ELFa( 4(@4 (  %%88((@``_DO! "&@00Q_: 0/@\@/ XX@0 6QQO @@( @0 <  B00 R5Р -L| `Hf`main() returnedԆf   ),@@(LQ 0/p`pf - 0LP@p"`""`VZ -LM`P@p"@D0D 00``"""@ -LM`p@P 0 0 0 0"0""0  {"u"P@XP 0g"a"@TZY"X 0P -LM@P`p? 0X0 S 0N 0I 0D 0?i " - L 0$ 0 $ -LM  0@ 0 0T p-LMH$,$HP0`@ 0p p-QLM0@`  `pQP* 0 P(U:p p-QLM0@`  `pQP* 0PXU:p p-QLM0@`  `pQP* 0P\U:p p-QLM0@`  `pQP* 0 P,U:p -QLM@E0 @%6%6 -(L  -(L _ "- L p-LM@ 9!P` 0/!00PY YR` cUpp p-LMP@`V0 pd !T0H@ 0S' 000H@ 0?' p-LM@` P ?XP 0s UP(0Sp(00PS 0U 0 0 0P 0UPp -0LS`p 0S 00 J 0@? 0@TTppPPpW pP W5,0PUP12eW%1,@0PU0aP0u 0000S 00  000 = 000 0@12e1@, TP00000p 8 p-LM@`P/p -2LM PR|2   Jh0S`2`h0 0SL200l0S 2 2  B^h 4$` ,p@dP,` 000S2022/`VOھ21  p,@`0,K  `VOZ`@0S2`VZH00,0K,pK!0(@ *pK+K|V 0< iP202H202" WP2$00$0h0 ``^000P wQ` 8  8j 8( &6Tnd p-LM4@PU @$ `00  $ 0!2c1,0  0!2c16`,pXP $ p-LM@P`~@p p-LM$ P0S 0 $p4 `  0DPT0T $0 0$0 0$0 0P$00$0p -LM8@6@ 00S<"Z -0@S0L00ph 0PP00P=WP`U L    (v sp 8j&660&6<&6 0-L@LP7 0( z0( 0hq' -0LM@p a00 ` P00 PZpd3 <# R800Wڀ0?3S -1LM`@p+`P0 R( d0S `V 0+$0 0( -`0VLpP@ 0DPT dT0`0 0V D0PT -PL4p`V 4h$0( 000$ 0  $00 $00 DPT$0 0$0ꀌ67H&6P&6\&6l&6|&6 -#LM08 ,0 p0 P 4 )3RR 0 A= 0 0   h3 ,0S \,0S 00g 0S@0 ŕ0őSS000@0000&2R& $ ` @0S6`V@DZX 0@00  00 `~0S6V`VZ6 `0S61`VZ0S0 00S000 @0 00   p pR00B"0P0 00    ,  R00 0B$`000 0 @0S   60S0 ` 00`(1 fP0 0  0 S   50S0`00`0 fP0 VE00@p x0 fPk40Sh@@j0H 00OK f,`P000/,d&6 8 -08`P@L p0 T P0 0@e0 -08`P@L p0 T P0  0@e0 p-LM`P@2PUOp 0 @|P00 `0 0T2 <201$2&6&66&6&6&6 p-LM@8P@`4  00 00S p  0S > S 00p000 d`p 0 00  (000C0 &6,'6\'6 -0`10#0LP8pP@/ 00 0000  0 0, 0 004 Pp`0 0@ 0  @^0$ 40   ! x" '6 -LM0p ` PXj0SM  0 7P>0 @ @00$0J0$0 i B i( ; 0 P(0 0S  0 Ph ,000i=  -LM0` @2c1RP,p 00 P 00 0 (0000  dW 0 p-LM(0 @ 0P<0(0`0@000+  00    0  0 0 0SphcQ000000 00 00 -LŒ _ @hp0 P  &H0!@&l 0 0 0p 0 0' M-L0@0 ἐ$8h , 0$̠$$ $@,l 0` 0 0 0'%x 0-_020@P L0@ 0'00@- @ 0S  4000$0 0$0$@@ 0-L@P(@T` B0Tnd p-LM @00P $0`0$0 @R 0$ 0 00  0 ophj\Tnd -LM4@0S @440S -L M$X @R0  l0@ $@F h@'6'6 - L  -LM ㊣@  0S@0 @Pnd -LM@ R000 h 0-LP,0@T 0U @T0Pnd -L MPP@`x 4K2 KP4[S?0?  ,<' $T@P2"#K <K#KP2[t2\# P6K 00 Q0N@0"02͹ 0ҹ 0͹/  1 1 1 1 ߹ + I t?l!0?0\ֹ0T! 0ᑹ 0匹/   0္ 0z 0t/ 0m/ꀖ,d&)6)6*6*646(6+ ## 6} *8&_eNa&'(#j) 0+ 0x&/ d 0^ 0/ 0 / 0 0/ ; $05 0</ 0T/ 0 0bܸ/  0и 0ʸ/ 0ø/  0Ἰ 0"㶸/ 0㯸/2H2@ \`0ð/?\2\?0ð?d2Qh22 P0ð/?Š2 P?0ð?Ŵ2 o2/2@ Q2}>ø?2/ 2R 2R/ / < ?0?3#Q? ; -/8 L#8 $ϐ R2 d X# -/8 L#8 $ϐ R4 h X# -LM?`0 5Rϖ R2 d 0X OR4 h 2Xxrϐ R2 d 0X ?R0 ` (ϖ 0R4 h  X2Xo_  ?R" D ( ϖR@4 h 0XH?$HT@ 0  `1ϖ R4 h :X41ϖ R2 d $1X1Ss0ϖ R4 h 0X0ϖ R4 h 0X ϖR4 h 0X  ϖR4 h 0X#p -40Lϐ 0R ( # -LLME0 P5 0R5 Rz P` ; 1 D0P@ D@0@ P <C4SL S ! 0@0 0S 6S t| <@0 S#8$0 P@ @DP3 R3Q   ᡲ 0SDl0KP6[p5[ 0p0 OP`} ; ;1t p0 S00pC bp b2 R 6[* R^  R[ $[Q  "0. P|p0@`"0S 5[  H20S S $2 RlK Px> 0@  D P 8] 0@>  D0 $[Q>K  =8K < *K < 0 0D P 0P@ 4 Rx갤[>0Sڼ6[  lK<0 <0 < P 8 Pl<00 0lK &&$*6\*6*6##*6*6H+6@-05;505 @0 @0  p-LM` <0@<5K p$ H0,0P@@ T ph&h+6 -LMA0P 00K  "[D10R8 = R 3[pCX#mW$`ϕ   20K#0ϕ R8 p (K#[0 R3K#[101pW 0 008@ L@H0[q= 0   &#|##" -OL@DtpP ϗ (0  @DtTeaϗ 8R  #8X OR8  #8X 0_R8  #8Xϗ 8#8 XA ϗR0 ` (0P@DvtT8< 0D ?R  (ϗ 0R4 h  X0X  8 ##+6+6 p-0L M PR`0 PEu @0@0 0S PE#uU?0? d1`01K02K01K80 K p,p?P#&+6 0-0L PR ?/$@ϕ<</0Tϕ@/0T0h0# -2L M @RP 2R 2R 200!P 80Plr? R8 p (0 hVu ?R8 p (0 Pe`\0  RL8 p 0? SG 1 R 1R |1R 1R P P 0 00 001R 81R0ASH H H H H H H H H H H H H H H  0P 0S0S` (PK?2K02K]< <0(PK U# &#*D&#(( -L8MP`? Q 3\ 3P [2P7  80Pp.؂ϖ R8 p 0X OR08 p X0\  RL8 p P2 Hp0P0""K0 2K"K 2 R 10S SK[,PK1 R\1P 1P0S2K?,PK2K "Kl!@0p2PTKPK&9U?G  K5K90 Pp@W 0"K0C "K SL L L K L L L K K K L 0[,PK2KX0000000S>L0,PK0K2K# #&!(###& 6S-L@p6 8S `,Pϔ0S8 #8X0ϔS8  #8X|Pt0ϔ R (0  PEuU<  `#+6 p-LM@80PP`0 ( R8 p p# -LMPp60 P a 0? R6 l  ϕR6 l 0X OR6 l 0X 60mP@ ?R6 l (P0 S ?R6 l ( 0 S#4xV -|1LMp00  @PHQJDaϔ R0 ` (0PEQuU4 ?R" D (  ϔR4 h 0X 60Po?PPl0ϔ R6 l 0XP?U<  &#,6 -LdM⌐Kd 18108K0p8K05 -BTP @ 00`W ǯ0S P8Tp`@00X 8K0 5<5 d70 & p-LM 2@RP`0 Oʔ2RH +ʈ2R ? R `ph2 ~ `T2R L2RD2@@ !@0 7 71R 1R 1R111R 1R -11 /1RM !ʄ1R x1R p1Rh1>\1R T1RL1@@1 @ 01 (1$1R" 1R 1R10 0R 0R} R0`y Q0u p 0# D 0v 0   -%*C##8,6## -LTM_@`\ p?l p  H?T 9P  4P1S Ǘl ᰡl崠lP5 > =T> =T 2 = S! =@S h> 8C8??  (> R \=2K03KK>0K ? = R = 2KK"K@ 505 0S = vl= 0 m帡PY  T`<T zT<T# L<TE夡PE< Rn?! < ,00003KK <"K 0K*僡P$T< R 52* 0< R7  h;l 0l)  ;  lP ;M@[   K0+?A1c 1h h0 hB0 2c0*QL+0*:T* :T(P  P:T 幖8:l 0l,:  lP l0 > ` 埖9l 0l <0D: lPl P 僖l )l7Pl ^ |,9 \* Yt9\P  \p  \ |I0lPcl\P]5Z 0Ul0uO8\8 Q|8 \! `8R d8R P8R P8R 48R^7? 3 ? / ?+ ?@' ?# lp 87\ ʴ7\ 77\ 7\7 R@7 R 7 lp7'0HP dl T'lZ7Pl 6T9 <6T 6T6 T. 0 J  t6T:  寕l &l)7P5@ d6 R l P@&l75T 5T0 5T5 5 R" ~5l 0l <05 lPl0 S !hlp  p! 幟PZ !Qp p! 6PNp0  QP40Sp0@ ]P  @X`K@&@!4@T4@EK5K D%K RK4 p勭@ ᧫Pp  3T 3A3T`dP3 RC  3l 0l <03 R 3 lP:l0S > ` h 0d0 0lh0` 0aR0|S:Vv l0` 0Pt0 j | @3x  < x<t 0 4#0@R0S@0t0 3 %<0 S0 S0 7S 0 nS00t0B20S 02 BB0 C 02 R0x0x Px00x0d0| r6P0h`0` 0l0d | a`d Q |0R*Va ] |T`Al q @30l 2` h 0d CЇfii iii i i i i i "8i gfff`,6ii8iB-%Ci i i5i i i i i "Ai86i(i|8171"##&# l , lz5Pl0 SHl0 0RM  R 0R |0 lGl00l00?l T $2l+ 51R%  1R'P lD2%# lD 2P1RP1 RhAl0 q ;0l0 1l0 0l 00!l00S001 R?   勓,l l0 2 lPl,2 R 101{ 5t 0-M0LM PcR  0 R ?AKA A 8 x0  00 |0|@x0 Kp ̠0KPT0K R<0< Ca0"#h,6&8gfff -LQM? `! 0d 5@7ԧ0 3K?3K#K<K ?;'K4K DK$K 0|7|4K04KLKK T7 0%K5K?5KTK (7('5K K%K\K 7'6K dK&K &K 6&6K 06K&KlK 6&7K 'KK 0tK? @qblvPK@&@1@mH6@`@K KK;KK1 0@T 5 R* 0S R$ UAoK@@@&@f1@K  .@`/1 04K3K0O 10K 1 4K,4 R 5 dd4( K-K00QK3 ?C?=PCP 0nK0  P(`!0/  P?`! /dq5 @05%<+%<¿8j,f$$3( K S0BSKR/K00"2(K UK >K 0 2"##00  2P 0S P W_KVoK h2 0`0\2(K!0s828"Q1"W_K(KVoK01( KOKN/K00 0MPK&@E0@,1@K@ =KMKK<0 0\10K8KKK 0,1,!8K 0(K8K 0K?00/K7K'K 0|K?o&  """: ,6,6 ##"# ##*#!-# -LGMA0`S, 0p0 0P ``1 \K c.8K _.18"0C#K "K4K1p0C8#8#$0$#K@QBK* 5[90K 5KC. <L$0 B@$[\4[Q04KD 0  0000 <  L@ B0 DPp 0 P0 0C0 0 c0 R 0 R 5[C  0&b5#-6 #Qh-646-6D.6v'N$ -LM?`P(0Bp S?괁 p x 0H S$ ` H ` h  000NP@x/3P እl0l 㳀pT0 R    p-LM@!0! 1P` 1 R |1  , RU CRT1   R p81 00S ꀃ   0 8 0 \ 0 t@p0 ^0 V0 t0 h0 \0  R  R40  R? 0 0 #& 0-MLM@P800000|1 R?  & 0`!00SSS @1/K 4!0K(1AKA APA>K0C R00000000 K 0 K, 0AKA APA.K B00C S񟗽 ( 4 @ 000000000&D -ML M?BKI0 I| 000CSu#  D =40T p0S^XPpڼ8! #  1  P`C P`=04H8( K81BNK0!@@D(0K 1  P`# P`8 0(K 0$!  0  P`   P` 8L0  @ T -P`@ & p-LM?#̀@ ( 0 P `  000ӕ 0S`V@PpR 0 SZ-P ppp##Їf -<0(,0L0 &0 0   p-QLMPC  R?`:? ?-:?`000 0P@ V p-0S`+s է 00b=C4`#ht0  1> 0P@8p-0 $? `p&8h.6 0-LM?@+P"0 00> Ph0ϔ R  ( P 0,0B=C1? 0000-0&# R-L 2 0 0C SE긌 ، 0 X d 0 00 0 0 0 0 00 0 0 00 00 x0 0d 0\ 00 P00@ 00 40&&&&&&&&&&&&&& 0-LM0@PShl l ` Ȏ l h1 \1! 00,1 @ 1111 @P !1@P0 @ @0 000 000 000 000 | 00t0d0`0 @ T 0@P@0@ @P&&&&&&&&&&&&&&& p-LMP\` 0@S0\0S p(  d B 0000 0-P@0@@L r(00000 0-LMP0!0 }0@ 0K@{0 K0 K@t00@i00@0 0S ֺ0,d|.6 0-8MLP @4(t0 R 0s? X0  @0p  R0Z0x0 20h逶 # .6 -8Ll(PᵏL@6`p"'`0  '  ' '밠 J.6 -8Ll(PᵏL@6`p"'`0  '  ' '밠 f.6 -LM8mp `;s/000F@T 8#@0SP?U@0H?i$@T h@ 2F@TZ% .6:8.6 -LM] P@T # 1  00p , W00$ 0 !0*0!00 @@Z00W00S@ 1 @T 1  o㒵00 1( 8`  1R010000 0 !0*0!00 @@`\ 8`  101! R009`=/6L/6 p-LM0@]r PR0000 0` !*!0S00@@@P2 phT0 Ca8gfff p-LMC0IDPm@D `D20u? @$ R00000   R 0 0 0 @P/10C1p* -LM0@D!0N0  0A 0  pK0K@K @0 SK 0K@PW Pp 媴P P; (3 p,\P%2   O%  % %,6 0Z $ Ӳpڨ K0 K& (2 R R# R (pZ (p@P 0  @K!1@RTں1010@0(p@0S @K@00K@Tڼ(  ( 0P@?0 RQ1ᴠ01(s? ( pj!0R ʼ8  @pWL(pUD S 0$#|/6/6/60606<06 -LDM`MS, P` d0 @+ھ00 S0 Lh `0 d dpK [K!`K 0P\K`K  80KPp 8䢟\0[ R 82 ,0S ,0͆ 0\[ D /PsPP 1 8K VPoh  p0S#< 8/L@j$1̆6 _` b$  ^$ Z$`0h `K `0`0 p` 0`0 t1岐`00`0 p& vh8 0$1 R$ h0 h  0S !ᴓ 8018p!8 8 h 8pl8`TLRR0 B`0 d ,,d"l06|060606#16,16d161616 0-S@P L 0P 08 2}016 0-S@P L 0P 1 08 Z026 -8L`@P80  PP !+K3;K#+K3 ;K:00KM%p pᩍPpPK $PpPP 1 z 8 1ဍPpĀK $PpPPp !D3R pô~+[P! 3Qk a:3QvpPU@ 0|S:?0 K|! K+ K+ 2&K0 6K34K3U K#4V0K3f K4K:00 f0Ke K:0 f0[h K0  f0K:0 f0[h K0  f0K:0 f0[h K0  f0KK| $PpO0|@00PUH  |0R*Cs?K $pPp K $Pps =[ 0 K #Pp10 PU@! 0S:`K T!3HQFQ p 0p0 R2 0& 0 H0S H00 嬠KHR # @TP 0 @TT000 T0   0T0Hp0ҜH,dx846 N -LM@5p0  0p0- p-L M@%0pPt`x0p0t0880V @U 0@@pk74646 -PLM@E 0RA 8pP堀`U UJ +<W0  p0 o0 0# U*堠`0 x p0 0RT<p0x 00 h `P"U:0400 T8/8 -L M`84PP㈀ $8 ,   $g $@\  p $0  ,p@;0  , 0-  , p0 0p0| R,0H, h04"20S  $ 0  `0 `S 0Th0!20, h0!,2P0 000 Tlp @$0 0S> 0 $ 0@+0T:x t0 0Rt0x  $@lT<U0T, 0 0000 T@0 R 000 0pp0/8<.8 -LP `0pvP $  $ @$@ 0Tod -LMP`p}N $0 @T 9P80 T00 0 }N $0 @T P|@ mc $0@@T  0T 0Tod N -LMP `p@= 0T`@0DD @T0 T 0T 0T @0T0 T $i -0LMpQ` 0K 00PP S0@  T x0x@PU dPd0 0Q S0@ 0 044 08(odo`,od\` od p-LMp`l0lP P0P@HH D0 0S0X$0@p`(od8od$od 80od46 -LM⌠@p` 0PU 0 3@@0@ <040@, ,0`pod8d(od88$od8 0 (odod0 0 (odod(0 R 0 R(od8 0-@L =04 00P0 T0h. -0删S@0 4p 00  LT64 Qh  $  0@ T  0T  0T 0Td# R* R  0 T R RG   0^ 0 S0 00 0 T  $0@  T@0  T0@ L0T<ğ<$00 S Q0Q4 r T O< K :Pl 8S080m50$04 40plh`Q00j000<4Q 00 [0@ 00 xQ0 002  R g0 00@  $0`  T  $Z0P  T  $`0 @ TP@ZTU0  00  T  $0 0R0  T!0  T  $P  0T  0T $ 0  $ P P0 00  0P00 0S0 0 @0 0 pah^(od46o` \`d46  5656(56D56`56|56565656od6568 od'56 66 -LM0`4PY 0S@00 T 0T 0T 0T 0T 0T0S0'0 Tpp0 T}N $0 -@T [dXp}N $0 @T J0S\ pT  $0PPpT W066 Q0- L@P Q 08S0@궧  0-8PS@L ₟L4QK#~0ĉ PP*8 p-L Mh@V PK 0{P ,0"  000(^ `08 00pp80 -L MX`U(pK 0{P@)P(,0 0@00(PU 0HZrqH 080$00g ` p-LMP@U`e 80HphJ -LM4 < @ 4!P< , 80 4p8  0<0CR76, 0 90>0P`*@G S : R#: , Jc0 @`p`B0 Xp0C$ 0P8 R <0 ,4 0 zP@ 0P0NPP`  0 0B@$B -LMxPW$`K 0zP@)p$ ,0#  0@0(0(?^ HH 0p8040 0 p-LMP@`8 0Hph p-LMP勿h• lp2  h2l ,` B\0 @`0 DqT8V j0\2p0K76646T66h66 -LMh`plp2 p h2l , K T81SM h–lp2 p h2l ,hRlp2@ p h–@0l \@f|h–lp2 p h2l ,@cT\\hBlp2 p h–l 1\UDhBlp2 p h–l 1\66 -LMp 0@@T $0Z 0@@T &0Z>o ($8 0yPP t2 |,[03P P 090P P 090PP 0@900D?0P! 0T90"$@0>T 0ڔ@2|"@Th—lp2  h2l ,h—Plp2  h2l4 ,h—lp2  h2lH ,0 h—lp2  h2lL , \4 ,P ~d|{hBlp2  h— ,0l\dj{hBlp2  h—l 0\@ 4h—lp2  h2l ,@ Tt P@1@M>THEB\yh—lp2  t2 hB,0 0l \h—lp2  hB$0l \h—lp2  hB$0l( \hRlp2  h—l 4\hBlp2  h2l ,PhB, _Plp2 P h—0l \hBlp2  h2l8 , I$I00<#N>C 0ChR0l , Ȅlp2   h—4 l 0\2hbA$lp2  h—Ql0@ \hBlp2  h—0 :lH \hBlp2  h—P 8l\czhBlp2  h—lH 00\hBlp2  h—l40L \00#@z@ `:zh—lp2 ` h2lH ,@ T P 1PT!0040TXPX嚅0L8 ლh—lp2 ` hB3l1 \hBlp2  h—l ,0\p@TJQ@TPEZP866@%I$8!*8 !0 wx -LM HTe | H0S 8$T| l@ 8H SH0$(  0-LMhR@ lp2  h”l 0\0 -LMPpIUU U m?teh—0P00lp2 P h2l ,PHT hBlp2 P h—0l \2ey00C0h—Plp2 P h2l ,h—Tlp2 P h2l4 , X4$h—0`00lp2 ` t2hB x—,0 0l \h—lp2 ` hB$0l \h—lp2 ` $hB0l( \T8SP(R hB`lp2 ` h—@0 l\xhBlp2 `倀 h—0l \hBlp2 ` h2l8 ,XHl"00N>C 0ChR0l lp2, ` H h—0l4 \hBlp2 ` X(!h—l36@ \hBlp2 ` h2lH ,hBlp2 ` h—l:H \hBlp2 ` h—P 8l\lxhBlp2 ` h—0H l\2Zx 0P(0C0X(T(h—lp2` h2l ,Ah—lp2 ` T(hB$00l \+=%I$P 40 R(0 R0 RQ`= -PLMP |"RpW 0``00v VhB lp2  h•a0l \3` T2X"0 T2X"QHB,@T2V0CT2hB lp2  h•l 0\303 u(e㺘@`dehB lp2  h•l 0\Ql`\80\8qP`\(<0\80  h lp2  h2 l,|"`bh lp2   h2l ,`R |"pM6666(76<76 0- LMQP hB@lp2 h•l @0\0#hB@ # lp2  h•l 0-@L(PM0h -QpL@P`08S 0 R`,8S  0$ $Rp0S`@` TP$p@pPX76 -LMT2p0T20H0,08,8yT $PU 0SSoX@Y 4P$U  R00R\ Y "0ST20CT200ޏ3 `4 @0 0b@0 L @0 倠0 `#> 00Z 3Z 0L0$`n0S R000R0 A60S!0\@P⥗ R 00c0C20000#2w`n$0S` 4 00hB lp2  h—0l \Z0 00`nJ@Z$0S  -LM`@(0 S4p8PP 0$01l00<@ ,0 00 00C 00$@202LP0080004 -LMlhBP p2`   h2lP ,V5 <0 @ ȕ10C S1 !@ T 0 0 m nTph• lp2  h2 l,?> 0D <@0 Tp -LM`0Vp0Piu0 QhBlp2 h2 l,3 `VZ00hm10S  -LMh@ lp2  h2 l,3 h -L$MP%% 0 0 < pD8`,P, @ &P@ $4D@08 8 <2 00 $0880, T4  ,K4 <0P,0P @, k4040<0<@   *140<0,  0 0 4 0 22$p<P!,\H10L`0,0,0, ,0 , 02,0, $p[08 08hBlp2`  h˜0l \0S 0 R <P@ߕ` X0 P0 ,! ,(0=p!8Mb0 0  Q-L 0S S 0SQ 0 0 76-0#1? $ˀR 4    R 0 0 0 !1?0 P 0SP-(0,#1? &̀R, 6 0 0, R000000 !1?0 P (0S,P0@-@D 0 hPR 0@0x p0t0@f! 0-L@P0h -L Mp0,"`P0U@, > ,00P Ro PH Y4[ P0 ; 80 0$,S03( 00 0*   0S0000Y !!!!0!<00  cqP ;@400S  X 000o000, 0r00  o@ 9P 80(S"ˠ ʠ0S80 S0000 \888t8,8D8 -LM04p@P`/s0 0004i7 -LM@P0pl14 RO80 TXH1 R<側`P]090 r0 `  h0 zL0$ `R 090Qko0 #>XS @ $0S Z00u`PЇf7676 p-QLM@`Pp|T 00 @DRT0  0 @DRTʃ0p -LM@kP 0h -L\9R P9RL9 RR 4909R8 $9R 9R 9RU 8U!0IPPS񟗳"!D#!$!!$!!$!!$!!$!!#!$!!$!!$!!$!!$!!$!!$!!#!#!4$!p$!$!hB lp2  h—l 0\0ISh— lp2  h2l , ~hB lp2  h—l 0hB lp2  h—l 08 0 SU`0V@ C00BK 0( <25(  `40@ ^000P@@0 <D0*Q@8p0!@ 0)P`$ @ 0A,(0"A 0 P `4@  D 00p(04 0,08`090o0  oݯ860 0P  -LMP@00pSS 004`090LP40S lpfe0( 90 i P40S i霯086 - 0p`L<0@@pP4e} 0-0L@P80h -`V`A1V`LM$ ``_P/ P0U#p _0@ 副0S 00AP $p p@Pǖ U48o9` o18tod4od$8heX86`8686 -LM@0 00L hќ88 -LM (0("t0'Q0@K0 0Q0KU 00KR0@K l 8P@0KR0(p0tP@`%#7"00Ktod4od 0- 88 #$0P"PLX0A0T S >0S0 . 0tod4od -L M @ 6@a"0;! -L M@ 0@a"0;! -D0L#((0"4D!#2APTJ p0SGp<`(P 04000@`;00a@hZ ߚP*0SSS <`00$0P$0S hф82T3 ,2T 00S0 ef^@ 0e/R_01T 1T0S 0j0S e/|0S00L1T/ @1T00 0"  10S0S  0  㾙P0T 0%4400 0 0S0S0S S mz mY0S 0 0ymd4odr @sd edArdAr hdk~gd0;! -LM`@ePp<(00p04S80,0d080 4pt00 t, 07><4wtO.&(0("4400$ 0 0 i8686WEV0;! 0-D0P @L 0dP 0000P0H8 -LM0s@S* 00 0000 - qL`PU  0ˁP6PU $00<0$0@l0 P:00 @004;0000 `\ @1@!0 H P@00d@0 H <886 -LMp0PU  @ kP  r 0 S X 倎0`K 0/PP:P,dB86 0- L@P\P0  0S@ P0 0@8 0-T0L PR 0U@ T 0T000@[]@8 0-D0L@PT dsP @T00@8(00S S0S@8 -0L  p-LMPK@` t10C T#J0QZ0V0T00S p -0LMSK"*K 0SB$: t -T LM@HT00  (0R ѫH8D8hzd86 00H8 -Lp`P7@T@ h鸫 R(( `@ pp00 8686L8 -l`L@PTp P 0S `@T$h鏫0T0 hL896 p-T0LM@PT` P 0S @TppL8 -LM@h 0-pPL0S`0@T P@T00020#JP8L8 0-XPL0S H0@T P@T000 .P8L8 p-LMP60@`TL  (`0#pp86 -LM@ h- -LMx@0Slhd@T BLP0 @@ ߪ0 ,٪@TL8 96496I6T6P96#6 -LM@$h 0-rL@P@ 0hP P0 ,  0PQ 0QH80H8 -L P00@-SP@  0P PR  0S0P 0P 0 -LM@Qk o 0S`96 -LM$0p@$0 p P`y Pq P Pt $0S $=T` PK PW PS  @T N P 0@ \  0K0  D1D! <1 R41(1 !, P! % @KK0P00  00``  P  00 0ZKP PKdx etp 0,0 `K ,dB6h964dtzdpzdT8lzdhzdt96969696 fQp# fQ#[# fQ# p-@`LM @fRPPT  @TpL1e# fQ# fQT# fQh#0 R ~|XeL696ɛ i#Q0 _Їf#R#0 (8(8 -0LP4M 0X 0T@K@ut0 Rh@J P`00TALL00 R 0X  4tzd|zdpzdlzdxzd86 ;68(8 P-L !E0G`7|zd -LhMTa0lK 0 3P@<B lp# P, j ThK01@ TX0T 0 P0L 0 H0D 0 hK@ <K0@  0S ӊhKP@dPK P  T@P P8ʨ, P,d;6L6$;60;6D;6B6 - L2 -L-I -I L' -L" H -LH -L X -`LQ 0R 0 PS00U@ h% p P 000T@"0@S 0U t ea0 -LMer# -LM@, p  S `NoP4` 0S !@1(S! 0#!!0 V000 8` <` <P0SI <000Po0S`30  4 8<0(0 Q8 <0 ZY  !Y *040S R:  0 p ,0 d <000oP0 `P 0 11` R0040  \;6;6;6;6;6;6;6;6;6(<6 - ` 3p11#XLP@0XS (PnP 3X0011 ;6 -LpPPP T*0 S@T:t P p@-PP\`@ *0S \:T p0Q:0cS*S @V V 0#2 0S "" T @ 0#2 0#2 @ p-RLM@`P uP000U00p -L MP_P T*`0 S ` 000CSX! Y!(Y!0Y!+00 <0 @ @T:`*0&0/0` 0-L@\Px $t@ 0h_,8 -L4M8#0Z,0 PL LJ0P0 L p@ TP`A HKP I0D1S3,[!Z!Z!Z!Z!Z!Z!Z!Z!Z!Z!Z!Z!Z!Z!Z!Z!Z!Z!Z!Z!Z!Z!Z!@[!Z!P[![!Z!Z!Z![![!Z!Z![!Z!Z![!Z!Z![!(\!Z!h\!Z!Z!\!Z!\!pP@TZZ!0, PR ,snPr U 0@^S||P I `P\pp  6  / 0 R  R 0BP ^S,    l  0D R <80PC,dpzd<<6H<6TJ7T<6\<6d<6l<6t<6|<6#<6lzd 0-L(MdQ0\0 T1P10 a0CS]!]!^! ^!]!]!]!]!]!]!]!]!]!]!0^!]!]!<^!]!]!h^!]!]!p^!]!|^!  ̥ 0S 庇0 0A^S 㺥 4K0 @@TPL4K0@,d8#6<6TJ7T<6<6<6`7<6<6 -LM @ 剥hm#<6R- R 0S0 \R000Sa@\ 0-LM|P* uP@KPZ~0@vP KqP00 cP \0 0  0%0 K]PhNP TPP^lPP 8<XlPP (RlP <6<6t96964d4^646b7 -L@PT`p@Dt @ PP TP@Dt0Plzdpzd -LM@ P2 P0( P) P0" P0 P0 P P P  P p`f P 40,P (dlzdpzdhzd<6tzd4d<6 -LM@P P hPP  iP 00c0^<6 -LMp KP0@ PS@6$`KzP. T $0   $PU! T T @ 0 s0@ PS@ P f 00    $P P<6<6 p-L M`KPpF0@S@ PKPT T K 0 K 0C0 30@S@)00<6 p-L M`KPp0@S@ PKPh `RT002320 0@S@00 <6=6 0-@QLPJ@TZ0 0-@QLPJ@TZ0 Q-LPp`@00eT : 0c00e00000eT:p00e0$d(d p-LM<@<`04Pc0c000p$d(d,d 0@-L~S\i!$i! o!i!i!j! o!o! o!Tj!4j! o!Tj!k! o!l! o!$n! o!ln!n! o!n! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o! o!o!F&0S 00C0|V|f 0R 0 0CS0@6D&0Q3*V 0@R*0 0 0S0@:E5 Q* 005%0S*cUE 0Rtet# Qle deR00 PuP0 0 S0pP0  0 0 0dؤ^% 0S  0弄Rt00Q^ 0S 0^h4 0S00$T(d0 S D0 R 00Q300 S0QB ăs0 G0Qp3#0Qpcp dcd00 R 0 H P0 R 3 0c-Rs0b0CS5005@G200 050 ̂%@G"S 00CS0050005 0S RK0 dR 0 0DbR <p00 R 0  P0 R0a 0R С p A1Q`1 bp!hA0 0R:0RR0B B  0S 0S Qa 0R0R S  0R0R S0 Q 0@^S}P0Q0Q0A Q 0 00y 0c0c0 0QWu$d,d(d888zd8zd=6 d -P@L@PpP`P0P @D@PPP: P  000c,d(d d$d -8@LMxP00  0@鰊dd0d0 00ᰊd0dd8 04S00 0 0S40580dd0808 -$ L0S 00 8 -L 00088 -L!0@]S@t T !0@]S@00D SA Da0DSR\T_T3\TS( @SA @a0@SR@0@\T 3@Ut@t Tl_P Q:P00\P0S0p P@$V0?Sb0t!t!t!t!t!t!t!t!t!t!t!t!t!t!t!t!t!t!t!t!t!t!t!t!t!t!t!t!t!t!t!t!t!t!8t!@t!Ht!Pt!Xt!t!t!`t!ht!pt!(t!xt!t!t!t!t!t!t!t!t!t!t!t!t!t!t!t!t!t!t!    .P@ -:<P@  >P@0T,1pP, a00/TU# 9T0pD UA DA Da0DSR `TWpD@T7pD0s" @00DR Sa0D_TS7ToPOPP tPTP P xPXPP@(0P4d5dd=60=6<=68(dL=6 -LM||`P0Ulp@L0T UPe PUP0U00 P888 0-@PLP 0S cP  P h 00C0\@P 0SU00h:0 qPP=68=6 0-H1L0@S4!0CQF!0D]S& T T T T 00hT 00000P@00C 0 0 0n6 p@x0 0 S 0CRL000 % (00  y88888808 0 0 lQ 886 -LMS@ \00S SL L0L L0P 0^0?l 0 08=6=6=6=6=6=6 p-LMP@PLU` phȞ8`Ş0 ,$0h弞Pp`=6>6`#46h=6 -L4M4q44A0 T, 3*LKH`KPKTKP K 0L   僞 Lx T @Q 0P \ L0\ nP\ 0pe0T:`0H<0 ,0S D,L f(PO`,dN` >6D8(>66|f,>6<>6 -PL`%HpP@ 00CS 0} @TR@0Sq Sf SZ 0S 0S 00 4 S 1!0S 2!8S  1Q- 2!8S( 1 RT T U h1Q 2\!8S UP!000@1@,1@@DT$@DڝTB ԝ 00CS0 00CS0ڸ0 R徝(庝00  0 00Sv h00S 0So P00S 0Sh Hpf6HV764dT>688 -LMp0@SSHP S 0S iX 0  Pi/ NT`0 Q00 28 6S Q <0006\>6\;6 0-\L@P 2S P(N0P2 008>6 p-LM`P`@2S@T<ph1^cPT0"2 000p8>6 -LM@ K;40S0:00A0 R0  ` p-LM`@P1cP  0S  p%cP   -LM@ P0K  0 -0 SLP` :S0 `0SZ @ p2bS@TP t0`0`p0@2S @T:0T0 P0$bP8Hd>6 -LMP`@V 0FS \o錛P o釛 cp0S  S cP>6>6 -L M0PS` :S0 `0SY @0P , 0`K p R2S@TPP xW0`p0@2S @T:0T0 P0( cbP8>6!>6 -0LM pR K >TP@`2S@PT P Wp <88 -0L Mt`, p0 @–R\ ,0K@T00 ,0 S1051P5Hd8 -PLPM`\p 0K@  0SV 000Hd -L1L`MD0 PP(0 `pl KpKt KpP 1l R*t0S@hK 0@@ (0S (|l RW xK| K0P x| P@hK0@@ @8,dD8`7 ?6?6<>6 0-LM(P@ 0@?0Hd-00 CHd -L\ Ld - 0L0S Ld -L\   Ld -L\Ld -LM$@TLd -L\ Ld -0L0SLd -LAP MK!P 0Q)0SљH0@080 R0 R`x3Px庙t帙l嵙d X0cL媙HH0 @夙|f8dT?6d?6tzdQ`Xep?6?66#46$?60dDd0>0Up1 @TW 0@88 -lL4M 0hR,0 0PP0 ` LRH bR` (`LKHKp 0S! @P   0 p字0L  p壗L PP0S h0h fP<,0 S D,y8_`lR,d@6#@6@6lzdpzd@6 A6 -LMQ@` @h00CSꄗ!!!!ė!@!\!d!p 0d-LHD@1 R4 0dq0K0,0 dPU 0S00 RʸpU 0 R 0  Q00 x00S 8 0 lP -Q`P 0d8888ҏ1 ("P  Q !B0R05>`p0 pc 0"0T 0p 16 0 0#0T&8#0&lT#0T 0p 0"0Tl 00("QT 0 80k  3D{5;5+JN|A6 -L MR䢐`@  0@ 0"B0 T0  @ # $1 )Ru  0@ 0"0 T @ 0 1!xÖ0D#c\DQ , K D+[0[^0'0c "*$1/0a0` 0 A S0AĀ \!p0^:ُ0^* L("(@+ [ 00C0Q0և"0C0 T0)S{ 0 H0P@ L, KfbA6 -L MhrP䢘8`@  0@_ 0"0 T  0@ # $  0 # T40   #$ 0 #T #  0T  3 RT F 0P@ |3S7 H  0  0"0 T 0   # $$# $(# $,# $0P@ # $, ~ # $ ,P, 0P@ ,0@  !00C0| B0R05>0à 0  0"0T 0 16 0 0#0T0# 80T0!<#T  0  0"0Th ?(P0"P"# $ 0@JN -PL@p|d1T`: -P1T 8 0~R`4V h5@`6P`505 0S '$80T 0T*.0.X%A0@S S  ^P`5@05mi i 5i 6i( -(LM"(@_pW8 D`P0@\  iUSA@0  -5L,p`0 <5 00 R0 R\RU@ P5<5 U0S  U 0  U@P5 <500 R -(L"hѼPp80% V0`P@ mV1T$ UP! PÚ\   0 0e8#h ዼPP@  0c0 000C b b(0"X; ぽ1 [ -LM@rb@38#00@3PU8# $@3PU8 GA6 -LMRr` $ $ $`@ $@D@ -LM8#x<3@TP 0b좐  0pD@@lH$H@ @dHDDÕ$x@ -LMQ@P삐r`  \0 P `t@T -LMh3@S3S0h30S B6 -LMh3@S 3S0h3 0-@L3S8P*WS`G0 -L  p-LM9@@?0”PP"0`T2"$$0 0”"0Tp#00”#$@ 06 -9/P@0B``L*~"0T•"0T2#$ ?00S S•0#T2#$ 0•@0#TB"0T•"0T -LP0 T2 $2@ @$@T# T p• 0*^Th h0jUd`@ 0@lUThUT T$p0@#ppĦ!!8#G-AzMB 0 0Cjj0V` f3Ά⼀ f bʠ srʠ 0 P * @* !0# 0# 0#0#0#p'4 1J1# 00 z0Ѝdd5 -!LM 0,0  m0SV K R LxK*l!`0 R1CT!0#0 00b0 H<KK8 [<0[ 7 [1[ 6 [9@[ 5 [0[ - [2[0# 3p[ "  @$" ;[:[.[/[娐 4`[" <0K0,.P"<K 80K;K:K9@K7K6K5PKsd 0R 00 KXa<K^0 ,0S ,m,dԓddd0B6 -<3LM,c BPPvß#03QB" QQ2 2 p0 P@ 0Kb 00 ,*A4 00ca bP`\lQa P P!88S Q4  40@040 4 @ 4  40@040 4  4 40aA040  00bC2S0c0S4 P1s0t R0+A"RX1 Q> P40T000  p:#04 0qcp=<0 8p @? ?C4``@0 @0 P``p8@0S<0 0S <0|0hP@0L  `@`@4 ꠑdd8d8DddLdԓdԑdd d -L M0q`,ih@0 0Q3 0 R;C"0% 5Q+  0 0,0 P0K/ 00S 080R 0S\̫0B`P 0 bau .00  ƫԑddԓd88d d 0-LPFQ 0ܑd -LAM䐟0K_K,0 aIK咫<  R !x+,O+`@<P t0`p T`+8} ,0S 4,bl \,dԓdԑddd8@B60 ᄹd -, L0S  hhꄹdd p-LM`@PT ph h  00 0  t @@ X0Q H0R 00 !cꠑddd!d!dԓdt ea0 -LMTpPPH` KD +@0  ԓdd8d -LKM⼠0LpK,0 ݪ * P` NKp` ۪ **  * &4# ,0S ,k,dԓddd8LB6 -pLPP WTh꟪ 4*00 P` ` h靪ԓddd8 P0-LP0P@`` @rP:0 88#P -LM0Sp, P  90 0S! 'p@80S\|0! 0QR0 0S6$0, 0TP U@KY 0 Za0Y Za[ t ,  0(P '0 0PP    Keo` -L4M$|`0` D 4 @ 8` <` L` P` u qP@ rPڴ5 Xf4040 P@D PR 407P@l0; p0S,0 0, pH /0K;P@%00HP DP0S S 0PpcW,00PL0S L0 DD QPDp @0P<\ D R40 V 9.0 2 9-`@LP P04 8P  -LDM4  000 8  < <@40@PH@ @(4`p$0 Sd$d40SL P @0P<3TP ʯH(3p8@`Kh000@ R*H`0K ``K`0@P 0P0K08`Pp0H0P`UD<H`0 @/0@`S:(3D S:Y<`1S% Y4 R YD3L@0c04PP` `0P ?T 40 <30o( Ph(|2 Ut< @0X@ TnDŸ 0!0Ug0_l0/<`1S@ _,>\0 0S# < `1 S000 l *0K!tA*0[@up0 S:![00b0![000![00b00S <Zp$0  R*0 S`%*/e -LM@  -LM@ 0 @b%0@ [% -L M@`x80p0CS?ld0lPPd p | 0 D040P< 0R 0 PlpH<Bl@004;00ߕPٕt(68C6 - LuC60@$00CS"x"x"H"""""0 `1S  0%00 ; < 0p@-P`Q@1!2n1[/73n1Q1Q0[/ Q@& 22a11U3a11U0S@0S` C0Q@ 0 0@C!0"b12cp0 Qd5 -L4MPK@p0 !!0CXa00/A!b2c2c!babSD[0^ l0 4 Pp ^PU \e*!l!P2@0P8 Y f400 00U \F*80!l!1@Ye0P J400 0 0 , 0 0 0>.0 N^@PT \*l81 @e00  0000  \*!l!0@0P8Y 4 00,00S0c,00, a08 c@T;"@<"t=" p-L$M@P0`   K 0`P0Sp -LsMf q, D  ! 1 儀 |p K5PPȁ ́ @80S P10ş,0 S |,NU!0 0 PPT0$ a00 PP`@K 40PPP5[S Pq00 X 4$C[ B#D 0@jPP#[ P q2Spq qWy  00CL1aR ! DijK10. $ioK! 10>0>0S0b1 @2R>222>3031 50pq  p000 #G0 _%P0000$``p`Ƞp!k?K pPt $0l 1jK!0Q! !  .a bq00C D1aS#[pWq @ 20CS2T+",",",",","Q3 aq0 pb@nK mK >KPpH^5: 0^*  b 00b!$11 0#[1 a`Va !0p1 )%!$k?Kp` uP|q P$0%W0>0jK1 a  c. . i?K!`#[ a ,dD65 -L4M 0PL @ 0 )K3SpH P GP10C8S1D RBB B"D  @D0@'P01 1"`WD@0SW0 S*jp @0 P"`V @1S 3 41@04  0 h3@.P HC`0S 0K)K 0@ `1SPP)0[@402`VD@G 8 < 00CS9p/"@0"@0"@0"1"1"P R0 H0T4  H0 0b40 40K 8K0>01! 1s8 40 !1 4!Q80%000 0a00b 155 1%W hjD! L HQW P $SH0SH@ /e8(D68 -LLM@Q@D1U d0 ` 8d0K00"pW !jPp@ `K !j0`0 0<X0 \ 0P0 T 0H0 L :D0 @ 080 04p < 00 0$p (p ,0 p/e0S -L MBpBP ,0  ` 0@P@"@2V*0S @T:@W R!O! 0 PP: p  0P@0 S 0R , '7P -LM (14 < @@ Pp 0St 7 P 0 SR*0 S  R:R*08 S S0  Q Q 0S4 `! S S `0S S SQ 00 Q Q Q Q Q 8 00S0 0!D0;D0  @  00 # @D 0R0 T0S .,K P@{(1, 0(100,0, $,0, (00(0,,00C,0,(04 0   (1?0(1 @?  `4 680S 0 @?8 `6? (10[+`00 0P0<@4"(10(1 <@5i(1! 0(1,D0 001@  D0 100 (10(1 00(1C 04 iY ` P ? 0S ? 200 X01$ `+o,xEk0D6h48/e4D6 p-LM@P0c0? <Ad`A + 0P?`p p-LMPU`% *@0 PR@ U: @0\0 ?00@p  -LM0PUp*` @0 0000 P00X0#02SP` -LM PR@0:#:S(0:#:S#j&jV 㤹Pp $@ Ȍ qΌP00 ``xP@0  -LMp. .\@0  `P`$@ @IP@0`P 0  00P 0R  $ . . 忒 -LM@. .\ 0P p`@@ ȌqΌ$  p-1!LM1!0@ 00>0>0^`P 1.*!n!00`G/ 0B!0b0!P PPP0^*!n!00` 10G?  