00L  L 0 00L P-  *0 R: R$0 R:  Q0-LP0 S\  8[0S @T0   0PD܋ -LMP@ vPpvP \ 00CSP0 @ ($ 0 VV؋ VHVxV -LMP, P, 4#, Y,(3(cpp0K0CS d, B, l0  , ,2  t , ,2|   a,  ,l2a-d2bb0  00 02R(0 ` >0R 2 "00<(@ /R }   @<0S@P `1`) (@0/S  00C0Xl1 @1) @1  5R K0BS` 0@Q KP0  @P00 9p 0 0 :0 d@0, @m, 0PT , @b, B$ (,H8   -3LCM |3 B, RT4@dLXdd83 R  3 ,0S ,F1BP0SPdU <"KL d2K0b S Sy 0CSV+2 Kd1KK 0P>KdP2 0P >Kl,20 P  2 X>Kt10 Pa=.K0 PK&K 0P|KP P@!0S Sa]P K@ 0K@P `p@< 0S@P``0  _+0 Kd2.K@/K N@KPt0h0x\0pP0hBS$  #0 $ 0<2S (@'(PKdA (KPYoK P0 `A \A XA TA PA LA HA DA @A LPdC000 (3>K 8PVXCX_K#^?K@|A oPHx!1RS@$0P0;CS040@4Q0S|  `sdĠlA 廠!r 10C1 =At0\ T0 02iP@bT00< KcK0 ! 典`VKe/K:1  < K eK R x0S:t A ) 0S k5  1 刡 @ 00Ì bK 0Pʱΰ 0<~D$&r464\&=K@vPpOd&Y?KP0C PhP Y?KP0C PZPwjF]?K E0(PK0@00  O? K ^ 300 0p1  000+]?K W ]?K 7 ]?K  ~P@ 00 yOOK,l@@H 0-LP:㮟0^  x0\*P0\@ PL0@ D@P@4㏟ Ѝl(4 -LM@@ -MLMXXb0PpH,0 pp03*0* 201 0 2 1  Q P1@ԡ`0 810 @@0P0?P P$JKx!(@D@D0h!`P p= [0P ,0 Q  ,' Hi`8#8P#$0$ @JK(@D @DDK<:(<2: !<(K0<:(<2:(LL!<  0呰L̍d`\\]̍ -L4MD 0K` D 0P@K0 Z L7  ,  ,GD h0S '0S0 0R0; 6"   R000 0p 6F 0 B0p0 \Ɵ0 ` DX@0S #S $ 0 0c@BHX@000CS00  ä0ؙ S7 S@PHUp|0 ă ā Ă< 4 <( "4\,<PEU, pH'W 00CS00  ä0PHpWp!pW T0W6 'W00,P|0 ă ā Ă< 4 <( "4\,<pW0 PH 'U00CS00  ä0Iv p{D 0T ߰Phß0_0p@gU0#DHL'$H 0 \LDPH0S.W)4S4#0pW@ *0 @S0pW:+0pW@ *0Sp 0W:P@K0/ΖPKP@0/40 \ 8K 48 < ( 4" <( "4, ! 0,< `Rc@0 , =9 A0 0 0 =,0 2a, 3c#0OPK< LH0`KqPK@ P K`KPKH 0@PK\,!L@0SPK! !H0Sh0L@Sd*PK`T0 A 0010Z1P7   pd]̍lh8]L]T]`]t]x]]]]]]]]^<D,4^MQڲ0AQQ00  8#8LȃLȌ 00Ѝ -ML$4Mx4Q (K @, \ 0 CR 004K(IITK(JJT$0 t_m * K_0# Vm* B_#0S`V* XӉVP@͉X0 Վ - P@ΈV0 8#0 $m *_ * _Q 2 R H  f,0 S ,$2@2@P0 ၕŸp`0 z6@PK0L X0/0j)K@ B0/ϖ0/P@@Z0/P@@忖0/J0/P@ @寖K0LP@0/@9)K0 BP@0/@坖KP@P!<0 @l *^ #i W P@M  lf  l *s^3K (JJ0 yl *e^ 0RK(II l*X^Y@AL(^lD^h\^,<D,4p^^^`^ _ -L0 K M00, 000K 0 ὔ p/? 0@ @ _` Q @0 RQ   -LM@+T (0Pt0P#l -LM@Qs (T\`hQ $LT\dlt|h0S #!Q pW*`XOPLHDhD84L0#$(,"(h70S S0Swusqo0("#__8_\_|_____` `0`@`h`````a,a0 Q00\0S@`.Q,*\ L0S `00S  0 Q0/S0S:0 R P /P R鈔d  -MLMp0P@AnK 0 `FO`F 0 0U0 U00S0 U. 0S l  @G0S D 08: S0  Lfdf f(f -L@!x1hFSP/ 0Q0 0 : SFH` d0S T0S 10g1hhP  BPP 0hܛP(f,fTK0C4 01PßPoAJD  \ $  0 B00S00Y X 6#1@% "X`P$R`1 ,0S X, 0@82P @" Q 70$ :  0dPPd 0hƑ(0CC1/|x0Pw00S  n Q<;P9Lhhhh؛ -MLM0tC\d#, 4 <(  P@\434 #A6T8 4 ` #140\F" $p`B6# AV#1%Y X @0 0  p2Re L 8(LH0PS@*KAAD R& 48 S <8(000 @XT:8H000,0 S , 4 0 |00S00YX   D0TPDHGPH @7 Q L 1HH@8H0006#!P*8H0L Q@T *BKAA@ 0 S@@T:08/|0a @P0088  <  +Lihhh؛ iP -0LM PU@p$`H` #T*U0 R D 0喃" l=`▂#0U<0 R 0- 0喃" ԛ@@iTipii -0P0 P00LMS0 P܀ R0 P.:p$60PP5`@2:(P`@,F0B֟$|P0 R0`@00-$Fԟ00$ᾟ@0 pdi -!LM0\00 \pG\(:`(P``ᢟ,F0B$嚟0 ƚ \ሟPt0t0l h d@d0 A0(0000di\ - 6 8`0(@ 0L 0SĠP`Q묀pp;P3@00 00`PS P@0Ss0SUP,D눔i -LM@P00s -LM@&B ?‹ Pa("PUp* 0А0 T00P00@ 000p@0 (($`d0 dS D 0 Q00唝P 눔X`TLj -P0LM@ᥞ<0 P 0S P 뼛T0j p-LM``0S TPT 01@CT*000p0T*T`X 0  ᨛ -LM`P@aUpᰀ 0SP 0S 00C0$d p\0 iDh80  \0   >T?Hj\Pj(f 0-(0@ LRP 0 ,B, 00 0-(0P@LT ,~[P  T00T0S 0 T @0d 0-LM@ 0T0 T00S0 T0P7@H᡿0S|tp0 Rd T0K0 /  8 (\jddjljpjT|jj,Y -0LM@ 0h o\ 00CS p 00 00  jj -PLM@ @1 Q (P0P*0ES;PU:0U z W/ , Ẁ0 0V`P( 00@$K?L$ @0 0 /&`$ 000H0G  W00 Rd\ 0- L8M00 H0 <0 80 40 00 ,0 (0 $0 0 0 D PK@ HK@4 /$0$  00C00%\ -LM@Pr0 `0"pM b0@SBDDDDDDDD(D<DDDDDDDDL1 b 0`ip1 h \!000`01@ m0U>0(!S 10`00!0`00 0@TQ P 0 R T@DG  0;T@DlzX T0 R w봛`XjdLj@ TjTHSdSk p-L@M P`KB0S 0S  j p(k -LM`t`ğ QS, @ DdI 0S 0Sm p P0S 3 ,0S ,Rs 0ṢģL0S/ P1먓0S 0S'0\CS 0S 70S 0S @C 1 R,9 Qh;Pe@0 ! PPZ @@TP|6#1@DT PM\1 R 0  | P+ h1 !0/o (K0 N@0 ,?0S 0St P 00S(< WP0S X] P D ٚ<I tt̛@mHjmT\n0n`P@n\nhnnnnnn,r -LM@P4Ppc`VWW1 0S>000 0. $0`F0V$0@X L0 S00*ㅖP (@ R00  0R 0S R0R0S P 0 R IP` gX0 S00Dŏ<</țHlro\noT0oK0C4  L44 _$0ß 3 R( K#d `$ *B>KMK0CL0C L4 p0 R X:p# X*pCp\  X:_$3 ,0S <,; 0S 0 S s S # P"   00C0 " P  000 00C0  TR0S-@<2VȖ@Z P  2(K_KK@$ (@ʘ0\4  X$ sM!Q& B0O0  0lz 6`X!0SV Eo0 C5@"%$1 R0 P P. Pd P D0:90|fLooX`"@oopp pD4pT`fTf,rTotof\noo -MLM$p\0,0 (`; R 0S  L0 S8(K 4  `0 A?(K  A?(K D KKLS0((K0Q 0@^^>KMK  P$ $\ 0S  R0.S $0'$00Q0Q0 Q00SpG h'dY X (,0 S <,00 00CS񟗳`x$0S&&L0S6 `03  00C SK 0S 00C S'800&c P%00C00000000      0S $\NK @D@D0, S^K PE0 0%z5 R 7$\00 PO$0SL0 R$ 4 RO$\ P; 0: S0   4$009$\R  0.S  00q PS L0S|3(K4!  `0A?( K A?(K KK R$\0 0 Q0hNK0ᴀ$00$03  0`0C0 ߗ@@Q @T; Q 0S+ 0 SP $00$0P "00C0"t>KMK ᎖ PH"dD000.S "X 6P00L Rm `0j 0Sg <\@P^>KMK @dS$00$0@1  0`0C0 j崀=@t?PQP( j50.SR 00Ph L0S# `0 0S 0<0P$0  L`pdpdlp|ppppppTppp qqo0q\qqqqr$r10@k3PL ax3PTChG VT3P= NP03$- 6SR ,@!0@T00 "2 ,B00&0"S P x2lPP\He,(PPP@+lT J/ Iqw1  LPP?, q&R0S&#0!S$< pvׁPL+FA ,#>A  뚙?ALdP|t\n\T`tЛܛhhtěDLtttu4uXu|uuuu@dԛuvț4vXv|vLX`Tvv%vw,wPwxwwwwww,r -L M, Zß ?w3弃 ;mP c+ 式#x3R,p / pW,P  0bW@ቍ0EOa.6 0@Ɔ& 6F@Vw3 ( &$6pr 0(& 0Dv00 qB 0+00 0S02PU D2 00  0 0 00 ,0,0 00000 330330 33033 @0L@0 D0PD00 550550 55d00d0d0d 0 d  ` d0 1 R,d0\ +sP 0 R,w6P@kU*0 Q@tPU:aA ,0 Lě\hSwwhd@wxPxxx@-@0 0   0 0 0$  (@$, (@0@, 0000 D@0HD LH0L 330## 330## 330%% 舔 -PLM@ 00 R$hlgTx,Y -LMp@I`@vm Pa0@S p1P  0PUZ c qh10  00S 2WnC` `F R R010!,!mc.X 0P3 00C .  p_%[EUPv0GOa.U&`n  0 6 & `@0PV6@ p$*P|xy -0LM@H HK{P0T 9> 븒edAHy\y-L0(&S  d0 P0S\P P1 Pa S\Q 60Qꈔ -L: S  S  S H0 R4 S S  S S@y -1LM `ReHP@@ T|1 RRp1 RNd0ST D1 R <O0QXp(H.w00CS0X0@ӤX0,FT& T 00CS00 R0 0  yTYT nTNT ԴYT00yTP |s P00XGts@4 (FT\n`PXyyyy -0 @LM̀@@0 ` @@``PUPTp p @P00TQ  p0WD0@@W z 0-PL@T 0&"0S @T@T# 0 @TT  d 000X 0000 0 @P@0눛  z p-l0LM@Ɠ0\S` @088 000 0 `Pp鈔P \ p-LM0@S` PU 0 I0U P 0 PPt0T p 6 Ul`P6@ S6& "," Z 6T ě,rxyyhP 0-L0P LR @  (C$P 0鰳 T8z\nLz -LM8pP(2G 2 R b  ? @_sTo 1 RP a@T T rPUp@ U QW!0Z00 lQ3L1 R% PZD1 R 1尜o魜 1 !@Pᘉ0 @C@0P P  ?8s@0@ 0P PPUgHlP\hděT`z@ |zzzhz -L$M0 !0P@`_ᖄ@K &" $"40 D @K0, vQd4 ,4 P[ 0@0K,0eQM@4 8@ NH4P8pT54 ,h R0,# @K@_@K0 A 0`Q 00Vs# @0P 88 x 4@0pW 㒲8@ۈ0@80 0ězzD {,{4{ -PLM, 00 ]@_l!@K0/a,@@K,< QG 0 50PP< ,@`K 0يQ.0pZ oA @ 0R  @@K0 `@0PK_tp ᶊ t,\o0 Z<,S00 ,Kě<{D{,{4{Лp@-l@00CP XPX`  Q2 00CPp02 0  pԛțH -L8M 0@K0 ,0  -RSL4M@ Ppl h\\1  BRH OET 0, P \0 , K X T L H D @ < 8 4 0 `HH\KP@ 0 P0 X T0 PP 0p  0U0?00f fM`` /00f V:TPU L0L X0 0 TP  U \K`O4Ўh -L [y 0-LMMpPANK@D0@D` 0 H /80 w 0S 0Lp{{ -LM0@φww@ -LM0@S |TTTT00S lh0 R \P0008d<W T{{{ -L`P^똡嘁q@!ṿpb@1 PUUUUUUUUUUUUUUUUUVVV V@@1@@@0  :00(@0 0QQ0 R|0 R 0 R|0 RP0 R XoP LH0M,r(,{$4{0T -0`P0@LpP DPxP00U0`00n0S8{+PP$_ 0 lb    -sL` P00CS00@Ӥ0tE U T T 3 R^ T0M CR `o000- CR 8^00@t$3 0 0 0S= 0^ CR /000T C@?R 00p P0@0@|2|t"0`000R P, 0Rp0 CR 0@0R P0RЯp0Rɯp1 R 0^ CR X000I CR 0000R0Rp1 R 0$ CR 000Rp0 R T 0 R2 0T0Q0S* Dl 80@" eX`n@0存  $0,(|T -0p`0P@LP BP@ 000T0S yP@ "0 lb   -LpM` 0Rp䠟%  p@ PP  ϮPP p @THPl0ld0 KᲛPL, P 32P$T   -PL M@, 0 YP@0 -SX0`SpM 0A0C,S?<__p__________`____________________4______P______X_0,0  `  L4H4 0`00  p0SV PEU@ AP PEU@ȃc0S APPE@ $0S33 |3 00S UD30 0 O*Y U Z U < ,  AU "0p0t0 ڴAPPUU|AP\PUSPb0S }AP 0S0S20S p ` 0pGS # W R0S) 4Q P  PE@1QP Q d?PE@< 000PEU@ 00S1Q& 00S  A0 5sP (01S00S00S @ @|0 sPp㸖48D |L!|dtWx$( 0-TPL0@S s<0  0P@0000$ p-1LM0`@PPq rPUP  rPPp rPx0l rP`P0X00 DrP< 000p$Di zi 0i tЇ~i Ġ -L,MD0P`K@p,0 ($ : E@ urp h0S d0S `0S%@PwP<   Xrp<@TU  @00PEU00Sp<,0 S,L$i$ p-L,M`0P@@K0 +$  ?`0` r0sHD ,8 L 0S pL$i$ $ -L8M0@(0 LKPp`$ ᪅ ?U0 @ PK+P @Rp0h-S`@d?P8@ 9D0D qp0d (0S (eL8T$i$`p -PLp M`0  *P`  P 0 Sr200000S0p,KT)P p*,PU V" X 0 Sr4200000S W?P n #Ph0 r1000P^ 00S .  AR #     tAR #݃ d? ? 00S UP2  p,Z  ?P% 0 00RSY 0@T 0R @0S 0 0S$0S 0p0SPUx,)*VW<<( z4m逈|8 4 -L0 ,>(0( pps 8|$zi  -4L ,>(0( pp] 8|$yi  p-L M$@K DQi8 pp$ $uP`  $0 0 ` pp/ 0$ PS 0@UU0  CR 0 R00˪h 0PU@H00CS00  ä0 9p$xi ̈  -P0LMH@D0  \ (0$0   (x -0L0   -0L0   -<0<L00, p0Sh\$|i , -80L4000 0p0ShF$|,ri , -L, 0000 0,x -0LM0@S/ h00S00S P00  a,0T, @00 0 0 0( xO< -$$ 0L00    -L(Mp0@PK` @ 0 h o0S X=3[x DT 0 T K}oP@ 0S, L$|i 80i t Qd0d0A00d0L|ꄆ -L M Kp0,` ($P@\  0.t0p00dS X=0SHD p@h =$ P0t@l0@B L| p-0LM0`0S P P!K&P@T 00S <P 0S 00S` @TV8㽌0(p l8 -PLM`@Kp| `$<1 @`'@0 DP 00 ,(0n0S|8i $ -PLM`@Kp| `$^<1 @`'@0 DP 00 ,a(0|n0S|8i ,$8 p-L,M`0@PK@$ 0 ! ,<0S V P0r00000Sp  ,K<PX P%H0@np8ݑ 0S(pL8Di$t$ p-L,M`0@PK@$ 0 ܁ ;0S  P0r00000Sp  ,K;PX PH0mp8 0S(pL8i$$ -LM@0Pp`P  R0@r1000xSY@Qg W ;PY r10000D0S  rt10000D0SX0UYDD"Y 0- qP100000S00B R00000ӑW0C q000000S00B R00000ӑW0C0@00W0\R00S ';P@00 `hV f`(@\ p-QLM@P` 00S R00000ӑxS T0S r000000S r000@000STT T00P0SPP  ph8@T$@Tpp`x0d 0-L0MPQ! @0K  <K㪀0@0  ; K@ P \@@0[X <0K:H0H <0K0lP0 0S u0L|8$i | 0-L MP0Q 0 @!K  Ł0Sp / KC0@KL s:@0@ lp0 0S A0L8$i -LM䁟0\pK@8 P`K$0 ?@ ;0tL0 H0 0L0 Q P L0H K2lpK1p`K01@Tژ2 jp.QtPP@1@SPTUpPl rp200000S 0:SP P8l PPU t@T0, CR 0 R00ꛤp0K1S-U@ Tڴ1S0Sp\X1PT![ L0D jP 1S  0 CR 0R00^l0I00CS00  ä0 \N00S),0 S,L|$8i i8iiiiȌi|ԌCB܌ȋ,r$i 04D ->MLDM1圑0 ,   >KK(@DD@D dl}` w7P iP` 0S;,68>{KL@K(pG $pG>[Q} M} 8P 4p V7 iP@ <0S <0TP( 0 0CS00ä0£<0@T|PZP ,0S<,0L$8i Xi|p -x0L`! @ T @ 0 CR 0R00ꆣx0 }}tSpRW` LDLYWTP@YPQWtY$Ybd0S B0S 0B 0 CR 0R00?505P &d 0 CR 0R00(x07< h 鬍̍؍CB 0-0L0MP0@@K( 0 e| p6|0| hP0SX80 P0 H00<$ o 0S(/0L8$6i(ܞԎ 0-t0tP0Lh@h  \0\00 0046@08 ahP$0|ܞ8H$5i  p-LM@`00X`PD 8@P$NP^Ppܞ L -Lqd0d0`pT0@#nPp@@Np0  0ܞ| -LM@KD004 (م 00ܞH -LM@-D004 (㻅 00@ܞ -L M0p$0  @pp`0h\㖅$KP`@ $0@@S ܞl40S 0S0S -L0S 00  S\0SD 0-@PL0 Np0 C0D 0-@PL0 9p0 .0< -Lpq PP`@l܊d0p0`@0 @8 m@T( u逈X@ p-LM0@S`P 00  SXPp@0Sp -QLMPp W@}cX0$t o A0S 0 0 SP @0S@0S$ 00 S0P QWl`||Xt? H; H00p@0S% 4i.t|,r@$ -LBM MLCNK@DP0 @D/㋏KKoK,0 PP>z I41 xfPp2(K 0Sc 0( K @<PP@rP,+4(0K 0(K 0QpRKH K <P@PrPP,4 0D ,0S4,L8$Ki,r(Е -LM0@(0 4$4Q4QT00CS00  ä0 aT 0S 0SSzXp@K Ddy 30K( `0 eP`0SmP@KX( y 3 eP0PKjPp 3 ,p ePxYpB @4 @0R0 0  CR 0R000( CR 0R00 40) CR 0R00֟`R00CS00  ä0 8ʟ80< LH20@S& 4Ÿ0S @0 0R 2!0S 2^ 80 00 0S1@1S^0\0CS00  ä0 8p10S P00@T`10S V8` 0  U00@T PUsX0@T  @0S 0 0$0S^ (0S(L,Y80ttĠ$i 6i(ЖX^,r |H -LMX0Tr$0 0S0+S (X$B$ ~24PK v5 Dq2 DdP 1` 01S OxA0 x! dP z01S D:x\4 0B2u< 14 8#"0! 40K@  DZdP M01S x| 2P u00CS00  ä0 d $0ST$L$D8|%i 0"i ,<D#i Tdt -(0L00S 0  0S 00S "48<#80  -DLM08@,0 0S0+S 冇`p㓏Kpp <_pP,1Z30: SOK.w 1O_K0d cP01SD@ fw,3 (K @OOK < pP,^1SOK.Gw R1OK0 {cPn01S hMKP.%w 01O_K0  XcPpJ01S <1<1<1<1<1Y 10SB .v4 00L cP01S) (b&81S<1S o"@8P PdP Pd~{ ,0 ,0S,L$D,r08"i %i Ii ̗Qi ,D< PXd -LMPP1@q`P4K $ pvV00V@/P 0 K0p@ 8PK 0`4P #.00`_P:P@ 0 utP  <Ki<004 R $0S$L,ptd p-L MK,` 0 AP0S |.V0000 P00P0S 00p0P@0P0P0 `20p, p-LMR@!X` 0S   TZ p@0< CR 0R00_0S7 0CU3* V ,0 CR 0R00G` \0 CR 0 R \ 001 \0 S0 S0SD>0 CR 0R00pphp餘 Q-L@ x`B @0S> 0CW31 V ,0 CR 0R00 ` R"R000ӑ0 CR 0P R  U 00ћ R0 S0 S0S -LMMp0UK,0 d1`@ Qu0VP1 L //P MK!/AP //00>0@` V?K=P ic 0X1 R  s0S 00S Q0S !"4 40X ,0S$,L<<Ⱦd -LMK,p0 Q`. 0@S ~W0000T00TQP  t tT@D0T0T0 d20<@-^@ 0S\\  P2  RR P2 R\ 0S\ -LM@  $4 -L(MHq0D@K$ 4a 0 6t, A. q`pd0S5 `0S1 4P%eP0   Y`p0@`TU0.PPE V|` p@00U00SV v0o 0S, L$8i$ ,<$  - @LM0 14 0-L u@TlPll 0h鉘- 00qX404 _0S 0h?0|H8$i hDD-D0D-0@-@@@((0P\ P, ,0PRP0@00@-@@@((0P\P, ,0PRP00@0@-@@@ 0P\ P$ $0PRP0@00@-@@@ 0P\P$ $0PRP00@0@-@@@000P\ P4 40PRP0@00@-@@@000P\P4 40PRP00@|@-@@< <0@R8 80R < <0@R8 80R@`@-@@< <0@R8 80R < <0@R8 80R@H -LM`p[ P8 ,&00pEP6 P@ &< p< 10@GS񟗶$HP\dlt| 8Thpx4$P@@4@@4P$p4@$P@@@l4\4X4T4 H4H$P@<4$$440$0 s 4 #4@@#3@@330샟80 ;0e#00#3@t#P@@t#t3PT#@@3@#PP3|3x3t#PEl3(#00?$3#< s<82"P2@@@"0#s"000qS`a%2 R2 R 2 R2 Rh"0S0S\2 R42 R0S\2 R 80S0Y 0/;40$"0S9 !0S3 %S" !0S! 1 R!0S!t1 R!!1V   z11 S41 R!1 Rx!x!t! 0S SX!S0 R@!0 R0!0!,!4K< q< >pP L0H 0000 K]P"[R0 ,0xؠ(,ܠ4$ \ppLpȠ4 ̠lİԲPph(ht@ -1L1\0@p *P`h Jp1 R\0SPPK 30CS4D0.S# A0SW @C0@T@S@@T  003S 0 R Dx偕 D0 SDTwP0 0S0㌀0РȾ ̙ -LM H 0R,0 0 0 0 $5 R5 R 5 R @@ ` 0KV㼐 嬐 娐 夐 堐 尐 崐 帐  @  QQ \  D0.S (0^1Q o @p0 D0S@@@P 80 @T@1Y1Q@ 80S @K 3 R E 3@T PPK0 #\@K/.0 #*.P @ PXpl QR P   jP@ 0 0 *0 0 0*0: S S 00R0 d@ `Vw R 0@S |@ p2KL"0 ST2  `V j`V2 ,0S ,D@K"0 -ox !0t p -o! 0l -o1h R0d0  ` `!0-od  000 )0-S jLpo 0R@@@ o P [  ?0 R0 0p Q0 R =D `\0 ]'L$,! ȠРؙTȾ  -LP# \ \ P  \  Php P 3S40 RP \ 0̠ 0-@LTP 0S@T0  , 0 0CS00ä0 -L MԢ ( 3S 2 R2 R 2@kpQ[ 0SU l2@` RL2 Ry<@K囃$ 00@z(2 Rf  r2 RY0: S SK 0SC (080c!0^1 R 1 R0(D1 R&1 R# : S : S h00CS00  ä0 pW (0S ((I 80([ "88 #$ , x X@ 0B ?T@0 hu  XlL,$(40 ,rܠ  0-0P R 0L0x0 R00d0 RX0 R H0 @Tjj00$( -LM,K0 P| lR0 0 Q{00P4 U 0S 004!4  R0 P,@4j8 4jjP80080 3S 1 R1 R 01@^jj80 R< ;a/P  :l00Sb0@7\i0PdS T0<0 0ꐛħMbЛܛHp -LpP`H QPP=XdP@0 X P2i `VMP0`  (`G(0S<0 0P,` P0,,0$| 0S0@)d'dLL d,0 00  ħx00P 0 RPħ p-LM`kPP@0  0P0c\0dh  z00TTPPPPPPP pMuprꨚ, -LM,K2嘢@ 4pKT ' @,0@PQ h2 R,0S:P0 P, 0,0@40Q9 @T40Q& , Q ៵00 0cP l  1 Rʄxx!=9 B = 0 0R 0S(,! 0R`YV `0 0,00 R D Q $08 0bS$0$00,0a00STd 0,000,0,@ m 0Rdħ8Ldx p-LM, 0@<080RF(400 S407ڤa08P< 408 8 0R  K=0l!8 0Q =9A =C@@  0<1@ Rp<0!s 0R@ 0 fp`8P0800 Yp0 R`8P0t`8Pd|X`8P"2n3c1@./A)b2b3c13N<000S `8P0?BȚC -PLM@ 0S & \0\ MXL0 M g0PdS " 0 L 0 44\x --M L0MpANK0 @D@D\ 0 P0 ` p0  U` 0S L %4 % L4 -@bLM0 0Cs0$r r@ 0b0 0Cs0Pt@$K@ Pl$@T 0)@TAQ ZbP |1 p1 R0PQ$. 0<{0PU v  0 R0PQ 0S 0 R bP㘀P   0P 000hD0 PP 0UXa00ĞО؞ -"L,M0S l0S0=aP L2@P@ 8@@ @@@@PP`"1h: 㑌쁟PYLPKp)$ 0L` pbPI0)% pL` bP6@ H0K: ,@ 8 H@ D@ @@ <@ 4@ 0@ pbpP HH00D00!81@P,!0(1 0 10 `@ `,0 # 0x ` 0PDx 0`0PP dܚȧ8T@td4Ldp -1L$M@HK,@ |H0KP0T0@0P 0P @ 0` S@)p. p ````   @P ^@ @/@@,P 0P20 ֚PP0P 02S I 0\` 00,000,0 Q 8,4,0 RL8ȧ؟ -LLMTTC`0 $0 UPPp0 SP )Q )Q 000  R0S^ " $0S $V \0P R T K.0lbdK@__0@L"0SZ0S T K.0bdK@H_0!W 0S T K.0bdK@4_!000SPP `T K.0gb ,0L!(lL0, 0RL0RR000,0T K.0IbdK@^ T K.0=bdK@^0 x 0>l` g0/STR `Q0.SK R pGꞵQ< 0L|(LxԠ$Dh0 ȧ -L(Mlq0@PKda @ 0 cH yPPD3[1 ,,!0zP"P  0 S  00 0 x 0x 3K01 0 R 000 ^0 0-@0P0LS\0S 0' ; b0PP 0x 00P 00.8H 0$$ hLtd -!LWM0,0  p&PUaKJ/ ad T NP=WoK0PS @W 0]KS  @P U00R00S|q0 ,0S , \\ K.0 F_0 O \ 궲iD0D <ꭲ` 0$ 3LJi(t Hd -LdM┑@q, KⲠP0K0`0 ` p@ 0K K` `0P` 0 R  )0.0 PPPP0 R /  \ K^l`K@ [0 0p ၖP ,0S X, t[@<0 Ld|؟ -RML 7 M(% 4% @% , 7) ǟxx   , 0 8 < D  t' p2 H0@/S(LXd0DT0@Llx0Ɵ:;;@00S lVA0C2SE  0<00S|090;0:0;0:080gş80:( 8 07IjFKL L4EG.Kx t :  B0p l UP 0 ^5 09tN@ j0:;8) TNKA @ 0S 0 R 4%RQ #NKA <4P|ß0 R 4 R Xh 0@0#uP00<0{,0, "NKA 23 R 4 R0 S  "NKA{-l2`P0S2 4 R.". 6P"5=肟@:0 ?y/ "?(=T 2P00(10 \tP >T tPp!NKA P L0 R 4 Rk (`rlXDD a080 00V00NKA h1Pڠ0 R 4 R Pø;d0 0:;7B/0<0:;:?.AL̨d( @`x''TZ̥0LhD`|Yܦ@ب 4Ph <$4ܧ@'uLlШܨ( Hܨh8dԨH[01 bZ Z0% 1PFKL@ L@@@@@@|aGK@Hx t : 0p l P 0 R11 P0Q1  t.]2騄<P 90 I,%R0 KL@ L@@@@@N>K@0C, @:0C D uPJ$0S p0 00 )vZP"0  NNKH2@D@DP)`' 0T `_ZPP2)( 0`TZPxYs 1Qp X 0S Q0S33 0 $.0% >5 XP$  #0 5@T @@T \T`$0 00000000@'Z@Tt@0D @T4 @0ROK4 Iq DP` 4)* 0 Ypr FKNK@D0D% R44:0  4 $: 0 YPO0 8LuP00 0 s0% 0% 05S8%R 454 00) .00   ,0S  < 4 (%R  <5P(%. 0s 400) /0   0Q4 Z|&0) %R P0Sh&\KPEt '@0@YYP86'0@NYP&@)$ 0 @BYP6)% 0@9YPE(@C @塱  囱 50C5 堮| @ >qII,(0@ Lx00MKBKK dhdKL@AI L@ A 0IH P L PUd@T]0SV(0 NP@0 5 @aP> H804 =KL0Cˠ 4 $5 4 HP5 D 4 LP L%$  R 0SLPڴ0   ꃭ0S ӱ^Xz0S  @Pr8NI@:0=KEK0CL0C 0 0Xp: Rh[f 失; 塱/k ЀD0 S \N>K0Cɠ@ 0Ct* @ZX 开05 KPP ;@<\0+0@0 )<5. 6XPh0s )|; (XP0s ); XP@P 0)3 XP%`P$O.K B BzkPHpkPJvI4%4 0 @% 0) 30  @0mIP@ V @ThOnK`F`F 0P@5@ 0S>oIPFTK,3I4]:V@=PH) P04 X=@O>K0C)0C& D WP 'KNK@D 2[-D)+ 0 WpDOKI) 0wWp$,.N>K0C 0C@ hWkPT.00 1l$x>x 0P  1 PPj1 hJH  0 V$ RVI,%0d/PP0  P$ 000P   -LM8P |0 R 0 l00 =:L z;h8P 00 @4 @ @ @ G K )W@@0<1<00    0 $ -3L$M R 0SS@@@@@@@@@pp3  W\\!00j0Kvg_3 3 .$(," \"(!̠0!0 `.2 p22@80K8P  0 0@ ,@ 4p 吏0P0?@ P`2 X00P 8 k,喯@Kw<@@<4 Ġ̌(<"4!Č ̌$t0 0@@X8#8#$0$d1p@ t1@d$t0 0@X8#8#Ġ0Č$ X0 pt0  0````X8#8#$0$0p`t0 0@@@@vX8#8#Ġ0Čh lX00 p@Z<4Ԩ$بd8ܨ D@( 0 Pب -L YPB -AMLM@p, 8$ TF*PU 0T  ?  PC*U5 0S@? A R:0dU7RPE6T$*BnK`F`FqD1D @ 04^0(! '1\   P0PE*ST:U @@0 ,0S ,T:8$0b? S84S8 BnK`FBKX`F@ @ 04 P   P:LdLT -LGMMmKS`F0 `Fp @,0 h 3I.KTp  PU Q $3  ,0 S x,f}0SW 2   Z 0V}~pl  Pt P 0S4 p 4S) \0  < Dp$"000CS00  ä0 Q0 A- |~P a!481 1LQⰀ\(0pW `Ѝ@-A\.b 2l20@\@=B\2a20\0 -0LM`pP@000s 0s!,K kP,00CS FF F F,F@F@@TT(00T (00 -LM@ KPP"_:p` 0 p8N0s 0H H@0P* L$]눣tLWpбܱ -T0LML @K0*0$L000 #:0s hptLWб -LMH0HD@|@ 0@ :Ph]]Xxl$W  -L'< -PLdMPt>p6Phw\>T&PHFH 9P,6,6, P9P:`Ɵ*~M%%5@@@5 F?%@@ş5ş!p%P0K@@i/H?@{Gz?~@tlx%W AX$W HpV>\p(Ld? O }+)( O \ u+)X XTd ͠` \0N @壠=0P@70p`[ -0L |o4x -LM`0X"XB00P0H0PPE 0S00(2( rP000*4b22 .0S D,B,@,>,P u@0SPE .,U 0+S-S0S .P.P .U@PE PiU`@PE0SvPfP wPr P ~00S 00SQ1 1)t<;RPBPcj_,8@DHLPHX p-LM@5KP `p -LMJ<@T00.0鄴0 S S0 S S0@-S@  TAN Ra0NS\ 0RAC\ 0^0 S -d0LMP@@L0 ;<00S 000SJ/;R  -L0MԂԢ 0Pp(0 PTPK 2b.30S @@ዜPH nP6 2P- PD2[KP) XP/ P) RP, KP- M P< 1P/ KP) CP, K P- > P3 K P- 8 P0 1P0 21 .1 +|1 (p1 %d1 "X1 L1 @1 41 (1 1 1 1 0 0 0 0 0A[?[0HP @@[0G @0H P 40K9K3K6Kd<@T K^pp (0S4(L 4@0lԴ p-LMP`0,@KHP 0  G 0SpL -LM@P  00R0R  00Sh$L -LM@P hk00Sh#L 0-LP@P $00S0h# 0L -L M K5P@![A[R0 ʐP 5x0td P00TT0@LP !400 PP00ht@,\ -LM 000000000000 0000 `0`圢0A> 06 pIpq QcPa 4S4S 4?0 CpP@u|*`0A>@t 0 001 0*l(pP|[*?T A.0O0P000B>0,10S 4PU/0K000 z*Z@040 00S 00S" 00 0000000`0` 0 0 0 0000000 0000 `0`0 $4SY*0Tĵеp  -pLM@ 00s)0@ܵ@-`@? 0"00\ 0S0S000\T -LMZIp q  Z0Y0:H!O 4  6y†04 S4 S* P%0 4 S4 S0 4 S4 S*p 00 0 4 S4 S:T0O YA. P ` `6& 0I6Y$T -x0LM@ 4 BN@Ap@0t hz 00NpT 0-LgP" 0P0Q  0R 0R Q(00A> 000 $$0T(00S00B>0pT@-(0A> 0$Đ6I T -LM@$0AR 0  0R0$$R 005:| L0$$R0$4 A  0@0 0$4 T 0-PL $4S0C! 4S4S 4 A> 0@0P0 A 0@d0 $4T0$0AR 0  0R$$0R* 000hcT5=?0/9P6 0S000 p- LM 4B>0 pQ 0P@00QP`@BN@0 A>0A> 00$d0(@K B>R0  40 40 06Apqph(pT -LMw3Px 404@0  0000 0 00 0 T0 00  0?\00T -LMX@ 0S 00 0< @0S0 04hT -LM@0 @pq @ -LM̀p`(P@TC@!3A>B.A 0 0$D4 dD P  40 40 4stoT 0-tP@0L 4@ 4@EQ 40 04T<0@0h0T00 TpD0 00000Sp00000S p0 000  -p000L00 0S0  Pt t%P@ qL0 0000 0S8 0(0$   X (0 $ 00 0 p`h`l -L 00 0`d p-LMP%A$`$@000A000p`dA` -`Lp00S 0P@@x 0 0S %@0 0 00(`S@0S0Sh`\ 0-L@LP 0LR0 0CS00 00 00`dl`h -鐠p0 刀0b? |`PUL@0S 2@0 P0b?U0S( 0f0@m\dl`h -錀p0 儠0b? x`@TLP U uv@0 @0b?TU,0@ 00c0m^\dl`h -PL0`0pS @R@ 0 R J@ 0 0CR00S 000$8@000h`\ p-LM|` x0RR@#@`0`P0 0R00C0@00`00S c0Sph`d` 0-p@LP@`0P0?D P:00@P*0P0`h 0-t@tP0LS 0S 0S0800 P0S00h`t - 0L00S Wh 0-xPx@0LS 0S S0S0S S 0S 0S S 0S0S S0h` -LML@00 S00 S S 00 SSh -H0LM0@S ,0@$ 0@]00`lht 00t 0-L@dPꔅ\dȄlЅDh؅؅؅؅؅؅؅؅؅؅؅؅؅؅؅؅؅؅؅؅؅؅؅؅؅؅؅؅؅؅؅؅؅؅؅؅؅؅؅؅؅؅؅؅؅؅؅؅؅؅؅؅؅؅؅؅؅؅؅؅؅؅؅؅؅؅؅؅؅؅؅؅؅؅؅؅؅؅؅؅؅؅؅؅؅؅؅Ѕ0h0hlA00S S y00S SLM0.0?.00e=@]@0 S=@= +=0S?0SeXC`0SeX@e dM0S P P 0S#0K$`K$K P P 0(K(0 F@(P]T0DcS&l4 h4|ԘК,Ȝؙ|`4XЗ4@DD4̝\L|Л$Lhd44H 0Lg,+0S0S ; K0S0S-:0S:  *0S0S : |J0S0S  | -L M@000 p`P00T,0  300CW 30SW200CW 9B2 R 200CWUV T0S x20S R,UVP i; R Ry <20S pWWJZZ`P#p`Pv0X,0 p@q>P ,PL1AP-00Y000 # 1 00S0uv   00S00S0   00S, 00S 00S#pWZ00S0   ,0S 00p 000 00SYk 0 o~ ,||P px -LM@`PpTW 000CT0 @T Jp`PvY Z@@TZXZ!o7 ,x -01L M0pS` 10S P; i9pP@+u)V 0AP 00S PP@ 0pP@u l0 000 0x,p -LMp`pP@uV iE 0S<00S,00S 0 0S00C',Iи P000P -P0Q0L00 00 000 - L00 00C0 p-LMP`(!@0  000p P0-L@P@ 0T )0h )00PP0PP -LM@0S00 p-DPLM@`T Pp@Tp 0-LP@P000P0000000000   -pLMP@u) 10S1!00`Q0 #P+_p@ LP@< P00 P8p0t T 4  P 0`V00S100 P``V0P@` P@@P@Fx00S00 S 0 P@ P p:P@p -pL MXrPp20S200QPW0 P@P v20S @ T T10: P@ P p1@0`PP` x!0$ P@ p`PP,  0,0 @7Qp@ 0000  &0 P` P b @0Q P 0Px00Sl00 @,@ @0PU`XW,x   p-pLM`Pv ZP2p P P@0P`40`%@0P`p P P0`p -L0SH hp0 s 0 0  Bh, -LMp`pP@u P |00Sh0 tW V P@(0 f K!( -L M@Kq O p-LM`pP@ux<pP@uPph UT0 phHd p-LM`P@P  P pyjP@$00S/ ph -L M`P, , SP,0@cT A dxlP@ Ho1pw0x00XW0A ,0@T)y z  V0 U0 1 ,0c@0;p`Pv ,0@T| ,1 ,0@d@ 0@ܠ,@00CT Tp`Pv XW  000S o20@0CTA D0@@Y 0 0@@逹,x|t -hL-` 0S 0 0S<0040   0+0 餹,̋ -p嬀0L`%PPጠ %@T0 %0P0@:  cW*  bR*P@`L0 0DS@0 80 40 00 ,0 00 0    -L M@@0 S( P@p`p`20S, 2Ÿ  00 r0s 0SR !0S0S1 01 00p 0 00 0S/@@K 0 *$1P a,1UP0!c0@PP 0 0P00 0 0  0Rph0 00d0 0000 S 0 (0S8(L T p-LM0`SQP@0SPE P P@P0SUfp0SQ 0S0ASQ 00S0 0S  -qaQL 0@ l0T@lT@S   0^ࠡ0nP 0 000 h0 00000nP0<0 0n d0  @P $$0 0004X8T@P h`t|$0 000$L`< p-0LM0@S 0S PpP pp`P R`000SP PT R ,0000SS Pp -@LM80 00 B0 @00`0  -T0LM0@SJ@000S P @TZ -0LlP, -QPp1MLP0 0``P!A0P000SPh0S `1@HT1@0@T @1@a0 0CRP  UR1000S S 00@0TS P0ø 0D Rڴ000SP W00P00S U PT P00C0LL0 0p<0 0P000t \ -0LM00@0T0p` Pcڴ10U 010`@q$P`  TJ1U RZT010Pe0 DPPE0 0U00 lp -p@LP`P 05P  T0P0@` "l@h 0RX0X 0 ?R D0@0 000c  $\  P-L@p`5PU U nU"0 Pa50Sa uꈥ\ |0L 0R 0SPUQL0   RRyxw0 P50000050Sp 0S 0S0STQڨ0   RRPO0 P0 00& 0SI 4Q!0S 40S0ST0   RR(0 `P000 3 0S R0S300PSU T P0 :P000 ßS0 0S_T2QW T g 0 P_T$0S 0S a 000S|2Q00  C\2LB 0 P 0 P000=_S0S 0S  0S  0S 1 T "0  P  T  0 P000 P D10SLSS G >PC <P2 10S ST0 )0P?&0 @@0@0@0TP 0 PX 000P 0 yP  000t \ 0-@1@LP T00 P0S1b Q 1 Rb\0 00R 00S 00S00S 0 000 00000 00 p00S d00S *00 00T000 $ \hdP00S 00<0< 80Q0(000000Ĺ,0 0  p-pLM@0`t cPP:p@ p%#@0t T T000CUP800@P@0 V000p -@0LMTpP$P $@0ꌀ0P0PE P@ p U `ZP @0<0Pf#(0PE0@W0000@-p@T* R  :P0b0D 6@0@@0@0 T0P< @-P 0S 00Q 0 -L``P@ T 0S0S*0 S0SB @ T 0S0S:p R000 0  `0St0 @ R0 0S0S@@0 S$0 0 0 0P -L^ 0 ȹx -LMH@0S dR 00 000P00 -2LM0pS px} XW"Z 0S 0S *Z 0S0S:0S0S0$2Z 2 00`PQ PU`R?Q=PP;1 `XW f1`P0 00pv  0x@0XW4  0 V;U9@04P 0 `VU a0`P0 00pv  09@0VU80   0x -LMZP,"PU 0 S 0 S *PU 0 S0 S:0 S0 S01U 00 p ` Q `VpR+Q)Pp+P(0`ZGYE $1p0 00px  0@0P`Z,Y)pP ` V U x0p0 00px  0@0P` V U0 0 -LM P@p` P@t0u00X00S T00XtuP@tTU@0, -L M0-S \GECU, ,2`P LPp% 0S" 0S@PP` s"@p"@@?P 0`,AU0SP!51  1{Y L W40 , o8,YTt 400S Aa0@S<0 -A @L2$0R20@ -'PLM! $P .P ^P@0 00 WP|@000C 0`@`000T@P@ 0s0s(,  -LP 0-LM@ PKT 00000 -L M@K0,sώ0s 00@3 -L M^@K |0^0s 0s\0000 H00 0400 S P  -LZP ,0, 0S @-, (02 S@04R 0-PLMP0K K@XP# 0S00R0S$ 00  08| P-L0 x hu|`O 0-PLM@Y P 0P[0=0C:SGlPhPdP`P\PXP@8Pv040K 0(10 e0 PPP0PPP= -@LMTd ThL0 !@<840,h}\ dȺ4 -LMЁ0P@$0 * TTbA`6 00B S10 0C00B S0hQQ@`#0,SVVE1C B(1`$1 <qK 0S#T`VPK K @ 0@1` 0`V@K 0@  `PK@P0@`0P KHP  $0S4$Llph@xat  -PLM! P P( R0 0 0S 0S l|T0T Q0000K (0,0 K0K00K0K0 e -l0LM@QT T@ hN$0  hȻ0 R00, -PLM$ \ R 00S S  P$K ?0000@0pS $0@ D$0 0RV,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,$ 0+SppW0$0 q1 +P0 (K$( $ 0+S0(0 1[VX$0z@0C$0 6a0DPS``-P@<0K0P 0(0 000CS4h@hhh W'P000"W $00Se S$0 $ 0 S 0$ (K8$ $00SR $K 00S($00SH|ܻ -LMP( `P@p@@P0U 0@ 0$K$0 1U0  0 0S SU(00SPPU`  000CSWUF U IU F 0 0 S008U4 U 7U 4v1 0000vp1 0 00X0ESDU U U (K, K,0S 0 000S U(U 0 W000CS0010$K0$0 U 0  0   $@\tQ PP -LMA@0 w -LP0 0S00 -LP  0   0P -LM0K0 =鰼 -0L0h -`LPp@x`0PSE 0$S T; "P80 0C$S'4 @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ 4 @ @ @ 4 @ @ @ @ @ @ @ @ 4 00@f C 000S -L Mp`P0-S@@000C S U 00V(KX(`  00B S10 0C00B SU0@0X`̼ -LM@ R |00S dR 00X0 0P0 0H00 R 000 $ Rt\0S R 0 R000000ӑS$0S0A0@Sa @0R0-P00 p-LM@P` kX0@0P SP000000STlm0Spp -LMK -LMpWm `W@T@@# 0P`Ⱦ -L  M0KA 1@ _P1$a0d {P@00KT0d  U0K lj0 e -L`P@M\0K0 0鐆P@ !) M0 K4\0d 0\ >0 K:00PKF" $0K p-D1LM00@`1 (1 p0S! 0DS 00CS ($@T U7`KPP0DS { 0@pt  p-LMD`DP0@S 00PAP0  Pp t 0-@ L08PS@00 0R+0@00  -LM@P P -Lp`$M姯Z, H0  `vp0.0K.K0 0 P@0@@hyp`0Z-00hH  ,0 S ,ŐL -Lp`$M姯Z, H0  `vp0.0K.K0 0 P@0@@hCp`0Z-00hH  ,0 S ,L p-LMP0ϰ0 0@` 0K K\0/cC!b10@00R0a\-00a  0SgpLgfff 0-LM@P0$@K 0 O 0S N0L 0-L M@P0@K 0 }7 0S 60L -`LPPp% %P0 `p`0nS dS sS@P pPpP -LMt qP@] T T Tt h -0p L \ `P@ 00S 0@0 S @ \00ShLD000@000T(0 hT<\t 0-L@Psj 0 0 p-LM`0PS@ t00SX 0@S  @00Sc?(0 0S0 >p\tpT00C p p000C 000C?001,0@-H 0\8001000\0 010,0@-<00 CR,0010 BR0 000,0@-8 0R (0P@0100 R0, p-L MP` 0@R$K0S ];0 &00$0s 0s 0 01$ Kp, 0@-P 0S0S0X@0^! 00S 0SN00^0, 0A,P<00 r0s  P@-p@0\`0 0r0s 00000\0 , 0P PPB@, -LM\X@TLD@0 840 ,{(0録 tȳ p-LM@@`P8 0S BPl   >0  p -0LMK0K00K 0-L M8P0@K 0 . 0S 0L 0-L M8P0@K 0 N 0S  0L 0-LM8P0(@K 0 n 0S 0LЎ -LM@u q0r00T00S 800T@qr , -LMB@6P񟗓!! !!!!!!! !!!h!!!!!!!!!!!!!!!!!|      !!!!! !$!!,!!!!!!!!!t1 p1RDT10SD1@18B01$1@0S, lpq' P0mp@q XQP@@ K0 SPO@@=p q  (0\Px p-LMB@6P%(&#(&(&(&(&(&(&(&T$(&(&(& %(&(&(&%(&(&(&(&(&(&(&(&(&(&(&(&(&#4#@#(&$(&(&($(&(&8$$(&(&$(&(&%%(&(&(&&pP@u2HP@UʰP2 R B@0`PP`VUP@UʒPL2  B?J@0%2z2S P@@r@0`PP`VhUfP@U`P^ph\0P@ut0 u SR?P@09 \p0 s2  0 _0 S*P(Rph=Fp0 s ph| |0S0S S00CS00S S p@,0RP phph-p,Ta 0:S S@.S ?S  \SR R 0-0LP0CP@ SfL'd(d(d(d(d(d(d(d(d(d(d(d(d(d(d(d(d(L'd(L'd(d(d(d(d(d(d(L'd(d(d(L'0B0C2S=<(X(X(X(X(X(X(X(X(X(X(X(X(X(X(X(X(X(X(X(X(X(X(X(X(X(X(X(X(X(X(X(4(X(X(X(X(X(X(X(D(X(X(,(X(X(X(X(X(X(\(0 00 0 PE000 -<<LM0pSP0:S %S .S) ?S \S / `V $K00!c(PPDP`VPE $K@@!O(P (0S PW00P:g,r0 -D0L<080`00 ,0b A0 \T<(0$0 0b0c0A}\T< -0LSPp`@7  r000000S R000@00ӑ0 T00R00S@D 0S 0S uP0S000S&10T00S 0T S@D00\00SH00S800SSS00S0S r0000000S0S000  $00S00S -0LM0@SԀTpW.0000Sp頠`00CVP@tu 0 0S 0`0CVp|(, -$LM0s0s@ !1 P@R00or00SnP`00CV)pP@u XWp q   Q0 P0  Z$`00CV(|, -LU0S, ,h0S000hV -PlpL† @:0SX L0SD@0S0P -LM@PD0  p-LMP `@ (0K l0 0"T\j^PP (0 00 p 0-DPLP @T000  00@-p`P@Q|0s 0S 0S tu' 0S$\!:00SP00S0Q 0S 0S tu 0S0S*Q@-0S  0S 0R0S ^ 00S0S:@T 0S 0S 0R 0R@ @ -LP@ M`, K00 p`PWY Z 0S0 S` M Z  0 S0 Sp`A , 0S? 0 S, @0 P`R @0P`, P,0S, 0S @0P,`00 ,  0S0S , @0 QP`R0QSW -LM\S\p`@0 :< P @0RV@00hï @ 00 0hï @ 0<K%0SP0PS @K 0P<K 0O<\ 0 <0 <\00S0 0 T -LM@K=0s0s n0 c -Lr 0 0S0 h -LM@P  pP@udP@0pX W``0P@,0`(WP@  hpP@u|0`0VpP@u p u `VJpP@u , -L,M@@K `Pr@K` ph200 <q8 r 08@ T<\  Q R`( 0@0C 0, K  `P @0 8 ` P @0puv R@0KD10S D@0dS0c S0 P @,0K4 K0,m@K,#0"0P00S`0P00S Q   H  4  , 00@z00CS0uH00So4, 00  @~@TH -QLM@P` 0S!-P 1,0<R A0S* 0S!0S001 &뀁p0S  PP1Wp 0S  01A 0S 1 0S{  0K(0s$@tm K>0 ` PP` h P00 R00SH0  0K 0P ,L -L4MP@pß00K @KP  R0S `  D `VD r0s tu h20S R0S0S *tu $200@_0 K0tu 0S0S*100@_10!0S0S00 ?SRp00pWÏ0K D1t u  y0z 0 U T P @t u  U0T0 " 0 @0K@  Pl q0s  ,0S00S0K@0K0 K0@ K 0p@-`^@P  \\ 0S 0\ 0SP@Up^p 000 000 000 -@LMTP oDl< gdah]AAB -81LMXH @@ K}sC@F`9a:eK0  @`Pp0S0S 0 0?00`0  X 0S L0DS$0   iAt\,x` -LM0$ KK 0 0 P$ - L P00Y  -LML0K Ap@T0[S00KT[  -GMLM7GnK, 7ǟ`F `F@0pxX D D E d'Cp 20@FSFFLLLLLLLLLLLLLLLLLELLLLFLLLELLLLEL0GLxGGLLLLLLLLLLLGGGHLLHLlHLLxHLLHLLJKKLL\KK$6 R6 46 R0%<0UK1 L4S 30(8UK1 Ll4S d <%tT5  n@5k$UK0 LQ4S 08:$000S000;ꬤK0 L34P@S X?04@ 00@008<4 R$ , KJ @ P@DJ PE,$ 0 Pv /P* P P#0004SP0;000@P Pl3 Rd3 PP`3080@0 P;  PD3    P 3   P2 R0"<P P070$H P P060$T 060$P 070$L 0H70LPT00RK1 L芲4S >0$000QK1 Lt4S (0,0dQK1 La4S d0 0QK1L N4S000 1 bXq$B^KPEPE@bP  3P $0P ]0-S | yRL'08<Tdx,0(x4 $<  -L4M0 4 00[ ,0 zZP@K0@hP@P 0L0oP 84 R 0@ D0  @ D t0H0 0D S ;0 oR04  0S00@ $8#8L0 T3 M 00CS0|S0 00i2P@7^@ 000<%0SC0S #0P 7]000 0㱁L< C444 00 0hBD@0pxꔻd2 R  4@ 0SZ ,K00D ]PPJ w=D080 ` 1B< @K0 00!P@$ P 1 xᓺ]0q@ R xቺdS0`1 RH@4@0t0@Y.@P?/@@B@DRPN`,0 @P`VP$@Z -@L MX &>opn00}X$`pZ p-LM&> @`@X NP PU$@p$ -LM@_d0q,' PQ P@   x,` v  V  U0 0< -LM4@_d0q,' PQ PP    wp00P0S@,0  ,^  ,0P @t  T @ T0 0Q  )@<sd -GMLM 0`p,0 MK@D@D 0P]%0 )K oO~@0  pW `V@$p,0 S ,3yL8 -LM堐UZ>,0 }nP 0  @hP@W,0X H0\S ,0 W,00XP`p,0  )Dt8 - 0 S\R -LM P@ ?0 1<00 ! 0! 0 QQ?  0 1<00@&0! o0S 0<?S 0S 0S0?S0S  M-LMPT00\,0 `00S S00\ ,0 !0SS:P% 0@0@ 0? <#! 00!  00 0? <#! 00g,0S 0@0 @   !0$0   5Tp -L PU  -`q00 L 0p0S2 @ԛ PP#Uw 11>p S11>.QQ$ DS<P pS8`P 0-LM P R|@|K  0S@ pX P@0TD  <KsQ 0<DT7 p-MLM`@0 0 P᪡p* AK@@+0YP! T*AKAA 0r00000S  r\00000S 0S@\:%0 S.tpL-Q* rh000000S  r@00000S0S QQ: p-PLMU`x x0d X) 0@0-PP0P0p p-LM 0@Px 0`0X0S 00 0 0v@P @ p  -0 SL0S S h0 hr -0LS S h h -LM0@S S }  h -0L D7s4  -2LM0, S Q 10S 1 0 RA000Z ,  00S SJ10S? t1 R;,00 ^SZ 00S$S0000 0 a@!T@@@@pPL0 0`Y P00QP 0 Q`,  i pa Pp P`lPd0`@%P 0, 00 0!0 0 000@4 H\P,rxdt 0-LPcP ۶@Te 0hU 0-LMdPhP@ 0 SEKP0@   0   -9LM䙟 000`fS0  eS gS )))000P@00GS񟗲4444444444Бpؑ(4PX`tВ (08T u6 0 00 R5 5 5R95 ! 0 B 5E ,Kݞ0, R( P00R0S p AW`5 `EPH%00D%6 ,K0, R P00R0Sp44t44  44 4 F$4 4<$$000jxx0 0 0' \4\XX 0D4R@4P4AOA30000E3 3<3   83 33/3)3 |3$3"3 333,CP83d P LP 803 M 3P0@S@ # 300pp6L20 P2U0!0 `c TPV00 S&V00 S00`F00 1h0dS"0T00H2 0@T03 0 h1R0S040  00CP \1 I!P !<{x!04@T<10S\LV00S0  VTP0P 0 p `Fvp 0 `F0 ?vpWotP\l d$Tp8,4<L<X$d0`XP``h |H(  -LM@PdpK# H p P0Sʄ0 Q T p`p  00 00  -LM@  h@- 0@R:T 0 S* 0R S R  :0 0b0000 00 0 -@L0P00  S T00 0D S0<PP4 0 0PS0h 8 4R00C0 R0  -LM@T- -LP p-0LM0Q 0R0SP  10P` 3S S S 0T-P 1P@8J0S pp8Ⱦ̙ -PLM`bPP20S|jN P `20S5DD"0@S82@@ 00K0` <@ @@ &0K@  0@@pK0 K\ , * 1@ <0R0 0S B S@ < lP@tZ00 R00S H!000 810S,10S 10S@q0S 00S0?M 00S_S:   P0S r200000S(0_S% 0S! 0R rT200000S0_S0 Sr200000So00S_Sk  Uv 0b00S10PcUmp]0O00O0SO 4SL @0 0 SrT100000SA00S_S=   P0S r000000S+0_S( 0S$ 0R  r000000S0_S0 Srh000000S00S_S@,@  0 S 0 b10PU, -LP 锗 -L0P (8 -LOP О0@-@TP* ^ \00S.^ H0 0S \4000 ӑ^ 0@T:0\d0-\0Q 0\ a p-1LM0`S@PPP10S U t0 CR 0R0 S 0@00,/IP$10S U 0 CR 0R0 S 0@00IPU 0 CR 0R0 S 0@0TL@0 00CS0 ph0  0pX`xaLT -LM@PXE`p!T)pF@K 0PD̯įد` 1p1' 0`0 R0Y00 @b0Q T00S J0 R 0 R V @PG0P@S@0$dLd p-LMKP @P`J011QhTZ P@Tj_EZpD]P TP`4`O -LKM MCNK@D0@D,0 pLIKKPPPM.KAA^gP@4: S  S \H,0 S <, imK`F`F P@ PP  㒑P@h 2 R_2 R B PO {P4S 0G0@$<@ 8@ ;0K4@ 0@ CK08K )KKNN( 0<K @jwP`! $04 1D MNK !0P %0 0ex3H{p oG@㢬P p @RD@0 0Pd :㏬P $$  pvR:0P 0 2P T]] (P@T Ph5mK`F`F P8LiX  -LMp(KPP3 @T `W@ W Tjo(TJPZ ( D (00(8PZ ( D (00TG| 0-x0L0PS0@Q  tP 0S(0 R00 R0L P-L` 0SnS 0@ ,˫P@ l0PP@p` ,㹫Pp@0oS` 댮L p-PLM@ PPp$P .㒫P 00P @Q T`P. }P 00P 0Sp -L 0KM#+ -L 0g4$<X -OML M\3PJK@@| ,  =0c(#&ph 90@?S_DPdp404004 0408 0404 Q.K B B< 040tq 0S BnK`F1`FQFPB 0 4 04 $ 0* ) T XQKAdp* Z5<4 Y584 X5;;44 J>K 0CPAP P| As0$\-PPL [0<1 /fLd|ȵ( @ -LM@3P L  q0@0  R\. jH -LM@b P L  q0@0  R\  I` 0-LM0P00CSK @ 0$ ϓ0 R  /00@Ttd -L0Q e4 -LM`P_P( @(K,pK 0  (0@S -L M0@p00 0Si ~DPP 0S nSZ =P0`0@Q CP QLQJ  0V0P 1 0* Y0  0000V 0`0@00 ,KҒ, ?R0S@p @@0"Sl 0Y000 LPH00D 0oSP }@\t| -L$M<@K`PPD  P40K*PsC圃 -0,0K * K#u$pr ?0L:Sl444444444444444444444|44444444444444l444444444444(440000S  @@Kp| @ ?@嬋2000,K +K.0Se D 00|!0`VQF `Fv  )PPp   0z`Fv 9P@ p姨P 墨P 坨P  P@D0S  Dp\0l 0 aC#40K`6Xtd$dL,Ltd -LM0@S\ SPH NP8PCP ꄩdL -ML M0ß0`@( ,0 @+3P`d088 B~KpGpGP"04 0X 048"qP0 T  TPP KA >KA B0Ck048\480   82X4"@ ,0B08@Tn @ p@` P- U4X@ 1 ,0S ,cKAA mBP<8#4P   \RPC00S Y B0S>0S 'cY  BBBBUt4r48tB08@TBbTk Lȴ8X`,rȾD|$ 0-`0L@PT  㫋P @T(0 R00 R0 0-D0L@PT  ㍋P @T 00,r p-LM:`PP 0h 0@T  nP @T0 ph  Jpd -`LPp@0   0@ -PLM  0SlnS `0 @KT\A0S@ @ 0oS0  ꌮ@,r 0-PLM@0P L\ y TU0KhpR4Lt -L M0 40 (KP`* A2pP@0H U0S -Sl01=P APAKP@0P0$`P00`40@< -0L a4| 0 00 --L ⨪a4 p-PLM@P`l0l R NT D0 Rp80@ o 0  @a,Ys --L  --L  -LM@=崛 h8d --L ua p-LtM/PB@TK _P0: S p0`rS  0-/L@BPU+D0 00啥/00(+y+u00t -LUMpPKP_P@lK8_0S(0: S  SU P U@P P@0 R000K@j_P h1: SD @c$^=`O t,t, 8 R" 0PU 0S  0řU  0P嶙PU884P00`XKc9LL%t4,rX^,8Hh -LP@P : q00  R.@P*`p@T  "P0 R @Tj@0 0 000< @0@000eP`* 0-T0LPU @7> @T ,1>@T PU0 -LPp @`T mP @T@74 100 00 @@m  p-LM @`P 0PP ,0 R +p 000p -`LMP@($1$ Pp` !B0s ?S mS 0Pp) 0 PbQ VU UWt{V f^0 pR0`0s,rd -LM0@0cSZ bSZ4 `K   0pR R    0 P `V | $40"WĂ,(0 ("4S @ P G0Lh  p-LM@PP`pP$0S`=  -PLM808 4 $@,  ]4 -L(MP4`K8pK4  00 PPp 8P@ 0 PPp 80( (,K ,@ $ 0 C], P-L 0 ,0, (岗$9 0]4X -Pp@LP;`"pT@6 "P/l|`1`1 11111a Q@b811 RP |x10sL P " @*P800^p]00 0dP840(LD -83L,M pR@`#TT` 0-S  P P 2@2P@DK  H0KD @ ,@ ;RPp H0K  PP9PH0|p>PW 0 W Dt(L0 P8(@d -LMA$QB$00000 000000000000000000000 0  0 0 |@xx0  Q d\0S P 0R 0000ڂ$@,T -86L M P(R@`,P 0 4P {0gS 5K@DT%U0-S 50 , K P5 RןP ttt%w:00@DT\5\%0Q4  S4  040 5 s 54 PppRp@600 /PP 603S 60S4 R0S ,Q  0S ,0@ ;0gS 6,4` R484P4$ ,00:0SU V  V/ :U7V  :U00T00S 3 R39A0@S 3 R 0kX9T6 b0 0, K4 [0@,SAt<Tthhtt (08LTt\ttdtt0 0<2 z|@T , KO4 0 @T  B@T p!00000@T  @T 000 0 w@T {$1 1w @T  w{@T >eyyph0$ @T {|Z(,rdL`8<4D\|@tlT p-@@LMTP` 0-S*@P!`@DTD0ph_`,0 ` `-P000 R b0P P51:P13:4S<4<,!4$ <,0!$d.,0 00 0rS R0l008#8S ` 0-LM@0 S  0S 0S0S0SP 00 S 0 S |zY00 K 0 (0 $0 0 PDPU <ᤝP , 000HL<W` -L$MğP`P4 t4E @ Q(s3 @ RPU U ß 000U000DS񟗿dHKLK 0D@ H @ < 8 4 0 , 2iP7L R/0S ,L R R H0S U 00S S0S 1#$0$0 0 00S  0H hP X00U @ AP BP X0 PH1Z@ 0 P P 0 ( "# v P P0 R   $00@Wl dp`p\pXp@PpHd`X|<d<d, -LMP @00S p SpBT  0ϒ005Q^` ^ T0 U   V CR 000Rh 0 R \0R \ 0 S0 S 0-,@LP0S tP@0 0-LBMP0\0 @ \ x 0S dS0 L1\F/K < R Lx -0`PL@ p 00B S0B a0BSWBA0BS7BR@PP l L x `   ` `Q:0e0b``` -L@LM "00ۖP 0;0` -L M0 K@8 0R -LP,MDKHK`@  0D @ ,@ 2p 4SP44  RQ  0|@th0 XB0 ,0S@,IL,   @ EE9?    -LR6@00CS00  ä0 孻0S t00S h@h0hP`0Xp01P@`p`p0$0垿@0?h99 ? -ML M" P4 , 0 ʂK@ A@"/P 48 2}2 48K t2@ l2@@@)PP H忿8 @Tp R 2 k 20Sg KAA2P1 N[480PU 10S  BK@R@ r100000S0 R0t1000ӑ0 RBKA00AD10S w ,10S  Q10 S`0 pp0S00S @PpJ0P0P0004 S/P@8?80@ ,0 Sd,GL  @ E904 2?D E9?h7 ? l ?l 0 St -LMHCD\ <<3|8#0 ,媁 寁30S]%0S 2 嗁圁N%2r20 \0倁2 yŸŸ"2p2x2`l2P`2@ L0Z<242@ 0 N2 G21@{ 0;10S !12710S !1%*1`X1@T10 |p1pqHh \1AT1T \|00<0S(0@T Q 0@TP0 9@t 0,r  ?  $?   l x0( LE 9h X 9  EE 9 D ?( @5@ 5:?L 9   ?   ( E p-PLM@P`0S00P x^oP00 \VoP L0 D兀pV 0 ypt@   -0L 0 9 E - 0L0 0  $  E? -0L 08 p E 0-PLM@ !0S000.P 1 5nP nP0 K1 u\0 0  |0 0T0 HPH@DX 0S40 80 5@H t?l  E  h& -0L ? 0   E -0L 3 0 9 E -0L ' 0 : E -0L  0 h E 0-PLM@P\1 T NP@!0S000!P jnP  enP0 T;u0P @,Ή0@0 @0S 00S 0Sh0~00`0@0 P\04@b0 00 0@$t ?4   E -0L 0l  E -0L 0x E 0-PLM@(1 -%mP1  # mP K1 t\ 0 0 00 0S000hPt 0@S00000.,0 D0~0( S0000@5t E9 -PL M   KK+P 0S0 0~0 00P|@0}S t00S\0h~0\P H0R@0 P,0  @ E$ ,X&? -MLMp0P 0 00P0P 0 ~`?-P0 KP3$ ANK @D@D%P X0 \`~P $ 80 V 0S( qDL@` E | -PLMd   KK_+P 0@S 8080 .~(0 0, @ E -PL M0 , ,K0K0!:+P 00  1 ~1 00 1 0 X4 $ R0  0S 00C,0S Z0S0@0S 0P0/,P0P000 9+P0`@4$@  @ E290??h  -PLM   KK*P 0| SKK*P 0\S T0T0 }D0 00S$0 @ E -P0LM0P01@0P1 q}ˇp 0\``P #,P0 P᳇P 00|S ,P +Pp0  X0,0%PU h@8@H EP7 -PL$M0 , ,K0K!?*P ,0S ,K0K!6*P00 1 }, 001 4  4@ ZP 400|S 4K+P 4\D+PP1 00@ <1 41 9< $ι1p0S. ,00CW*Ww0a050K00`!50K4G0pS0@0S 0P000 +P0P00h00S ,00CW<4@0 P,0   h@P E290?@?h  -ML Mq0$0 ܹ`عPP@P@@Tʹǹ|uPP 0S`Q/#P@Lq@BnK-0 K@`F4!0♆ 宆P+0 K0 10S AN| Y-X00  !0  BBK@Pyv`Pt00P!@ $0S<$0BLT5@9  E -L`Mq Px t `tKxKd!)t0x 0CSL1 D{@1B8SP-t0S x0t00t0 x0CPt0S@{pPK峴 PkP  `x0 Pt00t0 x0 `#P \0{ Vt0Sx0X  T0 0S@ AL@ E, 9 0-L@0LDP0P 0000}S$0{P0  E @L 0-LMMlPANK@D0@D0 "P DD @0W{! 0S$0 mA0LTh@ Ep -PLM   KK^(P 0S |0|0 -{l0 0PH00}S <0<0S 0"{0$x@ E  -PLM   KK%(P 0S |0|0 zl0 0^PH00}S <0<0S 0z0$Mx@ E  -PLMX   KK 'P<800 z(0  '4@ E,r -PLMX   KK 'P<800 z(0  L4@ Eh -LMM(BNK@D0@DP+(0 ÄU)0`P00V00S B.KQ B B 0BNKp0@D@DQ+a 磄`P00V00SBKA0A@)0KPP (0S(`@L p -PLM   KKS'P 0d SKKJ'P 0DS <0<0 z,0 0 Rx@ E 0-0@0P 0 0RLnP0  0-0@0P 0 0RL[P0  0-0@0P 0 0RLHP0  -LM4@0S 0S?9 0-T@L0LPSH %P׮40,0P 009M?  P- L<80 y,0  jh@ E -L-800S7 (0( 0S00/m?9DE -PL M0 , ,K0K!&P00 1Wy=00 #p4 tAtUy7d14  40SDAL 4  0S$A0Ay#$Pㇶ`4  0S 0PU @(y q0 PtP@ d ,040@ L0 P0R  Mt@0 EH\ X9 0DE -0L 6 0xE E -0L * 0E E -`VLt Pl@lph000x000H000V ,00h9 E@D@-p0@S @ T00R00S0S `P0S  0SQ0ѷ  Q00R00SU000S 00D 0-PLM  1A00cx P KKw%P 0S 0 0Gx 0 00 P0 v0@0S 0 S  @j@00D0HD 0 S , ,~0@? E9?@5 p-LPlM@ `K01 R R; 0S8 0$S \S0S@+0^ 0R 1N 10 1<0K  R 0S`0K  0R@T 0S0 SR 0S0S0K Ac000S 0[S@ $S \S0S0$\( r$300000S 00S 0 S 000S1C0K 1SQ <0K`K ! 1R 00 1R@D0 S,S : ]S8 0\S- $S' rP200000S 00S 0 S 000S1C0K 1S <0K`K ! 1R 00 1R0S 0 0S,S ]S0SU @@T0 0 RK ]R \S0S0 R ]R0S2:0,Sq ]S@n) r000000S 00S 0 S 000S1C0K 1S <0K`K ! 1R 00 1R000S1000S(0(vpp@5@ -$0L \00'0 l E -0L  0 E -0L  0 9 E -TL P D00}S8080S00v( P 0  0 E 8@d? 0-0LMS0 lKlP@tPu @0 \ ,0|v0ov000l@  -L MTr0$ S( D P8"$K(Kx#P $0S (0 2Hv 2 10S1Fv(0a z0S1 0 14v1@0 P00E0X1 `1!!00 00T11 PU @!00CS00@Ӥ0n@t0 S@  1 0U UP 00PUP00CS00@Ӥ0N@ T tt 00CS0? P0 R0@0u (4@ EhL( 0 0-PLM   KK"P 0S t0t0 ud0 00$pP@0<u   Pu0@0b@ E -PLM   KKʟ"P 0Sp0p0 nu 0$0sK0  BH( 0   [u 0 b@ E 0R  -LM00 @P  0 0h8u7@ -PLM0 ,  !,K0KM"P ,0S00 0u0 8 #P0 P  0S 4K1p] `0 p吀@ 00 h04dP_n4A00080S9b@ E<DH5    -MML M<ğ P,   % OKAOKA$@!P4  S0X C4 lcP@ 0X30X 4 3t3 NKI I tt#~1Tß5 01 PU  r@300000SP0QcL 0$S \S0? = r200000S@ 0 r2000!0S00@C4PE0CS 4At"0 f~4@iQ4 Z% P 4("  f~4 `000SP0S0q0#00p`1(t1`CP 0S 10SX1tP1 1h10S ,A0 t 0@0P,0 B xQ  |A "  ?iBΟP  PB $B (B |  tpbPp \ hbP@p @ _bPPp" U`/}P` 0ST PV 0ST  "Rt! Mt t1S t10ST ^ QB0T00V hx x1SLE x bPx1p x bP$x1pW 0S /FY}P 0S00@P}P`( 0S% 00:E}P$  0Sx *$ o*0$"Ϳ:.}0p@S *000@SpbU ጳ| |1s  |}Klp<o/K<00t*}P;01  t+n 1S0 1 孯Pt <P@< 0! pǏ" ĽP E;b  !1p` P 10`S1 l;0S, `;0S(`+0S!0S:L;# 0C\0\00A:0 pÏR0S*:M|*6P :0S3 |:0S/|ʟP*0S'P:0/P0S*@:#0 CR 0R00: 00CS00ä09 AT .P"90S9 ri B )0[S ]zP 0:SSPp :oP0@0x80S 9t` 0`q^K  48T0~Kl1 0h1 8  0YHp70X L@K 'P0  0HHP t LQ0U|1 G SOK <寺PX,{70S7 8q,| |1s ǟ $ | P0S |1@ 0@|1  L@K0@yPPU^|1Sh|`̪F( 0S6H"]qxQU% 0S6$"Sq$P ƟQ$Bş%0(@0LRşUş%0(#?ş%0(:f{P fP@t0 %[{PP(X%0l( %0X  h{P0%(4\ 0ğ$(050S(5  (^  کp /K(P  !R 00S S S B B0! 0!R0 0S S S 30Sp4 "p zP` NK` zK> jf2SPKPP3P 3R P R R xũp3(/K]P  !R[ 00S S S  B0! 0!R0M 0S S S 1SF X20S3"ip L_P"zO0`0K  f2S2 j2S P 2_Ph2B0 `SX2$ ?p(RU `|1s|Gx剻击 "  TtzP101  t!Ȱ 1St-01 P 1S) d%H`L1P@H1 0! pǏ1 O P0 1 MJL`,XlE850xaȾDԨ ,r4P\p@X3$8H5:?t99 @ L<":(H  b0@PP  (p` P PU00S, 00S( 0S!0S:0# 0C\0\00;,1$0 pÏR0S*D1G1S|10S3 10S/P*0S'10/P0S*1#0 CR 0R002 00CS00ä002 1SX-Odp0s 1S"0S 0R 20S 2o20S2oMP R  t(\ |1s|.x,*P#,0 S`,4 -LM$@G"n嬧庫@$lE -LM$@5"n嚧娫@<lE -ML M60H ,0 0L P$ D4 剫P@ 60SD4 ߫x卽PX  0SX T僽P\  0 S \$ D4H`D SpD4L$:xPi D4LT d P `   =]P   7]P5\P$   +]P @gX$R P$ p/+@/ox:Pkx@pgxPW3 W1*P0#03U0S* TD @@Tx`@ OxPVV*4 T4S 0S Y 0SD4L$ttT.T +T :+x/`'xVP P`3V U  R0305`1:` :xPT 0S U ppU 0S /6PpP30S t3tT$ 0PP m30S@3 0V@4 10S 1U! 0;mV BNK@D@D0!o{x1 @4 < 8  \ACKX1APA@4 PP4CKSAA4$ 84 O1!0?2cS D40`4 \D4`$0RD4 D4HSD0`$0Sr5` ,0 S, 3L>9T`l`5@ ? ,r@hl  EQ P-L`7 6۷P@ 0pSP' +Q 00 %Q r00000D0S  r\00000D0S PP0pS@00gp000000S00@ p0 00000S70@W0@ 20rP000000S00@r$000000S70@W0@ -LMl @2[0SX  +[0S<  $[0S$ >0P 0`D -LMP0  B -PL 0   -P- L0  z0 -$LYM0@,0 4p@` [K) %p4Kl  0h d `A bBpP4"0L@K6vP 1vP $LK 0'vP#LK P0zL0[S LK 0K0C0C0 +, 弹 %@$ ڦ p< 8 4 BK J4`J U0@S񟗾||DP 0tDPp 0PUi@u04S1440S (D(Li.$ U; #0SS5V4X24UV 4V00V00S30S#30S X X0Sp3|3 iX30 CR 0R0 S 0P0Xu3 00000S "01000C0W2 0BSpRdppW00X00S u2 00000SpW)0U0 U00S@$p0 @<2QP4@ 5dW(UpX-U848S1  8 V-0K`ZP4A PP210SS5V4Vڐ10StA0 CR 0R0 S 0P0Yr4$RB>K 0C c R+#$r8Q 00 S Y44044 1V 0  <徥 0 YRE 00S <$`0RR0F<,0 S x,l.<㡥 0 LhX EM@ @H DE0gGI  -LM00 (@(0 'h @0G -JML M@͟@<͟KK`4͟VSp(=(͟N_N=,p 0P@004 <P@0< 0 $ 4  Q 0-S<$gTU< g<@T $q < <Rxp

K0C 0C)00P ㆤヤ4S ~4 S9T 9Pz PpI 0SG lqP gqP=T9`0S 0CS0Y` 4P907pq `v  4S8P@80<HKP 4TSt8P- 84 $R 5P& 4DS8@4$P 4TS7P 4S 4  4S  p7 0S m0CSjppT7/4 Pp``@VP70S> 60S 60S6&4S.ʸ4S 4S'46# 0C\0\00K.K6 B BƟ0O4Sʸ4S 4S5BNK4@D@D+*P`60S7 50S 50S/pşP*0S'<50/P0S*45#0 CR 0R004 00CS00ä04ӞV WN0 S 4" VOl4#0 CR 0R00,4嬞K.K3 B B0Oh40S 30S 30S #4Sʸ4S4 S440@3 0 CR 0R00\@3P@ 0 CR 0R0 S 0`0C2P@ p`$30S2 20S 20S*|"4Sʸ4S4 S4T2#0 CR 0R002 00CS00ä0140@ 40@ 0 S 1 O4$Sx1 44t#a^4S2  X.TQ4DS0@ I10S$1 "@P004SC4 S0  4S4T 0S0S ,0 S,*? L999:@? t7G h  |  Eh `  ?5 -LM00 (@(0 ds偡@0$H -LM$ϟ@`0 _X0K, 0` 4` <` 0>Ο0Οp0 >Ο0p0 P` nPH H0S > 0RS ,0S X,00-S h>, `=dQL>P 6dD>0S H0S , .0 80 R@0  D0 H0 S  L P! =0S {=0S$NP00@0S@\<0S<W8= p 8=p.XMP0@0 H< X,,EnPS ,00|SO ,6P@/,L @G0S C0 S , @$<! = T00,0T  T,| T/0p0W\<0S 0 S,1P(<0S 0 S <0S ,x , ,0S HQ;0S 4 ; ;R,qL;"PX hPH0S h 0S T P0S  4 ( P@ 4 40S pW%,mP:00 x:p) ,00|S 㙠D ,0 00S,  *0S:p: ,U0 00SP:, R80 00KP0S;0 Z0 SI`#P0`0 `20: S ()0S00$9 &T9@T 0DS< 0S 000"QIpp\#Pp90  cp@80 S pWPdUOLȟ80OP< 80S 80S4(T0S,T0S X0S%X07# 0C\0\00b|7XK |ǟ0OT0ST0S X0ST7g4077 &P`ʐ70S7 60S 60S/ƟP*0S'60/P0S*6#0 CR 0R00h6 00CS00ä0 <6!V0 S6 W W,h$V 0S 0 UPPU 0Rp P@0S@0 nUP,80pS45p85 080> VP00P0  V[5#0 CR 0R004Ě4XK 0O50S p40S t40S \$T0ST0SX0 SX0(ğ@04  P`L0S 000@20 0 CR 0R00gV v V 00 CR 0R0 S 0`0O@3P@ 4p`~P0S CP iaoah30S2 20S 20S*"T0ST0SX0 SX02#0 CR 0R00T2 00CS00ä0(2400@ 0 St1 000@ ,O80 S1p 1p080@c<`D0SD [4&f@ RH0S R0S10S 8 d1Rp \00 0,K0 p{KT.x3 0$, `D0S`0d0D l00S70 @ < ?:\999  @?EH  `Od9 t?  7|5hp E9P4 0@P@@80S 00S08040S4l 0S0Si@㵝<㲝 -LM0 S 01 `0, 1 a 0 S00SS 4 0S( p͟|` XP L B500$= =0 >K 妬P 0S S5 Q<0S) |0S%̟L0P 0 j< <P?B1cSQ < ! _1SA l< 0R0P<X _\H 1  B< \iP,:(:?B1cSQ< `Va  V@ 'jKiKKgK qK mKo/K=KnOK@ڢ PW1S_1S\1SY 8 Y!1 (,10$10 <4<  4 KP"<  0jKiKKgK fKeKKcKbK aK$K(_K,^K0]K4K8[KK ğpP0DS00p PaV00 0Sd >K{P@0S S >K  iP >K ) \PPC -P430 >K EPxrXC0r/K1 彽P@SfP_Q ZOK3(K0S S 220S3 20S/L3(KKoK\0P1 \ S_K <@@PnP 0P R d2 0S82  @2H`] QA Q^ ^ 8 0@\@)0@0 0  (         $ ( , 04<8@@D  ! 1S0s`0a 0 \^(1  0S >K  兩P X@0P00  ,0 S,"lFL lHD98  ?P   Egfff@X 5   0  h  !X!4!t!!!}~!HԨ9!"8"[ܨ\"d"t""" -0L,MP؀0p0U$0 D @KD K `C@TO囼00啼?[\H0K @H  P<7֕ $0S $"lLlF"" -LM4 0S@0S[@9 -L 000 -|@0Lp0呙T\" 0S0LbLr0 0S 0b(r@(2(R  Q ,_fBΆDQAφA@E0<1 <10@! @10D!D1t00lH1 H1`0L! L1P0P! P1@0T! T10X! X10\!\10 f f  f f0+11b0eb+e +e+e 0S00 ?890HlFGMt  99ED?@5 -LM`@00CS00  ä0 Ha, 0$0000f@GF0 -DL$M0D ,0 H 00 @ eP4@ 3#3Q040 3@T 30S 30S@@S0SP 39[t30S \3d.[T3 0S44P(PP7fc0@H ,0 wP@ ,YL00000 4D cP`B000QM,;82`D H0PZ.4"0@0,eP 20S @"eP10S {Q0S 0@T4D $PK Q0S1Pb0S0@T 4TD  P T0S. +0A0S1PC0S 00<K0  <0 KᾯP900S0  T00S" 0,0S@0   9p h tE  @"9(# E@#hF?H#? G'lG 0-h0LM0 0PK!K0  t@T0(0 T0GT E -/L`PPU1 1U`U/0p0W 0Z@+9df.0PW0PdZ 9X0l0006Pp 0X0U.S100E 00EPEW `Od @`# -LBMAq0 S P 10S1  RAnK `F`F0X!Pg0 0wRP0b, Y兒10U B>K 0C0$  0 K(4 0BK @@ ǮPʰB00S0  ]U 0K0 +PP@00S 0S8 zML#G E@l#G'# -BML M7|'|70 t't7t L , Bd'P  0 SD70@7+ 87PP07@P(7(wP$7$gP 7 @7@@PP7 7@6@P@ 0S bcPP [cP TcPP NcPPP6DcP@6  hd&P 0SL60V0S 060@T$@ӧPP@ 0S cP cP cPPEᅑ5P\5  5X zP UP y40NBS񟗩````````````d````````````````P```````````dd`$`0`8```<`H  T4_#00#0\84Q440 0 0 Q33 I|3CKL1 MH3\  +6 <3033 xbP#h3% '2 2\3 2LCKL1 MH03\  3  l2 0"LqpI2202 2l0 2L L UP ,Zk}P BNK@D@D+bX2@& H04SBL4aP 10L P4嘔P@  L@1 0@$ D4 < 8 4D 0CKhAA A0QS R  1l1 Ẉ0S 1 ,dP@@T Ĕ @LEP0$ H? hl0 $: E?$ h$$$?,r#0 $$$?@:95d $4 <$pT$?E9  >9p$  -L > p-LMP0` 0S @0S )00@P 00000S T@0S  00$0 $ 00K`p9MDE$ p-PLM 200CS00  ä0 10S AV夏AQ FP  P^ @0 SP00U1P`1tV0X!0CS00Ӥ0 PB p?0a0S Q00Np@ P 0S 00S0xV0  00S 0S d00 CR 0R00! \0R T㡓L ph靓@?0$: E0H9 99tPp@-& @`QP 0R0S  0R 0S 0`S`PQ^ppph p-d d0LM\` X0X PPP0@T000p09 E ::Mp@-AaP0$S!S0S S001  00 h!h1!Qp0 S S8  S0S00 S0000 S S S "S \S0S 0 0S "S P00P p4 0S00 S000p9M9t8 -PLMp(c1@ 1QQ! aUU0p2V*Q 0S 0S ^0`2V:;ioP@U@p`0` l P \<&U0< UPEU?@%܇%h8%T%p% -,0ML  0U4|% -LM @ T 0 釖P& 0-0 L0C@R P嗠P 0 Q000& P0-L@ 0S Q 0PU*00PU:0h0 -L MS( 0$ S 33 P$K(K"վ$ 0BS (0 2T2 B0S22R(00S(0 2P 0SpήmP 0S (0PP@20S 202 ]T@ @^2 @^2 @^1 @^1 ^1P0S1@1P(0 z1d0S0`0PV  ]^P@pl V^P@ 0T.S@DpP0@4! TTp,, BP 10S11  V  `0 S R00 V   BP0S `9@'0,' E$ E?H't' ''x0'9Ta0?tS$E9LEX t5I'I'?E@'' -L`M"0pVQ@,0 #20S *^K"_oKң,ΣP@1CPpB@@0T"aX`@B @BT'P@+P@T    0nS1jS|PKP!GC0S 00|0[S@T P@V+`P@ Whp`@T 0W0Z00S ,P &X00S&0P  _]0 0=` 0@P0 Pc]P@P 0T0 ,0St,L:!H(T(X(@d(,t(?(0 E: 9(-( -`LMpPD0@T0R0 R 00@dP BP )@T0P S00@@0 800P000(@(: E -AML43M0ß@0T,0 p0 3 0S3@ SP @0S 0S 00@T@0SpP@ 0SBҢ00SP/S  0 S R?uR@GiBnK`F`F+\00S/S/00P+e\_PPE1X0Q  \ 00 1P0S 0|0lSd1d!0?2cS XH100$R 1PBNK0@D@DC00+0SX000Q x`P AP@@3000 ,0Sl,0L TO\O((( 5?7H EQI )@<),d) -MLMpp0 S( P`L Tq0SHHA0 @Q~BK@@$!mAP9 1$K R01000ӑa0CS'0t0dQ 0 \0TQZQ(0 S4(jhL9@l)t)))) 0-0L0M0@PKS@,  c0 0S\@0Sx 00FP, l 0   -LMp0 SԀ0@0mP`P 1[P (KG(0`P R rp000000S`P T 0S8@,P 5 )I@ -LTMa0qS!0PP'PA[ 0r10000S@ Pr1000PU@p V?P \1\P000 00200`KdKhK\0KX K T@KlK &, ᱠl0X T0 h0\P0 d0v.BL0 `0A BH0 0D @ 40 P"pP X0S 0h [P00P X 0SH@8WP bu05  E)I)@)<*\* -MLMBNK0@D+p$0 pZ᪌`ZP ^KPE`P@t0 K0/S ᄠ@ >P0S/S$0 S$Ld|** 0-LMH@0Ps0 K`p 0SPP0wt@ -LMF@P00s;@: -LMH H0q,0 Fc6&6KY60S |&Qp6\Ɵ  d@ ( A@ _P$ Q@T@dTd@K0 %]50PCUڔ5 ra@ ş@ş`g0%]p `P`Pp%5VF%T5UWPT  Ÿ@ ῟5@` \ B0%@P~]0 04bQ c<" =9 B =<" $8 82 0 S0S*<#NK\<8" 0 T< 4020bS aD"  BD" @2 =9 =D@2 yP@@y/ 0 ~%KHP;%.K|3/C0ur b@ _@`0#$] V@ S@`t#]%K|T3OK0ua2g 2crB?0@; #? 2cc#aw0S0S%NK/ uPڄŸ0 S 0S* @ @" <2S @ @d"`\N !P@1P@;%K 0 %K T~n|1Po0uv @ @`0!\ מ@ Ԟ@`x!\d1OK0uf2g2crEŞ0@8!?` 2cc,! G\OKᲞQ 0H~㋋HP 00CS00  ä0  (,0 S,7.AL:99*HEQ*,r&&ų&d&&&&@& -x3LMp 0@@,0 KH3H0b0P a  B=9 = 0 xP@x/ ~0 }K{ KP@/ uP @K ~]QP0吠KS0SLŸ HŸH2@K00 OY~/ ~/ }"ŸP@Y00 d!p[\P 0SL0SI@K]/ tPBڜ R>1 P@@PR50S1:PP@ K \~0 @KV~ (}B{ 1@o0ef2f2c BD൝P Ო0Ϡ#PE0l 2lADd`0 @n[@K᠝0 S00<@,0 Sh,=.A>P? L9,r9 |<,9ųl,@, -LM0`V *0i0`YV@: H1 PUP@֙`VA0S,0 :p0AT0L 0S :000CS00  ä0#  0 P@| 0 @0 C\0\00w T,0p0S,0 `VHE@ -L MD00 K4@p( P0 1[SP00@@ht@HE -0L M@K 0 K  3 -T4LK0C( P$0 05R+ +P&00S" 0V0 05R00Sd0 05R X H00QD`   $0S($$L\\\78 8 -4L M@P  ? ?'P#p4 l4 h4 T4 X4L4 ?<$Dpc@$40@cTQ2TIdP bA#P 9sP  RP0S00#ᵋp Y3  |C)PtXD ᰘ`3 0000C<0PPP8  @  aH 30SbHT @g;0"0Z ڨNHTL2%2더0ST. X:HT ׈H2p@4M 8倵PP({$yPP@ 0Kp; ,0!0",1" 峈pPa@) 91P  !0QF   vl1pd  |\ppT P岗pH  =p0 {p  @p ߷L0G@0 00Ddp\t8\$8\084\@8P8h8p88x\\\48 88|888X9\ 97<9P98X9x99`O999Y  -0L yGl 49 p-LMP 0S 000` ph `@,0OP0080 04 ,0 $00800<`ph\\\ -t@LM0 \D0,000 0000 04 $0 0080hH\\\ -Lq0P@T Ut` ,`\ 0SP0 UV@ 0U0A 00h1S`P 0 = 000 00}=00  00'<0 0 00h|00 00 04 L0 D0080 D0,0h"!\.99\\ Mp-L$MDb (0SD(L\\\3;<D:8P9\<= 0-PPL0#DHLy40$H 0 0 0h\\=\ -LM~KMapGP@+!@K崑威-@⮑ !0Kx6 K0C0C@^d F l6 zό< NK0 ,6 p@ 00K?0S d 066KSK?6 0@00 0A00 0B00C ,0D0000L0P0T0X \!p\\=\ p-LMP$PZ(PW@`40S8Q`V@ZphK p-LMP0S `x10 @T @T0Px0 0ph==\ -QLM`PDB0S00`00@r0S  ?00?1  ? 0 ?( R?$ R?, R ?`@4 Q 0 8h!0!\x?`V@3  0 @ v> 0^?   0 v>  0I?  0 v>  0\4?P:?hxM===\==>$><>/L>`>>>> p- LM0Qq`P$0  $ 0 0 }$0000 n K@ $K $ Rzh(K0 (0 r( n 0p\ -Pd 0`&@L6Spl06S s40 6h 060S 0P&00D0D  V $,$ h\>?,r\77 -MLM P, p < 0BS8@<K⛍<0@pK@0 @G 00T`K0T0 S" Da 1 S@KHK0hPK0h0 S XF ( R h{$ R XvT` Pg D@ QN 40S0@L 18SG\EhEEE8@4@1 0@冡940!1ZsNK@D0 @D&1804 04 1`1Z\H1X!_sNK@D @D8  1 40!0 04 R8@Z ZK'P  0f 7`0V P7 {NK@D @D0h L  T,0 S@,L(?4?D?bX?/\d?t??xa?? -LM( 0R@40 ,0 00  , $P 0 X 4 , K 04 (pK0!=0 ( $0  `40`V0 ZT90  P  ,K (, 0K $0 4K 4 `4 84 `V@Z0\4\ -LM90 @ 0$0 @ tp$`KP 0 0 $0 $4QD 0( S@ (K(\\?? -LM80p 00@00f$@ p 偳PP(p  (KP00P@@TP D (@ $K ဘ$([\\$\??@ -L M?q`0P60S 0 6 z+P@0610=S 0`61SQ0&P 0AV2p_P@00(F0F0F0v0 61 p 0V@ 0@@@ᔇ061S @0@$S `Sڌ0Td : ӌ@ Ќ0@̌0@6@ 0 J\ @H@|@@ p-LMd`0P60S 0@6獇0&010P61S 0 06p\-00S ^0 0-S_0 000S0 0 p-0LM0 S@PTl`d0P@pT 0s 00p\|x@ -LM⁁@P4 8 0^ 4 8`@UPSRPSRRRRRRRRRSPSPSSRPSPSPSPSPSPSPSPSPSPSPSRPSPSPSPSPSPSPSPSPSPSPSSRRPSRRPSPSRPSPSPSPSPSRPSPSPSPSPSPSPSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSPSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSXSPS^@Th00pW 0< 084p 0 00@@@ -LMP@T. p, .T`% .V00.R0SV t0000PtX0000P-T_T _TW$pV @A 0-LM@P@ .R r0\00000S0S0 S0 S K'PP 0 -PLMp Qi@[0T3* Rr000000S 0RQ 0 YHጊ``P0'S"S $S `S \S`F\000`F0@0T:V00SM`ALA p-L M`Pmp P 1巉p 0@`ޙܙ PK0  ` 1Kp@-0DST 0 pA`O9\|AA p-LMa 1 1<  1  1P1K/ 1@P 1@ 1!1 0 ,00 ` 0 00,000 0< 0 0< @  0 ,00P  0 00,000 ̃0< +P@ PK_ 0s ?' SnD0Ppp\ (A$ ] -LMp@J d*P@ K r 40R ,Znt  A 0-LMP@K  @@%P񟗮[D]D]D]D]D]D]D]D]]D]D] [\\`\|\\\]D]D]D]D]D]8[[D](]\\\X[[[8]D]H\T2c0P@ (6( ?U00@@,P00Z00SP;P   4EPEB -LM0p$0 8@K 0S" `V 0@0lP00<K0`v,P ;P @o l $0S $$LtE\0BEE p-LMK(P PU0 0`@T(>P" 0S0 % 000@ K0D0S P@T\W  r>0D@PU,0D0S G )pE\E 0  0-LMT@T@ D1 0R00$!00@0c!S0"c1AP0S (0s 0 (00$K0 0$ 1K2K$@/t H0#S D0S |1[ \00S (0s1[ 0S 800S (0 \\ \EF -LPMq0D`K0K 0 pP@#3  L00L00S H0S L0S0 (呓0(@0P,K TK X0 儂P0K[X0K   ` 0S L\FoP,3[A0AS(0HQ&l@K(  < $oP 0S 0SpF 0H0 T  P00 S$0 S $L\i F6i(F( p-!LM@`TP 0S0P0 @TT P0@00 v}P@} Pt` R 0S @p@p0S  0S0S0@0p\FT Q0S 0R00Q$ 00 Q\ -L0Mp0` 0 坨pP1 H@K( < G< wnp j0S f0Sl 0  ,00 S0 0 S LlF6i(FG -L8Mp0P 0 T`K0 2@ mrP@P-0`S PPP0D ,nP 4 0 S  L0GK0C 0C1 BS 1S8x@T ,0SH,L\ K\J,rp#@I0(:-HI|:\0TIlIP0-H0@0 80840400,0 \N]NM\7N\\ -0 0CS00LӤ0b ^00# P 0 000t0 00p PPQ8 00C 0000NM\N\7NN p-LM@T1PL1`P p001 0000S#Q"Q0P0`pQ q0 00000S-Q0P0`pQqt0 00000S T0PL0`p408 P,0`(0 00pNN]\MN 0-PL0@S| p0 h0R`0 X0 T00040 ,0 T(0 000N]NN\\\N -LM℠0SxpxxPx`0 0 Z@^L0 D0 @Y(000N\]NN\\N -LM@p P p-LM@`Ppp UP\PP "P H0D0@T80T0s@D0   0p4KNLKN -pL`P@xP000PP px0000D0SX0 L0@T<0T49@D0  0NNxKN -pLPBo@P -P_P p0 00000S0 pt0 000D\0Q`T0@TH0T@@D0  , 0h NN KN -LM$@" 0ZhPl. --LM @0| &xp !0S \5{T SH O<!0S ,,*$cXxT ,LL4 --Ll i0T T&LD !D080S {$  XT x, --Ll C0T Tx&LD ]!D080S z$  XT x, --Ll 0T TR&LD 7!D080S z$ Ӡ ϠXT x, -L`@P pR %R0mSD*0L Z8p` PD"@`PT@D ń R00  --L@ 0C<0 2/P@\H+P@`@@TF0@@0 /P@5 P@.T40D0 P@#T)0H0 :P@P@T0L0 :P@pP@ T;TT`0P0 0` 4` ;P@ <@E0L!!!?!C!c,B^ B^DHL@PP 010000012c12c1 C @00012c12c1 C @h]]l]]]^0^H^t^^^B 0-LP%fP@4 o0S0o P0^ p-RLMP@` 0S(0 ws000p^ p-LM`@ 0 cPPhx u 0 0bU *Ho0#S 0S uc opho^_4_ -Lp`P P@TPtTF;t 0S 0#S h9D_`__ -MLM$0KA ,0 `hQR Q Q d8 SKAA ld8 S:qX lPP vePP0 l(KA Al K+B 0d(0Rp8:spP@ TeP@ p(~oo>K0C0C`#8 sd8! SD5;<#fKA A`t(d8!M@S:rtP eP t( GKA Bxd(0@R:q|xP dPT x( )KA A#|(d8@S:rv|Pp dPpk |( PゎKd8H@ HS( ];KA A01(81(Rd8@ST:rGd0P1(> (PUڈ< 8 e `n ^n\nP(1S>K0CTnPU!d8PS 0 ( hX d8 XP@t KA hKA A bx40 ,0S ,L_G4^__ 1 P-L`( 1ȁ 0@Qd 01 00PVq` Qxh!0 MPTP *@ 0O  Q0 Q@L00CnP 0@0CS0@0 0h* 00CS0p@0 0R*< 0R ] ](]$]HD_R_ -LMPWmPpB 0@ S 0 S`ev 0S耟萟0 XPP *h lm`0#0O\ lP<00)() C ` ]$](] `_R 0-DP@L,000 @@0 0 0 0`^d0 S- L 0S S 0SP S   ]8` p-xQxALM00P06T1 P!QP3VU00GUX $ 0nS` lS0 P 0 R0 ,000gPc `0pS`0  qX QX} 0qD=0  00Sn _Pph L= R|QP=- PT 0nS` ElS0? P 0 R03N0S!\  [\0S \>TTTWU 0d HP0P > R > RqXG ?;`0pS`0+? `|? R$! 0nS` lS0 P 0 R0u|?`0pS`0? ? NPD010CS0 0nS` !lS0 P 0 R000  Q0 P|`0pS`0< pP0000  ^^^ ddc -`0` LRTLL0<SS,0 0Qڄ0x^t^^8`^ -LMܠPp@* W* 0 0S@@T0TbW`CPP l0 R   0P 0#T 0EE@`^Ld^ -LLM0 R8Ÿ" 0 q00  R 0  R1 A0 Sd KP& 0!S] 0SWʬaQQڌ 0  Q @0 0 0 S 0  {P,q$Q0L00TWP 0@0CS0@0 $0y00CS0@0 0`00P @@0@f^bRXd|^ -6LM PR,P l,K6\@Pp P,0 Q@i0! ( P0 S 0 !R %R  Qd 00P0\ST 0 R Rʤ5 Z5 P %Q00!Q`uTş0 R`l00VP 0 0CS`0e0 |80"00CS0D0e!0 0 Pdt Q`l000oVP 0$0C`$S0d0 =|00S? h@[3 , Q@p,  0 0,0P0Cs,0 0 00@b\s Q`l000-VP 0#0C` #S0 c0,0T5 2`V0 0 P-ꈂ Vp|000UP 0@"0Cp8"S08r0 0l00CS0HPI 0SF q0 Qʠ0 0@T*0 0P T:0@00Pa Q@L000UP 0!0C@!S0A0 x4000CS0u`匐0 QP\00}UP 0T0CSP0PP0z Lw0ld^`|^^Rc|a -鼁LMⴑ崡`0SU !@PO 0 SdP? pqP0003@T V T (1 BR A0 0 [ P`00CS0@000.S0 S&P 0 S R@ 0 P0`00`p^^^l^ -43L M0 00,  R W,T P@` <PpX آ 0S2X0@` T QڐR2 Q@L000TP] 0P"0C@H"S0 P4 000 S/ S- @PP pP `0S PP@` @@ {P|0p p0"Z%P@ T,@P0$ ^4 'Rd\a -LMq@P0S S  [Rb \RZ 0S  S0匡Pc Q| S `1 @ RD1 0o(0 Q`l003PP 0`0CS0`0 0X 00CS0@000 SH@P@(^<8^Rdd ^R ]R 0]S S [S  0]S S]R.Q =Q:Q R]R 0 S 0R]S -PLMPP0`@p T/ 7P* 0 S0 S00 10BS gR  00 ]p00 PP 0P0 P ^dc(` -SLM p 0%S 0 R ࢟ Qx0  P0 pg \PG 0 R Q0"plR Q@L000DOP 0,"0C@$"S0B0 0g 00CS0A000 R0 pt1 RlA8P X1 0R S 0`00P 0S0BpG0` Q@L000NP 0 B0R@ q@0k ho0 lY00CS0@8h0SL(@00Pi0F^ `0`(`R^p^c -2L M0r0l^L@4 , 0 000 00,qP`0 0bZ4 @R  P8(PnP!0@00`U@T# U T00CS0@0 4 @ 4 0 zPP00CS0D@0 0t^^`Ld$` -LM " P2 P@" " q ğ0S   ?KRPW"R 20R2 84bPU$0S4 /Q"0S \ 2 1    ?K#P 3 `d 0Q,V,K 0S 2Pß0SH# P030 P\ 0 0%rŸ0 QP\00MP 0"0CP"S0R0 W0 P00CS00B0 B0 0o࡟0 Up|00KMP 0!0Cp!S0Uq0O L0n X00CS0$b"P U" 0S  gP0 K9P0x 0uꬠ0 Up|000LP 0d 0Cp\ S0Xp0 0" 0M^,`$`,dR -L MH0 @\, P40 p( 0&S \S~ 4@TM0 P0p 0cS3 Q 00c Q@L000LP 0t#0C@d#S0\C0 n*0(00CS0C0W0Ȃ T`l000gLP 0"0C`"S0xb0 30<00CS0 00S|9Sz400CSv02 @`1 d Q Tq, 0@TPgꔡ Q000LP 0\!0CL!S0D0 0=00CS0x0 `@0 dQ T2, 0@TP(꘠ Q000KP 0` 0CP S0H0 e0 (`0`$`,`R -LMؐԀdP`01 ^, p@PKP@ @q0@0 A0@0,A0 00(K@@R -LM"0 s8 < 0s BВ0S2  @0T00@D ڄ0r 0S?AAA00 00 0 T0@D0#0 N @0?T@Dڄ0qa4PK0 d 1 0C 0 d 1 0C @D /\ `Fʀ1 R!PX D0 80!0C,!,<S0(A0000 00 0@D0 00 00 00  00 00 N0G`^l^^e -`L0 0Cs0 p001 R 0p 0Cs0d0d 00T T00@PT P0@JT`^ -LM@`"렃0#Pp 1 0#"pN H0@*SFtDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD  0 1 x"Pt2pP(7\"pP2CD2@2 @bTaz$"0S "0Sn ! 0 g!0S ZY c1 1@DQq+_ PP*N0S0E= 0 0!Kipp-u0S?T%w  q 0S 0S  BKL1: S 0S 0S BK~c0: S.  0 0 \$X DX 8],rX`L` eP`d```,eT`\`dee  -LM/@P 0SP :0/S P:0/S @P:0/S@P:0/S  -0L|M$ ɄP  00 ᴅPP  30CSHHHHHHHHH00  UrQr 0S9 3SP$    ` P0$00  $ t0 p`/S @ 0T/S/0000a`0 S,$r0 b`Ktp 3S @0 Sq 0: S 0: Sd 0: S; * S  S QP00wd2 R Q/Pm QPe 2 R Q S  S S-gQ1 R1 R 0S 0: S; !00hX!\LLP.@q  D $ q? 0S q@ 00 0: S   0: S0 R0S @0r@P3S0@0e՝0S j<v\LȾeL``` ef4fd`̙0# R00R\R0  QQQRQ -LM0  SP #@TY6 1 R,0  !0S [[P QK_P  0R|1 !ᯰP H89 P}[{[  !'80[@Jp qa[][0\0Kl0S4  Tl,X !LNFP8G[4`8`P`X`4\f d`T`\` -LMMpA^K PE0PE` @ 0 Gp 0T0 @PxphPP\0P 0 S @ @(ᬠLlf|fd`ff -QLM@l 0S\TH~0S@4 40 0Rh.ꁠ0|ffd` -QLM@p 0S`X H-=0S@4 40 0RhY0|ffd` p-LM0AP: #:0$ h?`L3c0(  ,0D?B3c 0kIP@BV;  ᩁP ՛0S $@0<0V$ ጯP @㿛0V0 LၜP 0-S |l@pL0S LDI4p Y$@<`Mbffff -L 8FKP郛0 R  џf 0-,@,PL $ 4f(g -ML,MP:L:K@(L@:L , @0 `gS0*Kp KKZHLH000䩟੟*P0K0L0 0uS0nS0 0 0JK(@D@DxP l P\7K@@ 09H0090巔`0wS  0  P  0 @X@H@L@P@T@u -PLM@Pp`(0S 00wS` rS`U |0 0 0l000d0000  bVS`SD>T@H@P@L@ -LM 0K# tiP p-LMD0@S PH`U ;P)"P0 D0` 0C00  p 0-LP@@0D0HL0 -RLMP` @10@P]T@TSQT1Tq 00 @0D00@Dt p000 V@O@0P00 V4|p V00 0P00 lpX  ec8 000DP  O0 0gH@L@ -L Mp@  T,KPt $+K*K < ^' K)K&K%0K(K  ^  $ K` 0# KT, K< 080  4@ rB0000 T  <Kq5 0 pS  LL@u -LMD0PSp NRL @T D@H@)*P0D0@ P`.  gsp0P $ 00P  00$ 000 P@D`  L`VD0S0S$@  g<0 cP@L@ȠR0@-,ȠP @ 0"\LL ^NNQ0RPBu 0PEu |2\x2LL7&c2c0T2RCV]EH0PE0 0  0  0  0   0   0   0  P @l1'7c2Tb"U cbUI U30 0  0  0  0   0   0  0  PE U @PEu 0PEu 00'7cb2" cb0q[ -`PL p@(.0(Ã$H7c"( 2'H@`c\@^B^BN00QA>AAQAAq 0S 000  b0 QŒ00 , P080!Q,000S,g`( -0L0S(` p-QLMP@`p00SV@+00$0!0$D"0$0!0$D"0$0!0$D"0$0!0$D"0$0!0$D"0$0!0$D"0$0!0$D"0$01`FV$D#V 0 0$01`V$D#p(`Q  0 " p-LM`P@@Tp -`PLCM p4 7 0 (1 0JK1 R0ڨKKK 0SK p ?@`PK  R p ?@`P4!' P@-P $ RS΂@ 0p`809 PL0  (,08<lPP- $P Q <01 Q0C 80<<ࠓ80 p-RLM@` @0S01RPPU pPp(0 PS00P(0,0S00,0| (PpVF20`f$00FPS0,0$0p040$`pht0%0 0X00L0 0T00P0go -$@L40pS` $P0 (P4(Q$ 02(0,00( `cV:4b=(0,0000004PcUP!f =`V 4f =(00` 00( 0S00,00`S*0,0 -PL,M4 8 ] $`VZ 0SW 0S0SQ0 S 00440@  < 8 0JpWh: 0 Q7h威pG:hQ D*00 0Rh S.0L T0l pl0T/ PP0L 0Lh 94 094 000`0  h0S*T0 #L B ,K Z<+[0SZ0Jp[PW*Z 0JpW:+0[h pc8 VP0W*Z  0JpW:h +0[Rpc8 00P(pG*P0W*Z  0JpW:+0[8pc0P⨁pG0W*Z  0JpW:+0[8pc0 P⨃pGh` 0S|PEu PE0u h ` h0Sw:0S+ S 0l@LT0l` T/^p0PPL Gl0`P00X0d 0XpPP0L 0 64  03T 02L0C0,@K ;+0[SZ0Jp/,0[S ,000 /[0 [0 20C"[0L3  ;/ [+0[0SZ0Jppb82[+ [@0,0[pbS80  0@54 00H000HQ W*Z 0JpW:01@ 0C0 @ pa800X 02P0C0,@K ?;+0[SZ0Jp,0[,000 /[0 [0 20C"[0P3  ";/ [+0[0SZ0Jppb8,0[+ [@pb8&2[ D0,0[ 0H0HQ W*Z 0JpW:01D 0C0 D pa8H,0@D 00lR0034 0f@Qt H D0PaS<@P c 0 PeU(0@Pb40e0eU P@@0UP!0ee@0@ 0<PU0< @0S @ RK @0< B0< @ 030S4 WZ< 0JpW4H@ l0@H 0Q00 < H0c 48(4<,(<4 <@SH  14 000p00 L 0L0 <4@(08SR :%<,0RP0 e0e 0L P0l0W0e0l0 $0 4#84p$`0% -L|Mp t x0 p0pLK W R *t0  0 Z00: LK00SP Y!Q | x ,@K0P00@0,0K0 2K+PKw8x0 00o8P|00SP| |pY100pcQWWQڀ p0R0P0SKKplK 0p Wj0K Z*t 00S 0 000峠 Z:p\ \   T#T3̠ 0 @@  9x0 p [S\!`0|p  0 0 l0 Q0+K,0KK `0,0KպKځ 0,0K0 "K0 | BPPd06 ,K 7U G0B @T0DLK `0`0C`0 W< 00t 0p W0^ \ l0 R|00  *00cQ0 R:p [QR! C x0  00 0bC10@0 V,0K+K"K# \ 0S x  p +K06  ,K b7 G0B @T0D```Vx010 nnqPqu 0`q@3 -Lv3 -L4M@P\ &v0oS000 gR   0尖mS000 0fR   `X0 T0 P H p&vmpH0@ 0S񟗇<HT`lt```H  P 0SB 8 1 -R1 0@cTQ6H0SL P R/V``X00L` L0 @T 0 000CS00,K 0\@0S0 t,0 R0 X@ 4@ PL nPP `oP@ 30C S $$T$t$$$H RI 0S 0S @ R4 @4 L00L0@8 L00L0@ L6P D`0S @0SD ]P Z 0S0SPQ TX 48P ZTX {F@0<> Up l`[0S <`[0SP 0!R0C0Ss F4K8 K0K)7P0 #80@ 080 Y`V+ `000CS&,K@ 7P@0S ,0 R D@ @ = P @@ F "00>P< @@ +0S :@P` _X 2T .P@ 'pT IX 0S0S0L04]@@P,rddddvw Ⱦ̙wt0w -LM0@Sp SdP`^0   K R W0@hw -L M0@S $G^ 0 K R 0^@xw -t0LPd0 R X0XP PP00L@0( 4P000(dd 4twdww p-LM` `P0@0@\  0S 0S 0S pm -LM"40Qp,0 x(P^`0@0 P`O 4d[$K4@04  PN$\P4 K` 4KR>K0C0C @@_`0 K~KpGdPpGPU0\%S>R0(5 5^ x$=L0OT H$0\%R !040US  Z$08 3 #00\0P1Q>KR>K0C0CE.KpW B04% 0 45Po0C45 |0\%t3Rh 4!0. H3 \5<#SM>K0C !? 4%1 @ 0 0t/1E $pWZ`P2 ,0S ,40 S00X' @BNK @D@D0P9'HD"P0\%2R  0S@2 WM>K0C !RBNK @D@D0 '"PWdd1 \5S0000 /PL1 kC \5S0S%P0dLmTmDmdlHmTXmPm0q-P 4 `_ PZH4 R 0$\lQ11Xu 4 R 0\% R1p((0#\QE  3\(Q8 0S:0S : (5SL3\%Rh0  0S0$#\Q  0@> S` @CT`0t0@DT ` 0@#? 0S:0 2 R @ R0SR0;S00"\Qh0 0S "\0!0Qp"0Pd ( cpp00 8P`1 R 0!\Q00 00 d1\Q 000  PPu #0(!\Q  (O0!\Q0h0 0 %N00 R 0 \4Q000'u`()P  h0\%R4040 O 00 0S0 #  LlTTmknHjjTk$ljj$m\lmm|llmXldd0n`tlj@n\n`lknn@ ,r -L M0` p0P0 ,0 |X00Sk8"> R,A2   (0 PH0 `X(0,0 e! 0 @Q6 P3 P' `| R0pl0  0R 0S R0R0S 10S0S jP+  0 R bq dP0,0 0  0@YTn Xl<<M mhllrdmTlo\no|l0odKMK 3-P( (\0S#  R0.S (0&(00\ &"F 00CS񟗍<  $ $   (0SX ,0 S ,, 00  & 5 R E0 S % 00P%00C0 r0S$ (\NK @D@D0@$S^K PE0$0%5 R mP (\00(0S0 R$ 4 R4 R$ OhP M0:  S00044 0 0^(\OR$ 0.SH(00^P[S0 41 R33 (K(K  (K0AO0KK,}0S<3(K (K ( K(K0(00\P000 Q0hNK0ᴀ(00(02  0`0C0 @@@\+0SP (00(0P l"00C0x">KMK P8"4300@2P \ *P !0l!00S 0S 0D0P>KMK Pe(00(0 1  0`0C0 崀t$v@P_ l0S V0x0P\0 R\ 0SY F<00M0 tlLlXld`pdlplpmpp|ppmpp|lpLkp qqo0q\qqqqr$r/1(K^00!1\$ł0V`0U30/>1 10S|8K01$E(K0!Lq Q`8L.0\Q0 T (K0!K010X00P%0\0(K0!\0K0/>( `000/> (K,dK0$5S A h $5! l `0S10>!d d0 `8K=K !0K(A0A(K@1 9 =K(@0@ SK@ X8 ZK(AD0A(KD1@  K0848 00C bPX 0 2X0X,8K01,D0-BKK4H(KL!00(K!K 0,00CR8K01;1 K<K f0$5S8bp000$08K41K( 0,R0 Q 0( Q,0,00K0:\%R KK04 x00Rx x0(K0!Q0t0Q0 ɟ0 RP04080<0@0D0H0L0\08K !LK0pL5(Ks K00! ! PX)0 00CSp" T" H" H" H" T" 000  0(0CQ 0\0 0 020K 1PX(K!R 0R\0 0020 X B K8\*K08PUԧ0O!> 00R# PU^ ^ $0'0Q$0.`0!008K01K8 > b0Q0cP4 001K088K`81SK<\K0$5S,l p@h0PX`P  ^ 8K01$%^ࠡ101p@0SX^ K0$%^ࠡ101K(@,@$K0O(LK0PPL5Ks(K$1 P50K?NDePx4 ,0S ,(K@ P 8KD K0$0PP 0K8K 4!AP84 RK4W K(XK4&(K4!cP\000/ QP(K4!K\0400?000S @}@TK( X(K,!X"XcQ(K4!K`0400/ P`000?0P00S @9@TK, X"P\02QK4K\048K !PJ K@h8{PC K4\0T"SK4\00S\08K ! ,Q(KK4!40?\0000S4K0(K0y8K41Q(KK4!40?\0p000S4rK0(K0]8K41eK@p%P/ K8K4!  %(K@Pd0 0008K01$%R(K0!8S8l  000DLllPkPhXTtl mdd ~T kmxspLkЁU  l|l4Plhs0 @0R`0 0020K0 8K<PU8K41x0 RU0R0 QdK0 0#0>PK$KT1 (KK,1̠A/08K(K0 !P5MDA0S`` P 0S |K0KP%0 00@K/0>$1/01^ K0`0T30/>11K0=8K01L 0@KPo002D P Q$5SlB0S xj0S PK0X K$10 $52 X^\0  0 00 --L ɉ4 p-PLM@P`l0l R LT D0 Rp80h m: 0  h㢉,Ys --L  --L  -LM@d h8d --L s p-LtM/Pj@TK ЇP0: S p0`rS  0-/L@jPU+D0 00/00(+w+s00dt -LUMpPKP哇P@lK8ጇ0S(0: S  SU P U@P P@0 R000K@hP h1: SD hc$^e`O t,t R 0 S> {g0Ss >.@@@0 > @@ @@ 0 0 0\S PP.P(04.4<00kPMn0S@T = ,0S ,d=-K B BP CPd5PTt%x $O2,% @004Pd5PU8͟84͟44-4=4 gd5U `e = R0  V0S  C>000, 0,0 t010C@_aK0Po0E" $`PaNK  0X Z0S0<cQ0K QQ " 000S c0S} Py  00H0cQ  000cH00S c0S_ P[  40L0cQ h  400cL00S 8 c0SA, P= 0P0 PR @0$g@P0S c0S# xP 0P4 TR @4 g@T0S p ic0Sd _P Y,5S05 FS.S 8 0a.KS>0S Kc0S AP 0)\(5Qx@<@S  0(E0S 1c0S 'P  iH080@_Q l n H0S.0O 0S  c0S P  hL0@0@_Qu P L0-0O0S b0S`P\ $9 X0S0,%R0S0L%r P%0 0p/>1/$E0ࠀ1TPo`0W30/>11=L 00@UOX @GP%0 0P/>1/$E01T`0U30/>11=`L 00S b0S$P  7\%R0000#DC0xQ 0x@0S nb0SxdP 6\%R0000A#A0tQ l0t@0S Rb0SHP E 0S 5 R @ & L L3S 0X%58 p= 0000`d 0hLCV`@0 `P FXT 00 X@0`P`/>0@@!~ pāO_P``5!?VAQ!or4PW PLDf4PW \p4PM TPL4@7 0,H,4P0 ,, T#T0 ?>T(0#3 .C00(0#S P  5 3  4t3d@+S@0T@PF uPfx$Rh q*$2 2  2  Q0 0 0V0S8 "0p00Lu 0P5?T5 V>X5P%0 0P/>1/$E01T`0U30/>11=`L 00 p0 p?P 0S" b0 00,%0aKS><0(5 H0S.0O \ L00O ,P L$kxlkm|t\n|lltl(k(m8mtm`lpltttuXu|uuuu\l,mlЂ܂p$HlTăPk T$<Tv m4vmXvXlm khm`mdmkkLk؄vl(Ptlpdll(kw,wPwxw؅wxlwww ,rH0 0 0D5Sl0 0 0w<5S_s0P O@0 0 0045S+H0S0O L0-0O 1s1 P1 P(1(! P P<1< T1T hQ0 0 0xx<P  0<0 ]2P 00 O~$0!Sv0c 4a "P{rcjk_ <bc_ Xbdd -4L M , RtPp1 xdx@ dğ0`$ȟʠ 0 pP8ğ8  \5 SS P1s@, Sς S3S0S1s 3ß:0,\,՜ڴP,Ռ\%l3R X#h0 S,d0 0B RR,<40L\?>\, rd0OSh" #&l  ?"2Ÿ`V<, 0 B0_@r h0/n0S ("P! @2 R,0,F_1P@h00`T*0 QP@T:aA"b!1\%R  1  0COL1H $0C.O (0O 0-O 0?O 0/O0O 0+O  S0LRK,!T't0lȟ 0 ʠtP@8 <0\%40RR ,$plzmlkTTwl (L(k\lPxxp$k -PLM@ 00 R$ha|lx,Y -L$Mp`P@u Pa0@S pt3@  0@T , q830  00S, ,2WC H R R2!" "  0P 00C   I 4 0C^Q0 0C#0 0 4`0080P40 00pp, (! @| ,000, 80D 0,  ? 0 @  00P8 H $@ 04 < P U 00S  0E000D0@ @`0@ T0,d 0S d H08/>/1@ 01R`0@\30/>11< 0SU0 0Ŭ ũ,P0(  <0Q`,Pdmy -0LM@H HP0T \妻 hedAHy\y 0R  0R 0R 0R 0R 0R, ,0R0 00R4 40R8 80RH H0RL L0RP P0RT T0R` `0Rd d0Rh h0Rt t0Rx x0R 0R 0R 0R 0R\5\%R -L: S  S  S @0 R8` S S  S S\ly -1LM `RjDP@@ 1T1 RU1 RQx0ST X1 R P_DQXp<_00CS0X0@ӤX0/FT) T 00CS00 R0 0  0 yTYT nTNT R1YT00yT  R  P00XG@@_40@,|l\nlxllyykyy -$$1$!@@@L0PP; 0pP `P`@ @pp0 Y`V`T$d0@0`P00T  RP 0X  @@X}El mmllz -PLM@Tp` 0d 0 S& @T@T$ 0 @TT  0d 0000 0 @P@0S lllm z -P@LM `d O0P@Sp T0LL 0000 `00Slxlpmk -LM 0@S pW` 1W`  ` `` T 0 V0 `8 = 00d Ls p0@0 j T@Ű, 00 Zm,rxy܆lxl p-X0LM`\ P@ 0 ($OP p/ ]|l\nLz -L0 M(K0!0 K0pS2\%R PHbp2 R 2 ?0Su 2 R\ BbZZ@T T PPOMUp@ UQ("(0Y00 0 1 R+ =Y1 R APP0K P1!@P0 ]0 0 \PLP 1 ?g0$!P@00 0 0S04PJ 0 84$0@4(0 H4030 3040 40000UX@00K 0gLxllT$km|lllm m`z\lkpmlm|zzlz -L$ML"@`_@0K< , )"0$"@@K< Q}, |pPt  @K,0sQd 8 \)]8 0` Q4 J40@`KOA0 ,p| R0,0 @pK@`K0@P` Iq$ 4R- @_dXy!?'% @K`pP@4`0 p\80080 @4`00p`V4` 0 .8H /H\@ l$ emzz`l4`4{ -LM@@K  P, 0 eQD`/ᖁ0㒜,@) QQ,0 +.0 PF @0K87, 0Q6`4` \0pV o4.  , .@ 0R, 4pPo@pK`p`@_ 4f@@KlP/l^\4`0p`V4` @PK@40 @pKm<{D{`4{(m -x2LMP`"08 PHb0SOT(2 800jP" 1S2 1 800jP!80Q/0ORQ \ 0!0R#S \`1`0 0 p_B 0/0!S 3S , 0 \@0 0 20 0 R!0`000 2 \0t\  /80Z0$00C0j0$0 \ Sull,m mU ~hl -L@000c0Q3@T TX0X  0S  R1 018Ġ({L{p@-8`PL\ j Pj j j j j j j 0 Rp!>0  ARp" @0O0 \p @0#O1A-8pL\  k Hk k xk k k k k  00!> ,A "`P?HA0?`P@0A-8pL\ k l k Ll k k k k  00!> ,A "`P?HA0?`P@0-8Lp\ l l l 4m l l l l 0 R!>0 R! "A"!?`P0HA01 ?0`P@0 -LDM@PP G@ <UP ( ! PP fY sY !1 1 !|9p10S  i P| 0 @PX0P @PP8 L  8K0` p  $( @8 4@Kp`,PL  i  0P ,P 4` % !00y눇4-ȇЇs XTq q ( -p-L M$`K 0P$0 P @ P00 0 P Pp -0-L0PS @ CQ0 1Ñ0T000S0 --L <D --L 08 --L M((K0(K 5P0 R \ -LM@a  -LM   K 0KK  p@fT4 -LM @ \K0   KpBT0 \ -L -LM@@0S  hl,r -LM@Qp$ pQH<9 -LMM B~KpGnK0pG`F+`F(0 ʼ+ƼrPÏ)PP"KAA NK@D,X , 4h 0X S]V|,`4 0X UV`L$BpDa008 NWP6KAA EWp@S0S' T 880S@TT 0S 0@T8800 |  SpleT(0 SH(+xL,X LTK0C\J d 1 (K 1(PK 1(`K <9 @09 ;9 99 唠@9,9 0 (K   0(K0"L0dPh$D`,\x8Ў܎ l DoHs$Ⱦ<h$o 1$0.1^0 `0T30/>110SQ:0 40 c | R P P r ?CKPY 娐8 0 `00P @xx@@s`0@PCU ?%" ?WᣎVP%00/>$Ŕ101\0 `0U30/>1 10SQ08 0b0P @5x@@0lE00 Qˀ50弐U@C B ?,``0xQ08@@ <4pǏS 84S*C>0( @N`C>⼠0 ?@0XW0 80 0c0Pp@x@@0Ħ0 Y Ć0S 0|  00 00 ,00P%00@/> 1$0.1^`0T30/>11=L 000@嬗`0xQ0 00 0-O  ,@5L 2000P P@5LV>00h0 h0 S:h0`8 0<0l8 0\ x8 0 0R0E>0XT0P0P0HU0 00@0PP40@@ ,C> `0]0SO0SOP=` p`8_@%0VO 8C>0LP@+P@_  0`@_0 ,0+0C@0P@?>0 Y-0SO0 OC.0S 04 0 @4(0 H40 30 30 40 40z0S=PC>0 @4B/ d p` @ȃ0 P@T0H@p,lP4i"/ `P80 H 0S'P@'R *0\%2R2 \5~*0@Ÿs0*l("(2Q0\50S lE P)P 1  Y0 00! S0:1A0[1P& l1*0`,0V<d1`01吀KpW,d1K 00@_0 A0K d  P@0dPF@cTc@#t0  PSG0`0,0VP00S  l00S! 40Ph>Д(8TT4$oD Lsoo\ds` (oxo`sTsL(p0SP H@ 30 30 40 40EP  `圀@0*00YP=T0Ypd  0 0 i R 000 0Y0@a 008P40 H @@HAt 0, ;00R,h -P:L$M, 0 0<$哀`R84S*C>0 ,@ @K00@_0,A@0K d ɟ9P@3ɟ0/S0S*(t{\,@P0 00 #  h04 h40@ 9 Y 0,@280 3000 /8 00h @0 0娀t0 x0 0Sx0x 00S0\& ,0p`0CT+ ! 0ȟ0000wq0t0x0T T0 1X0 X0 0\0ǟ00\0/>`00`0/>dd 0R%h˸ 0,0^ 0,p4G4'0S\0ρ0 0! pW 00C 0,Pk4XgF`V8r6 R`0 >0   p&0SG0dZD6 RT000T000`6 R 0dC @XPd:P5P5p`PYd@P(0 0P p000 508040XU 08@P# 4` !400400800`ZD$0S`0ρ0 0 ! $0Z0$0l4 80 0S 4j`@80T04 R`0  00030SG0d3 RT000T000`3 R 0d @XPdP5P$3p`PZdt@P0 j0P f}p0002 80 0SژŸ 0X!0h14  4 0X0`" S!0`0@Ÿ0 0! $00$00X8@0a0 00 S 0x 00 Rpp@WP 0\%1Rl@P\pW,Q,` 00O1d `p 0F00S080Ճp&.ࠟP0U@l0Px0@U`,P0 0 O2d 0O[00 0080p `0x@`TWTsoo,o`sPsU ̕oT -LAMK@Pp,`1Y0A SA A Pp ` 00!  ,K01B00S{FOK004P0 08`(G<  (G`[~ [~(G`@@<@TU )G``b )GA (G)G7%)G7%0 ~A(G*(G*(G* ˯"A(G" )GZ )GZ 5 6A(GG(Gܿ(Gܿ XLyC(GG(GG(Gzy |kKA(Gzy(Gzy(Gzy A(Gzy(Gzy(Gܿ,)G (G9=(G9= ( ż~!(GL#(GL#(GL#AC!(GL#(GL#(GL#"m!(GL#(GL#)G%QU!(GL#(GL#)G@H!(GL#(GL#(GL#s=!(GL#(GL#(GL# p)<!(Gڼ(Gڼ(Gڼ#7s!(Gڼ(Gڼ(Gڼ7!(Gڼ(Gڼ(GڼԪg!(Gڼ(Gڼ)GA Xh!(Gڼ(Gڼ)GJ< !(Gڼ(Gڼ(Gڼ-Ħ!(Gڼ(Gڼ(Gڼ@a(Gڼ(Gڼ)G {!(Gڼ(Gڼ)G DZa(Gڼ(Gڼ)G j!(GU(GU)G  09a(GU(GU)G >!(GU(GU)G na(GU(GU)G ҉h!(GU(GU)G ;ba(GU(GU)G P}!(GU(GU)G a(GU(GU)G i!(G(G)G fa(G(G)G c!(G(G)G a(G(G)G l!(G(G)G BOa(G(G)G y!(G(G)G 5a(G(G)G o!(G(G)G a(G(G)G P!(G(G)G #a(G(G)G ׳(!(G(G)G Q0a(GTP(GTP)G G!(GTP(GTP)G nma(GTP(GTP)G !(GTP(GTP)G a(GTP(GTP)G Xѕ!(GTP(GTP)G ^ a(GTP(GTP)G Z3s!(GTP(GTP)G ~֖a(GTP(GTP)G !(GTP(GTP)G HCqQa(G(G)G T!(G(G)G * a(G(G)G 'T2!(G(G)G ma(G(G)G k!(G(G)G Tora(G(G)G !(G(G)G ^a(G(G)G hw!(G(G)G Mcaa(GU(GU)G s!(GU(GU)G dma(GU(GU)G ,5!(GU(GU)G *Ga(GU(GU)G !(GV(GV)G 1 a(GV(GV)G ̗!(GV(GV)G a(GK(GK)G m!(GK(GK)G `ya(GK(GK)G T!(GK(GK)G Ra(GK(GK)G ^!(GK(GK)G ua(GK(GK)G 5!(GK(GK)G 8r{a(GK(GK)G 쨣!(GK(GK)G 7ƒ4a(G(G)G YY!(G(G)G XVza(G(G)G -u@!(G(G)G fa(G(G)G ?/!(G(G)G sea(G(G)G N!(G(G)G a(G(G)G Nzz!(G(G)G ^2a(G|(G|)G }E!(G|(G|)G &a(G|(G|)G ۡ!(G|(G|)G  !a(G|(G|)G #H!(G|(G|)G iCla(G|(G|)G u!(G|(G|)G I:&a(G|(G|)G ËbW!(GG(GG)G qa(GG(GG)G A!(GG(GG)G ^Aa(GG(GG)G c!(GG(GG)G [a(GG(GG)G !(GG(GG)G a(GG(GG)G c!(GG(GG)G K5U>a(GG(GG)G b!(G(G)G “a(G(G)G F !(G(G)G a(G(G)G 6O!(G(G)G E!(G(G)G8 $Bu!(G(G)Gxi lUBua(G(G)G ,x!(G(G)G -a(G(G)G Sf&!(G(G)G k!(G HF(G HF(G HF?{I!(G HF(G HF(G HF?PQ 0`004 00 080^,0@ d 0 000KTsPsU  4`s -T"LM0, S2,0l.,PPbR@ d  0 1Q) 00C 0 q0S\0000  10@ d  0  0@`1 00C0帠,0Y ! #4%+  (P0@o%,p"P`@0 `  x`0P@`pd p0 0`P$l0@ d0R0x , x ,,0 00 o5TsPsU `s`o -LpM\pP Ph0o5G,$mPD0o5G,, @ P0 "$oo4oXs -LMp\ 0P0o5G,$m\00SD0PH0o5G,, @ P0 $$oo4o(o\s -8L0@S" | d P 0S0 R00 #L10S0 #1NĖ -8L0@S!d H $  00 R0  00B0  20 10ܖ -8L0@S!$  @ @ @ @ 00 R0  00B0  20 10 -L M@H Kb0s4 A[TP @TP@ht@ - L0R P$  -LMP@p1儑儡`px!9!pP@4 "P- $ , $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $  $ $ $ $ $ $ $ $ , 0`0``p0 PbUA20Sh0aa>X0W 0 Re,rxshsts,ls|sps -(bp0LS2 R2 pRpW "PPr ԡr#P@b #0B SO ( C 0pu0S@ bP o$ 0S P '  0S R R 0 R-AP 0S@U<0Sw0S@ #P #W;<0Sm" hstsps|sȾxs ̙ -LpMP@T `KOP 0 R <0S d@0S@: S p0S : S 0 R@P 0S P (0 Rg|shs xsls4 -LM쁟0Q@(0 Pp`i 0: S (0 S (o` 0S ? p` K!p 1 S!3 NPpE 8@ IP P ?10  p0 X ,P {P0 G P iPG MKP  LHX |s -LM@`P  Vp@0V U@0 @WPPU`VUU -1L$M℁PUp$ `Sd1 R 0: S P$0 S $$_4K@ +[ Q003 Kpw@`D`00CS00Ӥ0 PpP @00CS00Ӥ0 PpYU00yU ,JtsLps,r&4 p-LMP`P @n@P0/S+ /@P0.S P0S@p0S .S0S`V d 00 Q P0S0P,   @@P0/S |s̗ -0L ^4 -L0M0`@/O@d#P000L1P<H0K ㆽ0 AT0 P0 ST  TP@@:p_0p0Pphd0DSatPphPhp(=0 TLsD <d @  mTm @@ hF|EȾ 0-0@LP R% AR@ < & x"t00CS00  ä0 H< <0h< $$A0h<H xИԘ -RLM@p 0S   <Tc W@` 0S] |Q<0 CR P00 R%  B02? X 0, CR 100  \ `0 CR 00  \ R@0> CR 000Ri&0 Rd \0R R R0R 餘 -40L R(0$0$   &]D s44 -LŒ<0 R4  l 0 $s s - L \ -LS\ -LMhq0S \\NPPL @!PD 4a@P!@0P P00FP@ @3 0 0@@Pp@K;0$!  P 0EP 0;C 0 0d@d @9ˠ$0K $ @18\l |p ss -0LS \|0H0  00S_\-\0S f  p-LCM``GOK0PL  嘤80 Y 0S m\pL̙h ԙ -LM$@0 S A00h ܙ 0-D0L R 4410P@@T00h Hw 0-LBMdP0FOK\0 P 0I4 0S \0L p-LM`@e,0  P]Uphs p-BMLM`0<@KP0 B<0[ES FS AS A R0r S00x ;Kڂ0 S X[pCNK@D@D 0 <0[FS 0  L4Ⱦh  -$0LM K YP [s p-QLMP`@00H @| ph0PE S U@00p@h -LM`P对Mဋᨋh!pXq mP pP P@(@ 9!0AT3 T`7 y@P0/S Z  1P0S@!`MP X: p`:  @@P0/S O@  cZ,r|d t -LtMp@ᘐK87@R6 00 RPPEY0S``0 0: S U PU/00V 0: S 6600:`O  -0L 嶔Z4 -\@LM80(0( 04XP\T -LMp P( :   Qq00  R(  R00#R@@T;Rp 0P00 p  (0x嗞P`@@(X0S 0DH00S (S 0S(0 0V0 S񟗫 h t H t \ 4  (0\(   Qq00  R( 0000((0\( ,  Qq00  R( 0;Sp( \ pSg  Eb(0\(   Qq00  R( 0\S  d*(\( 8  Qq00  R( 0S  /  (0\(   Qq00  R( (0pS0Z00 0PX(0\(   Qq00  R( 0S 0(0;Sx  ( K_ (0\(   Qq00  R( | ( KF 0S P(0\(   Qq00  R(  $s(0\(   Qq00  R( 0S  3 @T00pp#(p}v4)( 0HWt8S(( ( 0\SS, (tP(  L( ( (P( t  Qq00  R( 0;S @l(\(0 ( P(   Qq00  R( 0;S S ( `_QZT(@(KP( `  Qq00  R( 0,S00\(   Qq00  R( w(P( `\  Qq00  R( Z lw  Lt$̜ܜH Ⱦ\ԝ 0-LM P@U W \UXQ UM  0S 0[S: \S1 0\S \R 0S 0 0 0S000 00\S  0S  0\S0nS 00  0[S KP@ !0d@-@000^S00]S00 R ]R0 0[S \S 0 R ]R00]S0nS 00.^ =^:^00 ]P P 0]S0PP -LMMpNK @D0@D` 0 BPU 0 K0S0 v U qP T0S5 0S 0 jW L\LX -L M@X, 02 ,0 p1 100 ,0 0=P0S4P  \S  RE ZQ@D0S4 0bp00 g R APU0 00 !/P \00, 0 S0`B 0V, 0S`3\Q&Q\00 S SP$ 4  0bp@, 0<h -LMr ` 0 ( P0 (P`Ÿ  Qq00  R( 0gS{ 09S,1SUK A A pP@P@(S S (0(8 0 S x V;SpSD wSP( 4  Qq00  R( 0NK @D@DS  S ( 0(0S0R0 ܅0PU ( p 1H 0tvdr00U0P0e(LDlH Ⱦ| -MLM` P( 0\SSL ~KpGpGPP ? jK$`FP@ `FPP3 0Qq0  00SPC@@T 000S0S   0S(0 S H(U8,Lğ -ML MԀ0S P R" 0pW ` 0@ ,0 S0 ,%Nq)0S! Pf)yPJK(@DP@D *03\ 40 ̽0Ľ$LP,h  -LMr0@s `PR |R0VQPq`20  00SG \PD 0, CR 600`0S0$ CR "0000CS00  ä00@(0S ( \H0RC0R P(;0\ CR #00嗑P 0 C0 b\ 00`0\ PD,`0R tG)`vd:P HtfL$ KP2[S<00Z hȡԡPht@ -PLM؀`pP@) T 0 S R@D @00U00  0 "P P &D <0S10T\Xܡ -LMP, Up & &U0 \Ud 0SDb p9  0r1 P`0@0S*,0   *000PU@0S*00K@ 0@ @K @ 00s0s\U @0S*P000K@ 0@ 0&S\SPq(00  00S00@T -LM@P P`p W00  0 0  W P0-L@P 0wS! sS @T0 p %P 0 0{'.0 d[{Sp P00b' 0CȾb00 0-PLP @3T000 0-LPP@0 0R0 @@0^H꬯ 0-SL@p  P`qP@4 U@@V@?H h꬯P @\0000Q00 -L,MS @P D #$mp LP ?PPP|#0SA lGdVH \SL Q 0S 0S0#0S$ XP0 #PPe2p D 2`a"P  DP0@ >|"@ 6PPd2d ; 00 , D00 0<80 4 AO= m8,mmꈯ@tH|`įЮX IJ -pDaL MP44!ep dP ?P aPtP`` 0PX(PKxxP@ 0 00 S0w CxP@p 0L 000S 90@زHį p-LM0@SP P `K 06PP 0 RPPSp@ܲ -PL@`p Fep nP ?P lP`pP` zPPPP 0P GPp G0PpSꈯ -L@͇pPPP0S?` e?P 0P E0 SU0S E Я   -tLPMB^p`L  0@ P @l0 @ Pꐲ -LM@pTP 0-S c@#dp lP ?PsPxPpPV?`W00S!0(R00S l@?Xd R $@KaP $0ASA2 A$ R20S`?1S2 R hBxR` R PdBd`VZX??0D,0  P5?BQc U`, (` ,pKPB0 R,0 PPV`U ,@0!@3eWpp@R 0%S# $K^aP $p`P`AT|| >>;DP  0p00  00S& @wPp6 P`7d僆P`2 ꈯ(,< Я  gfffX I ȾH 0-@0PTL 0Qc@@0pЯ -XRLMP"@c?P 0A`V PU / 0S 㲄0S ;>1 LPl 0S0@  $0 S  1SqQ0S 1-0Sl> @P@Pc?0P0P00S` 0+0 0K@KKV0?0 0K00K?V000@ ;0 Q't K0P@@ RV  0 @, 00=(ꈯ ijܳ`pЯ$8 -PL@p` bp lP ?PmPp`t 0P0 PP =h0P0 0PPS鈯T0fP p-0LM` P@b?P 0AT K0L3\0 S0 1 !0l p$M=pH=`  -LM0@P,0 #vbp ?P SPP,0 S ,@3 AT #0 P 00LS!00LS0B \L =p\ p]  Qf` ΄XIP@PR  Q8 „P3 0X0C ST S S S S S S S S S S S S S S T S S S S S S S T S S T S S T S T T PI PQP'SP0-V +V ,Q@ |P \ \ =V1h0liP 0a0CSU V V V V V U V V V V V V V U V V V V V V Ispmk@hpU @@K`Pp 0 0=00 b200P B\,0000D<<3L $08@D p-(QLM !@ga?P< 0aV< 0 0K.P( 0Q0 R 00 0 S   0S  0XPpy P;P< (;pyp鈯 Ю`Ⱦ  0-PLM @a?P 0PPKPKAP 0@0 SR R 0鈯  -PL4M0p @P0 TP XP $ `p, rP' ?P pPLKg=PX L;sP uP`PX  L K<PX L <w;0T0 0P0 0!R40*X<$Xe?@;P` 00X̱PT0Sc 0 00 ,  00R080 4 x 4`u U 0S C0 P0ŵU u 0  $0StP0;0 T0S H00c RHK[pP800c R8K[`Y U u P2 P$ R Xr P ,PX2  SP0\U00Su US 0"0  40VG 0S 00h|0`71 R,4 }P# 0SSeT0S Xu XuXY<\00 000D-8D<2e  0(e U0S4V  V 00S`FV 0V0 R fPF\`0  @0 < ;@0p0H0 D 4:ꈯH:(`Я@P  -pLM P_0?Sl@ M0P 1 00S<0< `W@9鈯 `Я p-ALM!Pj_?P4 0P@ P 0SPU @Zp: '`:;sP``V 0-S Pp,sP@P lt0S,9p0S`ꈯ `4l p-ALM P_?P`p0AT Kb\P 0 ! 0 rR @0S xX$X@P00`h0 R 00C8S` RV 0  9ꈯ D` p-DAL M` ꌊ -D0D L0\0 P H ꐊ P-L`N \ RT LR0S0f0QE$@F0t0f0Pp F@Dtp 䀟 ` 00H0 0 c@BTT@@DtP @D tu@ @Dt00X0 0PPu0UĊ -L -L -LZ 00錊 -LNy - 1 LP@8 `00Cs0䠟p- P P r0 0  R0_S $S@@PP P  q00 0  R_S $S@@00Cs0Sw錊 -1L @\7 `00Cs0ࠟp- \  r0 0  R0_S $S@P\ q00 0 R_S $S@00Cs0-錊 p-0LM@P: 00P:p0@ph`P0`P* 0B0R0T:pp00U0Tꔊ -LM@@t @Dt 0-@PPL 0PS0 P0 p(0  0 P00 -hP@L` P Lp0T*0V  0S 0T*0V ꠊ - PLM@ pH 0 0  R ^T@?hhX -D0D 0L0Q0 P`0Tyꌊ -D0D 0L0S0 P0<aꌊ -p0 @L 8`P00Cs0 U0 T o @R 00Cs0(0oP@/ꐊ 0-0PL@00Cs0 tϠ Qd0AQ 00S 0S0@0Cs00ꌊ - L 0   鐊 -$0L;  -0L?ȯ -0L6d - 0L0@*鰊 - 0L0鰊 -D0L R80000 ,00@鴊ȯd -0P LU:0` pUh0P0@  `,o p0 V` `01 0Rh?$ ȯd-000 0 0 bL1C 00Nd000 0Q 0 R Lꐊ -LCM`0JK $0 @ PTJ P/,1 P0' )S S1 S (0KU*0T0`pP@ g0^S@ (@T$0 S `$x*U 00eU@  L̊L\ -pQL@@0 @dT` :%PP 0@DT*d0 XD0@労@0@^S@D} 꼊ȯd 0- L^RP@ 6P00d0j RP0 -p0xP @L@b\`00YD0 <0 40,0 !鐊Ċ -0L,鐊 -0L#鄊 -L -lpLMP\r\`  P3 0Rs 4"42@PTᕰ 0c0@0d0CS01 1E D 0RI 1`V# 0@S0P0cPcTp!h0 0CR& 0R 0R>P*Pt @Dt Q@0T 00t0T 0R P

R0@D?R0 00p\0 T 00 0S< ^00,P@0 ?00 00xy P0-L@P T t$|0 0h S`0 ! XT0hb$H0<\$40 U$ꔼ̊Њ    -LM⠢pQ, S |,@01Q 0` 0@:T+$Pp 0B,a dP00S S xYS 0S@ WG@01 R;0@:T;T 01  l[#00 RPq 00@ ,0T1 ?> 1 @  ?>1 @ p 0P -'kP @, 6 ,Pd00@TTPUXxWT$#̊`ЊԊ p-LM<8!00( $A 0 PP Ġ00 PPUP` 0P4GU  @PĠ 0PPU㜄P@ DjP80  p,jPꀊ̊Њ܇ЯԼ@-?>,1@LQ 00Ԋ̊ -LM@Q  Q Q Q Q$ h0 ጊĊ p-LMP` R @0@0R@PcPbS3@ptĊ -L0Qh0 9Ċ - LM0 0 p` P0@@cP0 PP!t 00p 0L0L H0@ @0@p`E T T鄊 -Ls -Lk -Lc -L[ -LS -LK -LC p-0L$M` 0K K$K a0a(@K @PP 0@ 0K @}T$0盯$0P 0S@@TPphꐊ  -h1L M`` 0(K n0n4@K0K,K @P@P? X04 D?0P0,0KpC*P00T0S`T XU U 04 $P00  0R/S \P(0+ 00( ) PF鐊  -\0\X0X T0L0 L08\000 5 hꤊ0  -T L0LS00P0 S  0S0  p- P PP0PLM`0 0@R 0 R R00CRphp0DS 0 0 0 00C000ꨊ p-LM@,`PP 0S 0U p頊 0-L@Pp0p0  0!0S 00@C_ 0 00000t0 @P -LMPp0` ` K"`@T 0 0@0@ &T f`ꄊ p-1LM `Vr 1 RPC0S S S "S 'SP0S0C00 R R R "R 'RP0S S S "S 'S00S0C0`@0S S S "S 'SP00@Y@pP@U0Օ 0  R R "R 'RPEU  R R "R 'R0u0 S S "S 'S /PdULC -,2,B L^P r00Cs0e b^  q00 0  R_S $S0^ LUT  r0 0  R Qp!B00X0^2  r0 0  R0_S $S#UU r0 0  R Q 00000 r0 0  R Q 00Cs02000 r0 0  R Q Dꌊ0 -LMtQlh0h @ PT *Tp0Q`ITP*0U@00鸊 -tt`0@0Lpa2@@PP+ P4p0mM`$\ -LM0@S`ps P$ ( +*(0  (0 P (PK x0S( 0Q *00 $0 `(0 h$ @`DA _A@ @ $ ( ` T $ ( ` p-L Ml`0P0@,0 $K 0 $0 9$ K 0B #1P PRp`  p-L M`0@0P  0$K0 $ $ K 0B C1<@ S@  @ &p`  -PL`M@ ` `   /0S 0S0S @0  00 , 00p(0p 80 4 P@ Lp p p p  `K 800c R8Ke>PW񟗩8   ` V񟗜 `X 00 "" " V  R X V X 08.0004, `@[0T. @0T* @(0V0 0 0  00 , F004 080 PL=@` DA OA0@0@0@0T * 00 r  < @`DA .A0@0@+ 40 0c0 0C Vm Q 0 R00S 0S,0[W 剐Q   l!0F]Sh l D T l   0   0 00S 0  0 0 0 `0S0000 > S<   0 0  00 @ {V @ 0000W(  0 8K KP dP 0 UPuX p=40UOP  @0T*  0@8@` DA #A0@0@hu0`0  `   $00(   0 S 8  b R8Kښ<P00 0S )00 HKPp c  000  $00(   0S 8  b R8Kf<P00 0S )006 0 | dK@K 0c000 d^0@S 8  b R8K8<0P00S00  00@0 }c KHK 0KPp~ WX  PJ ([ 3[0cഠ00@ 0 R00#0C S-D D h 00 ?00A `@0  (CXUl4pUZ C0  0A 0  00#0CSO p p p p p p p p p p p p p p p p p p p p p p p p p 00)  000p 40P]  H R000 0p 40P"@ 0 ]m]0p00 0 40@U Ѩ k  X 0 ` t0|`0 r)` np H0`VH0 f R 3[SD0 RD0 H p00C0 1`VQ 3[S ` RD 3[S0p0 >QA ` :D  0SC' D 0`0V V    0Svv  D D3[Sp[0DF `A YF`pN 40 U B GH0`VH0 `Pク ,` Я`,rܼȾ  @D@ 4Y@P08 @WPL -L MPpQs 0#S  `P@@:T 0ş00 `@ 0`S VPT`0@@T*TQ%XJ K#XG (5  0S8  @T000@ ğ0 @" 0 R +X 4 R 4R 00 @T+X ll@-X=X ?X @4R44@T0@@[0=X[[aP 0@S*S0]S =X Z\@00  #0HS 2 0,0 0 4 bZP 0/Z40 0`CA 2020@S@@^,0\ *000 4  @0@S000MŸ  10,0 0 4 4,0\* @ 4 [0 @` DA A@,@ 4 0 0 T`V T0S@`@@T 0`SFP[`P 0@S*S0]S( @T*T0 @ T00Q00S V 00 8080,Z>[l0`P`@a!ZL0 0`S`Z Z ꐰ`Я 0 -LMtP,\aPP@pNPhUpG 0S ,K| ,A@B`(P  ((2N=00@0 R0`V 0S 00S 00P>AP@`40(  V`Hdh -L@P_@%Tp? #T U@` :P`T`T TU@ :P@T0e  mG8P@:p`p :P`DT*P@: :P@DT*` p-LM 0CP`CA)P @0T *00ấ TpX0 @`DA wA0@@0@`Adph_< ` -0LMpH`C -3<; R,0 Rr 00;00 ,  0S_,0 R[ ,0 RW ,0 R ,0 @ R P:0S, 00CSt  0 L L p p T ,8 004 40*020040S 00  4 M9 R 2,00w00Y000 0 0 0 @0 @,0 R PI0 0  ,0@00@00 4 `@K \,00`  `00000 , 0,0 , 0S ,0 R ,0,00,0 , ,0 R ,04 ,0 R 4, 0S00Q0#S,0000<00 g,0P^,0T0  7P 'H0 D 7'TK@0 < N0U0K, 0SVH7 0478  7@T@ 6  PT4 +&2?4 ,0 R@ 8U[)P0P40  U@K,0T lV,004 80 R ,0T80 80 YV,004 80 R,0 x,0,0P , ,0S ,0 R,0 8 80 R ,0 , ,0S ,0 R 80  @T 5P80080 8 0S,00"4 004`@T@ 4  uPsTn040 ,0,, 0 S00P0#S ,004 ,0 R ,0P,0,0  00,00,0,f,0Fa,0 @Y8 M1,0, 8 ٫0S,8GMd KhH#0P@O4#0S 0SFS]0 @_0 @Z``K`P-BP\0P0P 5dK 㸞x2 0000 000 ,0e`0\ 0 00 0\ P  `dK ㍞040 4 1V 0S0  Q@@ 0@ 1, @@p1,,  AI8 00 4 1# R 80 R 80 Rm 80k`gzST P 1?8 1S p880!1P00 ?8 @1SxX<,8KOK9O P$Я`|  4 @  L   Ⱦ -L,MH, \00 p4 L H  0S 0@S \ |<V T,0`S ,0 R V 0S ,0S ,0   D 8@ RD00D0  1S4 `0 7# RP Tq 0ǟ0 ^7 0>0 0 R^ D 0`dVL@Q D0@ 0J 0!RPU7 ,0S 6 R /XP0H, , 00CS h  x  x x  ,4 0044 |6 e/, 0@3,0 R,0 R @ ,0N00 ~040 0,0 0-PmH P 0, , 0 @@ ,0  00x5 p0S 0@SLUD0 ,0  ağ#080 , ,0#20#0 ,< ,0<0 00P@> @48|$,,#0< <00, 0< S 0DS         44 4 c#/ 0\/a,0 , 00, 000,,0 RP,00 3@  00 0@(EM, 0T F,0  ,0 R  : ,0M.B\ 00 2,  0 p00 0S B @KK <$U,0 S X0 Uo:oQR$ '=PV ,0S ,0 R ], 00D L0 W ,0 0H0 1RB ,0! Q5 ,0! Q7@4||!4pP@ p*TH  0 R H 01` Q H0, ,0S ,0 R 0` u0S00p000 PU  , ,0S,P |=Я<  @н` p, \вt  m j X7  p-LMP`PQP@ 0ST 0S`@0 0@l;L0 $ 0 0@긾ľЮ 0-L@F 0GPP$ 0h A4о -0LMp@`T P FP L 0V0R00S@R F 0 0 ` -LPp`dF  @0;` 000W eM0  0S;0GV0 0N p-LM@`P0=S\ *SZ +SZ@#F F 0 ` p4 -LM`pF3/SVPP` @0T00SV 0 S PTQ 0S 0 U @2 Tx2x2 0P@ T2U  H.T  82>000 OP2P 0 PQ0@00Y @ @ Q0000 5F0P9U&10T00S 0 PU10T00SPPU00S U EPP 0 ܥP 00000 0 PP 0dXOjP\0P 0 d4 E@GЯЮį`$ H4 p-L M PK`pFFP@  V 0 /R 0(00 0pHį -LpMPK`@}PpoP@U WV 0Sp : S  S pp@Imp -SLM0@< /0)UP < P  UH1  000 , 00PT080 4 4 :4@UpW7 `eW 80 0c S8Kڞ-@ @ƙ/0080  cR8KPڌ-@  ᶙ<4 zP 0SPU4,4`, p` -x0tp00lL @`0PP60D02 @\70000xX ( -LM0X pP `ጣ $ Q bP0,K  PX`A00 R  0S AQP ,K \7 X S7 0,y1!0  ,K؅;70 h 0 q 0< }9K,K 㵅lW,K 㮅T00 !H꤯  X $@h@Ⱦ 0-0@ LR# P0\$ 0S 0S0Q RT p0phTd  0X00\ 0S@ 0S@lЯ̯,r8@HP 0-LMPK@ K80@0S 0@S >0餯 -L M,K`PD p-V`pUF 0KP@3 X XT ,40#00 V  @  00CS0<0U@T@T 0 t@T   000!(@꤯X@Ⱦ -LM pK` ΄@T P0S 0@  00CS0<0@T@T 0 H@T0" 㧄Я -LM@K 8㔄00 \000 0餯 -LMQ@P 0= S< 06 @`쀟40 0Qp@Q Q 0  T  0R@QT t3 0R0   0S 8@,i$ 00 000S  0S$4 0S000l -LMP00좟000 SQr`0 SV Q  Q  00. 00 R} `2 Ry 0Sv QDbj @BPY 0SN P 0S? " 0S0;004 S 0S# ( 1 1`@ 0S Q !|! Q 0S V PP 412  00S0  m 0  <m-40 `|P0h;0l`0P@j 0`00@0000@00Za Q_MЯ X Į -LM0` V 2 0S{ `VpK᠅뼠K  mPPhڸpKᔅ`V 0@T 0S @T`VH `V (0\Q=9A =C 0(l0c (( Q=9 =p 0( 0b @(( Q  =9A =C0d0  ch  Q=9b @ =  0H 00 0S0 0SS000l0000 l?B p-LM P 00S QT 0PS4 0S 0 S0000 00CS A0Sa 8 R 0RS  @ a 0S0 * 0SD 0S$ 00S D1 R 0S 0S RA  C 0 0S 00S p 0S 0 U  ,00 000ppphP00CS0y00$ph꬯Я` $0 -L`\MD0V ,0 x 0 #@003# Q Yt +0 0Y 0-0p0 0PU5 0@S|q ls s s lK@ i=V 00Ul t "Va VR tŸTp"p Q0l KPx "U 0S UxQ1 ,0S ,"0 SVt  V  PU 0S0 S t\h10}"x 0P@LDTr"l0[S (!T100l Kx` e" `" p0Z"V 0SlK~ lK@ W"{0l0Kx @VT0 SS 02f 0lK2a R4P x X+"LT`h  &p   -8#0L` %^0?Sau Pv Pv Pv Pv Pv Pv Pv Pv Pv Pv Pv Pv Pv Pv Pv Pv Pv Pv Pv Pv Pv Pv Pv Pv Pv Pv Pv Pv Pv Pv Pv Pv Pv Pv Pv Pv u Pv Pv Pv Pv Pv u Pv u Pv Pv v v v v v v v v v v Pv Pv Pv Pv Pv v 2P Z0010S P 1 @T 0S @Tep1@PT 0 PX@TX Z 001@T 0PU pP XPU@TZ 00Q00p @T 40S 0S @T@T 0S S @TZ0ꐰ -p LP00 X R 0S R 0SRl㛫$į -L,,0@ S00 鉫 (į0SS 0SSS  000Q  0Q0 0  ` 0ST 00C0H0H < P000P00(l $- RR  RRR00Q00Q <R 0S  R 0S  p-LM0@`TP 0S@TpWPP -/LM0弟,0  ?@ 0@ t2 |" 0K/KH" 2 x pB |20 2 ϟ? @p@嚯K`!200`d"  `` P\P 8ϟ 0S   X X #X  $0 0$0.0S 2   hb  P\P Ο0S00 X V V0P.020c RKCp V| , < x Ԏ  = R $010!X00Sx P\P ͟0S0P0 PUf U00 UPP!UK u -00 P -U u ,00 PF u,00 @KQ PK P\P ̟ 0PS  p PU U U U P-0KT:"0R0 K6P; AT 0 !R 0(000 < H [X @X*X ?X+X !X 'Xk V"XE \X \X$X   - P\P P˟0S00  (X {XJ [000@* 00X  " b RKnp P\P ʟ 0S  00   00X    20c RKEp00X  @00 00$0000K p P\P ɟ0S00 :X %X#X 2 Z 0`0 K r 2 Z 0 K    P\P ȟ0S00  P\P ȟ0S00 t (X A 2 Z 0 00 0`d K 2 Z  0 2`0c 0{ K `X2 Z 00|7 ` R< R 0S BR RB B+R ' Kf  P\P $ǟ0S00  $X "X 20c RKlpX 00\00" 00\X `X00" Z@ `@ K& \X P\P Ɵ0S00 X 005 2ş Z  0 K  P\P ş0S0P0 P(U 00 u h2 Z 0 K "`R 0057P )K P 0@S " b RKp  00 R<4Un0(20 00 < b K0) @# )X (X0000S0C P\P ß0S0P0 6 P)U0020c RKp/KZ V`>X<XBVPW U V00W00SZ x)X O&X+  X"t2 ,0S x,(XT2 R P\P lŸ0S0P0 P(U  P\P Ÿ0S0P0 PU |X&UF ;X |X 1&XK;X |X0x"`w|q0FSGLAz@T *Xl (Q dZ}X0A0EA0US2 " / AE'2`A2&  f'P@ 0 0S 0S <0S 0( @ 0, <0M `L`Яȯ49@ `\,0(AE ''P@  P0R }R\  300T*X 0S0 0 0ΦU0`00C >X000 P\P 0S0P0 PX< <X>U&P 000 0xߦl1E` P\P 0S0P0 P-U0 0 0&U >X00  |U00S @0<X00>X'X2 JZ H ` 00C0 K "Xy2 JZ `00 K}X]2 JZ `0 K0S ԍ (X( "X 'X @TS2 JZ `@| K p 00000)X \X  00C000"X \X0 0C'X0000C`X  " \X P\P H0S00 6$X "X X\07/0S\X `X2 JZ ` Kr(X000 )X00CS0 P\P (0S0P0 P)U b@P ay000( `p 2 JZ ` K5\X 'X "X 0 0j2 Z   &`000 K"X \X P\P x0S00 $X "X X  \00\X `X 00` )X |X (XL 00  2 Z 00` K 0 00T}X |X (X0 00  '000 P\P  0S  [X X'00C0A p-LM0P0`0@V:`p0T:TP -LM 0, !B0001 < 40 0 Ҥ408 0<0 @ 80,` pcP\P 1 R0P0 PUR W U p0U <00c R<K` @P`S UU( P\P 0P 0R0 P U<K U$ <  b R: @P<00c R1 @P8 0 08 @@0 `0 00C00,0`, --hLM 00CS0< 00CS0$@@ E  p-LM@@`00DSp0P B    $ < (`8 , 0 4 p<408`400,  p-LM0`%0T- X 1 R$ R 00S  RXiz  0S 00S 0S 00 (1  tuX0001, dP  0R@ S 00@,0c aR, ,@@D0S    $0S R;T 00S $<0 0 3uaЯ̮| $@ 0-0LPp@-P0@08 -0@L MTP@ T J,\-0E,W- 0, 000 L e@TP0H , W 0 0|`<@@< -!MLM4ʟ` ,  PT( X8 \ d  @ 0 S\ @0S 1 !KLLl dQh S \SP p\Pc !P@3 X00 SH X\ h R$ 0 B 0d h(R`80`8 0S X\ T8Q ,0`S ,@!P@ 8!mK `F0`F(0 r.xXPX\d h(R`80 0(XePh` @Q 8 R!0AVS񟗄x ̡ ̡ ̡ ̡ ̡ ̡ ̡ ̡ < p d ģ $ 4 H l Ԥ 8 \ H B^KPEpPE0K,0A+K0+0Bw`XP@p86B^K PE0PE0&]5p6B^K PE 0C00AS00@SB^KPEPE%0 0 B^K1PEaPE0%95pl"luB^KPEPEl%0l"lhB^KPEPE<%`}1 P00{RPPU B^KPEPE0$ 5~KpGpG+ 1}0PPl"l=B^KPEPE0 }0@p}B^KPEPEl"l$B^KPEPE0$B^KPEPE +0w*+uB^KPEPEB^KPEKpPE,LSB^KPEpPE\0HB^KPE0+K pPE,0BDlM"lB^KPEPEt#{B^KPEpPE0K K,0L+ A0B^KPEPE.0P0p0"3B^KPEPE0)}}P CuP@ B^KPEPEB^KPEpPEB^KPE pPE 0` 2B^K PER$0#0pPEB^K0PE`8 pPE 082B^KPEl!lB^KPEPE "B^KPEPEo C0P  >0P B^KPE@PE+=0 )*@)*av`F0P l)*>0P B^KPE~0KKpPE,0L+A$)* P0/S)*B^KPE0PE 0B^KPEPE0 30 S Sh8`8  p S \Sd80#pd8 h Y`00`8 LDxaЯPTdX dPԮ`Op 0S 0O -LM䡟䁟p@`P\P 1 R0P0 PV(꠨   , #U` 00``` 00c R*@P000  V[U(K8P/ P(0PS  b R0@00S(x0{P\P L0 R0P0 P0 `,`x -1LM  0((0 $ (0p000 , P`P\P 0 R0@0 Q@000c R0KP[T@` ]T`FTV T00,$ `V00`, p- LM0`S0C0Px0U  Q@@T0 AQ 0p( P@ 0<0,  p-0LM R 0 0P 00pphP0S`  0 0R@0 \T 0 0R0 P 00plj@(0  0P 00p0, 0-8 P0@0L _ @=00` -LM0@=C0 0 ⁞]` -LtM 0S00cS0P@$ T P0 0@TKXPx0: SH K 0S 0X S `0S X ,'P 0@@HL480L 0-LpMP0@S|0lS`t0 TK  P|0: S\0 0 00 8į -LMp@:``OPP :-`PP%-P@ 0T\S T 00U0L0 R T?-@s Dq4įЯ P0-L@ P@(T 崝T0寝į p-LtM@PHk08`KP0: S`0 0 0pį 0-L@D' P(,0P0h+< -LM0S L " 0@QOK08G/7s00 K(h@*&&a    @ 0@S P@1PSg@0S P@1PSXgX7 0P<&8 /(0$00-Pw'00  A6 ! P PP @0 @*0SƟ@P0PP @ *|o&`'0@/SP@ P P60S0@6T  'q@$V&F(R& '0USqUe%5Q00>&0@ 0S 0PP PT5P` `$PP,00S"P@T $@@45p 01 ZPK㩅P2: Sx 0`@S@` 0hDSk4$02 e0L0  T$P0``P 0SO 0S<@T 0,33 R$P PUY00 0S3  000%&P %&4 R  0X 0@T<! 0$I 0S cZPs @$@$  $ 0 00 g$2kp00  P P 0m 0T1X1pSP00] 1SPCp@pTW&#+P &0S 0S0S p!0SmKPKP!