B0 P0PPpt=" -4$LDM0'K_Qfpp}mU[법A5j!m @p 00 pp  ``0ß0S 0 0 80 < R0< @0 @ 0S00 0#0Dp0H @ !0 ',0  !03(3 I15  p| J J` P0@'0 `-2 (0.[ 00PU0|"|2P@@0@A Q#@Q0@0pǏPK @2PK@4bFPFPp00 0_`P@`*1@@@11$ > 0@!k!A8+|AD*MtP0S P0S㗌@*$3%H@K⏌ ,!P11PUaxN80 P P`Pt0S @0  HA0Se500S P= kЇfe5L6dHdddPd&l8@D6M#g# d dd 8d\_f|dlddḟf 8,d(d0G"HD6\eTD6*8`\D6L1e/epD6ddPd,D6D6D6pI"D6D6`I"D6D6PI"D6D6(,D6d*8|dhhP $09$00 P@ p 06 0 @ 0 0( 0 @CZ 00B@@Zs<<1 sPHP1P kP\xd1d cPppx1x [Ph1 SP _ P KPKBP K@"@$E21@@41@4B> -@ LHM0, X 00 TK0P0 T ( PP0 S$ kkD(E68E6`E6 -L ,0P  -L M`0  P@D   0S<0S90 V5*Y/ ,0(p0,0z0V, K  PP ,0( 0C,0 U ,>,0V0  0P00` f 8$F6 -L,M@ @pL P OP` ,00,0 RJV"HW"\W"W"W"dX"X"8Y"HZ"["0P 0S70S45 U0*(0P0 D KPP P &,0( 0C,0P!,.>P  D0NPP,0( 0C,0 ,>P,0( 0C,0, > 0000   0 000 0 8C80C (0B8 HK 0 0 040H0  0PP0@0H0  0PP 0 00H 0 0S$0<   0H KH0P0c0S P0`0PP 81   (0P $< 0 @0 0D0x0S Ps@K  $ڸPPj2[S 2[8SS C8S S\@  0PPS  :@K 0S40S00 8Ks 0S@0S@pK $嘸PP(2[SA "[R7 1R0 0  !@ @ !L 0 PV 8K@㺒K0 㼒KR0@ 0[@K 0S40S00 8Ks 0S@PL  8~f}fwt@vt -L pq@P? 0aV,00,00000 ,0( 0C ,0'V 0V@ 00T   1 2 1 1s 0T@1 21,<,0( 0C,0 ,< -LM0 ! @ Q 1Psbp 1 81 U $0!'! -LM@!pPW. ,00,0 b 0Q 1s 1 01 U 00Ui%   1 0 1  -PpL(`0S @ @ -LtM`p됀KP@  0 ,00,0,0( 0CP,0,U 0 0S@P p 寷P; -LMp`PP* ,0 0R,0 R0S<``0,0( 0C,0,;-`$@ 0 7 `  -L M, p0 , 0!  Z PP0b\! Y!04   Vg0EEW  c03PP +B@Dx8 X0  R@0SB4  c03P- +B@ Dr0 R U  1 2 1 1s 0U 0PZ P00P1 2104 S@ Tp@ T @02020Tp@T 8 -L Mp 1Qぐ2 A' 0a ʳfij`   f໳ RH02 0"2 SA' S', 0 00202a ,噳,0@fᑳ00202c0 ኳ00PfႳ00202S,00000'('%'! -LM@`p PK 0S Sz``1 \/0L0H]0(0 R 0S00 0 0 0V  000W 00,00,0 0S0@  0^ R1s 1 11 ^ Tpb1 11Td 8dXd,6 0-@L\TP @00 0S 0(hd00@2000D 000 @2 @0Ծd4F6d8 202 -pL<{\PD 㲲P P0\2fD0 `P0 20BT0Ҭ 0 ' '0 0B @B`儲 ဲ!C{ w00s @` V 0S 0S ` V 0008 4 < ` V@ R 0s  ` V@`cVڌ Vڦ?`cVV' 9 0 }xԾd -pL2`0C(2BP@U R ,00,0 5PU@Z000S&0202SP P4P <Pdh\'''0Ծd -PL MP`4 (  00CS 0FpV Q @0 0S' W ,0( 0C,0,80S@ R000 . 00C0@\@4K$<@K@㶒K0 㸒KW,0 S( p,@0 6,0SʩTdd 00C0)8 P0 0 p-L MK` KP@T0 p0  000xX@0$  00S0@P(00(0 ,00C,0(0,06\dP)8 -L$M`8 P 0S ,00,0P^P$< B @ P !!@4 <PP?4p P" @0 :0GPUp  0<S< ' 90 P 嚱 0 0 B 0 4@ W 0l !S <Q8 P 0 4K 408P0,0( 0C,0,50@K PP@ -LM0pS,p @`PsJ ,3Y 0S8P < !4!0QU 8C(0Q PU 0v v UB 0,0 0 0$0 ~80` P (00(0* ~  (0  (0W  ', ~(0` R0(0 ~  ~(00(0~ WPP( W`4p8 ,0( 0C,00p,0 0 p p00fP,   ,4 0,0  80  0Vq1RnU rmPp ,0 0 ,0 00R]*40QUY 0V PUR!0S )8d -LlM Q$P  S% 4 P,/A#bl p p@K \0 0  % :Pip T4RL$002c2c30 xKB5 t0p$x0P 0p 0 =9@ =C  0p }0pS`XQ#0#00F02}YAp0Sl0S x@K 5xp0\0 p KK| 0cPl=9 A = | |0 2R"002c2c30 z Z0  h0  !! l t0Sy #Y ` 0X\0  h0K0`0K0 @hK R 0 0 00  0T m (   ( 00C0X` R\0\0 00` \0 J}1G 0`01 ' 0 (0 0(0 00C0ZH,} " 匯 %}Yp ` 00 0 @(  ( 00C0 }800 F }p80 P(00(0  B | X, Z ⌐ p l MbQ8?BXF6 -LM0 @$P`|A@p 0 S |p000 p-LMP$`p 08O*0 H0p -LM0, X$p4 1@`T 0WP`/ U@0X8Q q < 1@`T 0WP` U@80X:llV,0$80HbVP4,00,08  4 SVP\dd -LM0@  t h p 20 0-@LTP 80 P (00(0 @T0 p-LM@`TP 80 K@Tp 4  -8 L0pS`( 00Q@LT P 0 P!4@0`84P 0@4P40Q000p(0 8\ 0< #4# 0Q80 @q$8< 0-80P@Q08#4#04 < 0!0LS0  Q0 0 0S00(080 R40hU40,  , 4d 0-@L P~{00  0@(00(0   n{0h 0-@L Pe{ R 0 0 00  0 (  ( 00C00hS{P(0 0 (0!P -L$M`"0$0( PP@8pW@ W @4h*U0 0 P@T0$0!0@;00 0 P@1 I 0 0VP@  0 @p 0,KeP@/, 0@0b 001 Y$$q0S  p*0TYT$1 !S@#@3R 0! $0S: 0S* @T  0 4`TP418 (1TP#2@0T00S D/e88 -LM0D H" L P0  !0 0 !D"LK0? p1 1 Q Q Q 匡 0˟l1 h! n?K `1 \! >K/K KT1 l < dQ 0P 8P XQ HP Pp`:mrH0P @ D0PS R   R00?A 0SD?: H00H0 D"`Vp H0#K`P2 Pd7 42 Pp?K` 0"R? 4"屮P42p@ ?WpWK:H0*0Q$8PL" 0p[` SP9P'p?l 0  !0 0 ! S0@ H0 D"0`T2 V 7  42 娫Pp?K`0"R T" T" 4"YP42p@P2Pd DX0 @R T"0<  P"0100b0P 0S42 p !P0 *h0$P 0d0K>0#60`00\ 0. "&0 P0>0#60X  T00Pp~42OKcT2( 2 K P2<$Po = Pi * Q|1IS0# 42 婨42  0I? Pp plp @!0!!0 0)0 !!0 w QZ 0  !0 0 !2 0  !0 0 !0  0 000 v%P'otRL"p 0Xz <,0S KPD< H2 K( <P800 1?l 1S H R < S <H0 7  @0S@0[70@0S0  !0 0 !K < l?  0  !0 0 ! x@)70 0000 0 0  0\ixj PL 0 !0 ',0  ! L@D2  0 202 0`  20082 0S/KK 82 4#VPpH;M KjPpD 0Q @ yPp#H@"D00D082帀8"0082@"82$ 8(00(08",00C,08(0,`Vź.< 8w@k\!0Q8P ,QL"p 0F!P'n;Q< 8Q0Q 0Q0Q0!!0 0'0 !!0!!0 0 0 !!L7.xb00C dl8Q`/e)8Nh48 -LMp$K4 ,@P  `@ PT4(  01 B10R,0 P@( ,K ѩQ'00K@8,!P4( 0,0 B0RP,0 ( 4K  㷩P@"`V@J,K ᬩQ'00K@,P0 ,0`V0P,0 Z  㖩@P  -LM40Hv 8h"80,S000000000QP8 R 0040S 00 P8 00 A0 !&00 67c@Y* R0 E, <0 0000  1,  0 0000  # 0 0 000  {(@yQ۹~0Bb0 )88`)8:6H8dM#g#/@J"HJ"ddd PdLdHdN\_fF6 -LM@_P lP80Q 80S 81 R QTd 0-0-@ML0KP-.@ @P@ 00 !0 0,0   !0I QU00꘼d P0-L@8P eP08 I/QЇfF6 p-h0LMP`U@  pwP(  0`@PpOd)8F6 0-XX0@ TL  P0 RP @T0)8d -Lp @P`60 P 0 0p`p 0S 0 S  -4 @Lxd `8pP 070 ' 0<$8 R0P  0AS긲"""""p""0S7  0 00P 0000  0 0S0S 090 '000 0P%0P0CP0 0 MPP000 R 0SO0 0 0 0 90 0S &0SJ  0 0S0P *0:0 R0U:0090p 0S$0 0000 0$0P0CP0 MP0S000 0$0P0CP0o 0 @ 00 PbT 0S 0SB 00C 0 R0S00C00S0  0 o0Sl0Si0P 0S 090 0$PP- S0 0S0S090p0S4M (iN$gNЇfp @ F6G64G6XG6xG6G6G6 -h2L MP`@ DD,P (O CN PkP_ PYPppsoAQgQ0 0S1 V>0^Ã0WPŃ. B&, !0,  00 eP@+ t!t0 0cC61 Up ,0Ų0 0 e R0 e Q @0003o*10T00S ㈞ 0!o@Ppp P P pp P p p P  P P p p PppPPppPppd*8G64H6d)8ddTH6 - @0 0cC61 `BL!bQn`p T 0 S0``00`mn 0&e ddd)8@-TT0P@SH0ɠ ?#/0B!S 0R !R %5*8*8*8p` -LMp|`00 Kl !@6$ K@_dLPP @ 4$@0@e0H8*8`)8ddd -L0à PP PP @P@ P P   P   P  P P   P  PPP -0L|H6 -LM0@ ;Ph? -<0LM   @)0Sh,Їf -LM0@ CPhp -LM @ Ph`0S00 00 -0L88!M11p *`@0 PP0S #@ @ 0@ 8PK0R<0 " 0w"< P"Y @0 # #P "e5Їf p-LM@P`@V0D  Ppph# -LM00 3`0 P0Q&Q< , 40 0 l00@00000l0D`4040, 80 Sl 08 a R` 00l 0D @ 0@$;D H 0S8<0 D ,0l00@ H 00000l>H4 `00  4Z< A 0l   0 l\Z 0S 800S80 ]l00<70Q@00 00Ol 00500"00P !00  005000$ !00SPJЇfH6H6 0-L%lP(BE@lu 000h-e!Ce -LMx0@Sh Fúh-e<0S8<0 p-L MQ/A`"1) ``@tA?#)h1 @PQ?# D1@)00!S 0SJP A  0U@@C 0@@C 0H@@C 0P@@C 0@@C 00@@C| x0@`Cp8PdTdLdHdddddtJ6.8J6dJ6dJ6dJ6dJ6XdJ6dJ600d 00CS0?d 0-0LSP P @ᡝ000 0-L@P Pᒝ000 0R0 81 H 0-LP@P0 08 x?P00  0"R   0-L0QP)@3 Q 0P P0@ )T 0D000Q^0 000P 0 0S P 0T@P8 P ( 0DT@PdP&Pd -LM0SP`p7 S P@ T  >,@S0S0 000@T 0 0S @TW pP8 @T   D@Tp PPd p-LM0P0@^ `V 0 0^ V0 p\0T@ T@@ TP 0$0 @c@'c0& p-LM0(@KP `ᾕP0  p0 -QLMpPI0 @ R  0R`0S  0RrP-` Qڐ0V 0GSH"""""""X10S0S0P 0R W   Q0 PQ0ba>0>0$ 0)h0ab0P\0HL0 /<00A0@0 @*8 *88 8\ 0  -L$M@ , 0 40 #c0 @@0Kc@K@0 0 @0@0 ,@4 00R000 001@K\1  0OH PKL 0S@#-Q QPn`3% 8. p80@R/ 8"M2 0S @##mSPU`!q p0奎 @K3' 7 7,@  74X 8< @K@KP à ]C@TPa`~ pà &7@K( 74@@K 7@Bd8 0-LP| 0\ @ IH 0h֔0 0H@0@- @P0P=9@ =C 0 0P=9@ =C0 0 S  0 \00Z0?B p-L Mp`@PT 0X LN;@ ㅑ0 0 pPG:00H`dL6.8 00CS0<d 0-P@LH@L@00" -LM8@L ,0,P000 @L`L6"L6 -0L@ pa0P50$a`@0S 0S 0S a0P50$aL R <Q@0@0@0L R0SЇf\d 0-LPM@K0 0aS0  `=9 = B 0 0 p0Q=9A =C0 L0 S<0L <0@0L0L@@0~aH050増<@ԇf?BM6 !0Q0\d-I?8,00 $ 0 0, \d\d@-I? "Q@@00 00 0S0 >0\d\d 0-@L0S 0LQ050,a Ug 'a0X05P@P R0000 0 R0 50\dЇf\d 0-PL@ a0S  000@0000h`\0^  00lS R00@(*8,*8 p-LMP @`T0`SX 0 R0Z<00@4<0 R00T00T0ph`X R44 44^ Q4 ^<000 <0@40P<0< 0bS -LM@ `T T00CQ000 0 S0  0S00ht`(*8,*8 0-PL @l`T0X0CQT00X0 0 S0  0S004 <00CQ 0hM`,0 P 0SP,*8 0-L@PP XP 40S P0<0S -LpP` (@ T $0 `*0" -LM@ $0S :S0$0$ Rh 0( $0S0$0$>M6 M6 -LM@0 < 3! 0P0$00"8 -LM$0S@ 0$0$0 S 0$0h0$0hAh0@-P@Q4 P2 SC 00 / ^(@"@"@"d"d"d"d"d"d"@"d"d"d"d"@"@"d"@"@"d"d"@"@"d"d"d"d"d"d"d"@"@"0  Q 0S 000  Q  Q 0 S S 08!8 0S -L M88 0@, (O 0@n7 d #.8pM6`d 0-LP Y8(O/@ԗ0810`d(0(0( 81081 0-(0L8!PR @(@0( 810CS810(09`d -L M@PD^`(P T T,pKX* !, 0 $ (0 1 $ 1$00$0 1$00$0  1$0@0$0 T  0000 02PP 㪐P 0 $00$0 $0 0$0  -0P` AL r(@^01 0!000X8<0F 0110010@ 1 100 1011001011001Q t1! Q0  !  !X101 10 1mY^101 R 100, 0  !0 0 !80S 0 0S 0  !0 0 !0  !0 0  !0 0*8D- 1B#20R00S1 11R0*8 -@L (`P# pP  @ 10 1 ! \1010!!!0 !!! ! 1S0 10  !0 0 !PQP0*8 p-LM1@0P ]0`S S `]p0!8< !S08<1 1010 -LM(@!1!0108<1 J0\P xM6 0-LM(@P1 10 1Q#P0 K LP0 1101  !00 S 101 !01  ! 01 K 0 ! 1 0 夏P 0-LM(@P1 10 1Q"P0 PK P0 1101  !0 S1%Fτ"0#1%( 3(F mP -@0QL`p& RPP @ 0>PT $r 0 R0 b0h -LMPS`p' <1@T 80,S@TX00T^\ 0P V R8 @T 80SD@T0  ^0P V 500CSgPPd P-Lp`P$ $` VP @T U 00 V  V 00V U U U D@T P@ U 00 V V 00V U U Uhk -PLM@ P h p-PLM`P @T U00 00  D@TpB -LM0A P` (@p 1 0q(,$am(0  <  < !p !101!  1V 0 1 0!1 01010*8 -L MP0p 4 dR0 G u t03 a0 1Q10  10 000  0  ! 3 ! 0  !  !.!0 %0  !@0!!!0 !!!0Q Y[, 50SN HS ,O[4QLo0   (200Q00S#&100Q00S 0!!!0 !!!S/p I/02S200Ň0!!!0 !!!S@1  0   W Z& 0!!0 0%0 !!00S4  00S x0S0500!!!0 !!!Yx0S ~  {Z~ 50S{l00  0 0S00Ň( 81 Rl #0*8Hid& -LM0`!30#P13\ p0@à@0!!!0 !!!!0` 0` !> S> (0!1S S  t:0`0  !   !80S  81 RS?Z8Z OZ MZSZ %Z0`  P 0@!à 0!!!0 !!! #Z !Z 0*8M6 0-50L`0 , !0 0, !@@$!0 "0  !  VhX0 @PY0pS Y000 0@@0Y dd 0-0L@T P00@T00!!0 0"0 !!L 00 EL Pd -|1LMP @0r`(@0 !! ! !1$!,0 0R00 ,1(40 0140 00 ,0S5 Y1011  !1 1V 0 1 0!10101gY 0<  < $ Q001$1(1,140000,0 0 oЇf0*8 0-0LP@ , !0 0, !DD 0001 0hc(0$QPPN0*8 -p#LMM0 ,0 00 @`$D 006:D R @0S ,0 S ,PPKI" 0p"p19!P 0` 00 K0- 0P 0 @ cPP 0MK<1   0UPP<80S P <0 <@U,\8 016 (1S >FK 0 <8h!@0"00U/@ |KP (P $1pKh0 (!`P d 06\0 <&X  Ơ0T p PP< 0 PP8 8[<P p`@ٺPPPL 0 9 8 0S5 0S$1 @,d46LM6XM6N*8dM6 - L xN -LM@P`p僇T0EP@S######################p $ 1 01410Їf4 1S01 Q0 0 0S00 0S 00 0 P -QLMp`0S @PU 0 0C W0SUP!P P 0 e00 0@epe0 S~P D0  0S  p^Їf 0-LM0PS- 0SC)@ 0R0 0S S 0 B0 0@0@ 00 K` 㷉P 00 P0-LP@T*@T:P 0S* !0S:0D005M6 -L@`p PP0 Vp P  00 00S0@ R0000 0  p-LMP @T @Tpp@T ` R0000 0 V@T 0- L@P2P( 0 S600*8 $0R0000 0 *8 -PL VUp ``@T @ThV(`@T @T*8 -LDM0`SP\` p 0B S|!XK^P@MX00C Sj#### ### #(#0#T0尡 S PH\ P@.X t1\ H  a R2: 0mJP@'\`0 \KA0TK 0 @Q XT  Q  ㇈@ SJ \K P@d`\XT-HDP@v#*8\_f,T%$'#,F/,!% -LGMĨ\, P`p @% 0B9S9##########################################################,0 S ,0BFS񟗛 # #( #@ #H #h #p #x # #!#h!#!#!#%#!#\%#!#T"#"#"#!#"#T"#h"#\%#\%#|"#"#"#"#"#"#"#"#"#"#"#0##`######## $#$#8$#@$#H$#P$#$#$#\%#\%#\%#%#%#,%#4%#<%#D%#\%#\%#\%#d%#|%#%#%#%#%#�&#T6 @6<6 (6$Ɵ 0ƟƟ 7앟0 0K PPW 0S0\80Sro0|ihş0 L@P00W00SP(5 E0MK 4 I41P0F A < 744 -ğ0 L@P00W00SP H4 0s 0n4ağoğmğk 4 ̠ßc 0Y 0T0 S<0U KOKϪ PP3Q p3R  02L 0@8CÃ,3S 1 01Q2 2 `2 z"0L 0]"""`2^ P2R  0ZL 0 24BNK 08 zPPx8!0BSR nlL 0@?c!!!1 Ϡ&-UL 0OL 0PHL 0RA  0 <( 04PPaL 0%)L 0 "L 0l ,dM6<$6D$6$6(2e8 8 > 0K0 1 z_08 K106, 84001! 0nO 0rϊO 0vO 0~oO Ί 0O  $0冏O !(0O ,0O 00O 40O 80O <0O @0O D0O HP00 L0T!P=9@ =C, 0 ,0 ,00  "$20 $ 41 !01@0 !@1@5  00 0 1I/`0` X0Qx0V/@> 300&3N6?B1%2 -QLTMPQ0DSP U 500CS00   $| 0 00 80K`0 `0Kp=aX0 P0K\ |` XKH D T @ <` BPpT  40 T T,4pl lp 0 8l`x x tP 1  0AVd p 0ySw*dKt Ppt xh0K`0 @PP0K|0@p pXK``K 1R50S \0I/}=@ 0#1"S " 00 ꨾ddfdPd-8Te% p- LM0 P1R@0ll00BP0 0CS0 ktP 00CS0lphdf 0-P0L @<=@0I/0P50 @00@0$0h*=Їf% 0- `0RL P=H0 I?@5  D00D00h =Їf%O6 -LMq$PK`$ P\ 0 b0aS$ 0=9 B =$ 0 $00S,0S00S7  0PS0U 0S PPp0Si0h 0T0S <4{p0x-8P68P6QG?PPxUs. @0 0 P`0VfUc^` \V D\( -\   \ P @P@ P 0x\0SG 0S PK0 00  0O02PP \ \|@K0 ^| K00 \  0LS\ \   @0@0 @  0S 0S  Yq q 0x @R00 tP00S0000t,0S0?0,0t80S00, 8xP,U00LS6lS6S6US6 -L$M80PS,  (0S KKT re 1R0S PZJ ,@@(208 40 R00 Dڸ`帀0p 0@Q6R40 4@ 8@ 0H0 0@@K H0@K@@ 0H@ 0@RQ 0S0@ R 0  0Z (j,e/ le/lWEV -L,M, <,4 D ?08p ;"4 WLp 0 Pob , l8 0S ? < _008p@0 @K( #<0 0@$@p8 " P'! `VU@<0, @@K0@# "`P PU ` 4,p0@ V ,4<0(8L 00 @@0`pF80X,L %05,p0@, 004 ;0000`S6 -LM`D 88#0| 40 , 0 a@̡ 00!1  0,0  l@<  R TUş d <  B?+$0O@ 0 W5 U44 20 @8 P0 e0,0  8 0,@P0 Q0 p` @0@ X < (0R 0 `#,f5#T6t7 T6$T60T6: P< Q$  @0@0  c  Ba  @0BSH05 :P @ B Q0 : QHS0#03 LR0S4 L0d0f s  )<R0#03^0S< 8@ 0P L<0 0QP8@0P  000 0P' ,#,0 p0@4 L ,  V6 -L @`PBpF PI \*PB R?T+ 0T! T U *0DQ 00 pp0000D 0W ` U*00 U R000 OPp  H  (V6PV6 -0L@`p# PPp0U W P  P @R000  +WP$&@+T00 V6e p-LM P@* 00  00 R 0  @000phn*`h*0 p0 0S0 0  @*` ph*e -PL M@ L 0@ @T  @T e pV6V6V6V6 Q0-L@0PA 0R Yx0 0 PR0 R P P0000 0S0SS RRt ea0p eh e-0x0 R0  0^0\\00 0RP00t ea0 R00l e0 l ex e -D1L P@p+* 0R`) !*000\ 0 AQ 0 `\ @1@!T 0P` 0Q 0Q`0S@0T``` P` 0R ) )#t ex eV6 - L@P)A@`p 00( Sp )t e| e 0-1LsDP@   0,0, 800<0)00@) e.8t e -LM@ )H 0S00  Q0 0 0S00h) e<0 A P 0-0@ LRPD00u 0h400000 0l e| et e p-0LMQ@. 0Q 0Q p0 p` ?)0 $PB9)U0 PP0Q x0Q \ 0 0 000S$  00000}ff@wt@x et e~fvt 0-0LS@P00 V 0cQ $0Q  R 00 0 0P000 0 0$ 0aS p-LM0PS`$ % 0cQ $0Q  R0S00p@0 0@p$ 0aSpp@-@(M0 P `000c\O0$0\00S (\ 00cSP00$ 0cS00  0S 00 00 0000(Ѝp\ 0 cR0$0R00S 00  0S  `0$ 0lS0S@-0(M @00 Q \ 00  0S  0000 00 0000(Ѝ \ 00  0S@0 p-LM0@S0`0C0@ H0P0bH0 R000 l  V 0S00PP`<0 0C <0 phAFl0te -LM P@U`p P:0 0Sz WpV`@L_080l$`0 ld0P    < 0 4 h (pXPH L 000T0 R~ 0$`/">CVD* VB*l00l0 (PBP _`,_`_0@0` _0xQx p0|X($^ <0S 0  0 000@( 0z B00Pt00` 0X@} QPs>0>0Q! ! ^Q`0`0!!QP]\D0D D0D 00 O, ee.8V6.8 ee###d#V6 p' -LM@Q  Q R0 00  0 .8 -l0L 0e p-LM@`'&P'U 0 S U 0 00p$ V0S 'P' -0L M`$0 L P0R PUp6$ KP@  PUT  q0$ 0R0  ';p'T  h d0 h  p000@T^ R0000 0 H L0 B0H L0 R00C0 R000  R 0PP0 00 S  R000  R 0P0P0H 00R:S"0S h  d0h  0S0ZP dL6W6 0-0LS@P & &0000 -QL(MP@ l0`\ X0  Pz 0 0S0PPP 00C0L0 0CH L0h0Q H 0h0 R000D\08 0S0 R000  R 000 @00C\  R000  R000 t0tpS( ` DKt(0  bR  $0R  R 0 bR d4W6HW6 -LM`@A&@P@@D\\PP@$K P@  GpWT  04U004PE804 R0"80%&T ~ -LM0(,S00pP 0@`p`@X0 $ l0* |x 0 Q0||Z0@ 0j@ @@H00AqH0 0A0 q@@$0@ 0 S<0 p0S<00t -LMH 00@R*$pK  PP  `VU 0H0 0Q0:U  0S 00 0 Q0-P0L @@@ \\4|%H 00R:0h% Q0-PL @@@\\80 p-LMPL`Q`3:Qq 0P`` @@@[[8p0  0-LMP00 6%@T <40\ K@H0@00lS:!T.%P @ R000 l0 @T0e 0-@LTP  @T0pW6 -LM0PS`p pS0pS,l@$ (0d@X0P@H L0W" 0S0S|0S` P@0W6W6W6X64X6XX6X6X6X6X6X6 -L* 0S p,d<74[6 -p-LM P  0@`` ,0 \0 p`l e -<1`@P,1Pp  U00SL 10S@Pp00U00S&$10V00S VV 0 RW 0V0Q00Sh`T0H(PW  0U00Xe8p eD.8 --L0LM0  8!0 \ Їf --LM 0w --00LM Q0f8 --LMH  0V(0@ R  \,.8Xe 0-LM@HP  0P;(0@ R  0A,.8Xe --0 L M@T@ K ( T0   -L M@@T ( 0 K T0   -LdMϟt  Y  0R p h P l , 0 h p H X H0 %PP p H0W0H0 X0 0  X0 u pX00Y00S 2 H0 0%SSRS HT \  pH d ` H L H L  0BZS5t$, $, $$, $, $, $, $, $, $$$, $$$, $$$$$$$$$$$, $, $, $, $, $, $, $, $, $, $$, $, $, $, $, $, $, $, $, $, $,$, $, $, $, $, $$, $, $`$, $, $, $, $, $, $, $, $, $#4$$, $, $, $d$$, $, $x$, $$8$T$$, $$, $$, $, $ $, $x $T0  0` 0 0 x0 0S S S  h`d `0V`S`T`T \ @fT@Dp PX0W0  X0 p X00Y00SP } T@D`Q X  X p X00Y00S` e \r dh @bT@Dp 0PX0W00  X0 ` p X00Y00SP F T@DhAqh  p P0W P0 X0 0X0 > pX00Y00S & h  Brh T0 \ @fT@Dp PX0W0  X0  p X00Y00SP  T@Dʭ9X ,0S ,\@fT@Dp 0PX0W00  X0  p X00Y00SP  T@Dml`  gcT ` X0p 0W@0X0  p X00Y00S  XTX p X00Y00SL009L  :8D@Kd(0`xD0[Sx  p X0W0  @X0 pX00Y00S v 0S  x0@| Tx0  @ T@D )0@0` |X Qp <, W@X Q p X00Y00S F x !0B^SX00T  X0 4 pX00Y00S + x0 x0 !0B^S| x@Tx |Q X  >X p X00Y00S    x !0B^Sx0 x0 !0B^SwD@K%RD@K%OT0 00 T T @ 0 P` 0  P``QH0 H0 HT0 0T0 00S H\0 ܥ0c\0 HT0 0H+ ` H 0*SH L0  L@00A S HL 100 A RH L 0@C0Tppr0@ 0Tpp bH0T T \@H L10H 0 L0@C RL \@ ST  T T0 n 0` Vc WTdp ̣T d00\0-KSP  R1 :R D3P0 h l% >P &B`PbP P(K 0a0Ch0 1!P0`P0c P0 T 00SP000aP V0 wP 0bP 0 f`PV PP000lP  U- Pu`` T0 00 T T @ 0 Po0  PozT  T T0  0` 0`0 oT0 00 T T @ 0 P`0  P`TT T   0`00  T0  T  T@ 0 P`0 0 P`\l T   0`00 T000S T ,d<[6D[6hT6L[6T[6p[6[6[6T0  T  T@ 0 P`0 0 P`0DK P 00 h ` D KHT0 @0H lR H  T00T T T0  0X /00 T T@ 0 X0 0T  0 X0 00X  0 T1P` l0 x0 T L0 0H 00P0 P1QW P  P P0cPh hp ` ?Ph \l NL R D0KD KP0 h ` -t0Y00SH0T ̌Hd -LL6 -@LMTJ7 -LM @pT0T0 P  @ 0` 0  00ѐ0p@- `0Q c: 1P#(80S$H*   0!!0 0)0 !!0 pHid -LM00P20#0R0Sp ` 0Qc : <"K#80S $H:@@JL0S 2[02KLP ᦐE-Ƞ@0Sp0 p `P@ 0@s  0R0 s$0@S$P10 R$0 @$0@S 00C0l8P.8L.88T.8 p-LMh`@qP T0T Q 0QUqU@@0p e0@PX.8\.8[6[6,0, 0$ Q 0÷`.8h.8d.8e -LM0(h h`X\@\ 0 0S<:M80 'IE000E7ed.8h.8e000 Q 00d.8h.8e`.8 0 S-L< 800( S $S h<7H.8L7 \6 -t0@LMA \0SH$d$p$H$p$,h$h{l8`7<7\6\6I6 -LM0@Qaڴa0Q @X Uژ!00UG@HT|iSp!1hMXI@ P0s+ <A0|Ps0S$$$$$0@` 0 Ps p0$@i 0s0s @0l!0 S0c00cA R\i(L.8P.8$\6 8@\6l8\\6d\6TJ7h\6888t\6|\6\6hD6 8 8\6\6p@-0P-S0`P0S @,  0C0 RSR 00L0 Sa LW0LR7L0AL\0S 1! 0B RSR pU00a0pp0@XSxS0@A-P@a@P`pՅa0@S*P 00@ S 8C81000C0 @8 R#H0 S S 0 S S S P@ S -L M0 ` S S, 0  S S  08 R R# R RP0Uʄx@緿0GS  08#h XE8S@0 8Cp,0P%X0P T.888 -LMp`P@`(^0 S S 0 S S S RPU  KP 0P0 S \6"e\6\6 -3L M PP:bP2 PoxGab@yTYT nTNTYTyT cpBah00c P2 b1 @G9o, @3b@yTYT nTNTYTyTc1 000 R @p]  X 00S0 $$P00SL d几0s  0sa ħP4 @4  4Fa 0s 0/pa 0s%X0P ,@HA=o !44P40 044Po+ꇠL.8P.8\6 8@\6\66 8PG6 8]6l8888]6\\6 ]6,]6 0-L1L @PP,401 RX$$$$$01 @[Ud%0h01 PPTшڄ0 Txt0 `1 h0\ 0c!0S0cd0<0hL.8l8\\6<]6H]6T]6P.8l]6 8@\6 8]6 8]6 0-H1L @PP,001 RT$H$T$$\$01 @Ue 0hP01 PTфڀ0 Ttp0 `1 di0X 0c!0S0ce00h\L.8l8\\6<]6ع6T]6P.8]6 8@\6 8]6 8 p-LMaHP0@SN A粽 P @`:@T1 D B2RV$$$$$$$$d$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$P!@0Sp|xtplhd`\XTPLHl.8]6T6]66^68^6\^6^6^6^6^6_6<_6d_6_6_6_6`6 -h`hP0 @0XpTL@000S@@70 0TP.8 8X.8 -X`@0PpTL@ @Pp0S 0@0T00T.8X.888L6 -LMX 04 D! Z0 , p((@ P 0 s ,0 Ƞh8 V W@ P8sW 0$Zڤ000 R 00 R4 peR dR `4; 40sS8L {80pCL.8X.88l8<`6 -L M |0p S S0 @ SQ SO 0 8 R R# R R0 S S<0 S S S `0VܐPb0HS ! 08#x hF8SP0 8CXu Q ,`KPXs F牼P&h0`  ST.888T`6\6 -L M8#8cZ00 (<2"(@4@, 0Sp `P0PE $`0@S$Pa@0T0 Ё8CX LPUc0J 0@TcZ1  S #$#$#$#$d1P k<1M$! !@0  P0 8C(R R% R0, R0SSPc0JS$$$$$$$$A\ -t@0SS X.8l8 8 8P.8h`6<`6 p-LMP0 S S` S S 0 S S S S0 S S0 S S S PH @K P0@ \pp S`6\6 -L Mp`0A,(0P S S= 0 S S S R`V ,KP0, Rڰ0!1 bP aY ,0 `0?P QPqP Hf  0 S "e`6L.8@\6l8`6\6 -(L4M8"(`LK$T #B#3 pQ Y C0S P0ʺ0S $0$@SWJ0PpKa phP0s \# PLK@0@T@4i p岤KDKQP0s a$3@0I.P,RŸPp@Wʼ"1Q$@D0W0$PEڀBLK @ h2 0T XŸ @p PT,2@0T Ÿ @p PT0001 R P@0A0S I $0$@StA0pS P0.0S ( $0$@S(p0S P @00S  $0$@S[)0\P0S S2ḠSrı0MP0S S0Wp0?P0S S0Z01Pp,L.8P.8`6l8`6a6,a688 8 8Xa6 -L M0P S S@` P P 0 S S S S `0 S S S Su 0S ᤹0S  ] P1| R0 S SN0 S S S x@ 1 D B2R*(.$1$1$1$1$1$1$1$-$1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$1$0.$p.$.$$/$/$80$1$0$1$1$1$0$1$1$1$1$0$1$0$0$1$1$PH 0KP0 04  P  0K* K,0KP"[2[0CP 0KP0  RR R 3P 0PKP0* K,0KP"[2[0c0P 0PKP0d  P0d* K,0KP"[2[0dVP 0PKP0e tP0* K,0KP~"[2[0eP 0PK\P[k* K,0KPf"[2[0f\P\hXq'^POLPlQhE0K.PB0S 004Q0 0B RS R  0B RSR P P P P Pt#0KP0000 R@@R@t0 Sd S珸Pl.8a6\.8\6a6a6H.8a6a68a6b6-87$b6(b6Db6 -LT<84(0S JP h`b6tb6\e|b6N-  0`1,R`  02\`-T0 $\ <0 \ 00  Ƞ 0 Ƞq o`p`o`-l0 $ RT00QD1R  Q (04(o`p`o` -LM`@Pp᥇P  0 P  ,00,0 -L,MPUP0 P0K4 0 H0 D , LP 8P !0H K P80 80S pP #P 0Hc@0 Po` 0,0( 0C,0 ,l -LM`@PpAP  0 P  ,00,0 -LlMp`WAa W]  P 0 40 ,` HP Dp 00 AP5P8 08 8 0PS;^9Q80@ H K P8 8 ^ pP! #P 0@0H  n Po` 0@T j,0( 0C,0 ,W㌠ PK -LM`@PpᭆP  0 P  ,00,0 -L,MPUP0 P0K4 pH0 0 LP D 8P , "0H K P' 80S pP# #P! Y 8Pc@0 Po` 0,0( 0C,0 ,r  80 -LM`@PpAP  0 P  ,00,0 -LlMpW`Al Wh  P 0 00 4 HP Dp , @P9P8 08 8 0PSE^CQ80H K P1 8 ^ pP, #P* Z" 080nP0 @0 Po` 0 R e,0( 0C,0 ,  ㉲8W㌠ PK -LMp#@0,0 堅PP 0 `43V ,3V &8yy W9,0W0,000 嬐KV&?0W00S 002Vd E2V/  0 @T&?0W00S,0( 0C,0 R 2 ,0S ,,e  4@@0S$ @<00 0 0@0c01V 1V00 S00000 K 00L0 S00@0@0 0S 0R0cҰ0 lP@ 81 $@< 0 @0 0D0 <rWn   X?P@i  ѝ T 000 00 w,df f |f{f@b6wt@}f~fvt -L\M0`Y!0rYt A P 㞝2  @P 0H D@ XP T0 P L PP PP\ ` 0x0 C0p  !0 @0 !tLX  0P@Mt 0SI0S# hPKMh`0\w >`@KpKl 0pcPl=9 A =p p l p l0 2R]ڠ"002c2c3x0 00P@ dŸ0S 0  !0 @0 !$"Fx0@ T 0  !0 @0 !t@#T@TQQ QL@ KPP >P@T >P@X >@dx \ d0S`K Z>P@`KgP@hK\ d0` h0P=9@ =C` \ ` \0 =D =>P@2 H 6>P@( L />P@ @K;<0K8 KH0 D 40K0 KX0 T ,0K@ KP0 L "eQ8b6"e?B -L$M, ,@ p8 0 4 < H H 040ZD 6D2a&0S0CP8c% U#yP@,  ,<0,0 R,  1@ 1 @ 1,0( 0C,0 v  Z<0H0S<0 H 0@  0f5E 0-08PLS@ SP0雠P x 0R0000"e 0-@LP, 0*0PP0# x 0@R 00@0h 0  !0 @0 !50S 0(0  "e"e -LpMW,0 P`*0 S0!ԂP@  ,00,0 ,0( 0C,,0 0Sp`VP:,0pp 00 -LLM0@d d0p S 0!HKp h W! Rl d0pl =PP *p0 R0:z 3 PKBa2a11J"c11L0 P PrXKTL T0PX0"PP L =9@ =CP L0 0`  !0 @0 ! h0pdh 0SGz" XPK&XP0\o =PK`K\ 0`cPl=9 A =` ` \ ` \0 1RUڴ!002c2c 00P@ |!0S 0  !0 @0 !|0 Q>x  0,0CS0 p||8d -LM`lPY0 p@"  0@D  D \@0訠 $☀ ";p05 B R @a 0SU 0S T )U}P ^U~P\U; A0ES P  @ P P  PUpU p 0UZm0 "0p" NU Wn x .U W_ 0xU U U|Uu 05 0D  (0r05 UZ   ^;8p09` (0S.@E 20U0S 6 :   y0PD 0@$  $ #e#e 0; `0HS4k$8k$8k$8k$8k$8k$8k$8k$8k$8k$8k$8k$8k$8k$8k$8k$8k$8k$8k$8k$8k$8k$8k$8k$8k$8k$8k$xl$l$l$l$'A0H\XS X X"@0`HP``d0\0d0 P "30 X00S =S  0@d 0 d H P!0?0SPl$Dl$T@@Fp\` -LM0@  (0 P0SM0 p-LM@&P`H0Spp% 0  0S H0Spp 0  0S p, ,0H*PP p/8 0-L@PP 0 p-LM@P` (Q,Q&p0 >;-p0.(php0m h< p0ŒHQHPBHP(\` ,L/8 0-0(  SL@P* Up0@0  (0Sژ0  P HP 0 0S0Pp0@0p0p0@0p0p0@0p0 0-@L_p0P0p00hU -0LS0 -L _N -LMp@  0 Q   m0 ̌0p"%p(Km =#P@ ( P@0p 5*0p -=`b0V``V=J`VZ0@   p0  X:p0\0= 0-p0@ 0L50 "20#0 P0S @P 0P0PU00S P ^cU?@0h]U0 -LM@rp0 ⲯt h|x0s S0s-t0 A!`?̠0 S S \h\ !h3 3#2 11>gfffON -L4M`mP,"0$"111;5/"b1C|0St xQo @TPi wPPD@Tt05c1 @R  1P  2R;⣕$00@K $< 08 Kr,8N=0S,0 00 !0 00 , 4N=0S40 80 0 80 4 50ISp8̀ S 0R 4@_4Op0LFd0>8 <AnRe 0\@PFu8@dfQc6c60c6?BHPc6Xc6dc6hlc6c6P0@-0 5@5P0 SR0C BSRP 2P# 0DS00 ER  R R 0R0S0  000 8 80R000 R8 80R0Pl l0RS p-LMP@p0`  0 p U  ~p 0-L@  0^ᠬP>U00  #e#e 0->L B@ \P( H  800 @00 0@R0#e#e$ -d LM0@0C0 R0 <00  0 (H>h#e#e -0  Lˇ0 Q l00  (00H >1>1=1p00|  x0S0 0h0$0(Q#e#e#e -LMQP`/00CS ꌘ$$$Ș$И$000 Pi-p0l0h0PpT0T@ 0 徥 p#e#e#e#e#e#e-R Rt0t0\ \t0t088Q   p-LM@`P >=0E/V> 0` 0 0P0  p& -LM0@S0S000A?&>㳇%>㭇 0-@L0PS#  0P0^ 00l!R! l 0 1\ 00 0S00000CS00 0m0 -LP`dVp-0S# 0\@l0% @l T@ %%`dPp 00S 00 d0V 0SS 0 03h0 0 A -L@P$`\p U, 0 ` \L 0 1S>0`Q\L0 Q` \L0 0H`F V0`b 0-@LP U000 0 UR 0 S cc Q0S00 aPa 0U  RR  0h p-LMP@ `R2 R0S$ 0 0 0P 0  B\   00  110 0 0Q00  0p, P0 ypc6Rp@-@) 0/. PaCPN  10C00& 0b 0 R 000 Rp0a # B 0!0 0p1 ! p -QLM`PpF6 R- R0S1 0 0V$ R! 0 @cR@cT@ w$`dPp  00S 00 0V  R 0 A( P0c6-0S0| x 00QSCT0P0Q R 00c!0R#<0`@- T0R   \ 0L0c!R!@ ` 0-@L PR 0S0 0 0 0 Bn \P 1S>\0S0 00 -L Mp0S# 0S 0R qp @@`KP@K U -`00p81P LP@U @ 1X 0Z @)\ -LM`00p81P HP@U X 0Z @\ -LM`00p81P HP@U W 0Z @[ 0-LM0@81P P" 0\ 0\  0PZ081 Q 0  !0 0 !000at qt @-00@81 00S   @Z@ 0-1!LPS 0 0S-@ T* 04@S!T:PU R0 0Ո0@0@d@ 7ll 3L5P0h1 #e=818p@8K`+e&e`#e$&e`T$,0 P 0SP#e -LM@P  P*0S S 4P: p-PLMP@` P P* R T 4P:p0SRV`0Sp -LMQP@!P P P U \*0S 4\:*00S E 00*Am -h0LPpU` @ T*0S4@  T:PU#e p-t0LMP`U @ T*(04@S T:PU(0ph` #e8 p-|0LMP`U @ T*$04@S T:PU00(0aph; #e8gfff -@ML 0@0xtttpt`P1#5`  0P@PtU`pm0d6%e(808,8&e`8d6 -@p@`@PL@ <0@TPh$818&e%e p-LMl0`PU @ T*,04@S T:PU( 000ph #e#e p-LM@`T@@PLH0@ T1010T a 100p%e#e p-LM@`T@@P|0@ T1010T8    a37000!0022$0(0,00060p%e#e8 07  #   ""$ ( , 0 6  -LMP@   $ 1RP08ɠ R000 SR0!03Q0Z p-LM@P`1p]npp@- 0S 5`1P1l0:x 00c|0 S01W01R@1@!  00 0 d dR0 0pd0 UX XP2 000PXP` 1@0 @ 1 01!1* 01 1@01!80  0#e,e Q-LpPe1; 0+0S6* R3 0S 5`1P1pl0: 0S@1@!  00 0 pd dR0 00 UW WPr 000iP WP` ; (1 1@  @ : 0 01001@ 01h,eQ 0S cP QQ 0 -LQRQp`P[@PW 0\@ cTP 0\TK 0 S?P+PP 1 p000 0X0j 0  0 S  0S0S  0S00PX+gP! 00 000000g0  0P -LMPP@` 0QP`cU 0VU 1 f:Zp MPp  0j0    0 `088@00)T0!T01Tp T01XPXp000 <Pp 1 01!1* 01 0 0180000h00,0 Z0j 0Ó 000 sPP),00 -LMR(K `@ )QPPJ V@`p*,0S7mQ+,0S 0S000 pbX0ph000W@1@!S @p   `dVP,  ; 1{PPp,+e -PLM@ 1 8D 08  @T -RL@`P0p%Q" T S:0bS@UT  cU 1PbP0U@ 4!s:0T00SL( 0S% 00#0X00S 3S0 PPd@T7077807|Tl  Z00R00STa @ 04p; 400p40 4 L 0Q0Q00S 4 0  70778U0|7P0S\040070778> 0|7ɚLAWT @ 0 0S 5  40@Xdlh 0Sl4p <\< S0 R 0 ;00 0 e00 L0P 0e eL0P 114  4 40p@&L  aL 1SS P00bP0X0,CX 1D00cX00Q @0@ @d@0 pT Xl@Xdhld@8D  ݋P P08 S H0S 2WXdhl L00bL0!RR P00bP0X0,CX 1D00cX0 R @0 \ 0 R  @0d0 d@`  @ 0Q 0 R d@L L00bL0!RR P00bP0X0,CX 1D00cX0,Q @0d0L  d@@d4C  TT 1S, 1)@T 0 90 SR  407077LE8Z 0|7ᛙ#@#0 @0z 4@0  @Pp Q! 'pZ00W00S@ PT fЇf p-L MQ@P ` Q pT ,0  0PpQЇf -L4MLP3 p@033@033`3033#TK@0402[03,0(0w0 00S.<003 -LLMZp`,0 P \ 0S*U,0K0 0 R  V AV )V $V *X \ 0S ,0K0 0PU 0S0 R00000V@V  VVU 0S 0S S  V  V  V V1V)ڈ1VU 0S@000 `10~T14 ` wQ!Ã401#8#(00 S  1V+ 0V'U 0S :F@0CT@S񟗁t$$$$aP 7YBPq TTPL0T@0dT0T`@`0_00V|PL ;88Їf -LM^P@p \ 0S*p 0g0 T` 0 ( T T T 0 00`T TT @T T  T 0 0000T9  T  T0T 0TT 0 0Tʨ0T` 0P 0@l0 X0T P0T 3 003 88 -LM@@ D0<mp@h( 0-!40r@L$ r 00LP<0<080(  3(@03 0P181818 0-40@$PLt0S0t0  Q0 0 0S00t0S7070h40$ L 0  191# 3S,000`0Q 0-40@$PLx0S00  Q0 0 0S000S;0;0h_-40$ 0@N cQ  Ŷ  191# 3S 0 ,0 0 0S 0R40$# P0 00   0-0P; 00  UL@  0S 6♖L^0S 0hULM0S 60h= -LM0@00 68 k0L-0S  -LM0@00 6. NL0S  -LMP0L 2cC0Q0^, 00 p3#0 Siʰ㳸PG A0 @0 0 @0 @D@刀   -LM @40 0Q 000!RR 000 0, 1D00 0 0S 0Q0 ! !101 Q-Q 1S/ S' 000!RR 000 0, 1D00 000 0R 0Q ! !101 0Q -LRP`p  10Z @W 0R@0@ N0aR P\P= 0 0  Tp`Wp @ 0  1SS 000 0, 1D00 0@0S 000!RR 000 0, 1D00 0 0S@ e6 p-RLM@P 0RP^ 0Q0`D F0aR \p0S 0  1SS 000 0, 1D00 00S 000!RR 000 0, 1D00 0 0S@@ @p尻e6 Q-L@`Pp 1 0QpW 0S0 0@TW U 101Phϼ0SJ !1R U# 1 Q U@ @ 0P00!RR 000 0, 1D00 01010@0@ \!1R0    00 0 0  1SS0 00U0f6 -LM 0@S 0S p-LMP\` `U@\ W 0SE Pc c 1SS 00b0 0,C 1D00c 0U\* 0S  c 1SS 00b0 0,C 1D00c 0kP 0S \` \ 0S p p` 0e  000e0!RR00e0V`庺 f6 -LM0@S 00 0  c 1SS 00b0 0,C 1D00c 0 P0S  00 -pL @M T` PP0 T ;1@ @   0 0 000ꤻ0(f6 -LMp`(Pm(K, KwWP@0K (0 ( 00(0 Q@T0 (0$ ((00(0( ,00C,0((0,,00m,iU(X0/8 p-L M@` K4PU K0 pPP  ,00C,0(0, ő0 $kP  0-LMP K P@ 00$n @,00C,0(0, -LM0`Sp  ,K P@0K P@ 08 00< $P @S   3S 3S0@3G  PD 00 ( @ (m 4 KVP@V40tu0 t^@ 00 0 00! 00$PP@ Q% ,  0R,0   P@ 4T0X0(m<8,0( 0C,0 ,,K @T0 (00(00,00C,00(0 ,PD 3 0R3( D (00(0,006 , 媐 #@5@3Sn3Sl 0T 6F $P@3S_3S [5 50#W0/80c0Q P0SX0   X RX  PP)X0X0 XK PPQ `V T0S*``UL 00@L H /L0,  B, L(0 PPTP,ˍ @ V05@1 0305  0 S@`V00PU0SX0 `cPP 0-LMP KP@ 00$? @,00C,0(0, p-LMP KP@`*0 S@ 0S 0`S$V  P@ 0 00 $0n`@Vh0,  B, (0p,P7@; 1 0-LM0P K 0 P@) 0S 20$ 0KP@ Q  R 0S R P@ 0,  B, (0 P0,K @K RP@ p-LM K`P@T(K  p 0(0 $ P@ (h(~P${P(h -LMp`( K!PP ,K  PP(0$@  0PP ,  0R,0  wPP (0,  B, ((0X ,⑌  `P -LMp`( KP@2(!$P0 R5 ,K  P@F  0P@ ,  0R,0  +P@ (0,  B, ((0V,F  @,00C,0((09,4 -L Mp`$ KP@ $0$PD 0S4P7@  0P@  0S-@@TP P@ $0,  B, $(0, @$0,  B, $(0-,ۋ -SLMpP`&  R;V@; K1  ` PPW@0`kg7R -LM@LP  0& S,0 0,0 -LM Q@`P) QW 0S%0Q0U00S3Q4!%,"%8"%L"%`"%t"%"%"%"%`#%`%%h&%p%%%%&% &%8&%X&%h&%!%h&%h&%p&%U8 WgXd  L {0S  0S 0S  E   0g0S SR P , X0 a00,L(0 0` ( W  &P0S= S9V2 0S8 WY , P QL@ 0P7V  0Sp   P90`  P W& L0 ,0 Pp X,0 0c c 0,,( L0 b0b0 (^0S  L0,0 5" H 0S 00 R1  0 (0    PL00H0--0S 0  0 0S 0S0a4"00   28Xf6`f6hf6,epf6 -LM0@S T0S0Sp0p Sd0d P 8 cP0 00@7=(28,28028428|f6 0-0LSP% 0SP 00t0 R ed0h0h_d6Q0S@|@@,e -LgM`pV0,0 ` 0BSPB[FOK z`0qK1 A 堡 嘁 P`AT8_OK 0|1  ˠˠmK.K0x >9P` 0 ,0S ,A0 |0 0@ '0P 0P 0@P$@:K:P 4O0K,df6ʚ; -LTM @T`PD0 H0 l p LP D` P\ pKpP@`P80S&@ 0 09P@|pW? 0R)@ 0 ) 03 P- t P0  p0 0 0 0$  t t0$ 00 $@4 0x x=@0TS (ʚ; -LM@ 0)R  0S S00 f6 0- @LT P P0S S 00S00 @S 0S00  0000B P0h>Ͱf60 R P0S 0-@LP0S000v0hb -LM0  Q4 D2  A B`"q!1Wp!1 80 5b4  < 0@S PU0P,0 Y` U(dZKZ<@ P,K  !LP@(0 P,0U1W<@ 4P0PU,0   B A8 <) 8  04 00  0(db PUJKPUZZ( (cLPU<@P0,0 ,yPU$0 80S S0 5P Їf,e -L M`P0S 1R  Q 00R 0A#140 @b @ Tp;ڲ 71  ` 70p40 Z 00@ (,K ], pH0PK\` 0 @D2 0s 0s I0  0pG0 00000 40 Z  @Z``0PKp -0 J 0Z0C 0000C0  B  @,e -LM ROqa@0T0  0:0@T@T  ` * 00C0 0*S E @TPUh1 &`@`TP R Q@@@TPp  0S @TZ@WPM@TZ&ua00$0S 0R0 @, 0 0 0, $Q \0 R0 d < Q  0Q,eXd,eTd18X5%P 5% P-L@p T 1S Q@T 0 S\0 R0S0` 0C#1V P`X`VPP   0 S0*00 * ,eP-,, 0 0C0, 00C0XM,e 0-0PSL PU* 0S PU:U 008 ddB&0POLQ0000  0@0f,e-e-e,ef6 -LM@( (0  0K/00 D0!Ce-8 -L`P在pwW03 0d@l0 `K`0 D0 8 H 0 t 4 @ < | @@vU` `0Sp0`@0P` p`@0h-e-8!Ce828,e ->0^H1LM <1P %6?QP?, ,:00 , , 0RH0000 0 R0 0 0S0|08 X0d0@`@0P`$0 ,0, `0,eQ`h-e,e8.e828,e 0-PQ0L0 < 0@0S 00h,eh-e p-@1 ML ,1,a&QP 1 a.@0 @æ勧0Q* Q:0/" @5w0/"ρDQb!bPeh0bL` T0T H0H PPpp`Qfff,eQ`Q`f6h-e,e@.egfff,.e,e(.eL-eD.e0.e -LMpb00  Z80S|0TP Zp00P@ `00T 0600 `0@P``w60 ,00,0,-eЇf -LM@h& -LM p P@`U @P PU@ o1 p-LML@`PP 00 00 ;00P1S^0X0ph -L0>0`Z @`K`  00K84@K@5PP400 @r4@  T  > R D  ]P D@pU@K0 @_@P 8o0S 8P D@pWD@DP 0AJP DTpH j8 \0"!L P0 T@ X@ ,ß,C`@0P` `"00R6000L0Cbd0!00!R  !d000! !2Ÿd000!dBd0`R 00! 0`KX /l1X8<P0H0T0@X_X`1H\0 `X` 0TDp WT @@K `P 00 0@Kl @0K d 6D000d1Lt08@Dx@80@  &5$1 ,00,0Pp]10 *0 D`pWpWJ10 *0 pWZ]0pWJ10 *0 pWZ] ,0s<-e,-e@.e,.e=%Їf -LMx pR 80S|0T0 00Q00S $0@@Q Xx0h0P@ `P 0@0@006*=00N@TP0 00000x0p  p =004004X J@[0$-eЇf 0-00LP 0 RE 0a Q0S 000000 ,0 0h10h00H 0000#0 0@ 0 00000-8,R`o`Їf00000J40000 0000#0 0-80000000 p-LMP00`" 00:0000 i 0S 20S^0000000x0SSH0SX0S 00ph0050028 (B&0OA 0R(0S(000S0 0000P@0 00 0t!0S00 005000C0峁0028 (B&0O@ 0R(0S(00000 0S0 000 0P00 00  0P P0K?<8 B&0O$P-e,eD.e,e,e<.e-8-e,e0@-0 Lt0P@h0  P d0d S P00Sx0S00 @.e,.e -LM A@ 匢吔p` , 0 D0 T"T咔P#10QU d0d S= PUXU 00:00 R 0 0  ,0KDP,0sSX 0P0S0 0 00l0d P 4 @*40Sx0@S4 0000  x@ K@K 00 000+4cX 00:00 R 0 0 ~00P 50000%04,0 D,0Sj @.e,.e8.eD-ef6 -LM@ 0P 00(:00 R 0 0 8.e -LMP2Pr $@_Q 0S*$2( @_Q(0S區1 /P"(0SA0/PbڴaPx0SX\ 0 0 00 R(0SPP"8apP@U @x0S\ 0 0 0PU @DtW f@0@j 0\D0 0p` 0 0ld <@t@4@@@@|@@E(0S(,e,e0.e4.eL-e,e -2LM 2 r` p!0 R 0S* !09~0KⱀPU 0 R 0S:xG00 L0S 00L1\ <PJ8K⊀, 408b00Pc=9 =<  A<0 @ @ $@0`SPU003008 `B&0O  00|0P@0d0 )  !`Їfd-e,e,e(.e,e4.eD6P-e,e 0-@L00P  00 00  40S000;0000 }00  f6 p-LM00` D00 <R00 00S700' 0S 00 0080P@ 00@ 00 ph00500ph00@000tp0 D$0  0@x. 8P-e,e$-ef6 -0ML @ @0P`ʠ0  p @PP 008 80H8t.e|.e\.e.eT.ef6 -LMp300H 0R009 1  P82105:P 80`CV*\V XP8 |A80`CV:H ox`xP@@`` 0@|P P RT0T 0T0 P T0 T.e|.et.efX.eP.eg6 -LM@00A100h p-LM@H0`S``PP 0P00T0 @0S0C00A100ph0~t.eX.e p-LM@HP0U`H0 8EҏX0S*U$ 00HP00000 P RT0T0|T00P T0h 00200 RP @0P0P T0 @Tspop급ft.e p-LM@bP `RT0T \0T0 P T0 HP08H00兏00 GpFt.efh-e -L,M, 0 9< 00PK &pP`0@VJ@K`Dp0`K`F PA0KP` @ 0@@@D\ 0 0!!( 0 (  !P @`0@ VDP,0PK0\0 00`X 8`<oU ,嘥H.e.e$g6-e4g6 -L MX0,0 0 80\ C60X0Q@0`Pڀ6 ,V000i 0@8 @0PB&`?SR0oP-e -4L M4pQ0& 0SP A2qx4x$00 aV 0S `VH@0   P0R(0)Q KmPV   ! Q, M0S 3P@ \ 00 ,  00 `X3P@ \00$000 R000 R 0S  0 0S0 20 0 `,$PP0U2,0S Jn  -0,60 PI08"0 RK \A,P0U" 0 -1P@ 0, 0\0R0S0!0 R  )P060 P1P@ \  H 0   0` ,005 1P@  v)P060 ,0 0, N P0 0 R  0 [-0600 T@0 090Їf<28H/e.el/eT/e/e\/ed/eL/et/e -L`\p 0P 0 P ܠ 0S P0P@ 00$0 SPU U  P0R@0 W @( @bT)@P0"0<28/e/e/e/e -82LP`P^ 0S[r"0Su@TQ  R0000 0 0S R00 00 0S  R 0 0 0 0 `VP0$0P0)0 ( ( 00  0P@ @2p1!00 R 0@0VV@0 0 80S ( RR*0.S 0P 00S0 0 0@ R )0.S<<呝00@0<28/e8/eH/e.e/e/e.e p-L MP@ @t0m``? `P0lDPP<< 8H0@cp/e8.eH/e/e/e`g6.8.e-000P0 R`` 0Q :0S $  0S0AQ*000P0/eH/e.e@-\ @0SQT0S @R000@0 0 0S R00 @ 0S  R 0 0 @Q 00 0 /e -LTM0 d0K 0 x < ` X  0`0 0 @X X ` RD 0 l0<d0  X`P0@W0@l<d  <T04(D @R0, \0   0OS a &80 nU@ V 0\0 0 @<0P0<`PP 0O`"8@#!P7 d,K< 0Z+P0l0s ,0S 0@00\@0]Xd` \0d0s0K0 0d `@ \0`X@4 Q4@VX0@WXD@ Q 0 < 0 `!<PBP+P @T : +\ T\000< %T:@T +TXd `@ TX0l<d B`0p K<0pKl$0OPK0^ld -0S*P KPKD 0OW{Xy T0<0P@@@00@ ] M-LM0000K0 p` \  0. 0@U( W00@0P`pG@0P`pGY  W 0 y00, VW @0P`pG -L M@0, 0a + R 0@0 Rp`0  @<0A ,@@0Pp` W p-LM@ 18 `R3 <0   &< <0<0 | 0P | 0S P<0 <<0 p88 T00Q0S <<0P 0v|P PU  P0 EЇfhg60- Q000S00 R0006 - L0; S 屛/e 10S08038 00@Q1 0 ! 0 -LM0@\ Q 0Sd0Q !0S<0 Q0 o(48/eg6g6g6 -\ 0L!R @0Q1S0!!0Q48/eg6 0-@0LS 1@ 1S 0S @ @ 0!0R0\P@0S HP@0S0@1S@x1S28@68/e 0-LM@ddd 0PD0D T@@P@0@T$P0h6.8/e2828 -L M$$@ 8 0@ h6.80e 0-L@PHUUT T 80 Q0(0љ0P0 0 Q0380e -LM@0&U00C0h隚0e -L M00 0\40 1, \b\ `P`V 0 Gp,PY  !0Y 0P@/ 0`000,04 @  00 4  0080Y40 Y 4PYo  @0ppVʯU`Їf -L M0SPIJpP`] V @ 0@  xQ 0CS,  @T! `(p 0 (, #P0t@Q ( R,0,0,0$0( ,0 pT 500@0W 0@  0R xQ 0S0^ #(pK'`@0K 0BP0`P v%v% w%w%xx%x%T,0P0  0 S 0 00S* 0 0S  0R 0 0R,0 P@00 0S0+ \ ( R,0,0,0$0( ,0( P(0,0 00 \T00,  ,0P00@ ,  000S0 @0 P0  00,0 @mT,0 P0 @0 0 3838 -LM0P@T`K0&$pK  0pP@ $0DS y%y%z%$z%Xz%$0 $?$ 0S = $0  0R 0P@ $0 $0@@0$ $0 0 @ @0$  -Lp#P@A 0@1A 0 Ps `@0PU`P``4000 s@0 p-L M0PK0%@ `K 0`P 0S 0 Sp p -L M , P0 ^  0R 00P,0  0R r0 S R :t Xʄ0S00 t0 0 0S0Su00Sb X00S rV tQ 0SR:X00S :t> r07 SRX 00S*0S$R"*r X00St0 0 0SRr 唜sus0suu0sXR0S0 uq000 0scgh6 -LM 0R ) 0 `R 0 8 P(p`0@  ( P0S@ 0R 0@ 0 R@0  0-L @\ P( ^,0,0,00(, 00s \0 -L,M,0$p 0  0 `P 0S 0+P@P@@T  000 0CX:0S/S X0h 0c #0% %0 0 R2  0 /R @@%T0S @P@x k D20<"Sa 0S0 0Z0SQP0K P@KH0 @00HK00 4 ,P P L D 8 i$P@880[s@"  0 S?@#*R0@×000 @0/S# @埖P 嘖00卖㧕>@ m$ ;0 pudqPmHX_:0/S U0+2 {%/e/e -LM$P$ 0 0#40 @ Rp8  Q R 4 00  ( @0 <  , 0 /S I  , 5R  /R  2R0 /R, KR, ,0 lR ?Ò00b0 /R07 00S09940S009900900S 0:00  0T 4 T <0 0  0@ T0@3P 00@060 !P R R0 j7ã000b0 0 j00 0 R090@8 Rd RR R  00l00CS<<0S;T0$ 78 R2 T0$  3#0S @0S00 \#P  80S   K#\20S 0 0 j 0 ( |`V   0S  8 R|`V   #00K  X0@@ @ p< RT0$   <+@@&X 0.S0.S0:, 0/S  0b0j007, 0/S 0 b0b080SW0S8 0Q0R00SI@090&/e @ -LM80@0 p,0   `0SlX 0 T PP p 00ZT0$  P0  0`0CS ZT0$ ,0S T0$ 0 ,0S 0  M"0@ < RP  8" ,h6@h6 0-h0MLP\@PTT 0L@X8808 @0 @ 0hD 8(2e\h6.8\1eT1e2eL1e p-LM 0PS`@<P @ @@@LPpLdh6L -0LM`@Vp aP `VV  !EJP@P ` 0$0 P0 00$0$(0$0 ]a/Y 0Q@28H- P 0S P 0RL1e p-L M 0@00400 S000t ` 044 P 0  PK P 0 0 0 00po``L1e0S  0"S  L00 \ @0D0<0804000,0(0H0$0000 00 -L MaqQ1@0\00 .00, 3 0@S @q R4q R 0S  ?0P00@8@뀐4,90P@0@@PR P XPU彗PU X R\0\0\00X \0 H  H 80S 00|0<0$2e(2e`Їf2eT1e\1e8:6T0S ` Rd0d0d0 QT0` S`00d d  -PL`Mu 0Kp d _ P0@0  P8p 0P 0 P P82e -LM800CSl1l!p2?0`PQ@T | 0U @T $H| 0p P ppT` < +< <0;<08 80S@0S  #PT Y80S  0   40 840 ]Їf<2e -<0L @P`   <<00 !lH @p00Q00S0@0 PP @ 0W0 BR00S@ #L0S X R\ L0 \0\0\0 H00H0޷@ X X R\ 0lh6T1e2e@00@0 -LM@ǷLH8t t0P\HX 0X0 \ 0@h鮷0XSX00X \ @\2eT1e -LM@0T 0CS@@0  h Q@0SH0 hЇf 0-|0@ P BRL@ @  0a0S.@0SH0 Їf-H0 L R@0SXP^\0\ D0\0 X\ 0X0 X\ 0L 0L0T1e2e-L0H 0CL0S@0SXD^\0\ 80\0 X\ 0X0 X\ 02eT1e -`LPp @T T0S`@P T -LM 0P@  <0 D0S 80S @0S 000 800CS0 4 Їf82e -L M@0 K  0 @ P0% -L M@P@U0@0<0`p48<<0`<U5 V-]iP#U @00CS@0L0SW0t 4  @L:<0, 0< <<0imX6 0 V 0-th6h642eh6 -@ 0RL 00Їf p-LM<0PL  | 0S; QV4 Q<0;<0<@;<0 G0|0@0 S8 H0pL0S0S X R\0\0\00\0X  RX d0X0X \0 P\phѵD@8 80RV`h6h62eh6h6@-2@H?0\ | 0T \80Q<2e -QLMp@`P$K40 P@T$ -LM@<0  | 0P |0  R Q8 80R@ 0P0R00S @ -L MQp@@ @\ R h1PU 0S PU-U A@@@ 0,0S S - 0 ibS0X icQ&0PU 0S PUU $sE@$ dP$ P 0PcPF2828,e -PL M0 `L 0 0H!X P@ 1T0 0j04` \,  T0S ,KP! U`p'P@ ` ,P@W,p @0 0j0 D0 R4`0委(0 00 !_. L1e38h6$2e-|0S<0  0 R | 0 S  R8 80R0S -LM\0PS@p$0  0`004P  4 $0 <$0Skd RhSfRd01 D`ᄀX\ "P@* \0R\0ń0d R@#P@A0\ 000   0V0P@@T@ 0004P 0401E0 R 0S  R0\7@ \ $ \` P@d0 Rd0 0ǰ#e -LM@0  01D p-LMP#`@4T  D00`VPZp鸥% p-LM0`@P  0p30P$0<$0$0<$00 0-$0L @P R  01 R P 0\ 0$0  p-LMP`\@ $30U00S I p p\ 0S  NP @  0S p@ 0S p @  -LM`@pT P R0 U@W L"X @0 ~P  pL1ei64i6Їf@i6 -L@<0< R  0S hdi6Xedxi6i6 -1LM 1R  p 0`PU 0 00S00`PUV Y'Z@pὒ걲@qᩲW`pGY娒Їfd'828 i6i60@-QMP0 @-PT \ ,P^Ѝ0Ѝ0@_0 <4@PT P !`咥\#100E SP`@T,^@T `咕\#10l0E SppP`@T@l6\m6m6m6n6(n6Tn6|n6n6n6n6n6n66n6n6o6 -LM` P |V\0,0 h0@80 ,00@ H P@PKZ 0P@ ,0 S <,PoD0 QK A 1 @! DQ q P@ 4 <0 TP$  0 P HP@0 Q   0000P@0$ 8 $ 0$00$0$4$04$0$0 0$0 Q?KpP3@ $0 h! Z$0$07T8$0$$0 0S ~@P00|PT-H!00000 R0PPP $0 , 0 P@ (0|`=1--)0K0 P@0 0S HGP@0 Q  00T $0000 01P@80SAJ<L1eDo6 -PL@pT  P@ T$0@ @` @$ ;00 V$0@0$0L1e p-LLMP `@0`K80 \ ` < 4` P pP0T@g` p-L M@PE0S `K . 3\ 2\\ 0 p(\0dd_/ 0 -LHMp @0PdK<0 ` d @ 8P gP0 T0T`,@0 P0 $048,00 -LM`$ KF P@ $ $0TPU ,p0 $ @,00C,0$(0 T $048,0 x,`,00C,0$(0,` -L M1, 0 @\p T.4  P@ TWZ0P00WZ,`*40S, 0PU@$048, 0,P~P@ L1e -L Mp$ K P@ $0$`$ ,00C,0$(0< 80S@ =0@ 0RP@|PU 0S(K T|PUT 6`0 @T (`,;` 0-LHM D040 X \ 8 0 \KP5P@ 0 L00 -LHM`PpMD@TdK   D0`@ @@ d <0 8P P@  0ST0 0TT00 p-LM`PP@ P@8 0R@ p  @P 0 -LM@(p ; KK% PP 4 00 `@0"0 0 P  `0P p  000 kK PP PP ` R0 PE'PP  #uPz&t;s&0@0 `܀ 000 $#  0K⤐K0 )K9KK  @0@ 0 @PP! 0 090@T, 0  P T0$ P80SP  PP   "@K/ p0K 0(PP s 0 (00(0 ,00C,0(0~ ,_{ h48 -LlMp0`$0 @,CPUK $0 S $Dj D0P dP `0 \@ P@KUx@T00T 8K0$PU ,d\o6 -LMC0,0 0 P`pP BP@ 00  \( e:K K#P@P HPK P@`<PF@ 0@K K P@` 80S-@ 20S 80S@  P@{ 0MP@s  @KdKP@ 00^P@b 0P@Z D0P0D000 P0! 0$%  X0K`PK0 $K4K DK @0@0 @P0@0 ) n 090 h @ (00(0 ,00C,0(0  9P,0 S ,Li,]0S 9_!$P  0 P@] ,dh48ho6 -LMԀ0p$0 `AP@ $0 S $i@PK P@_PF 08K K P@PK > @dTp d,dto6 -L$Mp0`$0 PAP $0 S $h@@K P$P@F 08KD K PDT@.,0 P$048,0 $,do6 -LM`P}AP@0 RC 0K@ 0 夀 P aP@pW@ KLP W  K& 20:#: Q0 <   Q @TK K0K @00  Q㄀ 0- -LHMd@K` p@0<0 ` d @ 8p PUT@80Q0 `P @ <0 d 8p PPT0S@ KPn P@KP P T0R TP -LMPp<`+0@TK0 @  p 0 P@0@KSK0K K ˠ0ˠ| `l @H 0R @@ZX/e -LLM040 0XK0 T0 X , P H@4K<0DH4 K Dn D0S + -L|M0`P pPW 0SR$80SN  S0R0D 6R pYX0@@ 0@ K0  P 0(P@`@ 5K01#5#S0 0SRK 0 Pp0Kp0 hd -LLM 0 p`P000 0pK D0 H0 l p L Dp P@`Q `l`@` WP@0 @h -LM` PD0K0  P pKP@ 0 @ET0?0S<@ p @0 -LM` P0K0  P pKP@ 0 @T0?0S<@ p 0 p-LLMD0``K@80 \ ` 4 < ZPP  pP PP -LtMp0Kh0  l dp <PP `HK80SP 08 0b00K @@KH0 D 0 4P 0P ,p 8 0 P -LM` P@0K0  P P@ p *T0$ @0s# >P㄀K0 @0  0 @~0儀K 0 P@00CS@ -LlMP` KP@ 0$p T0S $0@0s/ >P㄀K0 @0  0{ @  0,  B, (0 ,_Z0儀K 0R P@00CS@ -LM0P#Q`0K  @00   ` dP@ 0 p儀KT0@$  0*0 :#:0  0" @ -LhM0P#88S`4 K6P@ 0$p VT0S $0@@K0 :#:|0  0 @ > 0,  B, (0,Y -LM` P@0K0  P P@ p T0$ @)0s, =P0 R 0儀K 0 P@0KT@ 0@ x0 t 0 0 @Q@㄀K0s38 -LM 0PK`0 0 0 P P@ p T0$ @)0s, =P0 R 0儀K 0D P@0KT@I 0@ x0 t 0 0@ @@㄀K0s38 -LlMP` KOP@ 0 $pnT0$ @)0s8 >=P0 R, 0儀K 0P@0KT@ 0@ x0 t 0 0@ = 0,  B, (0 ,X@㄀K0s38 -LMpKP`P;,@KY 0K40040  @0K0  ` P@ P T0$ @ g(0 "c1, ah $ 1\ d0 ` 0 0@,K P@,0s0,0 $0s0$0  -LxMpKP`sPC,@KQY 0K40040  KP@ 0$P T0S $0@(0 "c1, ah $ 1\ d0 ` 0 0?@  0,  B, (0 ,#X,K uP@,0s0,0 $0s0$0  -LMp P@0K  0 P /P@  `@T80S @T0  匀K @T p0K0 @ -LlM`P KP@&0  X "00  @$P 80S@ ]P@   ,00C,0(0,W@Kh0K0 0@ -LM` KPPx p  0$@ 0  P ,00C,0 (0, `W -LM0!P`@0 dK0< `0 d 8` zP@ATp18!Q K0@ 0 ` hP@LP`U 80S> 80S@% W@W@TU |PKT@ K0@xz\P0|ztK$V U@KPP80S@@KP P,,/e p-LM0 `P0 K0 0  P P@@T|@K0|0 "0ˠˠK Kx P@ p}KP up 0-LHM080 0\K4 X0 \ 0 P@ LP80SH@ 8KHP NL0eHP@ <0@@T8 KG@ -Ll@`T 00  R@ 0S -@ 000 M/rq6q6 0-@L0EPS 800S(0!e10P-e,R` -L M@P8|0Q 2 Q[dP (d\q002(  i)UP<0  002*0 0S 81 T>08!0 0<0 " 0 <0` V  P<0  ($ @0!b1*   Vr\`,R`r6 <0  |0 p-LM`P<0L   |0 _|0 0  @Vp <0  |0 -0L| "88 #$Us(r600CSL(&`(&`(&(&(&l(&x(&(&`(& 400 0 < 0 -L M@|  0 P@ -Lq@r6 -LM`p|P Q2020 P?U@U |  40 K1P@  | 0 @|  0@* @T |0 00 <09<0 *# 0 | `<0;<0\` 0-PL|0  d Œ*P@ 0| "8|8 #$ 0\`G-p堑`aN`M\0[ xx1&V1d1后ETX1""ᓆ L"b l A N AD%X$1U`; P ! 10UPc "*0P  00U: QPc0 20\00{.L B40Zx000\ | 0Q0Sd00@a00Ѝ88<3eųE.D3eH3enm\g5tg5@3ek_k P-LPp>;T!52c~HaȀ2ca10 0\რ+ <@4TP *[O[O @@R: 0``( AP*0 P@:00@C "b"b0#l00X d2111H"c#b1 `130$qQP3eL3etg5\g58Tr6@-0PSpU0 0 000@ S  p`U 0 0R0@0 Sb0 S .000@ S  LpL`U 0 0R0@0 S00h5i5E-` M@p 0 0 \0 0.\T.0V0 Ѝ.\ D\ 0 S.S\Z\RP J0 S .S RP \ZUv R0`@e@c\ 0  0S Wpp0S 00Np ^\\pPEP*0  0S Wpp0S 00Np^00P0#02SPp3^_000S00W V @V^P 6!10F000nR^`VL 0 S 0n0 lS0d~0^ 0*0^ 0:bP0u S .S PR y0.STWVMg50@-P| U@B .U@ 01 c0 C  0 R0Z  0  01 PJ0 R0Z PJ0 R0Z P J0 R0ZP0@0000  0@000|@ S .S A-@pP@  0Xx= ?0 1 C@nT0 7#30 T00SP-@T`,J 0P$0S!^Z@TJ 0P0S^Z@TJ 0P0S^Z0S0S i5p@-@?\00\0AS`P?@01 P0 0RPu2 0?0 1#0C0 R0; /R0 0S"QZ0 R0( /R" ^ 0SQZ@0 R0 /R 0SQZpp@Np00a0C0p00Np00a0C00a 0C 03  QZQ p R .RAQQ 0Ғ?AcON -,0L;0 808X3eT3e -0LM0吐pP`,0 ࢂx 0  AT 0U @$0V0W00S , PЇfT3eX3e@- @ $ 0 201 R 0\ R R $0^0T00S X3eT3e0S R00  -LMpxP3Qp`@` PU,0K @T= 30P"<@,0P, @ @8@00 `$ ,P@ , T 4p 0V 00q x0sk 4K 00Kp P@ \4 40 h 40 i 4 0464 0464 0464 0474 0474 0t4 04 8  r)P7x0 qD0 4Ht0T$p T q! (0$| (0K$p [Pp( $\ W (0SDBb `@0T$p@0Rls6xs6 -L MQ@p`d%X` 0D 30nR\050@ 70 0 `PP X 0\ H #00`X H a0N 0-LM$P 4@0  @0 -LM00(P0C4`p00 P,K0KX PE5 0P@600K4@K00@墳P@-4\0H0 R (0U  P 0 PE A\0 0S 4P@ 0\ 00U00S鸵4嵵 -L$M40@0 < D <0 D0PJ 4K 0 K0oPp<@00K408@K@EPp+84H@ `0T*PU  0 @ H0 `0T: pWD00D0  E(P 848p^8ZPD\ -LM4p`0K4K 0PP-00K408@K@P84H 0R *@T T 0S H0 0R:` 8 -LM⤐Kp  | P廲P@$  0S   @T:$0@-@T4PQ @0(0$ ,gP@|`80S|0" 0Q}0 0S $0 LM|0 0P@  l$0S 0V@ T 40 08  0,0007x0s1 KvP@  D0@'P000@KY 0Za╯0Y ڴZa≯ [| ㈯00 05@ K\Z 0 0S10Q`` 0 0vP@  o o` -L,M|0`p QPP RP7 V 0@ 0@@P U $0000  0PP(KP!4 4 :励PP, ;00j000,0 H@  0P410 $8 !8 0 UP42 0 $" 04800 $" 042 4$ 2@S\D 048<,0 0$(,0 2S<0 \80S0 4S2 x0  048<80 0400020U 0E8  R:0B0Q 8\ 4@ ,0@0!@ x PrH 0,8<@D < 2B!?04 H @D0H00cD80 4Qt0LP `3RX3 H0 x0<3H tR880l0l0P R*l0 4p0%4 C@`\ d0%d @0RX OP|0@@,P0 R0 Z P ; B<в,Ͳ0,0 |Q-P00B 'PP< P ` PP$00100P0010h0 0 刐 |04 "!;42 IPP,0,H@ c%P 0|0,倲0,0 y V%P P%P J%P @CE^P@b0  x0H0 K"!0 #L,4$ 8<@0H&%0@ 4| !0 04,0Lds6s6j5s600 -@L p3P`0  B|`PQ[`h<;$0 :$0 " -LM0K"@ P0   -LM d0 0d  L0 @T0@TP,0``rZ$0,@0Z  Z [|  | 2% p-LM80@SP0 0<l0S 0S W`V p 00S0 a -LM R`0(  $0 ,` h0@Sph, K 0S>TL @ 0aP$  7$ \~&s6 -LM0@ 0KFP0 00  00 00$   0- @P L@P00 4 0 0 -LM䑟0 ,0 @`t0 pS( x0RP#N*K R\ KkPPC04 K0 !P0 PK  DP @P L40  < 0 0/&00  K0PP0  0  ,0 S ,>VpVLKN KO0KJK0 0FKH KP0[ 0P0K,dt6/e -LM 0@V/e p-L M@0@SpPP `K30 004 0  0 00lj i000n00rp h0 0h0 0-LMPx0h 4l0 0.$ .10.!  0 @8@0m -L M00PKp4}30 004 0 00000h t` Px0s@h0($240 h0 0 !1@00#!  "  004 ` 004 0PH` x0 @040 (8 Dh0@ 8D040Ld $ 4x0\ 00@ 800(0 i 80x0S 1\X `H@0L aP` 1$E,$P`T lj i00r0n0j0rp h0 0h0Zm -LMP@0S` p0s 0s0s$0sH0sL0L s0s@0s 0s0s80St 0ql  0P(0s] 4 0R P \00 P 40 (0s (n0n00s 0rp 0fh0 0 h0 p 40 Q Ph0h000h00 00Dp 40 Q PDh0h0 0 0h00 00h00s0s -LTM@P 0ST 4` X 0ST h0ҥ0D0 TpXx0 R0S*XX GMP@0K0\0d 0L0 TpLx0 hDQ!0`Q!\H zp`0pX `K c M@pKT00\ p S; X`  bM8@Kd0 P@8@0K\ 8d0@ HP0bSP1TL H c"@8gT0SUD0SPpT0$  T000S,0STXx0`K pLXʵW`  bLdd0 @pK8KPp 4K00 K0P@00K8@K40@ҫ@ -L P.\ K P'@ PK K 0@ PKD @ P oP0  ˽0  0 ,0S ,N7^O VO尽;[0 [ 740w 5 @0QLKN KO0K0N0 JK0E0FKH KP0[ 0P0K5,d(98t6/e -LMP` V$ !P 0@ B`Tqo.P`װc 0 @`ʰrS -LM@ G- -dL[ML 0 ,0 d! dA P! h0`! 4l! p! >K @h |A  KK!h ! P 0@ 0 6 ,0S ,6h1 `LA0X Sd1t 2R\1 2 x0s, h`V# `>K/>KX XDG`P@ld\d0x a0`V`!\T KOK\ `1QKd =KwPP >D1ROK@OPP HD1@ H0bT!S0!P1 0U*0S S0|1  Q > | >KH T1  @ 0 PU:chA0S`LA R0p0l0!h0XA00dNKx XxQL0 0P\PL0 x0 pĂ0 4ȌS \p@3 (@K 4 s|!R<  KKF(@KA?A/(@K0K0000h0 S|! :h!MK >KPP  lAT p 0Lp \0lA H}HHx1s KtAtA?(K K?K 0 48<S@1\SX `H@ a0C`p  1HF,`$`h2 (K 0<|!MK| 0@ HNK0H塧]`/>K<@0R@@0@ T`! SbV~KA_x0 s@0041 81(@KV 3 V) (K00000h!0S:MKiPP @ 0l1S pA@DpA Tl1 `Vڒ @0@ NK 0(@KpKK,0\0(KKK,020P!p1 yl 0 pc,dt66Q70 <50< .0<! 0-LM0 PR 040@0T  R00`0X @ cE  0 00 -LMPpx 80@0CSBld0l`\d | | 0 D0400sr@r 0R40`X  lLE0  P0  l|0sH<ܡl@BQ(68t6 0-0L@Pt $0@zR 0"P  0 0.$lR0 u6Pu646t6 0-LM 0Px @ 80鲱00  B40Rꈬ&&&L&l&&&&0     ;0 0 0-預@0 @$0 @ M! "Y lpb"`0%&&/@&0O% & "!! @!0P @`! ЍCCX8^n좙N - QLM`pd XQS :QM Q 00@ T0iTP0; 17. @P P% 0P: 0 S:Y  P `   0 0i 0 500Q  Q iQ Q00  0-80LS@P0 S0  0S S00Q0 000,#P8P PP \u6u60 3e 8 8-#LP $0X  0X H0 :8 8 80-#L@*q0PSq0 - 88LM#m0PS  0R~qX0 0rpX0 $0S1 $  0$00S\!S :0S \D | 08 %`vV- #V 0S p `p0 p 0  ap@TQ 0 0 @@MpGp$@L\#`*0  0  Q 0 0 %pľdu6 -LM@ 'D0S H0S \d0`t`\0 h9L  -LCM q 8 8#$ P @R `52 P$0 S $42,IK J/K0HPP(h 0S@0SP0  K .p0@ (hP#p(,du60 S 0 4   0  - 8L8M#@`pb;0SP$h5T \5T{ ?P5T0;0 #<5T 45T 0S o80@S o0P080o@4T 4T004T000P 0h4T- \4T P4T@0@4T=0<0(4T 4TL0 4T0004  C " 3 o0@S0@o@H03T 53T- 3T t3T0:0d3Tz00S0@0vQHrp43T00=0k 3Tf0Sc _2T0D000S0<0U2TQ ,2T$ 2TI0L0 0P0 0T0>2T:@2 82@T @/0S0+ 0) 2T 2T1T0S 0S 1 0R R   Q  0P  P 0T 0T 0T 00T 0T :00S0T|0T*`0Tl0|0T 0T|0T |0kB @sB@vB hB iB jB@fB@qB@f@xB@tB@|B@nB@wt@oB@88~fyBrBpBuB}BzB}fwBgBvtmBfBlB {B:8 -LMP0R,(Sp@TqnZP,@(NhnY s` VA  9P^PXEnZP,( -0L@pTP`/ 0S0 VPV 0R`@TV 0SPn0@V S n3e0 ] -APL` 88#OP@ m pR:0S 0S  0Ps $0S(0 $ \ bmľd p- 88LM@#P"1`s  p 0<@80m`00`Pm :8 0-@<L 88#Pm`0S0`0  Q0 0 0S000hm -LM@< 88# :0S00 0 P -LM@pTP` 0=  00 @T(\0 z<0S25 R-L`Pp U @V@1 វ`VPpKu6 -QLM`p P 0 PR@T 0=00 0 @T(e\0 2<0S101& -LM@0 0 $K01K $@ 1[!0 ! -L@M 0(K( 0 $K01K $@ 1[!0 ! -L M Y pp0Wp`XP4  R400400@0 @ @4`0K@#000,0 j0  尡 4:0S$P X 00S* P0  $  ľd -LM@ P 70  0P00  y70 -LMX0@0CSX0P(P,Ph_\YP P QN -LP`p @00P, d 0 `0J3eu6 -L@T 0` S V@0D00`PU 00S PUQ dp0S S l0SQ h 0?3eo`&\`3e 0-LMQP-P P@K00, 0'P0S000-0T@K00, 0PQ0 Q0:8:8,0 P h0SlP3e -LM@\t  P( h@0lSl00pp 3el \p0p0p0| -0 @LT`P p 0S @T p0 S 2! 0W*Pp 3e p-LM ` 0S 0 PU 0S PUp 0SU )k@kpp3e@-00 Q:bP, Q*@0R : 08 <4P 000aS a00R R 08< 408 08 -00 Q:lP Q*0\:00 0P00 0 -PLTM@`P p@@ @0S񟗱&&&&&&&&x&x&x&x&&x&x&x&x&x&x&x&&&&x&x&x&x&x&& &x&x&8&x&x&x&&&x&x&&x&x&x&&&x&x&&x&x&x&p&&x&x&x&x&x&x&&&x&x&&x&x&x&&&x&x&&x&x&x&<&D&x&x&P&x&x&x&&x&x&x&x&x&x&x&&x&x&x&&&x&x&&x&x&x&x&x&x&x&&x&x&x&x&x&x&x&&x&x&x&x&x&x&x&&x&x&x&&&x&x&&x&x& &x&x&x&x&x&x&x&x&x&x&x&x&x&x&x&x&x&x&x&x&x&x&x&x&x&x&x&x&x&x&x&x&x&x&x&x&x&x&x&x&x&&DpB `0K> `0Kq:070A4 p0.0 c+0\ 0@$0  g\ 000S 08< 4 Ud Kd0S 0 0\0S0 āUh Kh0 \P*U 0 P: cR 0P*0 0\*W \*0 RUhl K9l000| 0 RUTp Kjp0v w0P:UC 0 P: cR 0P:0 } { `0Kw `0Kqs0àpǠn0<àk<ǠigpelcaP07*0qZU 0 P: cR 0P* 00A S@-@**\ *!00S &&X&X&p&&&&00@S S S\!0S * R:!0R0SS `S0SS 0@S S S S 0SP`S PSpS S0  P P P00S*00S:00*S:0P @P:80 0 2&ľd3e3e -8@LM ,!& &h,`&3ed& -rL Q0P0 졟 0 R1S 1 R d 0R0!R0a50S 0S 0R%L\ 000R00R00  s@P.0  0@ g@P0@0@0@0Q!R0 0! Rm( :  3 0\0 F:8:8:8:896:8#eu6 -1LSp>0@5e0X0H0P  (`00(@0 (0e%d00P a l0R0000 p 0AU@@@` PE0U :8& p-P0LM`%QU kg@ t01ph`gp:8 0-LZg,0P@T @T0hLg3e -L`Fgpr✖H0PU ,0SPUh3g@A#e p-0LM0`PS@00P `~0S $0 0`t0S (0 0`jPP , 0`S00@ ph E:83e3eu6 p-0LM0`PS@00P `;0S $0 0`10S (0 0`'0SL,0 ``000 @5uphX pE:83e3eu6 p-LM!1@R5 `0 Q0 00   `00`0lp`0  p0`0 0 0 @0  !  !\0 @Pff0`S ph^f000 0@@0Wf:8ff 0-LLf`@PQ \0000  `00`0lQ0h1f:8 p-LMP*f5";52l!p1"2t!