$2R! 2RT+Pq qPppq0 @q+P`@\5P APG40`n!!  +į`H@4ЯT <( ̯l`h0  <HP<LT8hxdȾ -TL$  @0 <0R4S0 h*%03ȇЎԮ -L$M< @ D0  00, 8  PH s @ R1@000  000  040 1Y]P@. ,P,0 00S X00 4 0 0DS| | 1D R&0 R  @0S 0 @000 <00P4, ,0H 8 ,@ ,%,0@ L00S 00 40` -,0LM@@@h` -LM, 0 ,0#$ 0S 04 80  00S2 < @ <0S2  2\P@) 0@S񟗙ꬾ <0S@ \2 P 82 R ,0 R40S, 00,0", a2 Rh,0< R0S, , $0$000$0<0SR,HP@. 0S40S* 0S' 800C80 8 R!d, 00T 0S ,0$  8$1T 0S <0S 0S00$40S P0SP ,0  00Sy0@ h0 =:,L7y@  0 ` ,ЯD` $  P0-L@ 0S PP0 R @P 0S [T 000%0S TT Я` -P`LpGP@pP P00 Q @` -haLPp0S  0R7" \ @0 R@BT0S80S W` p0  h`V#0 R!0 P0@CTT WU@ wbh0 P\  0P$ `Я̯ p-LMl`PU \ @0 @Rڃ~ T ̘0 0PU 00p` -(0LM@T @T` -,@LM0 01h\` P0-L@ (P 0R @T0nl -LM/@P@r_(P0 0P0T -LM0P0@cSZ bSZ k `K C 0pR R 6  0R `V  $40"WĂ d,(0 ("4S ``PB /0LhȾ 0-L@qPP0) PȾ- X 00Q0ڰ000Q0  Q䐰 -La 00zQ0A 00ZQ0ھ;\0;LD<4 ,@$hꐰt<HPT\` -H`0DpL0f@P9j00fDjP@dt p-PLM`0P m@a@P y'0p 0Q0-@PLN0 00hт0 p-LM0`S0 00@ 0PLPf0P00p p-LM<`P@1S@$TpQ'Pp< 0-LM@4P,,P$ 0 0Яt -PLNMP! p0PH1 `AT P$UHR?K o'mQ?K-KAQH1`PH TP@<`0S 1<SP$U(<X` Я  0-L0M|P0@@Ktt0  R 0S $Q@000* 0S 0LЯ<` -qLMPP0` 9 PP. P, 0S0P00S R 0V0U00S00 U 0HS0 0Q$`k @K$ kڡP0 _V 0000`QR bЯl̯ -L,MS0L0 0H S pP T W㸓 DK   pPO 40AU00#`B $?U sU00WP0P0 <#@0U @$T %T  r0  goU<PP@ 2 V 21   N<V<0  L0 T 4D1S +R-R0S-RG D H R T0 SD1S  H0 T R L 0S O$0S LP0S D1@S @1S``!T RDD L!T'D1 S 1 SD  0S0#0@0-S /P 0-S 0唐 @6@( y%kl@0* Pp%kLT@0@S 00$T000d<Яܳ ĵ 0-LM@P K0 S  P00 Q0 Sp 0 0-L@PP 0F -LDM耟0QP`@$0 P$0 S $?k0p;kUP!P0dP@UdpK  %P40Ҕp 0eL` -PpLM`@*0S @T:X00 S WP*U> ?U< [U) ]U" |U )UX IyWpGY00X00S |$P X pX Y X R0!S@ R0]S@ꀽ -RPL MP@p`R *0U5#SP QT:U0S d?S^ *S 0TQ T PE0 P0PS:< S P, 1 0TPES% ,0 S Z0@00  00\ , 0Z,0XP , 0P,Q vP@QSSڿ0CS P, 0TPES,   U0@00  00U\ , 0Z,0XQE\  D0x U ;P r, 03Pk sP, PEU0  g 0@ P ,0X , 0PGZp@-@^P`D R6 R0 ^ R 00 Q00S @^0]STp0-S0S \ Rp0 \0]S[Qp0  R   R( !^` P-L@Pp`*0S @T: `)\ 0W0|\00S V  #P``Fvꀽ1 -LM, ,0 i?B10Q , ` P@BpU<:T P @DU 00 00 P  00 U 00 6HpG@ , 0hC1 iBS, ,`   P 060  P" 0 0     -LM@`Q 1 PU$ 0Q-P0 Q -P 000#0+P0SPU00 -P  0  0 0:U?U0r ,U00;UppWj#Uh P"Pc :P. ;P, ,P# #P 1\ !000p01S 0!0 00! 001 p 10 R 00%1S00! ;Pp :P 0 00 P 0?00P000:S00P 0T HD0L0-SX^U0 00 鐰,rp( $ 0-LP0 S@5 0  0S0hq0S 0\@ 'Se U 0S C  0  00SU0<0hP4LPIP0ꐰ pX -LMh4 4  , 00 @Z4q8 3dPPP@,dTX` U`V`P40cdp0S0W<0 ^ ~,@\8   00@T pWP8oU, 4 0, T < 0`   -QLM@ PPp `PP*PU e*0S P0S0@e P:eUp:0h0 -L`p PPZ 0#S 0@P@ -LM @$rP 00 rP00 p-@LMTP` ᴽTP pU fP0  ✐P00ⷐ0[x`` -`<LVM`0 0 /Q40 8 , P80 0D .Qq 00pW8p  8 R 0 S:S0 0S:S0S0g0 080YS 0/S , R 0S38 0RY 0c0 0 @ cRP @ e 0 SP/R/00040 bf @0 bRP d8 R00 4Lf0 cR@P ,d,  P0 S/R/000.S0S/S  8 0@-S`G /SppW @/P/R7 ^/ .^ QP R/R0 00S/S /^^  .^0/SSQ000 QP@ Q AQ0/SQ.00 /R P-Lp@` eP0 Ulp cdT X0T L0h驏P像0P@@0į ` -LM@e|0     O00 K 0  P 0P/0000 `P` -MLM0ܑ0c0SpP, @ PT? 0/Sb S: /.P`dU VO V> 0/ c 0 0c RPBNK ` P@Dc@D` saP0`(K P/R P PP X@,0 S ,0S 0.S0.S U0u/S U0.S e`0/S L -LM@p|0`ᤎ00 0,0< (p0P UP@20 P00S 0`` S`` og opetW@,宎` -PLM`lp@82 T& V`0 0,0$ (` p ` P oꘀ[=x0\500@0P oP PP PPPP` -pPLM`l@*$ T P (0St0W< 00$  `  Zo\W QoP P PPpPPP8X -L^M\pP`@)T0㠀 0WB , 0 E 00p(Ppp PPP $0BRU@Pᘍkpl⑍@`x 0- 0PSL@FP isPP0 , 0,媍 0- 0PSL@ +P Ns 0P 0 P0 0-0L@P  0S0 0  00 0,w 0- L @ 0  0 0S[ :Q0a0 /;b0 P0    0h Y$0 0  -@L P 0 Sw p   0:0@ #  = S , @0  d0d@0 0 90   0p``V  'Pp``V@ 90 000S@ ;0 0W$ 0  `000@ϳ$00@ -LM @   0S9 / &:0  P 0S0 0S0:00;0啳0 00$ 0:p  遳$00  -LMP `p* V# @T T@ a0 `d d0V0 pX f0;p @T pl -P Lp7 WpG2 @Tdp) @T!  JP @0a@T@` `pW00 V dP  X@$ -LM @T 0S  0C 0 P 0S  0-L@P8 50u  0 Q)  Q000  0QS 0*A0 0 00: A0 PA 00 00Np  0S   p-LM @`A v" + 0`KS" PK  㛇P Po0S   ;0f0 $0p  \$0 0\  R 0 B `0p   l8L P0-L@P 9a 0h0 -LMP `pZ XS@T 0PI T@ _0 0 d0 `dpV&p" VQ@ z]@`T`d  Pp@`TV  _ 0 0f0 0S 0 ;0ױ 00$ 0X d| --LM 2 -p-PQ LP@4MH`KH 0 0  @p --L4M@@K0B z  -L`M0VPD ,0 < @  @T %T  R 0 B @0D  D @T0D |8 ,0S l, @T 0DLS \ \ \ \ \ \ \ \  4 \ , < \ H \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ T \ \ \  @TYT A0DS 0@%0DSSk                                                                                    0 <0<00 <0 d0D,pK< S/            L     ,   L Q a@ @ 1!10A00R0guT @P-0+0 0(K0gC Y @Ѫ30#0 P0S X i @ = ShC @ @0@X+YD D I0S C  0  0YpIXDD 0S C0 @0 HXʨ}D00hD0 h0S C0 @0 Xj-P+P/ P- 0P 0@0S# 0C0 00 DIYpD 0xS0S 0C0 00 D p ID 960S 0C0 00 DpID $0gX0000gQ 00SN 00!10 ! g@ \pGX0x00<0倠 8pK0<0 8 K:<0p (1Wp< ^08@K8pK,}<00@0 <0@0<0 t@Xqhnlꀠi@fd0 b 0@D@@ @0  @10@00C @0 0@`FQ@ @E CLt 0-0@ LP0 SlPl0  R0S RR 010000 ČȌ -L!PP@`p 0S 0|R0P 0 T  0e@aP00|PČȌ -LPP`p 0S0@0 p0T d0T 0P <T2P^@XČȌ -LMp, PP0@07 T`( U FT&T &T 0PX W  0pV000 ;T`,0S U(0P @ČȌ p-LM@0S( 0 ER p`0P0 Q@@Q$T00 0h 00`S000 L0RP4 5*p000EPyČȌ\Tx -LML0@S 80  Q 0PČȌ -LM$`Kp@H P 0b -(L P0 @`DA SA@,@ 0 4 ,0@ @dDA AA@,@ 4 0  p`ČȌ\ -LP 0@S x0  V=QT 0SdH1@P U0`0?(0 VPp Z 000F@߂0@؂ P0P0 :00 0p0 p@ 0p P{  0 U됰`Č  -LMq@⢂Q@0 0 R|a0$ ( 0P d1PH0S00?  P( 0\*,1  ( $ @`DA ⒂A@ @ ( $ ;0P0 P@@T,($ 0`CQ 0\*@ $ `( u  p10 0 $ ( ∂D;P00 ;`4`ČȌ\ p-LMP`@@P`p -LMl@ll P 0S0S $l0 00 0 0lį 0- 1LM!1P@@ \ 3 )\0@S0  - P 0 S P0LSPKKK }PK 0t `PE\X K0P <@ 0 0bȌČl\d@- 000Ἄ0Ἄ -@0LM@ 㔁  @     ` -4404 LM,@0PT 0-0L R@0x SP 00SXP0S8 0S$ PЯhP 0S $0<P 0S -LMPR0@SD2Q00@A2p Q`z T1s Tp Te T_ TY 0DSLTEQ;1  0BS51R1Ep`0T0 W P@0T*0p0@1@` DA A000 000P0 pP P0`p V P 0P`)Q``(Q``P H0`PL0Q``,0 RČȌ\`qtXlN p-LM@0`S0@ %  R 00P0Q* 00p@t0 @dDA ~A000 000P00P 0 ČȌ\ ` -0Q0L0 7(0 0 0ČȌ\0S  0S R   -PpL@T`01@T 1?A1cX0P`+ @ Tm/QU 0   @ T 0A0 S R 02SP00C0gfff -pLP` 0@01@PT  0R U0Q@5TP0 -LM0Sp@0< 8C80C01P`U  0R' V0aP6U0Sсd0U@w000 P@ 00 RT00C0PP 00 0000CS 0 0P0 000CS0r p-LM0P10`P@ 0T S0 0 R@0P@fDA %01p` ) -LMaQ @ Q1!0 dT Q  0  褀T@tPa4p0 @0 P@`|hT@tPa4p L @< oꐲh Ќ- ،вp0 ) ꐲ+ p-LMD`0@TP Pp)QP 00@ "Q , -LM0!0Pp@ `0P W %P TP`V @Z 4PPP TPT P K#P PP0鐰 p-0LMR@እ`\0 @ P0  0S800 0Ss`pꐲ$, 0 R(,4 0S 0 0 R CZᐲT 0S R 0S 0  R Q CZᐲ p- LM@`T P0@0@ x0 P0S V 0 0SPU @Zp0 0d $,  - p WL` 0S XX P< 0@] XX@0  p 00<}0  @ 0 *į p-p0LMd `0`@` P0` 0S 0SPU @Zp$,  0-8@L P0#0 @ PUZ0bꐲ 0-@ LPP.0U< 0 0R0 00Q00S` 0h7 <0 R 00Q00 0000S}į- Я 0-\@P0L  0 S 0P 0 00S 0 -LM@p PPP0 "  ` 0 R$V` p0ppS 0p(K (p $0 0 R`( K0R(0 S  00 0Я- ̌ 0- @ PLt 0 0 S h4 P4 l4 |4 0  000 000000  $ -LMp`XP 8C80C S?<5 6 6 6 6 6 (7 <7 7 08 L8 ,9 8 8 ,9 9 9 : : L: X: `: 0SU @0S %o0S0SB @0S $a0S PU0 @ T&@PT 0P0S 0S@Z m0S ) 0$0 '@T 0#"#0#0#t0##P 0 p#\#T# @0S4#1(# @1S R 0S0"""@0S"d"0S0""0 0\"PU @"@0S \)|"0S0 !PU!i! P10!!0!0!yd!0S\  P 00DS ; < @< H< X< `< T \ 0  0  0i 0S|  @t t ` X X T L L 30#0P lDp2tx `0-0L@P^$,@0h'S^$!? -LP`p@ T= = = = > t> > > > > ? ? W@ `T"T $T \$(P 0S)P$((P 0S)"p"p${P @T }@T}P(|) -- L 0 -- LP4M@@K B 0 0p -P LR`p %R s R ;0B:S@ ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? @ ? ? ? |A A A ? ? ? ? ? ? ? ? ? ? ? ? ? ? @ A ? ? ? ? ? ? ? ? ? ? ? ? ? ? A ? A p0  ;R   Z @T @DTʜ @D T  pa@p  p@P 0Sx ?dRX`X@-00dpPg 0S` -PLM`G y p 0 S P 00P @0S`x@PP200P @0S`x@PP00 P0 00000SP p-LM`P@ex phM p-LM@`P0 SD D D D D HD HD D D D D D 0S Tdp@P0SVU@ PEP0TVU S 0-L0MDPK@ B 0 PE |E |E E E  q q ! -PLM@ 0T0   R0 0Q [R P@ꐰ-0S00 0\00 Q\0[S 0S0 [S ]SQ䐰 -LM@P0 0S00 -LM@P  0S 0=S   -1L M p< ,0 0 4 Y ap`VJPU 0 0 S" `VZLY4,0Q *00010 0 `40 p0@` DA pA@,@ 0 4  pL@T   P000L@T0 4,0Q* 004 0X0@` DA pA@,@ 0 4 Q0<0 ` 0 RE -LM@0 $P 0  -LM@ {P h -LM@@P:f Xf f f f tf f f f f f f f f f 0<00<00 b0 <00 <00S DEB0T <00< <040 0<0phL p-LtMPy@P g g g (h Dh Th dh h h h h h h i 4i Ti i BPtV00LpXop@ 42 p0<0a@ "@`@0<0p0<0jyupqp0<00<0D!0<0ĴUpQEp<:0 ! P 0Ӫ0p p0  0 S0`P-0@/S}OPK္P0: S`pLuo000<0qD0 b< @0<0kЮį  ̮L -LM@@P-j j Lk $k k k Lk Lk $k $k $k $k $k $k Lk (k Lk @P000h逩t-old0 hh<@P o00hЮįP  -LM` pE0 :0W0 PU 0SPU 0SU 0S  n@  0 A?U0@0 pP0@ 0 P]P [P P]P Ra -LM[@0Sd 0  h` -LMpP%0`KW1S} @1SPH -LM Q#ph`a0S  @T 0 S 7@t 1 R Q 0T2 0T/ 0T! :PB B @<t @ XQ YB 0  0 0  R X0 Q\@X T?}ԥХl -|XL0@ So r r ds s o o o s 0 0d c 00dR0c00P@$h@0S\0PpH0P0  c>0  A Pl|ptxЯt -LMPP`0  @P0 04? R 0LyS{ꠁ \ \ \ \ T \ 4 \ l \ T \ \ \ \ \ \ \ Ā \ \ \ \ \ \ \ Ѐ \ \ \ \ \ \ 4 \ l \  \ \ \ \ \ \ \ \ \ \ \ \ \ \ ԁ \ < x \ \ \  \ \ \ \ \ D \ \ < \ \ x \ \ \ \ \ ܉ \ \ \ \ 4 l \ \ \ \  \  \ Ќ \ \ \ \ 0 -0S= R 0R0B00\=! R  04=" M  aP 000k ,000,0 P 0?PPPlNS|P%< OP@,00X @< T \,0S000@L0 , a0PPS 0 ؋P 7P 0S  0R c?@Q0 0cc  i  p=00@Q@@@pp` =8,i @;+;@@@;  :@G: +:*@@ *@8J0 0 @0S0C0)UP d:P*00ePc(j@ErP00 *, :ɟ9@@: @P9)i9@ HPPEU@T 9 0S0C0U X9<9<)0)0xY 4@0 Z9(8(XP HP0 0H0Sڈ8x(l8UPe0e, 00e0Th0 RV 0   QPc\' 00^P@0@%SP@c\Uy\ 0Pc\q7l'h7H7g0WSwS0 q@70  00S0GN q00  RcRP 0 @ P㡬PGUFN @P t r0 0  R= P; Q @P6L%5 0R00 Q q00  R PP ?P  0S0C03PPU0 Q q00  R ^^$ PUD! R r0 0  R PQ q0 0  R PP PUP @84$4$ 0#S0 00Ue3P_CcP  00 {CceP  eh#t3弣\#T3 0dcS000P PPEU eX 0Sg 2"2\ 0 0SXP0  Pֵ 000C] -2 R@ \2H"D2@@ 0Qp"`05X  ' U 1 R1! 0b0P0U1! 1P@<0 0P 00005A 0S 01 !1 0QP`!0T00 R U@`p开P0 |0  0  R4 0P0Q 00 00CQ00P000,ԥЯ̥ĥȥ@įp t |0plq00  R 0P0QP HX@ 000 S:  0 0 0 00PE: Pb 0P0 P00S@K -LP0Lp`tS񟗀 < l d l  X d ؓ  < Д R3 Q PP3 P@0P 0U0P`P 0U V P 0U0 P@ pHXWVPPUZP P FP00fP``aP@@P2,R@$0 PPWT R2 Q CR!0 0SgWP 1 PR!0 0SdlP 0CUx0 q00  RPlR !0 0SeRࠟؠ0 RZ 0PSTZR㬠0  RK QE 0PUP@hh0 sRD 0 0S3-0 PPPUPE%l p-PLM@@lPl` R  XP0@D S<0 0S0C000pp`|tl-n$0 Q 08ꄥl[P(P)P{P]P}P 0-4@4P0L m80 0 0l  , ,000 0 V8l   p-\`LM@cPc 80 0 pį 0-@P L8 0 00h 0- P@Lc0hcį -LtQM0l!d1d `1`@$K@` ```@ ``( 0 Q C$0 P0b!0 !0lq00 c`R 00CR@ 0@0C 0c0 c 9 |9 0 0bd 0C0\0T0T P0@Xlp į  p-QLM@PpR `0 Q 0Q 0  7 000ppD`  0S0 co7 00 0l p-LM@`@P 0S d Y7 0 e0b 0plp@-P @Q` L| T  0P 0 QL|VT @pppPZlE-@A`0 P.`Fv+ Qp0 0  00  0P0 q00  R 0 PP0`Fvq00  R0 0 q00  R0 Pl@- AP0P+PEu( p@P$0 r0 0  RP 00 ` PJ 00 PPEuPJ0 0 |0 0 Q lG-$P0 P1PEu. p`BP 0 r0 0  R 0LP0@ 0  P0 0@PPEu P0 0 q00  R lA-@P0 P)PEu`p# r0 0  R0 P0T q00  R 0 PPPEul0@-@0P%@Dt" PP J0 r0 0  RTP 0 r00 Q@ P@Dt0lE-Ԁ@ 00CP-@Dt* p`P 0 r0 0  R 0APXP P 0 q00  R @P@Dtl Q-LP@,0 Q()0P`V Ttp@o7 0P0C 0 r5 ,0P倩ȥĥl -PLM @`; 00CQU5 0U@@A^S`00 ץPpXấ뵥`P@)7 0P0C 0 ,5 00TU (Pȥl  -l0LM` `0@ 6T 2404 00 w w 0-PT0P0L@@P8P 00` r00c00% 0-pPL0 0S0R@@0 P0 0B0@ Tl -LM̠0@ `T,@ Ppᨐ0 g?R,`,@ 0p0@ PT0 h?R0` 0 0 `?R`l -0LM P@0 s0 -L M0, p^P"0p @7 0^40U0 ^00S00,0 0 P 0W PPĄ^00 pW@0 0Ĵp02 0^U Ÿ000C,0 0W 0!^0  ^!00,0 0W000   0pW 00PPEu`p @ 0 PER` \0 S S v000u@p 0 00S  R+@S<@P0S 0 1v@000,0S o"0Q @>@h0 Ru M00 pW-00Ĵp k  0pWurlЯ p-LM`@PT# 0dR 0@P0@p^v0S0C0 Vvt 0S00Lv0S00<0 P bPQ  P0P e -LA9 0-XPL0S S 0@ S0 00 -LOM\0X,0 0P S ,0 S ,,դOKKK`VT UP W?K+yPW?K \!QH1SD1 L1@_0P S Tb818S <3 8L,r  -Lp`@T TT#6P0S! P T0  0S T ,+@T TT 9+8 -Lp`PU U @0S P U0 0 00b0bPU U X8 -L MP`p@T T T TT T$KPKP@ (KFP; 0D S0 H         ` t $ (0Rpp`$ (0Rpp$ (0Rpp$ (0pRp$ (0Rpp$ (0RppGE0D S 4         H ` | K*PppýD*Ppp=*8*pPp2*PppӤ+*p p-LM^`P0S p.T@0S 0S uP0S  p-LM``@0S pP0S {@0S t 0-@LP|UTp0 \0@ R0S<OPP,rH -@L8Mp` M\l2` N\X2@ L"Ybp5&LKTpK`H P K0T L` *P@P00P0 'PP 7 P ,0H P0 T @@*P |<<K +P800 pS080 80W@:0T@Z >\)<\00S#\! D`K 0  \wC0[SD[0 CR 0R P 00x-Sl\0 pW@X D00CS00  ä0 Sd 4  -0L 3&4H p-0LAM @P` ap sP` /0 @bTQ!P ,PpGOK.PP V ~.2PP <Llx -0L ԡ4 -LMnQ@0,T  h7}00000 0 000  -LM0p (0 TP@/UoKK/PKU  S?K\ R0SKK,L1 H1 D1 @1 <1 81 41 01 +,K]L0* R;(0 S (吡L -LaMb>K0C 0Cp( @ẟPv$6: Sg  S+PW(0 S (d:PBnK`F`F|!|1u+0S+@aDPP$[NK@D@D  P-;2W>C R0 RW W;ƀo|0S o+@PPW d岀BnK`F`F+EQ0)0KW LedAp  -LM@KX C0s aaaT0:at -SL Mp@P|00!1/P`!  CVx |0S@ 0P P* ,W@{?00 \@a` X0P P* W@{?00 ,r  -LM@ K K 0K @@V(P -LM8 < @ P`pm 4KP@h 4 0R SB B%P`Z 4 1)40@#WP0PS ,KL mPP 0 P@ U10  XPP 00S0 KP 0 R ;;S BPP 8<P 6PP 0< @0T *PPV %, P8@T -ML M0$ , p * P`:{?000!1 ,0S ,废AP@ PP 0 9P z0S08z0S !0eBKHH F}(0@C fPP- x0@S" 0S 0S+ 00L| \ 0$ 0:z?000, 0.e$LX,dtxd -L`S$Mp0K,  Qq00  Rp0+S-S-S +S 0+S-S QLq430  00S.^A0.S7 Z0PC Z04 "O1@K00K @0KD@H L P K 00K\ 10(O @//z "00Z &z 0V 40OSl,0`( &"0K`PP, P0 Q!000ӑP PUy"00 pL1  0P81@@K1`E% 80 ,,8 2p0@0KX0 4 W$0K J40K5 B"0@Z$$ `JPU *0 K0 P00KU:@ K00K ,@ }V`-V` -L00K,M,P0K?Op#$pW4 @@K0 PX @P Oß$ 4Be!5P[ 00Sty"0 0 /";0@@De#%P[0SY8<!!O1@K0@ oP P`O$  !5;B S<0 8 N 0,E @,P00Q 8 0,Puڼ!@@PK0 4K !0 0d|8^,Q@00 K00cPE: UcU pP/DDD0,gfffQ p-PLM@`PC ph10  00S H100PC r0 0  R1.\P' *\\ 0SU 0B8 S('08C?P PPڌ@PEUp pT00  0<0S000PC r0 0  R4(6 -LMp`#0P@ r \P \0 P@H -"P@2L MR0@K0 p` UsLz\Ō\pG   a 0a>Ìp4G6pGƃ??p`F R bЮ?Ф@A P 00Q00S Q b`.^L2a?@ C_`0 WPx 0 XP0x0Ńƌz(p , 0 KV10U0 0 P@0 0 0 ? -L Mp`@P@ <K4K0H0S񟗦 |  , L < d   d    d    p  L d  L     X L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L |  , L < d   d    d    p  L d  L     X 8D3#cX Q0@ 0 KD0  DK5P0S s!000PKp Hs!00CP3L#cX Q0@ 0 KD0  DKP0S s!00 Hws!002cX" 00D0 ?0PKQ@  DKP0S [s!00h {HRs!00ŸH2D"cX 0QD0 @ 0 KH0S DKP7s"003s"0020K00!1cX! 0QD0 @ >0PKA0S DKPps"00ls"00ht10 KdQ814!cX 0QD0 @ 0 K(0S DK|PLr"00Hr"00D00K000 0cX @ 0Q@D0 00K DK\P,r"00(r"00$Gdlt4 4HHL@@0D cX 0QD0 @ <O0 KX@0S DKPx0 R r!00 Gr!00000KP0 cX 0QD0 @ O0 KA0S DKP01 R ]r!00l }GTr!00x100KQ1!cX 0QD0 @ kO0 KA0S DKP1 R /r!00 OG&r!0002U00KDR\2`"cX 0QD0 @ O0 KB0S DKPb2 R r!00Z !Gq!00Q2'00KR2#cX 0QD0 @ O0 K8C0S DKdP4X3 R q!00, Fq!00#300KS3#cX 0QD0 @ 0 K`C0S DK6P@3 R q!00 Fq!00200KR2"cX 0QD0 @ 0 K0S DKP{q"00wq"00d20K00T"2cX" 0QD0 @ ?0PKB0S DKP1 R Sq!00 sFJq!0010 KQt1p!cX 0QD0 @ 0 KdA0S DKPD1 R &q!00 FFq"00v0L00KP0 cX 0QD0 @ 0 K@0S DKPY0 R p!00QL Fp!00HD000K4PX`txH?G?m"00@ ^BL ZB1m"00`AD1@!cX QB0@ 0 KD0  DKPw0S m"00p@ 7B 3B m"00c0 0cX 0QD0 @ @00K0@0S DK|PLl"00Hl"00DD00 KTdhlpHLt|HG?$P80< cX 0QD0 @ DO0 K`0S DKBP0 R l!00  Al!0000K000 0cX qQ00KD0 @  O 0@K DKPl!00p-`P@0!@`Pp -P@E:::LCLM/\p, J\!h1S   00 \ 8AS, 0110 p0 0 10 46@ d,0 "&`'@0@p 0y0 `P@0,!O3\ \0 eL03  1S@Rp@- b@0`P \02l`1^1b\@0pRp@- b@0`P \2lPnR0l@0pRp@- b@0`P \02loQ^Qb\@0pQP:  -P@L h -\ *p`T<  0 p`@A -0P@0@PPUL  t  0   x P@Xp`X 0 P@.p`@A? 0-L LP@\4 00A -LMO@k0S -L M. p\G/ `P+P`0 `P8@0  KR70 V p0SP` PU` K?@0 = 0-H LP@0S0hp0 -LP@,M⌥0KQ0 @ ,@ WSO@S`8 RPRI*R4%0 0 0 s 8 0b038 b&x@(8!8HT*@@*TI2@0@bP8@8#8XU*P@*U@2 ȀP 0&@-O@d4xB 02d @-M0Ѝ@4=> 0o {9 -L MQ@0K00#  0 V0T0P00S00#0 -LM K K!|P -LM K K!pP -L 0KM#N( -@@L0MP0  0 L0  00S00 K( KP(c008 -LM`Rp @t%  P`F @pT`P0AS3 Q)0 0  00    p-LM @0`SPR0 S    0100p 0S Q0 S  0S0 .R@- P@0@ .\Q00Q0S@@ 0S0 .R𠁢Q00á?P R-LP`@p0V  :00@@@@@@ 0@-@TP Ž0P000 -LMp0 S P%0`0! @! V@2CP0@KPUN 0 S  均L0S 00Q -0S 0  0\\00 P89 @9 H9 P9 X9 `9 h9 p9 x9 9 9 9 9 (9 plhd`\XTPLHD@<8d#(Dl<\ 0- LM@P K0  0p0*Q@-@Q*\?\ [\#\ q 30  00S+.10#0 \00S#10#0 \00S.20#0 \00S  \  0LS00S qX2  00S \\ 00@M \ J,< < < < < < < X< h< x< < < < < < < < < < < < < < < < < < < < < < < = \00n  0000D0\  S00000\00a \00b \00t \00v \00f \00r  R   ?\*\ #\[\ 0 \ #3 00000 00@\00M0 0qL00  0 0S-00 ^0\0?0@0\00s  p-LM@QP`0 f0p0  Q -LMP4 Q @pB8 | Pz*QP*Q?Q [Q#Q p10  00S+'10#0 Q00S#10#0 Q00S'20#0 Q00S : Q  0AS00Sp1  00S( \Q PQ T:`4P00 V Q 0K0  jQ@80c@ T4:@D`0K0  j` VPE  @` -@TL P`p T0g0 0l 0 e@DT ** -AMLM#0,0 3 &P@U 寲PPYBnK`F`F sP 0#S | l P2 T|P D vP4343 0mP BKH H 0 弴4TU WP@ 0  謴44S O$`2 ,0S t,B^KPEPE\ 74rP 0#S 0 ,  '  "P ``` P BKH H 0 @i4dV P 0 @Z44SBNK@D@D +8 P@ a0S  P@0S0T 0S㤐 0S  0S  0SP P<  `LPPTx|ȴlP@dL -40L R4P P00PT 0-LP$P P$@ |P00T 0-LPP P$@ gP00T -LtM@0SK 0RP H K 0S x0L: S< T_O00Q_0귯P0Ph  -LM@0S00P -h0L,M80 \0 00 T0@4 , (0 $@ ڽ (00 8K 0  (hp(, pP0@-@P  0S ^ 0S^0 @0S SS00@00P0= * -QLM@,0 pR P4 i 000 h 0p` V Vᘦ%j:$,0P  0\0 p` V000S00 YB080 4 0\08 0\0I` Vp Vᘦ%.:"0\0p` V?`Wpᘦ%$ 4,0P 0\04 0\0Y4N @,0PP`@,0PP`O^0 0 * * --L]M qPM?KC/`KK \1 4Q 0Q  =K0K00S cK|1 1  x }p@ 1P|fP 0S L 庂|1S00^ 000|1 LB8L *yyG * -4LMQ<@ 8#8Q8:0Q 4 %*0 0K Ġ̌.Č#̌ !  -p-LM`P@>KC/JK X1 0Q ,Q | _?K A xA D0 bKd1 t DQ c 0S OpLL QQ *vv * -LMP -LMl"  2 ,  " !H pe^0P2 0 PP 0S{ P WP 0S o]$481!`)!w\0`X0 `0ᕯKS/K ڜ1S9 @T  0(KQ QMK0SMKP"3@(K0SS SQ 8  V12  P1, OK @DH1 P-?(K R!  ~0S 21?(K R2S "RK H K@ [基0 4u  MK0kPMK P+ 1KMKu P[y Qb [0S [k LC* 41`)[\LD 0 h[0#S [L $ R@]K 0@,Y"|@B"2@@eP 0S"2PL!4دxa 8Lt,rt -L,Mp`@ KD0K< 8 @ 4 0 , ( $ JPDP@  0`4PP @TDҦDΦ< -LMp@P `p08K8 (P , 4` p7K0 8K (0S (L -MLM Z,   4 `c V $ 0P@S X3`1 / &Pp) B^KPEPE0,! P*@~&`~V INK@D@DP 4: S  R 0 Y0 ,0S ,KPt $R 0R\ 4 L ;8`LL < 8Lt -LMh@pP` 04K4 $@ ( 0P `3K, 4pK $0S $L -LEM@pKK, 4! 埨K081 PP@  #R 00T-* R+ R) R' r0 0  R r0 0  R0 Qh#0000ӑ000\*0 S S S0\*0 S S 3000 \ *0 S S\*0 S S  \* 0 S S S R r0 0  R> \*00 S S SP\P 0S ``Pz0+Sd -S D 4zP0+S0 -S PPUb ?? UP[|,0 S t,D~0S @S tP K?K,`0S @S K?K,0SP @S  4.P`8~ 81S  K?K~, 4t8 0SP @S 8~ 81S  K?Kf, 4\8 L -LM8KKPp <, PP `P@ ,0 S ,}P/K%>KH D LB @B KH L @B R@?00/Q,0 @  BR0/S  0-LMP@ 0030 4b14c021b!*9  P0PGϠ\*//X*""T*jjP*''L*++H*D*..@* -p-LMPU/ @0 㦾 0P0S0c 0b`PU 00 00p@ K$ K(0K ( P @ PRP$00P 0 w,YT 77*88* * -LM^8K- 7<K@ K0 <0 >Rp` P" bP^DK@ U `@KQNvD@K  @K0 8K (*** p-LM@ _PP! `@0  Q,00R0  0S 00S0 ^ @ 00p -QL0 M4 0 0Z000(K00) yTPP9 0 P0S pЀ`@ڹ0S@ ` ҹP p WW0S 4 R 4 000Z0 000S40S 040** -LM`tEPPdq 0SL0HH!plP0P00@(K 㤢P(0 R 0SMR- $GR R $@Qʑ T#ppx#KRdpKXpAkR gRmR,pFh,r,L||f **uu* -LM<`p@P0$ P@ PpXt -LM@` q00  R@P pK ! P00\0SP:Q UqD0  00S0SPU@  -L0S -ML M0CKJp`@P J! ,p P`@ P呼 ` &PE~KpG`pGf ǟP\ \ 0 S RL\  \*B^KPEPE B\4  BNK\4@D@D<堟PS~KpG`pGe AP[ @ 0 S RL@  \*B^KPEPE @5  BNK@5@D@D44!\P-RK@ @PPSKLSKLN4 0ɩPR.K B8 B1P@ 88x0 ,0S |,sRNK@D@D P P@N00L  p-LM`PP  Q Qp r0@0 @TQ <NP spN00pP -LM(a0Sp=QQ 00 !1Q耟@P"0 !11j?0P  / 01!0P0S00<@  P  P  10BS0)00 00 0 -LMp @GWT`P W6Y4UP00h00C0@` @@0P00 R0pp Ph 00@` P 0h1 0C 0 -LMP @EUTp` U,Z(V`00hG00C0@` @?@`P `h 00 @` ` 0h1 0C 0 0-0L)SP'010CS#\ 00 \:0@S0 0P*KP0000@P000 -0L)S`p%010CS!\ 00 \:0PS00@T *0S P@ T:00@P000S  \00 0S00 Q-0L AS  00 P  1Q0C 0 -0LMS,0 p`@2Y00DTST* T( 0PiP` PU00XQW Z@@ Z@0 J0  0@C,00 0@ -R0B0LM@@^ T lR0 0 R B0 0 o 0-L@ P<@0 -QLp RP@@T*`0S@ S CP@ T:00 6P `0g0 @  -LMQp` RP@@T *P 0S @T:00 0g0 @  0-@L P@0*bb**|*x* -L0S H "00V:`>P@ `8%0==0` 0 @ a0AS"  0 @0>0@0 @ C. @ @00p+WP -W=W@0D =W << D @0 0X0C S񟗖 ԣ ԣ ԣ ԣ ԣ ԣ ԣ ԣ ԣ ԣ ԣ ԣ ԣ ԣ X ԣ ԣ ԣ ԣ ԣ ԣ ԣ X ԣ ԣ  0 X ԣ   IPI< @\  @ R  @0<@0 X V:H   ₑ H P@N  j 0`@C80@ `< D0R0+W00=WSD  V:H   ₑ H P@(  j 0`@C8@ <0X~ `< V:H0 0⃑ H0 fP@  j 0`@C8@ 0c` &XD =WRD0=W0VD0 :H ⌑ H @P@  j 0`@C80@ =`< R V:H0 0qH0 $P@  j0`@C8<0X@ !`0S ,S 00 Y ꒀ;I9 G 0@'͌@ G @-gQ@ =Q +Q -Q \ XQ0R0- 0+oQ uQ\00@ ! 0 00 0 +^00 -^00 =^000 0@-P 0+S -SXS S5 0+S -SXS @ 0-S" +S XS00 T-00@P^+00P\ X00P0  @0  @0!!n* --LM p-P0LM@`P8 4句T  Y yk4,Y - 0p@L` GPP0S @TP@ -L 0SD 0-0@SPL((% 00 00U  0-0PS@LPP PP0TP -LM0`Sp (KᣖPP (QC 0#S@ S> 0 S RA(  #TP0e(0 (P@} ( (0PPhP@ P0 S S0 S S YP0P0,K e,0S ?R0Sp0PB U 0@S  R00 RZ@ T 0S 000 ! BX @P@ bPP 000  bF0@NE0@ P0YP 0V D0D -L>0SD\\**;;&* -LM,4C8̓ <.K #h, ?KKK@D3 0# p @ iXZ  CK@@0A"$1Q  H BK@44!@?P@ BK@Ƞ@ 0zP p?W 00Z00S  "$00R00S &8BK@<@44@ BK8X -p`LFPP P @P ṐP 0S0S X 0-@P@0LS00$ 0000ߓl X -LM(@0S0 00lX -LM0St (K /Q@`Tg ( 0 S RL0L(  S *(0#` @Rq ̫PU`@0S0T`ÅPP `0 S S0 S S P@00TP@ 0U ` 0S  R00 R@@TP U 0S |00x0V:\帔PP 00PP@Ņ,,Plpt  @-Mp` @0\@X\x\@ Q $Qq0 0  R#0C'  Q .Q0V42:ЍQ q00  00S 0gC R17 1RTq00 D R q0 0   Ra0LA0L*AϠ* -PLM@` +B00P,K0K 0, ( PPp VT000Pp  0 PPp  ӪA0@A@H* 0-! L0TT!P@AT @@ T 0A0 0 -LMp`P@匀T ;0S0d0 @ȥX00U@ <:N("A8 -LM@(@T0 @8   B00! RA R0000000000000000Z* * --LM -L@`pEA`0 XXPϟT  8噮8 $0  徟e4,Yp( 0-LMP@ 00"0 ?0-1pQ LR@` 0S HP @@ ԩZ0@< ŭ0000S@<<@! ?0-1pQ LR@` 0S P @@ ᠩZ0@< 呭0 000S@PPT! 0-LM 0xr.0l@hPTX0 RP 0 PP@ 0hd p-LM@hP`\ 0 @4Tp`0@ R 0-@LP 00,@r.0  0hhd -rSLM"0@P` :@@p 0P 5@0p0@ p-LM@hP`UM \0 @4KTp`0@ Rm 0-@LP 004,@r.0 . 0hhd -rSLM"0@P` :?p 0P ?0p? p-LM\@0PSP`PP j@0PPPp(Pp  0-LP(P0@P @0 p-LMDP0@S8`pJ$0P@@@q -@LMh -LTMF\` \ , d h g l 2%0S U@T %0S :Sd P0@T @T@KB\d QR d5PPBDBPP XK X0S p00R0Sd@\T00Q00S ` PT0PS l  R T@0,S SS S UP0T0 UP004D,0 S 0,cUT@PPh@T P@K0h LK@峙Ph Uh  LpLP PLyh00fs`V tCDK0\HK P@KLK @PULD0LP 0H3LK2 P@K@P`P: h0S@- zh@ )R P  T SP@ 00CS0 0Ӥ0 P p m0+S:P P P 㓌P TKA\ d0@RSA00匒h >PzP \QP!00 DQ0SG d0S7 ?,0d LKP@K@PPP LLP0T@KPT AAAPP d@T XKX 0SpR`@@K` `0ΪH0 =PL!]]>*97*IϠ$2* -LMğ !  \ ,  Ḕ ' !0R0`p 0P1 4@K K 0  K K,K  K K K K KU0 \0 x X0 T0 P0 H0 D0 @0 <0 80 40 00 L 0 0 |0 t0 p0 l0 h0 d0 `0 0SH 0SE \  !@0`C⅀K O`Pp.0[  R) R' T*00K[p20  00S  Q"0000ӑ0K[ Q"0000ӑ0K[00.=L0`X XKK, 4PGK 6K 2K .K *K &K "K K K U0S ==0S. 0CS*V w@1 ,0S @,a<` KOp<0S  WK<P1KXKL00L0 60[S0X K60K#4<00HPP < 0L8 0,Y 008 -L0Mp0P 0 `@ LKL@KD00D0 Q Q i<00 0 S 8 a, dQLt,t,t,: Sb0 d Sc0 ] Sp0?0 0r0-00w0-00!=@SL CS-0> X! r0-0 0w0-0R00 &R-0! !r0-0 0w0-0R0 R-0 00 0 R 0Rt0T0x00 R 0Rs0S0x00 S ! Ss0S0x0 Sd0 Sl0  S-0 Ss0dd/*KK+*'*%#*%oo* *R0S 0S0S0  R00 -MLM00  0PP `^@T T 0T,S 0S UP kg  0PU  0PP  0PPP( p-LMP0 S0 `@0 P P0S.0X S0L@0Sp00  TX -L M̀0`Sp(` +P@# P\  0ǯP x$ K10wP(KO{=P (80  $T0TXL@-0S@ @ 0 0 0 X -LMha ^( @Pp$ < 0wPD ( K10'P= (P8U00T00S*0U0T00SW ـP` P 0 $@A$ 02P $ 03c$Kz0T --L 0-<0@ PL,,T 忙 0h,Y4 0-0L@P 0SP0 CR 0P0 00R P1, 0 0 -L M, ,P0 `@ t00  R-T0@40  +T4 @VV0TP V0T ``yp$t0 0Q0@Dt0 0Q t0 0Q7 DW D@T\ W00 T00SG' +p"00@40S\00pgS \,00E0XSxS@`P -PL4MPL p` 0 S@P X 0 S @P L0@KjP\!H0KQ, < 8 4 0 p4@HP D `` @0)Sn6 0  1/ `+0U# >E0CS <0pCaH0S  M H 1 D 0H0 L0U 0R*0 0\){} 0-@PL0\*ql0  0!0S T000@CT00^00S 0 x -LP0SPp:tP` P\&*0^S00p\*0]S -S \0* ]R S*-R P0]S-Rx \*0]S ;0SS 0 0@SJ0  t0d2  00SH@TZ 0S?W"  0SJ 0 @@000l 0\0Z 0  00 0 B 0SP u hp hHP  000  00 -00-0 -  Pz00 -00-0 -  h00 ]00]0 ] h rP & P0S.*8  zrP( 000 -@PP050#-SL [S0 :Sa =S1  pR*0-S `WW  0 00 \  X\*0]S -P0`0 `0S0%*00-S]S P*0S*0=S .0]S00$P*0S0"*00-S]S 'P *0S*0:S 0]SP*0S05l:o h -LM @$Ap\ *P q00  R@ `ePi qP0S PP PP  000   PP0S 30PS\ -LM@=>0 00  0- LR@%*0S*0[S 0 0.Q00PQ*0S*0.S [00]S00Q R* -PL@  R)* P*0PS 0]Sp`ePV , qP0 R 0Spx0   0 R PX 00p , 00  RP 0 p-LM0K KP` 0 ]0@K0K KeP`p -0L `@8pP Put00  00S P h =0S04  4  p-LM0K KP` 0 ^00K K]0 @0K K!P`p -LMP`@p0SGT1 T00W0 W00Si7777H9H9H9H9H9889H9H9H9H9H9H9X9p9` f 00   f  f"  A   i f0   f  f"  A   @`pG f 0  f  w@D q@D`q0 S  - L @P0 00T`%^  R ?>1&,1D #@0 000J0@@ D0@ 001P 0 P 0^ ?>1  ^0 f p@-0`@  ^R *0 00  n^ :0E\  00C 0p -L M, p0 0 S@"* 00T0R00S P*`P0 00 R0#S P: P @ T:`@ T*,,0p-0 R*0 R:@-0@P*0  \: -LMP@p0 000`V@  ` g ic 0S  `ik- 00/>\ 0S0\ 0@- 00>Q\@ 0R0\00 -0LS8p`0S PU`P 40PU040@0 S @TP -`RL@PpR 0!000 p-LM0@S`P 0\ 0  !p/ p-LM`\P p@  A 0S0 0H0SHP Z  e! B 0A0S 1>3 01 0-0@SLP0 0S @ 00h 0-0P0@L 0S 0 0 00 0- LR@00>#R0 (R" R @0Q@PR@P0%P< @Q >3SAQ 00@0QLR RRL>31>#R R "RR R(00(000S0 0>3S S S\(00(0 P L -LM 0R  @T p0R000PP P<PheE -LuMp0 (, 1 P`_ PPQ 0@p1 0$P}K@{K 0oK. ̡ ȑ q TuKm#P! 1@p@nP oK ]0 ,0S ,aD 0'10SD0 <{ 0 L4P0  -LbMȠ0JK(0 4kp! @)@Kp|Z_K`vPl0 \ TjKjK11 P 0L(0 S (CL  -$0L!00  -LMp 0:S "0 R00 02"00 R2 0:S 00 S0!d2 l2d"X2Q  ,0:S D<",@0:S:?0 "0 0 R00 S0101! Q , 0:S !,@0 ,0 0@|-TT0 R, H1 R , 0:S 4$1?@0 R0000Sg0S4@0 0q0  0 0 a0b0000d@h d0qTP0 @P0s0`@P(hd$ ,r8X -LM 0c -L M@@Y -L M@@O *tt*PP***33 * P-L h/00 -PL`0\p \=|# 0 0  R3 @ Th P1@rT%0\ \|h3  00SWpG3 /\00\0S@.\ \|3  00SW0 0/\@- \ V t0j T ڊ>j1!W pG T 8(00 0S @S@S@@@0j!T@QQ10  00S V؁P@ ؃h P1@0\ \|1  00S\ Tڹ`\!\1g0XSxSQQNq$10  0D0SE W0P 0\6 \4|00  0D0S+ |  0 0  R \ 00ӑ@ ႃdP`a\ h000X0 WpGk 0002XpGH(Pd -LM0  yx4 -L M@ 0@ y4RR*ZZ* -QLM  0K  0   0-LP@kp P_p U T 0\ ္pP Un`O{{** -0LM@`(BPP0 0$@ $0 P tP@5 ]P, 03pP1XY(ʐ LP p 03$0 Y   < P$00$0U   p0S $ @TD0 003$  u3S03Xpp 0SW,0p@,@ ,@ 00l0 0,rd -LM( Dp$ ` /PP P Pz@ (@00 00 0S -PpPL 3@S0S0@:3S5$0``PP)'v zp:@6@ -@LT` $0* 0QP3 Q# R 0PU@G 3S3 3S S  $00 S/0/R@0( D  P 3S 03$0` P3ա 03š0 #0$0@P$0 :>$0P3s7 0$ @Q$0@ 0 S003P $0 :P3 $0p P A 0@;@$0 @2 up @@_Q $@ 0 0R 3 P0 3L00 P  *PP$0   30P0K0 8PJ3 03 PU 0  PU:$000# 0B8S 3S  $0H ZP3ԡ 03ġ0 #0 d R-#L 0 0 :Q0-Q@@TLP`=p@$0 3C T TP+ U$0P:$03PS0 /R $0@  h Pp P]600d -L,M , 4 `PV , R0H0  $ 0S0H0 L ? ,0H S@@PRP < <0@0 4 $$00 S/RA  0T0 /00TT 4P #0 ph0 D 8 Z ;PP $0 0.S  P@y Qc*D #  00S$0H:<0S HQ 0 03#40000Q08 8@ @0@ 8@ H R L0S P P $0 0D00$0D00 H Rں#0B8RSH00CH0 0( 0 DT0{ 40$0:$0?00puP  W $0 P T 0phTP0S 4 03$0:$0P 0S[ 040. ScU P0SA$0 0YXT0AT T 0@0S ,YQ4 3S#$0 Y 0SY00 0 ,0S4 # P 4 #$0:$040 0`0' 40VP @   4 <3@ 03`00 <0 |@X400420#4 0 BH  L ,0S V4 #A400ꌡ -LpM$0@0PK@P0J 9P10: S S 0  S00D00.S, 040  3S,0Q  3S000P0 E0S D040. S00`&Pp` p 0 0pP 00 -0LRP@` V P  0X @T` 0@T000(00PpPppꌿ -LM$0HPPp`CP@ 0 W$ 0I00D @0(`"0 -PLM@ @\T 0-00L@ :0S00b?0 00C0媿PP 0S P3 R D0P00c00 R3 SD0Q00c000S0 3S 0-@PPL0"0UP1S -LpM$`@P R K(Pp 0 0R, 0R p00V@@&p  PP -P@0$pSL$0  0` 峾 屾0S᫾hd0S H -LpMpp`  KPP0: S B0 0 p# 8=P@ (0 0P (PP 0 PϫD0@000*P `p$PPP7 V -L4Mp, &$W, Q< , R0, & BX 0BX0 嗃#(R@40 T P?4 P0`Y 00  Y 0AQ0 X`P&TP @0P UR PUJ P"0Y<0 00  Y 0L\0 `g@g' 0L\0 Y 00  Y 0L\0 P@g< ' 0L\0 < RV 0 b0hP,0P㗃#40 Y0`; 0@P0 4@d0fgP!P Y0` 0L\0 ^ T4 , d/  0  0L\0  0@P0 ʿ,0T`P0 0V*@T%Pg PY 00  Y 0AQ0 @' 0AQ0 P`0V: 0Y<0 00 0 0  0 P Y0 0L\0 0' 0L\0 ' 0AQ0 4 4P4 P4 40P01@80  8P@ Ph PZ 800cD0 @ 8PP? P10@4 ` aH 84 HPa P4 P4 k4H H 4P4 PH4 40H P D D0P0 PD D0P0 P   P P  `0VL *@T%Pg PY 00  Y 0AQ0 @' 0AQ0 L`0V: -LLM` d d@` @d@ h0 \`K$ h0 PpW:` <Q U@ * 0dR @T`05<5:T 0 00` 0 0Pp$0(0,0 0LPP d0S`@H0SW 0 P0P00 d\ Q D0^ "0D0^`H0S0 t `0L R0Sf R0S]  0_P@ E U 0 CPU 0; HP@ d\ 0hc/0cOdP^*hP@pD0^ 0  d0^p@P:PPHFTPP\< `@L  0%0DPc`H0S[`@0\ 8PP'p -L M@0TP 1>3S S 0P>3S ? S S 0@U S SS S 0P` 0 P Fp, @E  0@ PP, P , 0@S8 S !S 0P` 0 P Fp@E  0@P 0 S S 0>" 0c O 0 > 0c" 0P` 0 P Fp 1>30@C0  @P @p1>3@!>#"R@D 1>3PLSJ1>3P!># RA -L$M@ ,@ 0 p RP`A>3S S  S PU00^ PE0A>3S aSV 4S1>  0 0r% 0 @Q00dS0  0dV0  P   1S P1S 0sS ,1V >3,@0ca0 0@P@D ,@  ,00C ,0 ,01 , `{S@ S > 0  0cO0K ,@00 VP000 KS>30@C 0,0 @>P0!@># R 1>3@!>#"R@D 0a @ K> B000 K@K ,00Ps000,00 P>30 z V  VR  0R MS S  V`EV V@*0 S=090 0V V0V5:-0 SX S&S- S V$ V*  R rlA 00  R _Q 0VV r, 00  R_Q00  V V*0V S VV r@ 00  R_P V5:00 PA >3PA>3 S>3 2 V  0| -LM0Q, `Q0 AϠ lp 0 4 00XP40`l ^0p U40 @  U V  Vs T e42W  U' u "0 0Q_U  V v 00QF_VD  U u!0 0Q%_U# A?G0CS >2,0X  R 00  @P4  0  @0W  V v 00Q_V pp0  @@DTʎ0 00\@\ d0Wpp~ 0w0r ,@pn 0g -LM, 0 0Q0 `Q0AϠ l040 0PX`lp U@  U V  Vr T d02W  U' uŸ 00Q_U  V v!0 0QE_VC  U u 00Q$_U" A?G0CS4 ><,00  X^4 00  @P40  @E0W  V v 0 0Q_V pp0  @(@DTʏ0 00\@\ d0Wpp 0x0s ,@po 0hG-Q0`A $ P !>3Sy < S7 S S S Q@3"Zp0   S S0ZS S S0>#0S S S S "S>0!># R0p !>3 S >3 !>3 S&S S\0X0>0400 S2 aB0L~ -LTMd h h@d @h@ l0 ``K$ l0 PpW:d <Q U@ * 0dR @Td05<5:T d @@PpP$ 0 0( 0 0, 00 000  4  0SPP h0Sd@H0SX 0 +P0P00 h\ Q D0^ "0D0^dH0S0 y d0L R0Sk R0S`  0fP@ E U 0 FPU 0> NP@ h\ 0lc/0cOhP^*lP@pD0^ 0  h0^p@P:PP${xvTPPYl$j *d@L  0'0DP^dH0SVJH$Fd@0\ dPPSp -L M@0TP 1>3S S 0P>3S ? S S 0@U S SS S 0P'` 0 P Fp, @E  0@ PP, P , 0@S8 S !S 0P` 0 P Fp@E  0@P 0 S S 0>" 0c O 0 > 0c" 0P` 0 P Fp 1>30@C0  @P @p1>3@!>#"R@D 1>3PLSJ1>3P!># RA -L$M@ ,@ 0 p RP`A>3S S  S PU00^ PE0A>3S aSV 4S1>  0 0r% 0 @Q00dS0  0dV0  9P   1S P1S 0sS ,1V >3,@0ca0 0@P@D ,@  ,00C ,0 ,01 , `{S@ S > 0  0cO0K ,@00 VP000 KS>30@C 0,0 @>P0!@># R 1>3@!>#"R@D 0a @ K> B000 K@K ,00Ps000,00 P>30 z V  VR  0R MS S  V`EV V@*0 S=090 0V V0V5:-0 SX S&S- S V$ V*  R rlA 00  R _Q 0VV r, 00  R_Q00  V V*0V S VV r@ 00  R_P V5:00 PA >3PA>3 S>3 2 V  0| -LMp, 00 Q,(P4 0 8 0 Y0000AϠ0 P0P 4N < 0Y04 `<0P 0 V<0 @  V X  X T sp2Z  V' v\ 00Q_V  X x$"0 0QT_XR  V v 00Q3_V1 A?J0CS$0, Y00R0S0 80 40 80P1P<  0P00 P P0Z  X x 0 0Q_X 긠00 P@DTP0y 00\@\ d0Zo 0h0c ,@_ 0X -LMp, 00 Q4(P4 0 8 0 Y00 000AϠ PP< 0`Y V @  V X  X T 00 P@DTP82Z  V' v$"0 0Q_V  X x 00QU_XS  V v!0 0Q4_V2 A?J0CS$  0<S 4< {P ,Y 0 80 40 80PDP< 00 P8P0Z  X x 00Q_X |0wX0X `0Z@n0h0c,@`0YG-QM@p(,P >3 S C S> #S S S P@Ѝ3"Y0   S S0 YS S S0>#00 000S S S +S "S 0>00 1>3 S 0   0S0 `>3 S >3` >3 S 0&S Sy`0\00 >00`0 S00h0S0`@Cca@-M ^@ P`pX\ Ѝ(@ \@Ѝ@@Ѝ@eE11* -4L|MHK0 @K0PԤ1e/ @ \ \ R *0S0\  \ 0|S :S 00hh$@``$@X: @PX0D0L K@X0pL0<P K @(0P0T K @00T0X K@,0X0@\ K40P\d K@p00, d0h K@80}p408 h0l K@<0sp6[>dp K@4kp7[0Ht K@4cp7[0,x K@4[p7[0| K@4Sp|00 K@P0Kp00 K@T0Cp0: K@0;p0,K: 0Ln 0KHn 4KDn. 0 XRxR @@00 :S0-LP 0:S0@0h@0- 0 Sn@Sl -LM K"vtOOI*E*$$A* -LM0`=S`pP߮,K6P@; UӮ P:0P00@S=S 0S=Sg! P,@bP 0 ,0RA 0=S 0S0 0=S=000P0 @0S 0S` `00cC QةP@ 0 0S 0 @0@, 0(X p-L@`M@PKɬP 0! 0S0 p( 0-L M@\H0P (0 $ 00K K(0@  0  ,P ߓP 0, BB*A``*##* 0-LR@@-@0S  S 0Sd@(n*(g*Q0 L 0L$hhW*$%%P* -LM< 08 rSwS@T 0 0 ㌨, ,0S| 4KmPv1 Rop@\ P/ 1 R(< 0rS <0庖P4c,0aP, @0S h, 00,0Q0 @44囖P0ܭ1@T 0:@T< 0rS 014P 80p 4!0@4T P0 R40,P (墭垭,F xH\(T p-LM`0PS4 @T 0S  @T0SpxT R00000S`K pP%0S upW SH\( -0-LMP0 S@   R1 00 cQ  R!,0  0S "0L(L -0-LMP0 S@   R1 00 cQ  R!  0S ^"0LT -0-LMP0 S@   R1 00 cQ  R! 0S +"0L\ -0L 堷( -BMLMh#0P,0 0L4  0S [00,3 ,0S ,"/fPL$H$ K2P@@E00 cBK J JH fMK@DPpP 0Sr+`0CK0A S A P2D4 H2@ K0C0C0  A  '00C=S񟗗ttttt ttttdtttttttttttttttttttttttttttttttttttttttttttttt0 S  1S!00 c0 pζC0L4 dꞫPnL$R 060S3/Lddlx(T@-@^  0 S SS00N0Q --L i 0-LM@Pf0S 0g0S e0S  e\ 0 @@Pi -LM@`PeP pW奧W0S `U @YT :0S 000@0PTP:@T TWᗥPP  㫪 0\4 -PLUp`@: PP@ U:` `       --L p-LM@P\0X T`%ZT < h000 K0C0C/  +*Y Pp* +9cp`?00^ 0@C/Z0@hR>0N0SZ IF, D\+c>00S8 B>K0C0C+< c!Ld p-Q00P00LMSP@`P 0s pp[ᲣP@`00p 0S SJ* --LM  -LM0P\04#   R,0 p 1S018 `< @T1 tT?   0 R 0S0q?  0 0S 0 0C`0ǍP %T 0S 0S0 0C` 8,0 S |,BᩍP 8P@pzT|@44 (444<Tdp|iz 100Cu@ <# 0Sq 0q;  0 0S 0`0CS0 P MTD|@Z  @ T *000ߌP d X2 `0 j 0 0 43 0P4#83 04# `83 Z  KK @0S 0 0CZ @ S0 RT `ꢌP T4#0KK@Q4C @ 0Z0C0   0S 0 R@X 0088 xP XZ @&43@4 0qL9  00S 0Z0C0   0SQP 8#0d` 08# 0\0q8  0 0S0Z0C @0 S0P x8JZ!3Kg @+0DMSaTTTTTTTTTTTTTTTTTTTTTTTTTTT TTTTTTTTTTTTTTTTTTTTTTTTT <3S<  @00CS0000TZ I@XXTxT@ ;6 3K<# -43@ 4C  43 43 8C@8C 3K0``@  43 @4C  43 43  43 @4C 43 43 3K<#Hv3.KXXohP  <D%00<3 <,00S<3 ʔ<# R  &3K 00X< y4JZ!3KL @+0D:SFdddddddddd@00CS0000?Z  /@xeTET& 3NK0d@3Kxs =K43@ 4C  43 43 K83083 43@~4# 4# @x3KXx3.KXᭊP    9 S9ᛊP @< |KKp@u@r@phP@0<3 f倐lP  43 @4C `z 43 4 `r43 4 !@43 043  43@ 4C  43/43 W43 4  43/@4C `H"@ 0@@ < @" t00  0@P@oL4 @-^R  \R n-\ @\00]\0S  R\ A]\ -LMP pR0 0V@ J000P`dp@V : 0 f0 0  f -LM, ,D0 ` v00  R-V`<  +V< `YY0V Y0V <Q +. 0@K  0O@K 0 K@@K 0KP@@K 覊<00 KSP T@0PiPepv$B 00Q0`Fv  00Q[ v 00Q7 FW F` VM\< R& 40S 8@T80 W V00S N"00`D@ 1B"@$$pSƏ4X004 X 80W8@<0W V00S pD@ 0B"@$$pƏ4 X000Q \,0 J00 K\0XSxS`I -LM, ,`\0 4 P u00  R-UP8  +U8 P4 RR0Uv 4@T0U 4 4@0K/0 ʌ@K @@K< pu 00Q0PEu P!0 0Q4 u,A 00Q7 EW EP4U%\ X  W W0 < U00S Bp"00PD@ <B"D@p$$ŏ X008Q\pw0 R \,00F0XSxS0P40 ` -LM0 @0pP `冀WPP @ ឡ00@P0  㞝PP 00_0 ;0P`0@  `VZP p0-LP@H l1 RV 00S  R 1S010 :000P0S  0S 0B0PB0000P 00 0R0 P0PS 0@ <08 0B0 0BP00 @0 0P0000i%P 0-P@LT a DA0DSR0D@TP0 \(.\P.T.Q0 -EML M@H$ 0r/, y'H4 YL h Pl4 Y 7 ,0S ,!4 $pǟ8(<,"(S\$ D ` 0 l 8PpDP 6 0YY`  \4`$ P T  S\4`$0Cd$ \4 V:6 D 0 l 8PpDDPLd$ d$ \4CS\ d$R00V0#02S`4S T PY? L ""`$00R00S Y! 0S L0 h CKA APh%H奡D4@ cTHn[D4 0D$ `V*9` VX *9`V H*9`V x*X4.SS`TYYX^ X$ YR X$ R @@ @x X}@x0%(H$G Y\ YY d^`` jD?PD3 WX^/ `P" D4 0b3 RD :dd Mt3TP:hQh DT4  T4 呅`D40D4 D40D400D4 <K 㣟<0S80S40s2 D4%sGYDlF?P%D4H$D 0 l 7PpD^Pdd ``QD4!0 2P^D45p#04P 5wy DƠpC>K0C0C t4 z7Ppt5P t屠D4@ cT`dd tuZD0l D4 L1PP*CKAAp 0 p4P7Ppp Pd40d4 D4P0P }D4 00pD4 vD4@ cT`p>ZD$T0D4 D4< 0b,00H4 D400D4 OYLȰ\(T)|$ 0-0L@r/tlP80s 0  0S 00Ȱ\ -L Mr/0PC8p X X0c. 0YP  q30   00S 0@T tX3  00S.Q q0 3  0D0S}:\D ,pKn K,0[S6 `S@ 0fS+ "bS @TV0S bP Ƞ 05/P 0L` ቚySX`{ gY,0[q0@T t1  0 D0S:R .R 0P.S  <P,AYh!hh1H @0 p@@81  :"YPz0P.Sl  <Pp,Y < 00 @p@0 0x@v+h0K ^/PP'\0 "/00c0[Ȱ\H(,T -BMLM3@0r/, .8 x7p XY0S XY0S R0s R S 0S S X X0 SBKAAX@ Xt BnK8`F `Fn =2(K Rb 0pS@ 0fSU LbS @TW0ST2 ,0S L,RIP< Ƞ@ <4-PP&@$< 02Pp Q<l  !0X0P 1 8$0  0 0 <NySX p  b0 +X@tP. K`g0 , !\P@p PPUZ.0K gXp900 0  0 @ [\%/00L00SS (  hLȰ\8,THHPh 0-8P@0LS((e?0@0?X \\ 0-,PLP 0@T 0陂@X\ -L M0r/븢4 0S ,K >P@ ,0 S R@0@,  S*h \,0`` @#R #WP`,@PP r` ;P], 0 S S 0SN ,S!0p0 0 S S0 S S 1pP0`~@PP 00U 0S  R00 R@@TP U 0S @@4 0 0@+0K 0 0VP4M@PP @, :Pn4 0 ,  P H0 DD>P WȰ\X(,T$\  -pL` 3P@ 0Sc;P PP [;P 0S t0 -pL `P P@ 0S 0S 0P -鬁L0M 0嘡0 0` px1Z>*p?P@P7 P 90 S S0 S S ?P`@ 0 SP P`+U`T 0S  R00 RPPU@ T 0S PX000 R X0W@4w?P@ P\VP $0W`4`P$ -L(Mp젟0 S( P;P 0@`8PK P@ZP00AXΞ    t@@0p!lL0\S@0 !$ 0^A(`   t 4 G-@M`@<T8 40 ğ0,`0#0c0, `0cC 7?04 #/(00 ( ~- 0 ~ " #~5 ~ !~7   ~9 / 00, ,: "#:0 :"&!* 1 !00H,x P `@p` Ph%%),%\P0!ē @ 1 )Wh _)| 0* 0 ` 0+p0 `08000 @`@1p0lPz0p[0ˌ0 00400@Ѝ  4 t \|$ L  -LM`0(K\p@P.  t($ 8 ( #"., K00K, `0@,<4 Ġ̌(<"4!Č <.̌ (0 $ Ms` -LM0`$S@ 3 R (PK0000e@SP0m _Rl zP `P;@ ZP@P5@9P-P.@0zS `S;0C ZS@S50C9S-S.0C0p 0@SW, K00KTPP2,pŸ * =? 0 7?0  ?0 4 [,  9?0 &?  3?0 ? 000  6?0 #? ?00P 0zS `S;0C ZS@S50C9S-S.0C0 Rp 0zS `S;0C ZS@S50C9S-S.0C0 Rq0S  0P0S 0 e0#R0L@0SP0SH@ PĖ@a 01S `<d@-!P.*@0 S0ԧ S ԧ RQ 00C210P*0SԧQ <0 C120P *0 S ԧ R 030P:9 p-@L$MaP2 ` 0( 6TX%X@ ph -LMp0@P 0 0`K 08#HT UPUP#08  0 S   |L< -BMLMr0D`K@P ,0 Ô02S0$S aS@ l,0 S \, @0$S2P 0KY @ P TKDAK`Z0(H K:K4H  K@TK 0i TN:B]KAKx1 (PE(I(K @PE6I @T@ @?T@BKCK!"41"",!1AK1@TPZ$ @20@0  @*K0 iSTK ᗕ tK @TK  T:mL(0@-"Q*|@P0#!0\ "0'*0#" \ ! *0##? 0 \0:00000E-0``&&&C&̠O 1t@X 00#0P 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 0 0#0 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1@x 0 0#0 0#`&&&C&̠O 1@x 0$0#0 0#P%%%C%̠O 1@x 0(0#0 0#`&&&C&̠O 1@x 0,0#0 0#P%%%C%̠O 1@x 000#0 0#`&&&C&̠O 1@x 040#0 0#P%%%C%̠O 1@x 080#0 0#`&&&C&̠O 1@x 0<0#0 0#P%%%C%̠O 1t@ ̐0@@0#D 00#P%`&P`E-D0``&&&C&̠O 1t@X 0@0#0P 0#P%%%C%̠O 1@x 0<0#0 0#`&&&C&̠O 1@x 080#0 0#P%%%C%̠O 1@x 040#0 0#`&&&C&̠O 1@x 000#0 0#P%%%C%̠O 1@x 0,0#0 0#`&&&C&̠O 1@x 0(0#0 0#P%%%C%̠O 1@x 0$0#0 0#`&&&C&̠O 1@x 0 0#0 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1@x 0 0#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1t@ ̐0@0# 00#P%`&P` vH0@-@P!0\#0 0(S"Ƞ0 -L0M($@KP"h0dp 0 8#x "W 0@2K,0 00 p,K0K  H,0 0("x00W0p@d  608 0#H,0T108#xW -L M((KⴠPp@"hh   0 8# "Y 02K00 40  z000# 00 s40 0#0K4 K40 00 0("04 Y @  X000# 00 Q40 0#0K4 K40 08 4#H00T108#Y p-LMH`P*$H ph? (-"xPUL`@: 08#XU@: (-"xPUL`@: 08#XU@: -pL MW`,*0K0 8 Ƞ<̌ Č40 ,K ,0 0 a,00 ,@[0P[p#Ġ"#" #8"(W0@ P`: -pL MW`,*0K0 8 Ƞ<̌ Č40 ,K ,0 0 d,00 ,@[0P[p#Ġ"#" #8"(W0@ P`: -pL MW`5*0K0 0#0P0 8 Ƞ<̌ Č40 ,K ,0 0 ,00 ,@[0P[p##Ġ"" #8"(W0@ P`: -`CL0V Mp@CPC,K0K6,K0K08 <40,0   Ƞ0̌Č  0 )0[0"[ ,0#40, [ -0[0"[ 00#400 [ 0 0#0Q`FVPE@D08 <40,0   Ƞ0̌Č  0 )0[0"[ ,0#40, [ -0[0"[ 00#400 [ 0 0#0QR-D?0 \ !Z -LM@t@ğ0 8`, 啐 .P 00 0S$S 00R5:0PK c x r K e  [P@    @0"xM 6@p    8"_0e0Tw "0C1e1cTiW   @  T60[< [48!A0[  950[;[/ [48  -40[:[. [48  !30[9[- [48  20[8[7 [48  01[0 0 000 ,00 S< 8 4 l t,Mᝏ ' "呏000LD\VUUU$IL00@- 0@00 00 vT2#Egܺ -LM1^0@!N?P1p@`eZp:U?ZZ o @Jy?Z@p ݍ n fpP -L 'D\@ @'(`@ ?0(LX\ @c@@ '<@<@ (H<@ [H@ @D@ - K(DH [P@ @L@ . K8DP [X@ \/ KX [@@30K`0T@ 0 KP@ L40K, 1K2PK 84K ,0(S(h ,LX 0-PL@U !", 1#80!"$ 11PX 0h钎0 -LDM@@ hKc p0(h0 0'00 * 霠 d0  (  ly 0)pgz p`00* 00H '臠\  )  $0( jX 0 0'00 * 霠 T0  (  x 0)pgz pP00* 00จ '臠LP  )  0( jH0 0'00p * 霠 D0  (  Lx 0)pgz p@`00*00)COH臠 0'<00) 00 ( j8  '  ܗ0* 霠 40 0(00w )pgz p0  *  0'臠,00)00pd  j0*00(00LP 靠 0)00*00(w< p{ p 0'0 0)00hh0(0 0'00টT  j0*00(00༖X 靠 0)00*00vD p{ p 0'0 0)00th0(0 0'00T\ j0*00(000H  靠 0)00*00 vp{ p 0'0 0)00셟4h0(0 0'00ȥ`  j0*00(00कT 靠 0)00*00uH p{ p 0'0 0)00\h0(0 0' 00< j0*0#00 < i 0)0#00ud pz p 0' 0#00Xh0( 0#00 ꤠ0*0#00औ4  i 0)0#00thpz p 0' 0#00dh0( 0#00H ꤠ0*0#00,\  i 0)0#00 tPpz p 0' 0#00샟D h0( 0#00̣` ꤠ0*0#00ଓ i 0)0# 00spz p 0' 0#00t h0( 0#00T ꤠh0  (  0 0 i *s pg{ p00)00舠T0  '  ̢0 ꥠ( ଒\ i 00* 00r pg{ p  )  l 舠d 'H0 ꥠH00( 00$ i   *  r pg{ pP ) 0舠400' 00༡ ꥠX0  (   i <* tq 0pg{ p`00)00P 舠D  '  (  0ꥠ    xjVp $ν|*ƇGF0FؘiD\"kqCy!Ib%@@QZ^&Ƕ]/SD!7Ç ZEogL*B9q"am 8D꾤K`Kp~('09|eVD")*C#9Y[e }]O~o,CN~S5:*ӆj*#f*# -L P @ 0T `  p0S# @T 0R 000 00 @0p2P 0p 0 0R @ p-LMD`0@S$ 0PS$pH Q-L@ 0Q`Q p 0R /0t0 0 0R P  0R0Q 0-L P@ T @ T0  R 00d0R0S 000 嫋P@ 0 p-LMD`0@S$ 0PS$p郋ꀋH -LM`0PSp"P@   Ή0ST000$_ 0S 0S$R$NHg*Π0c* -LM0p@ LP 00 00B S0`Ba0B\W`BA0B0S7`B R Q\S P Q'TTTTUTTTUUUUT0U0P:0`d00c0CV0`ąrppp0d0C0pp -LM 0@Q`pPT*.X0 R0""00 0PT:400 n0 SP:004 -LM@rx 0-LtPM@KT 0K 0 %  @@厊p 0 S 00 0@0@L p-0LTMP`XK <@KhK0 0h0 偈0XK< K0@0 dK`0 \0 d0 :4']xL`|0 S0 R0 S0 R -LMP LL1R00 ^m@` 0@T1@0pT^ mP` 0@11 T!@ 0T p`PCP_00 0@T0@Tlpk0@Pᾉ0SHp0TCP00(pl+5P -)MLP|M0pU K,0 $! P 0:S /S .TCP PU 0:S0/S phV }@z@@ T*BNK@D@D+@C(+&9+"9.,CPP APyp@ )K(JdJ' 7 *KP :K4S! K *K $(P2U ,`^ ^\K\P2P :KPP K0P0P@@T00<"  %# K *K0 K$ja0Q T PX @ T`@ T 0 0@Qe T@TdP` 0^- S@P0R00 SMT@ T 0@ T0 l5Q@]PX5 `0@T`P@T"^- KQ  0S 0@T @T^- KP 0S0@T 0@0CT 1 R@@@T44(K R K0j c@ KT$00 :K4@TXʈX KQPڸ3(K R: 0@2S00S00#0@S@ @D,0 S T,Dß2>@0  P 0!1lv@P@2> P h@P@0\ S0 S3K0(AA 0L;P2(K Rp" 0 02Sn-K( B B@0@T00Z,2( K0@T{KNPN 1@ T 1(K@T3K0(NN1 R @T1Sڄ1( K0T p \3KmK(N(`FN`F Q :K 0 K@$ T0P Q0nK0(A^ A0 %0nK^ 00(A 4BX TtPU/6APT P0L`OHq+[[ p-?P0LMS`?QPPU1!1!^^M\@ 0`R p 0R 0R 0R AP``0S0 C,S R-S+S0SS0SSP@-@  00L S 100C^00L S^ 0-LMPK@ 0P 02c2c20 :R 0 ;0P 0 2c! 0:S<0 P0 00 0-0P-SL@P +SP  U0 0c00 -LM0@JS: MS 00C S00 0P 0/S00    00  0qP 0.S 0fP 0.S 0 0 00 m E-P@p "22a11\3a11\p0Sl S  W02c2cZ@]E ;RPS J^P WXa  102c2c^S,! 1?0c0AZ1`L ` !Ϡl  B 111F/N!b  !@!A! B 0C`aR0B S B^ W 00T` 010S^ 02c2cS002c2cSQ*gfff$I -RLDM P\ ` N\0<S< \0@0cd0 0S TKP@ P00 `R <R `@ ~` @ bh 0S,S ;S XKP@ 0V0R00SD ;Q,Qv Qr@Q`PP001 R44 `b \\(0011 R\\̃ṣ01 3  RT0 0f   0R`c\Th3d Xa\3`T#L3,#<3  h0 Sh00 0 0 SM@ \>d h0^@ `>@<K^P@ 0,SPKUP@ @Td0X0T8"0,2`$"$2nK}"2`p@@@0< K {X0@P K uT00@0000@01 2` 1 !3`1X1XT! 102c2c3 S}00KSTwT0>CX0 @>`@ 0@>S`@nh  T0h 0c0h 0d U>\ f0@>S\ @ bd  dh\@P0` ^!@d T Q -@LM $0S h{ -L@08S 00Ph!X}( -@LMJhG`} 0- L⪂P@< P0S=P2 PP%^@00 , =0hl CP 0:S H P 0 ,=00hX}X|( -@LMh`} -L MR0S@(  \ 0S` 1 \[\0$ 1 l bH2A<a!/0C,b `11231113c\$0$000a$0 $Q01 Q$K P  (0S10&O@#/ 2!Nc10&O@#/ 2!NQ (0^& 0S@  RA 0@ 0S@A^M@0t (Kt 00=01(0\0!0^\ 0  A(Q"p p-T# 0ST Š ŖP@@TPZ@တK?0/0S0 P S@ ňK 0P0SÈ0S S UP@P0CS0 @0S0 Pʶ TKP4^C`0S@ @<<"\0@S1PQJ0 R @TJ4UZ0`S1PQQJ0pS KPE`V4UZ10 00n0  0S TK P` 40R00 ?\0#S a0 K P00:TKpPT;0 T0 _ JnPEDP0\  “2a1H`3a1R1R@0!^H PPKTK< RP lnQp@M( -LMp@P`\ 0 u -MLM 04( S0 0ł>K0C0Cp0 D8 ,(RJ 00S1 ^8 8 8(0QBKL !80Q80@ SJBKL@8( 1SA0@(K@1 @( QZ@0S<8 <K@1$188 P 0S <@(Q< @XH KN18(1aH\ठ04(D8@X P @dUPP P_,8S 0 0`cR   p@M( 0-4PL@~h  W@~0`}p0 0 Ilt 0 0Clt@0  R J1 0Q R@Z( -LM@K$0c -L M@K$w0@K 0 `RA 0 `RS  0 `RS A -L,M0P,0 P0p А R0<@K0 ᨠj&}0` PP   0@T P`;00P@@T 00 ,0S 8,W00LDl -LM0H @0$}PH  h}} -P`LV@}p0S  SP@D -``LM9xPp !0@ `0`VQ0@JDX |0P00SC/7}`VX@E_Z} 0-0L R, P0SJ R 0SX@ZP P P000     D 0 PH  C/|0!P -LM:L@0cP0S @0cP0SPe " -PLM\\`p@P0SpC/0p|PUX`EOZd0 h~P -L0M0 @00 R/Č4<HTčЍ܍,8DP\htȎȎ0 (0 $ (K, K00KYzp, 0 0K|Pd 0 K0 (0 $ (K, K00K4zp ,0S  0 0 0 0 0 0 0 0 0$0 (0 0 0(0 0 0 0 0 0 0 0 0 0 0 00! 0(0 $ 0= (0 $ z M-L@M@ 0p`vP{ 0 p`dvPPk 0`0`KX0V0S   00 R 4 40  1@ 0 (@\`$@TpPCx`8@ X0pX L H T` Pp r/XK.P* <0 0PS` 00".0 @d@ P 0 0d Kg@@ 0000UvXv0 D0D/a ,0$@((a 0000~f4x M0-LM00 0 PS0`" -LM,ş `,  (q 0  0  5 $0 K0 0 0 8K 匠K┐K80P800X0K00 P  0P   P 00 0 X 0mP0S0S 3`0K KP L ] 32a/@#b! P pj `@? B7c011N0 d 0!T 0 L0L " 鈚/utz|xEن~v00P 0-0PLr/8m4@0, ,mB@0S0Ȱ\`hXH -0PL4r/l0`Sp- S  0@W0 0 R@ 0T0\ 0S 0S0S0S lPp 0@W0 0 R@ 0TP 0PȰ\ -AMLM,48 <#h0V,0 4  P`F&B~KpGpG 00PSP@ ZH00$H T00S4P 0S`F00 ,0S $, PL -AMLM,$p(. , "h  V, 4  P 0 ,0S ,P`F%BKHH 040PSP=@:H $H( 0"(lP0P`F SL -LMH L p r/0, kH` 9p 0 1d" L"0 R0t2 0<Sh2 l |2 p2 0^x xD R" P P |x0,X0S @㒟KoK%KAK  0@P񟗢  |)TP tQ$ Dȟ 0 Sp" ,0 S XD"0S 0@SD2 pPM00D"pPOK?K@DH2L42  p70 ni,8@7 P%LȰ\ -LM4@0S x$ 000 G-@ 0SPPRp 0 SZ0h0? 4@ 3 #T #R p0`W RZh0 0 ^ ^*.000S*0 RpJ\`0.\0 \\ T* RZS*` -SL M, p`   Z 0 S 0S@TP) Z 0E  0 pP020S 0CX03`505 `.T$ \T V*@@T0bST 0@>S TV*00, bZ00`F@T@Q*@$?#<-"-0 0c`0, bP *0S  P*0SPlR Pp4 0 0  RP 00ӑ -RL M00 , *,p `PU 0 S0? 4` PU0S 00X: iPUJ0.S \S@TpPUZPU0S .U 0@- .R .R .^ABa0B" Q00.Q^APBa@BABa0B UT00B SQ 00\S0@B-R T0\S0B ^0*S 0.S S0S !0B]S.R000Q\R R.R0S !0C]S0S0 0   < 00 , 0 ( Ġ P 0000ӑ -OMLM@ 0r/ , g05 - 0gUT U U U 0O`= K AAH !Dp7 To!4oS* I>K0C 0C000S000@S0005\ =000@Q eY/0`00n0`A ` P@ \ `Ppa  H D< (K OKAPPF $ R*EnK`F`Fe4@@ ;P@(K R  ;P&+(K0 S S %R0P S S \ \ \00\``V`@, 4 P`e  P1+(@K0 S S+Pn/Y 0 SS S S ,S PPP 0bSyS fS P 0bSyS fS}D PW *(PK0 S SQ\n0P S S \ \ \00\@@T\`, < 0 P@`0DS PH` \ V!* \00 \PYP\ V: P P P 0S S S  xPx((@K0 S SrUUo 0 P S S \ \ PP P 0T r0 0  R  0SMKL LL@K '50  #N.K B0 B0C P0S  R4Epd4 R2% % P kXdT ,we P&(@K0 S S U UP 1115  \ \ \ \ 0 SS} ;S`z 0 SL QP ;Q Qq6  0P NKJ J  FPE %4!@% h1 +P`3  Q;Q Qq00  RP 00  PE4 l1 00 %h1 % 05l!$05  $  \@hl\@K P00 ώhO`  Q;Q Qq00  RP &Y  ! /P P PP0`30E R@ %5E $0$@ % 5 E  APt P`#(K0 S SHY?P  E " kI`0S= UU`0` HPD SEH`P 0.\@SPpVP *T.@DaPPV:00|P0:0 000,0 S <,.0cPP ENK@D@D+P.5P ,`8bP@ `p,.`0e SDpPH` \V!* R R00 R0SY P\ V: P P P P 0S S S S000 4ST1o/S0Sy1SLȰ\`hX HPP (!47@LX\ -0LMP0r/d0pSD Y@ S S@0TP S S  P`3$K P$Q |H1  00P0S0 ^00 0 0 00T R R R @0TP R R R0S P  P0:0t P0; X P0; < P01Ȱ\h<p|<4<("4 <1QS0 g 0-L@PP@-^T0)^ 0-LM@ P K 0K  P @@`p0 -LMKPA-M `p |20  00S3 0\ Pt A\ |0  0  R#0CU\|0  0 D R |0  0   Ra NA N.\ 0V54:Ѝ\ \| 10  00S 0hC10S \ <^*0S쎑W <4<("4.<0^* R0S8<^P0S R8<4X\x\PP P-L \hBꄳ/00h -LMP@`T,`K,pK :P 010jP VX`@TX ,K `0V0.T00S` X  -$"L$M0P@ <K ,0 a0:QK 0C`cV RN K0 A .P@+t U~ @@y 0  HPpK> @y>K 0C1Kc@@2AlA H D< L @L Khl\PPl@ 0h hKlhP\th 0\t0l 0l 0S$@T @dJPϠ0Bl4? 2cc1D1AL Ўl T** $Ip Qnm$ ,, xa8 TD  -LMTp,@KP` 0    0S LL Q *0S0 Q*0S0 -aLA@_OReBd @Ap`@@qGTçPDdp@DW00ä?dpG@Q ?T00S L U'@(0 0QT T* -L M@KƉPT `0 -L"ɠ2l3c13@"c1MP 1K0  G C -L^M⸠p`OKPC/MK@( h < 8 TVat0V$KOK`?cKpG 0@FfKq q A A 1 (0S (LX  -PLKtP(K@0CP@ 0CT d H P@o 43( K!$(,"( R`*R^ 2Kp3 0 IF>K0C"P pt0,^0S 0t t h wh$0 K@P@ @PD"(0K!48<#8 S*S 0H T H0L P J I@P  LPh@hA Hp\ L0p4Smp PB^KPEhPEl!l1 P/*Bp@' QpP͢0#SEKEKALK 0 LAIP4 \ X T QX4P$0P VahPRaOah@p$RLV0L    gh4 !!$! -LM` @0 0\ `0P -pp`@LTP U P `@T` 0V0000h:Lꤲ -LM$@0 S K0Ě -LM@`PP|B ,K0,np!0p   P),0|bPS);;;;;;<,<;<;;;;;;;;( 0pP,P  $(0p p  P(PpbhP04 (00  Ⱦ!,w!!! ! -Lh\4P04!# -L  hB4 -LM`VPpP 0 S S 0d f 0 0 @0$ U@5$ -Lh4P0|! --LM  -LM@$ cP0$0KQ \  0  K 1S015 -@LM zȚ 0-LBP|@ 0S L| 0SPeT 0S \00LS `000P0 -LDM@ d JP dJP`} 0Sh 0S0J0@ @@`K+7LLpP dP00 H XP L T@ fXKP0SVJXJ r_P0P0H0STTA 0@81H  uP wTP0@ 00垠00p0d  N X%4 40qJoJ  `0X@\4 00}00 00(@,4 00q00`FH4$ -LTM` `\ h0 0Qd 0p KLP0|0 pK0 0Rx0  x 00$0L< 4 P@ ț -80L0S ( < 0 ț 0-L@P4  P@>00h_  ) 0-LP@P0  P 0S S1P 0h+0 0-L@P P 0S S 00h0S 0h  0-LM@P0S0P  \0G 0$ 0-0 0 0LS@P 00S 0S 0S  0S 0hPLLLLLL000 0 0 0 0 0 0P0 P 0 0 00 0-0LS@P S 00  0S S 000  0 S 000 000 P0-  @ \<@-0@SC @<4(<"4!<0  -0S C   <4(<"4!<0   0-LM@0 SKCP0 J<4(<"4!<0  -LM0@SK C < 4 00WZr>P 0;) 004 ; -LM@pP`~P  R 0S  RV  -LM0@S`pP7 S3 KP RpW :W V>00<PU 00 >PP 0 ,0(U QC L04  P ss$s,s$s4sT0 " 01@\A G   DT:0XS gfff ON -- L`^M@pTA0TPC/M_K 0 KKM?KPE@`1 4a 0a Ad0K?aK@D 0KQ |A Q A g1` 0S  寷Lh0 -LM0@S 0'000 -WMLM0@P=KC/NK, h5 @A ( K @  0IZS |dd|dddddd|~d}~dHXXXXXXXXXddddddddddddddd dddddddؑddddddddddddT <dLdp(`dȚHddXd.(K0S 0(K0  00A SP cX˟1  UPb #U0PB 00@ S $P7 2S"12 202 2 02 PP ` " " ]ꍑ 0 0" 2S P ?KP f02 Pʟ,0 S D ,#b\ R \ 202 b  K).K?K h+ >(K *Y 00I SP 1UPi U0PB00I S$Y@2R SjK).K?K <b 00A SP =ɟ0! UPc0U0PC00@ S $P 2S"12 2P202 0U@@B\ R \ 2PB  K).K?K P1UPi IU0PBF00I S$YR   p 2S"12 2`202 VZTB   00\0S㬀K Q. :Q  ?`>(K VR  "202 @"PaUUژ&0 "2 0RPEK2 " pUT6( "2 0R2 " p>(K R ?K 0C0 20Q2  pʀTc PfUU[E00@ "2 0RPEK2 " pFU0 "2 0R2 " p3ʬ" `` "2 0R2 " pNʬ" "2PcUUğ00 "2 0RPEK2 " p/Uʤ! "2 0R2 " ʴ"1Q0lQ g2S 0K 2 KP 0@ XKP PK KPKeYV K/ nPQ3@ "2 0R2 " p>ʘ"2R @ "2 0R2 " p$ʜ2PCU}UC00@ "2 0RPEK2 " pU0 "2 0^PK BKPKKPK"Rڜ2RS20 "2 0R2 " p>ʘ2P`UU6A00@ "2 0RPEK2 " p!U0 "2 0R2 " pʬ2 t1 0 2Q02  K4PCK/PK <AK&P5K20 "2 0R2 " p!ʸ0 0 20Q2  p K 0C0K@ "2 0KPKKPKL 0d<t 0@ "2 0R2 " pL@" "2 0R2 " p9ʘ2PcUU1ڔ@00@ "2 0RPEK2 " pU0 "2 0R2 " p 20 2"0Q^KPKPK \AKPKKPK2Sgڤ1. (K K0 "2 0R2 " pN Kz/O 7P 20C0 2"00CQ2  p ʆ?K0 "2 R0KEPTK2PCUUڤB00@ "2 0RPEK2 " p U0 "2 0R2 " PK ,$CKP%K00 " 2R0KPKPK C P`UU'C00@ "2 0RPEK2 " pU0 "2 0R2 " pxڠKPKqPK lDKPKa^ K00$0(0K0 "2 0R2 " LKPK4PK# % >&B`Ph( K0h`C1!`P0h" 00S00 0hV0 '0h0 %`PV P00 U- >(K Pu`  2"S 12 2`0" 2  2S12 2  Po " y2 "  2S 12 2 Po  d"@ 2S 1 2 2Po"  2S 1 2 2P2S"12 2 2Po02 6" ^   2"S 12 2`0" 2  >(K   2S12 2`  " 2" "  2S 12 2  P` "@ 2S 1 2 2P`"  2S 12 2P` 2S"12 2 202 P`    2S"12 2`202   2"S 12 2`0" 2  2S12 2  P` " 2 "  2S 12 2  P` "@ 2S 1 2 2P`"  2S 12 2P` 2S"12 2 2P`02 X  " "  2S 12 2`  000S" "  "" "  2S 12 2  P`"@ 2S 1 2 2P`"  2S 12 2P` 2S"12 2 202 P` 2SK 12 2`  "  >(K t@ GYgYT@ 2S"1 -K2 2202 -KP K/ =넃P- >(K ` -KPX2̌S QKL -KK K2 IGYgY |\ggYEeeY"fY \  ``y?(K R- >(K \0l``\`T ` 0`L K l2 S``2 2 KS12 2  hQ2; @ 2  lQ" L 20 W 2S12 2  2 a@ 2 KS P12 2 202 M  2 KS"P12 2 202 9   2S"12 2 202 #008  2S"12 22 /202 2S 12 2 2  02S1x2 2  P`" 0" 2 k X2S12 2"01X T "  "P`h`-9P` \ Y K >(K`2S0 2 %KP "+sKPK0S"y 00t -LMj @PK  4pK, 0 p 4K3K2K1K0K/K.K-K8 0K 0KrP@ڸ0@%SP@D0p7 @ 0BZS/ꄠ\ܠ`llp (pTxpp000C S`KT1Q,0!cQ00C& 00B S$R 0X0  0Z|KK0̀ Q0  @Z0̀jKK& 00^ 4 K^ 0<^00 @g,0 S 8,  *R 00B SF 00B SA000C S`"1Q0!cQ00C 00B S$R0Ѐ Q0  @Z0ЀKK 0<Ɵ1 Pb0P0C 00B S$R0p  0X 0Z KKo D  0X KKb  0X KKW 0X KKL@ 0X0  ZKK<  0X KK10X KK(0X KK0pp  0X KK   0X KK  0X KK 0X wKK@ 0X lKK  0X aKK0X XKK 0X MKK0X DKK0hS0{@p20lS0p- p+  0X ,KK 0X !KK@ 0X KK  0X KK  0X KKv  0X KKk0X KKb0X KKY00X KKN0|RZ  p`0 j6pp^  PN0Q0S괦P P&P0{L 0 -LM0@p`PW10S 0 6pP  34@\P  b5pD0 5p ~Jp -LM @`PfT40 p ETeTpG/  P090 ,K0K0RgTGTp400  fT@ o P0@ 0 R*00SC 00 0:0 g 00S 0@8  P0h0-0`P -LNMp0Q 0 P-0 +0a0ŵ0ť \00 K0 ` l@,/C!bL0 Rn000n^*0^0: 0eR  Lgfff0 p-LMP5 0Ae10T0d1 P50 00p <00c1S1@0`/@ܛ$ -@LMT( a5  10AhZ5ܛ -PLM @ 0S@@ 0-@LP0 S0 0S0U 0 0@2 -`Lp@P8#8S"!"81 ("((^ XU 0V1`P`n !@ p3p -Lp B/ bR@P`0ڃ0RN V0P0 P @@ 0 BPU@UPe 0 BPU98 88S00000P0   0"108#8S2 "$"""!    -LM@00@ -LMp`PW, `pP 00 R0 0!@0 < 0@ , R40 @*004 T:aPX8` 4P @9*0h&hV 4@ p(8#8"(2, !#, T x:p0#h 4@ pP %82! 8"(#8P2! T, x:80X:0 @0R<  0>S000CS00 0>S 00, 0, -LMPp3EQ ܀`V@" P @T `3@T 3Z@S0ph@3<?`@$3 0 1p$q -LM0b 0PUp@ڂ U R0  R00@ d 040 Q2 :RP 0E0 0Q0: P!0 <01R\3# -L@PP`9 @P``p0@P `a(8#8"(0b! aL8U0CȠ: T * 8#8 "(L8 T0CȠ:0>S0>pGS p00`@-@0!"** B\0l Cʠ\7SL l0\20 -0pQ`5L@3 0` P0U 5 \ lU2><``6> U ` 6> 2.0 -L MP@94Q6%z00 600 T`,@ ' ,KP0 ,0 `100 ,02 0 000S  @0 W 0C>C5 `0C0 C>@0C!0B@`@0K00 0 @ -L MP$K`@0(Kp{ 0$KP N0bŒ\0 :C -LDM< |0P|C00KHP L L  q0 0  RLL 0-S +SL0L0 0 SY 0S L`/RP T` p9RTW1000CT0 10W0`CLp /RL 9RRDp C @EReR@@ 30 0. L +RL @0 -R- 00B SL #0R! 10BSࠃ@ L0B0 /RL0 9R L@10 0C/RL@ 9RL@!0aPS^@ `@ W D @R lT@ D  T@WT0K ZD0KHL " VP@0 0 K0W`0 @@0jPU6 0K 0KPd MU4{"000`0@KP X5\3d1`/h-<@TLH^ 0 K00KN0|1||@??ER+ U@LT`@P 0K 0KU`,056C,0 0@K 0K, `0`V0V,00 56,0 ,0 0 PD T0H` l `0@K`0\  l! /4 K80KUX @d \ P48@ 0p!`n`PCP`P`^CN@6@lpP`U࠱ࠡ^ࠡ^pn`nPnQdXd @XX@ VX>X X\\ U\2\ Wd,d \Xv0h 0d1 hdE/O P@sP/O ZP@p`p`AP/O p`,  3PT _ T0 S3.O 5P /O  Zp`p`0Kr0 0K0 0 K,0c`T0S X\dh< 0 ZP@00S,046S / P/ Pڷ/ P00K,00K56C,0 #0 0K0 h0 K,2"0S,056,0 2Y ,0 000 x~Z %N0p`h00S,046S 00S !N0!nX,0S"0 K܀`0S"00cr/ P m/ KP@7N0Z1 ,0!46S! 00D Z0 K0@K0 0K0K- KP10@K0K0 0K%00s, 006,0 0 ,046S00S, 00C **0, 00 Z00S,046Shdh P5?55?5???|10A8Pe ,0 K 00KP+ ERU`U@lt`@P 0K 0KU`ʄ10K0 K0 0 00K0K O P`0 o0K0 K 0 00K0@KM/O P0,` 00 !Pp@@T #Tg@0PeʔA0 K @ n@ l0K@A 0@Kd0Kx0K [0Ko@~E0 KL g00Kc/O !P@+/O  PWL UL 0RL L L L0W L0 60R- 10BSL0BPP QP U ETW! pT 1W`^WT p1Ѓ0T0 W1Ѓ`PL0 L0 00B SL@P 0RL@ 0B Q{L@0 0SL@ SQL H L E -LM, 0 0 S0 J 1P,  4 p*P8P - ` 8#8!"(!82$8!#80a("(40 (bA(U $Bh0SpG W 0SpG WJ0S , 0,P1`8P 8#8!( 8 H!#80a("(40,(bA(U $Bh 1 pRpG W 0SpG WJ0S ,  -LdM@K4 \ 80 ̳00 0 1#:@":SZ @K/ gP  @K00K, Kp ,:ც᪪Z K0K J$6E0ƄJ l KY/  .  W/ P@ R/ 0  p` P RPP 0RX0 P@K 5PP 0 BP X0 0j@SP`@ U@dB@SC<@ U<@ E` EQ`0 0@ d `0 40 S0S40 0C40 4@\ @Q#,,?aCoc?`(?yPD?<|10 PR b-  \ 1<20 0 \ ?\"00 0QS@-@0c  \1<0   \ ?\0 @0 @\ PT0 0 -RLM@8"x8S,0 `D%hȠ,Ƞ*H&$!PQ # 3(!( '#P020cY ! C2R `0 !8,0S&hh %` 0 Q 2RhF0P13P1 <2 1-(0(   &P ;;( ;S0 0P0 -LM`PP0@ KpD0 K04 4K00M00Ѝ -LM@Pp`EUW 00-_u@T0-`P\9p T0 R @  S$0 -LM`PpP%J6 K`P`,K0 0K00CM-00!OO$P`0"&pЍ -LM`Pp, H0P`pY ,0 p-LM`P@@@`@p -1LM0S``V$ P@pSS PpR SN $8?S @ U=|:JUT!0000à@T  RP;?$ $  u00Q0SpJe\0 \03  0<$0 00P@ $0P0?45WCpSpp p-LM`P@l@P@` ph -LMPP@`pW P `034 `RE0E0BUPU0H @0`043P 0 00` -LMdß@TXp, 00 ` T W 0^0T3("S*2V ,P0;,P02S|5P3 T T00W00ST00W\ /O0`PP#>`P`P`0O/ <`PP`V%^!000P 0\P2 000 ,P 00 0O/O0`*0`@0@ P` 0``!v00Q0 S  P (1U:  |0#03  ,K0f0K "Y` ^X,P0W T ,P0^,P0T^,P0{0^0TD -RL@M@p $0 0 $ ` `AG P@U0e $ e0(0 21%$ `e( $0 K(K$K$P0 P O4  b p-PL Mp_@@` P0Q S0 U UJA>`o0OoPJ0P` P 0 `p0`S  0 S43"?S04# 0 0 p-;PLMDUEoJP V 0T0U00S pp~UPD 000p5 D" 0a4000V`p -;L,M\< 8 * \PoO 0^8K< K`P80C8 <=PoOoPJ  0P` P`PD @ `Po4KO0^`P,0P`$+`P -;L`p45gSM 3^@$P 0 )V! W2 0 KN0^0 ^0n03  1>0$0 2 A$0 AB B0Q0UzW V2$0 n$Q0 Q03  01$0 0P0S;V V ?"0!P -;LˠP` 45fMà3^@p $0 $U V1$0 N$^0 ^0n03  1>$0 0$0 cAH0Q0\U UP` S:\: 0S00 lp'V U Kn<Q0 Q 03  010$0 1$0 0P0S ";Ϡ\  Ϡ\  y -;@T;LM/UT`ᠯ", (@ 4P 0 H X9 T^(K, KV0X4P 0K4 KM0,4sL'h$H X!1"4 R0#038"8(!,6.(0\ ! 2\ 0C QCR ,p 5U`; i^0U0X00S; -;PD;LM0/EU"4 0P ,@ (0 h Sb ST P ?45(K, K0PU4P0K4 K0P,0454( S b4 ࠑ}~ ,0 4 p?0S`,Ƞ,Ƞ(XB[ 4!Q0#038!8 5"40P 20bP  CR`P`  0P0!02S `FT ^S ;T -;0LMS@ ;0S P  00 45S P{P c45S;0 S-L# ;0S ?S S 00 P *S S 45S 345S;0 S-L# ;0S ?S S0 0000P *S S 45S 45S -!:**@LAB14LM\?@(0R\0l0&03  T`PT P TQx 000T`0R@L0R000 000 l>"0   -p`':@ナ7DL⨊ MXO<0KP  @KX@0H1@0 A@ 0?48@K5 0 ( -LP@K4MH)JJp,jP@ 冪 #T # 3(l0 $(h0.%pH(N.l # R2^P2t 3#S#3t@p#8$0 (, PP@2`3`#\ # 3(t0,( Ƞ##!@ Q020S ! 24`h@^ ! 2ldxY00RKAH D L0 *L`H0DK HKLK0D @T0 0` 0O/ l0T Y 00` 0O` -LP@KlM`K PP<,JXJ@ ,Jᄪ@|40 X%X "| t #[,Hs[2,.\0#03^#38,8 Ƞ&.x 8 "# V2R02 3#h00c bVQ0C2Y0C2S`h0 fh  00|00|0 H0 DK|D 0HKLK>L`dD H0h`Pxt@030# 3# h \|L| h|H ph0l@ 3 #030#0SPLh P DP t ` 0/O PP@Z ` 0O/A?O`PP` -p(  LMP`P' &:::S@ W @0 O00X64460 PP 20460@ -p(  LMP`P3 &:::S@$ ?S@ S@0 O00W VUS S X64460 0460@ -p(  LMP`P3 &:::S@$ ?S@ S @0 O00W VUS S X64460 0460@Q0 0aQ03000100P0R b0@- @P 1<\0 0 ?\4 00-b1R"  @-Sc@#0 401  00S20@-  3#@3@# 0  0bQ@2c0 0@-Pc0 @R#3 e d \@2 n0Q@20p@-X h%X ! $ T#3 Ƞ$ȌH.@!Q2pG-(!X  "(!& ' V#3W#3 Ƞ&Ȍh$a*'x%p,Z@2\P2 3 #P$ PG-ȠM!h,Ƞ !#8() X#3 Ƞ"( X(ȌPA*% ᑌ,Z@#@3H*H F' ᙡ&,QP2 Vp2` P@3@#\#3P, Ƞ%".p RP2 3#^#3@ .,$<0\@2@PTP28 40@0 PЍQPP  :Q00SP  :Q0#02SQP@-0 !-0S! 0  00 000 0$0(0)0*0+ 0,0!-"0.0#00/D80S40 00 00 ( ! !#M0( 1S Ѝ0SM0D #2::S Ѝ046S0S Q0 R0 P0000S00 0-0LS@6 00S  R011( 0PS00 P @0P 0 00DP0000 00D0PPl 0 0 -LM00@S  R 1S01P 00 0 0 St 0-p1L @RU 0 P0#<2 %000S 0 $0P:0000 0@0 00 0i9P0P00Pk 0@0000 P @0P v0 P<0S0 8000qP4 p-LM@ P$K, ,0K $0 (` ` P `p -LM`V (  0SP@ p`@ V`pV@  V 1+#,PP 0p0`S0`` 0 @00, eV`pV@ B<B S=  P UP! 0 0e P0 0p0eS0`e0PVPV: ,PP 0 P0f  000aP P*0P` 0PU:$P 0 0c  0P0 V,` `pV@ ,0S? 0Y 1! P Q00P00S$ Q ,PPkY 0p0eS0`e^P], P +0 0e 0  !000P E  MP0g0,0 lj 0 03 0-0L @R5 P-  0P @0P 60P $00 0 00 QB< S  0  0 0c0 00000P p-L M0K K@C 00p!`PUhC  0 SP P000peP` 0 0 p鄋 p-LtM@PP`K ,P0@: S  Q  SL  p( 40R p; 0p0+ 0 pX% -LM, 0 PPPapPH0SJ@T 0 0S;1 p@& ER    000010 0@S000 !00 0  ,0 0PpH0S P 騳H -L Mp01 R 0`0V0 @@TJ0Q 0 S@T PEZ`VW 00CS0`V `P>V00W4K 0W [P0  W 044 0JX -L M`KPP"0S=p@T 0S @S 0ST  'P0 `00 0Sop0 p@ H0 Eⓡ<0!0 0@SH 0-LTPM@KT 0K  0  @@=p\ -L4M4@0@K0 0 S :L7 t,@ P-L 0 hvh 00h* " p-LM`0p@T 0Pd@00U0  ,PP`@Up0@00pp -dpLMW` P@PUJ0SX@PUZpW`R @0S R Mp-LM0`0 @`}Ip p-0LM`KuPP $ #"P@  R 00RP P0 0<0@0@ $0, 808 `(0  pg0 0$$X%% -LM@ᰊPP/0:0 p-LMP `@0 : 0ph<x -LM@opP  0:0q0:0,& -0LrS aS g0 0 Ϡ0+S bS 00 0+S wS ̠  -pLpMW@` wyPPN 0X1A  ~p  i!K^)P`O\ K 0SJWH  P`P5 Z QX0a0 100410$1$P@ 1!01 ! 01 !01  P0 f0`f`f`U%f`Z 0S 11 !A/Ɖ@}t AT O` 0R00CS  @0P0(TP !D010CS1!N1 pf`f00)0)D//03- a$7 P0-PL @q0 -PLM0 0At 0yf00 -X1LtM@0 00 8p̠ 40$18p` DP @ V K?P H hU P0S400S 10SQ l `0QQP(f00B00S 0  p-LMP@4P+@0 H$0D @0`D 6R@D0C ,0P0320<00@(@0 03S0php -L4!`yPpGP/eP W& 1PU@8PP@UPP pW$W0e0p1ep10Cs1 1!0C1y10Cs1rep -QLMP @4P  P P0 ke0 0 -LBM`4P0 0  NKQ@pS0A/pbp AP@18!0R@T,P .eO00+e0,1a$7 -LM@S0 h;e00,1 -LMSS@0  \h!d00,1d0 -LMR@ 0 hd00,1d0 -LM4  4< 0 @ 80  0 \PpZ 0@00P`V R0b<0lP @`V0P1H1H11 4 80P00000@ < P 0Q[1@21x2@ 0S 800 0 c 000  80P  P 4 80P  R   R< @07P`p(Kp! w  ,  0Pp @ P`~,p~@ -LMSS`p@ S$!S00/ 0(1 !$! \Z (0 RP0 0P > (Q0S R$1 !0$1^ 0S J?P0S) 1S$ 0P000Q 00b0 !0000  c 0 S(%*$1 0(! $1   0P $Q( UU0$Q $1Ś 0:P 0S( P0U(1( c0 0,1 -LM(0 p7b00VP(pVAv %P! @AP 1!0 1!( 0P1D!D, W00  ,0i -L`p@ PP  U d# P -0LM@ ,0( P00 0-@LPIP UQ0<P Q0!311Qc0@"b@p@-0P0 @ 0`0  00  00  00 0 0 0 0 00  00  00  00  00  00  00  00  00  #0 0" ! !0"0 # '0$0& % %0&0$ ' +0(0* ) )0*0( + /0,0. - -0.0, / 30002 1 10200 3 70406 5 50604 7 ;080: 9 90:08 ; ?0<0> = =0>0< ? C0@0B A A0B0@ C 1 G0DFEEFDG ` 0V0pG-M0 咀 0P0呀 @P`pL吠叀 @P`p0P0 0 L0 0 0 兀H儀0D僀@@傀P`p0 <偀8 0 @P`pH0$0D @00<8000tw|04vx 0u0 ~}|{@zPy`xp,t( 0 @!P"`#p40$00%,0&0((0'p00 ,04h jl0r s0pon@mPl`kpdq$i hgf) *(0+,-@.P/`0p$0< 10 @2030405080\ \`0be0a`@Xd c_P^`]p[ ZYX9:;@607 8p0T@?0 @0A0B0C0D0^T0 0TD E0FG崌⾉0 0 ZЍ -RL M`Pp 0 @T 0S @RT ͅ0! A0@ &P@ V00 P V, 0 10 731 B,0  1@01S -L MQ 1pU, 0 1S{@`x 1Uu 0  \0D 0S0SZ 0 0<3Q B K  1F 0 10S% @ ` 0 Y \ಐ\% 0 Q10  @0 @00, S00 0 P 01-0Q0 P0P 00 ` P@ 9 PP  N 1 P@ E1S0C1^ 00! Q0PQX 0 AQ=Q10 -LMPpPmP@ R0 X 0W@ P  0 AT  0P @-0@0 @0!00 Q'  0R!CS񟗹PPNPP(PPPPP0P@0> 0T0 ` 0Sk*@T0Z`c Sd2 R  Z&fQ *6 p,K(2,  R 2P@0T1 *P,0@ 0, PT1:0S P,0 0, P11 0F0 Q 000S P!0S0 0  P  , R0000@ 0f00  x R,  0#P R,  0#PR 0#P L[0 0 0 ,0 `,7 -LMp 6P`J 1PPW WK0p0@0@0001300` P1@P" @0d!ST 21 @!T &6 ` K?0 @ T@0 0@xQ 10 Q *02'70 p `騥0@S P-L @ <0!RF 0q PRQ @`@` 0 R0!0  B8# 010 g!0`BQc R0 TP`VP@@`@P3P꼥, -81LM @RpC 1`VA Q0S8 !T00Q00SJ t&* T!wP0 RU 0  00U00SU00S  { T%ZP 00뤥ԥ(7 -3L M0 P4 d3@T\m X3 R :H##:S )f @ T0b,3 T,K03,P UP3 2p\P \L000C@B *"*2`21 2!40"00  RSR00Z0S 40S00 b D2 R 00 c409P@ 0 ZR Z 10 %  Wxu :#:S `P PU,P  @$ET P, UU` !@i1ScpWPU,P  h @$ETP,p U0 00 SR0 :JR40S00 b0 R04P@  [ ԥ778ܥ,8D8d88 -0LMR@0 0 80 t R h:#:ST,K0F,@(< <00010 pPP,`,0`V,`   @$ET @`,` 00PVP" '1 S01p7@Pp,`,0`V,`   @$ET `,p 7 F RǟW0 0d aQ0  0 6 01 @0D0 6 R6 RvP 0<& 0Q@0 \600LP0D 0 ZJJJJJJJJJJJJJJJJJJ }J xJ sJ nJ iJ dJ _J ZJ UJ PJKJFJAJ=Q:Q:Q:Q:Q:Q:Q}:Qx:Qs:Qn:Qi:Qd:Q_:QZ:QU:QP:QK:QF: QA: Q<: Q7: Q2: Q-: Q(: Q#: Q: Q: Q:Q:Q :Q:QA ? QA ? QA > QA > QA = QA = QA < QA < QA ; QA ; QA : QA : QA 9 QA 9 QA 8 QA 8 QA 7 QA 7 QA 6 QA 6 QA 5 QA 5 QA 4 QA 4 QA 3 QA 3 QA 2 QA 2 QA 1 QA 1 QA 0 QA 0 \aBC`B0QA 0  -LM@tShfT -LM@\Pp` h^\QU0SD R 0S=W00  00CS\w4w\w\whwtwwwwwwwwwwwwww0 0#S00 1 0 0 ;00 0 0 R 0;S< W  4 R 00R 0, @- 0-LMPK 00%0 @+ 0ST 0S @S 0ST 0S 0SRS  RS00 ꨳ0100*2 lP@-@p `0S0S=S 0S=S PdP U 0S  0R^ 0S ^0=S P00cC10( -LMK@-Q:@- R (2 R R -PPPP RrPP B PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R@- RP1P P1P RrP1P  B P1P B@  R010 1  B R0q0`0q0`0q0`\0q0`0q0`0q0` R 0\6 R B0@-81, Ġ%̌T$\D#L0P  R0@ Ġ01#̌  R R B0@-81, Ƞ%ȌX$XH#H0P  R0@ Ƞ01#Ȍ  R R B0@-81, ̠%Č\$TL#D0P  R0@ ̠01#Č  R-R0 0c BSR48 R p-@P`x BRpR0 BRRR -LM`@ 0pP`o20S  0Sb RCA 0\R! B Mp-LM0`0 @`H2p22**"*xx*JJ* * -p@L00l8#hP 08#x `0 0c8#h08#x 0b0C`p`0 -LM@P 0S p7U0R G0`8U#h 0  by Rʂ0 S00@0@@0@Rڰ 0000G000A8  B8 000o -L4M@ 0< 开@ PD p <0Px D0@ 00  0 ZH P L *P0<S`R0000 l , @0g\0KH8 K8' 0080 0 c4 CP08#8P0 0ZpPP0n0 a B 00ഀD   000#8ᲀL  L 08# aL0 00`0ᲀPD  0<@ D   000 -LLMT X PpP 0L8#hL \\P ` h [00C8S 0@TL s \d `E0S@@KHKd0@ @ b 00H0 0L c@d@ 2P P3 0S 0 00S L Pp   00008#h\0 0S\`0S L'\0S 0 00S\  TLPT \ \  hT 000 0a0C0 h 0b0C 0X L0PX L` X0@QPh  L X` eX 8K TP X0LPP4PT 8pW\ 0 RL0X P X -LM@p0Qs P`0 R=V0e S0 0RS 00P U*V0 00Q *^ 0/P@  0Y008 8(40Po P0 00S"P@ 0S 0 00S 0P  Q p-LM40@SP`$ 000`!H 0 Pp0000000 0 B@ 0p00S40040 -L M`pxQ  0 0C0ppSa <0R@W  P@0Pp  P P>Y 0S00C0pp  ,1R Y 0C\0K 1 00  0 !0  00[\002K)0[* [0 0\ʌ0 0"K+ [,[ \MO0 0@0@0<  JPPBJ@ @00@ -L MPx`p@ `  1R TI 0CP0K100  0!0  00[P0Z" <0W@ k P@0Php  P FMO0 0_@0@0< J PpBJ@ O@00@0Tʀ0 0"K) [*[ Pڸ5P  -LM` 0H20APP p0 101  d 020 0  崜8Q0 00P -L M  !4 0pD $0@SQ!P40 BU00 ,P 18aV U 0, 1 CU@  T pb @ TPU00ZD0 $0@0@@c TD ZF !4 0@  A@ D@ 010CY ?=2!I !U08#X&ʊU0 aP`40@ D0 T0D0Z 1@@ AU@ D 1 !XL001 w!OLd@?=2D  $0!E!P@T$ U D0T P U D0TU1@ \0@bT5У 0$10C@/-"@dP`S9 -0p8#(=1@0@A0C$0^^ 18a!$ BVLP ?=2!E.!h` -LAMq0P 0 LAnK `F0@S `F@D3 \0 0ᙸAK0 A SA *0$4 ᨷ0s1 P  1s 0S 8 TpK?005LTO 99 -L MⰀ0ሐ` 0cV8#Ƞ, F0@p P0 00 0c8#Ƞ 0 밀,000 0Pc PEP00@ -LM1@QPap 0 Rp8! ,,P8q8#p -LM@p4 00 , 08 40L0 Ƞ< S,ȠL 0X0C8#Ƞ3 X0 08\<#X5 0<0e8#h < X0` 0n0C 00,`0 0X00 00C8#Ƞ Pp@00 0E8X#X4  R 0("X0e8#h 80`0l0C0 , ` d8040 ePp80 4 4P㌠!\/ X0 08#X\< " 0<0e8#h< `Ie00e0 `0@040\ 00C8#ȠQ00X @ -LMP @p`0B8S`RE 00Q 00U@9PT3 V  0S 0Q S0ò000 B0 00C0C0 0 00T00 UU800C800 R -LMP`  a("H T p 0 ʲ0S T0 P  `Q0 pPpd`P 0 0b8#H Tʲ0S  0- LP@0S 0\HP 0Q 0S 0S 0S00 -LM@ PQpl 0 RX 00 P) @Y 00d0 0S 0S 0 P  0(1 P$1 0$1  $1 0(! @0 d Ƞ Q`ἠ,P   04p  0 S N1 06I0 00 0S0P 张@`0 0S0P 0S @ -LMP`  Q@ n, $ 0 0S0P  0Pp 0, S 0  H0 0  pP!P Y 0(10S$1 0 ! 0S 0XP  0P$1 0$1 0-LMP @p 1 00 -L M`@ A nQP, p'P"5P 0 P 0, S 0  nH0 0 N0 0S0P  0Pp -LMP<0 80K0 Kp `P@Q0, 0 <KRp8#80CY 0@00PP08#X ("X 0 P L 00< 0@00Q<Y0A  P00<PP< 0}P -Lᴃ%s: %s not compiled in instbinUsage: %s ..., where is one of: mount_cd9660dfmountmount_ext2fssyncnewfs_msdossttylndisklabelpaxtarcpiofsck_ext2fscatifconfigrtsolping6ztsscalelessmoremount_nfsfdiskgrepfgrepegrepumountmount_msdosfsckmknoddisknamesreboothaltmount_ffsdhclientcpgzipgunzipgzcatchmodchgrpchownfsck_ffsnewfsrmmtejectmkdirksh-shsleepmvexprdmesghostnameP`<h@@|̉ )@@0cbsconvfilesifobsofskipno value specified for %sunknown operand %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationscbs cannot be zerobuffer sizes cannot be zerobuffer sizes cannot be greater than %zdseek offsets cannot be larger than %qdconv option disabled%s: illegal numeric valuefiles is not supported for non-tape devicesstdoutinput bufferoutput buffercase conv and -DNO_CONV%s: end of device%s: short write on character device%s: short write on tape device%zu+%zu records in %zu+%zu records out blockblocks%zu odd length swab %s %zu truncated %s %qd bytes transferred in %ld.%03ld secs (%0.0f bytes/sec) summaryskip reached end of inputLXdhp|userquotagroupquotarwautoaccesstimeatimedevexecsuidrdonlyupdateegjo:Rs:cd9660%s: Filesystem not supported by kernelsession number is %s: %srealpath %s%s on %susage: mount_cd9660 [-egjR] [-o options] [-s offset] special node %s: illegal value '%s'needsdoes not need-o %s: option %s a value-o %s: option not supportedhiklnPt:retrieving information on mounted file systems%s mounted as a %s file system%s is not a local file system-h and -i are incompatible with -Ponly one -t option may be specified.empty type list %7s%-*.*s %*u %9u %9d %5.0f%% %7u %7u %5.0f%% %s 1K-blocks%-*.*s %s Used Avail CapacityFilesystem Mounted on iused ifree %%iused Size%-*.*s %s Used Avail Capacity1024-blocks 512-blocks%-*.*s %s Used Available Capacity Mounted on %-*.*s %*d %10ld %11d %5.0f%% %s df: %qd: %s usage: %s [-hiklnP] [-t type] [[file | file_system] ...] ffsext2fskerberos uid mappingNFS exportedanon uid mappingexported read-onlynoatimenoaccesstimenodevnoexecnosuidwith quotasread-onlyroot file systemsynchronoussoftdepasynchronousasyncexported to the worldAadfo:rswt:uvforcerqnoauto/var/run/mountd.pidsignal mountdgetmntinfo:@nfsunknown special file or file system %s.root_devicecan't find fstab entry for %s.%s has unknown file system type./usr/sbinexec: mount_%smountfsstatfs %s%s/mount_%sexec %s for %sno mount helper program found for %sforkalready mounted%s on %s type %.*s: %s %s on %s type %.*s (%sunknown flag%s %#xv2v3udptcpsoftintrnoconnrdirplus%s%s=%dwsizersizerdirsizetimeoretransmaxgrouplistreadaheadacregminacregmax, %s=%dacdirminacdirmaxprmounthardmfs%s%s=%lu %smsdos%s%s=%u, %s=%u%s%s=0%oshortnowin95direxecnorripgensextattprocfslinuxversion %d, ctime=%s%s,%s-ousage: mount [-Aadfruvw] [-t type] mount [-dfrsuvw] special | node mount [-dfruvw] [-o options] [-t type] special node ufs%s: fstab type %s != disklabel type %s%s: fstab uses outdated type 'ufs' -- fix pleaseLXdhp|o:mount table fullspecified device does not match mounted device%s on %s: %sfilesystem not supported by kernelusage: mount_ext2fs [-o options] special node $FreeBSD: src/sbin/newfs_msdos/newfs_msdos.c,v 1.9 1999/08/28 00:13:52 peter Exp $%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) %s: can't read sector %u%s: can't write sector %uNO NAMEFAT%uBSD 4.4%u clusters too few clusters for FAT%u, need %uwarning: sectors/FAT limits file system to %u clusterstoo few reserved sectorsno room for backup sectorbackup sector would overwrite info sectorno room for info sector/boot/%s%s: inappropriate file type or format160180320360720120014402880%s: bad FAT typevolume ID%s: bad volume label%s: bad OEM stringbytes/sectorsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorsfile system sizesectors/trackwarning: %s is not a character devicebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %u-%c is not a legal FAT%s optionblock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: FAT type limits file system to %u sectors/dev/%s is mounted on %s%s: unknown standard format%s: can't figure out partition info%s: partition is unavailablegetdiskinfo%s: unknown disk typeioctl (GDINFO)%s: can't read disk label; disk type must be specifiedbps=%u spc=%u res=%u nft=%u mid=%#x spt=%u hds=%u hid=%u bspf=%u rdcl=%u infs=%#x bkbs= bsec=%u spf=%u sec=%u rde=%u%s: no default %s%s: illegal %s%s: bad %s"*+,./:;<=>?[\]|usage: %s [-N] [-a FAT-size] [-B boot] [-b block-size] [-c cluster-size] [-e dirents] [-F FAT-type] [-f format] [-h heads] [-I volid] [-i info] [-k backup] [-L label] [-m media] [-n FATs] [-O OEM] [-o hidden] [-r reserved] [-S sector-size] [-s total] [-u track-size] special [disktype]  \|$,0 8@ HP X \P`h:hlptx  #3#3233#@@d@@ (4<DLT\dlt|  @@ $,4@ H T\dlx@@@@( 0 < H T\dlt|@@  C$CC$C $,4< D LT\dl@t@|discarddsuspeofeol2lnextminquitreprintstartstatusstopsuspflushrprntoption requires a numeric argument -- %smaximum option value is %d -- %sundefoption requires an argument -- %sillegal gfmt1 option -- %sillegal gfmt1 optiongfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:ispeed=%d:ospeed=%d %s=%x:%lxoflagospeedlflagiflagispeedcflagcbreakcolscolumnscookeddecekeverythingextproclcasenewoldostartostoprawrowssanespeedttyillegal option -- -%s%d %d TIOCSETDTIOCSTARTTIOCSTOPcs5cs6cs7cs8cstopb-cstopbcread-creadparenb-parenbparodd-paroddparity-parityevenp-evenpoddp-oddppass8-pass8hupcl-hupcl-hupclocal-clocalcrtscts-crtsctsmdmbuf-mdmbufignbrk-ignbrkbrkint-brkintignpar-ignparparmrk-parmrkinpck-inpckistrip-istripinlcr-inlcrigncr-igncricrnl-icrnliuclc-iuclcixon-ixon-flowixoff-ixofftandem-tandemixany-ixanydecctlq-decctlqimaxbel-imaxbel-echoechoe-echoecrterase-crterasecrtbs-crtbsechok-echokechoke-echokecrtkill-crtkillaltwerase-altweraseiexten-iextenechonl-echonlechoctl-echoctlctlecho-ctlechoechoprt-echoprtprterase-prteraseisig-isigicanon-icanonnoflsh-noflshtostop-tostopflusho-flushopendin-pendin-crtnewcrt-newcrtnokerninfo-nokerninfokerninfo-kerninfoxcase-xcaseopost-opostlitout-litoutocrnl-ocrnlolcuc-olcuconlcr-onlcronlret-onlretonocr-onocrtabs-tabsoxtabs-oxtabsonoeot-onoeottablet disc; ispeed %d baud; ospeed %d baud;lflags-extprociflagsoflagscflags%-8scchars%s = %s; %d rows; %d columns;speed %d baud;#%d disc; slip disc; ppp disc; strip disc; nmea disc; -aefgaef:gTIOCGETDTIOCSWINSZtcsetattrgfmt1illegal option -- %sTIOCGWINSZnot a terminalusage: %s [-a|-e|-g] [-f file] [operands] @(#) Copyright (c) 1987, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: ln.c,v 1.16 2007/09/16 18:13:57 sobrado Exp $Ffhnslinkit%s: disappeared%s and %s are identical (nothing done).%s/%susage: %s [-fhns] source [target] %s [-fs] source ... [directory] @(#) Copyright (c) 1987, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: disklabel.c,v 1.122 2008/01/24 12:23:35 krw Exp $T lh,L P$($\sF[w(M*-rtG^Nv/ @S_PVʡH`=_w_˫joߨFulݨh_d/do^g2+Mflfo:UVJgyUwt^{wkUvo0ev6{ ^d4;-"{oB~g=g.7]x5יƯ6,MЌ0uκL?uV7pI'D͟OSUV)}mi?W'wn ,a:ki6]>i|&Zx f~zHO~8-1:fc=:Aj^e`I;?~8 PMhumn;^^mMy۶4>`Zy䊡͝K#dv2/fP04 _V o] KU16_X+?;W 2S`hZaen%n~3X]W!7⭴a%:L`m7-LK7hO.i޺-x2{,8 kJ gG pvz+Wm];G#MĢWm;ءW"LqUָj[!pQ.#]Zta*,~@&aՠ0 /3vݫ-i Lo/OR/Q"3?ݤbFBfl'v)$ >^ZǨw(Hm%r JYE%klӠp(o>o`vLZcS^̰!E֯ y~~ n`?VL-#2Y c%[Rh5?0&*,FӮoAc'Ǜ-߆J]N*i%0nz`cAzuuL8Sx}u~قc/K 'Z@tGKhe0v K8%kFS Yi0hnm-0L*yĝ/_usg"ܩޠIn*YcN:ݏ,݆V/OrtGg;Q{~1 vtcYiD[TN 1A!ݛ nU ]"T$ D!*|J$*qa.@+R u <usp^75mwƚ^ո^醻Zm|#m0:iKVbmr;M-Y:tv#(b?yצ)u.LݮB1q1 pa^D!~lA01AM<0|/(iyMkIMU6WE!V3NSTb,>TEh5B No՝\/^]\P͋hSGr@)qշ[XηON䥼nv\o>EO}䪶+غTTba!DE{꾁ءb㑂"P*[ꉪ$3򮜳&*[):6tU3nW ج' f،!lsެ7{|78ޥñp0(hDŽOv:QL:%_Uˢ vhD`655lcI  -OY٦'tgNb,SeI Aʱ'_Xb:cĄ^/~L8r P3$c(7BbN;Jvpkr~$`H!]'~ Fm)SЭz}gA-뉪xRZ@.4~ߠ(j'n62D @N"x0jgdJ:(:{;z>yzїtojYcCmHfrʓNS (` #^@= * C}^e|Ԩn%'8։'`pF"i X-% 5AA>m 4F$rׂf4>`MfE53f{4!f7Yx9D1";$4Max,~7Џu2$g tQ"3 67@L.&FWb 5Ne-XPMbZ#ܭa$htGnRbo`r^I} >ͺ8J"JWJSR#e>w6U m^Z/hel)P X\ժuE-ZJ2piy0pP .1$;p\g8ı42Ε|Ih ފ @خlUDx୹*spth0pul\E "'3'M V^aI*2̅"!q T|,6sr e%y(?޴GG1$ޣ$0HqbYXa|T@5cT`寝VN WK{ hMtBz9Q/*v ]x R0Ҕ@1b+1w۱P0- ;`[H庶@ţj^5-R@:^`H$ )S1he~ScS@:b>[G05{׎[2@8ʃϼ #7?pt~AWqfneB)!s s~ + Ϛbϛ=?>=^w%-7q,mX꣄pNq[**Ϳr\54jDbRĽshWÅ?e*aASDzf !aF,ZKKS;;8lhr8DZ`%=FT`Hļ^;$ `Nn,-ed6R#o^cve擃&| Y30 cJ1/뫱4~Uĸpd?IEIrݑv. iABDO\tiB;*Gym9 \:[S߯gph;pȐ6 LdHh&L 7Oa&!2H/TH|c۪RS*9do!e[n ,roJpTqlh|ǶaBÒhwTaL`9)u{GH`yN'aݠ*#kW቗R^4ZSˋz;x\pc ÜE~Ĉ4$p=9YW EiD3u?C&R:,PfcPz+Lh?!ᦹkocPƤ ~Jۛ]a{S 51H轃CܢIY84rlY//a,P.jeA@<$'R-XgIm@ܽ/sCAꂢBigD00zsqB,9dj<7 l~$)߱ޅ;3Vx9^SZ*XJd;c6Fel)huٞfq|6/P:=wc ەƂjr('f?3} v9)"v=77ì/.&g9Nσ B\YQ"}v)!H0;(2zI"__X{b>·8dkC;Ƅ8T570:ŝd+S9T } E*2ѷq`Xh եK\KWIQF,ǂAqWֵ d:?}%O]˴WFQw&x8d^v Ut*T{L(S3T^eQx;.i%\sm] FQ Ȯrkܳ,e%-q:a 7ڴp Tw~o/>Aa ڦy%(=rϏE c Svs[J0&=hYՆ]o(S-PIu&K@߻,횪.**(jjMu ^ vv) $:diAM.8r._(zzu-.qhQM+jܬsf8pB  $)BG^Iz,]/ZܗLĐrA¦6>D.5);7Dijłz"|Sh?4\H;q(ӟ IKiTh1nP?ib`$6Fm5yP߸EHA`ңÖ/eq߬PI%.cPjXVʚqKKhU@bKMSP%=HDdHP P"l$qg?ODiJU*:32oށjpӆD^1Ĺ(6/;ӌ1W ̆gAk)RX1.G=UwXYkACN,ګ=ZPp|j J)a}hH䰑vgO22ix$u OУezan$Ne;.˾Ky'z(x+uNM08*nN&c=:g|q'lK]fѓ3>rL7mv"!I/u2O4vHա.a]i_䁱WiD˛[>񱠓i"nYqA I8} lՐǸ9A>[+S+F3sN>(]os&X޸ƍ1=n?X%o)(I>ړ }Gn#cʧqASAp+'̮`3ƛkhyfW[ oNf]sl^L@gd3*a|?"ܗBM[V&I&4 =ڴj2u6CiH`y8N_4~٣2ʄA? pٟ'['^e<ĨQd%yڕ1N&K-`TZw)h;,J݁e7ck,`TVOM`?>n7ź37J(ɰ-f׷_Z=tI?͇"8rhqy/}By(G3vZ`Cvӛ2hXQK2 sh+OW n4TngAnO"Ǹe/y7(樂WmCgTWʐܸFs@s<Ƿ]ZG7X]<]se S!9?\>gst_lTYL/GuYh3'DU۠™.B7t"#P kȸˏdK,Q"3c>_HPP ˓eD-s uE::{~Q =,͆wkESYu h@`uݏG)j>rTvQnXeɇBVI)rZܱ8Ƭ$UVLZ}v1ϲUf;R-ٗSEed1:]¢2z'&Gځ=;n[΁4d>!#-z6FnO#у{0Llaw?t1eѡB/N>Lkpy_K4CBoP?F1Ȯ*} w)u<G ??<36{|/r\ QeG C:Ѓ&QsadosudfunknownSMDMSCPold DECSCSIESDIST506HP-IBHP-FLtype 9floppyccdvndATAPIRAIDunusedswapVersion6Version7SystemV4.1BSDEighth-Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSHFSADFSNTFSUDFBEf:NRWb:cdenp:rs:tvwbckmgtioctl DIOCWLABELunknown disk type: %sDANGER! The disklabel was not found at the correct location!To repair this situation, use `disklabel %s > file' tosave it, then use `disklabel -R %s file' to replace it.A new disklabel is not being installed now.Erase the previous contents of the disk? [n]: writelseekwriting label to block %lld (0x%qx) ioctl DIOCSDINFOioctl DIOCWDINFO%s: No disk label on disk; use "disklabel -r" to install initial label%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of disk%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)warning, DOS partition table with no valid OpenBSD partition# Inside MBR partition %d: type %02X start %u size %u no disklabel found. scanning.no disk labeldisk label corruptedfound at 0x%lxreading label from block %lld, offset %lld ioctl DIOCGPDINFOioctl DIOCGDINFOioctl DIOCRLDINFOBootstrap doesn't leave room for disk label\ :Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:nc#%u:sc#%u:su#%llu:%srm#%hu:%sil#%hu:d%d#%up%c#%llu:o%c#%llu:t%c=%s:t%c=unknown%d:b%c#%u:f%c#%u:%sts#%u:%shs#%u:%scs#%hu:%ssk#%hu:%.*s| %c: %15.*f%c %15.*f%c %7.7s%7d%19.19s# %s %5u %5u %4hu %5u %5u %4.4s %c: %16llu %16llu device: %s # %s: type: %s type: %d disk: %.*s label: %.*s bytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total bytes: %.*f%c free bytes: %.*f%c rpm: %hu %hu partitions: offset# %16.16s %16.16s fstype [fsize bsize cpg] interleave: %hu trackskew: %hu cylinderskew: %hu headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %d free sectors: %llu total sectors: %llu flags: vendor badsect # Notes: # Up to 16 partitions are valid, named from 'a' to 'p'. Partition 'a' is # your root filesystem, 'b' is your swap, and 'c' should cover your whole # disk. Any other partition is free for any use. 'size' and 'offset' are # in 512-byte blocks. fstype should be '4.2BSD', 'swap', or 'none' or some # other values. fsize/bsize/cpg should typically be '2048 16384 16' for a # 4.2BSD filesystem (or '512 4096 16' except on alpha, sun4, ...) re-edit the label? [y]: editNo changes.-cVISUALEDITOR/usr/bin/vi/bin/sh # line %d: syntax errorIDEline %d: warning, unknown disk type: %sbadsectline %d: bad flag: %sdrivedataline %d: bad drivedata %s%d partitionsline %d: bad %s: %ssectors/cylindertracks/cylindercylinderstotal sectorsrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: warning, unknown filesystem type: %sline %d: bad partition offset: %sgetasciilabelline %d: bad partition size: %sline %d: too few fieldsline %d: bad partition name: %sline %d: unknown field: %sline %d: bad # of partitionssector size %dtracks/cylinder %dpartition %c: offset past end of unitpartition %c: partition extends past end of unitwarning, unused partition %c: size %lld offset %lldwarning, partition %c: size 0, but offset %lldwarning, number of partitions (%d) > MAXPARTITIONS (%d)warning, super block size %% sector-size != 0super block size %dwarning, boot block size %% sector-size != 0boot block size %dwarning, revolutions/minute %dcylinders/unit %dsectors/track %dcmplabelusage: disklabel [-c | -d | -r | -t] [-v] [-p unit] disk (read) disklabel -w [-c | -d | -r] [-nv] disk disktype [packid] (write) disklabel -e [-c | -d | -r] [-nv] disk (edit) disklabel -E [-c | -d | -r] [-nv] [-f tempfile] disk (simple editor) disklabel -R [-nrv] disk protofile (restore) disklabel -N | -W [-nv] disk (protect) %sdisklabel -B [-nv]%s disk [disktype] (boot) %sdisklabel -Bw [-nv]%s disk disktype [packid] (write) %sdisklabel -BR [-nv]%s disk protofile [disktype] (restore) `disk' may be of the form: sd0 or /dev/rsd0%c. `disktype' is an entry from %s, see disktab(5) for more info. /etc/disktab`packid' is an identification string for the device. `protofile' is the output from the read cmd form; -R is powerful. For procedures specific to this architecture see: %s fdisk(8)You need to specify a type for this disk.No 'c' partition found, adding one that spans the disk.Initial label editor (enter '?' for help at any prompt) unable to get default partition tablePAGER/usr/bin/lessgunzip -qc|%sunable to execute %sEnteringExiting%s expert mode This option is not valid when run without the -f flag. Write the modified label to disk?Write new label?editorunable to write labelNo label changes.In no change mode, not writing label.Free sectors: %16llu - %16llu (%16llu) Total free sectors: %llu. cannot open %sFilenameName of the file to save label into.Nothing to undo!Last change undone.Unknown option: %c ('?' for help) can't run when there is partition overlap.No space left, you need to shrink a partition Partition must be between 'a' and '%c' (excluding 'c'). Partition '%c' exists. Delete it first. partitionThe letter of the new partition, a - p.Command aborted Partition '%c' is not in use. You cannot name a filesystem of type %s. partition to nameThe letter of the partition to name, a - p.partition to modifyThe letter of the partition to modify, a - p.partition to deleteThe letter of the partition to delete, a - p, or '*'.Partition %c is currently %llu sectors in size, and can have a maximum size of %llu sectors. partition to change sizeThe letter of the partition to change size, a - p.%s: [%s] %s: [%llu] Rounding to cylinder: %llu getuint%lldhas_overlap Error, partitions %c and %c overlap: Disable which one? (^D to abort) [%c %c] Changing device parameters for %s: What kind of disk is this? Usually SCSI, ESDI, ST506, or floppy (use ESDI for IDE)."%s" is not a valid disk type. Valid types are: "%s"label name15 char string that describes this label, usually the disk name.The Numer of sectors per track.Invalid entry The number of tracks per cylinder.The number of sectors per cylinder (Usually sectors/track * tracks/cylinder).The total number of cylinders on the disk.number of cylindersThe total number of sectors on the disk.Not enough free space to shrink by %llu sectors (only %llu sectors left) The rotational speed of the disk in revolutions per minute.The physical sector interleave, set when formatting. Almost always 1.edit_parmsYou may want to increase the size of the 'c' partition.failed to sort partition tablesdrzFLOPPYxdhdCCDVNDsvndPossible values are:"IDE", Disk typeWhat kind of disk is this? Usually SCSI, IDE, ESDI, CCD, ST506, or floppy.Starting sectorThe start of the OpenBSD portion of the disk.Size ('*' for entire disk)The size of the OpenBSD portion of the disk ('*' for the entire disk).Treating sectors %llu-%llu as the OpenBSD portion of the disk. You can use the 'b' command to change this. The 'p' command prints the current disk label. By default, it prints the size and offset in sectors (a sector is usually 512 bytes). The 'p' command takes an optional units argument. Possible values are 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, and 'g' for gigabytes. The 'D' command will set the disk label to the default values as reported by the disk itself. This similates the case where there is no disk label. The 'M' command pipes the entire OpenBSD manual page for disk label through the pager specified by the PAGER environment variable or 'less' if PAGER is not set. It is especially useful during install when the normal system manual is not available. The 'X' command toggles disklabel in to/out of 'expert mode'. By default, some settings are reserved for experts only (such as the block and fragment size on ffs partitions). The 'a' command adds new partitions to the disk. It takes as an optional argument the partition letter to add. If you do not specify a partition letter, you will be prompted for it; the next available letter will be the default answer The 'b' command is used to change the boundaries of the OpenBSD portion of the disk. This is only useful on disks with an fdisk partition. By default, on a disk with an fdisk partition, the boundaries are set to be the first and last sectors of the OpenBSD fdisk partition. You should only change these if your fdisk partition table is incorrect or you have a disk larger than 8gig, since 8gig is the maximum size an fdisk partition can be. You may enter '*' at the 'Size' prompt to indicate the entire size of the disk (minus the starting sector). Use this option with care; if you extend the boundaries such that they overlap with another operating system you will corrupt the other operating system's data. The 'c' command is used to change the size of an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. You may add a '+' or '-' prefix to the new size to increase or decrease the existing value instead of entering an absolute value. You may also use a suffix to indicate the units the values is in terms of. Possible suffixes are 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, 'g' for gigabytes or no suffix for sectors (usually 512 bytes). You may also enter '*' to change the size to be the total number of free sectors remaining. The 'd' command is used to delete an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. You may not delete the ``c'' partition as 'c' must always exist and by default is marked as 'unused' (so it does not take up any space). The 'e' command is used to edit the disk drive parameters. These include the number of sectors/track, tracks/cylinder, sectors/cylinder, number of cylinders on the disk , total sectors on the disk, rpm, interleave, disk type, and a descriptive label string. You should not change these unless you know what you are doing The 'g' command is used select which disk geometry to use, the disk or a user geometry. It takes as an optional argument ``d'' or ``u''. If you do not specify the type as an argument, you will be prompted for it. The 'm' command is used to modify an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. This option allows the user to change the filesystem type, starting offset, partition size, block fragment size, block size, and cylinders per group for the specified partition (not all parameters are configurable for non-BSD partitions). The 'n' command is used to set the mount point for a partition (ie: name it). It takes as an optional argument the partition letter to name. If you do not specify a partition letter, you will be prompted for one. This option is only valid if disklabel was invoked with the -F flag. The 'q' command quits the label editor. If any changes have been made you will be asked whether or not to save the changes to the on-disk label. The 'r' command is used to recalculate and display details about the available free space. The 's' command is used to save a copy of the label to a file in ascii format (suitable for loading via disklabel's [-R] option). It takes as an optional argument the filename to save the label to. If you do not specify a filename, you will be prompted for one. The 'u' command will undo (or redo) the last change. Entering 'u' once will undo your last change. Entering it again will restore the change. The 'w' command will write the current label to disk. This option will commit any changes to the on-disk label. The 'x' command exits the label editor without saving any changes to the on-disk label. Available commands: ? [cmnd] - this message or command specific help. a [part] - add new partition. b - set OpenBSD disk boundaries. c [part] - change partition size. D - set label to default. d [part] - delete partition. e - edit drive parameters. g [d|u] - use [d]isk or [u]ser geometry. M - show entire OpenBSD man page for disklabel. m [part] - modify existing partition. n [part] - set the mount point for a partition. p [unit] - print label. q - quit and save changes. r - recalculate & display free space details. s [path] - save label to file. u - undo last change. w - write label to disk. X - toggle expert mode. x - exit without saving changes. z - zero out partition table.Numeric parameters may use suffixes to indicate units: 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, 'g' for gigabytes or no suffix for sectors (usually 512 bytes). '%' for percent of total disk size, '&' for percent of free space. Non-sector units will be rounded to the nearest cylinder. Entering '?' at most prompts will give you (simple) context sensitive help.The 'z' command zeroes out the existing partition table, leaving only the 'c' partition. The drive parameters are not changed. mpsave%s%c %s %s rw 1 %d Starting sector for this partition.The offset must be >= %llu and < %llu, the limits of the OpenBSD portion of the disk. The 'b' command can change these limits. The offset must be in a free area. Size of the partition. You may also say +/- amount for a relative change.The size can't be more than %llu sectors, or the partition would extend beyond the last sector (%llu) of the OpenBSD portion of the disk. The 'b' command can change this limit. Sorry, there are only %llu sectors left The size must be > 0 Size of fs block fragments. Usually 2048 or 512.fragment sizeZero fragment size implies zero block sizeSize of filesystem blocks. Usually 16384 or 4096.Error: block size must be at least as big as page size (%d). Error: block size must be a multiple of the fragment size. Error: block size must be at least as big as fragment size. Filesystem type as a decimal number; usually 7 (4.2BSD) or 1 (swap).FS type (decimal)FS typeFilesystem type (usually 4.2BSD or swap)Unrecognized filesystem type '%s', treating as 'unknown' noneWhere to mount this filesystem (ie: / /var /usr)Mount points must start with '/' Can't stat deviceYou must enter either 'd' or 'u'. BIOS geometry not defined. Note: user geometry is the same as disk geometry. Enter 'd' to use the geometry based on what the disk itself thinks it is, or 'u' to use the geometry that was found in the label.