|1`, }ᳪPH@ R 0,20  0 `  R0 10  0 PA A R0000 0 0SU 5 P 0R 00B 0G PQ QN0  0 0S0C 0* %01$(,0@T 0 R 01Q @Tx&0 !phe< R@0@ D0@0 < @0 &4&<&D&D>8zēf3e:8:8#e:8Hze -PLQp` 0@S` TV@0@S0 0C0` t000 p-LMK`L@T 0S PU  pP  p-LM@*P`% PP 0S 5 P@pe@e-ppp -0LSp` 00C S `0gS0S0 C RV> PgU; 0S8 U0S6 0@T Q 0S  @TN PT UP\ x 1`?Bc00L` S g0 U R0PC\XP0S :8gfff, ,00S0 000:83e Q00 00C03e -LM܀`0 V$0  % P"0 @PPPTU 4pK㽓   㿖P`PU@00T00S$0 S $3&,d3e:8v6 -LM0@S  P, ! 00ah!&8Q 00+ p-0LM`PV @T 0  R @T`Vp  P 5 0S 0 S Pp3e p-0LM`PV 5 @T 0 R @T`Vp0S Pp3e -LMX- 0pW @T 0S @TpW PU 0`\ *0 0#\:Z f P  P 00 P$0  Q 0 3e:8:8:8H0Q P 0 RPQ3e -pL"W`4@T 0S @T XR 5 M P Q E P0PP*0 0#P:P P-L`Pp @@T Q P P@ 00 0@ 0S0C 0 @@\ $0\   ^& 0-5P0L5@T p@TQ 0 S11 10C1sr0h%# -LM5@05#hGq -LM@#(h 0-@PTL @JrT00000 p-LM`bp0P@T %5R0C @Tb80phP (5|1S 3e8 0-@0L@PT 0 P @T003e -LM∘PU, `@ d8U \8U P80SP,8U ,0 S ,+$Pp 7U t j7UQ 7U~ d7U. 7U! \ @p  0  0,35 b@;b-P0l0 P%   &q $@T(@K0 (0K'KxP@ <P& P@D@K Ԍ bP@ <P P@0 S XK0T @T @ZT3e,d@v6,5Hv6 -L$M@0Q0  %2 @00S@0 0 S h<55P2K4 K p@00CS@0ʼ5<55 ,d`v6i -QM 0P P -Ѝ0 Ѝ P0  ЍO -L M\ @\*x0\ 5S\ 40\ -R1Rh 2i 1i i i -L$M`APAUD` H` @ p2` XHl@S 40 40 d0S @40  \Q 3 R*TA`@`@0 R񟗲''''''''''''''''''''''''''''''''4PK  @0PoP 1  5  7Qd H0S02K H@ 0  &q PP 0 B0 0 XF 1000@*K  㔋 㐋D0 S<KqP'\!1R001S1倁0℁1`/  0P@  _ \k1 01[77`H  k! 0#lH @0@4PK B@BK@04PK PP02K* 0;/` @0<K0D0 @0 @$@0 nd@PA` 40 @dP80@0Cp80`-8ʚ;lv6 -LMp`jWG %- 0(   R \ 0S  R\  P  P11<<10P@   0@XT "48<#H 1 5 R[ 4T  TC 3T 00S:0S50S2 3R.Q% 0 0CA 0p P0 0C 0 V 1000 㺓 o[ k`alj0  !  !2 @PZ0pS ZB 0R 000S`0`0`0000vj0S000 0@@0Z2T' 1Tw0  !  !1 @PZ0pS ZA000 0@@0Z5bp~50  !  !0 @PZ0pS |Z@000 0@@0sZ tP ojoij0  !  !p'l:8ffze5݆̄fD>8@-@@:@0\#" 00  @Z00D`:8 0-/0L@P1S0 e h1d hfPUe 0n0\2D0 0h00@0  8000E  /?04'UVWY -LM\"@R \0700\"R\@-@ *,  0!\ "0! ":j5@-^p`*#!^ ",!1 #: k5k50 0  0-0LSP@/ S /0  0S0S 0S0S0S 3000  00 00l ˈd0ST ÈL 0^ 0 000  0 :8:8:8:8 -LM@pHY@,`K4K P@Q,0[ 40[\B 3YT  40S  @+PP0 00Y7 |P@"  k g00 p\20S\"00?\B0`" `" Pd2 0d2X4 X7 X -LM@X@,`K4pK 1P@\B6T - 0S  @PP00CS0 X R0700 `20C`2 Pd20Cd2X4XX -@LMh:8 - LP`@T0 0 80 h0%0 p1h!0 Uppd0f e@7D 0 kv6'@'3e -40LM @P0 P03e -LMp`P@ DP 5T` 4 20Sn 0@/ 0S[ SAPP X 0R?000Sp0p 00pŠh0 .!  , !41 @PW0S W| 0@P 0OW000 @@W000_g W7 0t7Ug/`@Og40 3A0 wg6̄ffflv6zev6Q0X0ᴁ0Qx0Q *p0Q  5RA05L00R  R R / 0Q0h02i 1i i 'i -  0@  -@L`p  PP @  0` pP0 6v6 p-RLM`@PPU@p 0-L P@\p 0  170P \ 0 P5v6v6 -QPLMpP` J WH 1RI 1RD 0S?0@S000000@ PU P@U 0S @T1! ; P UR*01P UR:$ '0U0P00S @ P ` `T @P` P5i 6i( \ 00S \P p-LM0 PP `@u  0#U TpT0000 0  rH 0S  0 Q  0S ;80S 0  0S -0S 0 00Sp@-0 PbUe Q@ * 0`R@ Q:Q*0SQ:?T00S eP*0SP:Tppp p-QLM`P@ 0 P @4PT P 0S P 0Sp0@- @0PS1!^d0 0S1\@ *0 0#@\:00`` -LMPp0 S,P 0  0PP0S 0 0 ^0 R*0P  R: 0 0SP0 0S0SA^@PgU 0 9 0YPUPP`V 0 0Y`V,0U 0 Z 1!P@ 0 S @T 0ST  ]P XP @-0S<@ 00  @ 0 -pL` P@ 0\* 0S\:0000Q0\ f03 0@@ 0  P@@0P  0   P 0@@  -L MP@`0UPR` U0 V|Ք f p@T0TS@DT0TS $P`U"0WP 2 AWkPP0DUpZZW ! 0Pp8 |10@0Ճ ԃd1, K0X,0pS0@ T*0S! T 0 0P0P0P 00P Q 0`0^00 00 00LT@ T*0S |F3D  8Ppg 00 F}a4eX`=83e|=8w6`` 0R P* 0R P: p-LM0P@S0` 0 T\ J00 00 0P0`@p2pF@4e4w6 -LM@ 0 4 0p Q<0 @p D  Pp) 08#8@0 0, K0,0`S8 = PP  P0 0Z S ( Z S 0BS n0S {PP`VD 0R08 V00S P0 S` 8 0 00 0 0Z 0 0p p,08 SP0Pp08p#0SbP @I0S@T0@0Z @ 8 C8RḐ֡p< P0W0 R00S@T 0IS @T 0P ,0 SP 0 U 0S P 00 0@ 20S`W0 S" Q 0 S R 8CRQ 0pWP@0S 00 0 D0S 0P00`SE0PS0`=4( r0D 4 `S 0PD0 @PP@D` T Y1Pw6|w6 -LMPp`:P@ P R  ePX  PPR 0S @T 0SV T @T T R `V  0S PU S EP pP* T! 0 P00Spp 0 P 0SPP0 PP#0 0 #00PSp 0PPPSPPQ 0S`V `VPW   pp 0S  ppU` 0V PVUV 0!P000  BR 00`0`PU \ 0S $00E 0hp0 QbPp 0U0 Q00S`V V `V0 I 0p0 V `>`0 P00S 00CS 0.$0)4ew6w6w6w6x6Hx6 -Lp0`S0S @0 S 0S0S PT 0 @ T 0 P 00 S 0  0-0 SLP@l 0P 0h -L`lPf0 @Pp0`p 0` 0@0 80 00 00 0( (0@ 0\```%'*'x'T'/' 0-0L R (0Q R0PS0h/ ,|@Pt  0T0T P*00P:4P 0 l/#e4elx6\`x6``X`3ex6h-\  0RQr r0R  @QP  0R r0SP   -LMrPrXp@`@  Pl 0Sd Vn 0@S`` @0SR T  0R @Tr0S@2 ` T00 S 0@0P 0SPP R 0 0S 0S P0SY 0`0P0SP0`0PP!pjP`pG@ W@ 0S V``@0 SX.x6 -LM@FP@ p-LMP`@@V  r00S 0P@pU 00\ PPp -p @L` PP 0   0R PPVC 0 Z 0'ZXrrr0S PU 0 00\  PPsPr r0R S ceP0 Q0SQ0SPV -PLPp <0S 40P 40 0 R 0S 0 R 0S `5@90lHḆ$HpVT rP@g `VTV +`80080lA8K` p-LML@0`SP P0  hpѤP d`p@-2\ \ p"Q`@0  n `&"`b.bn  n ` &"`b.bn  n `!"`bP. b0n  n `&"`b.bn  n ` &"`b.bn  n `!"`b.b0n   n `&"`b.bn  n ` &"`b.bn  n `!"`b.bn 0   n `&"`b.bn  n ` &"`b.bn  n `!"`b.bn p0 Q| 0 n `&"`b.bn  n ` &"`b.bn  n `!"`b.bn pd`y7 p-LM@PT7` \\0 oPL P 0 a!0S00@@ p=8=84e -LM@00e R000 h 0 4e --1LM@0T` ,0 p !0R @TW LP 0 pP o0S  W]!R 0RP* P!W 0]PP L  0oP6]pn0S   P ,P4eʚ; -LM Q`Pp0@X S 0SUTX Qa?'@'@'@'@'@'8@'X@'@'d@'@'$A'@'@'@'@'A'@'0 W\T :9 0S ElmKnV 0S80 0 0pV p 0S 'd--P@ g| @ P +x6 - 0L10p \PP X0@T L` R@TP0$4e#e5e 0-LM@P0 t@$$ |d0d0P0 0S0 0P p 0s+x65e4e#e4ex6 P-L@P p0P`  PP T`p`` P@1Sh(p(` ! {=84eP0 ,0 0P0!R00=84e -LM@ \ <0S 40 -LTMP@`pp@ ELlKD {hP  P0t U P@N 0KWp  40 80080 Lpp0K 8 `Pp@ 80080"p@T 40  0t0  Da{ 0h0  ` 00d0 <0S 0 X @0 T <04 ` W 0S DA{ t 0hP 0S  00 04e -PLM@0 80 CR8 40R 0 00  B 8Q@P 0S0C 0 p 0h% h+c*x6 4e4ex6y6 P- L 0SC hN*(y6 -L\Mpt `@Px@ P3@# 0 x0 &30#0P00Sp 8 0 0R* @\  T00R00S T !000lKDztlK`  x0h dp P h Z000 ^ <Ppp@0SPp:Tp\ 0S 0S40,  \lKDkzp t`p0KlK8 ` <` 8P h dp pT\4`@ !40 040p0 p `A@4e 4e$4e -LPM`@K`Dd 8zdd0K \ T 0X 4 0 r XV"@T 80@ 0CR80 '@0S$ 0S0C 0 @P 0<0 0 S 0 P1 ,0S D,u   @080%P` P@K"v"0NK P0KOKh@ Y0S P@t 80@ 0CR80n Z VY3AGUP7 @ .p,dDy6hy6 0-LM\P@X T 0H@Q<0<@ 4(y000%=804epy64eh`D]'xy6 0-0L PR  nP@0 [vH 0QP  00@0=84e -LLM@`Tp# dK R 0 0 0 R000 0 0W  PU  0S0C0 @T R000 @&D v 0 ` r P04ey6 0-l@LTP  tR 0 0 0 R 000 0 0  0S0C0  l@T0&y604e -P1pLMD!P0l@0T\0` 0S& @TP@ up`Pl00Sl 0 0l0l@ 00@@0007 R 0 0 0 R 000 0 0  0S0C0 % +&-8-804ey6 0 Q0 4e5e 0-L@P0P   0 -L1LLMpE41`V1 @T+ 0 0S&lK R 0 0 0 R000 0 0 PU 0S0C0 @T 0 0S`V E H%D u 0 h r P-84e04ez6 -LM0`SPp@T P8 @T0S `2S$ 0W0 P@  ,0V0r,0  ` 0@@`00 @@`08V#x 2S ,00,0=8P40 R  2S R=8 -L lP 2 S R,00CS,0R00000)=8 p-LMP`P@ $ #P `#Vp4a' -LM< 0R 40L PT# -0LM `R lpPP@ :PP#U0pW  #P 4e=8$b' -LM< @R g0S 5 40r 4   540 r4  -L MQ`P@ X 0R0V00S PT00C0 P<800C0 00C 0zDVp2 1 R @( 0R0V00S T1S000 S0000 0  2d0@00NDY@0@ @  5eЇf=8 p-LMPR`@ P@ pQ iSP PS*@Q 0S0   @S*@R0 0 00 --LM` 0 S0,0 "1p@T !0R @TW LP 0 'fP 1e0S iS!R 0RP2 P)P 0 ! W 0SPP L  0eP@Sp d0S   P ,P4eʚ; --LM 0,  `PSp` ` @ p 0Sg1l  R 0RD p@0@9 R3ڤX0S X9 V 0 {T0QRU )9<X8 ,0S ,aURPV 1R0S  S+pWR {P`  0TH8 Q80X00XS P0S pV W0 p@00Z ?P 00 0 Q ?Q K D2r 00 K 0Rd0 0"S0S 0"SPP P p0@S񟗖j'k'l'l'l'l'l'l'0S @K 0K@Pp R L ($ 800C800D <0500K KoP㜠p80080 00 0 00 D 7SE | 00 <Y 0 @0| 50@0t0  t ᶐ 0 K 0P  P@ qO` K040(00 r0L 0?0 047p2P@K"q"0P0KP NK h@ -p 0P /p P  0 p aP80080Q 0 S00R0#S0Sq SKPp R}Pg|P_ RTT @P P 0SC 0S0C 0< @@ 00 0<(30S 4 0 0 4 $(L <050@0S 0S0SD0h@T $0T  T $000 T @Y K   K@4 P@ ]P@P@ Y |P0S P @ 0 PEpz dSb @Q r0SH P Q0S<ZA9 ]Q 0SS \P  0 S:*P  00 \0S@  90 8000 3KRKP`(SPP7 ,d5e=8=8=8Dz6ЇfDz6 0 000 0-@PL0@p00 00 0 p-0LM@`,P,pT*\0 T0#03 P00Sp@ 0B00R@@ -LM 0@PSJr'r's's'pNPW`3V/ @ pp@oU1 P 0$ 0A0Q0  pQ@ T0S0pᴠ0 P; O1@O`Xppp -L Mp 4 , ` Y YoYh ,0SXPLPV0P `@1P 0$ 0AQ0V P `o@ T0X0V00 SP 4 R 00S 00S 0S P, sPP0S`040 0VX, VR 00000P, R00V00S00P 0>o, RPTP,0SPP -L` ^@PP@ Z p帀04 0帥U 0 0P  0m5e=8=8=8 p-|0LM RPpP` d @505,P03x$ $0 ph5e=8=8=8 -LPLMh @p \p P `lKDnWV WVWT 0   lKX ` L P@2 $00  l0 0WV WVZ!  00lK` d0 h P@ %0 4 p0 0l  X4 0,0  0)`V5e=8=8=8 -t0` pRL]PP 0 @e `n$$ $0 ph5e=8=8=8 -LtM@0 SP, @ KDEn< 00 D\0   @00 | 50t0 7SW0 Pq0pS `V 0S.0 Pa0pS \ 0S,0 S ,40 0T $X0(0<0 0pP000040L0r ( 80<0< 0 0pP0000P`K"m"0P0K&P NK h` 4 0 v,dTz6 -LLMlKP Dm3pW  R 5R pW@T 0 X P0`S X 0S0 P0`S Q 0S^0X0 @T Y  0Y @T0T0 L0 `0 T 0 `0 0 L P0`S P 0S"0  P0`S P 0S  00$l00DpP000  00$l0 01pP~0005050d  e00f  g00h  l00x Rt000l0 0pP]0005d05 0>vl0 0 oPI000[3e -L$M@PPp 0AS^DK`l 0`U80 D @ 0 < Q n=D0P0CS''x''@CP0 VD K# V! @#TQ=,P80K  X8  000hS0:  10 ?A1c0EP DKD0  =  pPDy'gfff4e -LM0p @@ LCoP`X0 \lP00@ X00 0000 X0   L$$0(@4@M0 -`LM wu1}i h101o 'l!O0p00P@0S2PU@xAp1 l1R!    H8' 4!40Sd00d0 c> /0Sh2 ?l2`l0%Gh,xU 0 0P00o0 00 = S000 0S000 0S000 >S000C( 4>8pz6xz6 -LM@Gp%h"{Rl2l2l2 hH 0P 0P>@0C !p @#2  N=@0C40P ,0P(0PN=@ 0C! ̇ -?0LMo.S@ 0`?C0CQCD0T T0000 0 z6z6 P P111< 1N P PP1N  -LLM ğ0{@P`,0 $ 0h AdKh k몯hp#0S7WpWd0[PUTK8]h R h5t0A0D,0 S 8,rdK0  @T@P0d0[U ǖ 0  0 0  B0 ǖǖǖL2 1l0 0ǖ|rh _W 0PUp p 00  t0 rP@pP0U}l0 @0ǖ5,# d[t Qd K0 R QQdK0 d K0 h Ð R h B0 0ǖ 0ǖ 0xǖl B0pl 0iǖl0 0aǖl 0Yǖz@B,dz6Xk5 Q00S Q -LMP8S vSp   Wp!0S7 B `<` ` ``VW x1@ R4p@TT1 R P47 S74S gV '''''''''7<7F47<P` W@0\Ġ @Tyupp lS Sppp 0-0 0 7PS007L@S؍'H't''t't''t''2 0\:000 00CS꜍'''ȍ'0800008080:00;0<0<0: -LM8@SC \ Ȁ 0 S05x8A-_─pP0@T`t0 2 Q 0 0R<<0 Q@TpWPk5 -"L0PS1` QS1/A Vn00S^ ^q  hυpVL 1q R000^Q-1q>0 R!1?07^Q +1q>0@$T@m"0`jE1q>0@ T@0!0q.S 01000S {6k5 {6 0-7L P|000 Rd0S 000S20S@N0"0T0 P0Q00R0S>S  R괒'x'''x'8 1S1 Rl50 1 SRl5 Q-L' QQ[$P P  P  P HP 0P `P lP  0@*SX'@'p'@'@'@'@'@'@'x'@'@'@'@'@'@'@'@'@'@''@'@'@'@'@'@'@'@'@'@'@'@'@'@'@'@'@'@'@'@'@''7n {6 Q-L QQ20@S ''''' '('0' `0lH$7P  P PnP P, 8{60 0000  p@-1 @^PT * ^0 0S0:[0"0CR  202 ^00S0 00p00d0bT00"R 0S00 000S20C2 ̫7.  0>. 0 > 0.> 0.> 0 2"ᄙ'' -NLT` @\D0D0D0>@D0H fxNTN@PpX8 SP  @fpWZ9  hf@P$ꔘ'''''''''''''''''''''''''''''''   -0L0CS$\'t'd't't't'l't't't't't't't'\'t't't't't't't't't't't't't't't'|' 3 -LM0@0CS ('0'D'0'0'0'P'0'0'0'0'0'0'0'('0'0'0'0'0'0'0'0'0'0'0'0'0'0'0'\'  hf 7  0SO<1c1c10 < 0 0C-LS&h''x''''''''''''h'''''''''''''''''b F| -7@PL`@ R0SO/9 00CS,t''''''''''''''t'''''''''''''''''P EP 0R0  %"!:1`1c1. E0 p )P0 SCLR0S E 0@8S -LMPU, K@ p `K  ̸ K U0[PU0p0K@0 ,0S 0,@K Nn,dL{6 -LQM `, KNVh l  p@# K]KHhl!0(K@ 3  /,YK (V$08 `V p#H@,0 S 4,YNK n,d\{6 -LdM`!@0|  ,0 Pp GP xKmY@ rKm 60P lKmYP LKmh0hZZx0K0L00@0 0D 0|  0 ,0S ,,d''l{6{6 -LM─@KP` p$ h 1 -PK (& m $0S $,d{6{6 -LOM─NOKP` p$ ;h v rV_K mk ]m $0S $,d{6{6@-PP@  0@  0@ -LM 0`  4R$ pP& R $0S $qOK  >Q<ROK QWOK Z8PK ᔷᒷQ l,d{6 -LMx0Q@4`KPp $0 l c 4$0 PS $,d{6 -LMP0b0a^, d@c3 )^'Vpf  pb08#h"00 Gjc00C8#hOK  ߷!0ܷ08#h_ #<" a0b`0 ,0S ,1  l. 0p00 pW@J000 _K  klOK K fl 〴 0᝴,d|6 -LM0a b0^$ d@cp ^V $0 S $ @F_KBIl0 _K1 $l OKKl 9㞴 0V,d,|6 -LMNPT`p 0S , @@TH P@!  `k0@0.@D >@` k00'R/0? *PT p-LMNPT` 0\!  @@Tp0S V P 0- PLhP@ 0 @00 -LM@P00 -02L4M@, 0T @0X 0PK080 PNKO0Kpk  HKlk BKhkXeXPK o @ BXi GP @P@O 0 0 L0p 0 T 0  0T0 ☀\ $4 0@1 #2\0`%8XPP| 1|t 01!1* 01|@@0|0|@tEG| 1800|0 0kS0| p 0 S|0LK t@PH | $i 0@| \K#$<0 #  #(80`x%<TP4:0`&TPt@  h1D0 0; |>|1D0 0,d|6 -LM| E 0x ,0 P 8 | 0R <0 @a 0 0SPP F 0@ pP`#L4!(P`0@ '|@0pP` dP0 KS:@0S:x|=0=>4 ,0S ,|'=P 1| 01@!1* 01@00@|E 18000 0CmS0@K 0TK S  `D@KdK @L g @ DK 0@000t K0 50K6@KC堀0|0hS0  9ژ  0\    Xg  0 h0lR`1`! 0PU ptK 00#00 ,@T P7U f Q T%Pd@K0 0#0PUP4@K0 z?  uPK |>>x|=0=>4  ӞўDK08#̠#8t K0 @6K50KĞT<0PP 0m\ 0 0S  ; U=1D0 0x|t=0t== R  ;?= 1D0 0#0S00S100 @00S0000|=,d|6 0- L@PIdP 0 7 S!00 -LM@P00 -L,M@p`Q:''''8K  gf 2K cf00S00SPPK,0K0+0K)0K*0K<  0 @ g@T   00S008K8K8K  +f8K  $f -L,M@ <  D x;P 1@P 01!1* 01@0 0@@C1 8000 0jS0 0 S @pP L L eP#$ l@ 8P@K#8` U0xpxgXX p`Pt  0 V`US 0@e0f T@! `0[t dXt `P8PK 0 b< 0` E t00 R!`p@@K!x0 t IPppKpX: ?X: :T=0=p0Kh1T@X=0=: (/9P@ 0mXp 0 0PS ; 3:1D0 0TXt=0t=:YVY` \0E_`P`; :1D0 0&00Sd@000X:,d|6 0-LM2@SP 0ǐ 0^ \t0h -LM7`p 0  P@ 0@ "b!Q := 0.WU U : 0>757 : 0,R50,L5 0t x|6ľd8'G-P#00400M0a 4 㲐ᴠᶀ0p 0@0 40.#40 !44 "0 0 4 0"#4 0 !44 "  0 40"#4 0 !44 " 0 40"#4 0 !44 " 0 40"#40  "4 4!0 0\0ЍPm5G-8M#800Qڸ0 000庀40( #40,!$$0 000p40' #40,!$$0 000`40& #40,!$$0 000P40% #40,!$$0 00 0@40$ #40,!$0$ 00 040,#40  "4 4!຀ 0 $ 070pp0 $!070`` 0(#098PP (098@@ (098 (098   0$0#00ЍPm5 -LM@ B㊹P 00 -LM@P00 -L$MSD 0@ ,0 `H 7P 1D 01!1* 01@0 0@D?1 8000 0S0 0 S D @P naH0\ 2\20 ŠH01 ,,400<@K30 Ra 9KNa  HgD  0peW0`L0  0 UPVQ 0@f0eT@! LL   pdH0hWP`q=P|6P% 0 0LP P 0%$%%L P @ H0F 0 0 0 D7 0 ,0S ,?@D=0=7Y 7E6P@ 0W 0 0`S p ; I71D0 0~]; <71D0 0B,d|6 -L,MH `<P0D ,0 L H0T  0RHT <@K ` 9K`  L峨H05P 1H 01!1* 01@0 0@Hx>1 8000 0CmS0~ 0 S T d``TP0H@00 0eT X p`P0  0 V`U< 0@e0f T@! L0ᅨP dXP `P@@K 0 80L oP@0Q H!7 0 ,0S ,iD Hx=0x=7 7p5P@ 0mXp 0 0PS ; t61D0 0DHt=0t=6Y; a61D0 0v,d}6 0S QQ  -LM`P,0 S PU<0 ^""  000   0#20 0$ Z7 2S0 R8= 08=0 R8= 08= 0-LM@KP [ P0S L'T'\'d'l't'000000@KX [ P0SL'T'\'d'l't'' 0Po5So5 0-LM@KP j[ PP P 0@Kp X[ P00CS''8'8'''0000Po5So5 -LM@PP@`p0 V 0 p0qiPj Q@0 @$1S` A0B8R p#hK 0 SD0SA Q)0 @$1S` ' BV(00"h"Q 0@4Q1 0@4 Q0 R@@0S(S0 F0V(0"h@* 0 F0V( 0"h@),0\0 e8=(08=0\0 LW8=(08= 0-LP\@  0 S  CP 0   rZ00 -L\M @p#TP0 7 p! "#0$4t p0 `&0 S\ T $Pl h d ` X x | 00S8=08=0 SdP  S SXP  S\P  <=0<=0P R\ R 0SX0S 0 S1q>0  R!@=0@=7S x Z D=0D=P0 / @ X0PP`PP 7S ?  d R GT@ X 0S :Q.  'YP -0@ 0P0T   Yt  0#p ?0#p0|0t0`0\ @n7S 0VSL |2SI  C;@:0 fPX0 Y7S3 70 l R >!Y >00L K P00 P NPH00@  <008  3[d R > (0p 00tH KdP0d04[S +D0  4[S *<0 80^)<@#[ #[ < 0@S  \  40S7 \J ^H NPD00< SS 7 7 3[<.0[,`S0C.0KP X0 0P0 l0 3h #7p p p   tP@`.0[ CS. K 2W .W/0<0.hH K`vP0`so06 :  0Y0p 0t0 +  Pp @ 0t\=0\=2S\@  0S`@ SQ8=08= 8 LKVLK 5P0Sd@ SPo5 -LM@pP` $=0$=7S ^H 0440 P 57W202T=0T=2V"0  00 4R `80 P 0  00S8=08= 0 S jS0P RZ 0S 00! P 8 ? 403 0Y> P V: P5/000l1 R 3 77 777<1 R 3  *1 R 7677 /000 xt076/00d=0d=2S0P  SR8=08=X ,KV,K \PP}0Sz0S`vxN646}6Po5 - 0LSpP h=g@0V h=D V 7W 5!h 0 02xt}6 - 0LSpP l=g@0V l=D V 7W 5!h 0 0x}6 0-LM7@SP 0?  0)S }U00 0t 0-_0L @ 0)S 00Sc0;0- 0S0S\ \-MP\;  \ \ \ p=0p=Ѝ0Ѝ\Ѝ0\ @\Ѝ50\ ʀ\ \ЍSЍ\ \ЍЍЍ p-LMǐ@\`P p7  2S 0S<0P =0=p 0Sx`V 0Sx0|0 CR  0 00 00x7S`|7tg0xg|7l -`LMPp! @T' T:0 0;[Kpp0\0C4[ B  NK0R -TS  BK3535t0c0u ?d 0x 6 ?&06"l 2/p00/t0 0x0' Px00x07Wx00x0v 0-!@PL OT 'KT0;:0 KB0 [0C\J%#53c0t0d ?u & 60 0&? l "p02t "720v -LM7`Q 0S7 <4700CS@N@pP R YPp@ 7 B<7,40S R%X8S J0S00X800 !MP P   -7^<00<L00@`pP0SpW`P@D0ѵPX8SS 00 `MP Їf7  0S764700>0>0>>S0>00>0>0>0>0>0>0>>S0> 0S S S S >00>0>040>0>0>00>>S 0>7677 :0 0>00> 000>00>000>000>000>S S S S00  0>00>000>00 -LM@@;\, @P` ;\ ;\ ;\q B:\  0K`,0 S ,:P`1p ȠHȅ \9q>0  R! 1?07H87S7S7 p R 4`:HQ7`9\9P`@ P7;77S 7S7  ! '  P7! ; 7 sR<9喴P`Ǖ ` 0S7779\) 8\y8~P`x!8  R 7 7 ;k4`7h7 e ;8\Z|8 @RhZD8XP`R7@ 208S084`7FP`@&;7\ C7\5 7\+70P`*7!S [74`207\L7P`0S 79 5 7 Q879 57 H/6P`76\D 6\6P`8 06\L6ڳP`Pp 7P` 2S S S` 0t0` t2`5嫳P`7S  Pp x0   ]Pp5勳P`84倳P`z7Sw 52`s ' 07 7 S'  x$ 02c0$ pW4\ W4\L ,t4\7900I X4\?+J>84\67S'R 7!  G* Q''3\ 3\7@l3PQM3\ 7S >1 {.  017#500"00<3\ +03\" $3\PpK! G7S 2 P KP [OKP! :0;P0K2\p lJ2\O 2\7` 00!徲P9   0 0$2\( 2\ ` Pp 0|S:̐K |  3J`V0|00 Pp| 0S*yPp  yu0uP`oPK! IP`hP0[ SN@ FP [OK$(O7S7p7SH}M,dii iii}6ЇfiVo5ii i i8i$i i4i|i848((~6\o50~6 -LM(8@R(8RP808 0-LP@T 00p00000d G 0P~6 -LM7@SP ?S hgΧ̧07 -@LMsq  LOǔ\ p 0oRp -LM7@ '7'S7=-00 7-=50` 7X T0 \'0(40 ,0 y> hp~6~6P7 -7o~pPL`pPU_PO1s>0@HT@ 7 0  7p Uh@4A0sN@0'00pP x -LM5P@g707p@L O[N'p !N N7S7 '00'0z 2 @: : ;N- @@ WE103037 037 x  %l>0. >0. L7  0<70<N@ 쌅%E1q 0\8Xn$k 7  ?  DN@0< D>1.0\8XȂ k !  %N~0Z$  T~6 p-LM`pPf1q>0p@_T@H(1@@R p0S@7ST'P1@0SI @ $8@S : R3 @ % >> @@ @@ 0@@ >,@@ 0 S@@ @@@ p @@! '  P @;P   -L$Ml5 `$  7P#L30 Dy> KR7077PS} PpG 2@S f S"aPTW6  Wp2 !7J 0002'R T [0S x' 07 $0S $ )7S7  $8SP '0S y.000 0 7 EUPWp 0 RpPP DpKpMpAI 0  =PPDK0q>0  R! 0S1 \\ j1q>0  R! @p \,d~6P7~6~6 0-G.0P00000.0L  7  000.00000000'  </000000000S P  |L/0<07's\ 7S2- , -LM81@Sɤ081 -LM@h鼤 0-@PL-.CL0818!NR00h  p-!0LM@P ,L02 2 X PCL ?}7`S  8S0 8 phn긐(Ī( p-LM`@^PUH=0 H=p p-LM`@MPUH= 0H=  ''K7p p p 0-HLTP ! 1P@@T0 -7LSP` 0 G 000@pW  0007SSPp [[ K|2S   -LM K`@'P9  p@PU 0007S" lPP 0Q '_K[[ ZK|2S000 G000ro5 -LpU@PT` p0S 0S`3`#0S:0S`VP 0-7LQP@6 /09  2C   80C8 R xQ 0 Sx0|0 00C0!•\8S 80?  ~6 p-LMP`5@@D@0T2S p)@ph! p-LM@[`L0S  Qpph@ -LMwP07 .P@ (8R 0S `pV X@ m7 S Z=0= 0`t -L@`PKpP@ P@h -[PL@ p`@0@[0[ \7JV @[0S,= `0,=[@ &J[00[0 m!0@-\P[@[ Q 00S  Q Q @T00xo5 p-0@LM00o00  =΄ 0 0P0D g09SS  0 phphI0<0 0-3LP@0  Q  P/000X'0R007673 777007 q -LM?P@Q`'{>0SCgp9"Ƞ2C3 ,^{> R1/0ǔ9!2C#0! `R |2S00 t02'00D2iI {00 0ti\ - 0@00o0C00pLP|p 00C(0  0p<00O/00Drp 0-3L  P@ 00C07 7S? D 00C(07'6 70 -LM7@SP" 9RbC ǐ 1l61u 00R00C07 <0 R 02w~6 -LM%@: 0S $ 00?P o5 -LM`4@Kp-0 , 80 yH`XW@'0' <0 ŶPa T HP ,0 S , 8KP77 07  O[@T 8K P<\0 H8K P02  4'F0 <@!;<50@ ~0 `x!( r8K ]P t t0T 0@P@TP0PP^pWP@@y,d~6 6,6>6D6P66646@V7}60@-R9)Q??  @$,  0 0-WL@xQ 0S|0x000C0S 0 00x7S|7t0x|7l0?0!! p@-@^P 0S 0 0p`0^; S 0S1 0S  0 `\ 00S0  0Q   ^ 0S 0S0\@ 0^@@ @@@ ` ` 0 R 0S 0S 0\ ` 00 S0  0Q  0S0\@ 0^@@ @@p@-@`PR 0SN0RK \ ` RG R 0S 0S 0S  PP 0S 0R `S00 PS0  0^   0R 00 S00S0  0Q R0 0p0 `S00 S0  0Q  R@ R 0S7 R 0S R 0S0\ `S00 PS0  0^  0R 00 S00S0  0Q 0 `S00 S0  0Q -LM @Rp` 0S`V^ ` 0S``X  P0S P0S@@V^ ` 0S`` \RP 0SPP 0RPP^ 00S p-LM0@S`P @OP00S T0 0P PPP>pp 0-@LTP ,P@@T00 p-LM@PT` P`@@Tpp0S 0S0SQ  0PR 0P  R 0P 0S 0S0SQ  0PR 0P  R 0P P0 Q0P p-LMP7P@ S`` 0SI S p 0PQ Q 7S ' 㓳PP ㋳PS00S(C(dC(C(C( 7SS' rPPP00'R' 00'RPPV 0Sp:8 -`LAAP@Pp Q2 "P 0iSS  0myqP6 !1R"1S@1A0A1/  0P@ 5   l1 01 076 -QL Mp`P 02 Pt0 0C 0 Vj 1000@  P 0!21   rD nD' jD7  UU: U8 5 7S PZ rpPp@0*!007S 00`7S`d7\g0d70`g5l tP 0? @ 0@00  r`9vPq5p56 6Q0פ7SP1>0 RPG(G(H(H(P1>0 Rp5 Q5 0Q 0 $ (,<4  P $?S?S000@ A0$0 0 00 0@- 00  x0 p0B0 022 00 0 " 0^#40 (p5*00 40 Ǒ R  R    .00  00 -SL,@K0@K MP` A0 0 P A00CPS񟗪Q(PT(@T(PT(PT(PT(HT(PT(PT(PT(PT(PT(PT(PT(XT(00pP@xk$4@0pP@XKX:-$4X0@ P S00X00P +AP %A (P00"H  AP 0 8#H A (P00"H  AP00@ @ (P00"H  @P 0 8#Hz  P@@@o0f0d0`p5p5H6h6 -00LM0 @ 00d0C0 -"0LMP(@K0 `pL @ @00  0f0C0p5 0-20@0PLPEP  @@080-0"<""Ġ0  p-PLM U` P@ U ;0 00p1ph 넀6 p-LM@pP`"$8 R000R0C?  00 P@  $(0S0 0c0 0p -LMP'[1p:\ R   P \ 0 C[ 0<   0 4 zP`8 @ 676 3#40@d: ; 7@S6 0 R- 0S% '0 '000c0 0@@@ @@@ p-LMHX P%$ `$H%X 0  `P@p -LM("HP0  0 000L -[0S 1 #:0 Z00[  0pS00C0PL 0<? 00 0 ?  00 P`: @  p0  3    40 Z 0#40@4 : ;0@S&7 0? 7 000c0 0 1@A@ @D@' >@  -LMP[(Q010#0Q0"h C ?00V  4 <P[p@*  1V&40`  00#4000 L0S030V00S0 0c0 0 / 0 -LM("HP0  0 000L p-LM0@ `OPP  00`P>p  R- L0 R0 -QLM@`p 000@W{ 2W' " W =P0=A PP  0nPPZ= P0= W 0W("(!PPW8 PW W("(oPP 5 ! 00IW WH( 0("(JPP 5 !ܪ P8#8((PP 7SO뤀6Ѐ6 6 -(`L"x$PP0  @0 0K00p @=  = p-LM@8#hOPP 0 @0 0;00`l=p -'[0pS 1 #:0 0 7[S00`d2L 0RS00C0  0< 00  0 4 PPZ nPp0 0C 0 Uf 1000@00 岀= =' = ⶁ36  3 #4!0"7 : ;  7S/0 R& 0S ' 0 00`0c0 0 ' ' ) P:8 0-7L 0P@0 0! 0S0 R0?0 0R 00|0SP0xP0|P0@0000u0S 0 0S R? 0 -`LPp 0O 0 0P@ V hU0bS 0bSv0S=0= Rh Rb  040Pa0b $c \00 P0S 0D 0B8S0SS<R 0 S-: &        8   0S  8  +  P`t=0t=0S 0SR0S~0SzcXP` -LlMPSt 7S, x | GJ? RL x`K 0@ p   x,H P`x0  p0@` , \,d (P)$ p#Lx4`|0 P` $ P: 1S :tP=0= R,0 S ,x`a0b c@$Pe0S`ppK 00S0ST 0@ RV 0S|0SS?V  |t~P|`  B;|/0t|x0   p@  РK 0@ P`H,0d @pPK0 @`K <0 @ P ,8'x4!,P`p0@P.`J?`%8 P 0P/ K@  04SPP u`V P@pO p /렀 S?0 帐" w9 Pw?  P\ 0  0R @@ @P`@@1d1cQ~p p /4@砀0 \8X(娐 0\8DP`F E0@Cp@B$ %d \8' x 4`P)Ap 00 @ P@ P 8 P`` pWT 0S  T0E8S㴠 AeAdA L/@3P0 \8X( p P` 0@  p @$ %d \8' x 4P`)p 00 @   W8 PSP@`/000p  ?  ᘐQ =  Q 0ZD2 vpF DP`E0@$CpB@ %d \8' x 4P`)A @ 0`pP@" ,0$ 0fQ pK7 pK JP 0SP  S  ? P t@K 7  1P0S 0Sp 0SWp X!fP,dp6T6 6p5p5 -LM7`SSP0S Pp =0=⡽0 S p OO P. " w7 P/000$7S =  Q  50S00he!․ T@0L0@0D2p 0thr6 6 -LM0 p P` 0@0K  0lHP`P 0@ pP`4 8p |,#H p800%lpT 0 @\ `> =0=0S00a0b cP$e0S,K 00S 00S S 0P RZ 0 00 &R< 6  *P0S p5 -LLM0 74 S8 X4PK P` 0@ p  `, P`H04p  `PHpL,\(d (P) 0@ p8`$ #LP`P  4 P :8 1S:0=0=84|P 0=0=40 0$ @ 8P4!P4`a0b c@$Pe0S`< ,pK 00S0S" 0@ RV 8QD  0R 0P1e1cA΄  h ,P0\X80h0\84 4pDP`4F E0@CpB$ %d@\8'xP 4 4`)Ap 0 @ D  0 8PT <0Sa 0S 008 00t0 xv ,P=0=0S0`P ,=0=0r? 00 ,00C0 0 00000  ,P5 0`!g ,@0$0@,6 6 -L,M, 0 0P0P\4 M? R? 0  P` 0@@K p`,H0 P`  2P0 0 0S0000 SSD@ 0S^ 0S@Z $40@ 0 Cq0C#$@a b0 0SB  A0S  0400 0 /Pb%!1R001S`1a0a1/ @ El17@01d㡷 JH$H$40@@   `oꈎ p-LM@P0`S:S S 0S ph -"0LM`0 0 @K0p0P d1 1  0000S000`00 y1 p5 -"0LM@`0 PK00p <e1 a1@00 Z1@p5 -"0LMp$@K0P00 F1 B1 00 0 0p$40`@6TP#,40` 52RP6b#<0$D1pp5 p-PLM U` P@ U ;0 00p|1ph똁6 -L M0 0S` 0Ph R  P\ c '0 0  0 < 00cS= j 5+@0 "< 0@"  $4 0@9  &̠d `00$ȠH@%X&Ġl`'to6!ⲝp@0h 0@0SS @ 0@t66 -L M`Q<  JPpc ; @P'0B/0  U0  P00S   tP d 5! 0oSH@0@ 0@jP=@40 66 -LM0 0S 0 R R,  0S 0 P pc &0Sb?r? 00 /Έ`@0P``&  $8 0@"  42 0!< #(80$H!400 < 00cS ' 00g!$ 0 0%<  oN!ʜ<@04 0@' , , $4F0@2E#,4D0!8C#$0,0 V@ 0@t 66 -LMp 5P`I Pc  &·B"  $8 0@"  42 0!< #(80$H!400 R¯ c *40 5< m!0 <@040@u@40 66 -LM0 0S 0, , <1c1c1/0 0S0!-  P0 00pc %Έ@0 "< 0N="40 `@&T P `c42 0!< #(80!400 RI  ? 6 g$4F0@402E##,4D0!8C#$85e-8 -LMß0`S@0HPx#p0pS0h00p SH4 T < d0Sh0 S83e6d>85e -LM@ p, D 0P`. P 0@0@:K 02K<:04K   PD 0 ;0K< K< K@0h,0 S ,S,d:8 6 -Lp!`P    ^00 000  00Q H@T UT~ \0Q l"0Q0Sw 5pHbcPZ<2 !-BPT Q 0 P  A 00C00Sp p p 000\Q- 40040 R! !0Q" \ 0|!000Q40`!040\00\0 0P0  00C0z P000@0  ? P  00C0a P000YV R  "T h P@P`:8-85e$8\>8@>8,6`6 - qL`@T 0 S00 00C0~T/ 0 S$:P "48<S   0 00 Q : "48<#8 S  S{P@tP@D>8 -&LDM0 ,0 H "48<#8 CRT0 }H @K X  H0DK0 \0 \ @H0QY <\\ DH0PH <\ d0S Q 0 R7 Q\J H0/0P `0 H L P= H 0L0SD DP @L0 Q]P`c pW` 0PU]  R< Q' H R H0S! d0S d0ST0S D;@`~<0P000   S3 ,0S ,圭  `\0S 3 0 \ 40040 @0T0 h 0R    B L Ph0SR @TT R@L0P> T P` p<0d R. H0`@ 0P` X \@K\ H 00<0:K P4K <2 2K0; K<0K < K 0h0d RH `@ P` U0P0 P B 00C0T0 SOm`Pf 40 <0 S D@`Ɛ<0<FD{@`徐00  0\0IDl@`寐00 1_@`墐 0L @ _` PDL Q 0R\ 0R\,dHze66-8<>85eȈ6606p6:86 0-LHM@XPKTD 80S0 R 0S  0T0  L r 00400400M܉6 p-LR@LM0` @ 0`@$PP& 408 0B S800 R T Qp \@KD 0X0 0 T 0P0 r 0;Hp`- -@LMH? 0 <0 鈺(- ^ "48<S 0 000^: "48<#8 S  S p-LMP@ "48<#80CS,(,(4(@(phph|0 R p0 h`Q0S 0S< B( >00m6e5e5e5e5e -LM0,0 0P`, P 0@0@:K =2K00<0<:004K  P 0 ;0K< K< K0h ,0S ,~,d:86 -LMⴐ0PSp%0 ` @0?0x N#P@Dt0@S@ D  , 35e6e5e85e65e -LM K P0-LL @P<8T,3@T$ /T0h*66<7K7|>6 -@LMTD 4(h  66$606 R0 T6 p-L M`L00\48 0  0<|<0tS0 @`@TDdH @Hp,ꀊ6666Ȋ6Њ6܊66666 -LM㞢@,T$$  I646( 000`6e 0-P@LP  0R P 8xP  0 0 000S  ` 0-lP@LP 0S P8 xP 00@ 0 00`< P0S  P 008Wy` --L MTP000, @"48<#hdV000Aڲ1 0S*FP0P00 0p0d 00 P0000! 