[d]isk or [u]ser geometry$OpenBSD: ar_io.c,v 1.37 2005/08/04 10:02:44 mpf Exp $$OpenBSD: ar_subs.c,v 1.31 2006/11/17 08:38:04 otto Exp $$OpenBSD: buf_subs.c,v 1.21 2005/11/09 19:59:06 otto Exp $$OpenBSD: cache.c,v 1.17 2004/03/16 03:28:34 tedu Exp $$OpenBSD: cpio.c,v 1.18 2008/01/01 16:22:44 tobias Exp $$OpenBSD: file_subs.c,v 1.30 2005/11/09 19:59:06 otto Exp $$OpenBSD: ftree.c,v 1.27 2006/12/26 20:58:25 otto Exp $$OpenBSD: gen_subs.c,v 1.19 2007/04/04 21:55:10 millert Exp $$OpenBSD: getoldopt.c,v 1.8 2003/07/02 21:19:33 deraadt Exp $$OpenBSD: options.c,v 1.67 2007/02/24 09:50:55 jmc Exp $$OpenBSD: pat_rep.c,v 1.30 2005/08/05 08:30:10 djm Exp $@(#) Copyright (c) 1992, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: pax.c,v 1.28 2005/08/04 10:02:44 mpf Exp $$OpenBSD: sel_subs.c,v 1.18 2004/04/16 22:50:23 deraadt Exp $$OpenBSD: tables.c,v 1.25 2007/09/02 15:19:08 deraadt Exp $$OpenBSD: tar.c,v 1.41 2006/03/04 20:24:55 otto Exp $$OpenBSD: tty_subs.c,v 1.12 2003/06/02 23:32:09 millert Exp $Cannot write an archive on top of a directory %sFailed stat on %sFailed chdir to %sFailed open to read on %sFailed open to write on %sFailed open to read/write on %s%s: unknown format, %qu bytes skipped. %qu blocks %s: %s vol %d, %lu files, %qu bytes read, %qu bytes written. done. %s: Waiting for tape drive close to complete...ar_drainUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specEnd of archive volume %d reachedFailed read on archive volume %dWARNING: partial archive write. Archive IS FLAWEDWARNING: partial archive write. Archive MAY BE FLAWEDFailed write to archive volume: %dUnable to append, trailer re-write failed. Quitting.Write failed, archive is write protected.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Cannot allow updates to an archive with flaws.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to seek archive backwardsReverse position on previous volume.Unable to obtain current archive byte offsetUnable to backspace tape %d blocks.Tape drive unable to backspace requested amountget_physUnable to backspace tape over %d pad blocksUnable to backspace over tape filemark.Unable to locate tape filemark.Cannot determine archive tape blocksize.Unable to backspace over last tape block.ar_next ATTENTION! %s archive volume change required. %s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot open %s, try again Cannot save archive name.Quitting %s! %s ready for archive tape volume: %d Load the NEXT TAPE on the tape driveReady for archive volume: %d Unable to restore signal maskUnable to set signal maskcould not pipecould not forkcould not exec-dcCan't fchdir to starting directoryCannot chdir to %sextractUnable to open %s to readCannot mix current archive format %s with %sappend%s: Reading archive to position at the end...directory name is too long %scopyDestination is not a directory %sDestination pathname too long %sCannot access destination directory %sArchive I/O error. Trying to recover.Archive I/O error, cannot continuePremature end of file on archive readInvalid header, starting valid header search.Unable to append, archive header flawCannot identify format. Searching...Sorry, unable to determine archive format.Write block size of %d too large, maximium is: %dWrite block size of %d larger than POSIX max %d, archive may not be portableWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximium is: %dWrite block size %d is not a %d byte multipleUnable to rewrite archive trailer, cannot append.Cannot append to an archive that may have flaws.Archive read error limit (%d) reachedUnable to append when there are archive read errors.File changed size during read %sFile %s was modified during copy to archiveRead fault on %sActual crc does not match expected crc %sUnable to obtain block size for file %sFile %s changed size during copy to %sFile %s was modified during copy to %sFailed stat of %sFailed write during copy of %s to %sUser specified archive volume byte limit reached.Unable to allocate memory for user id cache tableUnable to allocate memory for group id cache tableUnable to allocate memory for user name cache tableUnable to allocate memory for group name cache tableTRAILER!!!cpio_endwrCpio file name in header is corruptedCpio file name length %d is out of rangeCpio link name is corruptCpio link name read errorCpio link name length is invalid: %qu070707File is too large for cpio format %sCpio header field is too small to store file %scpio_wrUnable to write cpio link name for %sUnable to write cpio header for %s070701070702File is too large for sv4cpio format %sSv4cpio header field is too small for file %svcpio_wrCould not write sv4cpio link name for %sCould not write sv4cpio header for %sFile is too large for bcpio format %sbcpio_wrBcpio header field is too small for file %sCould not write bcpio link name for %sCould not write bcpio header for %sUnable to create %sUnable to close file descriptor on %sA hard link to the directory %s is not allowedUnable to link to %s from %sUnable to copy %s, file would overwrite itselfCould not link to %s from %sUnable to remove %sUnable to link file %s to itselfCould not create: %snode_creatCould not access %s (stat)cannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCould not unlink %sUnable to remove directory %sAccess/modification time set failed on: %sUnable to obtain file stats %sUnable to set file uid/gid of %sCould not set permissions on %sFailed write to file %sOut of memoryFile seek on %sWARNING! Major Internal Error! GNU hack Failing!Failed seek on file %sFile changed size %sset_crcFile %s was modified during readFile rewind failed on: %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:Can't chdir to %sFile system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %snext_fileIgnoring too-long pathname: %sIgnoring unterminated pathname at EOFls_list%b %e %H:%M%b %e %Y%s%2u %-*.*s %-*.*s %4lu,%4lu == -> %9qu %s%s %s ls_tty%s: unknown option %c %s: %c argument missing bcpiosv4cpiosv4crcustarab:cdf:iklno:p:rs:tuvwx:zB:DE:G:HLOPT:U:XYZ0Write limit is not a %d byte multipleInvalid write limit %sError count value must be positiveInvalid block size %sInvalid -p string: %cUnknown -x format: %spax: Known -x formats are:Destination directory was not suppliedb:cef:hmopqruts:vwxzBC:HI:LOPXZ014578/dev/rst0/dev/rst1/dev/rst4/dev/rst5/dev/rst7/dev/rst8Unable to allocate space for option listTAPEProblem with file '%s'Unable to open file '%s' for read-C-Iwrite_opt=nodirabcdfiklmoprstuvzABC:E:F:H:I:LO:SZ6Unknown -H format: %scpio: Known -H formats are:Problem while reading stdin%s: Invalid combination of options: -%cThese format options are not supported %s = %s Invalid option nameInvalid options formatusage: pax [-0cdnOvz] [-E limit] [-f archive] [-G group] [-s replstr] [-T range] [-U user] [pattern ...] pax -r [-0cDdiknOuvYZz] [-E limit] [-f archive] [-G group] [-o options] [-p string] [-s replstr] [-T range] [-U user] [pattern ...] pax -w [-0adHiLOPtuvXz] [-B bytes] [-b blocksize] [-f archive] [-G group] [-o options] [-s replstr] [-T range] [-U user] [-x format] [file ...] pax -rw [-0DdHikLlnOPtuvXYZ] [-G group] [-p string] [-s replstr] [-T range] [-U user] [file ...] directory usage: tar {crtux}[014578befHhLmOoPpqsvwXZz] [blocking-factor | archive | replstr] [-C directory] [-I file] [file ...] tar {-crtux} [-014578eHhLmOoPpqvwXZz] [-b blocking-factor] [-C directory] [-f archive] [-I file] [-s replstr] [file ...] usage: cpio -o [-AaBcLvZz] [-C bytes] [-F archive] [-H format] [-O archive] < name-list [> archive] cpio -i [-6BbcdfmrSstuvZz] [-C bytes] [-E file] [-F archive] [-H format] [-I archive] [pattern...] [< archive] cpio -p [-adLlmuv] destination-directory < name-list Empty replacement stringrep_addInvalid replacement string %sInvalid replacement string option %s%s while compiling regular expression %sUnable to allocate memory for replacement stringEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern list inconsistentPattern select out of memoryRemoving leading / from absolute path names in the archive ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Processing continues, name changed to: %s tty_renameProcessing continues, name unchanged. Skipping file. File name %s/%s, too longrep_name%s >> %s >> %s Replacement name too long %s >> %sReplacement name error %sTMPDIR/tmp/Cannot allocate memory for temp file name.Can't open current working directory.can not gzip while appendingCpu time limit reached, cleaning up.Signal caught, cleaning up.LC_TIMEUnable to set up signal handlerUser selection table out of memoryUnable to find uid for user: %sUnable to allocate memory for user selection tableGroup selection table out of memoryCannot determine gid for group name: %sUnable to allocate memory fo group selection tableEmpty time range stringUpper %s and lower %s time overlapIllegal upper time range %sTime range format is: [[[[[cc]yy]mm]dd]HH]MM[.SS][/[c][m]]Illegal lower time range %sBad option %c with time range %sUnable to allocate memory for time rangeImproperly specified time range: %sCannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %schk_ftimeFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryFailed ftime table readFailed ftime table seekCannot allocate memory for interactive rename tableNo interactive rename table, links may failInteractive rename table out of memoryCannot update rename tableCannot allocate memory for device mapping tableDevice map table out of memoryUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryUnable to allocate memory for directory timesCannot canonicalize %sadd_dirUnable to store mode and times for created directory: %swrite_optnodir%s=%s is only supported when writing.Unknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format optiontar_wrFile name too long for tar %sTar header field is too small for %sFile is too large for tar %sTar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for ustar %sUstar header field is too small for uid %lu, using nobodyUstar header field is too small for gid %lu, using nobodyUstar header field is too small for %sustar_wrnobodyFile is too long for ustar %sLink name too long for ustar %sUstar cannot archive a socket %s/dev/ttyFatal error, cannot open %s%s: @(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: ping.c,v 1.78 2007/02/06 15:25:18 jmc Exp $setresuidDI:LRS:c:dfi:jl:np:qrs:T:t:vw:number of packets to transmit is %s: %sbad interface address: %stos value is %s: %s%s: only root may use interval < 1sbad timing interval: %spreload value is %s: %spacket size is %s: %sttl value is %s: %smaxwait value is %s: %s-f and -i options are incompatiblebind-R option and -D or -T, or -t to unicast destinations are incompatiblesetsockopt IP_MULTICAST_IFgetsockoptCannot set the receive buffer sizePING %s: %d data bytes ping: recvfromPING %s (%s): %d data bytes Could only allocate a receive buffer of %i bytes (default %i)setsockoptsetsockopt IP_MULTICAST_TTLsetsockopt IP_MULTICAST_LOOPping: record routerecord route not valid to multicast destinationsunknown host: %sping: wrote %s %d chars, ret=%d pingerping: sendtopacket too short (%d bytes) from %s unknown option %x LSRR: 0.0.0.0 (truncated route) %s RR: (same route) NOP%d bytes from %s: icmp_seq=%u ttl=%d wrong data byte #%d should be 0x%x but was 0x%x%x (DUP!) time=%d.%03d ms%d bytes from %s: %ld packets transmitted, %ld packets received, %.1f%% packet lossround-trip min/avg/max/std-dev = %d.%03d/%d.%03d/%d.%03d/%d.%03d ms -- somebody's duplicating packets!%ld duplicates, --- %s ping statistics --- Echo ReplyDestination Net UnreachableDest Unreachable, Unknown Code: %d Destination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF setfrag needed and DF set (MTU %d) Source Route FailedNetwork UnknownHost UnknownSource IsolatedDest. Net Administratively ProhibitedDest. Host Administratively ProhibitedDestination Net Unreachable for TOSDesination Host Unreachable for TOSRoute administratively prohibitedHost Precedence ViolationPrecedence CutoffSource QuenchRedirect Network(New addr: %s) Redirect, Unknown Code: %dRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostUnknown ICMP type: %d Echo RequestRouter Discovery Advertisement(%d entries, lifetime %d seconds) Router Discovery SolicitationTime exceeded, Unknown Code: %d Frag reassembly time exceededTime to live exceededParameter problem, required option absent: pointer = 0x%02x Parameter problem: pointer = 0x%02x TimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask Reply (Mask 0x%08x) Vr HL TOS Len ID Flg off TTL Pro cks Src Dst Data %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %s %02x%s (%s)TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xpatterns must be specified as hex digitsusage: ping [-DdfLnqRrv] [-c count] [-I ifaddr] [-i wait] [-l preload] [-p pattern] [-s packetsize] [-T tos] [-t ttl] [-w maxwait] host $OpenBSD: fsutil.c,v 1.16 2007/02/17 15:57:14 grunk Exp $lost+foundwrong type to dirscan %d DIRECTORY CORRUPTEDNAME=%s fileerror%s=%s DIRLINK COUNT %s COUNT %d SHOULD BE %d (ADJUSTED)ADJUSTLINK COUNT INCREASINGUNREFmkentryUNREF %s RECONNECTSORRY. CANNOT CREATE lost+found DIRECTORYlost+found IS NOT A DIRECTORYREALLOCATElinkupSORRY. CANNOT CREATE lost+found DIRECTORY SORRY. NO lost+found DIRECTORY DIR I=%u CONNECTED. PARENT WAS I=%u SORRY. NO SPACE IN lost+found DIRECTORYNO lost+found DIRECTORYCREATE (CREATED) (RECONNECTED)makeentryNO SPACE LEFT IN %s (EXPANDED)EXPANDLARGE FILES UNSUPPORTED ON REVISION 0 FILESYSTEMSSETTING LARGE FILE INDICATOR SET LARGE FILE INDICATORTRYING TO SET FILESIZE TO %llu ON MODE %x FILE ckinodeDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDSiblockPARTIALLY TRUNCATED INODE I=%ublk %d < cgdmin %d; blk + cnt %d > cgsbase %d blk %d >= cgdmin %d; blk + cnt %d > cgdmax %d bad inode number %d to ginode bad inode number %d to nextinode Cannot allocate space for inode buffer cannot increase directory list cannot find inode %d CLEAR (CLEARED) I=%u OWNER=%u MODE=%o SIZE=%llu MTIME=%12.12s %4.4s %d %s I=%uBAD STATE %d TO BLKERR b:dfm:npyAlternate super block location: %d ** lost+found creation mode %o bad mode to -m: %o -%c flag requires a %s checkfilesysCAN'T CHECK FILE SYSTEM.** Phase 1 - Check Blocks and Sizes** Phase 1b - Rescan For More DUPS%d files, %d used, %d free ***** REBOOT NOW ***** ***** PLEASE RERUN FSCK ***** ***** FILE SYSTEM WAS MODIFIED *****The following zero link count inodes remain: %u,The following duplicate blocks remain: %d,%d blocks missing %d files missing ** Phase 5 - Check Cyl groups** Phase 4 - Check Reference Counts** Phase 3 - Check Connectivity** Phase 2 - Check PathnamesINTERNAL ERROR: dups with -p** Root file system** Last Mounted on %s starting usage: %s [-dfnpy] [-b block#] [-m mode] filesystem ... UNKNOWN FILE TYPE I=%ubad size %llu:INCORRECT BLOCK COUNT I=%u (%d should be %d) (CORRECTED)LINK COUNT TABLE OVERFLOWCONTINUEbad indirect addr: %d bad direct addr: %d bad size %llu ndb %d:HOLD BAD BLOCKINODE I=%u HAS DTIME=%12.12s %4.4sPARTIALLY ALLOCATED INODE I=%uDUP TABLE OVERFLOW.EXCESSIVE DUP BLKS I=%u (SKIPPING)EXCESSIVE BAD BLKS I=%uBAD STATE %d FOR ROOT INODE DUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYCANNOT ALLOCATE ROOT INODE ROOT INODE UNALLOCATEDALLOCATEpass2MISSING '..'FIXBAD INODE NUMBER FOR '..'DIRECTORY TOO SHORTDIRECTORY %s: LENGTH %lu NOT MULTIPLE OF %dMISSING '.'I OUT OF RANGEREMOVEpass2checkUNALLOCATEDBAD TYPE VALUEIS AN EXTRANEOUS HARD LINK TO DIRECTORY%s %s %s (IGNORED)DUP/BADZERO LENGTH DIRECTORYEXTRA '.' ENTRYEXTRA '..' ENTRYCANNOT FIX, INSUFFICIENT SPACE TO ADD '..' CANNOT FIX, SECOND ENTRY IN DIRECTORY CONTAINS %s BAD TYPE VALUE FOR '..'CANNOT FIX, INSUFFICIENT SPACE TO ADD '.' CANNOT FIX, FIRST ENTRY IN DIRECTORY CONTAINS %s BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'BAD STATE %d FOR INODE I=%d ZERO LENGTHBAD/DUPsummary info for cg %d is %d, %d, %d,should be %d, %d, %d SUMMARY INFORMATIONS WRONG FOR CG #%dBLK(S) MISSING IN BIT MAPS #%dINODE(S) MISSING IN BIT MAPS #%dsummary info bad in superblock: %d, %d should be %d, %d SUPERBLK SUMMARY INFORMATION BADpass5ino_bitmap:ibmap:blk_bitmap:bbmap:BAD STATE %d FOR INODE I=%ld %u: %2x %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. /r%s is not a character device Can't stat %s Can't stat rootmalloc failedrealloc failedstrdup failed%s is not a character device (NO WRITE)cannot allocate space for superblock setupLOOK FOR ALTERNATE SUPERBLOCKSLOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ext2fs(8).SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO FSCK_FFS TO SPECIFY THE%s %s %s %s %s %s USING ALTERNATE SUPERBLOCK AT %d WRONG FPG=%d (BPG=%d) IN SUPERBLOCKBAD SUMMARY INFORMATIONcannot alloc %u bytes for blockmap cannot alloc %u bytes for statemap cannot alloc %u bytes for lncntp cannot alloc %u bytes for inphead cannot alloc %u bytes for typemap IMPOSSIBLE RESERVED BLOCK COUNT=%d IN SUPERBLOCKSET TO DEFAULT** File system is already clean %sile system is clean; not checking ** Fstate = %d NO WRITE ACCESS** %sCan't open %s: %s Can't stat %s: %s MAGIC NUMBER WRONGBAD LOG_BSIZEINCOMPATIBLE FEATURE BITS IN SUPER BLOCKcompat 0x%08x, incompat 0x%08x, compat_ro 0x%08x VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEsuperblock mismatchesoffset %ld, original %ld, alternate %ld BAD SUPER BLOCK: %s %s: NOT LABELED AS A EXT2 FILE SYSTEM (%s) %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION ioctl (GCINFO): %s %s: can't read disk label PARTIALLY WRITING %sZERO'ED BLOCK %d TO DISK bad file type 0%o %s? yes %s? [Fyn?] %s? no INTERNAL ERROR: GOT TO reply()cannot allocate buffer pool deadlocked buffer pool CANNOT %s: BLK %dProgram terminated MARKING FILE SYSTEM CLEAN cache missed %ld of %ld (%d%%) MARK FILE SYSTEM CLEANUPDATE STANDARD SUPERBLOCKSPanic: lost %d buffers READTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %ld (%ld), %ld,SEEKWRITETHE FOLLOWING SECTORS COULD NOT BE WRITTEN:returning to single-user after filesystem check catchquitSALVAGE (SALVAGED)UNKNOWN INODESC FIX MODE %d benstuvusage: %s [-benstuv] [file ...] %6d dq@-dqlqxqdqdqdqdqhtptptp%d: powersave on (%dms sleep) (auto) %ddBm%sHIDENWIDNOBRIDGEieee80211_status no permission to scanSIOCG80211ALLNODES none restoreieee80211_listnodesnwid chan %u bssid %s lladdr %s %udB %u%% powersave %uMESSIBSSCF_POLLABLECF_POLLREQPRIVACYSHORT_PREAMBLEPBCCCHNL_AGILITY SPECTRUM_MGMT QOS SHORT_SLOTTIME APSDDSSSOFDMDELAYED_B_ACKIMMEDIATE_B_ACKCACHEBSSAUTHASSOCCOLLECTSIOCGIFMEDIA%s: no link type?init_current_mediaSIOCSIFMEDIAonly one `media' command may be issuedmay not issue `media' after `mode' commandsmay not issue `media' after `mediaopt' commandsonly one `mode' command may be issuedinvalid media mode: %sonly one `mediaopt' command may be issuedmay not issue `mediaopt' after `instance'only one `-mediaopt' command may be issuedmay not issue both `media' and `-mediaopt'only one `instance' command may be issuedmust specify `media' before `instance'media instance %s: %sEthernetetherFDDIIEEE802.11TDMCARPautoselectmanual10baseT10baseT/UTP10UTP10base210base2/BNC10BNC10base510base5/AUI10AUI100baseTX100TX100baseFX100FX100baseT4100T4100baseVG100VG100baseT2100T21000baseSX1000SX10baseSTPSTP10STP10baseFLFL10FL1000baseLX1000LX1000baseCX1000CX1000baseT1000T1000baseTX1000TXHomePNA1HPNA110GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10GbaseCX410GCX410GBASE-CX42500baseSX2500SXSingle-modeSMFMulti-modeMMFCDDIFH1FH2DS2DS5DS11DS1DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72t1t1-amie1-g.704e1-amie1-ami-g.704t3t3-m13e3e3-g.751e3-g.832e1-g.704-crc411a11b11gfhmasterfull-duplexfdxhalf-duplexhdxflag0flag1flag2loopbackhw-loopbacklooprxpausetxpausedual-attachdasadhochostapibssibss-mastermonitorturbohdlc-crc16pppframerelay-ansiframerelay-ciscoframerelay-ituunknown %s media subtype: %sunknown %s media mode: %sunknown %s media option: %smedia mode %smediaopt instance %d physical address inet%s %s --> %s phys_statusno carrieractiveno ringinsertedno networkbackupUPBROADCASTDEBUGLOOPBACKPOINTOPOINTNOTRAILERSRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST metric %lu mtu %lu lladdr %s description: %s %s: no media types? media: status: supported media: inet %sSIOCGIFNETMASKSIOCGIFDSTADDR --> %s netmask 0x%xSIOCGIFBRDADDR broadcast %sin_status inet6 %sSIOCGIFDSTADDR_IN6 -> %sSIOCGIFNETMASK_IN6 prefixlen %dSIOCGIFAFLAG_IN6 anycast tentative duplicated detached deprecated scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime in6_alias%i%i: bad prefixlenin_getaddrprefix %s: %s%s=%o%s=%xin6_getaddrusage: ifconfig [-AaCm] [interface] [address_family] [address [dest_address]] [parameters] getifgroupsSIOCGIFGROUP groups:malformed link-level addressSIOCSIFLLADDR1ACFLRSTacdfghiklmnopqrstuxCOLUMNS%s: %s: %s: directory causes a cyclefts_readdisplay%*s%*qd printlong%3d, %3d %-*s %*qd %*u total %lu %s %*u %-*s printlink ls: %s: %s %*s usage: %s [-1AaCcdFfghikLlmnopqRrSsTtux] [file ...] mainifconfigmake_packetrtsol_check_timerrtsol_timer_updatesockopensendpacketrtsol_inputinterface_upinterface_statuslladdropt_fill)get_llflagprobe_initdefrouter_probesendprobeadDfFm1failed to open a socketfailed to initialize interfacesselect: %sfailed to setup for probing routersfailed to initialize %skernel is configured as a router, not a hostkernel is configured not to accept RAsadDFmemory allocation failedinterface %s was already configuredfailed to get link layer information for %slink-layer address option has null length on %s. Treat as not included.memory allocation failed for %sNew timer is %ld:%08ldthere is no timer%s status is changed from %d to %dNo answer after sending %d RSstimer expiration on %s, state = %dset timer for %s to %d:%dstop timer for %sillegal interface state(%d) on %susage: rtsold [-1DdFfm] interface ... usage: rtsold [-1DdFfm] -a usage: rtsol [-DdF] interface ... usage: rtsol [-DdF] -a <%s> %swarnmsgprobing %sreallocmultiple interfaces foundff02::2inet_pton failed for %ssetsockopt(ICMP6_FILTER): %sIPV6_RECVHOPLIMIT: %sIPV6_RECVPKTINFO: %ssocket: %smalloc for send msghdr failedmalloc for receive msghdr failedsend RS on %s, whose state is %dsendmsg on %s: %ssendpacketfailed to get receiving interfacertsol_inputinvalid icmp type(%d) from %s on %sinvalid RA with hop limit(%d) from %s on %sinvalid RA with non link-local source from %s on %sreceived RA from %s on %s, state is %dreceived RA from %s on an unexpected IF(%s)invalid icmp code(%d) from %s on %spacket size(%d) is too shortfailed to get receiving hop limitrecvmsg: %schecking if %s is ready...interface_up%s is duplicated%s is tentative%s is readyget_llflag() failed, anyway I'll tryioctl(SIOCSIFFLAGS): %sioctl(SIOCGIFFLAGS): %sinterface_statusioctl(SIOCGIFMEDIA) on %s: %sioctl(SIOCGIFFLAGS) on %s: %sunsupported link type(%d)get_llflagioctl(SIOCGIFAFLAG_IN6): %sgetifaddrs: %ssocket(SOCK_DGRAM): %sshutdown: %slo0defrouter_probedefault router list contains a non-link-local address(%s)ioctl(SIOCGDRLST_IN6): %sprobe a router %s on %ssendprobeTTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftinvalid namelen:%d/%luno nameunknown qtyperefused???unknown, type 0x%xrefused, type 0x%x%d bytes from %s, icmp_seq=%u hlim=%d(DUP!) time=%g ms dst=%sfailed to get receiving packet informationa:b:c:dfHg:h:I:i:l:mnNp:qRS:s:tvwW-R is not supported in this configurationinvalid source address: %sinvalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit -- %sillegal hoplimit %stoo small interval, raised to 0.01illegal timing interval %sillegal preload value -- %sMust be superuser to preloaddatalen value too large, maximum is %dillegal datalen value -- %sgetaddrinfo failedsetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetsetsockopt(IPV6_USE_MIN_MTU)setsockopt(ICMP6_FILTER)%s: invalid interface namesetsockopt(SO_SNDBUF)PING6(%lu=40+8+%lu bytes) %s --> new path MTU (%d) is notified recvmsgpollsetsockopt(IPV6_RECVHOPLIMIT)setsockopt(IPV6_RECVPKTINFO)setsockopt(SO_RCVBUF)you need -b to increase socket buffer sizeUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP setsockopt(IPV6_RTHDR)UDP connectgetsocknamecan't initialize rthdrbad addr family of an intermediate addrcan't add an intermediate nodecan't allocate enough memorysetsockopt(IPV6_RECVRTHDR)setsockopt(IPV6_RECVPATHMTU)IPV6_MULTICAST_HOPSgateway resolves to multiple addressestoo many intermediate hopsgetaddrinfo for the gateway %s: %sping6: wrote %s %d chars, ret=%d sendmsg\%03odnsdecodeinvalid peernamepr_packunknown code 0x%x, type 0x%xNodeInfo NOOP HbH Options: Dst Options: Routing: nxt %u, len %u (%lu bytes) Received Opt %u len %lu Jumbo Payload Opt: Length %u Router Alert Opt: Type %u nxt %u, len %u (%d bytes), type %u, %d segments, %d left pr_rthdr [%d] [%d]%s segments unknown, -%uNodeInfo Supported Qtypes, compressed bitmap, raw bitmap %s(TTL=%u)pr_nodeaddr(TTL=infty) no address truncatedpath MTU for %s is notified. (ignored) --- %s ping6 statistics --- round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms %.1lf%% packet loss+%ld duplicates, IPv6 addressDNS labelIPv4 addressSuccessRefusedNo Route to Destinationpr_icmphDestination Unreachable, Bad Code: %d Destination Administratively UnreachableDestination Unreachable Beyond ScopePacket too big mtu = %d Time exceeded, Bad Code: %d Parameter problem: Bad code(%d) pointer = 0x%02x Erroneous Header Unrecognized Option Unknown Nextheader Listener QueryListener ReportListener DoneRouter SolicitationRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sBad ICMP type: %dNode Information QueryNOOP, invalid, oldfqdn, subject=%s(%s), no subject, subject=%s(invalid)Supported qtypesDNS namenodeaddrIPv4 nodeaddrNode Information Reply, %sVr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->pr_iphHBH RTHDR FRAG ESPAH ICMP6: type = %d, code = %d Unknown Header(%d) DSTOPT IP6ff02::2:0000:0000nigroupusage: ping6 [-dfHmNnqtvWw] [-a addrtype] [-b bufsiz] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [hops ...] host ioctl SMODEmmapWSMOUSEIO_SCALIBCOORDS/dev/ttyC0open /dev/ttyC0/dev/wsmousemouse.scale=%d,%d,%d,%d,%d,%d,%d WSMOUSEIO_GCALIBCOORDSopen /dev/wsmouseusage: %s ?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for dataLESSSECURELESS-E-G-L-mMOREWARNING: terminal is not fully functionalCannot allocate memoryticdcmsomdmbvbbc|^srget_termraw_modeLESS_TERMCAP_ltget_envLINESlicokrklkukdkPkNkh@7kDTERMhcxndadbsgpcNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketseek errorread errorch_ungetchar overrunseek error to 0ESC^%c*s<%X>Non-match First-file EOF-ignore Keep-pos Regex-off (P)+ [Press space to continue, 'q' to quit.]less %sungetcc overflowPattern not found help(N-th) No %snext fileNo %sprevious fileNo such filemark: goto mark: Command not availableBrackets: [Press 'h' for instructions.]Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableeditchar"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)LESSMETAESCAPE\LESSMETACHARS; *? '"()<>|&^`#\%c%s%c%s%s%sHOMEbin_file%s %s %sLESSOPENLESSCLOSE...skipping... Cannot find help fileCannot seek to end of fileCannot seek to beginning of fileCannot seek to line number %nDetermining length of fileDon't know length of fileCannot seek to that file positionLESSANSIENDCHARSplinenum~ Calculating line numbers (press RETURN)Invalid mark letterMark not setMark not in current fileLine number is required after -lless Copyright (C) 2002 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less Tab stops and then every %d spacesopt_x-" must be followed by 1 or 2 charsquotes %sUse "h" for helpThere is no %s option ("less --help" for help)There is no %s optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric option-%sValue is required after %sNumber is required after %sfakeSearch includes displayed screenSearch skips displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by clearing each lineRepaint by painting from top of screenAssume intelligent terminalAssume dumb terminalDon't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesAllow help commandDon't allow help commandCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: Position target at screen line %dDon't display a status columnDisplay a status columnDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numbersprompt: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directlyDisplay control characters directly, processing ANSI sequencesDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linesDisplay underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: Horizontal shift %d positionsUse keypad modeDon't use keypad modeBe less helpful in promptsBe helpful in promptspostoalinenumtoainttoaiprint_intiprint_linenumap_posap_linenumap_intNo previous regular expressionInvalid patternPlease re-enter search patternNothing to searchLine numbers turned offLXdhp|D8" @ $@,`lbgdumbtimernfsv3mntudpresvportnfsv2ac23a:bcdD:g:I:iL:lo:PR:r:sTt:w:x:U-2 and -3 are mutually exclusiveillegal -I value %s: %sillegal -R value %s: %sillegal -a value %s: %sillegal -g value %s: %sconflicting version optionsillegal -r value %s: %sillegal -t value %s: %sillegal -w value %s: %sillegal -x value %s: %sNFS Portmapcan't access %s: %sbad MNT RPCCannot MNT PRCcan't resolve address for host %sno : or @ spechostname too longusage: %s [-23bcdilsTU] [-a maxreadahead] [-g maxgroups] [-I readdirsize] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-w writesize] [-x retrans] rhost:path node unused DOS FAT-12 XENIX / XENIX /usr DOS FAT-16 Extended DOSDOS > 32MB HPFS/QNX/AUXAIX fs AIX/Coherent OS/2 Bootmgr Win95 FAT-32 Win95 FAT32LDOS FAT-16 Extended LBAOPUS OS/2 hidden Compaq Diag.OS/2 hidden OS/2 hidden OS/2 hidden AST swap Willowtech ThinkPad Rec Willowsoft $NEC DOS 8Theos 9Plan 9 @VENIX 286 ALin/Minux DRBLinuxSwap DRCLinux DR MQNX 4.2 Pri NQNX 4.2 Sec OQNX 4.2 Ter PDM QDM RCP/M or SysVSDM TOntrack UEZ-Drive VGolden Bow \Priam aSpeedStor cISC, HURD, *dNetWare 2.xxeNetWare 3.xxfNetWare 386 gNovell hNovell iNovell pDiskSecure uPCIX Minix (old) Minix (new) Linux swap Linux files*OS/2 hidden Linux ext. NT FAT VS NTFS VS Linux LVM Amoeba FS Amoeba BBT Mylex BSDI NotebookSaveFreeBSD OpenBSD NEXTSTEP MacOS X NetBSD MacOS X bootBSDI filesy*BSDI swap Solaris CTOS DRDOSs FAT12DRDOSs < 32MDRDOSs >=32MHPFS DisbledCPM/C.DOS/C*Dell Maint SpeedStor SpeedStor SpeedStor BeOS/i386 EFI GPT EFI Sys SpeedStor DOS 3.3+ SecSpeedStor Xenix BBT ZYo9~-W .pƘg d]XeGC6G"Ͼoz4;J_.T"ne*W*?qg λ.o~F^==qȼ(KE"PL%6yerpp}>z(Oaʭ#̽܋^4ҹ=55yLKX kbef:{ ]2l젾 3a:8 ]}P=ϩ(JDD4r!`*(\RHȲB.b%2E'*)u!,-Z6M Px6 ;;JWb$tg`*R e@Z+Mdk(3{8^a=+Qdb.'a*p0I4{I@ӃB|q&Cb"xD%YgG'V"yjcVQ 9r,xl0BY>fbZ Hv}Ywi(L; Ъ d4h"x*+ɩ:FlND7<{Wsܻܻ{ׂ0z= (hoCBh^wH! R+b!yKdw,*pLI, %)P49W'wHHP"p3 !oxkMȣOP)hs1 4X$zS8، zi{çסfYM!\BH %qEFȔQ6FZ~>Fm`*%l*B\4^@Q*]OhH;Z*RAjݨt6(D5u'}woULq{4lѐ kRB}w-mXM5d\%Q,sԘW'z@Oz'P!^!`Z=ؙ.-T(YTq۵.1TZ8:/a Mx|U!p|]W9rc7F۶~ ގ-$YLkZ4UwEOV48xjRhjE(Q1D}$Eޯd6;zk3Ǝ܌wVZZ|T9!W6L X2#^Bߎ\-']r!l0&Cu:G#CϬ-wݞ=>?O.Ɩم[Ӆ¿X,NZO_<6 Ó䃴 F_ԟ8Ȋ9I\[Rڱ`PB2MC K-)vU8FImVT _ۍr4E*?65:Ch\qa_W@qM[GwJuaSٻ/R%l5"Odhfҏ9Iod͏0c?vH⴯H{)]xDž Vvl3Xbk Mΐx΁SGMpޕSe…r-5PWMi^p2 p+ (;rTnz*6HuTPi,bK|eUvCȠ9E36h:"7bcΔ?;&/rO#۲VXuIަqd?N@>П NUwft0 '鬆o: ?\"xIgx}EdN)S|I/op_5$x}%&ߨ*xO]G>X| ΘMxd{o60t0d-3>G$+´l;,{'@l$F )<_z:[ڠ5tg WHboi(ΊdgVY+_[%g[ 3 *>?CblV<38Cʃ+ֻһ=F-F9EQY͓נmgɦ:׭#F$cuv[T|ut,v]\ŎR}(6QzbNűf:779,[S-!ۆDZX[Zj {}J]!(㦜- %&Si `kO*ekkAV*~<3-sVEs'qTwy]\Q lvLH3U obzDba2dau䌬 V]kv^qrn䪚+j@Q+R֝V ģn *'CƪiYDDTV#MR"0يKaɢ ̬{%'=r5jz "P8V[вb1K]U atJ{;Pjӧn-:0KMWdsQ ӞMiV0 lucY5O ]?tT`v$vW8Fo~uv+hC}zTuB36;x^T4=: 5ީ dZ.+T(WRwn(4:g.[ȣT|WƵ 6 >G_KxoUWH ;e6'D _ʘN{((Yn=t98{L갾)GwFDOQVNUdDf6]dnxlIWGpo|@ > Zgs3W0۴q }:• ܘ;PaֈPtD=sV{JSwt7Z]'AX|yS:XK>wL2ƻ}2t (.)Pg"/d=eWSY<a9h|c.eNF40VjTlRMuMP2w"IR0Ï"# K)#$WICj < KPK; 75tQ#m+ՅN«z0dRJW>9`i;]`t:ӡ"/'? M/usage: %s [-eiuy] [-c cylinders -h heads -s sectors] [-f mbrfile] device -i: initialize disk with virgin MBR -u: update MBR code, preserve partition table -e: edit MBRs on disk interactively -f: specify non-standard MBR template -chs: specify disk geometry -y: do not ask questions `disk' may be of the forms: sd0 or /dev/rsd0c. ieuf:c:h:s:yCylinder argument %s [1..262144].Head argument %s [1..256].Sector argument %s [1..63].using builtin MBRCan't get disk geometry, please use [-chs] to specify.Please specify a full geometry with [-chs].error initializing MBRCommand help listShow entire OpenBSD man page for fdiskreinitRe-initialize loaded MBR (to defaults)setpidSet the identifier of a given table entryEdit current drive statsEdit given table entryflagFlag given table entry as bootableUpdate machine code in loaded MBRSelect extended partition table entry MBRSwap two partition entriesPrint loaded MBR partition tableWrite loaded MBR to diskexitExit edit of current MBR, without saving changesQuit edit of current MBR, saving current changesabortAbort program without saving current changes ----------------------------------------------------- ------ ATTENTION - UPDATING MASTER BOOT RECORD ------ ----------------------------------------------------- Do you wish to write new MBR? Do you wish to write new MBR and partition table?USER_initMBR is unchangedEnter 'help' for informationfdisk:%c%d> Writing current MBR to disk.error writing MBRUSER_modifyAborting changes to current MBR.Invalid command '%s'. Try 'help'. Offset: %d USER_print_diskBytesSectorsKilobytesMegabytesGigabytesask_cmd%s [%X - %X]: [%X] %s [%d - %d]: [%d] (? for help) ask_num'%d' is out of range. '%s' is not a valid number. %s [n] %s: [%u] Rounding to nearest cylinder: %u %s is not a character device or a regular fileDISK_getlabelmetricsDIOCGDINFODisk: %s geometry: %d/%d/%d [%.0f %d-byte %s] geometry: Signature: 0x%X MBR_pcopyChoose from the following Partition id values:%02X %s %02X %s %02X %s %02X %s Warning CHS values out of bounds only saving LBA values Starting Ending LBA Info:%c%1d: %.2X %6u %3u %3u - %6u %3u %3u [%12u:%12.0f%s] %s #: id C H S - C H S [ start: size ]-------------------------------------------------------------------------------Start of partition #%d after end!In memory copy is initialized to:Use 'write' to update disk.XreinitChange disk geometry?BIOS CylindersBIOS HeadsBIOS SectorsInvalid argument: %s Invalid partition number %d. Swap with what partition?%d same partition as %d, doing nothing. Invalid argument: %s Invalid partition number.Partition id ('0' to disable) Partition %d is disabled. Do you wish to edit in CHS mode?Size of the partition.BIOS Starting cylinderBIOS Starting headBIOS Starting sectorBIOS Ending cylinderBIOS Ending headBIOS Ending sectorLoop to offset 0! Not selected.Selected extended partition %d New MBR at offset %d. Partition %d is not an extended partition. Writing MBR at offset %d. Xwrite %s %s Machine code updated.Partition %d flag value set to 0x%x. Partition %d marked active. Invalid argument: %s [value] (standard input)(fd %d)invalid file type^\((%s[[:<:]]%s%.*s%s[[:>:]]%susage: %s [-abcEFGHhIiLlnoPqRSsUVvwx] [-A num] [-B num] [-C[num]] [-e pattern] [-f file] [--binary-files=value] [--context[=num]] [--line-buffered] [pattern] [file ...] 0123456789A:B:CEFGHILPSRUVabce:f:hilnoqrsuvwxybinary-filesline-bufferedafter-contextbefore-contextextended-regexpfixed-stringsbasic-regexpbinarybyte-offsetregexpno-filenameignore-casefiles-without-matchfiles-with-matchesline-numberquietsilentrecursiveno-messagesrevert-matchword-regexpline-regexpunix-byte-offsetscontext out of rangegrep version %u.%u without-matchUnknown binary-files optionBinary file %s matches [[:<:]][[:>:]]aFfh:t:v%s: not a directory or special deviceumountfsBad MNT RPC%s: unmount from %s %s: not currently mountedusage: %s %s umount [-fv] special | nodeumount -a [-fv] [-h host] [-t type]LXdhp|sl9xu:g:m:o:not an MSDOS filesystemstat %sunknown group id: %sunknown user id: %sinvalid file mode: %susage: mount_msdos [-9lsx] [-g gid] [-m mask] [-o options] [-u uid] special node $OpenBSD: fsck.c,v 1.26 2007/10/20 18:11:17 sobrado Exp $$OpenBSD: fsutil.c,v 1.16 2007/02/17 15:57:14 grunk Exp $$OpenBSD: preen.c,v 1.16 2005/10/28 07:30:35 otto Exp $start %s %swait %scheckfs%s/fsck_%sexec %sCan't get resource limit for data sizeCan't get resource limit to max data sizedvpfnyb:l:T:t:-b %s%s: unknown special file or file system.fsck_%snoInvalid option stringusage: %s [-dfnpvy] [-b block#] [-l maxparallel] [-T fstype:fsoptions] [-t fstype] [special | node ...] UNEXPECTED INCONSISTENCY:THE FOLLOWING FILE SYSTEM%s HAD AN %s %s: %s (%s)%sCan't open checklist file: %s/etc/fstabBAD DISK NAME %s pass %d, name %s Unknown pid %ld%s: %s (%s): EXITED WITH SIGNAL %d done %s: %s (%s) = %x disk %s: %s in fstab more than once!mkfifom:invalid file mode.non-numeric major number.non-numeric minor number.major or minor number too largenode must be type 'b' or 'c'.usage: %s [-m mode] fifo_name ... usage: %s [-m mode] name [b | c] major minor %s [-m mode] name p  ܕ`ܕUGHRBD M@dmCXLS1@2 3cJ0123456789abcdefold usage of trailing 0assuming route to if entry in usenot in tablerouting table overflow: gateway %s (%s)netmask missingold usage of trailing digit, assuming route via gatewayblackholechangecloningdstencapgatewaygenmaskhopcountifaifpjumbolinkllinfolockrestmpathnetnojumbonostaticproto1proto2recvpiperejectrttrttvarsasendpipeshowssthreshstaticxresolvebotched keyword: %susage: %s [-dnqtv] [-T tableid] command [[modifiers] args] commands: add, change, delete, flush, get, monitor, show dnqtT:v/dev/nullroute-sysctl-estimate%-20.20s donewrite to routing socketgot only %d for rlen Examining routing table from sysctl(address family %s) actual retrieval of routing tablemust be root to alter routing tableking bula sez: set_metric with invalid keyinet6_makenetandmask128%s: resolved to multiple values%s: bad address%s: not a network%d: bad address familyinternal errorprefixlen is not supported with af %dactual retrieval of interface tablegot message of size %d on %sread from routing socketwriting to routing socketso_labelso_ifaso_ifpso_genmaskso_maskso_gateso_dstRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics or flagsRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_RESOLVE: Route created by cloningRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_IFINFO: iface status changeRTM_IFANNOUNCE: iface arrival/departurerouting message version %d not understoodprint_rtmsg%s: len %d, if# %d, link: %s, flags:name: %s, table: %u, pid: %ld, seq %d, errno %d, flags:metric %d, flags:if# %d, name %s, what: departurearrival route to: %s destination: %s mask: %s interface: %.*s if address: %s flags: label: %s use hopcount mtu expire%8llu %8u%c %8d%c sockaddrs: gateway: %s RTM_GET: %s (errno %d)message length mismatch, in packet %d, returned %d locks: inits: sockaddrs: sodump%s: inet %s; %s: inet6 %s; %s: link %s; label too longinvalid table id: %ssysctl of routing tableRouting tables Encap:sysctl of spdspd-sysctl-estimateGatewayFlagsRefsUseMtuInterface%-*.*s %-*.*s %-6.6s %6.6s %8.8s %6.6s %s PortProtoSA(Address/Proto/Type/Direction)Source%-18s %-5s %-18s %-5s %-5s %-22s p_rtentry%-6.6s %6u %8llu %6u %6s %.16sInternet Protocol Family %d: AppleTalkInternet6Encap%-*s %-5u %-*.*s %-5u %-6u/esp/use/in/out///acquire/require/bypass/deny/dontacq/ah/ipip/ipcomp%-*.*s p_flagsroutename(%d) %s%u.%u.%u/%d%u.%u.%u.%u/%d%u.%u/%d%u/%d%s/%dnetname6illegal prefixlenaf %d: %slink#%d@(#) Copyright (c) 1985, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. KMGTPasciiimageebcdictenexusage: %s [ | Using %s mode to transfer files. %s: unknown mode. TYPE %s %sTYPE %sinternal error: unknown type %d.We only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. local-fileremote-fileusage: %s local-file [ remote-file ] APPESTORSTOUlocal-filesusage: %s local-files Continue withmput%s: not foundr+wusage: %s remote-file [ local-file ] local: %sRETRgetitremote-filesusage: %s remote-files can't get cwdSkipping non-relative filename `%s' mgetand logged inConnected %sto %s. Not connected. Connected for proxy commands to %s. No proxy connection. (none)Gate ftp: %s, server %s, port %s. Passive mode: %s. Mode: %s; Type: %s; Form: %s; Structure: %s. Verbose: %s; Bell: %s; Prompting: %s; Globbing: %s. Store unique: %s; Receive unique: %s. Preserve modification times: %s. Case: %s; CR stripping: %s. Ntrans: (in) %s (out) %s Ntrans: off. Nmap: (in) %s (out) %s Nmap: off. Hash mark printing: %s; Mark count: %d; Progress bar: %s. Use of PORT/LPRT cmds: %s. (disabled for this connection)Use of EPSV/EPRT cmds for IPv4: %s%s. Macros: usage: %s [ on | off ] %s %s. Bell modeEPSV/EPRT on IPv4Packet tracingusage: %s [ on | off | bytecount ] bytecount value is %s: %s Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeusage: %s [ on | off | gateserver [ port ] ] Disabling gate-ftp mode - no gate-ftp server defined. GlobbingPreserve modification timesusage: %s [ on | off | debuglevel ] debugging value is %s: %s Debugging %s (debug=%d). remote-directoryusage: %s remote-directory CWD %sCWD command not recognized, trying XCWD. XCWD %susage: %s local-directory Local directory now %s getcwd: %slcdDELE %susage: %s remote-file mdeletefrom-nameto-nameRNFR %susage: %s from-name to-n@ . .. pppAfirmware3Fgroup8Gspwd.dbH protocolsIservicesJ disktabK fstab+L resolv.confML hosts+A .@..B . ..C binDmdecEsbinEshareEC .B .. ftpgrep2fgrep2egrep2gzip2gunzipgzcat2less2more2 sedP disknames7D .B..E ...wheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root bin:*:7: news:*:8: wsrc:*:9: users:*:10: auth:*:11: games:*:13: staff:*:20:root smmsp:*:25: popa3d:*:26: sshd:*:27: _portmap:*:28: _identd:*:29: _rstatd:*:30: guest:*:31:root _rusersd:*:32: _fingerd:*:33: _sshagnt:*:34: _x11:*:35: utmp:*:45: _kdc:*:59: _kadmin:*:60: _lkm:*:61: _spamd:*:62: _radius:*:63: _token:*:64: _shadow:*:65: crontab:*:66: www:*:67: _isakmpd:*:68: network:*:69: named:*:70: proxy:*:71: authpf:*:72: _syslogd:*:73: _pflogd:*:74: _bgpd:*:75: _tcpdump:*:76: _dhcp:*:77: _mopd:*:78: _tftpd:*:79: _rbootd:*:80: _afs:*:81: _ppp:*:82: _ntp:*:83: _ftp:*:84: _ospfd:*:85: _hostapd:*:86: _dvmrpd:*:87: _ripd:*:88: _relayd:*:89: _ospf6d:*:90: _snmpd:*:91: dialer:*:117: nogroup:*:32766: nobody:*:32767: ame RNTO %susage: %s remote-directory local-file nlistLISTNLSToutput to local-file:usage: %s remote-files local-file Try again latershellusernameusage: %s username [password] [account] USER %sPassword:PASS %sAccount: ACCT %sLogin failed. PWDPWD command not recognized, trying XPWD. XPWDLocal directory %s getcwdlpwddirectory-nameMKD %susage: %s directory-name MKD command not recognized, trying XMKD. XMKD %sRMD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendusage: %s line-to-send arguments to SITE commandSITEquote1SITE CHMOD %s %susage: %s mode file-name SITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITusage: %s [password] Account:usage: %s command ?Ambiguous command. ?Invalid command. ?Invalid proxy command. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutusage: %s [mapin mapout] nmap: unbalanced brackets. Passive modeStore uniqueReceive uniqueCDUPCDUP command not recognized, trying XCUP. XCUPrestart: offset not specified. restart: invalid offset. Restarting at %lld. Execute get, put or append to initiate transfer SYSTLimit of 16 macros have already been defined. macro nameusage: %s macro_name Enter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4K buffer exceeded. usage: %s filename %s %lld %s %sSTAT %sSTATLocal file "%s" is newer than remote file "%s". |%sCan't allocate memory for $PAGERaccountbellbyecasecdupclosedisconnectepsv4formgateglobhashidlemacdefmdirmlsmodtimemsendnewernmapntranspassivepreserveprogresspromptpwdquoterecvregetresetrestartrhelprmdirrstatusruniquesendportsitestructsuniquetraceumaskverbose'%s' macro not found. domacroUser-Agent: OpenBSD ftpGET %s HTTP/1.0 Proxy-Authorization: Basic %s%s %s GET %s HTTP/1.0 %s%s HTTP/1.0GET /%s %s Host: Can't allocate memory.[%s]:%s %s%s Writing HTTP requestreceived '%s' Too many redirections requestedError retrieving file: %sContent-Length: Location: Redirected to %s Can't open %sCan't allocate memory for transfer bufferReading from socketRead short file. Successfully retrieved file. Auto-login using ftp URLs isn't supported when using $ftp_proxyReceiving HTTP replyWriting %sImproper response from %surl_getExtra `@' characters in usernames and passwords should be encoded as %%40Can't allocate memory to parse URLhttp://ftp://url_get: Invalid URL '%s'Invalid URL (no `/' after host): %sInvalid URL (no file after host): %sInvalid URL (no file after directory): %sCan't allocate memory for proxy URL.Malformed proxy URL: %sCan't open file %sReading from filehost %s, port %s, path %s, save as %s. (unknown)Trying %s... r+Requesting %s (via %s) http fetch aborted. file fetch aborted. ftp_proxyhttp_proxyCan't allocate memory for auto-fetch.Invalid URL: %suser %s:%s host %s port %s dir %s file %s Can't connect or login to host `%s'*?[]{}Retrieving %s/%s auto_fetchCan't allocate memory for URL decoding:/ftpgatehttp%s: bad port number `%s'connect to address %ssetsockopt TOS (ignored)fdopen failed.Connected to %s. hookup---> PASS PASS XXXXACCT ACCT XXXXNo control connection for command.---> %c ---> %s %c%c%c421 Service not available, remote server has closed connection. getreply send aborted waiting for remote to finish abort. sentlocal: %s remote: %s %s: not a plain file. REST %lldnetoutsendrequest receive aborted waiting for remote to finish abort. receivednetin%s: short writeWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %suse of scoped address can be troublesomesetsockopt (ignored)EPSVwrong server: return code must be 229 disabling epsv4 for this connection PASVLPSVPassive mode refused. wrong server: return code must be 227 %u,%u,%u,%u,%u,%uwrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode AF mismatch. Shouldn't happen! %c%c%c%d%cparse error! setsockopt (reuse address)setsockopt IP_PORTRANGE (ignored)setsockopt IPV6_PORTRANGE (ignored)listenEPRT |%d|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dinitconnacceptdataconnproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s runique: can't find unique file name. Lost control connection for abort.%cABOR abort_remoteNeither $FTPSERVER nor $GATE_SERVER is defined; disabling gate-ftpdumbemacssukeep alive amount is %s: %sretry amount is %s: %s46AaCc:dEegik:mno:pP:r:tvVRetrying... FTPSERVERPORTFTPMODEunknown FTPMODE: %s. Using defaultsgate-ftpFTPSERVERftp> sorry, input line too long. Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous help command %s ?Invalid help command %s %-*s %s usage: %s [-46AadEegimnptVv] [-k seconds] [-P port] [-r seconds] [host [port]] %s [-C] [-o output] ftp://[user:password@]host[:port]/file[/] %s [-C] [-c cookie] [-o output] http://host[:port]/file %s [-C] [-o output] host:[/path/]file[/] stringlist|%.*s%*s| %5lld %c%c %2d:%02d:%02d --:-- ETA - stalled -%02d:%02d ETAprogressmeterAlready connected to %s, use close first. usage: %s host-name [port] gateserver not defined (shouldn't happen)PASSERVE %sConnected via pass-through server %s non-printstreamRemote system type is %s. 215 UNIX Type: L8215 TOPS20Remember to set tenex mode when transferring binary files from this machine. anonymous%s@Name (%s): Name (%s:%s): Login failed.$initftp_loginsorry, arguments too long. (%s) unable to create temporary file: %sftpXXXXXXXXXXunable to create temporary file %scan't find list of remote files, oops.can't find list of remote files, oops. remglob%s %s? n, y, p, a, are the only acceptable commands! Interactive mode: off. Prompting off for duration of %s. confirmSIZE %sMDTM %s191Y2K warning! Fixed incorrect time-val received from server. %*s %04d%02d%02d%02d%02d%02dCan't convert %s to a time. Unable to determine real path of `%s'fileindir %3d%% *************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************%lld byte%s %s in %.2f seconds (%.2f %sB/s) ETA: %02d:%02d:%02d ptransfer/etc/rcWARNING: some process(es) wouldn't die(can't restart init): SIGTERM processes/dev/consolesetsidrevokeSIGTSTP inithalted (with powerdown) by %shalted by %srebooted by %sdlnpq~usage: %s [-dn%sq] LXdhp|@8T.Dreloadfilesystem must be mounted read-only; you may need to run fsckusage: mount_ffs [-o options] special node hl5"KKKKK%bKKK L L&̆7 L#(L$0L8L@LHLPL, `L lL!xLL [,rMXMMNM 08`(G<  (G`[~ [~(G`@@<@TU )Gn b )Gnn?A(G4 )GLb*)GLb* A(G(G(G ]=A(GXU(GH(GG 3N\A(GXU(G/$&(G/$& ^A(GXU(GXU(G 9?A(Gܿ(Gܿ(Gܿ ]b&)GF)G#T)G#T ,Dj\)G)GE)GE8 @ H P X ` h p x P'))GW@ )G )G - )G͌;#)G#)G#.  )G%)G%)G%/tmp/disktab.shadowgm)G g')G g')G g'/tmp/fstab.shadow0)G9;()G9;()G9;(/tmp/resolv.conf.shadowdύ )GLb*)GLb*)GLb*/tmp/hosts0Hkt$aSQ;x?{DqbT̗sm-eF~^L2ʌuXw`{XiyχLvQfKSS~, (log4i0>N<+HhNQWqԋghJ)߾bpn-KwTv8< ׮ t(79t},TlPg PBvg է>#&ٙN` 4q!1mYpU}' ~IO=sk9=89Ak簺w%_J>\ o׳q,%o^&HM8L*h>I[{Lfx&؃?]KvE (Wn dQmFv ρ`6F3(Rʔqr&8nux7 Ah\;{dk +Ȫ%wtZ^qoGƕRŴT-@?7@lƋD4e ʽz4C!&TO*SGt0{MqWs (WP,A{C (F+qNM$NM8NMDNMTNM`NMpNMN<NN<N<NXN<N<NNO O$Opiaddr%d bad IP checksums seen in %d packetsip length %d disagrees with bytes received %d.%d udp packets in %d too long - droppedaccepting packet with data after udp payload.%d bad udp checksums in %d packetssubnet-masktime-offsetIAtime-serversien116-name-serversdomain-name-serverslog-serverscookie-serverslpr-serversimpress-serversresource-location-servershost-nameboot-sizemerit-dumpdomain-nameswap-serverroot-pathextensions-pathip-forwardingnon-local-source-routingpolicy-filterIIAmax-dgram-reassemblydefault-ip-ttlpath-mtu-aging-timeoutpath-mtu-plateau-tableSAinterface-mtuall-subnets-localbroadcast-addressperform-mask-discoverymask-supplierrouter-discoveryrouter-solicitation-addressstatic-routestrailer-encapsulationarp-cache-timeoutieee802-3-encapsulationdefault-tcp-ttltcp-keepalive-intervaltcp-keepalive-garbagenis-domainnis-serversntp-serversvendor-encapsulated-optionsnetbios-name-serversnetbios-dd-servernetbios-node-typenetbios-scopefont-serversx-display-managerdhcp-requested-addressdhcp-lease-timedhcp-option-overloaddhcp-message-typedhcp-server-identifierdhcp-parameter-request-listBAdhcp-messagedhcp-max-message-sizedhcp-renewal-timedhcp-rebinding-timedhcp-class-identifierdhcp-client-identifieroption-62option-63nisplus-domainnisplus-serverstftp-server-namebootfile-namemobile-ip-home-agentsmtp-serverpop-servernntp-serverwww-serverfinger-serverirc-serverstreettalk-serverstreettalk-directory-assistance-serveruser-classoption-78option-79option-80option-81option-82option-83option-84nds-serversnds-tree-namends-contextoption-88option-89option-90option-91option-92option-93option-94option-95option-96option-97option-98option-99option-100option-101option-102option-103option-104option-105option-106option-107option-108option-109option-110option-111option-112option-113option-114option-115option-116option-117option-118option-119option-120option-121option-122option-123option-124option-125option-126option-127option-128option-129option-130option-131option-132option-133option-134option-135option-136option-137option-138option-139option-140option-141option-142option-143option-144option-145option-146option-147option-148option-149option-150option-151option-152option-153option-154option-155option-156option-157option-158option-159option-160option-161option-162option-163option-164option-165option-166option-167option-168option-169option-170option-171option-172option-173option-174option-175option-176option-177option-178option-179option-180option-181option-182option-183option-184option-185option-186option-187option-188option-189option-190option-191option-192option-193option-194option-195option-196option-197option-198option-199option-200option-201option-202option-203option-204option-205option-206option-207option-208option-209option-210option-211option-212option-213option-214option-215option-216option-217option-218option-219option-220option-221option-222option-223option-224option-225option-226option-227option-228option-229option-230option-231option-232option-233option-234option-235option-236option-237option-238option-239option-240option-241option-242option-243option-244option-245option-246option-247option-248option-249option-250option-251option-252option-253option-254option-endpadvalue %s%o exceeds max (%d) for precision.value %s%x exceeds max (%d) for precision.value %s%u exceeds max (%d) for precision.Unexpected integer size: %dfilename must be a stringno memory for string %s.expecting a network hardware typeExpecting numeric lease timeno space for numeric aggregatenumeric aggregate too short.Bogus number: %s: digit %d not in base %dBogus number: %s.numeric day of week expected.numeric year expected.expected slash separating year from month.numeric month expected.expected slash separating month from day.numeric day of month expected.numeric hour expected.expected colon separating hour from minute.numeric minute expected.expected colon separating minute from second.numeric second expected.buf_open: %mbuf_add: %mbuf_close (connection closed)buf_close (short write): %mbuf_close: %mbuf_read (short read): %mbuf_read (connection closed)buf_read: %mcorrupted message receivedreceived unknown message, code %ddispatch_imsgcannot read temp filecannot seek temp fileline too longcannot write temp fileinvalid address/tmp/ed.XXXXXXXXXXw+cannot open temp filecannot close temp fileEnter key: get_keywordbad hex digit in keybad binary digit in keydes_setkeydes_ciphercbc_decodedecryption failed (block corrupted)decryption failed (incomplete block)cannot read fileinvalid pattern delimiter& no previous commandunexpected end-of-filecannot close input filecannot open input filenewline inserted newline appended cannot read input filecannot close output filecannot open output filecannot write filecannot read stdin \abfnrtv\\ warning: file modifiedinvalid filename@(#) Copyright (c) 1993 Andrew Moore, Talke Studio. All rights reserved. usage: %s [-] [-sx] [-p string] [name] p:sx ? interrupt? script, line %d: %s number out of rangeinvalid redirectioninvalid destinationno previous substitutiondestination expectedcannot nest global commandsno current filenameunexpected command suffixinvalid command suffixunexpected addressno matchfilename too longshell access restrictedinvalid mark charactered.hup/ed.hupno previous patterntrailing backslash (\)unbalanced brackets ([])infinite substitution loopnothing to undoHLPRfiprthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s%s: name too long (not copied)%s is a directory (not copied).cannot overwrite directory %s with non-directory %s%s and %s are identical (not copied).overwrite %s? readlink: %sunlink: %scopy_linksymlink: %smkfifo: %smknod: %schown: %schmod: %schflags: %sutimes: %slchown: %susage: %s [-fip] [-R [-H | -L | -P]] source target %s [-fip] [-R [-H | -L | -P]] source ... directory n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @      inflate 1.2.3 Copyright 1995-2005 Mark Adler  #+3;CScs !1Aa  0@`@@4vDv,ruuuu vv,r%s not a regular file%s%s already has %s suffix -- unchanged%s: unknown suffix: ignored%s%s: name too long%s: input: %sdeflate.gzzcatzipunknown program nameGZIPGZIP is too longoption -a is ignored on this systemillegal bit count -- %s-o argument is too long123456789ab:cdfghlLnNOo:qrS:tvV-o option may only be used with a single input filemay not mix -o, -c, or -t options%s is a directory: ignored: unchangedcompression not supported%s: won't read compressed data from terminal%s: unrecognized file formatcrc errordodecompressfchown: %sfchmod: %sfchflags: %sfutimes: %sZgzztgztaz.-_method crc date time compressed uncompressed ratio uncompressed_name%-7.7s %08x %s %10lld %10lld %4.1f%% %s %10lld %10lld %4.1f%% (totals) OK %4.1f%% -- replaced with %s %lld bytes in, %lld bytes out usage: %s [-123456789cdfghLlNnOqrtVv] [-b bits] [-o filename] [-S suffix] [file ...] 1.2.3put_headerfile errorstream errordata errorinsufficient memorybuffer errorincompatible versionneed dictionarystream end@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: chmod.c,v 1.23 2006/04/25 15:41:07 deraadt Exp $HLPRXfghorstuwxinvalid flags: %sinvalid flag: %sthe -R and -h options may not be specified together.user is %s: %sgroup is %s: %susage: %s [-R [-H | -L | -P]] %s file ... [owner][:group]usage: %s [-fh] [-R [-H | -L | -P]] %s file ... $OpenBSD: dir.c,v 1.22 2007/09/16 17:42:40 otto Exp $$OpenBSD: inode.c,v 1.30 2007/06/25 19:59:55 otto Exp $@(#) Copyright (c) 1980, 1986, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: main.c,v 1.32 2007/06/25 19:59:55 otto Exp $$OpenBSD: pass1.c,v 1.26 2007/06/25 19:59:55 otto Exp $$OpenBSD: pass1b.c,v 1.15 2007/06/25 19:59:55 otto Exp $$OpenBSD: pass2.c,v 1.27 2007/06/25 19:59:55 otto Exp $$OpenBSD: pass3.c,v 1.12 2006/03/22 20:24:32 deraadt Exp $$OpenBSD: pass4.c,v 1.17 2007/06/25 19:59:55 otto Exp $$OpenBSD: pass5.c,v 1.36 2007/07/17 18:54:40 otto Exp $$OpenBSD: fsutil.c,v 1.16 2007/02/17 15:57:14 grunk Exp $$OpenBSD: setup.c,v 1.37 2007/06/01 23:42:35 pedro Exp $ $OpenBSD: utilities.c,v 1.34 2007/06/25 19:59:55 otto Exp $?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@dirscanexpanddirbad size: blk %lld, offset %lld, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock.fs_fpg %d cannot allocate memory for inode cache cannot increase directory list%lld %s I=%uCG %d: BAD MAGIC NUMBER dfpnNyYb:c:m:conversion levelusage: %s [-fnpy] [-b block#] [-c level] [-m mode] filesystem ... %lld files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %lld,%lld blocks missing %lld files missing phase 1, inode %d/%dcheckinodeINCORRECT BLOCK COUNT I=%u (%ld should be %d)bad indirect addr: %ld bad direct addr: %ld convert symlink %d(%s) of size %llu cannot read symlink phase 1b, inode %d/%dphase 2, directory %d/%dphase 2, parent directory %d/%d%s %s: LENGTH %ld NOT MULTIPLE of %d%s %s: LENGTH %ld NOT MULTIPLE OF %d (REMOVED)phase 3, directory %d/%ldphase 4, inode %d/%dphase 5, cg %d/%dCREATCANNOT %s CLUSTER MAPS FREE BLK COUNT(S) WRONG IN SUPERBLKBLK(S) MISSING IN BIT MAPSALLOCATED FRAG %ld MARKED FREE ALLOCATED INODE %ld MARKED FREE SUMMARY INFORMATION BADCREATE CLUSTER MAPS%sING CLUSTER MAPS DELETING CLUSTERING MAPS DELETE CLUSTERING MAPSUNKNOWN ROTATIONAL TABLE FORMAT %d INFORMATION; SEE fsck_ffs(8).IMPOSSIBLE NPSECT=%d IN SUPERBLOCK (FIXED)INCORRECT BMASK=%x IN SUPERBLOCKINCORRECT FMASK=%x IN SUPERBLOCKINCORRECT BSHIFT=%d IN SUPERBLOCKINCORRECT FSHIFT=%d IN SUPERBLOCKINCORRECT MAXFILESIZE=%llu IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%lx IN SUPERBLOCKINCORRECT QFMASK=%lx IN SUPERBLOCKINCONSISTENT CGSIZE=%d INCONSISTENT INOPB=%d INCONSISTENT NINDIR=%d cannot alloc %u bytes for cylinder group summary area cannot alloc %lu bytes for lncntp cannot alloc %u bytes for cginosused cannot alloc %lu bytes for inphead CONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATIMPOSSIBLE MINFREE=%d IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKclean = %d NCG OUT OF RANGECPG OUT OF RANGESBSIZE PREPOSTEROUSLY LARGEILLEGAL BLOCK SIZE IN SUPERBLOCKILLEGAL FRAGMENT SIZE IN SUPERBLOCKoffset %d, original %ld, alternate %ld NCYL LESS THAN NCG*CPG%s: NOT LABELED AS A BSD FILE SYSTEM (%s) WRITING %sZERO'ED BLOCK %lld TO DISK CANNOT %s: BLK %lldUPDATE STANDARD SUPERBLOCK %lld (%lld),catchinfo   init: %s init: already running initial setsid() failed: %mrootsetlogin() failed: %munrecognized flag '-%c'sfignoring excess argumentsfatal signal: %scannot get kernel security level: %scannot change kernel security level from %d to %d: %scan't get %s for controlling terminal: %m/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bincan't exec %s for single user: %mcan't fork single-user shell, trying againwait for single-user shell failed: %m; restartinginit: shell stopped, restarting single user shell terminated, restartingsingle user shell terminated.single_userautobootcan't exec %s for %s: %mcan't fork for %s on %s: %mwait for %s on %s failed: %m; going to single user modeinit: %s on %s stopped, restarting %s on %s terminated abnormally, going to single user modesession database close: %ssession database open: %sinsert %d: %sdelete %d: %scan't parse getty for port %scan't allocate windowcan't parse window for port %scan't fork for window system on port %s: %msetsid failed (window) %mcan't exec window system '%s' for port %s: %mcan't fork for getty on port %s: %mgetty repeating too quickly on port %s, sleepingcan't exec getty '%s' for port %s: %mport %s changed utmp index from %d to %dcan't exec %s for %s %s: %msome processes would not die; ps axl advisedinsane maxpartitions value %dP:T:b:c:e:f:i:m:o:s:NO:S:T:b:c:e:f:g:h:i:m:o:qs:t:%s: invalid ffs versionsector size is %s: %sblock size is %s: %sfragments per cylinder group is %s: %sblocks per file in a cylinder group is %s: %sfragment size is %s: %saverage file size is %s: %saverage files per dir is %s: %sbytes per inode is %s: %sfree space %% is %s: %s%s: unknown optimization preference: use `space' or `time'.file system size is %s: %snewfs_%s%s/newfs_%s%s not found%sr%s%s: getmntinfo: %s: %s: not a character-special device %s: can't figure out file system partition%s: `%c' partition is unavailable%s: `%c' partition overlaps boot program%s: maximum file system size on the `%c' partition is %lld%s: no default sector sizewarning: changing optimization to space because minfree is less than %d%% ioctl (WDINFO)%s: can't rewrite disk labelusage: %s [-b block-size] [-c fragments-per-cylinder-group] [-e maxbpg] [-f frag-size] [-i bytes] [-m free space] [-o options] [-P file] [-s size] special node usage: %s [-Nq] [-b block-size] [-c fragments-per-cylinder-group] [-e maxbpg] [-f frag-size] [-g avgfilesize] [-h avgfpdir] [-i bytes] [-m free-space] [-O filesystem-format] [-o optimization] [-S sector-size] [-s size] [-t fstype] special %s: initializing cg %ld/%d siginfopreposterous size %lld, max is %dpreposterous size %lld, max is %lldblock size must be a power of 2, not %dfragment size must be a power of 2, not %dfragment size %d is too small, minimum is %dblock size %d is too small, minimum is %dblock size %d is too large, maximum is %dblock size (%d) cannot be smaller than fragment size (%d)fragment size %d is too small, minimum with block size %d is %ddensity reduced from %d to %d bytes per inodecan't honour -c: minimum is %dfile system size %jd < minimum size of %dreduced number of fragments per cylinder group from %d to %d to enlarge last cylinder groupcalloc failed%s: %.1fMB in %jd sectors of %d bytes %d cylinder groups of %.2fMB, %d blocks, %d inodes each super-block backups (for fsck -b #) at:cannot allocate I/O bufferfsinit1 failedfsinit2 failedmkfsinode table does not fit in cylinder grouppanic: cylinder group too big: %d > %dcg 0: bad magic numberfirst cylinder group ran out of spaceinternal error: can't find block in cyl 0fsinit: inode value %d out of rangerdfs: read error on block %lldwtfs: write error on block %lldisblock bad fs_frag %dclrblock bad fs_frag %dsetblock bad fs_frag %dilog2: %d is not a power of 2 dfiPRr%s: is a directoryrm_overwrite%s (inode %u): not overwritten due to multiple links%s: malloccheckoverride %s%s%s/%s for %s? remove %s? "." and ".." may not be removedusage: %s [-dfiPRr] file ... bsfbsrdensityeomfsffsrofflinerewindrewofflretensionweof%s: illegal count%s: unknown commandf:ioctl MTIOCGETWriteProtectMounted76543210%s tape drive, residual=%d erblocksize: %d (%d) density: %d (%d) %d: unknown tape drive type usage: %s [-t] device usage: %s [-f device] command [count] Lost connection to remote host.shell/tcp: unknown service/etc/rmtwho are you?invalid user name: %sO%s %d rmtopenC S I%d %d ioctlrmtioctlProtocol to remote tape server botched (code "%s").rmtreplyProtocol to remote tape server botched.(rmtgets got "%s").m:pusage: %s [-p] [-m mode] directory ... $OpenBSD: compile.c,v 1.24 2007/03/20 03:50:39 tedu Exp $@(#) Copyright (c) 1992, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: main.c,v 1.12 2007/10/16 20:19:27 sobrado Exp $$OpenBSD: misc.c,v 1.7 2006/10/09 00:23:57 tedu Exp $$OpenBSD: process.c,v 1.13 2006/10/09 00:23:57 tedu Exp $0123456789/\$invalid command code %cextra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandunexpected }branchempty labelread commandw commandfilename expectedunterminated substitute patternsubstitute pattern can not be delimited by newline or backslashextra text at the end of a transform commandcommand %c expects up to %d address(es), found %dcommand expectedunexpected EOF (pending }'s)\ can not be used as a string delimiternewline can not be used as a string delimitercompile_reRE error: %sunterminated substitute in regular expression123456789\%c not defined in the REunescaped newline inside substitute patternnumber in substitute flags out of rangemore than one number or 'g' in substitute flagsbad flag in substitute command: '%c'compile_flagsno wfile specifiedunterminated transform source stringcompile_trtransform strings are not the same lengthunterminated transform target stringtransform pattern can not be delimited by newline or backslashcompile_textexpected context addressunterminated regular expressionwhitespace after %sundefined label '%s'duplicate label '%s'unused label '%s'ae:f:nuusage: sed [-anu] command [file ...] sed [-anu] [-e command] [-f command_file] [file ...] stdout: %s ..."sed: %lu: %s: \%d not defined in the REflush_appends\ \abfnrtv%03ofirst RE may not be emptyhpX? `' dX7 - p\7 |, 8N dG I F '- 8$, \7 \7 lE Ĵ83 ̴@H д@H [P V Q m 4a  m 4a ,^ ȶj ж ` ضQ  ` b Q de ^ 8X X m $Q ,| 4R <c k -a-b-c-d -e-f-G-g-h -H -k-L -n-O-o-p -r-s-S -t-u-w-x-z===!=<>-eq-ne-gt-ge-lt -le!-ef"-nt#-ot$<8xtf(c<dLs\lpmn,p l T l @    ̹d ` T   ` FT h s ( 8D H| T@ ` l |4 <L d , @ 0  к  4  t  $ 8@ @ L \̧ x     ̻ ` ܻ t  $   0 <H Dhb fd'(! ! %"#)< >g  0y7#-1 1= ?2*?* /&.&_606162636465666768695U5u4L4l3C3c[O%A"BCDA:++--==!== *= /= %= += -= <<= >>= &= ^= |= <<>><=>=<>&& || */%+-&^|? , ~!(): htIFS= ${PS2=> } ${PS3=#? } ${PS4=+ }8@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mknod.c,v 1.1 2005/10/06 06:39:36 otto Exp $ac$ei`k(lXmCnf bu$08prTlbsDhv0PXdtxlet<DLT X   ` hp\t{x}8|  ||&&!()DINQT]]<>  <PXTO h   t@(#)PD KSH v5.2.14 99/07/13.2 AAA  Q AA A QBunable to allocate memoryLPrestricted shell - can't cdOLDPWDdon't know current directoryCDPATH%s: bad directorytoo many argumentsno OLDPWDno home directory (HOME not set)can't get current directory - %sRnprsu,-p: %s-u: %s: %spvVpv is a reserved word special is a%s shell builtin is a function undefined (autoload from %s) tracedn exported%s is *GOK*exported is an %salias for alias %s= is a tracked %salias for not foundL#R#UZ#fi#lprtuxfunction %s %T %s() %T %s: not identifierexportreadonly%s[%d]typeset -U -u -l -Z -R%d -L%d -t -r -x -i only -t, -u and -x options may be used with -funalias-tadprtUxalias: -r flag can only be used with -t and without arguments alias %s alias not found adtno argumentslpnzjob control not enabled%%%*d %*s %s%*d %*d %sls:bad signal `%s'Usage: kill [ -s signame | -signum | -signame ] {pid|job}... kill -l [exit_status] %s: arguments must be jobs or process IDsmissing name argument%s: is not an identifierarguments changed since last callOPTARGc_getopts: no argvmissing options argumentlm+alias+cd+command*=export+fc+getopts+jobs+killlet*=readonly=typeset+unaliaswhence+bg+fg%s%*ldm%ld.%02lds%snothing to shift%s: bad numberc_umask=+-rwxugoXsbad maskaugo%#3.3o ugorwxprsu,%s is read onlytrap -- bad signal %s%s: can only %s %d level(s)%s: cannot %sfv%s%*ld.%02ld%sreal user sys system user real :ptime: -%s requires an argumenttime: -%s unknown optioninvalid file modeusage: mknod [-m mode] name [b | c] major minorusage: mknod [-m mode] name p*=.*=:[*=break=builtin*=continue*=eval*=exec*=exit+false*=return*=set*=shift=times*=trap+=wait+readtest+trueulimit+umask*=unset-tmissing ]internal error: unknown opunexpected operator/operandmissing closing parenmissing argumentmissing expression operatormissing second argumentexpression expected-atime(cpu-seconds)file(blocks)coredump(blocks)data(kbytes)stack(kbytes)lockedmem(kbytes)memory(kbytes)nofiles(descriptors)ulimit: %cunlimited%-20s unlimited bad limit: %sexceeds allowable limitinvalid limit: %sx_modefileglob: substitute errorFPATH;|&()`*+?@!IFS\$(){}[]?*&;#|<>"'`beginning-of-historycomplete-commandcomplete-filecompletedelete-char-backwarddelete-word-backwarddelete-char-forwarddelete-word-forwardkill-lineredrawend-of-historyeot-or-deletegoto-historymacro-stringauto-insertkill-to-eolkill-regionlist-commandlist-fileprefix-1prefix-2yank-popbackward-charbeginning-of-linebackward-wordend-of-lineforward-charforward-wordnewlinedown-historynewline-and-nextno-opup-historyprev-hist-wordsearch-character-forwardsearch-character-backwardsearch-historyset-mark-commandstuffstuff-resettranspose-charsexchange-point-and-markcomplete-listexpand-filecapitalize-worddowncase-wordupcase-wordset-argcommentx_search_hist I-search: nothing to yank yank something first%s = '%s' %s: no such functioncannot bind, not a ttyPOSIXparameter null or not setexpand(NULL)%S%s: bad substitutionsubstitute%s: parameter not set%s: cannot open $() input%Rfunny $() command: %s*+?@! coprocess already existsPS4%s: can't find function definition file%s: can't find function definition file - %s%s: function not defined by %sCFUNC %d%s: can't open function definition file %s - %s%s: cannot execute - %s%s: restrictedcommand -p: restrictedbuiltin: %s: not a builtinEXECSHELL%s: %s: %sshcomexec: %scould not finish (dup) redirection %s: %sdupcannot %s %s: %s%s%s herein: yylexerror writing %s: %scan't %s temporary file %s: %shere document missing-rPS3%*d) %sdbteste_isadbteste_error: %s (offset %d)%s: unexpected `%s'end of expression%s: bad number `%s'%s: expression recurses on parameter `%s'%s: %s requires lvalue%s: %s applied to read only variablemissing )missing :zero divisorhistory functions not availablee:glnrs0,1,2,3,4,5,6,7,8,9,-%c%scan't use -e, -l, -n, -r with -s (-e -)can't use -l, -n with -e%.*s ${FCEDIT:-/bin/ed} $_error reading temp file %s - %scannot open temp file %serror writing temporary file - %scannot create temp file %s - %s-16substitution failed%s: not in history%s: invalid rangeno history (yet)HISTFILE%s.%dhist_shrinkinternal error: %s[%d]: shl_stdout not validtoo many files open in shellcan't create pipe - try againillegal file descriptor namefd not open for readingfd not open for writingbad file descriptorno coprocess/tmp%s/shXXXXXXXXstoppedrunning and You have %s%s%s jobs no such jobambiguousargument must be %job or process idwarning: won't have full job controlj_init: tcsetpgrp() failed: %sj_init: setpgid() failed: %sj_init: tcgetpgrp() failed: %sj_init: getpgrp() failed: %s[%d]jw:last procchildexchild: execute() returnedexchild: XPIPEI and no last_job - pid %dcannot fork - try againwaitlast: no last jobjw:waitlastwaitlast: not startedjw:waitfor| jw:resumecannot continue job %s: %sfg: 2nd tcsetpgrp(%d, %d) failed: %s1st tcsetpgrp(%d, %d) failed: %s[%d] job not job-controlledjobsnotifyzombiej_async: bad nzombie (%d)j_async: job not startedj_waitj: tcsetpgrp(%d, %d) failed: %scheckjobcheck_job: job started (flags 0x%x) Running (core dumped)%-20s %s%s%sj_print%s%5d %-20s %s%s %s%s%s%s %5d [%d] %c DoneDone (%d)remove_job: job not found (%s)no closing quote here document `%s' unclosed \$PS1PS2dopprompt\%c%r%l:%M:%S%a %b %d~/%smissing ] MAILyou have mail in $_typesetKSH_VERSION-xPPIDOPTIND=1evaltypeset -i RANDOM MAILCHECK="${MAILCHECK-600}" SECONDS="${SECONDS-0}" TMOUT="${TMOUT-0}"hash=alias -ttype=whence -vstop=kill -STOPsuspend=kill -STOP $$autoload=typeset -fufunctions=typeset -fhistory=fc -linteger=typeset -inohup=nohup local=typesetr=fc -e -login=exec login-tUccdatemailmakeprviwhoENVSH_VERSION$ /etc/suid_profile/etc/profile$HOME/.profileCannot determine current working directory-c requires an argumentUSERinclude: %dUse `exit' to leave ksh shell: %d%s%s-`%c' requires argument%s%s-%c: unknown option |&;<>()*@#!$-? =-+?#% "#$&'()*;<>?[\`|0123456789ABCDEFallexportbraceexpandbgnicecsh-historyemacs-usemetaerrexitgmacsignoreeofinteractivemarkdirsnoclobbernoglobnohupnolognounsetphysicalposixprivilegedtrackallvirawvi-show8vi-tabcompletevi-esccompletextrace%-*s %sCurrent option settings -o %sgetoptionsparse_args: `%c'%s: bad optionA:o;sgmatch'\'%-*s%*sdo_phys_pathshf_fdopen: missing read/writeshf_reopen: bad shf/buf/bsizeshf_reopen: missing read/writeshf_sopen: flags 0x%xshf_flush: no fdshf_emptybuf: no fdshf_fillbuf: no fdshf_read: bsize %dshf_read: flags %xshf_getse: flags %xshf_getchar: flags %xshf_ungetc: flags %xshf_putchar: no fdshf_putchar: flags %xshf_write: nbytes %dshf_write: flags %xshf_snprintf: buf %lx, bsize %dshf_vfprintf0123456789abcdef(null %s)too many <<'s for%s: bad identifier too many redirections %s: invalid function name thenelseeliffiesacwhileuntildo{}[[&&||;;((|&unexpectedunmatchedsyntax error: `%s' %s ?%dsyntax error: unexpected EOF ERRError handlerEXITSIGtimed out waiting for inputsetexecsig: unset signal %d(%s)%S #no-args# #no-vars# ( %T) %T| %T%;%T%s %T ]] %Sdo%N%T%;done in %;for %s select %s case %S in%N(%S%c%;%T%N;;%Nesac %s %T%;doif %Telif %Telse%;%T%;fi then%N%T{%;%T%;} %T& function %s %T%s() %Ttime %T%T|& < >| <> <<- << >> <&>&wdscan: unknown char 0x%x (carrying on)j_ttyinit: can't set close-on-exec flag: %sj_ttyinit: dup of tty fd failed: %sNo controlling tty (open /dev/tty: %s)Can't find tty file descriptorOPTINDPOSIXLY_CORRECTHISTSIZEMAILCHECKMAILPATHRANDOMSECONDSTMOUTLINENO%s: subscript %ld out of range0123456789abcdefghijklmnopqrstuvwxyz0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZstr_valsetstr: %s=%s: assigning to self%s: is read only%0*s%.*s%*s%.*sy$%s %dfc -e ${VISUAL:-${EDITOR:-vi}} --grabhist: bad history arrayM-usage: %s seconds %s: destination pathname too longdo_moverename %s to %scan't remove %scannot resolve %scannot rename a mount point%s: remove%s: set times%s: set flags%s: set mode%s: set owner/group%s: set owner/group; not setting setuid/setgid%s: waitpid/bin/cp%s: terminated with %d (non-zero) status%s: did not terminate normally/bin/rm-rf-PRpusage: %s [-fi] source target %s [-fi] source ... directory |&=<>+-*/%:()syntax erroreval5division by zeronon-numeric argument_msgbufpM:N:sysctl: KERN_MSGBUFSIZEcouldn't allocate space for buffer datasysctl: KERN_MSGBUFusage: %s [-M core] [-N system] sethostnamegethostnameusage: %s [-s] [name-of-host] /var/run/utmplogout%s: not a device nodereadlabelfs%s: bad filesystem type in label%s: couldn't read disklabel%s%s%s%c/etc/fbtab(null)%s: bad entry: %s%o%s: %s: %mlogin_protect/*%s: chown(%s): %m%s: chmod(%s): %m%s: opendir(%s): %m%lld.