0`d0 0`0S S <$ 0,0 0%,u@ RS 00S 0004ppY t0@<TYT 0, R Z @ TY t0@<TY4S  @4R R00CS((((( 0S >3 00"P 0 3R3Y t0@<TYT `0 ,0R Z @ TvY t0@<TY 0S04S `2=2 `S[000,0%S 0S 000`0R 0Sh` R 0,S < R 0,SR00 0 R. 0,S < R' 0,SR! t@T  0S @T 0ST 0 0   00CS$($(4(4($(000L00,0% 0S0R 0S R 0,S < R 0,SR00 0 R 0,S < R 0,SR t@T  0S @T 0ST 0000S :S00 R6eHze6e -@L0 4S`   5P 0 0h0sp p2< 0 p6e00CSp(p((((04S0 0 \i -LMq0P@SR0 @TP  t0`<@VPTV R BQ0 00S U` PVi*T t0`<@VT0 R  006eHze -L H0 R <0S Rh00S0` -LMp@P`: 0 0   0; 0T0@0 0P@0C@ 0P00Pa0 0C 00  0,K0K0 +PKP @ 00 0+e6e -LMQ@P`p 0S T 0*@@@p;@^ 0 @$Ph x>86e|0 R p0Q ,0( 0S <Q00Q 400 0S <Q>8Hze0S  S  0 S   0 R010`0 BS RA* 0S RR0Q 0Sڂ 0-@LP|>1P P .  b8 -L(M0p(0 `BP' 0S <P! 0SP tPU 0 S PU 0SU000 (0 S d(Ԣ 6 IqPP 0 0 @T? 0S <@T9 0ST4 @ 0t 0 0R t 00t0tP0p0 \80K7 K4  H K P  R000  0S0C 0 6q6q,dHze61i -L(Mp0@ 0 0`0CS0 z 0S a R000  0 PS0C 0 U 0, /0K@ K$p6eq꺔,d62i 0-P@0L \0 $ P  010렋66-!QD0* Ƞ  $0Q1  0 <6e -LMDB^` 0+P@x _2" 2 "00`@ S` @@ @ 10S!0 0 0 A(P<.$4<,(, 4 "x %< 0! 00 ! R1@(P<4(<"4%<000A(<4,$8@veA8A8A8A86 -LM0@00 @`000\p, P4  @3 Rt 3(80" S 0 040 \, 0@S岠0S P 0 Z *48" <#R*0S`4x00 P @0 p 0Z80/h0424"` (2("`X V- @V&T@D!00C0P P*` 48<#\ 0804Pᾣ1M5`@Y T@D000P: P` 48<#\ 0804P%5, yP` 0`t0 0xPu @0 Qp ,eyPf l PZたVoHze8>8>8>8 p-L M@0@ `0PS[ h0 Z 0SS0SNPI H1Q 0SH0? s8 80S" S0 7P80SQ 0800(0PSpp0 1P0p@0 KHP`80P1 p 0% X001p/pp[pHzeЇf6 -LM@0@ Q0(0 <Q03(@0 hꌬ5 -LM@@00zP.HP)h0 # 2RS R 0 0 0 R000  Q00000 S$hŷZ@ve p-LM@P` P 00P30800p p-LM@0P `0 R @ ` 00`30(00pphd -LMPQp `V @T h0  @T(0S@0S W@  -LPM@HPp``KUD Hp 40L 00 \ 00X0  T <04 ppr400hr p+ -LMH0@SY0H0 -L M` ( A"(4 P 0, 00 Tp 3S @T, m h0  ,0S00S40S80SQ 0S0S0S 0SC , P0S 0S$0S(0S$ 0S0S0S 0S  ؃P34 SX 0 0 XX0 ,@ 0S0S0S 0S 0S0S0S 0S h0 (0S Z S}34 Sy80S Y SYZ p-LMH`@VHP p  @0 Q Q0S 0S$0S(0S  00 ,  (0S 00( 8  -L@\P` p  0RpV 80S0C80O00W\ <0S 0  000 Ҍ s \" <0%@`V 00S DX R 0`V 0S <`V100V@`xP` V@00`Vx`p Hze -PL` R 0 0 0   1S0 0 0  0 0 Q3 0P!0 00h  J (p(C< .$4 <($, 4,<"0!Ƞ  1S0 00!P(p(<4(<"4!<0 0 0Q(  <4<.$!4(, <,"8  !80!  m_(p<,$4.<( , 4"'<0!Ƞ  1S0 00!P(p<4(<"4'<0 0 0Q(<4<,$!4(. < ,"80@-("HP$$,(%Ġ,. Ƞ"̌ , P h0  P0(0S3S3S80S0P R000 R 00 -P L.("hp&$,('Ġ,. Ƞ"̌ ,@T h0  @T龁P3S3,S  P0T R000 R 0@@G-SMⰡ(<"4(8@8A8@8@8@8!)@8@8@8 -(3LM p, 001 CP  0S 2 @T H0Q 0% X0Q <@T@@KG0 ;0K< K 080 倊@\ L0P@ @@@80S0C80yH0Y 0Nڐ0PD0 `@` @QP Q TPU00U0S DQQ @e`@ Q> T 0@ T@d @T 00 0 "4 40i8#8#$ 0$  0!0i 00 0i0  BD1 <1.X0 ,0S ,[0  00 0P  0 0@ꀊ, T00T0Tz\,dHze46Pze -L M 0@p@A`0d` 0p0#!dP0 0d0  0ppw  -LMKFX? B8c0@ 2c2c@2`ϠAl  8 #, E.Mb -L MQ@P`90S S S 0 @`哃*^  0[Pib|p0 p3d`P PUގP׎Pګ@8we@8@8 -LPM P^P@( 40`pK`D\P 00 X0 0 r d0K`刋0SLdLᴉd@808 P騉饉A8T ) 0- L"48<P#HP1 T X"48<#HTQ00ADT@Q<0h@| 00 T@ RT 0hrJT:<0h T0T0X0SSX@0@8A8 -L\M`@p0xKTD4PK$0 / 400S T00X0 $0S $s 00 4t l0 p H r 0pD0<0. 10 S 弳,dD6txe>8\6 - 0L dP@8@8we -LPHM`pKUD 400S -`r 0@4P0\ T X@ 0P `岊决눌6 - LM@T`0`p0P@+ 0TPPl@pK*1[ 880cX%X 0 \ ``0A8 0-LM0P [[@[0[ P@年0b6 -L@M@`Kp$ PpK `  @PŸP 0@凬8Ÿ8 0@ P{ R eB!2b2c621b1c \0P*0 RS 04P:1!1!@P @@;|Q{4[S@ `08 !8#8#Q!5[@S `08 8 #8#P  V{ R{ N{0Ҍ0\ eB!2b2c621b1c1\ 0\嗲{5{5Č6({ě6ye>8txep@8|A88B8Hzeze{e<6eԌ6ze،6{e6tyeA8A86 p-X`LMP@T 0 S00 00C0T pze -LMe0@S xu000 RQP "2SX00X0 o 0X000 0X10S& 0S# " t 0 00t P000 "48<#Q000 R000 0S  b@4 X ]PP 0%600S p P 3 R(00(0 o/30Sg 13`V 0Qx `V`0 #$0$ h("("4 4Z0 "48<#8  `00`0g $)-"("4 4Z00SF 2  Q 儒6ʘPd00d0G 000 @PP@" @00@0P "4 408#8#$0$ 40"040 0 10 d00d0V # 0S 0S~ 0Sz}PP@i 00 0 R 0S < R 0SR t R 0S  R 0SR@|00|0 $R(00(0 "t00t00%p00p0hP@P000^P@HzePze8@-0@P H0^ 0%0S" 0 R T 0\ <P5 X0^ 80^ 00^ (0^T 1<1400 0RHze A8 -L M p0 01 cQ E 0  0 R6 0Q0R  R  @, T  "48<#0!$(,"P:,@ @T, R3 0 "48 <,$#8(!8 ,"hCV ڲ "48<#V p "4 408#8#$0$  "4 40f8#8#$0$ TA 0P $(,.4,8 <"(!(#8R`c-ڲ0#$04V ` R000@ Xx#00C00f8#8#$0$  "4 408#8#$0$ ,0S , 0S00,00 @ T,  ,@ "48<#Zk @"48<T#, `V_0@00 001SO pPP`0`0V0C0@  P`00C0V@ 8#8#$0$00  0 0 000  R000 ڪ0 0 0! 0 0 0!B W P 0P U ! h00h0D 0S0 0 0 0z 000A壪 00C0Q Q00x嵩P l 00S0<0 0 0 0 0 0  00 00({eA8yePze{e - @LTp l` P R0P00@ _0U0C0 $R000 hPA8({eye p-LMF0` R |P00C0@ T T@P 80S0C8000ph'N 00 0{ePze{e 0-4@L0S $P0000S0{ePze -LM|P0S ppp00/"?CQT`1@0000S 00/"?CQ@T{eA8A8Pze -L,M@  D 0 01H pC0WL0 `@T T WOX00X0SGDT GT phW`H0S x3 R@X.PU(PE0S,C( {kP H 000P PD @ 0D"P00P00iP0iPT T|2 R8 PUT0 0GkP, PE0S P T P 0 0H000  R H 0D0 P MkP pkTx D XPi4@K 2 [R3[Q0S 10[#0 210K[8K@  l10[0S% S 2[0<KA <0 \20[020K@0iPpS20[3 [0Si t JdjP. 20[020K20[3 [0SX0L0@ 0tkP H  1dA8@B8DB8PzetA8 p-|@LMPP`D 0U`D 80S0C80 <`000 (P0 LP@pӂ{e{e p-LM@0`+TP p0D #10PbL'6S 1$!S ! & 10cSƟ0006 {Pbl6lt  PƟoR` l R 0!R 410cSڐ6b 1P 40 A$1TqR? 62S 1 W |P h0  HP Y0@0b0aP;t 0h!0bS5t0`1 S`5 0 0bS6 0CS ~))Є)~))U 0 g &\  0bSQ   P 6 Sʸ$L00S 0 0cS L0 b00CSH00@00Q/0008[P0  ^ & R0PSh ,0K   t00t00 6S SI8C80CS`)h))h)h))0)0 t1S S \t0 } @`3A k0@<3 3Paz62Pazt0 0 t0 0SRt`2 R> ; 0t000,Ÿ1|0 @_W|0  |P h0  HP0  XL@0Si  cL@ ;0L!t0`zP2  F 0( 0 1" 0C S  0bSQ0P0S 0R/ 0@000 \ @ ,dFfD6 B8FfB828dXfB8GfH?GfGfKJIB8GflGfB8\Xf8lXfK`FfFfFfhFf|FfB8FfB8pXf0Q8 000h` 0 ?0PyU 060PayN|Uz 0Pay]aH@ 0P0i0< %;-D!0?0 yz PU  0RI @1 0c0cS000@8 Q V;0P 6*000  6@"06 8CR 6S" 1'0 1H 0 GP!AP$1`Pz0Q0'0 !\@0< <' $!0, 0cS `"000f0#60#?08Byt0`0`S 0K 00C0>3#3R 020 6 #0  0000cSL0L10T1 4@_0$0 0p 0\0000 0 0  0 O$0O4)T!0(0bSL<00/,%ItP  R @  00cS10cSژ000 0zP7 Q  0 0bS wy00[86t S7 10T01t 0W 0 0bSR@&0000h&60p&?08mxt0`0`S4  0KC0!R& 1'0 10000S00C0 `af_8 0O  47 pb7''R?\ =   0\ \ 00cS10cS L  1 0170S\ L!p00bS P0Q0R00S 0S T@0S\ X10cS0T1p L!Հ`Vt 00cS0nS 1S:6S( t 0R00 l Rl9 0!R 410cSژb l 9 W  |P h0  HP1@ ht 0h!0bS5t0`1 S`500V 1R 40 ;0S *0?0 ewDx 8 0Rs\ oT@L\X a0lS0V3 (  0000|  @_DW| 0 |P h0  HP50 ( L@0St; R  0t0'0,t0 wt  0L@ Z8p,p0 ?08vHPKd`K{xY Y  B0@ @KH@KGK0\K 4Kd@KcKK0 Y Yw " 0S+   #0 S   0P p `DpW TS p1 * L%Q >@T3 0R #3Rʌ tK 0P Y Y _P101 0S.101 aP 0p (    0}4 @0H0KGK D d0KKcK0`0 &K_? uP  0  0+` 0  0ZP` 0  ^0t0 0<4(<"4! 0@P P 80S0C80< nnKenIfEfPHf) -LMP@`p KPP <4<("4!<S ) 9S090Q9D00 01 000Q00`0 D001  B yo 00C0˰x 0@P P 80S0C800 vnxndIfEfXHf) -LkM PLT\`P@F n Tp p! ßD W pU`@ #t0D SD K1nK @P 0S o/K "PP@ b@0a X Pl0L0Pd @0 0@0d 阿tiPP  !  T pI᠀a0\0r U 1v@p l0L0D= SY `0`S6 000  10dP P P 80S0C80 Lmm81P@ d90d@  @ dm0[ 0 " 000  QʐT0S0 000  QT0S909PDXu=DQ 7B8FfEf)xHf -LMU0SP`0  S(  04 ,0 0)0Spp4 p0V%ᬽP` (00SV 0  U0S S @ <4(<"4!<0<4(<"4!<  0 4#$0$ 0 0 :#40  0 R $30(,!$#, 9 2"0P<4(<"4 <0L<4<("4!<0U 0S_ SI 0S|0S8 S# 0S S /, Q< ,  0"0S;0, P@4 0`  !4 8<#` #8 0U 04^01t000 04 l0b!$(," "( 4 0U 40!c 0"4 40H\ Hx D00(@/0 X0@0t 0 0 % 71!7; 㡽1@`Q/ 4 , +e B8|A8xA8 -DLdM0| tp,0 @P p `/1S+ 6t0&< r 0 Q1 !0npP\0 tp  Z S2\ Z h hX0G0T1!Xt \ TL0\p G P0c3R Xx  X3 pQtp P:0 ( r0S%@1X:S 0!0bSx Rڨ;!;xp0 aS0b0bS ^ tp0 0bSt1Sd   S(h tp tp00P 0S) J? dh aX t ɃXh  r X00R00Szh00h00!0bSxt:HD0O\zDϻPp 8ʟh00SW  0h  X0h0\ ᇾ 00 0\ 0Sy h0| 0x0S] x 0  0 @C t0 1R0B0X401 0,$,!$#, 0d,$,!$#,\ 4 T0x#Q7Q8ȟ 2Z`ZZ"("("4 40 0CS0ՠ0 S 0!8#8 #$0$ ! t1S S r0S 40 00 0St0 0t0 1 0cS 01!S7|ǟ 40!0000@ 0R P'0?0 j400t1SV uSS ` R.d1l\d@00@0tp 00 0tpZ1 0cS0Xt0 tQYT6 ,0S `,n0t0Lk7R `0(S `p2WAW6S6ópt0`5Qj|E7 1!"4 40| l t00| m0%00 |@S;0 0H @` S!@( B"40 0l 0|'|00H L0 a jFZ 1 0cS!S2d0 2 8#8#$(,"8S 0000IfFf 0-@PTL R0000 0 #@T0Wf44 0\0!0000 SQJ -LMD@@6S S6St0 R`06^LI0ShB 3QAQ @QF -L,M0@S`P(r 0S R 0S0S0S R 0S0s VV 0FSqgV Vc 1 R UY @ \H @ 0R: l| <gt1S  | 8]|( XK0 : 0P!0\ d g|,A| ('  500If,dFfHfXXf60@-dd0`@S =0RHP00Q=0P(0$0/ b 0lXf`XfhXf\Xf8gfff 0-@L{t0P  0hst  -LMi4@440 (0!nj hYXXfB8`XfdXf 0-L@PcPU@Z0 -L4MP0`,0 Atv |P h 0bS700cS60(R6rN/(00(00O/"9C1 S 01&6 SƱֱS0ü6l"0@?0bL2 R |PU 6S6S@0 R hP 40 T0tY0 8S ʰ0 G P!P 0QcPV$1 A@10@1VĤ ,0S P,f|T(N0 8)0 0<@K0;K<0K( 8 P@ T0 X0T0\ 06$0 0$0Q<0P [ [/ 5t0%K>`PKdK(0D@XK0808( ,dFf: C88|A86Fr@8,)pXf -@L_t0`0p hT, N? , O?Ɍ LQUP1 Q 60r00r0P0,H0l <^*40  ^:00000Ff:B8hXf@C8 p-L M@t0`V140040P,|0@ . P,ʼ0^ڰ0 ,0`0Q*80 080x0LP` `0 ?08aph<00<<0E FfdXfB8lXf8`Xf 0-@Ḷt0P6 S \0P\ L0,  a R 8 80 ?0ua0h鬣:dXfB88`Xf -LM` QpP,`  \ 0Su㒣0 @0W0T00S cᆣV`U W W TD4@ , 4 Wj))P)))))))4)H))X)p))\)))T8` ,0S 00T4A,  0P`0 0Sx  0D0,0 h0    F`  Qh0<  6P`,0 0SK S- ,p,Px7`0T:0,#000, 06#0 ?0, 8`,,00,010rP 0S PQ XP`q AP`k`h0 S0S0S 0S 0S 0SQ0s Q P`F  0S 0S CP,A, 300,WP, .0% ,"V,,500H0rH0S0@ 0 , QϠ 0#` 0 0,d1  00# 00 B0aR  r>, 00 0r ,, 0`r0h0    oh0    w-` ḱU 0 Q  0o 0`oʀFfB88E6 -L M`@pP, 0 S_ UD 0 R R/ ,  0Z 0gV, V ,ˡ W W *P P 0S0 Rڰ7R'P 0S0 Rt0t000t0 㢯0W 0 W* 70t0 0ꎡV 6 P Ӱ p-LM0PS T0S0 P@|XP@ p`nP Fh0 00t1@00_0@070pDC8HC8pXf 0-6| SL@@Pڲ0 0S WL P@0@ -LM6@S ))))) )06@T 6S|0@I6P S000 0ό^0608dXf -LMⴒX`, P P0SR9 Q㍯K"!: /P@/L2(K0S S~ K 0P@v 0KMKP@nɠ1X ( K0S\ SO X W DP @0  @X岠,0 S ,b5W @ 0  000 @ 040 X噠/ 040 00 1(K 0 S S WPp` x` Z|`,d*86D)M`Xf,5 0-QLMP 0S0S 00S P0@ SAPP T \ 0 0HP @0S  0冾*PB8D)Xf --LM` 0 pPY (@#*X (08 S, 8@}0 fP@rǰPh0 0C 0 V7@R 1@0 00208#8#$0$0 08 (00310#1L1!0S1 202! !48< (#( (!(!8#8!QA"A" 8#8tm#$0$ ,0H 0,0@0C>P@X , 8 n0兛Z  w`0x(0S9@C8Xf -L M QP`p@ 0Q0T00SQ,*** *( * * *T * *\ * *H * * * * * * * * * * *T Y تZ ժ5, ,-X2 ᠼPh0 22  s t , h0   , ኻh0  0S 0S$0S(0S 8, (,Xú(0Sߚ, Ph0  0S  0S$0S(0S9 Ț, h0<<,80᤼,廚000xͻvh0   0ok8 0oں-h0  XZڼVh0  gOK-Ih0   0 oe 0 ol>yXfC8C8K`xA85H6 0-LPl@n0he p-L MQPP%0S S S 0tPPGp*pT pL 04phH( 0pC8Xf?0@0c80 !<\ P!TP 8PtU"\@P P<?!0@?PP@ ei8@Pn 2?0S:@P?0S: -Lp M0`,0 @4K  b!X@T  ~0 S@( `P 0  RS  Z @$1  b!1@T(,0 S ,hGT,d656 -@LMT $ Ŵ@P⿴@0  5G-(M$$ $0 ```P 5j# "< "0  0#   D 0AiP i;,  0 0  ^   `00` 0 0Q%j3 0# Ƞa,0# ,e). @ @$ 0Q." p  aƠi! " 0 @ iˠ "! 00`@P?Q  ` $0 ` `@`P@` P0` 0$` 0  @P(Ѝ 5 -RLMp+ @>?A @` R,: P, ,!P`P` pl?W `\ @pG0@?W@WP ó0@Pṳ0@ -PLM, pX @0 @0K- M >}. Np >.~~΍.1@QS@@`aq  ␀!N01`$P~`Pa.(LQxh ,00)&$a9%G%ᨀ.,Qq匀円(nx%Th0vP.#^PLl G )ጫ7᎛ '(P!`"p`p`P , 0 0Ll\$1l(C|@厏 ='pp*C(`~P%`&`P`Pa0#@$^.T= }` 0`lppPCq(,ΠHD@l| 0q<`^ 0@N0lQpCpa`3` P``` P%00`&! "= p P `.M.  .0@~>. N~ ~0@TO^t^0@10  a0@N~ Q0@^  0@00 ^ߍ,5 -RLM`pG @>0A! c RX:P D!0@ R: @0S*H0P@ P p`i VHP  0@ `FRp @0 S*@0 VVP !0@ R:@0S*H0P@ P!0@ R:@0S*H0P@  -@LM, 0 0@K 408@_`pP`4%$\'&dts?s_`  0 @ #Ƞ8!(0p$HP``,4H[0@UP` !4%lT"$ K?K_`@8`p0!#^8'$Hxa ) ,0 p\P0\,@PPP~g,p00@ ,oA,0l PV PplQ, PP,`pPPI0P0 -PL M0 , / ^0,40 P`0p  @ 0 !ĠP`#L"$40@ 0@#Ƞ8!(P40$H`0S40 `00`00 Z,o -@LMT@ , PH0@ 鬧5 -PL M0 , / 0,40 P`0p  @ 0 !ĠP`#L"$40@ 0@#Ƞ8!(P40$H`0S40 `00`00 Z,o飮 -LMPp`@0@@T@000` 0@0ᦶT000@-@T`pP*000  000000 !@T:p@-@T`P*000  000000  @T:pQ0@-P @00 PU@  0 000p@-^@P%*`0 13R0   "7! 4<4 4! >! b1! `` ^:p 0-@P LP 0#40  00  0#40  000,50 -$( , 0 48 < 00 -LM@z 㸭02 -LM2pS`@Vz_z 00#P0 `FV@~ жb0cR1!~ ƶ20VS2z0 P0#0Zz_ `h@ -LM4r00@KP ` 0 c l3[S/Ki0 300Q!0[0!0K•\Q 3[S<0 300Q!0[0!0K0~? Q 0 ~? R"~ 00#P0z0 P0#0Zz $  0S ?0 300Q!0[0!0K! [x0 "! K~ 00#P0/K0 300Q!0[0!0K! [x0 "! K,d6 -LDM܀0@R@$0 pP*X` '00d@K@㺬 Ṭ 060#0 ?R@ @㦬 $0S $$2?X`ᝬ@,dĎ6 -LHMp0`@KP 0 `@㇬ Xᆬ 0\0#0 ?R@  @l 0S >,dԎ6 -LDM܀0@R@$0 pP*\` -00d@K@G F 060#0 ?R@ @3 $0S $$>\`*@,d6 -LHMp0`@KP 0 `@ \ 0\0#0 ?R@  @ 0S >,d6 -LDM܀0@R@$0 pP*` ) 01d@K@ԫ!ӫ 060#0 ?R@ @ $0S $$L>`ᷫA,d6 -LHMp0`@KP 0 `@㡫!ᠫ 0\0#0 ?R@ @ㆫ 0S >,d6!m!\ -L4M@ D0  @0\ < !\mL D嬴P K0X0 @@\ TT@ P p D8K⛴P 0K◴<8K8 KaPK@8pP0KPK`\L0[@]_`L$  @^` 0'0| P`M? )p !4 P `"$' 0tPK P`" p(@ p0K$< 00KP)`*D `8KC0K P?T@P K@T@ @0PT0@@SP XPX Z8K 45 -LDML H  4KP0 @, P@h Lh PP K000d0 LhP0P0C` \0 n 4K DKPK@8pP0KPK`\X0[@q_`PKL$  @k_` 0'0| P`= )p !4 P `"$' R?tPK O_`" p(@ p@K$< @0KP)`*\ `<K❳HDKD K^DK 4K╳<K \味P K@0\`0L0S`0 \ d^d Z DK<` 4K!L,0 PS 8,<,d45,6p@-(0`"\P  0". . @0   0 .0.  p<5 -!8LMX@p!hX  &@ h  XP @@  &8 8 -LM0 1# 0@P 0  0?,0-8 -LM@ᮩ=h -`pL@ `0000PS ,0SU -8 M-LM , , 00 00Y 0S 0?00` L0-<0`O+, !0d L @ 00S@Tk D/,0U.P 80<4S84S0 0I,0m H ,Rp`W, 0 R h00h0 ,00ğ P@0, 000P/,0.6P 0@p l0XXjY0 ?dLSψ 0Sh*b<5<6P6d6 M-L8M000@KS@0 0@ K,0 0P00 S<  ?`  L<-<0`O+, !0d #L @ 00S@Tn0 0 Rb 0 8@01p0 PO P <0 0@K00,@K@P@,0 P 0 0 R h0 0h0 0@K  0@0 @0T00 p`0 0` H p`<0 H ;H0, !,?/#?"/C1@B!LH40 8 A40\!$尔4D 8HQ\4 V8 @ 0@ 0@0`0UPP@1@#Y@ P@1<T@Z L2D`"S 04 S08 SH3 R6<0P PL2D`"S 04 S08 SH3 R P<0 Z L "0,@ S<`P PL#0, S PH,@ᗬ0PH0 PL"‘\0,`S00`S ࠡPP PL ‘\0,@S00`S ࠡP P  -LM p`P\ `P  1PJt0 0OT SV8 0# X 1P0H ?@G@,P5?@ ?xGTL3"0 S\\L#0 S\8 0‡(@80 -L MPp  0,P ,@`VPUPa0  0` ,@V,0`VP0  0P`,0UPV p-L MP O> d  `F@0 @K@ P@H H 0 S 3 Sp@<U -LM PL`8 @ TdQ P^@08/@ 0O ?S0 4 R P, ,@H2HP 0O  ?FTp`0< P̠\ 0!O>P `0/0 00R#Ac 0 \84@00d\ 0t!O>P `0/0 004@R#d \<0@P!L!40\0C40 d!40040T00Pà\' 0 O>Q `000 0$00C$0@0 L8 0@ 0\0C 000,)  ,v-8U -LM , p,L< 0KP P00Uq , P8 j 8 H`\00Ua "0O00U T08 UY P !40 SPUUJ 0K  PpX; ^0,"O>Q `0000  ^$0ˊ0i$0L 0QO< 00i 0 40Y i0C40!400400, 8s8\ 0K 8J p?E0 K8 Y0K 0O>Q `004 00 8 ^$0i0ˊ$0L0O<0 00 0 408040Q0K 8p8-8U -L$MHP@,  \, ,`00 0`0 !E, 0 ?P ,(0@_80 ,0@K0\4 ,( 00K` DP@0 0 ,,@  B  0@,L# "00C0\D2Qa dP0 K D@ ?D,0 28 R[ ,P20H H <0 R600K D ?E @K0O @@K D@p`_ ᖄ@K 蕖,)D`@@K FP,% DHp` @_ ,?!D<  < <@00C0,0 8R, T000T00C000,@0K 0P%,H H8 X000QJ80 a@_D0 K` 0l,0@@p0!,@<0 N<1PU`^0 0   R 0S<0^<@^0,0O`0 b s@#T**0Po 00 yPQ80@T0峤 Q80Kl  C` C`PO-8̐6 -L M L 0 `PP  kP, , Hp 0S 02 0O帐  ?CX"`PΠ^0 \000?00S1B 02 a^ Ϡ\0.aQ00/ ,P  1PR\0/ `PX 1 ^\0`00 /1Po0 0PΠ P`PKPO!0^ \000/ 010   B  0@0L0 : B S  ,0  ?   0@L# 2 0 20 0  P*H-8U @66606 -LLM 0PSp` 0O0  0ON8T0 LU#0O  0ORQ ?B<Ě 0@@K\ 4 84S 0O 0ȟ R00p  0N 4 aP0  7H 0O,  ?B00p`U( 8, 0L080 ?`0 X78@`Q.,@,`0!08`00?.8@l, 04S1 bP0 d T0USY2 p K@00,@&>^ /, `00 0 S2p K0@!>,0 06^,@ `00 0Y10,k$0` 0$0L 0O4r 0 0 080`@ 5R,8`0`@00088?.a 0 bS1Pd  0i ,80` S"05@_Q,`0 0 P000o¢,0 $8,@`$08LÚT  n ,j,    0@L# 000\H4Q 8d@PY,0 4R4 ,2P0p ppP8.@PB0 $0` p 4p0 00,0 p3R ,@0T000,T00P, p X0 ,00pK0@ 0qN` AP@,2 R,`0 0 P ,0 2R,,`00 ^ 0 ,,    0@40L#"000\1Q; d@ @P ?@,1 R2P0p N pD0 P; @ ?"AP K PK0O P@K @@p`_$PK`K PK X,,P@KX A` FP,%`K@pp` @_ ,?!@D  D D@ 000,0 R0D,T00HP, p X0 ,000 0M,P6666P6-8U T666 -L M p`,, Vc*)0 0 PP> x1HP 0OP1 AR\000?0`0S94 1R\000 /0900 V 0`5 L#0 @,000 Q"000 * ? B L0S @00" B"0 8FM=S 0 KK-8U 6@6t6 -L M, p ?3@O^P``!>@ .2Qd, Q8`0/00. 0 b  B@b020!P,2 8R`0/.P @0 b  B020!P] 00`1Po pǏX,PN,0840  j0S200 OX40  S> `000/>0@@!N1 Q 0 @c00\0^  !0S  ^ PoXW, 0pLlJKW,0 <L8,0,/>pAYU D8D5h566В66G-M$`PPjl0h (Qpdڥ!> 0! 0@$p ?> 1^ࠡD T! 0  S \ d@E? >i1^࠱D T!@  LP \l 0 \ 1( Q0 110b1Z 1(0l 1$5S!0SL\0 P3Ѝ!> 0! -LM d= P@0P 0 > K`85堐00Ȁ Zᰐ = \00^4PP@0 >p`W "ڤ0S0X0 Wڬ0X00X00S@TڠKKx0KPP0p 0C0 X0K`` _   Px@K000`K`UPP\HpK 2 ^` `   P0`K@K 0 @PP: 20 ` xK 00PPN0 d @=l@0<H凚0@P增PP@P ?ḀU00SaL  卞9K\Pq\ 0@K 0 0`T *00/묐00 T`:^00 V 0 0 D/04렐h00dh0   P xK00@K@埜P-@ p0KH   %傞@K0PɯAǞ K P@K2P`ɯ0PK 0@KP @MPPk Y` K00PP傟 d @ = l@0 @0P帐2a ϝ+0<H姙0@Pt \  @K00@K@PP%0 0P堀K00= @d <l@0K P5ɯ0PK`@K 0` @PP謀` h0K00PP d @<l@0K <HJ0@PePPp 01X` X0 0  ]P U>`娀@1( `j K P n< 0S:0S: \g  P@K00P噛P `PX ٝ`D 08%@0L 0`V YE K00xPP 0<6 0K(0@_ 堐K0 K `PP P`01(   `K`0P < 0S:@0S=*@5L 0`K(0e렀K@_0pK` p PPa \ @K00PPE 嬐00V<` d @; l@ @0<Hu0@P꬐0`( 0)0@_ K0 P zPPP @;@0001(  Q >   Q8 04 V& p;렐 0S+ 0S:0S* S>0R-LK ?@K  0 K0ؐ00 0АK000  0S:0  P OGLGЇf 6(6- M Ѝ -L$MP< Tp$ 80  000 8 00R00S 0K0 0 R 0U 000O 0 R U0D0 0 R 0W( 000O 0 R W0  @ \0P@ 0 0 R 00 0 000 O 0 R00  $ H 00 0\%1RR 0帀0P@0 呟o0@%,p"0@ Poqx}`0d 0@:4@K00 @@P@@0QFxR40 H h8@T <T0$ @ 4嗛Z434,5Sʰ0G@ W0   uW 0000fU0RU 0000CTT6 -LgMNKTQ`UP|a *p\q 8 0BRS p 0S XA0S R P@ >K\up`,0<4 D@ 0 pSpq  0K0 TPLX!1RHpATa45S:05XqS*NK `PPS?K 0`P 0P@ 0 R 0~K0K\)\ L博000  0L0K0>K\ pAXa85 0 R 0^K000p^K000P `P9~K@ 00@.K@`Kpq8Kt 0KPSo`t0尀 p0UOp0 t $x! t!t1 僑R00X0p@K /0SutLQt PC@KBZ 0S1( ? 0p0 `aQ  d!P 0S!0(0 0p0p`P U pհ000  0PRoK p 0S㰀1( ? 0p0 0 S0p (0P UP@K p 0S㰀1X ? 00 p0K 0 SpA 0 X0PU 0 R 0]K000TaVT+0\ @ 0PK  p`PtS/ PKpA pt00QO0@H KP㰀tQ 0S tAKℑ00``lhh@K 0 RXtPt Z`@ 0T PT 0SJ 1p0.Kl1hA0PE`0O TdS`Q5 0S da.K1p0l1hA0( `QUpQ0 0S ^K000`aVDpQ0QZ @aT pհpq^KT0`Q3/nK 0| p尀Č| 0S" ^K000 0 R |qg /0|00 / 0 |ah00fh0K0dq WNKpP  8 p 0 S# 0S:0S*pa LS>R-0` .K a0000Q가 0S:0 }K0uda VhNKpP 7 0S" 0S:X0SU*pa LS>R-`0 .K a00B00Q; 0S:0 3d!^K1( 0O$ 0S!0(0 1p0p` U pp P01R/1 0S:0S :p0@>K 0|a pdఀ|a pKS>0 pALR-NK ?  K00@가 0S:0 1( nK0Od!Sp1X@KnKd 00/7@K Kp` 000tQ p P%|qP1 aP`pa R|q @ pp 0 R 000pNK00 b|Qxa p尀P|Q Y0t 1X ta1X 冑>KFXqW0K0 tQR000X0p` p尀x0K03pa~KP 6NKp` PPS?K 0! 0P@ 0 RW 0K0Wpa0@\\80S L1iH HL1<@ LaL Vp1P 6 p 0 S# 0S:0S*pq LS>R-0 .K q00@00a@가 0S:0 0.K00-K0K\q 0TS( /& 0S :0S:(0Sh0S 0S 0(pS   0 R 0 0`00Z 0S:0 0TaS鰀X0S0TSBЇfp6 M-L`M0 00 0 K@00`\@ `@ 0T`P@0 H@ T` t0TpXTp 0KP KLQT0p`KOP@K 5PpK@00@0 DD X@ &< 00 $ 4 p `P,00,0 0@<@<8 00<6Q000P@KL R-@0K@ KPKD 0@K0 0S:0 A-P8@T`p T ?>00c0Q3@T TX0X  0S  R1 018Ġ D8D5h5p@-8`PL\ *H*******0 Rp!>0  ARp" @0O0 \p @0#O1A-8pL\ *@**p***** 00!> ,A "`P?HA0?`P@0A-8pL\ ***D***** 00!> ,A "`P?HA0?`P@0-8Lp\ ***,*****0 R!>0 R! "A"!?`P0HA01 ?0`P@0 -L7?먓6 -h1LM`Q`!00p噧P@<15 %0S7 " p-R 5$  =S3$0T $0T R $0Q @0(0$ ,xP@p80S@ *|0$ 0Q@ lP $0 LM0 0 @ }T$0N 0X | | 0S@T0KY ZaɎT[Kl Ǝ, 0 R $0 p =R R  5 0 S $055005 HM R@K0Y ٓZa≎0Y ΓZa} @D KbP@ d P"=S$0 ?5 0 0 P@I, ]0H0 +,>@< 0 0 ]@ T )0 @0$0 0  0$00$0%  E$0@3$000  J@(>$03$0@o`66`6 -LM@@TL fP  0 TPP p0 040  P0@o%,"0@ P4ox`0d 0@1,@K00  @;P@ ,| ᬦ0@0x̕,0 H  0 R0 000@00,b ᒦ<댔6 -L4MH $0PL DP P H 20T0 P0L TPP@P TTP@ K|0TH` 2pTO[P`4DK$:׏P@yD0HPPw L3Ph L3P<h0` SD 00:00DH(5 (0 cH H,P 40@cTL%800 S40 f0Pd V0 0DKT匏P@ +D0HDǑ80` V5$%R ,0`VP ,0`V$%P0L40 T0`H8 K0 8p ,0 aTH L0D垑D嚑 0<hd*6\%T0R 0 R80Rh0 S8P0!RTc D8 -LTM|0< 0RD0 0 ` \ \ PP ᪧP6 V @0\ @@P  U <$0 0X0 0gPP\@`v00 KT0PshP @P 4P H h\y \ 4@K@PK@_ 0Ϡ:/͎PP45h H\% R  TU !  1sP|0@@4PX\\ 0.@^ @< BLP 1s 50 Q 5 X@T 0@KR-`0Kp KK0`K@0@pK0@; 0S:0 2t  0S :0 S^ t TX 0t0 46F8D6 -LMp80S 0S T`lP@ 00300@TlP@ 0 1P0S+ U@Xl 0S!0\T SPTl0`S YIT 0S00 00A X h0S 0S 0S 00 00SP00300ᴄK00300TYᑈ{TlP` 0SP  |00Sy $0v r #3d6P-ep6 p-LMP` P@0$SH.@pD.8YfYf -L M@P0  00 0R@@ -LlMp Tp  @t0 p Tㄠ0|  04囋@ T@ h@K@ UlPKp 0PP@\l [ | 0(SO 0 1p0&t 0St  0S @0pX W Y | ,0R@P 1h0 0S 1p p0R0S@0p @ 1( ?R 1$ 0 1( 0 R 0 10 0L Sl0 x Z  00 T xP㨇0 0 40p 先x 00 M x0H l`1ɯ @00V00S& \# 0pǏP@| $0 0SR 0Sx |0H,!0 0Q p@0F@Sl0 @ x\ V|(  % t0|0  ( %x@00l 600`@0P` x`Y0x ,00,0P@ x#Usp ݇Pj@0 1XɯT,-e<-eЇf -L,MT,0 P œ0@ @K0ZZ@ 0 pD D0S~ @@$0@' "p X QDYLD 8Pc@KD 0S @ S/@00S@D0K ,0` 00 K,@ P 0@H0 ,@ ;D@4< @\D@ 8 @H $@ PH 0 O%p0  H%0 %P0KP@0KPo7, E",'$`PP0 K00K0D@ 0PT, QH  008@S@K0s@ Ypyi -,0 L 00 0 8ZfZfZf-X0X  00P0\ P0^PZfZf -0LMxxpP@`0 0P 0T P0U  ᾙP ЇfZfZf -hp@L `P0 0!R 0U R00 R 0@@0V ZfZf0S R00  -LMP@`Q 0SN 0S 0S0 yQ 0S& 0T $0pP! 0 00 0 R0(p 0 p00 00000  0S 0-PL@ 0P0魙 -LTM ` 0&p  d h  ,0 l ` 00\0 p8 X 0: S 0 @d 儷P@pt  T0$  00CS ` cP@h 0RR<0 4 D0 @0 tQ 0 004 D0 Th0S 2 4AT Q @_ 0S 0Si0SePH P 0SL 0@; DP \ 0\T@,PB,0K /00P@yP4Q;;S 8 @ ,0H `0S 2 R40S P  T0( R00000cCQD Q080 < 4 P T0( 0R  R 0L0 0L00 PRP P \ 0HQ0㐐AH 0,Pih RRt0S 0S0h#70P00S`   *0d  㜶P@*4P+ 0C R    0@$;D0P 0P ?0/;?00 X0+S   Xl 060hQ 8 <P0QP 8 ;;S 8L@0a0F86|/e6/ePh H0 S00. T (0 S000000@P 0S 0S:0S* n 0 RT0T0((    Q00Ŕ0000@000,嶃ph70Q00S0?00h R \ h0R0P00S tQ\p ,0S# T0 K0P@ X R t0Sl  E06000`00 W`   I p`l  +00 K60T0P@XQ t R l  P0@6 0| l P0600d  ㉵P@0S T0 K0P@ X `0R0  0;0 l 06t0Sm 0 d `P@ ;;SL0`00S6 T0 K0P@ 0 ' d0^# 0Sp00^ 0 0 R00p  R X`P  Xl 唶0600 ʖ` 0S:0 5P@ 4 R@ 80 s@ 0@D 80 Q08  00b4 <0  NP %2; ;L@DK 0 `@婮P*D0S'\ P P`XW0T (Q  R 0.SR 0.SH0P 0PW -L8M0`\@ p@: \@7 P@0< K8\08 pPPRP@@T0( R)0[*0[S""[0R0 0R@ R @00T@ K0P@ @P T @P+@..@6- -LM@ KP 0 0 0- @DP L@ؗP00 4 0 0 -( L0S 00 b 0-LMP@ KP  0S 0Sl0P0S F0000 0- D0@L PP0s0d38 p-LMP0 @B 0  P 0s 000Hp @_ 0S0( 0p00O0@8@垔@pd380 0S00D d< X R  0S 000 p-L M0@ `Rp K?0 R= 0 00 0 R  00 0 O0 0 R  00 0( O\0P@ 0 0 R 0  00O0000 00 0 00 \  0@0 0 -8 -L M p`@2 80S,L+ L+ L+,L+,L+ L+,L+,L+,L+T0$ $PW 0Sh0d `0X 0S  0S 0p  St00 8豖  -LMp0P$K`0 R 0 00 0 R $00 $0 O\ 0 R $00 $0( O\@0  0 R"0  "00O0000  0 * 00 0S00p00 0 0 R00t000 0 R00(0p0H0 0S0000 0 R000 0(0 0 R000D0,0 0 R000(000 0 R000@040 0 R00 00080 0 R00$0H0<0 0 R00d0X0D0 0 R00l0P0@080S; ST04 $  L 0S 00[D080T 00h/4[8$0\l0 00 $00\ $0\0@0  0 KK-8 -LM@P0S` p0s 0s0s$0sH0sL0s@0sD0s3 T0$   0Sp00R P R 0Sd0X0 3 R 0SD0 D0X00p00D Q  0 R008#d0#X R q T0$  0P|0s4 00K R000080Sx uSn 40p0P\4,0S:00 S*(0sQ T0$ K  0S00p  Q CP \0  0ٮP00s000(0s T0$  0 0 00(0 0Pq T0$   0Du  00sT0$  S0st0s_jd0C 0Sd0X05D 8#8S0 0Sd0X0#8#888X0d0 0 R$X00%$d00 0H1 HQ9 H1L 0RD0R `#DH!0SH L 0S L10   R 0S 0R H!  0SH1  p00S@( HPL0YD!000@!8嚨PD0 0C0 RD  00C0D!000080: S Y@D 0 RD00L H"6T!R \  P@Y6 T1SL00C0HT!0R0C0 L 0 RL  00C0L!000H 0 RH  00C0H!H0 00<1 0P@~u ᔌKPpP1P 0S 0 0  p   0 R  0S00t000Pp Pp  0 P֊ Ԋ2 ,0S ,[0000@P1800 00000000 0PpdT0( 2RSOK0L1  0@! U/K  < PpE 0 R0000 0 00 PR0000'sT1H pq 0Pp3TjPpMOK TP 0'pW y  P10o0 0C000C00000000P3T6  0S00t00t07,d/e68F8 F8 -LMPp@` Vv |0S  00S Bu m IP 0 R00D!d Aq P- 0lQ0  PPL020 , B 00*  R0C 0,& 101,o(0Z"p @P;  $  ,=o@66̗66 -L M Pp``$r0V:  , 6 $@K@lP$0$`H@ar`0 S2  0,0 00D 00$n$n; 66(66 -L M P`A \00\0SE(5r,6倢0 0 6,@K@zl0S-,0(H`rAp Q ;  ' 0,&0 00 00 Q,& 10C1X0,Enr< R,n;   L6l66 -RLp`$P@ $P`qA0Qd P 0l1 P0P9LP @P; ' @66В6ؘ6 -0LM ; P6 -LM p`0 W 0 0W 0` 0 ~ڔK x0K P p0 1 B XP0KU0 ) `xK06KkPPp@K Hp2VQ U` m 0OK0 0P2P"P0 0x K6n 6l3O H<h0@mP  R0F0 0Q lTmm0@KTPI:Q &0`0V@xK26@@rn 00`:00m0VU  04C0  00 0xK26@K@kP0p KHp2  lm6TP:UB"0K0 0PP P0 0 Q! vl6 /```n 6 3lO000<H:h0@`lm  6 /@K@jPM0 06/m 6l3O 0CK0 0uPYPh0KPP 6m &0l2O 0K0 H<g0@kPp0 X 0X0 0  V} A0(PU 6 @K@CjP0 l(0 K0 0P0 ` (0006 Fm0 &0 2lO000<Hxg0@(6 -L M@^ 0    Q -L\MT@t p t x T`P@儀  04vo@x pUhpKTl@K/ 0@PP}Ql ) (!(0p1@  Rp@0 P` V@x0S ,!$0(0Q ` 0 A1QX@l p< TPv U4 Xk0 0t 40 /l00 C  HlPA0T0U00S 0S $0`V * x0^1 ,1 S 0ESl0 pXk(0C0O@0p00$ `V*x SH,!0 0Q (003Ol 0原l0lP  ,00,0@0 BnPP Qk/ lPЇf,-e@-0 : S l0@@0p-`P : S R0V@l0 u L0S d@0  dPpVu -LMPp@` R 0S 0S1ST0$ $$K.$  000 0 ᜞P 0S I 0 0 p -LM@TP$  0`K0" 00 T00 0 U00 \ 0@0D!0 000 00@(` 0@Dpm,V0Rm$m664@K @hP@ 4_j000$@m40H :00  :70 nY 4i4i -8 -LMp`W q8 0BRSRJ P<  K0 W 8V50&Ɠ0F P /K0P    f f 6i000 0!i6P &]K /0P 0  Ff wf0eHd0<@ h@0Ɛ& ,P@ @4 6#!B0 6(#1D `, 6< 4|K0 @m 4K1S01X40K!@TZ @ T 01@D T( 00 00K(< d|K(< dK)Wl"0   @ 6 #1 c< 6@34 a B8 00XPU+4K1S @TZ @ Tڰ0!(P@DU T  0\50#0`00000!0(06 @0K&4K"1KN4K1P  S0  0 0 X0Vh: 5Q000 0T0(P0OTSU@0S~ (c @Їf -LK0 \  OP` l`P tAt Q`l x!U:h1d#0@hP0S:0S:PP R `Ppt0l0 `x,0 S h,0 0$ l!t Hl 0tlp ,d6 -LlM0 ` 06t0  h 0` d0 @l@ , p @4 0d `4h@h0@ PP<0 X@ \ h x  4T0$  00CS4` lPPl 0@RR@0 8@ H0 D0 x\ 0 008 H0 4 l0TS 2 4A0S*p@L@ pP Vt t0 BOK|  @K  KYP@`Q0 0R@`pd0S0@ 0Pp@d ` pg0V`0MKS >K>Kp @Pl!gd块0P0@00S 0`P/VUh1 0@ J H F D B @ > A?(K <,d(6@6P6 -L M@0K RK/P 0R000Kb0K/P)000=000 -LM@$K_` 0K pP$0 0 L0S, `0) 0#60C Sꔺ++ܺ++ܺ+ĺ+ܺ+̺+ܺ+Ժ+ܺ++00$0000000000 0  -L T0$ 8 0R ξP \0 0fP00s000(0s T0$  0 0 00(0 0>Pq T0$  000sT0$  S0s0s -@P0 LRp` vP$ R 80S   KP    0:0000   <0 0   _TO -Pq@p@`0  v`SL 7P  QR0`00R@ 0S 0;0Q 0S 0;0TV P -@L80SpP` 0 00   U ykwkk Pp0! B! -P p80LS`P T T0RGV  P:@1!R/ 00' !000 0LP 0! B!V  㼊(k P pkfb]/e -L\MP@H D `T T0RpX \ `  ?H0T jHP 4 jDjjj \ T0R0 0"0   P X PPD L 0T0 8!R 00T0 0 0d0  X 90: S jH0 T P S0LP0 0L! !L L0 0Ph 0 D坈hX D T` 0\Q ` R  R XEP RHhj TLPA0 H HK DgP6H0P ST  0P0 P R P T0RL0R P0L 0R T 0  . 0 R* T0R& P0S! P0S"jT@jYL000X D㦅P L 0! B!L0D jD"jP0 0: S YTL P` R00 S T0! B!T iP0Y 10C1 P@ 10C10 P 0aP 000Hi00 0 0y DK  fDPYi pL@P 0PT0 YTQ iP RDi`Q00 S 2PP 0! B!P0P@000T 1@@K0C1T0    0 0 D 0匃P.0[S L d#"[X3R`  04  0 D 0l \T P SP P0!RBY \4T0L 0R` R00 S T0P2!R !T000P0 !PL P? ` R00 S T@0! B! 0DX 偈0 H0P0X00S*X"0S TL Q 0 0 0 X D]TL 0\ 00 .RdDX J 0ІX ?80S hHh hDh00 0 0P 0DK 0 |e D T666ԛ666..,6 -L0 @41041.\_fЇf666 -LLMD R * < @ 0   DKP 0@8P0SD0Q  S 40R0 0  (0S  8⼣DKX000( L Q00RP b0SYP @ $0  0l ` #6P`1`!0CS00Lp Q   0Ka0  H 00@P 0V0R00S0 P PUPP U R 0 0,0cp @_0 P0Q  0! 0 fp XP@ĐKT D0 KP0 1@ TZ0(^00S  0S 0(R00S0 8 0@000̠ ,00 @0K40 b 000P0@ ĐK 0 0 0 S  \ @P`1sS@ TZD0X aDK PP P04 0R0 p 0p  0S W 0SEl000 0R0  D08 0 Œ@0%P 8⣢p h0R  - P #8③D0U"0  ! (( !dT@101P` 00' RVV 8\V 8p h0R000 000#0  ! (A( !0@ 0 cH000C0x 0&P : #@P 400C400P0 !( 0&(  !5#`0!!0( &( !! , !(0 A0(0!!#8E U P`  ` 004 ``@Tg 6 @01001V&1010 40 000 40S  jD00 8 Œ@0 P (00  ! (C( !8⌡p h0R|Q "(00  ! (C( !8jD0.! (0 0  ! ((, ! !6f (0 0```&P 6 "@0!!0( H ( !!(00!!( 0 ( !! 00 &0 & V %(00  !( ( !"8 # 000H ~P` @| 0@@% Q00V@@T+ | (0! !0 , !( (, !8⮠V[ 2Bp h0RU P000 p 10 1 !101&"0 (00  !( ( !@ !0@ 0 cH0 0 @410418[ 0000 ,00 P0K0@0@4 0lp000P0 0 0K PP PN, 0(HH86(646Їf@6L6X6d6Te\_f 8000840 4S000 0@( 40PS(T;(0(0  0 00 $ !0 , !( (, ! 0@ 0Hc`P T@8̟T0  x0 00040 D08 0Q 00,0 !( 0 (  !@0ĐK p 0DK PP*^ 1S0ST01O aP 40S(0! D0<@ "000D0 00DR\8 00@T (040S00S$ `@ p8C8>Y Q-Lp@`: 01PPJT: T    -pL@P` h -LM` KP@F P3 T *$pK vPJT: $0T: $0T*D0S d$0#&R :0R *0a !b(0 P "dfp6 -LM0 P 0 pWP @`4  P 0$  cR 540 W(@ 0 @ ♞ 00U W 0  ⃞P 0  㤞P000 C5 -P`p@N@RN^``LP@/ 0#@LH8- ^$  0>0>0 S  $ -L MRP`@A $$|  ;  CD 0o0$0, 0-@L$P0$P@*@Q0H8@- 0 00 0 80 0  0 0 (0 06P@\_f -L 08꜠6d -0P@LT`p 00"  @TV 0 R@X $0m@U50S SL0 Q* Q$0`0SpPPd\_fH8 -|0LM\ d q:\0+ KK'AE^%(m!i \_f`fdf6 -LM0S4 `0CPz:vp0`ZC%Z0>0>0Sp1x#  n0X< `80  40,K< D P8   W00 P00S 0~p Wz3XP8@e,T@! Ʋ 8 Pd0` @000 k0 $P0000,d0 00K H0 0P8 R X [H85 -LM1` 0 P.p@  |@0W `@^ K0 n @`P `@@kP0pXb`ff'H8Ġ6 -LM>\0ǠȠŇ@`P'0 ` p P`AP000=U 0 0 00 0]P( PP 6,6X6 -P`LMY'p  P@ (0%Ơ  0!!( 0 ( !!@:P`YXJw"X -PLM`@ * pKt PdJT: 0 #Q:b 0QQc05$ 50P M"R븉fdf6 -.L$M 80 0 8 0(0K#̌4 @# 40`P `@@PZ8` ,4\T \1,0  bp 0^`/ P  04 @T( 0!!( 0 ( !!40 S0 08 @:pj,0 0Vx\,88 \0 h p0S &,0 01,pH86f\_f 0.  0 -L M0@p` P000 Ľ0 }P0000 . .$0K PP ^0 $P ⳛ5 -L$M0|(K!Ÿ@00 P0 p`@ PPl1, X004  c`p P |;P@0 ! (0 V 0!!( 0 ( !!4!0WX00S,,4` `7|@@@@T 0!!( 0 ( !!8 04;4@:ʌ`4 pH\0@0D Q %,4p  a0Y`f'H866Їf̡6 p-LM΁T0|0K! 0@`P `@>Pp`f' -LMPN4A@Tp`0l,K, T|0   \ 0,鼼0`f'60 -`L0S ?#@Tx 8t4@0Q 0p '0S0P  0WPPpP@TP` -LM `R 0SPXPU  0SY   @pT p@TPXPU  0S@\PTp 0Spp 0RppU @@T p-LM`@PP  0@Q : RP T0 0P \PPpP  0 Q: RPP  0 Q: RP 0S 0S0SQ  0PR 0P  R 0P 0S 0S0SQ  0PR 0P  R 0P P0 Q0P 0R4 $0 $0cc0S  0R 1P 0R 1 0-LP@@T0 0-L@P 0!0PS 0h0 p-LMP@ `0QV php p-LM01PU+ O`Ph@T P10P1hA0T0pKP  X0,P0 0tt? @zP `0X0 P L?@TP890@$Q``f\_fKdH86H8dafbfH6 -LM@T0<<h((h  P1h@0CP1hbfdaf`f\_f0T ; $ 0D0 @-$0  CHL0"& I-$0  CHL0"& c -dd!L M\ X!X T!TA P!PQPq L!LLa D!0lH<@P000000` 000000000000[0h0PU Xh@ 0 @ 0X@Px tX0 PToLaft6cf6cf6cfȢ6bfH86afcf6b.8 6$bf6daf6bf -Lp`^(0 S$b ,0 @P0L0 S h0 0h00  `0`40  ( R 0S(mqHH -LM@p` @(0 Sb$@ ,0 @P0L0S!]h00h0 p `0`a40  (0S 0S(i/HH i -LDMP*<  8 <@8 P0 *, 40 , 0 @ D 0]STI E0` @000,%}0 6P0000, 4@0 0 @Pp d0U $40P00 x G, $0\p T  0R ,@00 0RD$000,00@ ,04P$ (40404(  4(040 04040`0408R8<<@@D0D`P0L H  0 H`Lh00h0 p @0@40l \00^00 Sl $ 0 600S 0 $ 0R@%0W (04S^ ,0 bPK0 P0KPw Qu40r808 Sn<0<Sj@0@SfP0DSbD0S_LQ 0SY0U 1 U!000NQ/!40S000 4@00S$00 0$040l ^00P00 Sl $ 0!600 ⅓0P y ,0 0 a,@00 R*E0 [`@PP 0P00 5H8Lafcf)8cfcf`af0@- 1x@P \  ^:\ $0S 0000h0S \ 0^5:$0 ^%:\ 0x0\ $0S\00x00 0^:bfcf -LM @T`pP 0D @74 Q0#03QP U 0U 0S: 0-@ TJ3>0 dPtuLe00Y7.VP# -LM$0@UB@N@N@ -L4M00 40 0@\@K@ P*0 40\h\ , KCP, V,$0 D V* 04  Q0#03QP D0 0R 0S:Dx4 Z  @PK0@400  D`@pK00K KP Q, 0S:0$ R:X $0R *0S!* R 0S!$0 S: 0S* R 0S!, %*Q $ 00\*\0 5@pK00K  PR,0 R/*X $@pK0 00K P0D 0S*, , R 0S, %*0S05,0 5:$@pK0 00K P4`Z0J0 0  @ c6 0 Q0] Q[:D RQ 0SD 5$50 5:J,D 0F 0RD $0 ( -L M04`p V `1Wp!V`!, K00 PNP,0@t 0 R0%0%0 0 T0,0 ? 0S<*$W\: 0Rc` (0S$ 0(6C0D0SI4  0< (0 r$ $ wx0S0x0h00Ch0  0l0, 0h Vl0 ,@ @ 0S:,00 0 $ R0 $ 00( ccM40(040 $| E $,@ 0Vx0S0x0 급fH8 P0-L@P L0S40 ( 00S0@T0(M -LMp0`\8`5@P0 0 P  -LMP$ Kp`@vP* $ 0S $0S(0SLQW# 0 S xp0P 0$5$0U @p h000Ch0$ @PTU0 Sx 00h00Ch00$ 0$ -L20 0pQ P000`!0 㱄P000PK00$ 80< 0MP' $00 >2>Q0\00 5:40p$0 , R ,00C,0,(0,m˄<0S pp0PK 0 0,0 80 5 -L$M`4 :#:S$@>0. Q< "&0@ PD  H 0 KNP 0D0 8 0@PL@  1 0<S-*$<0Q*0 S^ 0S[$04 <S1$ (0 $Q0V)0K*)K j#Vp:00L00 S  0<S:H̓4@ DL V8 (*80S0)0K 00 HaCP 0S)KZ )0[ S  )Kjp#V:0 , 000c P ) K D  -LM 0  S 0` p @ 40S0@0S0 (X 0WPU`pW >0~pW  0h:#:S 0Q0S:SQ::K q   `PS8 6 $0 0&P 0SR  R ,0( 0C,0  ,:  0 ` 0`K ?P000$gP r ,0 0R,0 $ 80SS SPT P: QS@@S. 0   000  : 0K 0 VPH 10S     0@ |0 P80 J,0( 0C,0 : M,Ⱖ VʥU]  R  /$0R+* @ & -LM`P @75 0S2 *S"*`R 0T)@PbT >0N@T 0UT$p  00 T ( K}P(0 $ @D P2X -LM` P  0RL ``R >0. RB 0V?X<:SV8:$@0p P000 j0 #P0000 0P (0K 0 (PVY0 Q5 -LM0S *"*R 0Q bQ >0Q 0\ $ 0@-@ *"*R  P b.P  P \ $@ -L *"*R 0Q& bQ >0Q 0\^ h,h,h,,,,, 0 $$ 0 d$ 0 0-LM*"*R 0\.@b\ >0\$ 0T!0 H,&R$P 4d 6R:`0S*#0  0P 00\_f -LM ʠ,ʠ\ 0R lR >0. R 0^ $ 0P  -0LS    $0` P P #  -L $ -L,M00 R0, P4 8 0@00 0S ,0>0>000  #20#0 Y030"8S8 p`004 $&80! 0 0, < 6P@<R0Q6 `0 @000d"Ϣ0 ㈀P000@, $2 H)&R R 46S  @ ,  0⹀,0 0P@,⤀\ 0 80S 0 @ T 0 < <\ Trp 80S   |0@ 0 P 4 00 T|0 0 , :#:S 0*5\_f -p| '6J`0@@X`LAH@HVT 0 S @T; 0S0S`f@-00S@(0 A R0  10  0  !( ( !@00C0(0 " R 0 000 0 !( ((  !  B 00 000000 R  0\_f`f`f`f-00x0CSp00000 000   !!(0 7(0 !! 00C 0`f\_f 0-(0LP R0  10  0  !( ( !00C0(0(.00  @ PP0!!( 0(( !!` 000决(0 D0 0!!( 0 ( !!0`f\_f`f`f-(0 H R $1@ 000 0  !( ( !00C000S(0 R0000 0 00  00  !( ( !44000 R  0`f\_f`f`f@-0 .!( (@.!@S0@-0 @@$!( (P@@$!0@臵0df -LM P, 0 "X0P0 ZY2  P(PP""Q0\0 dP`PX P U hY0  a0D"6!@AdA4  8 0YDQ< <0 b40Zj801cT0@8 04j Xf4 "*p@0&08`  0>00 00>0 0 0P  P00( ,0d 0 @\00`T@80 0R^PA0 pW 0gS*@`0S:>0 N@ T *$PK0S J $/T:|ሴPh5*DD@u0>0>0 0H8KdKd@6`affl66 -LM␢0^@xRxŸ80ShD 0pnS`nL> 0^ 0 ^@ 0R:0^@60 0 R   0S 0C^P0@P0UT 0R( 0R0S*0B60 0 B0CR0  R  B0^P @P0U 0R*60 0 0R0  R  B@0^P @P0UH8`fdf66 -LKP -LM@P\# ^/T%*p`V ^ 0S\\ 1`1 @0 0XrT 0@P<04m(b\_f686H8,dfdfX66̨666 -2L M0Z ! 0CZ pWpWa\1Ό 00 XPP00 T Z !0Z0T0G Z, XP`0\p3qPU,  Q 0 0 00   #&`:X !0 0` X01 P#&:`X P!UDF Z,<0X ,00 ooH8df`fH8Kd@6 - LM 0\ , 0` @,pP 000 p8 00\,($0$\oH86df6ة66`f6 -L Mp,0 `3#S 0pO<0sO  0OT0 S @0OTS D0R\)Y 0s , 0 Q00S (0Q 33D Q 2 Q { ^ ^/ 0!` V pQ00000  B (0 $00C$0Z (0 00 000 00 0A,,0 0IP(,0$ `0  !( ( !Z 0  !( ( !0^lY ,'&:` XP00P%,   HF 0`,0 0 000`  !( ( !0001` VtQW1D` Vja VfK4`fQ`-e\_f`fЇf`f02e6 -LMp\`P7X4 , 0` , %&:` XP00P%FF``  0p ` 000p  !( ( !000 #&:` X00$n R 0 0 00 0  c R0 00 0 0  !( ( !00C0, 0 0, `f -(0LP4` V 0  !( ( ! |s #:` X $ R 0 0 00 0   R0 00 0 0  !( ( !V00C0, 0 0, (0 b R0 20  0  !( ( !4b00C0(0 h R  2` 000 0 !( ((  !  B 00@S 0  00C 0 R000!!( 0,( !!X00000PP0!!( 0(( !! , !(0 8(0!!0$ 0R00 < hh R t0V @T 0  !( ( !pW`f\_f`f`f`fH8`f -pWL `At00TPPU pW(0&  0S 0$0!!( 0 ( !!)0!!( 0 ( !!ꏜ(0 -lalqLh$0 PS0HH<0L@T,<@G $R0000 0   B JP# 0  !!( 0,(  !!0 0S0@@@ 0$ 0 p0$ d0 R L0@0S0@@@P 0 00 h\_f`f`f\d -LM KH|D0 #Q :b 0Qc*0 鸉fdf 0-PLHe@0

U00R0S 0̠ W0U0V00S (0T 0 TV U0P0UA  V p 0!6 UP0 U00R0S  0 0x  0 0 -LMp0PU`% \ \ XJ (0C(0   0  !( ( ! 150PU0  $@0!!( 0C ( !!  0 !( 0 (  ! |(0  0   0!6 000 t0 0$A0 0 0Y, af -LDM008 ;pBf 4Z00P#:0#UhKhKHPUHPU@0Z00 0!!( 0 ( !!PU IX 00 xP偼30(0 @ Z00S r0 !( 0 (  !0 !( 0@ (  !h-e -L`OXPX0D pQH@ @Ԙ 0,h;E0 A`fЇf46l_f8hh 0@-\@0/,C2bS03S<0<<0bQ/BR@ H@0\_fVUUU - 1LM 1`D  萟蠟P 0ٖ1 0X1 @?CSD00D0 0qO0sO ?SpRD0W ,0R0S$]Їf`f\_fQ`-eT6`fVUUUl_f - LM0ppP 0`S' PS00U 008 0B6C0@`tTP,0XD"<8,$J b0Їf`f\_fl_f`f`fD6 -LM pW     S W̠  [&6F0Vcl @a^ @ R00\0 S  Q 1 pW V 10 1 D0u(6 RcS 400C40   !!(0 6(0 !!(01001 PpUR\%$10$1( 8şp00p0 1R0100T0@ 0S h p0S  4l h0R 0  !!( 0 (  !!hTƧ0X00 \ P0S P0KU q 00 PPP X W \0KQ0  @|SX41 `041P0P@ 0 K0KPXPP`P Q Wp  (0H@0!!( 0 ( !!(  R 00c  . RM (0J@ F0K$ V  VgdT0!!( 0 ( !!ԖŸ08! W8!  (0  0a/ } th0K @0 u 0@0!6 X K P 0  !!( 0 (  !!@@ 7   . 0 !6' 0P  0!6u(0@@({  P@010018P(10(1h,10,1`f,eQ`\_f -bLM1012"0@c@a@0T1A d0St"P1d0S@D 0 ^c@dlh0Pk 2@T YX P(  Z @ YX0S400C40 !!(0 6(0!!( pY 0P& X?<1H0<1 0!6 &P @0!!( 0 ( !!I0 p0!!( 0 ( !!( Ip T00R00 S nDx8Pti101]\_f`fQ`,e`f`f`f -LM @, 00 ,( 0 S4 #!p0aW4A8@ 80R!p0`W4Q0 < R@0RD 0SXXD4 R409,0 S*8PR1!SP! U 0 0c01cA(0P UT@(0#40 Q0!00000  B (0 $00C$0, 0 (0, 0 Z0000 @@4 \_f`fH8df`f`f -L,M`p Vj3P, 0 4 @ >0,~p'&@H H0T V#, X X0#03X@@T6( 0h SD @ ڰ"08@ T< ,T !P < P 0S!p8 0 <RT008 T0 < 80 < R@0RD 0S噔@0!P*, P 0@00TY!L 0 S<L 0.FcH0P T01c(0 T8 0*R0#X D@ TT T U@101ca @epP(0 #40 Q0!0000  00C0(  $00C$0, 0 p(0pp, 4 @T0T`040 PP@ x,0 40o`f\_fH8df`f`f -LMq@T> aqPQ0000 0!!( 0(( !! , !(0 8(0!!00l00g0@b0$ 0R@0(0 < @Ti:`f`f\_fH8 -@0LM@T 0( T  -@H8`6 p-LB MLP@  , `  0`\TP`PXL `0`0<La`Pa 0`xp\` 0`8$ a`($a! 1`<0!,148!t0dx |0htld0d|p\_fl666606X66ԫ66(6X66ج6646l66̭66<6`fP6 0- LM0PS0P 0PdP0#P!\0PPP嫮x@Tp 0@ \ PoP L0 Pg0h0뼻d(afLd\_fo`l66Kdddf66$ef6 p-LM@`TP 0U- @T0P\@00 0S 0  00 00 @0D4P H$l Q0`Dd`d00d0p0<S 0  00@T 0S\lLd\_f@-0\ P p@@4S DP \Q DQH4H40H4H4DSDd00Cd0Ld\_f -X0LM\  0R \ @ TT000@lLd p-d0ML` @P0 K@ @P0,d(4pJKdخ6-X0^ P ($\,40\DP ^Ld -EMLPM0,0 |$ tpm0S S vP@,P `V FK@0D @P4 L$ p t H P@dd00C@S񟗑- - - -\ - --80S|0# @#m|3 ,0S p,p,PP@ @\ 4pk P\kk00@d80S|00 0080S+  x\ UkBK@$@0yPP@ 80S \k\ku@吹0 uPP@ 0 c@\ pkPP@  xT} @yB~KpGpGG>K0C+<P@I mT1` _"P@d0SLBKAG>KA0C+P@ 1` Y( PU! WpG 4 O#J6; 0 P@An7$ P`@/DTU WpG Y|@"<0@d |4 ,dH8`66Ld66Ld\_f -L|M<@0XpP 0 0z@P@80S S @0X 00 x@%$ 2!b10S pP 0OP$K8 4#RZE P  0 0 Q$fP @ RCN@ 0 "0P C@\0PP@)0QC0X ! "0!000h00h0t!T0080` 1K_`O$K40@ !J"V `T 0 0㬬P 00d0 噹喹N0 嚬P 0K0 @P@^p KT$;, PP@PT0 4P$LdLd,R`H8(6\_f/e46X6x666 p-LM0@( +($00PP 000p(0; (ϿP` $$4R@80S# !0@ P 00 ?t$h00bh0@0P VL0(,$0p0嬫\jps@ ƷLd\_fKdЯ6 -LMlp$K4#&:@jP`! ($@Đ@b0O&#J86$;\ @ \@P'0OiA0 0+400 Pi ~6 -L,M< @@ `ḏD @D< 0RL 0 @_<00H@ 夛H 億 <L$@D? 8 [4K 8K,0K@P40s Z<Ld  ?ᇫ80P@f"pdj`T凱Pb@ 0K0 @D`,l0L 2Wpt0"H0V@0, 匠Y k 00 ;,PPKx0pS0 R xPp?;#$0|/<0 p00p0(Їf`fh-ed!Ced, -,1LM@ t K N`Vq\  lf P\gf00 0 @4@r}0 \4Vf $0ą{ PP @8\f\f =咴`h6Їf666 -LM$`0 >$ 0^P0l$ R(: 0S$:06>0. U$ & @0 b$Kp @@P$0 0c#& $ a8[  e$0 0e#&B6p@-$0Q:0!a61c"QPo * 000"F!V:Up -L8>8>8>8ef -L4M☒ 0 , P L SP`0S/40S 0S 0S0s ,0S00S40s HKH`KL0K@K qPp H00 ,PKxP P0S10P0 ,0 S |,aH R 40<0L0 L>,0sSp 00S40S80S 0 0@@!P0,0S 00S 40S80SQ  l0` 0cl RS=,<4< 4l :0 l ,0 01,d6K`Їf -L4Mß Ƞ, 0(,Y`P\0 "P 0S PŸ,0 S ,ݍ R 0S0S0S R P0s ^ HK ID0YRX T0 Ÿ@KY2\\ 1@ 0TL0 h0p W@X YR,0S00S 40S80SH0S 40G 0T00\00S @0S l0:0\/  rP@0S X 3S@0S<0S80S40S ,@K wrPZ 3 SP0\ 0RP0 L,@K arPT ZrP(HKs,d,65D)M`,5 p-LM`P@ P00P3,@0 hp p-LM`P@ Pw00P3@0 Np -LM⸡0p`DKP`KA(0 P XU K`P P 84K40[S2 Kd@KxK 1P 0 1\@0[d 0@0K@["tp0  K@ KT0 P \P 0S \00\0^$JrK K]PpQ|KL5T <5T5` (K``~ P K0[ pS (K@K K 1 0 1\Kp\Pp 0P WY ]\00CS\0H4T? !<4T 44T2 r 10aR001#0p 10bP001#0003T 3TU @(2.ZmUy @ (2 q8#0000q#0000O|g!2R/W2TO 2TX1X2T p2Tx2T d2TW X p L2  R): p (2  R*0S . 00SP 5#$0$  R 5R00%"48<#P a|1T @1D1XL1T\1T* 1PL1T N:@10SJW  0gh 1T-_ I[Wu 0Q0 T0Q0Q*00Q 0,dliHLi0UiViiileiHgildiHfiHii"i !i i ixFixi %i i 66Ri Ii Qi Si Ti -8i Gi Mi >iг6Ni0WiHPi Oi Ji(Ki -9LCMpWP0, `(1 ' 5 -0S S/cH0SVH QA HPZPP,蜠K E 0[S -0S h@ 0 SR8 RV5 H0S |0SH|0[Sn q<(0000q (00 00 0PP( Od00d 7P 0 0Y0 (ǟ,0 S ,2P0005S Y P d0 SK5$#Ġ0Č(7Kx@Kl 7KlK4J/Kp0 K倠KtP P 0FS0 000,1 0dK_\KHK cKdKVƟ@K.44HK HKGK3K0P zP@  @KmP 80S0C80@T 80S0C80Š@KJ/K`PM 00S 00,105 H0K Pk @KşP@K.DD0HK CKH0KGK0P VzP@7  @KmP 80S0C80C@T( 80S0C80 J/K@KP 0S0 00,10D4 R,*@K00 (p~zIOKDHK dKP 4ğ(0  PF|P( yz@KJ/KP 00S 00,3 R @KS( 00BuXz[@KDXßP HK( dK0 P |P( D =z82 R '00 Y hK mP 000 `~ }P0 02 R 0D P^ 1 R0(1 0 ݤ ֤@VA  (VP`7n 00( 0 )0 X1(  5 0`00|00 R` 0S  0S`00 0`B U 0 R 㓤0 R 0[S0[0S[Q5#$0$)K%"48<#Q PS,d0N`-8 655Ld8d56X666f$6h6 p-LM@ PvR0 `0S R Q0000S ph 5}P0`00 0700 `'긵6 p-LM@P R0000 0P @`U00 0S S @0S SS000S0@ R \00C\0 0@ 0 OZ 0S0C 0 ph7y ڣf 686 0-LQP 0 @R T0hR c -LMM$0YZ,0 0P X1  4Q x4Q -`4 ,0S X,}0S^0S[F/0SSV0SSRQO3XS O3X0P p@/`Kx   KU00  3  R0TK\0KBhP 0@ X1 !xK U0h0  d  P` 0@QP@0pS0S 12XKOK|0)v2Xq  SK r0T1 `V OK0 S `VT\ ]T< PU p ` 0S0C 0 00 R 0PV PpPKw0ST PU p ` 0S0C 0 00 0@0S00PVPpP)w兡Md6@-|0\ 0S \ Q @ 0 0R 0 0^@0 0Md 0-hP@LP 0S P 6R0 0@0 S00 0Md -p0LM@T 0S @T P P R0600 hkSMd -LIMp`0,0 O00P 0SvP,6 RP`g 0 0PU 0SPU69S '100,0 S , 0SU P 0 0 0R 0OK`0`0bMKpA0K<0A1T (K 000S:  R0600 R 0S0C 0 BvS/K 700SP` V hP 00 0 `,d61i -LJMp0P 0 0`0CS 0  0S 勃: R000  R 0CS  NKJK00<0 K 0-K p6Ru,d̶62i -pL@P 6 Q`V70 0 @T6@ `R -LM@P6SRP RP0S0S 00S0 0-@LTP 0S@T00S hPP 0SP0S00  "40  "80  "<0  "@-`p000 @0:P^0) S^0S \PP\00A000P0#" 00  0#" 00  P0S\8I`Ld$I` -LM0@S S  gPP P 0P P P0P P霬5 -LM@PPP  0-P0L@T P0 _gP0@T00f-P* 003P: 00 ? >-RALQBp`L4 )gPUe 0 S\D@ @\P0 S ,dH56@6 -L M`4 X, 0 2PU8 S@OT1 PU0 R) 0 P@ 0X0Ÿ,Ÿ 0 0>> Y 0 0>>P@ 0 0 0>P@ 01@T p0S @T00 R YDJ P?J8 $1 R 0 0 \ P00Q00Si"QPW,p 0@ 000, PʿP, p0bSʳX0 0 R PZ703eDxf,fK`T6 -LM{, @pT`P 0S$ @TW @T 0 R @TU0 0 R`0 h0 RP:,0SW y  Pp0K` -LM@ @0T0  0 R @T0K EK%d0SA  AR 0 R(Q R\0500Sh hS:00S S* S00S S:00S S* P3e8 PP  8 "Ÿ0D 0b04E"00C0H R (2 0@Ÿ@08  @Ÿ00P 000ER R:0`PD@ @PE( 0 0@8 @ D 0SLhIZ0S( 5ZP2Wb208 HQ (2 0@80zHP(20  0:g ZP E,0K8 P<080  , 0R0% *0@MdMd\xfMdK`Xff ffK`TffxfdxfP6 -PLUp `2X !@@( 0 \DZ P$4D 00b0OD 00C0XffTff0 0   00 80<808 8<<80808 < -LM0aS00 8PU U p00C08P<0 R% Up 0R`<0S P<@0 z 0XR<0S߲00۲ oز 0@<bMd fflxfTffK`txf -造LIJ0S `P00庲80S Hp`80@@80S㪲00m饲Md ffdxf -Le+(0k 0 k0 L`0L`TL``L`Q0-4 $Q Q(0 `0P@ 0R`-|---- 0@000 0Q QX0RH0 R@0RP0R00 R80 0-pP@LP 0S P  BP @0 S00 0PL`6 -L M0p`@A P0p`P 0'S1@ 0S 0S 0S0S0S 0S (0K  #) 2P,0:S @0 40 jP0MSy0Po:0 00C0 0 XX 10000 00SZ:XN 4 q m R= R1  R) R <4(<"4'<(#,(` ## 0P `@0P`(`V 00S S00000S 00S S0 0 0 00S`1 RL^/㌐00 nMcG1P@  0R0% :P 0 SR0]0P@ 00K VP 0 0R0% * V' UV$ (WP\ff0N`ܺ6lffdff|nfP6 -L$M8 4 8 p0Qg (" 0@40X<0  0 S< %D ` :V :4 0@ mPP0,!!- 0 @0S ʀS S eS) ; R4 @  @0P804Kl <0<@40 0<S0ȏ4P (2   0 @@0Sꤲ-Բ-- -0-4@ :P@ 40S (2 0@4 440@0 4 S S4P (2 (  0 @@\ \@ R4 04P (2  0 @@\ \404 q40S (2 0  0 @40S=ʂS400S (2 @0@@0SV X&S 40S (2 x  0 @4(0JP F);4B) 4 奿840S(2 p @8^400S (2  0 @X400S (2 8  0 @@ RA0'4@P@0@440 Z 1 0D ST*PH 1 01!1* 01 1@01!800<( (P 00 0g(0 0Dt(@0~ Z0  ƟA.L` BP`0@ `44Pu@ 44 0D SP : 00K |PP 0 0R0%P *kS ʇSf DS! Su400S (2 h  0 @@\'XG\%4 0xP  i4 @,400S (2 `  0 @@0SX'$40XP  U8H4 P8400S (2 P  0 @@\hXX$4 07P  C>'4 >>400S (2 X  0 @@ RGX#4@0P  44 4Ss 0CS30S X XT#40P Z (ß `LP`0@ (`Z @\40ƼP @  2( P4@@< T @ 04h 1 014 1: 040 0@004 14 800s0 (0@@ R0@ RXd400S (2 H  0 @@0SXFT!40wP  <g4 <1 R!4`P0@0S (2  0@4< 3 0"0P@ ;,0K P`4  , 0R0%` *H `P8幌\ff0N`6tnfʚ;nfnf@L`8dLdnf06|nfP6 -LM/R, 0 p^ 00 S0% I:X 0 ` P0 3V <+V V2 0R0% :P 3V0000`QQ@0 4 ,0S ,o 0KPp  0R0% * 0 S0% :X dK0\ d0Kc K\@Kl  dK0L RPS@@KHK0 H0KGK HK 00 9P@: 048 <:R0D0 00 H K\p 倠 |P p x 儀 h`K ,3 (3!10S dK K0 $(,<4<!4"< K0 l 2 R᯼f\@K   0K0 Ppr  00R0% k*,Vc 0@S0% :P9 0!4 R`P Q 0KPp  0R0% *_ 0R0%@ /:T 0 0Ra% 0S" 0S0% :P 00020C0 `P 0KPp  0R0% *+ 0KPp@  0R0%@ *<V0K0 Pp  00R0% *$0P@ \ 5,d|nfP6DwfTI`0N`d6P6 -L M0(  @ $(,<4<,4"l V@P (0S (2n1eT110SPD@K0 C0KD KSNpA @a0@RS00@ SD0SA La0LRS00L S:W@A @a0@RS PA@0@ \-P+^pGPĔĄ``W Y *0.S,0V* Q:0 0, S*00S0C00  00 S000C00 00c 0XF 0 ; 㺸1Y -QLMP`pd V00UPT0 SRJ00SSFPES`FLSH0SBj0S>0S:0 S6?Q3 ?R0Q0E\) R0FP$ Q$ @R" Q 00S00S QPP0pi0\0jS\ 0jSg 3PP -L Mp, 0p  4p 0SAR0 > 0`V @ T 0 R @T40S` pV,0 `Y0P OP P  0   P  000P OP040 3e -LPRM40 020 pP 0$< 0 W8 `x U @T 0 R @TWPU0X0`P`80#2   X0#00 PK EP<  0 <  4 R- R0' 0R0"00c,$,!$#,,  ,K  00S 48 A 4 8 100S00,0 08 04<#$ 0P<0 <  <0 3e-8 -#L4M0P,0 0pT0 Pp 0R0% :Z. HK}0H0KT0 0G Kc HKX0 U@T9 h0 @@TW1 h 20S'ܹ@HKLP0 GPᖷPP x2 ,0S p,i鈷@L@@0S  P KR t2P@ r0:S,0S00S40S80S T , NP0S 0S$0S(0S X NPQ 0"0 # W $!0̷P h 00S! d@P0LHK P  PP0P0 pi@L@0S   P K L0K rPP7 L 0R0% 0*,df6xfʚ;P6 -((LM0'Q,0   (\ 00S:p:00(L00 (( 0@℠K 0  K|P` K`KPK KT 0K@KgK`KPK  B 0 6@T 0  MP0 @T0[Sq RF  ` 0: 0000@S(2`6   0:( @@= 401K<1 0@P Q (2 0@Q (2 0C0@\ 񟗗-p-----------------------------------------------------------------------------------------------------------------------------------0-H-`-x--0S (2 0@\ 3 ,0S ,g0S(2  0@0S(20S(20S(20S(20S(20S(20S(2 0S(2B0S(20S(20S(20S(20S (2t@K KK0  tP 80S0C80 R01 R!|K0 ㋄Y0[0S1@  TȠ |0㍷P*^TPK(@L0( \6 00@S*zPL ( @0 R 4@40(0@P,dfK`Ȼ60N`ػ6686a -LM@PH`EpB @0 bMdh6 -&LAM0p,0 `@0PK Z - H6 R<6 R 0R0%P r:Uh  KK 0[ST 0[SH 0[S 5 Rş@0 u5 ,0S ,fKx ؃0[0S0S <5 R K0 ,ŃH@K 0@K KG0KHK UXP` 0P 0S 4 R80S0C80űXK KKU| 㗃@K KP80S0C80Ž0[`S 0[@S KK xKP00  3 R K KK)NK(H( 3 Py!R 0 ! 僑 e0 00 S T3 Ra KZK@ KKe0PI 0PBP !@! 0K@& !R3삟! ~]20SP8*dPK@Kq`Kmj0KxK c0KdK0K0KKKa\KK ]KK YFK !0@lXP@KHKK0 0KKC  e]X1 R K KK ݂0[0S@@ST1 R K KKdW> 1 R K@ KKx 0 㹂0 R K KKj0[0S5#$0$.K0[0S5#$0$-K0P@ E?K ᏸP p P  0R0%P |*L9,dK`,L`0N`0R@!0 0P` a 000 :PU'0Sn 0Sd 0SZ 0SP !@( B("("48

P L00S0L0 ,dvfK`jf6 -LM`@PT :Rp/U U S*` T Q \(`P Q` `S*`0S` ᝯ @`0T0U00SӰ - 0L ^P@; 0,|CQ  DP,$0\H4P@ 0S (2 0@40P 0S#Pß0@ R p L0@0S (2 80@00S0SP@ T  CP@T4 00S3P40g04 00S S !48<#,#80 400S  00S S !48<#,#8 0 4 00S00S S 04 1P@ A00S 00S S 04 00S4 5#00ST1@Q(pD gP4 D!0@W (2  0@00Sl> @ 0T  # 0@05S1#=#=`zDxfxfxfxffffffK`xfK`TI`DwfLxf$fxf0N`|6fxfTxf3eP6 -LM p04`(0@S1!(P3T /+T T `V 0S,0K ʬ3T+0[+0[11,@[PZ0S (0K 㷬&0[S'0[(@[1P <T -L MPp 0)S0`(4P 0 0A( Q0%(":P `@D 02P`P @0 00K( ᄰPP 0 0R0% *,0K( tPP , 0R0% *zLxfP6 -RL M`p40 @0S SP V g* }pP P`eV@1P@ ǪSN SVZAP 0/0K s00(<4<"4!<^00 S: 00g0 @P,0  00g0 @P,0  0g0 @P*0  0g+0 V R*K-"[P"48<4 #8V0PˆʎTxfxf -0L0@Sp S OS S 0@ 0S 1  70 d @0`P``0xf -L,MT T0@,0  PTh /  )0LKL 垾PT T0hh} 0QX 7 0(@3T NT +T-  PP; p3T0000aa 0V.3T !T +TTh0 3  )0_P@忩ἩH2 ,0S 8,\<TTh0 2  ᧩1P@ <T (tP@  00QTh0 1  )0 0ST h 048<,Ơ0Œ= )0PKP PT T0hhh@@K !@ [R# R Z 0STh0.  )00 PT T0hh1?0[0S S #K?0[0SH@KP$0 ŽP,d6Lxf -LM$0K@ py3T#0[#0[00QQvPU@T ` `\U*0 ^ P᪨; o1`ᝨ@(Q( R0,S  3S00! 00!R0 -L8MqP@ `PY 1 \ 3RC @,R/ )R R 0 S  Z0\:L0K VL0[0K0[ 0QR+R(@\:H0K( VB0[ 0@\:T0K %[h00SV T0[<R0\:L0K өVL0[0K0[ 0Q w,d6ȿ6 p-SLPMPK0`@0%0PP@ ppp p-L MQ@`V 0B+SG..............h..............................0 phFU pt2 0PphF-pL 0 phE1R 0$pEp p6DxfP5(M`ff -LM1p 0S 0 S- 0 S*0 S'0 S$X8儨h@0  Po鵧00-@*00 w0S 0o0C0 MRM.0*'Z`, 0S 40 G0S 7P 80S0C80Śdǟ00PP H00<'\0@0 V  0P6000 C0@<>TT h  0 @0 <0S (2 8  0 @D&DƟD0 0SV 0 [%6 R 6P 40 80S0C80ş00K00@ 0  0 <00 lv00<("0 R h0R:(2  R h0R*P&\ (2 0@V 0<("0 R h0R:(2  R h0R*0 h00 400,0 0\Z \4 R 0@55 R R  R R 0 0<,0 Pi 0 <0S (2 X0@x3P@ VV A\ I..................................................................Y  03   0]40 0@<0S (2 H 0@Y  0@V00S Sh000d00S^ 00S ST0 0 0P 00SJ (P0<; 0 h0PhJb@W,0S 40%@ P 80S0C80ڤ00, 00,0   P \FP \TC9J@ =PI xfK`L`-86fffxfK`$6K`|xff -LM\ϟ , `0 0  xK0 봠K9X p̠ P ` ,Q0Q 4QXQ0@S @0S 0@0S 0@|0(S 0@0fT0S0`0(@CT00:U K PppP0K`P| R U 00|  |0 <000S U 0 0   000S U 0< 0   00P$ U 0+ 0 0  P P0S@  " BxK B@D 0S 0S0S0S/ 0S, 4 @00 S X  40S8 X  \\0 $(;0S00 0S 0 :#,8#$ " "4"0 X 0s0 0h@KC0  `Kg0KhKKK 0P0S L0P@ 0 0S (2 P0@ R \! X 0S 400  \1<1  QKx0K@K@PE \ X `0S \ 5@   R R R R @ R R R R RpX j d0g Q ("0 RN h0RK*^"(LKP L0KR ȟ,0 S ,)VLP 80S0C80YHLP0SQ  ^  0 \: 04 <4(<"4\  0b0C0 S 0 ڀ0S   0S   0S ,0 0   ,0000 S/0S (2 `0@p00 jW Z0 tpYZkx6P@ cLҡPp 1 : 0 1 6 (@PP 7 @  0KcP n 0b8#8 #00S!$ 00l0  04<#$ 0 @ 0D8#8#$(,""(  0㒣P4 0 S  0S000 0" ##<0 p 0@R (2 p 0@KP wF8@07 I4P@ A0(S (2h 0@(2  R h0R*0Sh0\1@0100 K! 0KP1 @01 v00S Sm000i00Sc 00S SY0 0 0U 00SO00S SD0"410 0S;900S3 00S S) 0 00S X `0S ̠  1<<1P (2 0@5S!`P0@P (2 X 0@3P 0SP0S 5 0S00S0SP@ T  Q9P@P 0S   0S_e1P AP 0S(2X@0P@ ,dxf`6xf+exfxf:8xfK`xfl60S R(0   0LKLK  ZT@0- 吡厡匡|务8#8#$(,""( I K PppP" |K ! P  K !P  K !P  K !P xxp  R-LPp`᪟P@ U V P  @; 㮠1ܠ7 -LMPpU!ᄟP` @0 0P<4(<"4!< (K= 0  0007SP 0 @0` 0  YSPP ; c1@ U  0@ؠ`P0 0 000ˠP p-(RLMP`'0@S @0S1 P  00 0 0 0pP  0 0 7p( B(0-P -LMP@Pp ,  ` P 40V80S0C80O00P-0 0 eDP& UPV, , ,{ 1PV  {%PV 00 -PLM@ {h -L4MP0pP,0 @5\P W`@7 0FSAG.H.PH.H.xJ.T R 0\0 0S$0S \,0 S ,aM0S@T5y@PKºPP` `4 R T4 P 5`S10`0-0T RTK⡺T 0 Sr3T0[ 0 T RXK⎺X0SX0[0ǕT 0SP0S0S0S Qc 0S\I (3 R3 P `V 5S R2 R$ @T 0\  @T\ K~P@f 0S0 000@0\1PT00U00S S5#$0$ 00SHKL 0 H0KG K@KLKW>L0Sd <`>{%P 0)T& 0S#P0S0S0S Q; 0SP 81 RB,1 P= 0`S @T2 V 0S @T( 1PT  R000 00S1#$0$ '%P  5Pp7 $0P 0 0P,dЇfK`6:8:8 p-LMP`@= U  U U -p0 0V0 0pL0 0 0V00V 0 Q50K` -PLM@  R5hQ0000S  -LMQPP`@p. T  P0S!@ P U  \ L0P)P 00PU@P P -LMP `@p  \0NSU\ #0NStQ.(O.(O.(O.(O.(O.(O.tQ.(O.(O.(O.tQ.tQ.tQ.tQ.tQ.tQ.(O.(O.(O.(O.(O.(O.(O.(O.(O.tQ.tQ.0N+S񟗎O.B8-8 -LM@㍃ 0 S  i逃PU| <`Vx H(2Q p QrWs 10Sh.$g.