%1lld%c%lld%c0B/var/log/wtmplogwtmp\\#TERMPATHtgetent.termcap /usr/share/misc/termcap/usr/share/misc/termcapTERMCAPOOPS?Ynacosacosfacos: DOMAIN error asinasinfasin: DOMAIN error atan2atan2fatan2: DOMAIN error hypothypotfcoshcoshfexpfy0y0fy0: DOMAIN error y1y1fy1: DOMAIN error yn: DOMAIN error ynynflgammalgammaflgamma: SING error loglogflog: SING error log: DOMAIN error log10: SING error log10log10flog10: DOMAIN error pow(0,0): DOMAIN error powfpowpow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sinhsinhfsqrtsqrtfsqrt: DOMAIN error fmodfmodffmod: DOMAIN error remainderremainderfremainder: DOMAIN error acoshacoshfacosh: DOMAIN error atanh: DOMAIN error atanhatanhfatanh: SING error scalbscalbfj0j0f: TLOSS error j1j1fjnjnfgammagammafgamma: SING error 0C0longjmp botch. inet6_rth_reverseno errorunknown/invalid errorresolved protocol is unknowninvalid value for hintsmemory allocation failureaddress family for name not supportedservice not supported for ai_socktypeai_socktype not supportedai_family not supportedno address associated with namenon-recoverable failure in name resolutiontemporary failure in name resolutionname or service is not knowninvalid value for ai_flagsxxswfstabscanfstab: sscanfrcmd: socket: %s rcmd: socket: All ports in use RSH%s: %s rcmd_afconnect to address %s: rcmd: %s: %s socket: protocol failure in circuit setup. rcmd: accept: %s rcmd: select (setting up stderr): %s select: protocol failure in circuit setup rcmd: write (setting up stderr): %s iruserok%s/.rhosts.rhosts lstat failed.rhosts not regular fileiruserok_sa.rhosts fstat failedbad .rhosts owner.rhosts writable by other than owner/etc/hosts.equiv__ivaliduser__ivaliduser_sa__icheckhostrcmd: address %s not listed for host %s__gethostloopgetnameinfoip6_parsenumeric/usr/bin/rshlocalhostrcmdsh: socketpairrcmdsh: dup2 failedrcmdsh: fork to lose parent failedrcmdsh: execvp %s failed: %s -lrcmdshrcmdsh: setuid(%u): %s rcmdsh: fork failedrcmdsh: unknown user: %s 4P`|Resolver Error 0 (no error)Unknown hostHost name lookup failureUnknown server errorNo address associated with nameResolver internal errorUnknown resolver errorrresvport_afABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/=%u.%u.%u.%u%u.%u.%u.%uinet_ntop4inet_ntop6 $,080@`DLT\dlpxSignal 0HUPINTILLTRAPABRTEMTFPEKILLBUSSEGVSYSPIPEALRMURGTSTPCONTCHLDTTINTTOUIOXCPUXFSZVTALRMPROFWINCHUSR1USR2T`lxnosappndnosappendnoarchnoarchivednoschgnoschangenosimmutablenouappndnouappendnouchgnouchangenouimmutablenodumpnoopaque ,%ld%s-blocks%s: unknown blocksize%s: minimum blocksize is 512maximum blocksize is %dGBLOCKSIZE%02x:%02x:%02x:%02x:%02x:%02x%x:%x:%x:%x:%x:%x/etc/ethers+ ethers.byaddrether_ntohostethers.bynameether_hostton*** unknown regexp error code ***REG_NOMATCHregexec() failed to matchREG_BADPATinvalid regular expressionREG_ECOLLATEinvalid collating elementREG_ECTYPEinvalid character classREG_EESCAPEREG_ESUBREGinvalid backreference numberREG_EBRACKbrackets ([ ]) not balancedREG_EPARENparentheses not balancedREG_EBRACEbraces not balancedREG_BADBRinvalid repetition count(s)REG_ERANGEinvalid character rangeREG_ESPACEREG_BADRPTrepetition-operator operand invalidREG_EMPTYempty (sub)expressionREG_ASSERT"can't happen" -- you found a bugREG_INVARGinvalid argument to regex routineregerrorREG_0x%xsecurertsctssoftcarwindow/etc/ttys/var/run/dev.dbttyname_r/etc/protocolsgetnetanswerIN-ADDR.ARPAgetnetbyaddr0.0.0.%u.in-addr.arpa%u.%u.%u.%u.in-addr.arpa0.%u.%u.%u.in-addr.arpa0.0.%u.%u.in-addr.arpagetnetbyname/etc/networks/etc/groupgrscangroup.bynamegroup.bygidreadpassphraseglob3g_opendirg_lstatg_statmaster.passwd.bynamepasswd.byname__YP!__has_yppwgetpwnamgetpwuidmaster.passwd.byuidpasswd.byuid/etc/spwd.db/etc/pwd.db*(%s,%s,%s)netgroup.byusernetgroupnetgroup.byhostnetgroup: Cycle in group `%s' ,/etc/netgroup.dbyp_first: clnt_callalphaABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzblankcntrl digitgraphABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~lowerabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ punct!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ upperABCDEFGHIJKLMNOPQRSTUVWXYZxdigit0123456789ABCDEFabcdefalnumABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789NULSOHSTXETXEOTENQBELalertBSbackspaceHTtabLFVTvertical-tabFFform-feedCRcarriage-returnSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBIS4IS3GSIS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfivesixseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDEL[:<:]][:>:]]authunix_createauthunix_create: out of memory authunix_create_defaultauth_none.c - Fatal marshalling problem (4<P`lx(4DXp  (4<P`lx(4DXp HangupInterruptQuitIllegal instructionTrace/BPT trapAbort trapEMT trapFloating point exceptionKilledBus errorSegmentation faultBad system callBroken pipeAlarm clockTerminatedUrgent I/O conditionSuspended (signal)SuspendedContinuedChild exitedStopped (tty input)Stopped (tty output)I/O possibleCputime limit exceededFilesize limit exceededVirtual timer expiredProfiling timer expiredWindow size changesInformation requestUser defined signal 1User defined signal 2option requires an argument -- %coption requires an argument -- %sambiguous option -- %.*soption doesn't take an argument -- %.*sunknown option -- %cunknown option -- %sinet_net_pton_ipv40123456789abcdef0123456789/usr/src/lib/libc/net/inet_net_pton.cn >= 0 && n <= 9n >= 0 && n <= 15assertion "%s" failed: file "%s", line %d assertion "%s" failed: file "%s", line %d, function "%s" b0b1ncdtscilcshssbpxbxfxoxtxdxgetenttc%s.db:\|:cgetnextexeclexecleexeclpexecvpexecvp: : path too long xdr_array: out of memory   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~realpathvfscanfgethostby*.getanswer: asked for "%s", got "%s"-_/getanswergethostby*.getanswer: asked for "%s %s %s", got type "%s"gethostbyaddr%x.%x.ip6.arpa/etc/hostshosts.byaddr_yp_gethtbyaddrhosts.byname:2*" <4,$ >6.&@80( 91)! ;3+# =5-% ?7/'91)! :2*" ;3+# <4,$?7/'>6.&=5-%      )4%/7(3-!0,1'8"5.*2$                                                                                                                                  @ @ @ @ @ ./ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz01234567896789:;<=>?  !"#$%&'()*+,-./012345%2.2u$bcrypt_gensaltOrpheanBeholderScryDoubtbcrypt 1Ѭߘr/Ḗ~&jE|,G$l iciNWqX~=t XrX͋qJT{YZ90`*#`(yA8۸y:`l>w'K1/x`\`U%U攫UbHW@cj9U*4\̴ATr|*oc]ũ+1t>\3֯\$lS2zw(H;Kkē!(f a!`|H2]]]u#&܈e>#Ŭom9BD . Ji^Bh!la gӫҠQjh/T(3Ql n;zP;*~ev9>YfCoEå}^;uos D@jVbNw?6r=B$7H ۛIrS{y%P;LylO`@ž\^c$johSl>9oR;Qm,0DE ^J3(fK.WtE9_ ӹyU 2`yr,@%g̣饎"2u<kaP/R=2`#H{1S>W\o.ViB~(2gsUO'[iXʻ]=!lJ[-ySeEIҐK3~ˤAb Lw6~д+MەqՓkю%ǯ/[{AI~-%^q h"W6d$ cUYCxSZ٢[} Źv&ϕbhAJsN-GJ{RQ)S?Wƛv`+t恵oWk *!ec.4dV]-SGjnpzKD). u#&İn}ߧI`fqilRdVឱ¥6)L u@Y>:䚘T?eB[k?ҡ08-M]% L&pc^?kh >\D}W7: P tAu8/;21>8TNmO Bo ,y|$ryVw.?rU$qk.P̈́GXzt}K:zfC cdG27;C$CMQe*P:qUN1w_V5kǣ;< $Y,n<pEㆱo ^*>Zw=Ne)։>%fRxL.jxS<- N=+6&9`y#RnfE{7(2åZl!Xeh;/ۭ}*/n[(!pa)uGa0a4c\s9pL ު˼,b`\ndi#PZe2Zh@*<1! T_~}=b7w-_h)5ǡޖXxWcr"ÃF T0.SHُ(1mX4a(s<|J]d]B> EꫪOlOBBǵj;Oe!AyMjGKPb=bF&[$ti GV[ Htb#*BXU >ap?#r3A~_;"lY7|`t˧@n2w΄PU5ai Z .zD4Egɞs͈Uy_g@Cge48>q(= m!>J=+hZ=@&L4)i Av.khq$j 3ԷCaP.9FE$tO!@MpE/f m1'A9UG%ښ ʫ%xP()Sچ, mbhiHפh'?Oz|Ϊ_7әxB*k@5 ٫9N;VmK1f&tn:2C[Ah xN جV@E'H::SU kKмgUXc)3VJ*%1?~^|1)p/'\,(H"m?H܆AyG@n]Q_2Տd5A4x{%`*`lc´2Of#k>3b $;" r(-Exb}doITH}'>AcG t.no:7`L knU{7,gm;e' )̒9 i{f} ϑ^و/$[Qy{;v.97yY̗&-1.Bh;+jLu.x7BjQ满PcKkؽ%=YBD n *Ngd_ڈ鿾dW{x`M``FѰ8Ew63kBqA_^;Z4ٷ,Q+:Ֆ}}>(-}|%rZLZq)GW;()f(.y_xU`uD^mm%adâW<'*:m?!cf&(3uU4V<wQ( gQ̫_QM08bX7 z{>d!Q2Ow~㶨F=)iSHd$m-if! FEdlX [@X̻k~jEY:D 5>ʹrdfGof,ҏ"W##v215VbuZ6ns҈bIPLVq z2E{Sb%ҽ5iq"|˶+v>S@`8G% 8vFšw``u N˅؍芰z~L\HjiԐ\-% ?2aN[wߏWr:j?$.Dsp"8 1).lN!(Ew8fTl 4)P|ɵՄ? Gy$1$%s%.*s$md5cryptMD5Padstack overflow in function %sGMTmnabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789 :+-._Local time zone must be set--see zic manual page/usr/share/zoneinfotzload/etc/localtimeposixrules,M4.1.0,M10.5.0TZSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec%.3s %.3s%3d %2.2d:%2.2d:%2.2d %-4s %.3s %.3s%3d %2.2d:%2.2d:%2.2d %s asctime3clntudp_create: out of memory clntudp_callgethostby*.getanswer: asked for "%s", got "%s"explore_numeric# _gethtentipnodes.bynameres_querydomainNres_query%.*s.%.*sres_querydomainHOSTALIASES__hostalias __res_nameinquery__res_queriesmatch__res_send  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~/&/etc/resolv.conf;#lookupsearchnameserversortlist_res_initRES_OPTIONSenvLOCALDOMAINndots:insecure1insecure2edns001234567890123456789abcdef0123456789ABCDEFinet_pton6  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~(,48@7DPTtx     ,0 DL`h|`X0`(,@Hltx !"4<XH`hdef# @,INCHAOSHSHESIODANYname serverMDmail destination (deprecated)MFmail forwarder (deprecated)CNAMEcanonical nameSOAstart of authorityMBmailboxMGmail group memberMRmail renameNULLnullWKSwell-known service (deprecated)PTRdomain name pointerHINFOhost informationMINFOmailbox informationMXmail exchangerTXTRPresponsible personAFSDBDCE or AFS serverX25X25 addressISDNISDN addressrouterNSAPnsap addressNSAP_PTRsignaturePXmapping informationGPOSgeographical position (withdrawn)AAAALOClocationNXTnext valid name (unimplemented)EIDendpoint identifier (unimplemented)NIMLOCNIMROD locator (unimplemented)SRVserver selectionATMAATM address (unimplemented)IXFRincremental zone transferAXFRMAILBmailbox-related data (deprecated)MAILAmail agent (deprecated)UINFOuser information (nonstandard)UIDuser ID (nonstandard)GIDgroup ID (nonstandard)NAPTRURN Naming Authority"any"/etc/services,/$h"A"too smallsyslog_r: unknown facility/priority: %xvsyslog_r<%d>Error %d[%ld]%h %e %T syslog: unknown facility/priority: %xconnectlog_r/dev/log (0<DP\`dhlptxJanFebMarAprMayJunJulAugSepOctNovDecJanuaryFebruaryMarchAprilJuneJulyAugustSeptemberOctoberNovemberDecemberSunMonTueWedThuFriSatSundayMondayTuesdayWednesdayThursdayFridaySaturday%H:%M:%S%m/%d/%y%a %b %e %T %YAMPM%a %b %e %H:%M:%S %Z %Y_fmt%Y-%m-%d%H:%M%2d%03d%I:%M:%S %p%e-%b-%Y%04d_conv-0vsnprintfyp_match: clnt_callyp_next: clnt_call/var/run/ypbind.lock_yp_dobindclntudp_createfcntl: F_SETFDYP server for domain %s not responding, still trying clnttcp_create%s/%s.%d/var/yp/binding"("D"`"t""""""#4#X#t#####$$8$T$p$$$$$; errno = %s; s1 = %u, s2 = %u; why = (unknown authentication error - %d); low version = %u, high version = %uRPC: SuccessRPC: Can't encode argumentsRPC: Can't decode resultRPC: Unable to sendRPC: Unable to receiveRPC: Timed outRPC: Incompatible versions of RPCRPC: Authentication errorRPC: Program unavailableRPC: Program/version mismatchRPC: Procedure unavailableRPC: Server can't decode argumentsRPC: Remote system errorRPC: Unknown hostRPC: Port mapper failureRPC: Program not registeredRPC: Failed (unspecified error)RPC: Unknown protocolRPC: (unknown error code)%s: %s - %s Authentication OKInvalid client credentialServer rejected credentialInvalid client verifierServer rejected verifierClient credential too weakInvalid server verifierFailed (unspecified error)clnttcp_create: out of memory bindresvport_saxdrrec_create: out of memory perrorlibcUnknown error: Unknown signal: _catopen/usr/share/nls/%L/%N.cat:/usr/share/nls/%N/%LLANGNLSPATH0'D'\'x''''''' ( (<(P(\(t((((((((),)L)\)l)))))))*4*T*t******+,+L+|+++++,$,@,\,x,,,,,-$-8-H-\-p------- . .8.T.h......//,/@/l///Undefined error: 0Operation not permittedNo such file or directoryNo such processInterrupted system callInput/output errorDevice not configuredArgument list too longExec format errorBad file descriptorNo child processesResource deadlock avoidedPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkOperation not supported by deviceNot a directoryIs a directoryInvalid argumentToo many open files in systemToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksNumerical argument out of domainResult too largeResource temporarily unavailableOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not availableProtocol not supportedSocket type not supportedOperation not supportedProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceOperation timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downNo route to hostDirectory not emptyToo many processesToo many usersDisk quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticatorIPsec processing failureAttribute not foundIllegal byte sequenceNo medium foundWrong medium typeValue too large to be stored in data typeOperation canceledIdentifier removedNo message of desired type (4<P`lx(4DXp xdr_bytes: out of memory xdr_string: out of memory snprintf__sbprintfbug in vfprintf: bad baseInfNaN__find_argumentsexponent?$@Y@@@@j@.AcAחAeA _BvH7BmB@0BļB4&k C7yAC؅W4vCNgmC=`XC@xDPKDMD7yACnF?O8M20HwZ~???>ccpp `8 ǃx8 089 pp<cc8` a`p ǃ0 009 0`<cg8` q`` FLJ0 009 8|cf0`8  p089 `f?0?  ?8 `f0   8 `f 1   8 `f 1`İ   08 8 `8 q`8  088 0` `qxp ap8p  008 pp ~??>?~?> 0 4f xǎv|w0xxD\1``bˌ  .&Ș|`` 00( r @ t `"b`11F0 ~sLJ;??~~c   @@? `mF8|x`a1C  mv<88J|LJϜm~|8Z cc `Ș F@F R#cHX $|B b#c0`Ș ,FF gό9>|a`G8p 9>Xa@@@x@gg"" e j    ky ( JKYdu f    bv z!w" (F2R r u'g <<p%[)]*())* * ){{}}{}(())()[[]][]#$G>> P30123456789=:f/?/*?*n+n,N-N.m'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !+ Hh VqQ:q:QZZ    l h b  w  i x X      0  $  k  j  is a directory is not a regular file (use -f to see it)ab@p4TBtcȽdA<XepfؾF gDdhĿHAi4TljJ!lHL m8HXn"d|pHhPqr"$Hls!S!u"0LVw"dx(`XA 4yTlz"x~!?`#,.AL\  (press RETURN)... (interrupt to abort)tȳ382@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. $NetBSD: mount_nfs.c,v 1.12.4.1 1996/05/25 22:48:05 fvdl Exp $ $OpenBSD: getmntopts.c,v 1.10 2006/09/30 17:48:22 ray Exp $Ȏмظ11"t €u6Uu|agPtPS[X!Using drive X, partition YMBR on floppy or old BIOS Read error No O/S No active partition OxUԻLPdx8y|{ $,P,tlz'0LtD0(8l0t4&| |f@ԻܱABSCLD(E8FHGXU`V`a`b`cleTafthiLlnqqrsvwxu@(#) Copyright (c) 1980, 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: umount.c,v 1.19 2007/09/02 15:19:25 deraadt Exp $$OpenBSD: mount_msdos.c,v 1.22 2007/03/20 03:45:54 tedu Exp $$OpenBSD: getmntopts.c,v 1.10 2006/09/30 17:48:22 ray Exp $ @(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mknod.c,v 1.16 2007/12/30 13:52:40 sobrado Exp $K$,0` 8 @ @ @ HTX4<\$dl tЅ !|"#$%&'()*+,-.,r 4Pt ,Ll pksentrttvarrttssthreshsendpiperecvpipeexpirehopcountmtuUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CLONING XRESOLVE LLINFO STATIC BLACKHOLEPROTO3PROTO2PROTO1CLONEDSOURCEMPATHJUMBOUPBROADCASTDEBUGLOOPBACKPTPNOTRAILERSRUNNINGNOARP PPROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD LABEL`OXXX (%$E,r8dKtdjldWl5d&d%tdT<Xd%|dVdZdBdXc\d4Ud$WdZd8AdEUdHd$Wd<dVdX&dd@d/d$?d@d<Իdtd0d>XdpX d&8dO0dV<dRDd/Ld/Nd,GTd$\dcddVldQtdh|d(c,d&d>dXSd0gHd,7d&dbdd(d%d<d,#dUdNdd>ЎdtSDNOOP @(#) Copyright (c) 1980, 1986, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: reboot.c,v 1.29 2007/05/11 01:53:07 tedu Exp $@(#) Copyright (c) 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount_ffs.c,v 1.19 2006/08/11 11:47:39 pedro Exp $$OpenBSD: getmntopts.c,v 1.10 2006/09/30 17:48:22 ray Exp $7( 0(EHC P E(  0(EHDHC ;Zx0N$OpenBSD: buf.c,v 1.18 2008/02/12 07:57:29 otto Exp $ ]$OpenBSD: cbc.c,v 1.14 2006/04/25 15:41:07 deraadt Exp $@ $OpenBSD: glbl.c,v 1.11 2007/09/03 14:26:54 deraadt Exp $$OpenBSD: io.c,v 1.12 2007/11/06 10:22:29 chl Exp $b$OpenBSD: main.c,v 1.30 2006/04/25 15:41:07 deraadt Exp $XcH$OpenBSD: re.c,v 1.10 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: sub.c,v 1.10 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: undo.c,v 1.9 2007/09/02 15:19:07 deraadt Exp $,r$OpenBSD: utils.c,v 1.29 2007/09/22 21:10:49 sobrado Exp $?@[\\]^^_(_4`D{P{d|t}}~FFFGH?,r $,4<DLPT\dlt<L\,r,r,r,r,r,r,r8,r,r,r,r,r<,r,r  ./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz:./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz@0123456789abcdef ll8~%$X%$%$X%$( 4%$X%$<xDėH 8BEHE`EFE$JI(J0J8JJ K N|NO PlP|PPNNTOO PlP|PPN<U\VVtW XXDYY[ 0000000000000000$}567CV$NetBSD: ffs.S,v 1.5 2003/04/05 23:08:52 bjh21 Exp $$NetBSD: memcmp.S,v 1.2 2003/04/05 23:08:52 bjh21 Exp $.shstrtab.init.text.fini.rodata.data.eh_frame.gotpad0.got.ctors.dtors.gotpad1.bss.stack.arm.atpcs.note.openbsd.ident PP$tt#$$%>%88CHH JTTQ\\Z\\T_\f\q44~\m#!/bin/sh - PATH=/sbin:/usr/sbin:/bin:/usr/bin T=$0 [ "$eo" ] || eo= hex() { case $1 in [0-9]) echo -n $1;; 10) echo -n a;; 11) echo -n b;; 12) echo -n c;; 13) echo -n d;; 14) echo -n e;; 15) echo -n f;; esac } alph2d() { local t="$1" local p="0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ" local sub=${p%${t}*} echo ${#sub} } h2d() { local s="$1" local f=${s%*[0-9a-f]} n=${s#[0-9a-f]*} echo $(($(_h2d $f)*16+ $(_h2d $n) )) } _h2d() { case $1 in [0-9]) echo -n $1;; a) echo -n 10;; b) echo -n 11;; c) echo -n 12;; d) echo -n 13;; e) echo -n 14;; f) echo -n 15;; esac } unt() { arg="$1" tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" while [ "$tmp" != "$arg" ] do arg=$tmp tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" done echo $arg } dodisk() { [ "$DEBUG" ] && set -x n=$(($((${5}*${7:-16}))+${6})) count=0 [ 0$7 -ne 8 ] && l="i j k l m n o p" for d in a b c d e f g h $l do M $1$2$d b $3 $(($n+$count)) 640 operator M r$1$2$d c $4 $(($n+$count)) 640 operator let count=count+1 done } dodisk2() { n=$(($(($5*${7:-16}))+$6)) M $1$2a b $3 $n 640 operator M r$1$2a c $4 $n 640 operator n=$(($n+2)) M $1$2c b $3 $n 640 operator M r$1$2c c $4 $n 640 operator } RMlist[0]="rm -f" mkl() { mklist[${#mklist[*]}]=";mknod -m $1 $2 $3 $4 $5" } M() { RMlist[${#RMlist[*]}]=$1 mkl ${5-666} $1 $2 $3 $4 G=${6:-wheel} [ "$7" ] && { MKlist[${#MKlist[*]}]=";chown $7:$G $1" } || { case $G in wheel) [ ${#whlist[*]} = 0 ] && whlist[0]=";chgrp wheel" whlist[${#whlist[*]}]="$1" ;; operator) [ ${#oplist[*]} = 0 ] && oplist[0]=";chgrp operator" oplist[${#oplist[*]}]="$1" ;; *) MKlist[${#MKlist[*]}]=";chgrp $G $1"; esac } return 0 } R() { [ "$DEBUG" ] && set -x for i in "$@" do U=`unt $i` [ "$U" ] || U=0 case $i in ramdisk) R std bpf0 wd0 wd1 sd0 tty00 rd0 wsmouse R st0 ttyC0 random wskbd0 apm ;; std) M console c 0 0 600 M tty c 1 0 M mem c 2 0 640 kmem M kmem c 2 1 640 kmem M null c 2 2 M zero c 2 12 M stdin c 7 0 M stdout c 7 1 M stderr c 7 2 M ksyms c 8 0 640 kmem M drum c 3 0 640 kmem M klog c 6 0 600 ;; xfs*) M xfs$U c 51 $U 600 ;; tuner*) M tuner$U c 75 $(($(($U*2))+16)) 644 ;; systrace) M systrace c 50 0 644 ;; ss*) M ss$U c 29 $(($U*16)) 640 operator M nss$U c 29 $(($(($U*16))+1)) 640 operator M enss$U c 29 $(($(($U*16))+3)) 640 operator RMlist[${#RMlist[*]}]="scan$U" MKlist[${#MKlist[*]}]=";umask 77;ln -s ss$U scan$U" ;; uk*) M uk$U c 28 $U 640 operator ;; tun*) M tun$U c 33 $U 600 ;; *random) n=0 for pre in " " s u p a do M ${pre}random c 40 $n 644 n=$(($n+1)) done ;; radio*) M radio$U c 97 $U MKlist[${#MKlist[*]}]=";[ -e radio ] || ln -s radio$U radio" ;; pf*) M pf c 46 0 600 ;; lkm) M lkm c 35 0 640 _lkm ;; fd) RMlist[${#RMlist[*]}]=";mkdir -p fd;rm -f" n=0 while [ $n -lt 64 ];do M fd/$n c 7 $n;n=$(($n+1));done MKlist[${#MKlist[*]}]=";chmod 555 fd" ;; crypto) M crypto c 47 0 ;; bpf*) M bpf$U c 22 $U 600 ;; bktr*) M bktr$U c 75 $U 644 ;; bio) M bio c 52 0 600 ;; hotplug) M hotplug c 37 $U 400 ;; audio*) M sound$U c 36 $U M mixer$U c 36 $(($U+16)) M audio$U c 36 $(($U+128)) M audioctl$U c 36 $(($U+192)) MKlist[${#MKlist[*]}]=";[ -e audio ] || ln -s audio$U audio" MKlist[${#MKlist[*]}]=";[ -e mixer ] || ln -s mixer$U mixer" MKlist[${#MKlist[*]}]=";[ -e sound ] || ln -s sound$U sound" MKlist[${#MKlist[*]}]=";[ -e audioctl ] || ln -s audioctl$U audioctl" ;; apm*) M apm c 34 0 644 M apmctl c 34 8 644 ;; uscanner*) M uscanner$U c 69 $U 660 ;; usb*) [ "$i" = "usb" ] && u= || u=$U M usb$u c 64 $U 660 ;; urio*) M urio$U c 67 $U 660 ;; ulpt*) M ulpt$U c 66 $U 660 ;; uhid*) M uhid$U c 65 $U 660 ;; ugen*) n=$(($U*16)) for j in 0{0,1,2,3,4,5,6,7,8,9} 1{0,1,2,3,4,5} do M ugen$U.$j c 70 $(($n+10#$j)) 660 done ;; ttyU[0-9a-zA-Z]) U=${i#ttyU*} o=$(alph2d $U) M ttyU$U c 68 $o 660 dialer uucp M cuaU$U c 68 $(($o+128)) 660 dialer uucp ;; uall) R ttyU0 ttyU1 ttyU2 ttyU3 ugen0 ugen1 ulpt0 ulpt1 uhid0 uhid1 R uhid2 uhid3 uscanner0 urio0 usb0 usb1 usb2 usb3 usb4 usb5 ;; wsmux|wsmouse|wskbd) M wsmouse c 63 0 600 M wskbd c 63 1 600 ;; wsmouse*) M wsmouse$U c 62 $U 600 ;; wskbd*) M wskbd$U c 61 $U 600 ;; tty[C-J]*) U=${i##tty[C-J]} case $i in ttyC*) n=C m=0;; ttyD*) n=D m=256;; ttyE*) n=E m=512;; ttyF*) n=F m=768;; ttyG*) n=G m=1024;; ttyH*) n=H m=1280;; ttyI*) n=I m=1536;; ttyJ*) n=J m=1792;; esac case $U in [0-9a-f]) M tty$n$U c 60 $((16#$U+$m)) 600;; cfg) M tty${n}cfg c 60 $((255+$m)) 600;; *) echo bad unit $U for $i; exit 1;; esac ;; wscons) R wsmouse0 wsmouse1 wsmouse2 wsmouse3 wskbd0 wskbd1 wskbd2 R wskbd3 wsmux ttyCcfg ttyC0 ttyC1 ttyC2 ttyC3 ttyC4 ttyC5 R ttyC6 ttyC7 ttyC8 ttyC9 ttyCa ttyCb ;; pty*) if [ $U -gt 15 ]; then echo bad unit for pty in: $i continue fi set -A letters p q r s t u v w x y z P Q R S T set -A suffixes 0 1 2 3 4 5 6 7 8 9 a b c d e f g h i j k l m n o p q \ r s t u v w x y z A B C D E F G H I J K L M N O P Q R S T U V W X \ Y Z name=${letters[$U]} n=0 while [ $n -lt 62 ] do nam=$name${suffixes[$n]} off=$(($U*62)) M tty$nam c 4 $(($off+$n)) M pty$nam c 5 $(($off+$n)) n=$(($n+1)) done ;; ptm) M ptm c 98 0 666 ;; tty[0-7][0-9a-f]) U=${i#tty*} o=$(h2d $U) M tty$U c 12 $o 660 dialer uucp M cua$U c 12 $(($o+128)) 660 dialer uucp ;; st*) n=$(($U*16)) for pre in " " n e en do M ${pre}st$U b 25 $n 660 operator M ${pre}rst$U c 25 $n 660 operator n=$(($n+1)) done ;; vnd*) dodisk vnd $U 19 19 $U 0 dodisk svnd $U 19 19 $U 2048 ;; rd*) dodisk2 rd $U 18 18 $U 0 ;; ch*) M ch$U c 27 $U 660 operator ;; cd*) dodisk2 cd $U 26 26 $U 0 ;; local) test -s $T.local && sh $T.local ;; all) R ccd0 ccd1 ccd2 ccd3 vnd0 vnd1 vnd2 vnd3 sd0 sd1 sd2 sd3 sd4 R cd0 cd1 rd0 tun0 tun1 tun2 tun3 bpf0 bpf1 bpf2 bpf3 bpf4 R bpf5 bpf6 bpf7 bpf8 bpf9 pty0 bio xfs0 ss0 ss1 ch0 hotplug R ptm local wscons uall tuner0 radio0 audio0 uk0 random lkm R tty00 tty01 tty02 tty03 apm crypto pf systrace wd0 wd1 wd2 R wd3 raid0 raid1 raid2 raid3 std st0 st1 fd ;; wd*|sd*|raid*|ccd*) case $i in wd*) dodisk wd $U 16 16 $U 0;; sd*) dodisk sd $U 24 24 $U 0;; raid*) dodisk raid $U 71 71 $U 0;; ccd*) dodisk ccd $U 21 21 $U 0;; esac ;; *) echo $i: unknown device ;; esac done } R "$@" { echo -n ${RMlist[*]} echo -n ${mklist[*]} echo -n ${MKlist[*]} echo -n ${whlist[*]} echo ${oplist[*]} } | if [ "$eo" = "echo" ]; then cat else sh fi ip 0 IP icmp 1 ICMP tcp 6 TCP udp 17 UDP ftp-data 20/tcp ftp 21/tcp domain 53/tcp nameserver domain 53/udp nameserver www 80/tcp http shell 514/tcp cmd nfsd 2049/udp nfs nfsd 2049/tcp nfs rwd1iGwd1j=Grwd1jGwd1k=Grwd1kGwd1l=Grwd1lGwd1m=Grwd1mGwd1n=Grwd1nGwd1o=Grwd1oGwd1p=Grwd1pGsd0a=Grsd0aGsd0b=Grsd0bGsd0c=Grsd0cGsd0d=Grsd0dGsd0e=Grsd0eGsd0f=Grsd0fGsd0g=Grsd0gGsd0h=Grsd0hGsd0i=GƠ . ..MAKEDEVconsole tty memkmem=GƬnull=Gƭzero=GƮstdinGƯstdoutưstderrƱksymsGƲdrum=GƳklog=Gƴbpf0=GƵwd0a=Gƶrwd0aGƷwd0b=GƸrwd0bGƹwd0c=Gƺrwd0cGƻwd0d=GƼrwd0dGƽwd0e=Gƾrwd0eGƿwd0f=Grwd0fGwd0g=Grwd0gGwd0h=Grwd0hGwd0i=Grwd0iGwd0j=Grwd0jGwd0k=Grwd0kGwd0l=Grwd0lGwd0m=Grwd0mGwd0n=Grwd0nGwd0o=Grwd0oGwd0p=Grwd0pGwd1a=Grwd1aGwd1b=Grwd1bGwd1c=Grwd1cGwd1d=Grwd1dGwd1e=Grwd1eGwd1f=Grwd1fGwd1g=Grwd1gGwd1h=Grwd1hGwd1i=Grwd1iGwd1j=Grwd1jGwd1k=Grwd1kGwd1l=Grwd1lGwd1m=Grwd1mGwd1n=Grwd1nGwd1o=Grwd1oGwd1p=Grwd1pGsd0a=Grsd0aGsd0b=Grsd0bGsd0c=Grsd0cGsd0d=Grsd0dGsd0e=Grsd0eGsd0f=Grsd0fGsd0g=Grsd0gGsd0h=Grsd0hGsd0i=Grsd0iGsd0j=Grsd0jG sd0k=G rsd0kG sd0l=G rsd0lG sd0m=Grsd0mGsd0n=Grsd0nGsd0o=Grsd0oGsd0p=Grsd0pGtty00Gcua00Grd0a=Grrd0aGrd0c=Grrd0cGwsmousewskbdG st0rst0=Gnst0=G nrst0G!est0=G"erst0G#enst0G$enrst0%ttyC0G&random'srandom(urandom)prandom*arandom+wskbd0, apm-apmctl . ..chown2dhclient7 disklabel7dmesg2fdisk2fsck2 fsck_ext2fsfsck_ffs7ifconfig7init2mknod2mount2 mount_cd9660+ mount_ext2fs+ mount_ffs7 mount_msdos mount_nfs7newfs2 newfs_msdosping2ping62reboothalt2route2rtsol2$umount.dhclient-scripta  {n}of!NI u p + & P  P _relayd*YYRelay Daemon/var/empty/sbin/nologin2&_afs*QQafs Daemon/var/empty/sbin/nologin2_syslogd*IISyslog Daemon/var/empty/sbin/nologin2_kdc*;;Kerberos Server/var/empty/sbin/nologin2popa3d*POP3 Server/var/empty/sbin/nologin2_ospfd*UUOSPF Daemon/var/empty/sbin/nologin3U_dhcp*MMDHCP programs/var/empty/sbin/nologin3M_identd*identd/var/empty/sbin/nologin3_ppp*RRPPP utilities/var/empty/sbin/nologin1_ppp_mopd*NNMOP Daemon/var/empty/sbin/nologin1_mopd_rusersd* rpc.rusersd/var/empty/sbin/nologin1_rusersd_identd*identd/var/empty/sbin/nologin1_identdpopa3d*POP3 Server/var/empty/sbin/nologin1popa3dLDoj 9 4 S N  _ospf6d*ZZOSPF6 Daemon/var/empty/sbin/nologin2'_ppp*RRPPP utilities/var/empty/sbin/nologin2_pflogd*JJpflogd privsep/var/empty/sbin/nologin2_kadmin*<<Kerberos Admin Server/var/empty/sbin/nologin2sshd*sshd privsep/var/empty/sbin/nologin2nobody*Unprivileged user/nonexistent/sbin/nologin3_hostapd*VVHostAP Daemon/var/empty/sbin/nologin3V_mopd*NNMOP Daemon/var/empty/sbin/nologin3Nnamed*FFBIND Name Service Daemon/var/named/sbin/nologin3F_spamd*>>Spam Daemon/var/empty/sbin/nologin3>_rstatd*rpc.rstatd/var/empty/sbin/nologin3_relayd*YYRelay Daemon/var/empty/sbin/nologin1_relayd_isakmpd*DDisakmpd privsep/var/empty/sbin/nologin1_isakmpdsmmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin1smmsp&fa#A< r j %  G B o j ) $ J _snmpd*[[SNMP Daemon/var/empty/sbin/nologin2(_ntp*SSNTP Daemon/var/empty/sbin/nologin2 _bgpd*KKBGP Daemon/var/empty/sbin/nologin2_spamd*>>Spam Daemon/var/empty/sbin/nologin2_portmap*portmap/var/empty/sbin/nologin2_dvmrpd*WWDVMRP Daemon/var/empty/sbin/nologin3W_tftpd*OOTFTP Daemon/var/empty/sbin/nologin3Oproxy*GGProxy Services/nonexistent/sbin/nologin3G_snmpd*[[SNMP Daemon/var/empty/sbin/nologin1_snmpd_ospf6d*ZZOSPF6 Daemon/var/empty/sbin/nologin1_ospf6d_ftp*TTFTP Daemon/var/empty/sbin/nologin1_ftp_ntp*SSNTP Daemon/var/empty/sbin/nologin1_ntp_afs*QQafs Daemon/var/empty/sbin/nologin1_afs_rbootd*PPrbootd Daemon/var/empty/sbin/nologin1_rbootd_tftpd*OOTFTP Daemon/var/empty/sbin/nologin1_tftpd_kdc*;;Kerberos Server/var/empty/sbin/nologin1_kdc_x11*##X Server/var/empty/sbin/nologin1_x11_rstatd*rpc.rstatd/var/empty/sbin/nologin1_rstatdbin*Binaries Commands and Source,,,//sbin/nologin1binoi"ID y t 5 0 @ ; nobody*Unprivileged user/nonexistent/sbin/nologin2)_ftp*TTFTP Daemon/var/empty/sbin/nologin2!_tcpdump*LLtcpdump privsep/var/empty/sbin/nologin2uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2_identd*identd/var/empty/sbin/nologin2 rootdaemonCharlie &/root/bin/ksh2_ripd*XXRIP Daemon/var/empty/sbin/nologin3X_rbootd*PPrbootd Daemon/var/empty/sbin/nologin3P_rusersd* rpc.rusersd/var/empty/sbin/nologin3 rootdaemonCharlie &/root/bin/ksh3_hostapd*VVHostAP Daemon/var/empty/sbin/nologin1_hostapdproxy*GGProxy Services/nonexistent/sbin/nologin1proxy_portmap*portmap/var/empty/sbin/nologin1_portmapsshd*sshd privsep/var/empty/sbin/nologin1sshd[T vq ~ > 9 c ^  M _ospfd*UUOSPF Daemon/var/empty/sbin/nologin2"_dhcp*MMDHCP programs/var/empty/sbin/nologin2www*CCHTTP Server/var/www/sbin/nologin2_rstatd*rpc.rstatd/var/empty/sbin/nologin2 daemon*The devil himself/root/sbin/nologin2_relayd*YYRelay Daemon/var/empty/sbin/nologin3Y_afs*QQafs Daemon/var/empty/sbin/nologin3Q_syslogd*IISyslog Daemon/var/empty/sbin/nologin3I_fingerd*!!fingerd/var/empty/sbin/nologin3!smmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin3daemon*The devil himself/root/sbin/nologin3nobody*Unprivileged user/nonexistent/sbin/nologin1nobody_ospfd*UUOSPF Daemon/var/empty/sbin/nologin1_ospfd_pflogd*JJpflogd privsep/var/empty/sbin/nologin1_pflogd_kadmin*<<Kerberos Admin Server/var/empty/sbin/nologin1_kadmin&vm,%KB f a   p k ( # N I n  n _hostapd*VVHostAP Daemon/var/empty/sbin/nologin2#_mopd*NNMOP Daemon/var/empty/sbin/nologin2_isakmpd*DDisakmpd privsep/var/empty/sbin/nologin2_rusersd* rpc.rusersd/var/empty/sbin/nologin2 operator*System &/operator/sbin/nologin2_ospf6d*ZZOSPF6 Daemon/var/empty/sbin/nologin3Z_ppp*RRPPP utilities/var/empty/sbin/nologin3R_pflogd*JJpflogd privsep/var/empty/sbin/nologin3Juucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Bpopa3d*POP3 Server/var/empty/sbin/nologin3operator*System &/operator/sbin/nologin3_dvmrpd*WWDVMRP Daemon/var/empty/sbin/nologin1_dvmrpd_tcpdump*LLtcpdump privsep/var/empty/sbin/nologin1_tcpdump_bgpd*KKBGP Daemon/var/empty/sbin/nologin1_bgpd_syslogd*IISyslog Daemon/var/empty/sbin/nologin1_syslogd_spamd*>>Spam Daemon/var/empty/sbin/nologin1_spamdoperator*System &/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonrootdaemonCharlie &/root/bin/ksh1root \Vpk-( Z U   } x 7 2 Q Q _dvmrpd*WWDVMRP Daemon/var/empty/sbin/nologin2$_tftpd*OOTFTP Daemon/var/empty/sbin/nologin2named*FFBIND Name Service Daemon/var/named/sbin/nologin2_fingerd*!!fingerd/var/empty/sbin/nologin2 bin*Binaries Commands and Source,,,//sbin/nologin2_snmpd*[[SNMP Daemon/var/empty/sbin/nologin3[_ntp*SSNTP Daemon/var/empty/sbin/nologin3S_bgpd*KKBGP Daemon/var/empty/sbin/nologin3Kwww*CCHTTP Server/var/www/sbin/nologin3C_kdc*;;Kerberos Server/var/empty/sbin/nologin3;_x11*##X Server/var/empty/sbin/nologin3#sshd*sshd privsep/var/empty/sbin/nologin3bin*Binaries Commands and Source,,,//sbin/nologin3named*FFBIND Name Service Daemon/var/named/sbin/nologin1namedwww*CCHTTP Server/var/www/sbin/nologin1wwwuucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucplf% >9 J E   p k * * _ripd*XXRIP Daemon/var/empty/sbin/nologin2%_rbootd*PPrbootd Daemon/var/empty/sbin/nologin2proxy*GGProxy Services/nonexistent/sbin/nologin2_x11*##X Server/var/empty/sbin/nologin2 smmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin2_ftp*TTFTP Daemon/var/empty/sbin/nologin3T_tcpdump*LLtcpdump privsep/var/empty/sbin/nologin3L_isakmpd*DDisakmpd privsep/var/empty/sbin/nologin3D_kadmin*<<Kerberos Admin Server/var/empty/sbin/nologin3<_portmap*portmap/var/empty/sbin/nologin3_ripd*XXRIP Daemon/var/empty/sbin/nologin1_ripd_dhcp*MMDHCP programs/var/empty/sbin/nologin1_dhcp_fingerd*!!fingerd/var/empty/sbin/nologin1_fingerd#!/bin/sh delete_old_address() { if [ -n "$old_ip_address" ]; then ifconfig $interface inet $old_ip_address delete $medium route delete "$old_ip_address" 127.0.0.1 >/dev/null 2>&1 fi } add_new_address() { ifconfig $interface \ inet $new_ip_address \ netmask $new_subnet_mask \ broadcast $new_broadcast_address \ $medium route add $new_ip_address 127.0.0.1 >/dev/null 2>&1 } delete_old_alias() { if [ -n "$alias_ip_address" ]; then ifconfig $interface inet $alias_ip_address delete > /dev/null 2>&1 route delete $alias_ip_address 127.0.0.1 > /dev/null 2>&1 fi } add_new_alias() { if [ -n "$alias_ip_address" ]; then ifconfig $interface inet $alias_ip_address alias netmask \ $alias_subnet_mask route add $alias_ip_address 127.0.0.1 fi } delete_old_routes() { route delete default >/dev/null 2>&1 if [ -n "$old_static_routes" ]; then set $old_static_routes while [ $# -gt 1 ]; do route delete "$1" "$2" shift; shift done fi arp -dan } add_new_routes() { route delete default >/dev/null 2>&1 for router in $new_routers; do if [ "$new_ip_address" = "$router" ]; then route add default -iface $router >/dev/null 2>&1 else route add default $router >/dev/null 2>&1 fi break done if [ -n "$new_static_routes" ]; then set $new_static_routes while [ $# -gt 1 ]; do route add $1 $2 shift; shift done fi } add_new_resolv_conf() { rm -f /etc/resolv.conf.std if [ -n "$new_domain_name" ]; then echo "search $new_domain_name" >>/etc/resolv.conf.std fi if [ -n "$new_domain_name_servers" ]; then for nameserver in $new_domain_name_servers; do echo "nameserver $nameserver" >>/etc/resolv.conf.std done fi if [ -f /etc/resolv.conf.std ]; then if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >>/etc/resolv.conf.std fi if [ -f /etc/resolv.conf ]; then cat /etc/resolv.conf > /etc/resolv.conf.save fi cat /etc/resolv.conf.std > /etc/resolv.conf rm -f /etc/resolv.conf.std chown -RL root:wheel /etc/resolv.conf chmod -RL 644 /etc/resolv.conf return 0 fi return 1 } case $reason in MEDIUM) ifconfig $interface $medium sleep 1 ;; PREINIT) delete_old_alias ifconfig $interface up ;; ARPCHECK|ARPSEND) ;; BOUND|RENEW|REBIND|REBOOT) if [ -n "$old_ip_address" ]; then if [ "$old_ip_address" != "$alias_ip_address" ]; then delete_old_alias fi if [ "$old_ip_address" != "$new_ip_address" ]; then delete_old_address delete_old_routes fi fi if [ "$reason" = BOUND ] || [ "$reason" = REBOOT ] || [ -z "$old_ip_address" ] || [ "$old_ip_address" != "$new_ip_address" ]; then add_new_address add_new_routes fi if [ "$new_ip_address" != "$alias_ip_address" ]; then add_new_alias fi add_new_resolv_conf ;; EXPIRE|FAIL) delete_old_alias if [ -n "$old_ip_address" ]; then delete_old_address delete_old_routes fi add_new_alias if [ -f /etc/resolv.conf.save ]; then cat /etc/resolv.conf.save > /etc/resolv.conf fi ;; TIMEOUT) delete_old_alias add_new_address sleep 1 if [ -n "$new_routers" ]; then set "$new_routers" if ping -q -c 1 -w 1 "$1"; then if [ "$new_ip_address" != "$alias_ip_address" ]; then add_new_alias fi add_new_routes if add_new_resolv_conf; then exit 0 fi fi fi ifconfig $interface inet $new_ip_address delete $medium delete_old_routes exit 1 ;; esac exit 0  . .. catchmod2chgrp2 cp dd df edexpr2hostname7 ksh sh ln lsmkdir2 mteject2 mv pax tarcpio2 rmstty2sync2sleep2 ... ... .B ..ztsscale7 .B ..miscEkeymaps . ..termcapsk(s) to allow the creation of separate filesystems for /, /tmp, /var, /usr, and /home. __EOT fi set -- $DKDEVS [[ $# -gt 1 ]] && _defdsk=done ask_which "disk" "is the root disk" "$DKDEVS" "$_defdsk" [[ $resp == done ]] && exit makedev $resp || exit ROOTDISK=$resp ROOTDEV=${ROOTDISK}a SWAPDEV=${ROOTDISK}b dumb|80-column dumb tty:\ :am:\ :co#80:\ :bl=^G:cr=^M:do=^J:sf=^J: vt100|vt100-am|dec vt100 (w/advanced video):\ :am:bs:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :@8=\EOM:DO=\E[%dB:K1=\EOq:K2=\EOr:K3=\EOs:K4=\EOp:K5=\EOn:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=^O:as=^N:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:do=^J:\ :eA=\E(B\E)0:ho=\E[H:k0=\EOy:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k5=\EOt:k6=\EOu:k7=\EOv:k8=\EOl:k9=\EOw:k;=\EOx:\ :kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:\ :ku=\EOA:le=^H:mb=\E[5m:md=\E[1m:me=\E[m\017:mr=\E[7m:\ :nd=\E[C:rc=\E8:rs=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :..sa=\E[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t\016%e\017%;:\ :sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: vt220|vt200|DEC VT220 in vt100 emulation mode:\ :am:bs:mi:pt:xn:xo:\ :co#80:li#24:vt#3:\ :@7=\E[4~:RA=\E[?7l:SA=\E[?7h:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:ho=\E[H:\ :if=/usr/share/tabset/vt100:im=\E[4h:\ :is=\E[1;24r\E[24;1H:k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:\ :k5=\E[17~:k6=\E[18~:k7=\E[19~:k8=\E[20~:k9=\E[21~:\ :k;=\E[29~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=\177:\ :kd=\E[B:kh=\E[1~:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:nl=^J:rc=\E8:\ :rf=/usr/share/tabset/vt100:\ :rs=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :..sa=\E[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t\E(0%e\E(B%;:\ :sc=\E7:se=\E[27m:sf=20\ED:so=\E[7m:sr=14\EM:ta=^I:\ :ue=\E[24m:up=\E[A:us=\E[4m:ve=\E[?25h:vi=\E[?25l: onf resolv.conf.tail dhclient.* ) cat >/tmp/hosts <<__EOT ::1 localhost 127.0.0.1 localhost ::1 $(hostname -s) 127.0.0.1 $(hostname -s) __EOT ask_yn "Configure the network?" yes [[ $resp == y ]] && donetconfig _oifs=$IFS IFS= while :; do askpass "Password for root account? (will not echo)" _password=$resp askpass "Password for root account? (again)" [[ $resp == $_password ]] && break echo "Passwords do not match, try again." done IFS=$_oifs install_sets while read _dev _mp _fstype _opt _rest; do mount -u -o $_opt $_dev $_mp || exit done /tmp/ttys mv /tmp/ttys /mnt/etc/ttys questions echo -n "Saving configuration files..." ( cd /var/db [ -f dhclient.leases ] && mv dhclient.leases /mnt/var/db/. ) ( cd /tmp hostname >myname _dn=$(get_fqdn) while read _addr _hn _aliases; do if [[ -n $_aliases || $_hn != ${_hn%%.*} || -z $_dn ]]; then echo "$_addr $_hn $_aliases" else echo "$_addr $_hn.$_dn $_hn" fi done hosts.new mv hosts.new hosts save_comments hosts save_comments dhclient.conf for _f in fstab kbdtype my* *.conf *.tail host* ttys; do [[ -f $_f ]] && mv $_f /mnt/etc/. done ) _encr=`/mnt/usr/bin/encrypt -b 8 -- "$_password"` echo "1,s@^root::@root:${_encr}:@ w q" | /mnt/bin/ed /mnt/etc/master.passwd 2>/dev/null /mnt/usr/sbin/pwd_mkdb -p -d /mnt/etc /etc/master.passwd echo -n "done.\nGenerating initial host.random file..." ( cd /mnt/var/db /mnt/bin/dd if=/mnt/dev/urandom of=host.random bs=1024 count=64 >/dev/null 2>&1 chmod 600 host.random >/dev/null 2>&1 ) echo "done." set_timezone finish_up #!/bin/ksh FILESYSTEMS=/tmp/filesystems SWAPLIST=/tmp/swaplist MODE=install . install.sub if [ ! -f /etc/fstab ]; then [ -f /etc/disktab.shadow ] && cp /etc/disktab.shadow /tmp/disktab.shadow DISK= _DKDEVS=$DKDEVS while :; do _DKDEVS=`rmel "$DISK" $_DKDEVS` if isin $ROOTDISK $_DKDEVS; then resp=$ROOTDISK rm -f /tmp/fstab cat /dev/null >$FILESYSTEMS cat /dev/null >$SWAPLIST else ask_which "disk" "do you wish to initialize" "$_DKDEVS" done "No more disks to initialize" [[ $resp == done ]] && break fi DISK=$resp makedev $DISK || continue rm -f /tmp/*.$DISK md_prep_disklabel $DISK unset _partitions _psizes _mount_points _i=0 disklabel $DISK 2>&1 | sed -ne '/^ *[a-p]: /p' >/tmp/disklabel.$DISK while read _dev _size _offset _type _rest; do _pp=${DISK}${_dev%:} _ps=$_size if [[ $_pp == $ROOTDEV ]]; then echo "$ROOTDEV /" >$FILESYSTEMS continue elif [[ $_pp == $SWAPDEV || $_type == swap ]]; then echo "$_pp" >>$SWAPLIST continue elif [[ $_type != *BSD ]]; then continue fi _partitions[$_i]=$_pp _psizes[$_i]=$_ps if [[ -f /tmp/fstab.$DISK ]]; then while read _pp _mp _rest; do [[ $_pp == "/dev/${_partitions[$_i]}" ]] || continue [[ -n $(grep " $_mp\$" $FILESYSTEMS) ]] && break isin $_mp ${_mount_points[*]} && break [[ $_mp == '/' ]] && break _mount_points[$_i]=$_mp done >$FILESYSTEMS : $(( _i += 1 )) done done cat <<__EOT OpenBSD filesystems: $(<$FILESYSTEMS) The next step *DESTROYS* all existing data on these partitions! __EOT ask_yn "Are you really sure that you're ready to proceed?" [[ $resp == n ]] && { echo "Ok, try again later." ; exit ; } _i=0 unset _partitions _mount_points while read _pp _mp; do _OPT= [[ $_mp == / ]] && _OPT=$MDROOTFSOPT newfs -q $_OPT /dev/r$_pp _partitions[$_i]=$_pp _mount_points[$_i]=$_mp : $(( _i += 1 )) done <$FILESYSTEMS for _mp in `bsort ${_mount_points[*]}`; do _i=0 for _pp in ${_partitions[*]}; do if [ "$_mp" = "${_mount_points[$_i]}" ]; then echo -n "/dev/$_pp $_mp ffs rw" if [[ $_mp == / ]]; then echo " 1 1" else echo -n ",nodev" case $_mp in /sbin|/usr) ;; /usr/bin|/usr/sbin) ;; /usr/libexec|/usr/libexec/*) ;; /usr/local|/usr/local/*) ;; /usr/X11R6|/usr/X11R6/bin) ;; *) echo -n ",nosuid" ;; esac echo " 1 2" fi fi : $(( _i += 1 )) done done >>/tmp/fstab while read _dev; do [[ $_dev == $SWAPDEV ]] || \ echo "/dev/$_dev none swap sw 0 0" >>/tmp/fstab done <$SWAPLIST munge_fstab fi mount_fs "-o async" ask_until "\nSystem hostname? (short form, e.g. 