$g.g.dh.h.h.i.1 Q `V p p<00 0" P   p0041 ,1Ba  0 0S 01 00 0S \ 00001 0 x0BaV0 L0 Q000a (a a06N`8Mb$N`N`D6`66 p-LMD `<@810;A,1@T Q 1 Q::@T0Q P@| 0 0b S&p 0 0bS00000T0@T 8| \0H  a R@Tph鞂@M@Eti.HfN`@f-8fpN` p-LMxaPP $0@SQ TP $0@SBT$1 R `0S@2 T  5Q' 0 R0 R@0S S P 0 R 0S \ 0 \p 5R\`[ 0S 0S@fpN`xfK`K`4N` -LlMŸ0HKp,0 r@K0  H0KGK5PP 40 Z 80S0C80aPP U*0Y0ZP7  P`N @KDD0刀 ;0<\0 0K P7P8PU5 H0S !P80 0C8040  R00 R Z 0 R |0 ,0S x,CY 00X0T`H0S Y @0 R5,d0Rd0N`666 -0LS< 1\ 0S \0 R0 R 5Q  KP P0 0 (0#0 ,0#0 00# 0 40# 00S0#$(,"QpN`K`@fxf -L\Mx0 ,0 l1P<`K^Hp:+ <P@$ \! !0X0R00S 0\00  aP ,0 S ,B1TST 01iD @KD`Gr P 0| tP 6<B,dK`-88$N`6 -PLM0@) 4 00 S H^ 00S 0S1ST0t 00S0 S! <0H ( 0hQ  wP,N`8 -LM<0P,0 @P0H`CSd0PUh[|<0  B0, ?0#3 08.`f3etN`Mb -L M0PS, p@`Q PN U 40 40T 40  P|TX!(2  ,  0  0h$0 l@[`Y  D"0 000%G 1!S:R+ 8C8Sڼs 01P0 S @T 00("1 1Ba 0@]00D!D10 !01!10 ! }P@{ Hy0`P{A`hP`d0S @40W/@0 //d@PO '/P@P 80< 0CR80:864N`8MbN`$N`d0GS S S5SS ʇSS S p-LM@!`\ dP P ڊp3000  00  00pQ 0 0S X1[pPU60 ($[ ppt66 -SLMpP@` R00Q00S3R`U-  Z P$ W W *`X   c0X0P00S` U 6`   -L Mp, z0W00 4 `0`00PU @W(0 S(PV(`(@U(W ,0X 000 4z00 0D D 001100 %!@f -LM, 4 0 sz, 0R0 80 < ,080@0 2pW , R < Z%T@PT @08T#X1e1<@0X0@0 pW, R@00 0 @04 S0 0 080 <7z8<㍩ @ fP?L00X 80$0< ( 0538 r0 H10aR001#,0\040P !0 T@PT 1e 0( S`"X@TS0 0  (08#X XpN`6 -LM0XK,0 `@p l hKh 0RH6 0 0  0%P@ v:Tl `xK R0S@ u0S.0Sş@0 ;,0 S ,; ᬸ X0S hK⣸| X\50S xK♸X XⒸP⏸ @00 }XX0ST0SP0SL0S &[4R t0S eXd0S`0S\0[Sx0[S S pG@K P R0 1 0 0S 0S 0S 0\0R00Sh0[ xKSppP`z K0P@C0S e0 00 S `s0SX xK e0@\XM  PK T:X0ST0SP0SL0S 0 @ @002Q0@0 x K*Ÿ%\0"Ġ0 Č2 x KKX0ST0SP0SL0S ί WH@KxK@K0 H0KGK?,P@ 40  00 R T,Ve <P` 0  q0S ,0 R sWw0[0S5#$0$'Kp0S BPp0S0P@ 0K KPȀ@  0R0%@ x*LV,dK`0N`wf66606H666566T666|nfP6 -LM$PK 0 , h0S e0 00@@*P d00S#X U 0S @00 0 pp    0@00 :0` d`K0HK@30 0U H0Kc KG Kd0K\PK  f0S^ R 0(S@@K  0KK衾P @@K C(` x0(0     0 6 Ru Ri  RI 0@#$(,""( :( @@ $ 0^0K K@@uZ (2`P 0@( 0@H@0 \ 80S0C802 ,0S ,59 l+ P e@ 0 @@ 0P 0ጦ1 0 e @ @ 兦 00S S0 0 0 00S41 R P 80S0C80ᦆ/+0 VTD  ѵPM=@@@KJG5 #$0$<5K4P XP %KT0 P@K\PK1 <1 KK吠 ; 1@,d+ejf60N`6 -L|M0@,0 `0 p<K P0 TLK P0S㘠 $ 6 RƟ@0 :6 ,0S ,8 ᫵@ᨵP 00L U 0R0%@ t:Tj \PK  048\[<# #3 P ` M P> \1 V L0[S% pG@K 1P| R010 !P 0[4 MU<K(P Z e0 00S 4 R ? e0@,Uu Pp HPU 0@T 1SIZ00e RY 0e  XV- 0S R!40040 @`T` ` 0 p Px `M 40 <0#( 0 `3T#0Z  0SiPJZ\V\00Z00S?Z !0 R00S @u@`<+P Cu2 R< V 0 S  4"(2 0 Z\  !2!0Z e000e 徤1S1!0 0e  SP41 R HNT1 R (FT0 R 0 R B 4T}[0[0S S5#$0$%K[0[0S0P@ l0K P  @  0R0%@ z*<S,d0N`$wf(686p668$N`K`6606`6|nfP6 -LM  PK ,  3e0 00@@0P0 d00SX 0S  @00 0d@Kpp0\`K00 :0` 0 HKHKdKP cKGKQRS 5,#04%KKT P0 X @ !PK ٣K 0K jP @K  (`w0(0P 0 R R  R 0Sx 0Sl  ^R N0@#$(,"̠*"(** :( @@᩹ 40K K0@@0Y (2`P 0@( 0@@0 \ 80S0C80ڤ1 ,0S ,5 '(e@ 0 @@ 0P 0L1 0 e @@ Ee0 R0000  B 00S Sv0 0 0r 00Sl0 R P 80S0C80Z'Ѳ0 hR1 <1 K吐 K; 1렀,d+ejf60N`6d0GS S S5SS ʇSS,0 P 0SPLRd 0- @ PL.10h/1ꤪ. 2 -LMŸP@Q2  0 n 䁟0S00 0Sl 5Pp8| P`H 㒢pt0p!p0`00Q0`. 0U0 0 p @ppp 0S 1i0u0D 0 (0 0Ba0 00 |R0 dP`000iQ0 @P4000,QN`LRdK`ff0N`8Mb66,606l6 0-0L PR0?P@ W R0 P00  0|  0S0C 0  00C0'N`LRdff p-LMPrU`v P@o fY !0SJ 0R60 S0 S R*0p!00S R0 L10  0| x 0S0C 0 !00C0ph\r&0p 00 `Q< 0 (0 0Ba|0 R 0 xCQ0J `P\0008Q0? <8.Q6N`0N`LRdff68Mb66,6P66 p-L MP0`@T:  00 Q0000 00 P 0 |P R0 d00  0|  0S0C 0 0 00C0p2&phP66(6T6LRdff -LM00 0 0 @0@ @@ -PLM@ |0 0R h0 R鮰 0P 00hPQ 0Sht000 FPN`0N`x66 -PLM@ R000hZ0P6 -LpLM0P,0 `@ <KT2 l Rl@2 Rh 0S# (2 RŸ@0 ۀ1 ,0S ,$3LPI @007P<0S80S40S00S5 0R0% A:P7 d@KH P%` R 0 l 僡 e0 00 S 0 R <Ke0 JO@ <Kl  0@0 R O0P@ h0K ݅Pp h 0R0% *(O,dK`K`0N`,wf66@66|nfP6 -LpM0@,0 `(2PK E6 R 0 0S# 6 RƟ@0 *dƟ,0 S `,s2 ᛯP☯ @00,O0[S 6 R K↯ xO0[0S 0R0%` Y:VO @KPE 1P= 0 4 TPK8( LᢟKLK0T<0K0 43K[T 8 4  <4(<"4%$Q0S !E0$?0D@$#3 000  04 8 <4<("4!<0PPP @ P,d0Si A TQ 0S& @Q  0 A e0 00S 3 RF Ke0 DN<0K@ @u?90 $(,<4<!4"L T:0Sh  h SP1:PT0@S 2 R Ữ 0PN2 R ᮮ 0N R 0S N R0S\ 0SX SR 0 SB K`ɞ0 K0KK0h [0  /h K0h [2 00h0K1\K 0$(,<40>010  ^!0L$1]*!nx!00P10!R J 0 0 p0^=*!n!00P10!R +0 00p0!0>0^ P`eV0^*!n!00p`P pp miubn[@<"t=" -LM`0@ 1 ! 01 0^$!I*(1n  00  P 10!R 4 00!00>0^ PpeW0^*!n!00pP  >0>0  cR !o@<"t=" -LYM   ,0p0`S0  0S00g\Kc  a?K SPP0/SP 0S< 10 S@C/R 0t/S0@ L0 H l D pK0pp HP/0P0\0p 10@gnP?P  ֑P0Py`\ݧpK@@LP H@ l pp D PP0KP @ 0 帀 匠 PP0` 0 GKPP0 0 KPP!l1R!h1RP妧`大 a?K ᷓt@-@\  0S0  0ST 0Aq00 -LM  0 @ $ 80S0ß K0qP  T018#R 1  = P2 0@40 , D0 K@0KP  H 0@ 8  KHKK0K<PV80pcWn`PP Q0@ T^ 0ApcW `P6Q0 0 SRW*U 0S" @W$0S U0 03  P&U!  00C0 pdW`Wʸ0S ZP 0 <Y eUğ P ?SB@ w=  Їf 0-LMP@0 (0 (K0 $0   0$K 0 @P 0 00\0 8 0Xd 0-LM@P@ K0K  0@0 -L$M0pSPl V > V) V - @<K@0K< 8 4@ @`P@00Q@K  V <K@0K@ < @ ` @NP<K@0K< 4 0P ,` 8@ @j VY  V <K@0K< j VA e Vtt \Ռ\PhP@PЌ h0L 0` f0($0`@f0 0`Q0@0  @@ T@ @0 P\T\ D\᥏ <K@0K@ @ <K@0K< @ <K@0K@{@K PhGЅf,f<$6D$6Q` -LM@P 0 Xd p-LMP` PK0 p .@`@ -L M0@S K0q1 0 00q1 0 < p-LM0@ P0KⰎ(KP0  p0P,0oO` K0 p-LM@ `P\! 0!8< !\p p-LM` P@\! 08<1\p p-L M(@1P 0 1 `K0P 0 0S  p\P1 01 !00 ʎP -L M@` T00D^\P(:T8 p,KW" 1!,0 $ ( 1.$ 1$00$0 1$00$0 00$00$0 (00 (0 収PP P00# 0d R0 8 p-LMP0@0 P0,`KS   0S Dpԍ0S +0[2KIP,d|6 p-LMP0@0 ۅ,`KP  0 S Dp嫍0S +0[2K,d6 p-LMP0@0 j,`KP  0 S Dp働0S +0[2K,d6 -L,M@DK< K04 0 DP @` $p <@ 8@ ,@ 垃 -L(M` 0@p @K8 K0 , @P <` @ p8@ 4@ (@ 吂00000000101011<0S8000 00( 00(0H 0 @040L 8 P0<0 -LM` PD0FK0 !  P pKP@ 0 W@}TЀK00S@@ @ t0 -LM` P0FK0 !  P 廝pKP@ 0 '@MTЀK00S@@ @ D0 -LM`pH딀KP@  0 ,00,0,0( 0CPԠK,,0U 00S DP Q @ P; -LM0O K K \ -LM0O K K  p-LM(O`$K,K4 K, P д400p -LM0 0K 0 2N -LlM0pS l K$P`l0 ` $80S` ,00C,0l(0,Pt0KP t H0 8 0` 4` p DP , &l0HK0@0K hK@T1# |0K h0 TP x l0|  hK0K@ ``l0` K`P0X0 cPT *0^0 \:H K `  Vl  KQ08 `l0b0\`::0 0-L M0 @P0000 0(0 :(0  (04 0(0 (0(000(0  (0, 0(0  (04K0(0 0O$ Kh0T5 -LM`p㣤 P@! P P @T00PU0S 99p@W l9`FpGP  PH900PW z9pW`F6TJ7660hЇf``0h B`3`1`1c11c!0"b2c3c0acP@hЇf_ N0S S0S0S  S 0SQQQQQ1Q!Q1Q!R @0S RR  0R P0Qc\R 0R\ 8#8S  0   \5-0 R 0Q cP 0 S 0-LBP|@ 0S L| 0SPeT 0S \00LS `0000R- R 0S0 \R000Sa@\0S  0SbR0P0QcP  RR-0^0  R R0 R0Q- *0 Q*0  aR*0S b R*0S R0@-P@0 A@P `R00\00Sa@ 0zR @R00Q00S ZR 0 PP ^0b0  6#0 l5 -RLM@ I -RLM@ < -RLM@ / p-L`Pp P 0 RL t\ W0@00ڢբ00C0W L FqO`|zdL6|f -\0L0TS $0S p00R0S qPЇff -LpP`P@U U UPEP PE0R0@hX7pp00l6 -LMp8 Q@ 4 < ; P,, K00K!P4 , X3 X-4%j6+Fcj 8ؠT@!08 T d8  0@T0X00< X,008 R4@8@70 :#:RJc0n<0 0`0급fԆf6 -0LMPp`:0P:X@PH BP PE 0R08@8i6iw %7Ԇfl6 -SLM@2~s H00H0( (0 -L0 h0\Rd(/O` -LP/// /(/0/8/@/H/P/X/`/h/p/x///  $(,04@DH,56 0- <LM00CP@ SN / / / / / /4/`/`///1? ?0 0 01 K"0 0 ,1  ,x; ,$0 S////0 L  K20C0 10 4UU336 -LM\@  t\ u\\Q10` R``֊J@`z, 0 V. @    l \,0q6S @ Q q0` QJz QsY QPF @04  @TZ00e/C1"/ 0b\ Sh]P @1L,`8|fo666666 6<6T6L6\6d6 -QLM@|xhU5T5hQ5`M5PH5$@C5H4,=5D h95p66666606X6 p-LM0~n0`pf@LPP 0f0V@0*` VT( K,0K JTZ:0 P, 0L00 H8f -L3l6 -L2600-@P 6 0 -0LHP1 -LM`pEPQ 0 0S @QP|%> p02SN H%%>!D @A0AS= R ;%4 0 , %00 #0BWS '/)/)/)/)/)/)/)/)/)/)/)/)/)/)/0'/)/)/)/)/)/)/)/)/)/)/)/)/)/)/)/'/)/'/)/(/)/)/)/)/)/`(/)/)/)/l(/T'/(/(/)/)/)/(/(/(/)/)/)/)/)/)/)/(/(/)/)/()/<)/H)/P)/)/)/p)/)/)/)/)/)/)/)/)/)/)/)/)/*/*/L*/ 0ts0A0CS Q X@@0S $% , R|2xl2D PL4 8<40$ 1?3?3  0  0x0!pn x ell%10?30 @U0P%  0?200  024Px5H5,686@6n666H64^6\g6L6h{6k7O7C6b75`75@F75566P6ȴ5T6o7X66`6h6x6666 0-@PL> `Sl h0 $$ à 0 < 0 $0066566 -pL`@Pu$ T 4 Z DU pP@TXD4(4P666666 -L0 Z\@`%Z' !00St 0t  rW\PD  e/646\666@V7 -O8@LMpOSP!b$ $00S 0 hdX@@  f6@46\6666@V7 -@$40$&S !PL$pdxl dVH666\6466@V76@F7U16 )5 -LMp@`@PL ᘀ8P$1( <0D $00H@!000wwww -LMY  `Q00SpP @ZJ $0 0T@TZ S@* $0 0@T T: -LM\  Q@@Tp` PYJ@ ( 08@#8 XPUZ TP*@ (0@8#8 PX U: -LM\  Q@@Tp` PYJA , 0@ \PUZ TP*A ,0@ P\ U: -LM@!R 00 10 Q 0I/<% -LM 0@ 00  |0 Rh0  !!0 0)0  !!  5 00\_fЇf̆f p-LM0@S`P: S S00 S S R/ !R0 R R R =R 0 R R R =R=S Q `zP0  R R R 0  R R R0Spp p-LM0OThaT `!0X!00,SH1  !00(!3PP 00B!30P0 !300 30$6!@0`3PP 00B 30\0 `!`t0t @ n@4`P0P @08 0C0p`fLflfdfXftf\fxfTflRdpRdhRdhf p-LMB0Pdd0K`TTXx T`P H0T<0`u00`p .!iAiPfP`Ԇf !ipfІf6 -PLM`@P Q pK 0P 0S00S 0P S 0P0S 0-T@LP H0HP @rJL00d@0?00?0PQ`ȆfԆfЇf 0-@1L@4 PR~8040< 8 H0<0 @ 0 -Ld E~ -LMp(`@ Q@G 1 G1F?(P8PPEP 01 ! q 00  00  00  00 $00 ( ,00 0 400 8 <00 D H00 1 00 !01BK Pp10! 8PH<1X <04Y 10 1%`K 0 2ЇfԆf 0-LPMQ@(P> P dK>P8\00S 0@!X0T  P L  HD  @<  8$4 ( 0,, 0 (4$ 8 < D H\  d 1 100 1`08<100 -pL,M0`00 T1 0 !@1`4 R  R  R0R0000#q W0P KL0 P pH00CH0 p 020 ]P0P L20 HPK A e@ i8!P \_fЇf@! 0 209 p-LM@`  P`p$ 0S00|f \000 -` LMT ^LL @Q Q\ 0 @oЇfd (1 R 00|ftRd?/ -LM0P 0 !H1pAHp!Z5 `000F4 0 Q@1P0AT  0P @T` H 0V mD-MT`  0pЇfd\_f|f6 -`,1LM 080@0K(PUK  PU Kp0(  PP  OPU K0@ @ P_0:P00P0GH 0-tPtL0n@Q011!!P@0@!0*4  40L0C0\*X*뼇fp`̇fdԆfȇfďffp`$66H8Q`Q`QQ`Q``\_f06H66 0-LMQ@\00C SAF/lG/F/F/lG/G/0G/8G/lG/lG/tG/G/00 01^ 0S-00 00 0S000  0K;00 00 Rڐ 0 | 0-0T^  0T LP 0 P@g0$0Q`0LMn<`p4 IAP@B 40 R08 &8 P00U* Vؠ 0. E   0Z UJjF:804 0S80 dx@X00K@, KP00L00  'H8ԆffT6>0 >0 @H8M0@- 0@^0 0@T 0 P^0@ЍS0@P ! -LM8 \p$0 0 0c@0 < 唒W`D h 0x"Y, K00K 8, 0S 00 Rr .: #:L4  0808@0S @4^ P>0. U:00R ^ RG 0 0c4 :#: cQ!P4 4@ 000lQ0S@@ < \ D 0 RD ,040pW0<0 `D@0W@< 00 ^P @,0<@0 S0h (8(#8Q4 "*4*64 00S 4 K*y급f  0-LMP 0 .@K PP@ PiP*80 0\ @8:Q0 : @0 \0 0 0@-P@P`p. ^  R00\:\*R:^ >00 0 bS0!>0>00>000 0S0l0l -L@㬀TPp`  (0@T -L@, TPp` ,@ T -L@㬀TPp` 0  @XT -L@, TPp`1 @\ T@-^@>0.  Q:00R^  -LM@`TSp R a :@TVPbUP!W W `e L 0D@WHԆfhf -LM`0VPp R a :VP@bT@!W W `d L 0D@WHԆfhf 0-h@Ld0TP 0\0X `\ ,0R 0`0S0h&ЇfԆfDp6 -LMX`PV r @0S  2S @2S2S ppl&h&0J SZ/Z/Z/Z/t\/t\/t\/t\/t\/t\/d0  &d0&d0@&d0 P&1`VAA0S 1 R$ 1 ?#+0AB%@n& Z 11@T !mb&t_& h[&81\ ?# $1H1@Q1@!+B%0@ P>&;&d05&d0 0X a&t" 0|  R&bm&5Hf666666 6(66df\fLfTflf5xf065X6<$666tfXf6,6H6X6d6t6666 -L$MCp< #@ 000 0, !@ x3t#Pl3UPQ\@aZpH0< ZN@t T*3 R0S0"0S :S8 D H0&R| 20Sx 6Su 2"0S00D0 D  0 Pp2 RR00 D03PH  ZoZ ZX H0H0H  D0g%@< 0qH  R 0 H80 \0040 < @00 ,0 08, 40@0I/08S  0S00,=% 0X 00 H 1%@< 0;0 080  <0@4 00 , H 0R6BS`$dZ080  %@< 0@80K0@< 0 P Ԇf\_fЇfĻ5dȆfH8Lidl6666 p-LM( \@SP`8 0 $ $ ($$$$$$4$00S8@< D $Hx$he#d$H T$ L$,646Ļ5<6\666|666666(686D6P6x6 -LM \@P`p  0 P`0@1 0-LM@AP^00 H  0rP -d!LM0@00 0.!0 SPA1Hpx@1@5 X/:$`N @0M PP 02Pi P   00I/08S  0S00T$  @0 R  0H 0P\_fЇf6Ȇf p-LM@0P`XT" T "K/w0V0P00S 0[0ppTK?w0V0P00S 00pK"w0V0P00S 1[0pԆf6 88#4S S - xxLM'4P`0S@xt"0nP`(0S00V00\00S @Q0 0CS yV00\00S'TA0SP'4 SJg/|h/h/h/h/h/h/h/h/h/h/h/h/@\. 0 <00x 0 :#:cQ! [`*Af  @Q`1h#R& *7P  A`0S000S \`P  Q#  j00!Hf6ffLf p- 88LM#ĐT0`P @0  &R%&:FFpP Їfp`-@-0  <0@0D h0 TD < L0H000L0H0 0404550055급f-<<P0S P0S00 40C4H0 Q L0H00C0CL0H0550C0C55三f0@-<P @+ 0Q P00RP D0 0D0 P0 "  4400C4 0Q  L H0 0CH0L 0H L0 0CL0H  %5 0C5%%5 0C5%급f -@ LM0|@  hS Ȇff0@-x@PQ0000  00 0  0 Q 00  0P0bd- 0S  R0000 0 0  0 B 0S 0S0 <00 0 00  0bd -!!:APLU!x# 00A`Q  xX 000p0S '21,PP 0adfl`d -0L0b0^@0TP 0 x$0'g 20PUm'9? 000CS0 0h^급f0adl`d p-L,*(0MP"1"(  P! 0 S: @#P0 0D`L L0S   0+pp鸉ffԆf -L p -L wp( -LM<@PTp`  0S 0` @TL 0P\R S @Q Q Q \ 0h0hS 5S  0h @T\  ipP -LM<@TP, h` 0U Z 0`@TQP U00P00So Vm \j @R U Z @Tb ``` *(": 1Q"( 001 0R  0*"%,`VLp7 W 0S  10#R0 S 1D0Sp10a@ 0S0S |a d1P U P@R `@TU VZ`(*(": 1"(Q 001 0R  ! 0L0p 0S  0SpP000S 00 0P `1급fԆff -LMD <0 QD e @ 00 8 40  `0 :8p#*  ! #8R 001 0R  :#58PQ ,  0`w  T"`0 0PPP 04S`  L0H 0C L0H 4 R 0` 80S 4 0S(  0SP U 0,SP  0S@Tt100S T! @!@ 0S P 0S  0S D 0S 0P 5%0C 5% 0S  0 S  R H0@z0H 0S  PꘉffԆf -P@LM`pg 10S$0QPP 0SK SI \W- 0S! 10#VR0 Q S 1D0@S0H 0S 0PT 0S 0S|0< p 0S \0Lp `V  Tp@pЇffԆf -LM<@TN p1P H L 0S$0L`ppT0 4W PE PC P%*(":1"(Q 001 R40C4 :#%40C4 00 `0@UT@W<@ 0S 0SPP@P,@0S P@pЇff_dԆf -LMTK0 @$ 00 4$ B0S$ 4$$@^d_d -L$MPDP ,ȟ"&R:0R*0`,0  01c 0````UpH   "4 4 R 4: #5 < QD @ D@ >0S@ Xǟ#&R:0R*0a00  01c@W2 0D0 HQ`  D0 `6W  T  8 5S55SSH0 SL0L0S S L6!XD0`0ó D0` &U  D0`00D080@ 0`D0 00Q00S D 0S D0 10#R0 S 5D8 0`~TU X5 Y @ R4000$ $@ ZW 5Uh 5 Rd 0R0` <S 4 YZ  4$0 ) 2Q D 0S? D0 0S4W+ 5S55SSH0 SL0L0S S 4!ATD0`0ó D0` U  D0`00D0  300S p3 0 P3@q 0Sn ,3Ph ?P8 ]  "U 48  k0 `"D 0SK `I@0F HQC h2H=H0HSU @2 Y(2 T.  8 5S55SSH0 SL0L0S S 1!aVD0`0ó D0` x!U:  D0`00D080@ 0`D0 00Q00S D 0S D0 10#R0 S 0D8, 0@ 0S 0P O0 |eg)*(":1"(Q 001 0RꈉfdfffD5ԆfȆff_d66 -L0@ >#& R7:0R4*0l$0  01c!R <\ 0P \0T\ 0 D00D0   $0 2R @ ` #& R :0R*0l(0  01c!R <\ 0P \0T\ D00D0  dfԆf -,0L ^  08ЇfԆf -!*(L":M1Q"( 001 0R  0d* " !Q:0Q*0b !b0 P 0df -LM$0@Qp@20 T ?= ?0S% 7` 00#! @R00  00#!H0S  S 0 0i70QЇfԆff 0-0LS@P 0SP200T* 00S $0 R 0T 0 R 0S 0S  R00h00 0T   0 0 0P00ԆffЇfLidbd -LM 0@S000L00Ԇf -PLM` 0S 0S0000CS0. V( 10S $0 R V 1 R 0S 0S  R0000 0|   0 0 0L0s,1X0K@ P0@ H`[PP@P@@00mphkadadbdbdԆf0 0 \flf -PL0@P$ #60pS*`|\ 0 $>"*01\06S0:0@<,5tfbdfԆf 0-0 L"*("1"(P  \@! 0 SP!0!;   @00ȆffԆf@- 0 0 0 21 0 0s#0@$ ! 0#:8#*!#800Q! 0 S@ 020000Ȇf@-`Pp !:H$$X 00S | $:1P 001P:#50 000!S$010 0-0@P$L 00 0S0ڀ0 R p<P ` `000@0  0@0$0)$m눉ffbdbd6 -3唓LMp00P 0, 0 p0S P U:YZ @:(s(C<, c 00"R 0"  "0"0"00a3C?6C#Z!|"00#Rea!P"0H2@D"@@2  @@Z(Ÿ( 0  P  0 hRŸP 0$T D@  0@  0N0 @  0A< ePtJT:no`P@) E1? P 0 01  @`P 1 000R 8P@ c<W 0pĀ RdfԆf\fadlfbdadbdfȇftfad,adbdbdbd(6.8^d(p/_dQ`06_d86l`dp/D60ado/L66Rd66 -!: P0@S`LPp P@: #Ŵp0L L \  P0p@:8 0 0 U0 fԆf|f6 p-LMS@P` ,:8l#* #800R 0 SP*  ^0"5060p 븉fD6 -L 0 _df -p0LMd@\00#P00*0 $*0hꈉf R`H8R`00 R 0  \05055ꈉfR` R` -L$M(1"0^P`0Pl Sc SW 0 4 U,  @4U 3 #6SppW 0&*000 00^>>fVE1U,&: R,IP% 8#8US#&6?N00^ U.Q !hXE&14 0 0!1jZEPH0H 000 <0040 000 000 $0 646|fXff`fffh60hf -``LM0pS P0  @P@^00 RhfP0P0S  \:00Q0Shf0@-l0@P 0S P  T :00U0S000hf@-0@ @0L 0  0 000 00 0| |0t t0@l l00?00?X0 谉f ffPffxffTfff/f/`fffpfXf|ff -0L0Όn`VPp@0?0?0000?%:E%6;PK #;J jV!ZR`R`6 -LMPP̠%/*Ȑ%:8#*!% vWp!R#8 001 0R  :U#E*`L0HS @000ZU@:U:Ԇff 0-80L@T (PT  DT0_df6 -X2LMP, @ @,8, 00$ 080 00 8 ,1 R 0S 0040 < R< 40 6R< 40 80 $Q8 0 X 0@S@T1S ?@4 Tf?p P@0C $01!R.P I P |/////////////DP  0PP0!?#=?00c?S h@Tjڣh`,@Y@ BP@CPmPFP$N급f666 6bdTJ766 -LMp`P1SP>U#&R!:0R*0a !bA 0 T L8%5HL<@T V 0 *$@T@bddfd66 -!LM!:1`PV!& 0 01 pRPJ$JT 000P帠00 0+; 00帐 .P p@:#:S `@*:#:"*S:*21@`P0 P ,0 P adadf,adf -0LM@8pPP% KEPU$: 8 #! R#8 001 R00*"5*^ `  0@FP8 `ff p-0LMp4 40 1c!P+ Q)ڬ0 \0јP00l1  R0C0p`1AC\0^*PP06 @^:p`,R`$R`p` R`f8f -`3LM T, eLL3< r 8C0S ,CP "88 #$03 0pǏ42 fP0  0S",0S ,P@t oK.^|2~Ϡx KP@,2 ( jg< p000PPC$0P=*!a06V,*46!SAW  4*1 0 42P4;|!Uj1 !@0p&V:@U00 Z0#02S0ES̻/Ի/////////ܻ/////////ig4oYV` "88 #$xMW0SS 7,df`Ԇf R`$R`6f66ffi6f66@B6 66,686H6\6 0-LMPK `P@ 008@Ԇf -LM0@XԆf -0LS S  -@@L@`P. pf@!.@ @1:404@1L@H@@!L uf0V800`H`0 0 04`O5 -L M00' H ~p@g0>0L ^| P%U@`H@ $@K,0$ $ 00ZUzjZ Q`f6 p-LM`00l H0N@0d0>0^P 0,0 x$L 0L0H p4 븉fQ`60-P@P !200-P@P@0R0-P@ 0bR03 B0R0@-P@ 0bàR? B0QQ00QP:  p-QLM`P@S 0 V pp@rP`&p`0-P@P@0R0-P@ 0bR03 B0R0-P@ 0bR3 B1 010 p-QL MP@`S K0 V Ks 0K Kp@rPp` -QLM2p`S)P@WU (W # 3f g0T0e 0d0 "2R0c0 0 Z  p @rP*`ppp@-(Ƞ !8"(,ȠP@p^`b `n0 # 3\ c l0 "2R(#ȃ 0(BR00.8 c0(R0#03 8 " P@p0(R0#03.8@- a0`S@@B@-@0 -LDM@PKP@ 4cT QP 0P KSR0S0PK0 P@[[TK$P@KK ,PT@,83K#[$8KK[[R3KL K0KKK4pK@KX d0 d@@DTd@ 0S 0d@S@d`@ p0`SL` `` \JX0@\@ZXp3QPX h h P Uh R `0d@Dh \ l l偀 0 RPh H ;c `)c\ 8R \0`FP(*SdP\l 00 L cPe%88cP\X%X@ʷ0Pe%8P d`F\P l@00 L P\P%X@ʷ000l`X\l ` R" h0S d@\ c0 Sh0`@.L0#\ ʌ0#[[[2[P T PK $[[[4[P T P KP@b8#b0Hb8#b0Hb8#b0Hb\ h b  P T P0K(R`p@-^`@ Pb 0 2%$^ 040p0-P@cbP L0Q3:P:  -LM -LMK{0K0-P@P%@ 040 ( 40(S"4So`40 ( 40(S"4So` 0o` -0LM @R-) |*B? S" u0  "!  xu ts uguu\l X0lPg Hd 80l; @Q`*8666[66 -pLM0`S" @0  2 Bl< 0PU *   0;0VU:`2 0Sp`(6 -LM`T^@PƄ ?p 0p 0,`e0@@8q`Ԇf-??!0S0q1!1 R  P 000$0$ P 000d@d -LM[P( $ (( ?x , )0(;S(8* \+8( f KDb8(ȟ00 0  X I)à@ȟ儨ȟ b|x@ 3`d` \ <L a,Ơ 0 <8Hy 000 )P@ 9#9S*00 S0)\:00 0C0X 000b1,0 PUZ0Q I$IT  `0 C\Lg:0 0C0\7*Xǟ0 C\ W:0(0C *0X0 L0b1\0帆:0 0C06*lXx0 L0b1\0k:0 0C0p6*VX\ 0 L0b1\0U:0 0C06*@X0 L0b1\0?:0 0C05**X00l10%t5hşx0 C^:P5L*X000$A `P PUE `Zd1CP PUE `Z4$ D0T@ Ơ^NP@`@0&t@ ƀ@e 0@@@e :@ :@ :@ :@,0 9@DC(P `:@PU @Z, T3 @0@H"0>0>03 ap2"& Ÿ L 00X& !01 x2t"@l)\*_!%_1 _"2 2"2 O<0! 0 @=1,5#u1d  00k1 @0 pJ0C ^:00C0V0 0b10 @,@6@ԆfPfAi` fodp@hr`/t`T6ft6ffȏf p`f66̏f6f 6f܏ffffЏf@6`666ďf6ftf68?$f 6Ȇf`UUUU6D6 ḋfp666]/`c/`4R5`666f$d6 P-LP t2R l2 `B00Pb 0@"P@0 SS  QQQ00 Qx AP 0-S SPX 0-S0SQ q00C@CSW////////////////////////////////////////////////////////////////////@0000Sl00d0`0K@@H@0 S DSBO$dfp`p`66S  800S Y00 R  048 @00 R 08< 40@Y00 R  048 @00 R  0480@P  0@P@RP0 N -L M,`K@P\R0p0(0K([pZ,K0 +KP pP -L$MP @4KD@` p5R``$U-Kz4K 0 3KP `p,@K -L M0pK@` RR$P_0K*K[0$t$h .K)`K(pK@ P'@K -0L@ p60S h!Pu,0P# P 0`V U004P< (0;4P00@ @0$0 0SV hYP 0,0h -0$ `L@(X `, ,0P+0/////PU <"0p 5"U 00SXp 08 0 0,0P#66 -Lp`&PP Y@  `Q` 0$0  00 @0 000P 0ҕ20•U@ pP !#U`9!  -LM,0@S$$//,/,/4/d////00Cs0 0 00, 0S P9p  ,0S 6 -LM0@0S S T@D 0\\ dP0@DSSa`'Te@6 - `L$0p04@S0P0p0CS0ԕ PL//8// /7(>7 0-LM@PM < 0 Q^A0S<  R30ˠʌ ʌ00ɌH0 @P00P  0h0| 00  004;00PU8D>7L>7\>7'6 -LM@70S !,00 0+400  -L"M\P@`p h2\ ,@0S p  02\T 2\ @}̠ 0@ @:1\ ` V Q 0S'   0000 0  0p0#000,0 @6@(@ ` VL@D04p80P0<@1011011 011@01101`0\ X0\y0T Q1 <0000  0 0 Q@Q QQ`/@/5 Q- LA7 -D1 `P41L4`0$00 1S010 130S0000#Q0:3q P4" 00#PUq@ 40!@RP 3UP QPh0(B$Q`q`,A76 P{ ŸZ 7 P`K PK@K |  x 0P@]0!  W!P1 0 L\,0 S h,&0X!0P<Y 70 0 0 0 0$ 0, 04 0< 0D 0\ 0\ 0\ 0L 0T 0\ 0\ 0\ 0\ 0\ 0\ 0\ 0\ 0\ 0\ 0\ 0\ 0\ 0\ 0\ 0\ 0d 0긠괠갠ꬠꨠꤠꠠ꜠꘠ꔠꐠꌠ00 `P~tp,d`746A7 B7,B74B7@B7HB7TB75dB7lB7tB7B7B7B7B7B7B7B7B7B7B7,6B7C7(C7TC7 -L`TM04,0 1P! R 3 ,0S , P@ 0 GS00H#,$ 岀P08pS2U02   P0 @R~ R Ry U 41P 1  t R tp tt t0S Sn p! 0lK0T"0Q2ԑ<020202020 20 2l0tKS!2020S1Ա 01ıpp t@ Pp( U$1 ! 41 R0S1A\1 -Y L1pb0(0 hK c4P4 00, QFx x0R||P41: 8P~0S``R^U@0 -CP9 U,dC7q`q`55H00O6 -L MP PE㢟 , u`p@ 0PES u@,0Y(000 P 0 0 P  0 P 0 0R ,@ p-L,M:0 0`QP @ 0S 0@K$ 0P=[ <K Q R*0 S S@T R5,dC7q` -LMxA,K 0P`p )0[ Pᙩ  0P`3@0d S0K@6Q-[0d S0/0[ 0BQR0 p40 @0U0W  RW` fW|tp W x|4 Q 0t0W0`q`ݬ -LMK 0 5 -P`P0 S00Ł0@p$ (00LLp1t  0d 0Q000Y @p80S(|1 hq`q`65(0?0C7 -؀Lp 0 PUb p@0SP 0@ 0UP0U hpp@0SP 00@ 0U|P0Ubbo`0,R`o`\` - 8L8#Č M R00,` \, P@} 00 pPqPU< 1*Z  Y  Y 0  101PU 0.1 010, 100, 10, R ,8Q2 RP1Z0-.1'P X Z.P1Z01VP10 0?.\q` - 0!4LM#`p.P@7 0*PP- V0 70  V0 700(PUP ,.8 1 011 Y/ L 1<1q` -D@!88#L!PP<`04 0!<`0. p<`(NP&V 0   P M`hA<`@`>`xN8U h04000;00q` -L4M@ Đ0Sg 1@  D $X^ $0$0御~ @0@l0(P$0D0p`0<B0@@N P2 46SK 4`K MF00$((*$<$%4K20K1 K0K/@K-K,PK `@ 0P<H0H  0 40!   P@ #P  @0 0SD $ @0Yu@0YS0S<`KE00 $8$$`<K;0K: K9@K8PK00<; 4 00@M01 0uC7 0-LP}@M0hv0 0Q(0 <0 A0& 0-DP!88#L`!@T 0 ,00h0<( 4bQ<00q` -L M @ 6@B0T0 -L M@ 0@20T0 -L ȠLM` Ƞ| ,Ĉ@,d0 0h P,@ h0 @ Pp 1!(9U -9U 9U :cQ   k?P 0c1d5U<\5U"*T5U H5UP(5U Q QY00 "  d 0@DP0 00 0007x4U l4UJ d4U P0ES@㳥 0P90S 0" 0#$0$   BR !F%0 0bJ10000 2 0,$,!$#, \@Z@T ǤP 0@@@P02 <4(<"4!<002 0#$0$ 0 S0S000l2U d2UY a ]@0D,S| 0\PKP@P#Z0[Y [$ R !qFDP@ 0P@3`@K P 0 P0"  6[#$0$&K @C0U 010SU0U 0U 00U00U 00U 0,dq` Q@c Q D7c@c c c c c c c c c c c c c pd sd ccedA c@rdAc c cmdqdgdfdhdcmc ccddQQ` -LM`ePB 0d (08 , 0@0d pG 40! J 8  00( 07K? 40<47O8 P%0 0bP 0 PJZ ((0("4400$ 0 < 0 od 㷺0D786WEVT0,D7 -L$M@4 ` ,@ pqPP ,0K ) 0K@@@ pNP@,0S@@T,4 ,0 , 0^ @@0 N -LMP`p $P (P@ $0K   pPPPPP $\00S 00  00  季 -L$M@`p 0@ PPb 0KN 0@@@@ pP@0\@@T ィ 0,0K 0+ K  *K)K4K@@@ pP@0Q@@T, [00 0+0[ 0  * [000 0)0[ 0  40S T 0 J@B 0   N -L$M,`KP @ptAY0,K0 (K$pKP @@@  -L$MP $ 1`L  `Pp8 (K$0K @@@ `>P@$ R@@T00$000$ 0S (0S T0 @֢ 0  N -L M0pK@`  A$PE.KD$h$t*0K0 -`K,pK+@K)K(K P PP@  -SL M@`< Q8 p PP0 0@T@b@b`V!J! @0L\ 0 @Po0N^J0D@T;P -L M0`KP p@G0KP*K @(K8)K0 -K,pK+K@ @@ N -L M(`KPp y@@K}(K0 pKP @@ -LM@}̠ 0@ @ -L M0@KP `pJ@BU0K/[@/K&.K)K4 Π0 -pK*K`(`K -L Mp0@KP`  @@CV0K/['Ġ/K)K8'KP 0 *Kp (pK - ML`0 PpPP@0nT `:PP` -pLPM0k`@   0+ S+:R `0S0cS0 -LTB>5K0T@<K Rp@ Pp0 P  @弐@ P@P Đ 弐`P唐@8Ȑ 尐< 4(Ḑ, $Đ ᠒ .RP 夐 $RȐ@@ @婓̐ 0 *@TP @ P pPp夐  0   000 Z@,0 S ,I,d0uDD7 -L4MĀ0pP<@K3K$0 ==RP4K-K|0 @4K`ˠ.PK` @,@K+`KP8 [70[ 0 $0S $,d0uXD7 -pL M`@ zP0K U0! d=R@0K&K(Kl 0)@Kp 'pK@T  0C=0u -LMp0P@K`/K 0 0=-=R0K)K0P@0Kˠ @(@KP'PKP@ [0[4 CRK 0 = 0 S  ,d0ulD7 -pL$M`@ P,K U0% <R,K%K$KP0 p #pKdP@  04 S 0@y0<0u0S?0?0?0?0?0`6pP0S.@- 04!400@p0C S Q@ 0@@ 0 ( 4S 000@ p-LM@ `$P P00$ ;004P$ ND$Pph -LMK 045 -2LM@p 1@$01(00L^1!0S2`<23S2ԡ92ġ  0!0Q000h ^\0! G 1? Pp2 1* W W 0{Pt  m p-D`0 0g0 0 0 xp % Bq`0r`,r`568O0 Z6*8pW0D7D7D7 Q-L Q 0@00 -܀L0 PUb p@0SP 0@! 0UP0U lpt@0SP 00@ 0UtQ0(V~Vo`D0,R`o`\`*8 - 8L8#Č M R00 `, Y, P@~ 0@z0 0 ĀxPpnPU7 1'Zp ,0 S0 90  S0 90 0P0U0!1 010Sh.tY 8Y 2 RPp0! Z-.~101!.Pp ZpP1"01P1p01 0.3r` - 0!4LM#4`pP@E 0@A0PP7 V0 70  V0 700(PUP0 11 011 ^  1<1.Xr` -LMD@!88#!P`= p@:010 `00l0 $@Th@ $0l$0徑' `hPl0(p$0p Kh0D < RP0 @@P`p@K  0@ (B x d`2 pK?0S@ pK?0S@ pK?0S@ <K9ht 00`uyKwpyK"<"1vT!0xp@ py[$L@ "Ġ.<K[ O0H0 -L M@ 0@.O0H0 - hh&DLM$ pPl ,0 0P@00 @1(3U 3U3 U 10 0T2U Q2U? -2U# 2U T 000 , 0K0  e7@ 0e/#8ҙ1<12U 2U 0 e/KA, 0P0  p1UE 1U 1U0 0 "   Q*H10S,0' 0@P0 ~000 0 xP0 0U 000k&4400 0 ZY0 Y0S0m,0 0S000LD0UM 0H0?r`Qpd Q@mdtd@Asd edArdAmqdhdk~gdH0Q` p-L,M`P0@0 y7@ 8@H 3X .@K0$ 0S <K \  0S p X,dD7E7 -LPPf  >4@ ?T„p0@@ 0 @ P`X@/RQ@pP34`K 5@0'2K@#Ġ *0'H'T40K-K,K1@K0PK/pK50@:00<0 0 |  0 `008 $( ,<0 ,0P00 ddr`cd'R \ 0L_S BR\00 -L\MP pD , K4 w0H !L  Q 0SJ@00 ,0S40S< 0 0 S 2 S - S 0S0#P3 0 X0P0@00LKS0R? Q0  S S  S S S0S P@ 800S3 Sj `8` 1" R 4K@80K@  @```8\ 0?0S8 @4K P<0K@  P@@@<^ 0?0S @@Tm li  L  40H S0 D0 0 440  0 D H0@ 048D  04L0  0H @ 4K P00K@  P@@@q0^ 0?0S0P0 0P@@P@ (` K0@P`P Kh  #DP T@%h0 ,p00 ,P@ ~00 ,T 0 !!g -LMPp`0 1 1\ 6i0i0$j0$j0\ \ %1C 0 0c30 00C = 2  1\ \ \ %9 K  xF7 p-T0LMP`00@8 ,T00 8\pf p-0LM@ P0`<0 \00< ,T0000 0<< \phof - 0L 0<,f - 0L 0<,f -00L M@Ku0<0 \f -X0L M@ 00<,0P0 $0K0 6@ fF7 -LMQ@0>0~n0`pfPP 0f0V@0*` rVT( K,0K JTZ:0-U P, 0L00 H8fQ0H80 -LF7 -LG7 0Q 0RDdd@ -0L@Mt@l0d@ \@ A!0\@0 0  "!DddDG7X0pPpTX0 p |4! 0P\ P0TX XP0) ?P` \P0TX XPTP姡04 0004 d80*0x0 0PbUP#U@U0 PT0,PE\U@U5SP0T,,P0T0,\PT0,TPU0x0h -0L`P0 0  ^Of Pq0T @,000SNP0T,,@C 0`S0 P 0T,\0@00P:P  -P 1 P0LT ,P0T0 \P0,TT0 P: PT \ ,Pp0S00m1 P1LT ,@ P0T ,P0T0 \p0I7 -LM@0S 5 -P0PLT ,P0@T ,P0`T ,00pPT0 \P@T0 \PT0 \|0 0 |0  -`D0@0V|pLPD0@@|@ @0 T736"  @TD00CD02 Tx@P0T ,P0T0 \P T,0   P0T,"5 0 0 0-0LS@P P10S j00h0h0h$J710S0S 0-P0T@,L,Ps0S  x0S  R Q 0hI0S00#0Q00S 0h -P0L0@`V%pP 0l0d0l0x0V00 ?s 0 1 P/@ 0u`8J7$u`0 -LMh@Te Th $0Sh0TT,#6@h0$ $0Sh0 h -LM@FP 0h -0P ,@L0`@$@T@p@| 0-L@00P8;P?0h -LM@P 0h -LM0P 0`m@kLOTp_00 PPfAi -LMPh0d8p2/ p P` \h@h•p0p2@ l@  vh•l 1\ @0@P \h2lp"pb fwP Pp d8hPPH < 0 HI7 !