'foo')" "$(hostname -s)" [[ ${resp%%.*} != $(hostname -s) ]] && hostname $resp THESETS="$THESETS site$VERSION-$(hostname -s).tgz" ( cd /tmp; rm -f host* my* resolv.c 08`(G<  (G`[~ [~(G`@@<@TU )G`b )GA(GvD(G)%((G)%(-gWA(Ga(Ga(Ga JC(G.ܸ(G.ܸ(G{R P)QA(G(G;)(G;) A(G}Ϯ(GG(GG XA(GH)G6&/)G6&/ xЬ )G^,, )G )G 3ܢH2CwW ]fv$|!X*"}Oן:@[5t HV'/0T b%V~Gmw"oFm]L-Xqޚy^E 9/hĪl.۷2Nتݳ"kB.C:S\68BEG#.Q=Hd; P/tmp/kbdtype ; return ; } ;; esac done } welcome() { local _q cat <<__EOT Welcome to the $OBSD $MODE program. This program will help you $MODE OpenBSD. At any prompt except password prompts you can escape to a shell by typing '!'. Default answers are shown in []'s and are selected by pressing RETURN. At any time you can exit this program by pressing Control-C, but exiting during an $MODE can leave your system in an inconsistent state. __EOT set_term cat <<__EOT IS YOUR DATA BACKED UP? As with anything that modifies disk contents, this program can cause SIGNIFICANT data loss. __EOT case $MODE in upgrade) cat <<__EOT NOTE: once your system has been upgraded, you must manually merge any changes to files in the 'etc' set into the files already on your system. __EOT _q="Proceed with upgrade?" ;; install) cat <<__EOT It is often helpful to have the installation notes handy. For complex disk configurations, relevant disk hardware manuals and a calculator are useful. __EOT if [ -f /etc/fstab ]; then cat <<__EOT You seem to be trying to restart an interrupted installation! You can skip the disk preparation steps and continue, or you can reboot and start over. __EOT _q="Skip disk initialization?" else _q="Proceed with install?" fi ;; esac ask_yn "$_q" if [[ $resp == n ]]; then cat <<__EOT Enter 'halt' at the prompt to gracefully exit OpenBSD. You can then power cycle the machine and boot your original OS. __EOT exit fi echo "Cool! Let's get to it." } stripcom () { local _l [[ -f $1 ]] || return while read _l; do [[ -n ${_l%%#*} ]] && echo $_l done <$1 } scan_dmesg() { bsort $(sed -ne "$1" /var/run/dmesg.boot) } scan_disknames() { local _n _oifs=$IFS IFS="," bsort $(for _n in $(disknames); do echo "$_n "; done | sed -ne "$1") IFS=$_oifs } get_ifdevs() { ifconfig \ | egrep -v '^[[:space:]]|(bridge|enc|gif|gre|lo|pflog|pfsync|ppp|sl|tun|vlan)[[:digit:]]+:' \ | sed -ne 's/^\(.*\):.*/\1/p' } get_drive() { ask_which "$1" "contains the $MODE media" "$2" [[ $resp == done ]] && return 1 makedev $resp || return 1 return 0 } mount_mnt2() { local _dev=$1 _opts _file=/tmp/parts.$1 _parts disklabel $_dev 2>/dev/null | grep '^ [a-p]: ' \ | egrep -v "swap|unused" >$_file _parts=$(sed -e 's/^ \(.\): .*/\1/' $_file) set -- $_parts [[ $# == 0 ]] && { echo "No filesystems found on $_dev" ; return 1 ; } if isin "c" $_parts; then resp=c elif [[ $# == 1 ]]; then resp=$1 else cat /tmp/parts.$_dev ask_which "$_dev partition" "has the $MODE sets" "$_parts" [[ $resp == done ]] && return 1 fi grep -q "^ $resp: .*MSDOS" $_file && _opts="-s" mount -o ro,$_opts /dev/$_dev$resp /mnt2 } askpass() { set -o noglob stty -echo read resp?"$1 " stty echo set +o noglob echo } ask() { local _question=$1 _default=$2 set -o noglob while :; do echo -n "$_question " [[ -z $_default ]] || echo -n "[$_default] " read resp case $resp in !) echo "Type 'exit' to return to install." sh ;; !*) eval ${resp#?} ;; *) : ${resp:=$_default} break ;; esac done set +o noglob } ask_until() { resp= while [[ -z $resp ]] ; do ask "$1" "$2" done } ask_yn() { local _q=$1 _a=${2:-no} _resp typeset -l _resp while :; do ask "$_q" "$_a" _resp=$resp case $_resp in y|yes) resp=y ; return ;; n|no) resp=n ; return ;; esac done } ask_which() { local _name=$1 _query=$2 _list=$3 _def=$4 _err=$5 set -- $_list if (( $# < 1 )); then echo "${_err:=No ${_name}s found}." resp=done return fi : ${_def:=$1} _list="$*" while :; do ask "Available ${_name}s are: $_list.\nWhich one $_query? (or 'done')" "$_def" isin "$resp" $_list done && break echo "'$resp' is not a valid choice." done } isin() { local _a=$1 _b shift for _b; do [[ $_a == $_b ]] && return 0 done return 1 } addel() { local _a=$1 shift echo -n "$*" isin "$_a" $* || echo -n " $_a" } rmel() { local _a=$1 _b shift for _b; do [[ $_a != $_b ]] && echo -n "$_b " done } bsort() { local _l _a=$1 _b [[ $# -gt 0 ]] || return shift for _b; do if [[ $_a != $_b ]] ; then if [[ $_a > $_b ]] ; then _l="$_a $_l"; _a=$_b else _l="$_b $_l" fi fi done echo -n "$_a " bsort $_l } save_comments() { local _file=$1 if [[ -f /mnt/etc/$_file ]]; then grep "^#" /mnt/etc/$_file >/tmp/$_file.new [[ -f /tmp/$_file ]] && cat /tmp/$_file >>/tmp/$_file.new mv /tmp/$_file.new /tmp/$_file fi } edit_tmp_file() { local _file=$1 ask_yn "Edit $_file with $EDITOR?" [[ $resp == y ]] && $EDITOR /tmp/$_file } manual_net_cfg() { ask_yn "Do you want to do any manual network configuration?" [[ $resp == y ]] && { echo "Type 'exit' to return to $MODE." ; sh ; } } ftp_list_files() { ftp ${_ftp_active} -V -n "$1" <<__EOT user "$2" "$3" cd "$4" ls quit __EOT } makedev() { local _dev=$1 if [[ ! -r /dev/MAKEDEV ]] ; then echo "MAKEDEV not found. Can't create device nodes." return 1 fi cd /dev ; sh MAKEDEV $_dev || return 1 ; cd - >/dev/null } addhostent() { local _addr=$1 _name=$2 _delim="." [[ $_addr == *:* ]] && _delim=":" sed "/^[0-9a-fA-F]*[$_delim].* $_name\$/d" /tmp/hosts >/tmp/hosts.new mv /tmp/hosts.new /tmp/hosts echo "$_addr $_name" >>/tmp/hosts } select_sets() { local _avail=$1 _selected=$2 _next _f _action cat <<__EOT Select sets by entering a set name, a file name pattern or 'all'. De-select sets by prepending a '-' to the set name, file name pattern or 'all'. Selected sets are labelled '[X]'. __EOT while :; do _action= _next= echo for _f in $_avail; do if isin $_f $_selected; then echo " [X] $_f" else echo " [ ] $_f" : ${_next:=$_f} fi done : ${_next:=done} ask "Set name? (or 'done')" "$_next" case $resp in done) break ;; -*) _action=rmel ;; esac : ${_action:=addel} resp=${resp#+|-} case $resp in "") continue ;; all) resp=* ;; esac for _f in $_avail; do eval "case $_f in @($resp)) _selected=\`$_action $_f \$_selected\` ;; esac" done done resp=$_selected } configure_ifs() { local _IFDEVS=$IFDEVS _ifs _name _media _hn while :; do ask_which "interface" "do you wish to initialize" "$_IFDEVS" \ "" "No more interfaces to initialize" [[ $resp == done ]] && break _ifs=$resp _hn=/tmp/hostname.$_ifs ask "Symbolic (host) name for $_ifs?" "$(hostname -s)" _name=$resp _media=$(ifconfig -m $_ifs | grep "media ") if [[ -n $_media ]]; then cat <<__EOT The media options for $_ifs are currently $(ifconfig -m $_ifs | sed -n '/supported/D;/media:/p') __EOT ask_yn "Do you want to change the media options?" case $resp in y) cat <<__EOT Supported media options for $_ifs are: $_media __EOT ask "Media options for $_ifs?" _media=$resp ifconfig $_ifs $_media || return 1 ;; n) _media= ;; esac fi rm -f $_hn v4_config "$_ifs" "$_media" "$_name" "$_hn" v6_config "$_ifs" "$_media" "$_name" "$_hn" [[ -f $_hn ]] && _IFDEVS=$(rmel "$_ifs" $_IFDEVS) done } v4_info() { ifconfig $1 inet | sed -n ' 1s/.*/etc/resolv.conf.tail if [[ -n $_hn ]]; then _hn="send host-name \"$_hn\";" echo "Issuing hostname-associated DHCP request for $_ifs." else echo "Issuing free-roaming DHCP request for $_ifs." fi cat >/etc/dhclient.conf <<__EOT initial-interval 1; $_hn request subnet-mask, broadcast-address, routers, domain-name, domain-name-servers, host-name; __EOT ifconfig $_ifs group dhcp >/dev/null 2>&1 dhclient $_ifs set -- $(v4_info $_ifs) if [[ $1 == UP && -n $2 ]]; then mv /etc/dhclient.conf /tmp/dhclient.conf mv /etc/resolv.conf.tail /tmp/resolv.conf.tail return 0 fi ifconfig $_ifs delete down rm /etc/dhclient.conf /etc/resolv.conf.tail return 1 } v4_config() { local _ifs=$1 _media=$2 _name=$3 _hn=$4 _prompt _addr _mask if ifconfig $_ifs | grep 'groups:.* dhcp' >/dev/null 2>&1; then _addr=dhcp else set -- $(v4_info $_ifs) if [[ -n $2 ]]; then _addr=$2; _mask=$3 ifconfig $_ifs inet $_addr delete fi fi [[ -x /sbin/dhclient ]] && _prompt=" or 'dhcp'" _prompt="IPv4 address for $_ifs? (or 'none'$_prompt)" ask_until "$_prompt" "$_addr" case $resp in none) ;; dhcp) if [[ ! -x /sbin/dhclient ]]; then echo "DHCP not possible - no /sbin/dhclient." elif dhcp_request $_ifs "$_name" || dhcp_request $_ifs ; then addhostent "127.0.0.1" "$_name" echo "dhcp NONE NONE NONE $_media" >>$_hn fi ;; *) _addr=$resp ask_until "Netmask?" "${_mask:=255.255.255.0}" ifconfig $_ifs -group dhcp >/dev/null 2>&1 if ifconfig $_ifs inet $_addr netmask $resp up ; then addhostent "$_addr" "$_name" echo "inet $_addr $resp NONE $_media" >$_hn fi ;; esac } v6_config() { local _ifs=$1 _media=$2 _name=$3 _hn=$4 _addr _prefixlen _prompt ifconfig lo0 inet6 >/dev/null 2>&1 || return set -- $(v6_info $_ifs) [[ -n $2 ]] && { _addr=$2; _prefixlen=$3; } [[ -x /sbin/rtsol ]] && _prompt="or 'rtsol' " _prompt="IPv6 address for $_ifs? (${_prompt}or 'none')" ask_until "$_prompt" "${_addr:-none}" case $resp in none) return ;; rtsol) [[ ! -x /sbin/rtsol ]] && { echo "No /sbin/rtsol." ; return ; } ifconfig $_ifs up rtsol -F $_ifs addhostent "::1" "$_name" echo "up\nrtsol $media" >>$_hn return ;; esac _addr=$resp ask_until "IPv6 prefix length for $_ifs?" "${_prefixlen:=64}" ifconfig $_ifs inet6 $_addr prefixlen $resp up || return echo "inet6 $_addr $resp $media" >>$_hn addhostent "$_addr" "$_name" v6_defroute $_ifs [[ $resp == none ]] && return route -n add -inet6 -host default "$resp" || return echo "$resp" >>/tmp/mygate } v4_defroute() { local _dr _prompt=" or 'none'" [[ -x /sbin/dhclient ]] && _prompt=", 'dhcp'$_prompt" _prompt="Default IPv4 route? (IPv4 address$_prompt)" _dr=$(route -n show -inet | sed -ne '/^default */{s///; s/ .*//; p;}') [[ -f /tmp/dhclient.conf ]] && _dr=dhcp while :; do ask_until "$_prompt" "$_dr" [[ $resp == @(none|dhcp) ]] && break route delete -inet default >/dev/null 2>&1 route -n add -inet -host default "$resp" && { echo "$resp" >/tmp/mygate ; break ; } route -n add -inet -host default $_dr >/dev/null 2>&1 done } v6_defroute() { local _if=$1 _routers _oifs if [[ -z $(route -n show -inet6 | sed -ne '/^default */{s///; s/ .*//; p;}') ]]; then resp=none return fi if [[ -x /sbin/ping6 ]]; then _routers=$(ping6 -n -c 2 ff02::2%$_if 2>&1 | sed -n \ -e '/bytes from/{s/^.*from //;s/,.*$//;p;}') fi _oifs=$IFS IFS= PS3="IPv6 default router? (list #, IPv6 address or 'none'): " select i in $_routers; do case $i in "") resp=$REPLY [[ -n $resp ]] && break ;; *) resp=$i break ;; esac done IFS=$_oifs } enable_network() { local _netfile _gw for _netfile in hosts dhclient.conf resolv.conf resolv.conf.tail protocols services; do if [ -f /mnt/etc/${_netfile} ]; then cp /mnt/etc/${_netfile} /etc/${_netfile} fi done ifconfig lo0 inet 127.0.0.1 for hn in /mnt/etc/hostname.*; do if=${hn#/mnt/etc/hostname.} ifconfig $if >/dev/null 2>&1 || continue while :; do if [ "$cmd2" ]; then set -- $cmd2 af=$1 name=$2 mask=$3 bcaddr=$4 ext1=$5 cmd2= i=1; while [ i -lt 6 -a -n "$1" ]; do shift; let i=i+1; done ext2="$@" else read af name mask bcaddr ext1 ext2 || break fi case $af in "#"*|"!"*|"bridge"|"") continue ;; "dhcp") [ "$name" = "NONE" ] && name= [ "$mask" = "NONE" ] && mask= [ "$bcaddr" = "NONE" ] && bcaddr= dhcpif="$dhcpif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 down" cmd="$cmd; dhclient $if" ;; "rtsol") rtsolif="$rtsolif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 up" ;; "up") cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 up" ;; *) read dt dtaddr if [ "$name" = "alias" ]; then alias=$name name=$mask mask=$bcaddr bcaddr=$ext1 ext1=$ext2 ext2= else alias= fi cmd="ifconfig $if $af $alias $name " case $dt in dest) cmd="$cmd $dtaddr" ;; [a-z!]*) cmd2="$dt $dtaddr" ;; esac if [ ! -n "$name" ]; then echo "/mnt/etc/hostname.$if: invalid network configuration file" return fi case $af in inet) [ "$mask" ] && cmd="$cmd netmask $mask" if [ "$bcaddr" -a "$bcaddr" != "NONE" ]; then cmd="$cmd broadcast $bcaddr" fi [ "$alias" ] && rtcmd="; route -qn add -host $name 127.0.0.1" ;; inet6) [ "$mask" ] && cmd="$cmd prefixlen $mask" cmd="$cmd $bcaddr" ;; *) cmd="$cmd $mask $bcaddr" esac cmd="$cmd $ext1 $ext2$rtcmd" rtcmd= ;; esac eval "$cmd" done /dev/null 2>&1 route -qn add -host default $_gw && break done [[ -z $rtsolif ]] && stripcom /mnt/etc/mygate | while read _gw; do [[ $_gw == !(*:*) ]] && continue route -qn delete -inet6 default >/dev/null 2>&1 route -qn add -host -inet6 default $_gw && break done route -qn add -host `hostname` 127.0.0.1 >/dev/null route -qn add -net 127 127.0.0.1 -reject >/dev/null echo "Network interface configuration:" ifconfig -am route -n show if [ -f /etc/resolv.conf ]; then echo "\nResolver enabled." else echo "\nResolver not enabled." fi } install_files() { local _src=$1 _files=$2 _f _sets _get_sets for _f in $THESETS; do isin $_f $_files || continue; _sets=$(addel $_f $_sets) isin $_f $DEFAULTSETS "site$VERSION-$(hostname -s).tgz" && \ _get_sets=$(addel $_f $_get_sets) done if [[ -z $_sets ]]; then cat <<__EOT No $OBSD sets were found at $(echo $_src | sed -e 's/\(^ftp:\/\/[^/]*\)\(:[^/]*\)\(@.*\)/\1\3/') Set names are: $THESETS __EOT return fi resp=y isin INSTALL.$ARCH $_files || ask_yn "INSTALL.$ARCH not found. Use sets found here anyway?" [[ $resp = n ]] && return select_sets "$_sets" "$_get_sets" [[ -n $resp ]] || return _get_sets=$resp ask_yn "Ready to $MODE sets?" yes [[ $resp = n ]] && return for _f in $THESETS ; do isin $_f $_get_sets || continue echo "Getting $_f ..." case $_f in *.tgz) ftp $_ftp_active -o - -V -m "$_src/$_f" | tar zxphf - -C /mnt ;; *) ftp $_ftp_active -o "/mnt/$_f" -V -m "$_src/$_f" ;; esac if [ $? -ne 0 ]; then echo "'$_f' did not install correctly." else DEFAULTSETS=$(rmel $_f $DEFAULTSETS) fi done } encode_for_url() { echo "$1" | sed -e " s/%/%25/g s/ /%20/g s/!/%21/g s/\"/%22/g s/#/%23/g s/\\\$/%24/g s/&/%26/g s/'/%27/g s/(/%28/g s/)/%29/g s/\*/%2a/g s/+/%2b/g s/,/%2c/g s/-/%2d/g s/\./%2e/g s/\//%2f/g s/:/%3a/g s/;/%3b/g s//%3e/g s/?/%3f/g s/@/%40/g s/\[/%5b/g s/\\\\/%5c/g s/]/%5d/g s/\^/%5e/g s/_/%5f/g s/\`/%60/g s/{/%7b/g s/|/%7c/g s/}/%7d/g s/~/%7e/g " } ftp_error() { if [[ -n $(echo "$2" | grep "$1") ]]; then echo $1 return 0 fi return 1 } install_url() { local _url_type=$1 _file_list _url_base _oifs _prompt _passwd ask "HTTP/FTP proxy URL? (e.g. 'http://proxy:8080', or 'none')" \ "${ftp_proxy:-none}" unset ftp_proxy http_proxy [[ $resp == none ]] || export ftp_proxy=$resp http_proxy=$resp rm -f $SERVERLIST ask_yn "Display the list of known $_url_type servers?" if [[ $resp == y ]]; then echo -n "Getting the list from 129.128.5.191 (ftp.openbsd.org)..." ftp $_ftp_active -V -a -o - \ ftp://129.128.5.191/$FTPDIR/ftplist 2>/tmp/ftplisterr \ | sed -ne "/^${_url_type}:\/\//s///p" >$SERVERLIST if [[ -s $SERVERLIST ]]; then echo "done." _prompt="Server? (IP address, hostname, list#, 'done' or '?')" cat -n $SERVERLIST | less -XE else echo "FAILED." cat /tmp/ftplisterr fi fi : ${_prompt:="Server? (IP address, hostname or 'done')"} while :; do eval resp=\$_${_url_type}_server_ip ask_until "$_prompt" "$resp" case $resp in done) return ;; "?") [[ -s $SERVERLIST ]] || continue cat -n $SERVERLIST | less -XE ;; +([0-9])) [[ -s $SERVERLIST ]] || continue set -- $(sed -ne "${resp}p" $SERVERLIST) [[ $# -lt 1 ]] && { echo "There is no line $resp." ; continue ; } echo "Using $*" eval _${_url_type}_server_ip=${1%%/*} eval _${_url_type}_server_dir=${1#*/}/$SETDIR ;; *) eval _${_url_type}_server_ip=$resp break ;; esac done if [[ $_url_type == ftp && -z $ftp_proxy ]]; then case $_ftp_active in -A) resp=no ;; *) resp=yes ;; esac unset _ftp_active ask_yn "Does the server support passive mode ftp?" $resp [[ $resp == n ]] && _ftp_active=-A fi eval resp=\$_${_url_type}_server_dir ask_until "Server directory?" "${resp:-pub/OpenBSD/$SETDIR}" eval _${_url_type}_server_dir=$resp if [[ $_url_type == ftp ]]; then _oifs=$IFS IFS= ask_until "Login?" "${_ftp_server_login:=anonymous}" _ftp_server_login=$resp if [[ $_ftp_server_login == @(anonymous|ftp) ]]; then _passwd=root@`hostname` else resp= while [[ -z $resp ]] ; do askpass "Password? (will not echo)" done _passwd=$resp fi IFS=$_oifs fi _url_base=$_url_type:// if [[ $_url_type == ftp && $_ftp_server_login != anonymous ]]; then _url_base=$_url_base$(encode_for_url "$_ftp_server_login"):$(encode_for_url "$_passwd")@ fi eval _url_base=$_url_base\$_${_url_type}_server_ip/\$_${_url_type}_server_dir ifconfig lo0 127.0.0.1 if [[ $_url_type == ftp && -z $ftp_proxy ]] ; then _file_list=$(ftp_list_files "$_ftp_server_ip" "$_ftp_server_login" "$_passwd" "$_ftp_server_dir") ftp_error "Login failed." "$_file_list" && return ftp_error "No such file or directory." "$_file_list" && return else _file_list=$(ftp -o - -V "$_url_base/index.txt" | sed 's/ //') fi install_files "$_url_base" "$_file_list" } install_mounted_fs() { local _dir while :; do ask_until "Pathname to the sets? (or 'done')" "$SETDIR" [[ $resp == done ]] && return [[ -d /mnt2/$resp ]] && { _dir=/mnt2/$resp ; break ; } [[ -d /mnt/$resp ]] && { _dir=/mnt/$resp ; break ; } [[ -d /$resp ]] && { _dir=/$resp ; break ; } echo "The directory '$resp' does not exist." done install_files "file://$_dir" "$(ls -l $_dir)" } install_cdrom() { get_drive "CD-ROM" "$CDDEVS" || return mount_mnt2 $resp || return install_mounted_fs } install_disk() { ask_yn "Is the disk partition already mounted?" if [[ $resp == n ]]; then get_drive "disk" "$DKDEVS" || return mount_mnt2 $resp || return fi install_mounted_fs } install_nfs() { local _tcp ask_until "Server IP address or hostname?" "$NFS_ADDR" NFS_ADDR=$resp ask_until "Filesystem on server to mount?" "$NFS_PATH" NFS_PATH=$resp ask_yn "Use TCP transport? (requires TCP-capable NFS server)" [[ $resp == y ]] && _tcp=-T mount_nfs $_tcp -o ro $NFS_ADDR:$NFS_PATH /mnt2 || return install_mounted_fs } install_tape() { local _z _bs get_drive "tape drive" "$MTDEVS" || return export TAPE=/dev/nr$resp if [[ ! -c $TAPE ]]; then echo "$TAPE is not a character special file." return fi echo -n "Rewinding $TAPE (mt rewind)..." mt rewind || return echo "done." while :; do ask_until "Skip how many files? (or 'done')" 0 [[ $resp == done ]] && return [[ $resp == +([0-9]) ]] || continue (($resp < 0)) && continue if (($resp > 0)); then echo -n "Skipping $resp file(s)..." mt fsf $resp || return echo "done." elif [[ -n $_bs ]]; then mt bsf ; mt fsf fi unset _z ask_yn "Is the file gzipped?" yes [[ $resp == y ]] && _z=z [[ $_z == z ]] || _bs=10240 ask_until "Blocksize for this file?" "${_bs:-8k}" [[ $resp == done ]] && return _bs=$resp dd if=$TAPE bs=$_bs | tar ${_z}xvphf - -C /mnt || return done } set_timezone() { local _zoneroot=/mnt/usr/share/zoneinfo/ _zonepath [[ ! -d $_zoneroot ]] && return if [[ -L /mnt/etc/localtime ]]; then TZ=$(ls -l /mnt/etc/localtime 2>/dev/null) TZ=${TZ#*${_zoneroot#/mnt}} fi : ${TZ:=GMT} while :; do _zonepath=$_zoneroot ask "What timezone are you in? ('?' for list)" "$TZ" if [[ $resp == ? ]]; then ls -F ${_zonepath} continue; fi _zonepath=${_zonepath}${resp} while [[ -d $_zonepath ]]; do ask "What sub-timezone of '${_zonepath#$_zoneroot}' are you in? ('?' for list)" case $resp in "") ;; ?) ls -F $_zonepath ;; *) _zonepath=$_zonepath/$resp ;; esac done if [[ -f $_zonepath ]]; then TZ=${_zonepath#$_zoneroot} echo -n "Setting local timezone to '$TZ'..." ln -sf /usr/share/zoneinfo/$TZ /mnt/etc/localtime echo "done." return fi echo -n "'${_zonepath#$_zoneroot}'" echo " is not a valid timezone on this system." done } sane_install() { local _s _m for _s in $SANESETS; do isin $_s $DEFAULTSETS || continue ask_yn "'$_s' was not installed.\nAre you *SURE* your $MODE is complete without '$_s'?" [[ $resp == n ]] && _m="$_m $_s" done [[ -n $_m ]] && return 1 return 0 } install_sets() { local _d=disk _locs="disk ftp http" [[ -n $CDDEVS ]] && { _locs="cd $_locs" ; _d=cd ; } [[ -x /sbin/mount_nfs ]] && _locs="$_locs nfs" [[ -n $MTDEVS && -x /bin/mt ]] && _locs="$_locs tape" echo "\nLet's $MODE the sets!" while :; do umount -f /mnt2 >/dev/null 2>&1 [[ -z $DEFAULTSETS ]] && _d=done ask "Location of sets? ($_locs or 'done')" "$_d" case $resp in done) sane_install && return ;; c*|C*) isin "cd" $_locs && install_cdrom ;; d*|D*) install_disk ;; f*|F*) isin "ftp" $_locs && install_url ftp ;; h*|H*) isin "http" $_locs && install_url http ;; n*|N*) isin "nfs" $_locs && install_nfs ;; t*|T*) isin "tape" $_locs && install_tape ;; esac done } munge_fstab() { local _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do [[ $_dev == \#* || \ $_fstype == nfs || \ ! -f /sbin/mount_$_fstype || \ $_opt == *noauto* || \ $_opt == *xx* ]] && continue _opt=$(echo $_opt | sed -e 's/softdep//') [[ $_fstype == ffs ]] || _opt=$(echo $_opt | sed -e 's/rw/ro/') echo $_dev /mnt${_mp%/} $_fstype $_opt done /etc/fstab if [ ! -s /etc/fstab ]; then echo "Unable to create valid /etc/fstab." exit fi } mount_fs() { local _async=$1 _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do [ "$_mp" = "/mnt" ] || mkdir -p $_mp if ! mount -v -t $_fstype $_async -o $_opt $_dev $_mp ; then cat <<__EOT FATAL ERROR: Cannot mount filesystems. Double-check your configuration and restart the $MODE. __EOT exit fi done /dev/null 2>&1; then echo "FAILED. You must fsck $_dev manually." _fail=y else echo "OK." fi done /tmp/resolv.conf for _ns in $resp; do echo "nameserver $_ns" >>/tmp/resolv.conf done ask_yn "Use the nameserver now?" yes [[ $resp == y ]] && cp /tmp/resolv.conf /tmp/resolv.conf.shadow fi [[ -n $(ifconfig -a | sed -ne '/[ ]inet .* broadcast /p') ]] && v4_defroute edit_tmp_file hosts manual_net_cfg } populateusrlocal() { if [ -f /mnt/etc/mtree/BSD.local.dist ]; then /mnt/usr/sbin/chroot /mnt /usr/sbin/mtree -Uedqn -p /usr/local -f /etc/mtree/BSD.local.dist >/dev/null fi } questions() { local _d ask_yn "Start sshd(8) by default?" yes if [[ $resp == n ]]; then echo "sshd_flags=NO # disabled during install" \ >>/mnt/etc/rc.conf.local fi ask "NTP server? (host, 'none' or 'default')" none if [[ $resp != none ]]; then echo "ntpd_flags= # enabled during install" \ >>/mnt/etc/rc.conf.local if [[ $resp != default ]]; then set -- $resp sed -e "s/^servers /#&/;/#server /a\\ server $1 " /mnt/etc/ntpd.conf >/tmp/ntpd.conf fi fi if [[ -n $MDXAPERTURE ]]; then ask_yn "Do you expect to run the X Window System?" if [[ $resp == y ]]; then sed -e "/^#\(machdep\.allowaperture=${MDXAPERTURE}\)/s//\1 /" \ /mnt/etc/sysctl.conf >/tmp/sysctl.conf cp /tmp/sysctl.conf /mnt/etc/sysctl.conf fi fi [[ -n $CDEV ]] || return _d=${CPROM:-$CDEV} ask_yn "Change the default console to $_d?" [[ $resp == n ]] && return ask_which "speed" "should $_d use" "9600 19200 38400 57600 115200" \ $CSPEED [[ $resp == done ]] && return sed -e "/^$CTTY/s/std.9600/std.${resp}/" \ -e "/^$CTTY/s/unknown/vt220 /" \ -e "/$CTTY/s/off.*/on secure/" /mnt/etc/ttys >/tmp/ttys [[ -n $CPROM ]] && \ echo "stty $CPROM $resp\nset tty $CPROM" >>/mnt/etc/boot.conf } finish_up() { local _dev _mp _fstype _rest if [[ -x /mnt/sbin/swapctl ]]; then /mnt/sbin/swapctl -a /dev/$SWAPDEV >/dev/null 2>&1 while read _dev _mp _fstype _rest; do [[ $_fstype == swap ]] && \ /mnt/sbin/swapctl -a $_dev >/dev/null 2>&1 done /tmp/sysctl.conf cp /tmp/sysctl.conf /mnt/etc/sysctl.conf fi echo -n "Making all device nodes..." cd /mnt/dev sh MAKEDEV all for _dev in $DKDEVS $CDDEVS $MTDEVS; do sh MAKEDEV $_dev done echo "done." cd / md_installboot $ROOTDISK populateusrlocal [ -x /mnt/$MODE.site ] && /mnt/usr/sbin/chroot /mnt /$MODE.site cat <<__EOT CONGRATULATIONS! Your OpenBSD $MODE has been successfully completed! To boot the new system, enter halt at the command prompt. Once the system has halted, reset the machine and boot from the disk. __EOT md_congrats } ROOTDISK= ROOTDEV= VERSION=43 VNAME="$(( $VERSION / 10 )).$(( $VERSION % 10 ))" SETDIR="$VNAME/$ARCH" FTPDIR="pub/OpenBSD/$VNAME" OBSD="OpenBSD/$ARCH $VNAME" SERVERLIST=/tmp/serverlist for _opt in d f l m n p s; do ulimit -$_opt unlimited done dmesg | sed -ne '/^OpenBSD /h;/^OpenBSD /!H;${g;p;}' >/var/run/dmesg.boot DKDEVS=$(scan_disknames "${MDDKDEVS:-/^[sw]d[0-9][0-9]* /s/ .*//p}") CDDEVS=$(scan_disknames "${MDCDDEVS:-/^cd[0-9][0-9]* /s/ .*//p}") MTDEVS=$(scan_dmesg "${MDMTDEVS:-/^[cms]t[0-9][0-9]* /s/ .*//p}") IFDEVS=$(get_ifdevs) CONSOLE=$(scan_dmesg '/^\([^ ]*\).*: console$/s//\1/p') CONSOLE=${CONSOLE% } [[ -n $CONSOLE ]] && CSPEED=$(stty speed) md_consoleinfo THESETS="bsd bsd.rd bsd.mp $MDSETS" DEFAULTSETS="bsd bsd.rd" for _set in base etc misc comp man game xbase xetc xshare xfont xserv site ; do [[ $MODE == upgrade && ( $_set == etc || $_set == xetc ) ]] && continue THESETS="$THESETS ${_set}${VERSION}.tgz" isin $_set xbase xetc xshare xfont xserv site && continue DEFAULTSETS="$DEFAULTSETS ${_set}${VERSION}.tgz" done SANESETS="bsd base${VERSION}.tgz etc${VERSION}.tgz" : ${EDITOR:=ed} [[ -x /usr/bin/vi ]] && EDITOR=vi export EDITOR [[ -f /etc/fstab ]] && umount -av 1>/dev/null 2>&1 umount -v /mnt 1>/dev/null 2>&1 welcome if [[ $MODE == install && ! -f /etc/fstab ]]; then cat <<__EOT You will now initialize the disk(s) that OpenBSD will use. To enable all available security features you should configure the di0123456789abcdef\N_)`^-0-|-z-\N_ċ))$-))\N_,)k))|) j)Љ)\N_L<.xB.4A.lJ.J.xO.\N_: -xB.4A.lJ.J.-hI-Z-\N_<-\N_+-\N_,-\N_)|)xB.lJ.J.)\N_|)xB.lJ.J.\N_L<.xB.lJ.J.<<.X6 L_\N_ '@,,@ X Xd$`N_N_ Q_Q_Q_Q_Q_N_N_(Q_O_O_,Q_ ʚ;5ym8@ E8(@AAA==(A*N_N_N_N_N_N_N_N_N_N_N_N_N_N_N_N_N_Q 0Q_0Q_ ,6#f,6#f,6#f,6#f,6#f,6#f,6#f,6#f,6#f,6#f-6#f-6#f-6#f -6$f-6$f-6$f -6 $f(-6$f0-6$f4-6lYcx.<-6lYcy.D-6lYcPy.R_-6.R_0(.0.d/6.ć...ȇ...d4l4|4 4\44|44ܗ444 4444P44ؓ44̗44,4<4L4\4l4|44444̘4ܘ44440.H./64|444444T44\4\4d4l4\4ا4`4444\4T4ܤ4t4ܤ4ܤ4P4..@4P.036D36P36\36t363636zaurus /l /ʏ)$)$)$)$)$)$)$|,)$)$)$)$)$)$)$)$)$)$)$)$)$)$)$)$)$)$)$)$)$)$)$)$)$)$)$)$)$)$)$)$)$)$)$)$)$)$)$)$)$)$)$)$)$)$)$)$)$)$)$)$)$)$)$)$)$)$)$)$)$)$)$)$)$)$)$)$)$)$)$)$0 0x00\0P0)$)$)$)$)$,A!A!8B!C!@! @!)$)$)$)$)$)$)$)$)$)$)$)$)$)$)$)$)$)$)$)$)$)$)$)$)$ܤ/H//԰//5$8006000(0 0̵6x06\6t66666л66@6,66666л6H6̵6\666T6G\6< 1l 1>?? ' ` ~ ^ "' ,AAA AA'CEEEEIIIINOOOOOUUUUYaaaa aa'ceeeeiiiinooooouuuuyy"A"E"I"O"U"a"e"i"o"u"yA^A`A*A~ACE^E`EI^I`I~NO^O`O~OU^U`UYa^a`a*a~ace^e`ei^i`i~no^o`o~ou^u`uy6111 1(1<1,11H1(111lC5 1,14114111Ա1ܱ1 1811d6l6t6|6666666666666666666 66666 6$6(6,6064686????@`px|~ 08<>????????????????????????? @`px|~ 08<>????????????????? @`px|~ 08<>????????? @`px|~ 08<>? Boldface.iso1 _wfllllllll||| 0 `F8ll8vv0 000000 0 0f<0p000x6 0>p00p>p|`08l 8llF`0| 0|``f`?8`DDE9  2 2 a>wc`aaa?`  0  0f`vvf`    ` 00`000000006??a@ 0  @````@``@? !? ?1```@```0 00`gop``````p@??`@@000  000 ``````p?```<     `xx``88`9  ?0```g ollg`0? ? @@`@`````a``````````` `````` 0 @a``````````````````@a0@0@000?00000 0 0@0@000?000000x` ````a`` `0````````````````````````80acflxx|ngca`px00000000000 0 p`pppY`Y`Y`M`N`N`D`D`p` p x X L F G C A@@@`0 ````````````` @0@00`0`0`07000000x `````````````0@8@#a````|ngca`p0`` ` p<@`@``F p` ` ` ` ` ` ` ` ` ` p@?`@000 f f f v w@3@7@;;p` 0@8   @`p` 0@ ?   ?``00 || ||1`0009 ```gop````````p`xO1 ````p@0`````1 ````````p9`p0``````0`   1```1?`? `@ @ ?0p00790000000y 08````acf|x|ngcnf`f`f`f`f`f`f`p'y0000000y ````````p@8q``````````@p````  ````````p`8````s48000000x00@8 0?  @y00000009`p` 0@0@ pf f f 7@;@;@p@8  ` 0@0@  xp`A8 p`8    8 >`6gC0000~|V`s@ o`?0000?o`@ ``00`0?a00`0`00/@)@(@(@)@/@0``0`0`?` 6ll6 `??0/@)@/@*@*@+@0 33 ???<f0`~<ff< y00000009>`0000x?```?````````` 8<0`0`0`?l6 `` 6l08@@@@08 8D8D8@@@@ 000@9  ? @@` ? @@` ? @@`  ? @@` ? @@` ? @@`   # ##CCC` `````` 0 @  0@0@00?000 0 0@0@00?000 0 0@0@00?000 0 0@0@00?000 0  100`0`0``0`0`0`0`0@1 p` p X L F C A@@`0  ``````` @0@ ``````` @0@ ``````` @0@  ``````` @0@ ``````` @0@ 0`  0` `!!c`c`f`f`l`l`8@8@8o p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` 0@ ``````````8```acc````````ac 000900090009 0009000900096@&``?fff v@;1 ````p@0  0``````0`0``````0`0``````0`0``````0` Dl88lF ````p@8 'y0000000y  ````````p@8 ````````p@8 ````````p@8  ````````p@8 ````````p@8``#c`f`f`l`|@8?`` y00000009`y00000009`y00000009`y00000009`` 0@0@  xp````aaaaa`` 0@0@  xp__  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ͳɿپ̴ް__2_)_a_u__(_8_H_X_h_x__  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~0_o_]_h_x___&_!T_ 9666666226<``2`2,h2g2  % 3u Du u <u 8u 2u 0&'u 1&u 0&u     )%uu 0 1 8%u   3 D D%uu < 8 2u 0&'u 1&u 0&u  6T602202x"xe566*66# # 6660w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-\6{{663|3T3333d3`3Ȕ3h333866P3 363363 4 4d4T4d6404d4T464H4d4T46404d4T46,4X4d4T4L6P4|4d4T4h6!4"4d4T446#4h$4d4T46(4(4d4T4(6l,4,4d4T4X6\.4.4d4T4t61414d4T464444d4T467474d4T4$694:4d4T464>4`>4d4T4d6A4B4d4T46DE4pE4d4T46@I4I4d4T4P6M4M4N46444ث#$NetBSD: blockio.S,v 1.4 2001/06/02 11:15:56 bjh21 Exp $.symtab.strtab.shstrtab.text.start.data.sbss.bss.arm.atpcs.ident   ! ?(7( ._?4_?S9?D?9=?K@?  gA?[  7__  :7 H$$/Q#T:0EeR!`]2$f0, 3DG7 37<y.h%@U#pK0 W(4!Lw1"r_.#,|;$,C3LWĭ#Tjܡ. wxG'L ,+_C7*7 4P26(H\"H7)0$6&Lx_H&3Z&l08o&H/dw&T%(&0&|$&#&"&ܔ!&|5&@"0&f&+&x7'"'| e''24'.pE'X)S'3p`'1r'4'!'T"8'`,l'2$'&T'&'e' /' O_("\(p('('/ 1(x/XB(&\L(. ^(&\k(!~(\2$(51p(+('28($G0<( %f (l"f(<[/H(K7)0^- ))7)`4-)H6"L>)T! V)|p"c)"@m).~)8t_)4d53\M483!0b4*n4xB.z4u_40$40d481(4044'04P '4X&X4pt"P41\8L_8.8z5 8H_9)X!9".9t12 =9Ѝ3O9`H3^9+p9_1H}9@t_`9 9p!$9494I295 2<D2.D<2`O<(/f<{5 p<*"t<p2<G4<<3<,0@<dO"<.(|<) <k#<H1f8=`(4=(%@=G3`2=2X:=$*dK='he="o='%x=(=dp&P=Z%T=e=_ = 2=v(=x5 =_= t.=\'d>0,D>0)>|-#5>*$>>t="R>3pc>(C0Lz>L (T>(7> !>e> x2>$>v!0>|3X>/7>vd@>|!?l./?T2x"?W!/? #>?dD?D"fV?&xl?T0\v?<7?$?$?%0L?ād?3?,L1`?.?e?X%?`*D @$x@%@ #l(@$h/@z.=@,h2I@@:,<Y@X3 j@@*lt@1@(1x@_ @,B74@P 2@4@ $@<"\@2@2@Z/X@#< A8s%A4*10(AC71A)# uD4xDhi+$Dt/7D$/<D`/pD/4D.D=4 D#D$%D E$2EH- %EL $7ETN5?E@3tJEK7\E*liElD(|E,u_E%E<7E 24E@0,E$X4E@_E,1EP, F|,( F84#Ft0p5F4>FHL#SF`#`bF "qF41tF#F0 0F.FX47F/FX'FX!xF1G"fGr"\GĶ#)G"1G,%R$ LR#\VRd0lbR!1$xR`(R`+dRL"RdA&R<.R('TR&2tRH0R(+, S$tS$D*S$8S8",FS!\]S7nS 1S=1S(tSeS<3fS<" SH(SL"fS2pS.T$0Tp3)Tl e1T#l=T+PTS!dT#dlTH"~TԆ!XT,TR_TX^* TD"T L"Tu4 T"TԷ/U&U2%U1/U1XAUL-0RUH<7\U$aUdnUA%{UpJ7U%U K,U&PUeU04Ue/XU4U28Vh/0VĈ%Vi!+V$f3V4D'P=V 8&xGV_UV3PeV&mV$$ rV!V.VD%DV@(V4VeV hVT'Vx3\V<&"x W|) W܁d W_)W_2W2BW@$`LWP3_W 'tWDz'8W.WC7W`.,W L_W-,WHh(WhdWP_W|!0\X+Xq/$X $4Xu(AX#QX4Z4d^X$tpXX XHeXeX$fX!hX_Xp.'|XP ,DXd!<X_X/ YQ_Yd~!Yxx$(Y|d4Y؄_MY$/8WYo5`Y|dlY,r%vYdYg2YI#0Y4Yt,Y(%<Y"Yn&Z0#|Z$f!Z<$ *Z24Z@3fKZO_ZZ+$fZ#oZ$Z+7ZtvdZx/ZH4Z8T'Zt"Z!Zp38Z 2[\H7[#48[|)'[|P$t1[xJ7G[%@R[34b[>/k[Ԏ4~[(hS]|%_]\_f]%0lr]R_]X7] ,d]%4]$l]|4]04]A1h]xvd]`!]h!]. ^&X^T3H$^hI-3^T+A^/J^&[^x( xf^03Lr^D/^e^Ъ& ^e^0G,^e^|4f^t5+P^.^2p^7 ^X4 _Щ._(d%_!H6_(B_2pS_8b4m_'_*7_74_x57 _/_c!D_,0_\._)|_,,_{3 `̞1`0&`,/`./@4`-PI`(1@d`p eo`ldx`f( `D51L`\Z3`+``eT`4"8`*\`x2&4`P^"T`,L#`84  a48a#h"a#,a 4@a*7Ra0C7ca$27rav'<a)$ ada@1aO4\a_ ai+XaE7a`F% a8<7 b$@b4%Dbde"b/;b-Hbd"fSbX?7_bp 0<sbld{b +b/ bdJ/pbL"bN_bT!8b b|.c +cc/P%c0t.*c$\9cLb"Gc00^c 1@hc?7sc7c$\cg&dHg \g{_drg7~gxT0Pg,"g4_gR_gH%4g2$g,%0gȭ*gpx%Xg eg|z$the h|.h*L'h)2h U"@hL7 Wh/0eh%oh*.~hz*ht2\hPdh-/(h$fhN_h Dh|<,h1h\!4 i9)Di10i0:iT'Ni27_i(j4Nj.bjxc((pj|K7{jq j_j14j "j4@j7j~%dj8t"8j(  kl2k|f$kw.0k)7>k4!UkTd ]k3)ikesk_zk1fk-k$&k ek*k$kt0dk47 kX0kI4lp"( lo/.ld9lL2pLl#\l 0\hl(ul@$@lxS$`l" l44l4l xlt4l*l"lM4,lD7@ ml3$mO/4mT,Am 'LLmH57 ]mL!$umh/dm0m-/ m,0m\k4pm0xm /(mN2m2n '<n`e nإ$H*n&f!r4rt3<rl&r(X%r4rd s< Ps."sl&(.sH.;s0i2XKs @7Ws,00osW,xs%0sT7sH0HspP(<s|.s$s s(4TsX's4"@tL4t'+t/8:t,4MtHC7ft,qt$ft"t$y_Pt97(tlV2t40tF&t%t@8#tz5  u@3uX0$,u$9u+xEu!xMu%Vu0H`ueiu#8vu5u.7u4uw'ueu@Y'uh#,ueu&uu_uxi3vI2vTn.4)v"(0v@!\7v2|Ev&fUv|z-lavt4yv=!v_vdi)Lv#Dv|3vh1v0,v|R#Tv, w ;+|w@I4X&w%"@5w!=w,4,Hwо+TVwr/\]w4)kw,_wwL24w0t_w, w8_wF4 wP4`wi1dwd"8w4w2wB&DxexhH'l-xb1:x|(Ex 4Yx28ixl_sx)d~xV4x& xHN#x\ xI,px"x !x&xx&x8j#y 2y&x,yl /DHyL&8Xy$aye4Hqy2y0yfy"TyA!@ydy'0ytM$yv"y3 z@j1Xz/|*z!\;z3Nz4Uz&xcz4pzD',|zez9!Hzl0z z"Tz/ z!zЬ2<zHA/zl7zN3 {<14{*({P#/{S#<;{L0e{Ĺ4q{Xd.@{@04{tD7{.7 {3\{h3'4{R! {$@ H{n.4 |)$|"|E'T,|K7(9|37A|x%DJ|4 T|H3fn|(dy|<\2P|HS/|_|B+|e|x+(||vd|(4}3}d*$},A!+}\Z&8}<4&?}-HO}p+Xf}+u}9.} e(} "x}e}"}$} *(}:.}G!d}\0,~f~4~d0/~,.4~W*A~(HY~3i~i.~W,~x#~K(~2X~D2~&~7v~$57 ~Ts5x$xDC7(4@(~*<K%`T4*@btC0p#t~d$4<<.f!HJ0G#"8P!p,lS$hDF1`.-d/C@$M"|V}!`t_h$',q\2~P/\M/*5$,@(2ڀs.,x%X$3<!̒6!0p+'4eȗ*  T0d<90(JfT̵#ta4g$pw5 |3`0f$ ?7#ld07Гv$ٓT47388h4H`*l H1$I7x2N_A4P124c\_o4!0#7 \(1Ԧ4Ӕq4l4,m&HH '4438 2?<1fP$&_$Hi@$xqh3!L,?7W337t$d!8ȕ/֕%H30@*dV!.\"!\;$B4fFxz_U%D`t_m#3w57 L1+<&p#,ÖpQ_ߖȁ( &t4!0 (2Ȗ01Ğ(Bx_R.$b3ml7%<,'$h4(p?0lӗfF D7 '%ت'>`2JX&XV#4b%n/}| w1(*7(c'Ře.Pܘ%L:%l)2,1lpa/ %@)39*DFr#tV_]D$tgq N_!d _i#dh&0ƙ(p֙(h2pLe (@ D3L,"f908Vd `@H3 j4n)Pw&TL"l *< t", tp1`Úx%ʚ&ܚ!txG3hD,(J/<)d0/8@L)P e^t67 s57 {/@H7/7#\3f$ ˛Z2֛0h+Pe) 4+294NȁdVx5 bw5 n4vC7_@%4@dN_p2Ӝ%02d@4 '#%%T/+,T<1S,a &,mL~+x,$)4P%(pǝ"Dԝh< Pt#d2Q3e e0<#%x5 .B$LheZ(%dP!r0x'8"!44!!@ƞ"ўf3ޞ|$x$/h P_h%,+7h5+$U_2`a&@z5 LX*]!i<+uP4~*()l ,4ğt5 ͟2`ڟv3.7M!62(*7757 F|O5 U0xf(28o/3\z/ $f)7$P#dlX/h̠t$Ԡ`1$P+hD7 70l) 6/L&,=t.,D,TSX!i 4v14&fH#t_/J/(ӡ(t_ݡP12t0Ld!<2*4:ċ)$E.$Opf]hI!xj3L~;5`04L27L2ƢЍ/@֢L\.P4f8;1!#<&te/$D(HKV"hTdbt!To / P~881,1-%P%+Hţ4٣#/D4!P$4$?1`&/5N_Hd% Q,.'DYd%<f7iH0z\4lD74|2d$j+ʤi)pԤ& /t"4p20|2@{/@9,1G&$U!aL_0m(1|%dlB7\37"3,h˥Z4ڥdȖ3к0`,(d!#\0*L(T8?"4I0]4/gvds*2m+lH*7!/te/7h!4Ц$Q_ݦN_+* e &d4/$%L8B4DP(Y_`PH1Ppt4{(.X/7;247 ħ5Hu_ (;4 +\#h71#C$Q_]K7n0@2`)%@2xث#dƼ1,&*d 8d/\K&Wfc"r$|z$Hd_!P0#%H,DF/ȾT*ԾDg' %4_ +vd d-074*C/R (]t%j0z<(tU",7P3d'¿&ѿ@d޿dd41\1.>5:#@,4R4^3(i2$sԘ&<$ `3fp&L'P^*\.( e%,~'8@K !!P2Pl/\2_)z&DS!!8  X8&2T 0 (0"4(Ȓ1p5-7?u3MD2X`2a .\rT"lr-)%pF+D'`(?7 $ 41؂_ 42#05T .$F|-LUP87(j$42P{d _:3p\*C73;1t.81@v'p& "*7980D M]!X 7e}!4q 7y,#@e$`.@ā%0#'DD"Hd3\ 0$f@!%,<3@A$3PSn.Hg.#,u4z#0P0/T e$ ` e) .Pq. /U \'2f7 f(tDeL0XSh+@^8b$h(q5o_wd!_*4(_'08@W02f/e67  %D,`+*5)*BheL#T"$_1xrK"_l52\\*%(t)0_00`.4L%7 |3`4,h+.)X:-Kx 4HY2$b/HvPm.7@17e!(G/$.l$(< e"<Xw*0d0H)`" +_4dE7Bp/ U4` .qF).7"(̞&W-(=5ج*v#`/`( $@&H H$+57 <(Px$@Yx$@d_n,{dB7t&!Xp27d# \ (/4&f 0Ht_\D7d()t333C17K*7 1XD!@#/@4&(?&HL_V80hE7$p ?7~)$k4p8,2t 7N#P00d!4Py5  ܻ( R#d4+9390*7Ad3TL>2g4ve+LO!XD1ps-1P$_U4pD)`k! x27pd4#.$7$(?4]&<F !Qܪ3]`!q*P,#tL/v(L30/< eX`&%DXa#`3< 4,0 00e,=3|&̺04*<d47PФ"l4j.`/p+@8eE#OȀ*XXc4hgP%Hv/4.`+3ػ2z'02$3Hi+&dЁdM4#D(X7&G_Y/hn-Py2.\4t$T#i2H/ d(L#*"p)H'<?_GeYȔ3f4vĥ-  *74f37 4tk3"3,+`*5hfM0'f31 T=2OT*gev`#0P_W4D`%Dh*P@7@7/x+&" w_%x#!8*_2^#L=\dH $Q#db_i$n(4D1#p 4__t1U_h{#J40$x$2@;18*46 H0^*[x.4lo.\( $8P.7, 0148)2 0 C7((t 4v!p:!H,x 2@ eK4*0 `L=)Tqܯd37X1*1p-\*DtK2>1 (& r$"|" 2A%?C!G,TSX)gV!y ]#`3ܗ4Tm42d)$!l1`h1,|"l'<62LAs1H[ U_dPi4zxe51/(#Y,_L$X%t42TQ/2(R!!@ *_0`;"pE%Q42Z%f\u.Tm%xzq2t7'Hr)\|Q4`t.,xe_H#0x5 h&X$Z*0.lEu_N [_2kPey.@d#Q1p]!Tdw5  A-\"T+0_#)3h2  $f(')!X7|1D057 T@3ti>)w@1f~L!p@04\$e($'8T%0ܱ101X!0+T_;$FT;5V /0`*j#4u'&fl4Pt.&%`^-#| e2e F02X)E74>$=+N*p_DN2Popepe(I3@0 *H%hO!x&T3$e0,<_/Tt.$4%$0/6/h>R_ W#fL` i'4u_0e+TD P4e%@t42PX,/,$X 7$|**X $6P,B%LP"$Zx3 dJ5kP4 x ,$'x"d\E7D7c3p L 7lr*X(@)$P L p37/,X<,$,HU34Vb/d#ppn1-7ԁdH`(g(` 8|'4Te`57 2 84l3h/% :4TH4 Vv5xfx0`q #4{d4[!T)(\8(x! 4f$ (4%.#,p7+`4?-2\Os$_+x,{+hl.7867  /@ 0(h( 4x"<$f )Hd.`054;P"I U %fhd(pu`_0(0-Lp+@$fT_#/'  H&"3v2hBx1HOX0`b/pL-z 57 34 /DL*5<#/0/$'L/$3 %fk.-4@tdN4@7[x92`v(T"DH!$@u3`2}%|< X1 0< E7PI"&8%0\7m+hA,hQ =1b0o{,@v_P(.t$U#z/0%8&@03\ e !4`+ r&`U+R%H'!!@9&<D|%2 T(LfТ'v#LV+ e3'2T/u$8x!4k3_ 42ft&D`e"ds.&p $6r&D#PO+_0Dj T"{%X%!t-\_-f3`32, t-,d?/$ (*l4$)2`/DX44Q'h8)r`*${57 'M0,.x+h(.D*P[#$ d" <1H'P48%LD!0]w3uv2x<1t_0M!R!T@7# 7pd__4̸ X#&,X0 3LE_<Rk1h],hdw/$/ r.<.$#(X%H e@<00A'%#4 w#H_!74,/EQ,0S6!jq5r,u(DP100[1\@1/l8! ( 1t 0/  .\< L/M U_\ *7k `<7~ L( 3  1 4u% P2< ) j#( . %HZw.@_,7l<4`~004d(!48P_-P4`q.T57  3H1f @/)H$p8!h?O_Nx%xXL,g$dz$,$DX%-7p"f *2\ 1<t:25($E%,OF0\_'tt/@Li.%t4r#d` "%'X\  .(|)$j*)d(:,dQ 1alet e{tz$4-f \e3%ة4&5%<h4H_l1H&f e  1' .(, _5 |_>  \Q 4k `#\t @-f} " Є!h T3 f. 2 4f 2 0H!x$p*!xd3!)=!%2PM!0_!0`q! e}!ԝ$X!3!p_!"l!4r,!0(!\0d! e!h/$!l4"1"0(".7 #"!/,"0;"Ч-0K"Ly#X"0,`"L1n"&$"%"=!("D7"X%"d "_"f"N_"< 4\"48 #'<#`4,#P.3#*LA#t eK#d+ ^#0.$l#%fx#$@#B7#r_#Ѓ_#(1X#p3#F#$#2#%#p2%@#<"T#h_#d4$@.f$</'$K7 3$1,`A$3!V$@!1n$ ~$Xj4 $P.x$P 2$x4$e$/$ #8$&L$D(<%(N(%% e/%34C%+T%4ea%P(z% %22D%/4%$t%D"X%B0L% ' %(L%X#@ &L&0&12`(&!L8&3D&H'V& |f&!w&l.2&Ȝ.L&@&&<3P&'&+x&]1&t$'\" '8c"(''1''N/1'S.J'%XT'<(#P^'t\#4j'!$u' 0 '7'.'D7'@e'H @'h.',C,'2't* (@71(0.(7x@(d,|L("S(|-(i(#r(t"$~(d"(0(E$(/(&(%`(7(-2,(-(3 ),()$ )J20)&fA)`#H)H2R)P*^)?7p)4#w)&f)TH7)0 )P"$)05)22)/(@)@$)tz_)=3)2*H# *x_#*05*|7H* P*l4f ]*/e*`#v*X4*H2<*4)*${5 *@&H*d)*x$*L7* e*Q_*\! +@3+U0$-+,Q_7+|4F+M!0`+|dm+4x+!4+b3T+)@+7+3h+0X+R_+{5+48+T%< ,d/,184,4=,DeH,dN,h.D\,r3i, Pw, $`,1\,40,v%0,.7,Xu_,$0,*`,(8,$C14-,p-8%`-0'0-&A-4U'\I-#V-X 0$g-&<v-,(T-V%-7-0.8- 'h-"`-b#|- C7-+ l.xu'.D%.4 *.1<./F..7T.p"b.%m.X>5~.&.\c/p.e._ .+.xJ+x.!..4P/%  /67 /,+0/47 B/0'V/4T3_/(_l/ $/%P//0/ /d/PG2/\G1/ș%/6$|/0d/4 0T%0td%0(.50_$F05d0#dl0,'}0$%\0O(P0e0,0f0e0f#0T!0\30lQ_0ئ1 1e1%,14?11L1<$V1601 J6.Y6`2Dn6 Q_x676$6B*6Hv2H6036_6Hx$06t#`6l X6,647 H72$70w#|,7$%d5743D7L2Q7T,|c7XH7r73P}7\"27.17,*7%%7d$7-7N_7"(7~!t7& 8<)8ܽ+"8 e,8x':8`.(I8X04Y8pB7j8 $z8x3838'/8ܤ48!8d4<8t1`8%/8 17 87 9@N59pv3$9:37$I:N!$W:0k:<%|r:xd|:8d:4:(:@7:/:D!: 0:(2;X2 ;H*;3H-;1L?;$#$H;ty5 U;4e;. z;v.$;~.<;4";1p;&;ĺ0; 2d;d';3<$51 <#< 0*<1|8<ģ4@< lM<-7]< %f<3y<=2`<H0<ļ4<$f<R(<z'<d<0/<9+H =46"=XL +=)4=('M=4]=/m=P%w=@!D=`.D=44=_=$=<"4=57 =v_=D2d=&f>q/>+4(>|&D4>ܳ"$?>X/I>t*R>a([>@0l>ley>h%x>&>1>le>d>4Y d> >*>;&>XG >F2T>x%?D(?/7 ?0w_%?&05?% A?Z-N?<$U? #|e?0_v?'2(?<`"?!D?l+?3p?h3?" ?e?.@'P'@!4@<#8=@&Q@I!D^@< 10s@,@0H@|_\@O.@'@d@h @ @ 7A/,dAL,H%Ah"f5A.JAl^*XA7^A/PoA+AH/$(AxK#AeA A0PA&PAm#\At3HAܼ1 Bu'tB &H*B&h8Bi,@GB2OBH bB)+nBW$XwBu1\B3B#BdBs.(Bi20BB/B30B.BPj!B(.$ C n.4"C|37@-C+#h>CD74JCdZC4iC%tC. HCM(CN_C$C=1C57 CK7(C81hCP>5D̠,D+2D4GD) TD-_D4uDeD<)HD(tD8&(D7D0(D'Dtw"D' Eq5Eȑ,E+H0E J3EEA4,PEfZE8! iE0|E4EU.Ea1hEfE;(E $E$>"Eğ(0F_ F&F%@$F+@1F\4)@F'VFH7hF,|vF<7F FT1F+F _F`3@F@(F%@FT%TGd G0GD"&G 06G pSG8+x`GX'rGT_zGI 0G%DG~+<G(|GH0GА,Gl3DGg4<G"G"fH(C7H0%TH+)H4r)5Hl#DEH2\OHD'0[H/8fHe(trH\!H3H>1hH}.TH2xH47H/H<0f H#HX/HHn-I "hIX$@$IE72I\,|Pl57 MP,!VP4hP.({Px97P.P@'pPo&TP<4PDeP&hP(4 Q$t_Q"L#Q,67 1Q1fAQDeYQl!fQF5rQ dQ)dQ )#Q(\'XQ@#0Q@$1Q Q_Ql}'PQLc3`Q\u_R( R<(`R P"R- -R2X=R1OR7aR$12P~R)R3R|j4R<3RX#|R1R(R7R TS&4SE7'S,-0TH;%HT3YT/kT"PzT eTfTe(T1f@T$LT!@Tp.T44Ti2DUT' U|t&UK!h/U@$8U1GU&|UU'f(gUlC5(xU8P"U;!tU 4,UV3U4U"U," U2fUD&V%V)2'V/5V(0P>V+0WVT$aV(dwVd V`4V2V'V DV@/4 Vt~3|V\t(Vd5WdW(!$Wo#.W4'(BWT#JWw1<ZW\.`pWt*HW<7W_Wī# W\0W!XW$,W*LW/@W`7! XU_XT_(X\;5(6Xd_AXd#$NX,.#t\X4gXP,dwX4X|<"lX8v5X$0`XN_X$X#Xľ%TX=+ X<" YH}2Y0 YX**Y$6YP~(pGY"hMYX%XYp$8eYd4qY1LY`"Y\ YH0DY0Y4*Y$0Y|,Y$pYi/Y!DY" Zȏ2Z3)Zl3fGZ$QZD~.^Z*LkZ53{Z~2Zd4Z$Z