|I76XJ7h0|2tJ7 0-LPP@H8S8S p2 S0h2lpBHHH p-LMP@| 0U0`0  UD 00C0phC 9= -LMh2@ld ,P1h” 0l0d \,h2ld ,h” 1 l0d \h2ld ,0 h”0l0d \h”ld ,0 th2ld ,h”d0 l0d \h2ld ,h”,0 0ld \' -LMh2@ld ,h0h” 0l0d \D8h2ld ,h”$0 0ld \' -P1AL@`@ \@@`E0 p\0  B0C5AL8  <\0A 0 8/0C(  0B5 8< \0 $*;#30 \0x0 -PLp @`,0. 1 \JUKRLOML0@ P P@@@Dt :@D<t hu@0 \ ,0; \8 , x0 -LAMPD@Xp00`".(1 ) ( 0`0@48@40PIK L0 X 0 0 00PB0C@0 0`0 0R 0,0  @  0B0  00 00X,P0 p D0D 0SD0@D@ @00@0b 00 # 0c$0, X vQ`Lft%6J7 -`,0L(0(@dϠ>1 0(P\ p 0S ?o@  D00 $  0/00-.p10,p0p -LM`00p@0".PP0   pi ( PD@U40 0(0K00  ($ 0Bhr`Lfs`D0, S0D0D D @00H @0\f 0-PH0LS@ S 04G04 HP0 -LMp\ !PU  ( i@T4`  P$0< 0:000 `@0@Q` 0-@P LR000 @ H0 BT@  $Q  R8000h80 8004H00QH % 0Q 0Q0 Q 0000Q t0QD00\0QT0Q#!H0<0 <0 0 AW@\W@@W@DW@FW@_W@CWBWEW -@0p`LM @H ^ W@ D0/RQ80 0@p0 < -H0LS40jh= -LMH 00R@4< 07H 04hlj0P0 S 0- LRP@ @0S #S0S S S lh0h`XS SD@<S4J7 K7(K7,K74K7@K7PK76,6`K7,6hK7tK7K7 -0L00t0 S -LM@H0 R x04S%hy:Q` -LM@㤖dh @0\ -p0LS0 -L M@P` Q 0040000000040` 000/P P 0Q 0Q0Q Q QX09X0QX099X099  0lu`A A A fA fAA @A -X0L8  8!8T|T oed< T0S0T0 Q0 0 0S00Q 0S \ 0S 0!R 1s 0< 80T00Tlu`u` -LHM`h0d40i/0PU4!0  h Pzdzd@00 0\p 0  h|dp@T0p d@tlp\T0 0dh\hr`@K7K7\06f0AfL7L7f@8L7 -$"LM0Sh0PUd pp`j|z` z@`l ` ` @` ` k k t yugqQ6 \0d0\0h ,d0@h ,d0hP ,p`dh0P \d@h 0\dh 0\d@h0 \\0d0\0h ,d0@h ,d0hP ,p`lu` 0- L0S0PU0d0h ,@@ @  @ @ Id0HIhPT G,@@@ @LL@KK J J @H0lu` -LMd00 K $ PP@0  "!0 d0 ,d0 @ ,d0  ,d0  ,d0  ,d0  ,d0  ,d0  ,d0  ,d0  ,d0  ,|+ 0t+;Sv hhdh 0\d@0T h\$,$%h dsd0 ,d0  ,d0  ,d0 C/,d0 0 ,d0 4 ,d0 8 ,d0 .,d0 < ,d0 @ ,d0 D ,d0 O/,d0 T ,d0 \ ,d0 d ,d0| l ,d0x X ,d0t ` ,d0p h ,d0l p ,d0h  ,d0d  ,d0`  ,d0\ ,,l8X p0 T0 P 0L0 pd0,d0H ( ,d0D , ,d0@ 0 ,d0< 4 ,d08 8 ,d04 < ,d0'0  ,\0dx7,  57\d0h4 ,d@0h64 \dh0 0\6d@ 6+R00h \dh 6\d@h$ 8\dh( h6\d@h, 6\dh ,6\d@h$ 8\dh( 9\d@h, 6\d( 5h\0EUd 5\dP 5\d h5\dPC/P5\dh 85\"d 0h\ dH 0\dPL 0\dP 0\dP0 \d0 \dP0 \d00 \dP04 \d08 \dP0< \d0@ \dP0D \d0T \dP0\ \d|0d \dPt0X \dp0` \dPl0h \d d00 \dP `00 \d \00 \dPd 00$ \d` 00( \dP\ 00, \d0C/\dP0.\d0O/\dPx0l \dh0p \ dPX00F/\X d`00I/\dH0 \d@D0( \d@0, \d@<00 \d804 \d@408 \d00< \d@ ,0 \P0 T00@ L00P00 0@PfAiff ӂ?00 L*8 w` -LM,@0D 0  $ -LM?@00,D 0 T -0LqP 0-DL@PJ0000 4 0h1 0`1l!0h]6t0 0-XAPPPTL 0S@T0$0S U̩ -L MP00 4X1,n0040 U? VR 1 R?XaV' @Vp 0 P$0(0T0X0@TXAT 8`,KΠK 0$@ K(` $@PpTWd 0sP 0  `0```0 Xa fxw`R0T0L7 p-LMXA`TP 0S@Tp$0S ר0S $0 $00L7 -LMXAT 0S@T$0S E 0- 0L@t P0T 00P -LM0Q p8P9 @1@S  xaT0!l@dU!T01STJF04aS ,0S T<?Q 0S 5Q1/T%*0&W 1@S  0!p0T@`1T 01ST (PDꈃ6686 M746L7L7e6l7L7L7T6X!R0S`0(0S0S -`0L($M7 -LM(0@S d10Sd1 `0_Y `Xp\ `0 D 0`R:@P0Qw\,P400 P] 0D40H0 P0P `H(0X P?@ 0S 0 T0S  (0     0X1S 0S`00`0L  M  N O P0  C 040  d10CSd1  040 000, H0n\, 0@PD0H} 040 ,\ۿPM7 0-(0LS@: `0- 0 `0# 0`0XPP `0 0D  bQ:@00\P4H00 ,400 d10CSd1 0 040 0P喿PM7 p-L M @0@P4@P p 0X1S3 0S0 0 -  0PP0C P0L L QL5 1SP0  8M  4N 0O ,P0  C& p -L M `XPQpK 0SH  T0S Q\ \0^࠱ RQ3 V+a `400$ @TXp\`400  ` J 0`AT   5TXp\`/40 0 @ 0 -L M pX!RD 0SA `@V T0S T\ \0X@`VT \0S P`400$ @040 P `X`T`i`400$e p 0T@X@`A400$ 0 - 0L40 ( 0-XAPTL T0S 0@T08 XTU00P00 SP' 2 -LpM`K@p p08GF/V_ 8 PX( $ p$ 000X1 -LM 4`0p " @ KP @KL K~?K";P< @0D "H0 0 P0 P " L0P R0X0 TH0D$PL0X L PE PK "D$X0NT S񟗶000000000000000T\L 0PK 0D^PP$PK 0@D$PK 0 D@ D$PK 0 D H$LT T\&L#11@QPK 0D$1T0\$ T B  R{K(B (L0H0P0D$ 2P.K(PK 00D$(L0H0P0@D$("L0P00H0 D@ D$L0(P00H H0D H$L A("$ P  (" XK2PLTQ  @KT\APK 0D$PK 0@D$@D0S; 0hP$ 0@$@DF?@ 0hP$ 0@$@;D@ S 0Sh P @kTh 0 1h .  l0 00Sl@T 0s0@l0Td /kPl h0 0 @@$!l0h 0$1l@ 0$0S 0$d?PQp〠@@ 0UT \ jPV d\ '0X0l TXl0PdZ 000$ 00 `p4 80 < @  R, :0Q4 R 0Sn 000$0 00000@0p 00 00 80S! 0SJ 000$0=0@00@0p00 0<00 23j<Q  0S% QB < @R 000$00S80phG/000 `02 H0 0!L0 D hG/00080Q, D <0d h0 DQD<: h QP  D0S DQ  00$*00@$*00 @ D$*00H $D P0p<0ShG/000H RH @ : @0RT0 4 HQ H R  00$*00@$*00 @ D$*00H $H0TpL0SL0D0: dSX L R L0Sn  00$*00@$*00 @ D$*00H $LX p,80h Qd0 0, h d0 +@Q 0S 000$0 <0<00p;00;00T0 000$p 00$ 00@$*00@D $D  00$ 00@$@D 00$w 00$ 00@$*00@D $D  00$ 00@$@D 00$ 00$ 00@$*00@D $D  00$ 00@$@Do 00$dd2 Q  Xp@2 0S0"Qv St , R2 RVXZ PU X@ gPT@ gT0X140 0, 00 R( d NfP d @00@\ @fPP \ s X 0X P0 04 0 40  0 \ %fPP \ X0X00X P ⷵ,P@@Q UP嬵U@t姵ꥵ@P1sw@Pt |PpDPm |Pix|`Rw`Q76`76 -쐟LM`ࠟ @pF? R 0R$ Q PU P 1S`VV$p$@|P0 y|P0 RT  0 R 0R5 -LM `#0PU 0S; S XPU1030 0 S0;4 40@40PU Ö†Æ ?00 P(1P h;>φ40 40Pφ 40P@ PVU&11@F? R 0R Q pW P 1SpW Q0 K:P WU Y 0R P 0R 0R 0 P@2"32#"p32t#"30#3– 0T2 $PP> 30CS D2D"3#<2<"p3t#424"3#0 "0S 1P0 3 4003 4000#4 040 E2 $pPT1T!3#L1L!p3#@0PVU$$@Mn0Ki?{PZ0 9{PT0 RpNN0 R= 0R: ;4 ;4 0| S T7T75 , 4  L h | < 4!T7!!!$!T7T7T7U7,U7LU7 0-3Ls@  PP 0# 040 3 400#; 00 4 p-LMP@T`8  T@ p5@E 3SwgC  0R 4! -QL,M@P`p?38K 400 P03 <0K40@ K0  0P@80<  4$@T3@ p400 # 040 =9tU7U7 -@LPp`3 $@T`V@3 $@Tڠ3 $PP003 -L0M34pK P00 4\ 0`28K 40@h5 4005Pp?h<`9X6S~p   40@P?V7V7 6V7V7V7V7W7U7 0-@\5Lst )  PP%5S#h%\ 040 h5S 400`%r h5 400h% 400 0a -LMP@Tp` T dhh߶`ht\@hh 0 `h@)0S8d5h`8W7 `W7 -`LGNF@DTPp *0P 0S@T:W@ * R 0R @T:Q 0QwP0 P 0S wP@55 -LP -L Mp0("p`u~P} 0M@ ,@40@0Pn '̆ @0`P`1 2/Q1,/ @0Rφφ?2 d 0X OR4 h 01X !@0@{QP* 0*0\ P  '<400Y 4,00Yo\دTկLүDϯ'&&V7#&6 #646W78W7W7W7U7 p-LM?t`@0Pp0? '< 400  0,40 u^i' -LM@PU`p0  U |5@ ?0Q?l0U\0D<< 0$00 '#6 & 0-P@L 0 0 0-0>0LM>0@lP0 l @0ŒQΌÌ QÌ  0P  0 0׭1XZ7 0-PL0S!@  0ᓂ0 !?C1 ዂ$00 0R0#S 0S @ @(\\8Z7Z7 -LM$0@P 0h#0h 0-0L P@0,00 \0hH"Z7 -LM0 @Q@ 0( Q0 ,00 \0000 PPfAi -L MP@ m@0< 0P 0P`t@ 1  PHf mp!0pPLV <( 0@\h p\mno0@KJ.0 , @ 0$ (P ޑPD H0ǬLPHP@Q 

0( @\400 D0H P0<0P0@@0 \_<0@( ,<0@?( x`\@Xp0d  cX0 S@DRX0S0X0< <0 < 0H0D0[78[7 0-<0@LP , 0<0@( ,<@0@0( \<@ 0\<0@ ,   0 [7 0-U< 0 04p\0@4 0\5040 \004 , 004 , 004 ,@jq`]7 -h1LM \1+R pW`Vp`@PM, 0 4 08  YW5b X@ N QJ MS I@TPZL5= 04 8,o9PfAi 0-LM@seZ 0s0 Z0 p0t 0 Px0| P }.0S j:!H0H H D0008]7xv1]7v1D|1|1,}1t}1y1Dd|00\d -L -L -sLPB -2aLMqP@4`KT01@T4 @1R@ T$ @1R @TZ@TT1@T0(@VUUU -P0 0S  0S 0S01` 0-0L 0S 0 S 0SQ0@A0@ c c PD00l/"b0`Q0 0``Q -LM@vZh -LM0@S eRRP0 00S 00  Rڰ0: -LMP ̾Z0PS @@^p`V@@ Th W^ PpUZ 0V 0pS0`崀0V o韾VP0Ӹ09P000W0X0A{P 0S W rm0ݻV QW 0000Ba'|QJUPpW@:p@@p崀D5:8gfff p-LM@P40`S 0S 00'PpN00 -@Lp`P@PUPV0P0  0-@PLP|000!0h -Lpa0`@S@P`PP,0S d@ V7T_@D0Sd T` -H0LM @g0sBP hflu` - LM0S0 @T0Y_\hd0l,@ 8 #8~4P6 dl\lu`@B 0-LMP @02{ @0@0 P ch0 K$ 0hX0$1L56 `8+2 0-LM@PP0U{ef0StL0  H\0\  @׾H 0P0T 0 %  1]7T1 -LM@0{L0S0P0Jf0L0 -0LMS@  S00P0{H] 0hHSHQ0P0P>0 -L@Pp`P PTU=@ p-LM`\PYP P@0dS:ph0dS: p-LM`S6@ TPPU $   00 00 @ Td 0 0PPPp:A-,rM@`TR"00c@L0l01@Ѝ؁A0~0Ll1p@ A0c!10bS c 1 !\0 !R 0\ , 2q@?C0c ` 1 p0?00B0c !00aS c 1 !\0 !R 0\ \ q?C@0c ` !00?00d`ȕffdVUUU 0-LP㾻@0h鷻 -LMPPP 㭻p 㿿P@@TV,K T`@ ᚻV!P10SV ``VT0\ `S, ( X, (0@@), (0T``0\ d0Sh,0| l0ll p(0 t0l@l,@ ( H˿`00X0aBay<0@H帿 00 0a yꬕf8Mbd`Qp1@-QF X1Q00 <1Q R 0SQ @T`VpWPRS Q TVW0SS0SSh 0l0 p 0t0 x 0|0 0d0h00l  p00t x00|  00d  %W A W@$W R R | 0\q 0 Q  -LdM40 | 5| , b 0Y^40%0 03  P-XK  @0S S P@0'\00D啚5t,3,0S0T1T!|凚3  7072  7@077@w 2"@y>H_00%0Pf2 @x@KL2 3 L" 0/x0Kl KᲤP D|K<200|0L00$X1 " 0cP z w1 ,0S ,||* v|10x0K ?r Kl0 K|P |x@K `$!0U x0K?r Kl0 KfP |0(!(0` !yΊ_0@@%0P0`@#Hh P 8`p@y>0P0%`|xǙ,d 8]7]7< ]74^7`*8(1h1@^7D7L^7|^7^7^\ZX^7_7 -@L㕹`$P P00$ ;004P$ $P؀Ⴙ0 PUb p@0SP 0@! 0UP0U lpt@0SP 00@ 0UQ0C(Fbo`81,R`o`\`*8 -LMD@!88#!᳀Pp> ӳ ф(<AǗP` @0  R0V0(0.000@.000000.0 00<0x1H u|!哆PPP 8?z mvUq_7 -LCM⠁ x1eIK$ @0 1PS T11(10181100 ;004 0 <0 A&0g505K $0S $&z> @7S8a?0Q   <wd@0 |@)7S07 \X0z u<00 ,p(p$p,dL_7T_7]7p_786|_78`7_7 p-LMU@0 `&0ph޷ -L M @ 6@J"1 -L M@ 0@J"1 -!LP!$+P@B 0p'P`)0S* 7` Q 8Q2 R  Z0 10  Z0 10 00`70Y.7} 0|` - 0!4LM#P~P@ 0pхP` U0 80  U0 800 Q ᾅ~|` -LMe 40 47 ~_7_7WEV -p@LP`$((0"4 40\0$L0@ D0  0S0001 - HH$tL M' `0 D(~ PP, ǐ0{ 2Vu 22V* 1V  0-, &~,, eF@ ,0e/G|1V 0e/ H1V6 :<10S  0p܄P, 707 , aP, % 0S0000V 707Ą0  $44000 |<, 00 "   0,0 0S007|`mdedAsd rdAhdk~gd1 - 88@L#D M$`}P, " , 0*0  0 ,00ŽI(`唠PPd@ pFQX,*0% ,x}uPP@PP@ |` -LEM0C0S\, p01  8 8#D0$04}P` %P 0 S 4 (@1P 9$0tpX4! 0 0O]K  @P0 8QU <^  2 ,0S ,lw4 0@@0 p\T1!0 5 YEW^N'00000@0`004!0( S 0!01|1x!eP< P 1S t1̠111P1A?@4!0( S 1 ! b0 S 0!.pY0 h000LK,0Da/K/K<}KKTLHD}{ꔀ`,d|`_7``_7_76_7`7`70`7D`7 -L`PP@ P 媓P0pW YU ,3+( 6Hd\@00;00000Evv%00l`7`7 p-L$M%@0PSp8`K 7 @0 U00K10K002K8 KT0,0 P <埔2[2[  喔咔0u`7`7`7 p-LMP@8`ՠP+ 00 00000 0 (0 S0$0@00 @ ,00( 40 ,0, ,00 40呠0pp$111 0- 0@ JPL 0hr' -L,M`12l1,0,0 p ^<` 6^y6 00@ 5 P  <,  0$00$0/  oO 0(+@|xş@,tP000 o0@ ,@0S000 20<0 0<0 0@ 0S 0 00(X8 0 0` %4% 4!@4 0 0@h 8@ 0O 0$0Y 0 5`%`@$ 0D<0HP0 400  n@ 3 ጛP0* 080Ƞ,Ƞ0 gD L$0 0$00f 㙹$0   0  #嚛$0 0$08 4@00 P0 ``8@ Q ! 0(P\`5$0Sڰ0K 0 9`)` @ P2 .P+0.8@400 0S\0#1 00 Ğ0 1  P ,P 0$ ,尜 0(+@ 08 0Ƞ,Ƞ0 ڞ0 ``0S0 0 4`$`0 0` `` P,@S0040 [0P@I0R 0 @@T0(F8 Tʚ0S@ 0$00S  0 妒_|1'$a7Pa7ta7a7a7 -LMp12l1,` ^P 0@~RH20 |Ph 00 ` 0@@B 0T R P000@(0 T2 0 `000@T$  `0@ $000$ bQڰ0 000czT 0  (00 &00$ dU @ 0p@ 0@000/E  0 尐'Pa7a7 b7@b7tb7b7 p-LMPJ `@pK0 000 0 4 p0ph] p-LM`J@ Pfp0(0.000  ph鐘0C -LM02ct$Y1 pP,` 0 S 1$1l1t11,11|101̲1p1Q0$00$0@ 0ၙPCt00 k(0!L00 0@ 0S 000@  @ @0 000C000,   0S\0#10 0 00S  0  0" 0 00 0 @,(0  p'0000 0L+D+ 0004 dY 0  0@@000 @*z@ 0PA00 (0! 0} 00   倜0000@d@ 0ῘP@00 (0!T d@ 0᫘P@00 (0!] d@ 0 ᗘP\@00 (0!Y d'b7b71b7b7c7c7(c70c7S6l|7-0800"R(00  000+ 4  34 S0<04 0@00000 -LMđ0勯Kp _K,0 @ 0S @ ?(K ?Kd1 @2 Xa0( K\0< 8R 吚P(K0m ,0 S ,r  n09 S 0#" 'P0!" P0"" P3XX SS  ?K^  ?( K @" ,d `7NEFX' -L M<`Kp@ P 0<0K0 60K@?4 K7@KSK00 5 K#P3[= -LM 00 0 @R 0S ř0 0 0S -LMp\W`pP @WĠeT 0@T8岏VP 媏관`Ԁ`46866 d7 0-LMP@T V0K d~0@S0T0T LT)~000,0am0` d7p`(d7Ld78fQ -L␪ct 0 h'd6Q` -LMPp wP@ (0D `pZy@T  P@V 00:00' -L M(0 @KP00$p0DP `4y0Sl @$00Ox0( 00< P@e/ Hm@000@V 00:00 -L Mp$ `?P@  W Q0 00 P0  00 0 >PP 0S0 "P U ?? 0 0 @ 0P `f -L M0@S K K 0 `?]?l弶 Q-LpP 0S00@T 0a UP@ 0T p-PLM@` <'TA,!<0 phtd7d7d7 - QL MpPH<0SB8P@; 00K4 K400 ,0K( KP` (04@KP  @"P@ <׭p0S Э704`0 0lpp@4(00  0- PRL R1<@T  09U0  4U0p0Sl0 0 0-0LS@P0Pxx 00 S P <0 T  \0 0hh 02o`p1\`/8 - QLM`P6q0<@T/ 0R 0 Fp0S0p00p 0X00 $14 8 @Z(: T!t0@12c10 0!/B!0  j00Q 00 0U j  0(P@T:<4d7fd7fd76x`8|`1*81e7e7 -LMd@P``p"00  0 0  0f46dX`f - (Lt(P"!$RP01SL RK RG1<`VC @T% p !20#p1 0lP"  0 0S0p0h 0P W 0 !,0 !, 00 0`0 X 0K<0 ᆲp0`11/8+ p-<1LM R0` 'B 10p0H: 0`P@  G P` 0P' :!p0H 0R`p0 0 p0 R?<eH >Rp M0Hp0^  0 p0W 0  0 0F  0`8 -LM@Чp0  0p0ȧ0$ (0  -PLM 0 0 P"W P-L`@ 0PU R@B $ph02T@D/8 p-LMpP!/ PU,  \ h 0 \2pd0,R 0 K P@@ ,`0h "0 T@Dp/8 -LM2"0!Q2@< 0] -LM2@p( R U)1<`V W 2s 20 2ih*2 02p  lPp`i,p ˅Le7le7e7e7 -LM2@Pp5 q+ Q41<`V! U 2022 S04 0 R0|0@ #PP  hDՆP0U2pPT]ʆ偅 f41e7f74f7 q-LP@p QR1< RL 㧦p R l0U Ruᚦ2602R呦p`V) l02 1<   1<  ht1< \    0 2] -p0LS Q R h0 $  Q 1<0 S 00  p0 Sl  -qLMP` Qq<@T p0T 0 0 00Z<0`T 0`0 0p0S8 0Zp P00R00S`\f7Q0 0cp0S 0-4PL0@S\00P00f -dLM \L@0KK <P <P  fff 0-d0L \0R@P 00$\ 800S04 f ff0 X`f0  X`f1 -H0LMQ <\ 0 40@f -LMp\ Q  0Q  A b00@T04 -LM0@ 00 R 0tS0S00b 0-00L 0@S0 4 PR0t0R0000h 00b 0-LM@P$KT 0 P  0@SQP 0@S p0S P  !0 0@S  0A0p0S XW 0Ra R R P-L P ?#?00cS1111hP Q hQ h P-L@`P? T7 T# $q0@<\ 0 ?01 <0!! <0 <0 <0 <0 <0 02O 0(:Y"P00R00S0P 0200 RpP0 bꀁ`df7f -LM0Pp 0崁p@`@D0S0ץ0CS`` p0  00CP0ҥ0CP0p 0l"!0pP 0 od (0 p 00 0oꀁ` -\1LM p0 04`@0pP c0K  00p 0 @f8#xa P1: p0A!0@p A! p0!!  p0!!ꀁ` -LMp @ 0p 00 0 -LMA0p 00 00p 1S0a0c8#0p 1S0a0c8#8P * p101 p0!!p0 p0 @p0"Rh(e00 p0!! p0!ꀁ` -LMp @ 0 p p 00 0p 00 0 -h1LM p0 !4  币40X#8#8B0CZ80 >1 p04`0p0@P 00KPȠ% 00 [ 0 P 0 S0(p"0, @c@D0P8# 0 0 (40" X8 Z0 0 0送`f -h0h LQ@3E X 004Qmy,g7 p-LM\0PS`px@V0@@T tp0x@ 0-\ @RLP0Stp00 Y0SX0S7  - (L(" P`&0AT" P0S `0SXpW4P;`P`XpA> 鄁`0X0 -T0LM (("!X@ T  00X鄁` -0@LM0X@ -t0LM Ƞ Ƞ,A04S 0000 0CS0 vP ꄁ`@-$ @.MЍ@ꄁ` 0-LMP@@ 0@0CS00QP -LM\. 0\ 02pXP 81` Q 80P d0\ \0\XP 81 PXQ 00S00}f|f~fvt -4L M^P@`p 4^ 44^ 3^ ?3^: 3^ 3^00 tpp 0 tp p3^ x3^p 00 P3^H  00  2^w G2^B )2^0S!1p v) P` * c l }H2^3P`0 00  000 1^# 1^y0       0 0 p1^d0 S0 ! au3P`,0      00 000tpA@< S l0 K  $@ P`l@ 10< S< 0S   $L0^ :L00SW WW WW @W@WW@ W @`W@` W WW W-00 Ƞ Ƞ,1X0Sꄁ`D0P  0(1S \0SPᄁ` -40LM@ T0 \ 0 fd p-LM|0@SPQ \`V0U\0P\P \`pU 0 ( xpp\`VpHg7`g7PP 0P 0!R `0SX0S  ꄁ` -0LMP' 00S P @`Pp0 KS0C$ K00 0,A(oR0: S,>   P`0R P 0$ $ G00fd fd`fdfd -@0L R 000 0S 0S 0fd fdfd -4L,\ \ fdfd 0- 0P @@ @  @ @RL x0T tp  0x@0R  Q 00# 0Q 0 000 -L M; S, # Rr Re R n T PPM P `@0`0VA` Ƞ ;,HnP; S) 0 @0D T  8:S00S@ 2T@ 30D8S0D8#H8T@ 008#HA0A12,R0V0 R00T2T; 00 2R 2R R;00A Rx!t Ha[00S80 0-0 0(0 0#0 00 00 @00 00 < 0 <T 0 ; sT 0S 0 R R0V&0V#0 9,pK T 0S 0<0 0 ✀S  -p!LM04 S\q1Tq080 0K  o8P`@`V@DPEAJ3[ S"[00b0cS Y 0KRX8@ @08@ 040`၀?000 R # 3 R?H0`?À 4@ 0R # 3`` 4S @08#<@8oS: S>; S P 0 R0,RX5 -LM@Q #2$2$$2D$2l$2<0000000000000000000000 -<00000@ L `+ p\&0S \\ 0PP*; Sh!,\1R 0P: R: S:#:A >; S= ^; x   Sp , d0R P0 R:U  hK P0S fr |g7 p-LM0`PP@ S$P #0\  00  00  0 \p -L,M@  `^Q 0S `^ \ ^PK aQLXPpPKa @0T*<@8oS: S >; S|p2Q} @ T:XZ WePKa @p0T[* ; S1QO: Sʠ,ʠ >; S<@8oS: S <= S= 1P: 1P7 |1P4 TP*00@ ;   S 1Q P0 R:U 1 c0 @0Tp:XZ zq 10 p@: S:#: >; S Pw: SZ%Zr >; SPPm0SVq g7g70Q 0`c Q- Lrh7 0-0@l0P0 p00 LPU 0Ser0hbr`h7d76Q p-LM`0PSKX@T 0S1P!00 S P0 p-0`0CS0000 R00g0S0S|| 02c1FP Lr08 500Ho`22\`8$h7,h7 -L$M ,0 0 0, 40 0(0 @0#4 p0#0# 080 XZ 8@ |0t@0|08 @0,008  D 00008  H 04x00P@  0R"<0 ` 0S P?#<0<0cS 00L ILU` ` P㌀T 0,S P?#<0< 0cS 00,00HU`, `PD0S 00S P?#<0< 0cSt 00000HU`0 `PHPf 04 S P?#<0<0cSX 004  HU`40 `P0t@ 4 P?#<0< 0cS> N8@ 0000)L HU`P ` 4L80 P?#<0<0cS @0H UP\xPV0S0S 08 o400 GPE0S P?#<0<0cS 00  XHH U`HP ` 0Sy P?#<0< 0cS 00  ?HD0U`DP `0c0SD P?#<0< 0cS 00  &HU`P `@/|0S P?#<0<0cS 00|  L HL@ U` P `| - (L(" P` 0AT P0S XpW4Pm`+P`Xps` -\0LM (("QX@ T 0pl X0R` -0! LXl p -p0LM Ƞ Ƞ,A0S 0X00:0 0CS0F `@-$ @.MЍ@` 0-LMP@@ 0@0CS00F -LMPI(1Q: 1Q?1Q< 1Q0 0Q 0pl00pXP 81` Q 80P 0Q p0QXP 81 PXQ 00S00 |f}fvt~f-00 Ƞ Ƞ,1X0S`X R> -LMp @l0X@PP 0P 0!R `0SX0S  ` -LMp0PP쀟0AT P@ 0 APoᔀ `P@ V !ᑾ0 S0SV @ 3 *oH`L`%6Ph7ph7 ( (-"L@pPP@0 T0 `04@S X`V0p 0 -L p-LMp@p`TPX 00d@Tp 0-D0 (("ALXPU 0X00L` -LM@X@ p-LMp@pPT `00X`d@Tp-00 Ƞ Ƞ,1X0SL`@-$ @.MЍ@L` -L M`0V,0 :3V3V x3V Ll3V@ ;`3V% X0S\0S p@ppTP ,000 0 d@PPTU 2V 0x0 X@T 81` Q 80P x2VX@T 00S00,2Vf 2V0S SoSoo1V 1Vp@pT ^ 00  00d@TX@T. P 0 P?#<00cS`  DUPP!0S 0Sύ08 100UDp@pT 00 R d@Ty 0RZX@Tn 81 P#QaWbW`Wvt}f|fW~fcW-00 Ƞ Ƞ,1X0SL` -LM@P `0SX0S T0 S `0Sh$ p-LM@ `|PU0p4  p`m0 `00x p,Q60` -PLM`@@ pPdP`0ph0p R0pd@\Q 000SXQW d 0R`0h0h00h0hd Pp d 00pPppWx0S px 00 W 0-`PL\0@S 000Sd pRh0h00h0h0d Sd 0p `00X0S 00 -LMp@p`Tp 0P \ 0d@TWPpQ \0 S\0 S -p@QppPP TL\` 000S U\P `d@TV  P0-L@ 0SH00 -L(M0 4,8 mQ`( G QMQLQCQ _AQN -@Q (0S (zG 0TPR35 nQ@1@!pg\ Š%5 TP45%D 0 0aRP 0CS00P0 0S 0 0CR0T00T0 D0R 0cS0!PcP0HQ DQ0S, 0Q01 c, JQ KQD,( 0HSD 0Q   B P R 0 R 0 BS T 0T S0>"R ! B0,0 `0T00 S0R !0 TS2 a0 BRDpHP0S 0 l gR@1@!aL^HD HPDp34fQ @XQ- "PQ(0TPpS>0 gR@1@! b\ Š%5 TP>%d45%.cQ0S$ T 0Q3 0/S5h2Xi2h2h2`i2hi2h2pi2h2h2h2h2h2h2h2h2h2h2h2h2h2h2xi2h2i2i2h2i2h2h2i2i2i2i2i2i2i2i2h2h2i2i2i2i2i2i2i2i20@TPp @T@K 0D@K@IPs@0D @p004 8PJ?h7h7i?h?l?p$? -LM@P`p 0@0 00P+ 0@`@ 0@@`@ 0@ 00@p@`00 0 0-PLU@ U'LP000 ɱ ^0 /R 19R00C P^L0 0 C^L00C aHi7AQ$l2l2l2l2l2l2l2l2l2l2l2l2l2l2l2l2l2l2l2!R,00 ,R ,0,00,0 p-LM,@AP0CQKn28n2@n2@n2@n2Hn2dn20n20n20n20n20n20n20n20n20n20n20n20n20n20n20n20n20n2n20n20n20n20n20n20n20n20n20n20n20n20n20n20n20n20n2n20n20n20n20n20n20n20n20n20n20n20n20n20n20n20n20n20n20n20n20n20n20n20n20n20n20n2!R@ ,R@,@p!R@ ,R@!R @ ,R @ !R@@ ,R@@T@` @` 0V!R@ ,R@ p-LMp0PS@ !0@Tp0t R`@ 0!0@Tt x RD`@ 0!0@Tx ph55 -|0LS@` QP!0PU|0PPPp01| 0 !0P U"55 4S!3=8S>08S, >8 ST3T#1 $t2Q h2Q `2Q L2L2H2@2Q 82Q,2,2$2$2222Q 2Q 2Q111Q 1Q1111Q 1Q ʼ1Q 1Q1Q 1Q1Q ʈ1Q 1Qx18 h1Q `1QX1T1<1< @1}<1{81y41w01u,1s1k n1!10 101;C `@7Hj7Lj7Pj7Tj7Xj7`j7dj7hj7lj7pj7tj7xj7j7j7j7j7`j7j7j7j7j7j7j7j74fd؅`53 -LM@PTp`[ 0 S  0y P(0  0 P 00  P@ <_ Ky  0Q P j7j7 -L M` P@, p 00CS0(S0  \00 0T@ U P4$0Q44P8 8@  T8 @  0hB 4P00  @$D1c!HL <0$ 001T0$ X0($0P @0\`0d0 <0 1c80@ a00 2 Pldض` Z<2<"082 4"002 ,"0$2 "0Q0 0(02 0 1 00A S-x2Ty2Ty2Ty2Hy2Ty2Ty2Ty2Ty2Ty2Ty2py2py2J(  0t!0p1 0h1h!0d1( 0<(0,~(0,<(0~t \0  cI8@PU  \0$!0" a;<0 05  a28@PU )(0 0(0W QD$M@5<}]z2{2|222h}2p22{2{222222k7 0-L@0PS  0Rc0Q 000 0 R@-@0P 10RS<8 005 000<8  0 E-<p$@RL1P̂+X 0`5%7,@Dt" X P P 00  0 0  00  0 0 Z 0P0@DtA A"0pBP@%,`c -LMX$`$pT`FvC%B$  W`F0v@P -L(@pP`0S P$` W(00(0(00(0G-@MT (00 0h00\h0ZЍT= T1 ,P E-./0p1` U0ޕ0ޅ  eS22 R0ޕ0ޅ b BS22 R0ޕ0ޅ b BS22T T 1\h 4 8 <\h0ڽ 48<\h0ڲ5-! !^p@-C7@<00RP`h@$ 0<$ XL1H!!0"PEu R ^@@@ @@@@@ S ^@PEup(0  \B1 P0"A-(0@ @0 $00bT0C$ X>" P00c R b00$AL| 0 ^P 0 R00L|L| p`0VP0 00X000 ^ 0 R00Q0 00W0L00|G-T`p@X 2,0 1 TPh$4L|DA 0TP PL|L|@ 0TP PL|L| 0TP PL| b0c 0@cLD1|b@  X0YVP P  T PRLZ| p-LM`@PT 0S @T  P@ p  00@p00p` -LMX@$p@% bT0 apGL Bw &R$  tpG0w`@T0 -LM@p aPL `@  @0T0d0CX # $ ';<0A0q& 0Aq -LMpR@P`  0@T -QL M, `XD0@T , Pp0 @D0@T XSJD0@T ,0Pp0 @gD0@TXZ -LMRp`P@T0  @IT@XJ0  =@TZ -LMQ`PpD0@T`V 0pD0@Tp@-a0Sq@0!0 0!#1 0"#2 0$#44(< 0@#8 T0P@0,,!0 0!#1 0"#2 0$#44(< 0@#8 T0P@0 0 0 #1 0ll"#2 0$#44(< 0@#8T000p``UUUU3333`` -LM@v 0 ST0 S DY@00 0 000 0,0 0S02 020,P(0\ @ P* Z 0`S V jR0 P 0 PCUT| 1\ ,d1 0 c\ H1^<  VP@ PF\ U0S Q eR0\@$ R U0S 0 S eR0 A\ڈ0P 0000 !pGwT 0  000 , 0Q0 S3ꘆ```0 0 S$0 S000S 0H2222E-M pTJ<h@J+X< ,$P ` @h0 P- 08 PPEcu $(  04 8V@   ? R0PEu 0`FvL0 `Fv0ЍPEu 0V    RPEu@-A;A'<00<  |hx0h@  0011 @01 (01 0 R`fdfd -L<M@\`Pp mj1 WT0X(# U$% 08 P@Pcp!!( P0@#1<0 p 01<0  0 \ 0<L00C0@p (P0@00 pfdfd`fd -LXM@\`Pp m 1 WgT0X(# U$+ 0P8 @Pcp!!(P 0@#1<0 p 01<0  0#1<0  0 d 0<L00C0@p ,0@000 pfdfd`fd -LlM@\`Pp m41 W T0X(# U$1 0P8 @Pcp!!(P 0@#1<0 p 01<0  0#1<0  01<0 0 d 0<L 00C0@p (0@p0 000fdfd`fd0 0 Sh0 S\0\00,0S R/0,0R.000 0 0-10S 0ꀣ22؟202G-M(T) <h@pX)'< ,$P ` @h0 P@ / 0P8 PEcu .  04( 8V  @ ?10 R0PEup 0`Fv @D `Fv ЍPEu 0V @  RPEuA-!;!'<0< 0 P0h x@ 0011D  00!0000P0@fd(gd -L`MP\p@` md(1 XT0X'#@v$, 0P8 N`c~& (p @`0N0x0~  01x0  0 0  p 0L 00C0N80~   0N~,gd(gdfdfd -L⌡M`\p@P mT1 XZT0X'#@u$5 0P8 NPc~% (p P@0N0x0~  01x0   00x0  00  0L 00C0N@0~     0N~,gd(gdfdfd -L⸡M`\p@P m1 XT0X'#@u$> 0P8 NPc~% (p# $Q@0N0x0~  01x0   00x0  01x0  00  0L00000 00000C0NH0~       0N~,gd(gdfdfd(0$8 Q!0  Q:50@-P(P  $08@Dt @\ 0 0 A\(@Dt0 p-LMP Us80`@T  @TphDs4gd -L4M , <4 4,< 㓢,@$0 0⣡ , 0 404@,8 0@ T,0D $0L0 K, ,0$ ,L (0P0 8T@ H X@ L pX0HW#,*,  T08 @0 < P*?< >1G0c @ @P`?>1 1@V3 0Q00AP :L pP0W:0D QX0T 0 P 0X0 T L 4 ,4  0($080804|P4844 0-L@ rP%@rdP 0h(0-LQ@0 0R, 0 S 0gd`4gd,0 P 0SP4gd -Lp `Pqr0@T U 0$ R @T `rV 0 RX 0( RW tP Ir4gd -LMp P?r $ (0 0S 1U0@0`00 <@开p1 `r|< 屪$0( @n8088 ᡪ밁q4gdT` -LM@ P`qpdP@& U ,0U 0SU0,PV 00V 0S Y00`00("X0qqP -LP p`q@-PU10  qU 0-@L qPP@ 0C(S"H q0VPlk7@-0S4 S/0!0@Ġ\@(00\$ 0nQ T00T 0@bS 0 S00T0P00SS0` -LcMq0P@$0 40@@R00}/#\B1HQTTT ?Q0P0 $0S h$3X2QTa0S0D!0000iK1 ;0@00 l`0`2SQ@4 0P$@X0S 008 R 0  0S0 00C08t00X 80P0HP 8P0P0,d`k7k7k76Q`=k72k7l7 p-LM0P\^ @L p0p@KQ```P`` `0 ^ pP:P (fO$dO``72,`fش2`4l7 (B(0P3,1P # 3?0@CP  R0 I_KPE00 $("8  00Z00",S ?00^0#03^00SV000JKKK 0jP,1S QK% Q&0Q41!P0 S0 S0 0 SR 000 S -LM0PP,0 @`0<p7 S'V W 0S 04  CZ U 0S 0,4| oC,  o   0;p ,04PPPn7 o7 -LMB4 , @uCpT0 P0D01o7 -LEMh@PKp `K?K0 ,@ 0$! KKOC 01V h 

 <5X`Dp7tp7 p-<@LM`PU0 p0T 0-@LPP 0 0  !e<00h -`LP5Vp $@T@h =QqH=q<=V + ==P6p7p7t6p7 -LM@\ 0 0s S | 0s S| 0s S | 0s S| 0s S| 0s S | 0\ 000| 0\p 0P0 0 -L M0p@0`00 @I0H A$E D040G0F $ I H040@ E? A1B x1 p1 R001 F? \0SP PR ,@I 00\P!U00R00S@U2I? PePU X0S # 0PUYχ 0 0S 00 4 PUX X 0U 0 13 p-LMPP!8P P0@`TePP \Pephee@wT8 p-LM @`\ R 0PS 0 1< ph"\01\ P1Sp@-`P@  0HČ 0#^ @P8S 0S S 0PSdp PR 0R PR 0R0P S P0R RD555 -LM@' 0 S0 S  -LLMP#@0`0P ,0 ,P 0S  5<3 ,0S ,_0\KTK \0K[K)0  Y0KVKU@KZ@KX@KW@KRp[W00P00SQ@T@TW 0f ]P@ 2XH 0S00S 0Sl ` KPL `P8 00S$ ;T f0X0840` `PU# 00B0S Sf P P010  P 0S}?d0000 B0S0 S@\ X @ 0T4 0 R090A P@T 0tc;l`\;01 0CĠ  UKV0K>,dp7q7P3 q7Hq7dq7q7d 3q7q7q7 -L MX p, 90S 0S,`0Vʆ0AP ;P , `0VX 0 DXZ  P X0S  S 0S<  3 Kf P  T: P 0  0 00  `PP   :  :    d 0SS00D :4 :0 q7r7@r7pr7r7r7 -00QLX0 Q S R 1 e!\:0> 0C0 n>S -LhM ` PPpK $P@ < R RXp0 SD0Sl -LM 0@S  P 0S0  0S   -BMLM P0004P`p 0@0X0 @T@0s 3@R CKC.K A Bf08D [P 70p08<\`4p Pp:@0 7Wڐ2W" 7p7f PhJ 0@0dpH0 TC^KPE08< P@H0PHTH0@W0TH00` P 0<8P 08<P0  !14K,@ rh0C.KP B180@T8<P 4P70S SxA}0T<4 s f< P8 v <$ЏxSf 0  @0eP 0 S 00SX 0@T?`P00S@  <Fjs7s7k746@s7633Ts7```ds7s7s7 p-LlM0 d0 @P`KP d0T@p -QLM@ 60S6t7t7 -LM 0@~  ^ 0 S 0000 p-QLMP` Q pd@V*h0!@RT:0p0_d` -P80PLp0p\Pd` V@*h 1S@ T:0 vh 01d`fvK 0-LM@P0K  T TdD P00C0 Q *h0\ 500  <D608G0 t7\00` -LM5 `0P\ 5 l00Sl0 H0S f@D4PD $ H@80 @ WP@p"0[P< p X0s  4XL0P@p0IPP 0DPT L pl8jDf50@050Pl@P8@L@TP;T@8P@3 0-50L0@ 050l PBUlPPPTPLP8PDP0fDP8*8PL%LP -LM4p^@` 00 4`P40P 0004 40@@~ -LlM 4@T`pK$ P 0 04PG $0S $$;@KP4@K,d m > 0FBa8Q -L(M0PS`Z LpX @ W*0@ 0SLK S <00p0 T:!PP @T*0P\?@T:@T*0\%@T:L0W 1S c LK≉q@PTP LK0|  @ⴵTPQ*0P \ Q:0LKpQ*0 \ Q:0,LK p -LMm? R`1S  K` T!R\13 0K <\ 0[D!2 0K HQ 0[P!2 0K K00 Q-L h0Q 00H0Q @0Q 0 `1 W@W@ WW -LM<@T 0DfH0 P =>0S4UP 0 S00S=  X0S 0PUo 00S> 00S<  i].PS j F D B @ >S00Y0 %0!0S PS 00u7u7,6u7u76u7u7v7v76s74v7,B7 τ%d @$3nPP ̠ ` PFspa 4!pZ V d3e3z7z7{7 0-? LR_? ( R $@T L0@TYK0 0-@LOPxK000,  0 -P?`LP@pczA1T0 #x1T 0 0}4P gA5@5050 R0 W0T 0T/07%# = S =@S @ 8C83%3  @ 3 5 @ 8i i 5i 6i( -L M `@0Pp``` !A0 $KP$ 1S@V<{7 -LM@h -00%P-@%LU - )rPS P:P!<`PpP4P(`PpP  P ?  sDP(c4s>P@@N l `0P10p5|!|1p!l1t!t1o|! d!40`18 <0 L!L1p 04F$ R "0"!m' 0  L= MJ00S"t00S"o e p=`63x|7 3y76 |7|7``0`A683 3h3t3u3v30w3w33e|7|7 -LM(0PS0` ?P 9P4P/{x<`3p0CS`3R5@O NF_`3 0CS `3;< BeQ Q? 0-LJ P@; K1P+  ~N 0>L p-LMO0 SP$ , ` pP7  P 7 0-_0 @SL   0P7  P7 -LM?4 Q@0`p5@ R' RRPT #k04  4> P100Kp/00s[ 00S=  ,Kt[2[0 0 AS0 /Pp,08#x0g00 BPP! | 0@  ` ppt;@DP  =;00S 0P@ ꬃ3|7 -LM`?@PQ0p ;U UUi; 0@P pU 5U;5  )0  c7 d00S"00S"  4X\y733y7y733H3ܝ3U|7 -@L`0S0P+75p@ 2007  UQ Q? -@R80P`+pL  0 H @EP@ ;  F1+(  F7z7 ?0-LP 3$@7P  0S 0!P7  P*7 -LMO0 S   P7  P 7 -LM`0p,0 0PS0 5@ R- R00R@@T X30X3PU ̠|A0  @wX#0$iXC,0K  0, n  04 S,0 0P@  0@ H,00 046 7P DP } #6  0@꼚3Pz7 -P?@LT`0p 65X;E5 XXm5 0@ \X  0@ zE 1S rpz7P? R7 -LM? iRp̀  Pok``m0O 0OoP @0  p-AMLAO0P `0F P  0 C40 \\  'PL30L3p wp'3~7 -LM@? R5+Q P 5;5Q 0S110C1DP5 ;%5 -LM? PR0p5@@ '5" Wo gd@QTڼ5`   HR7P- (7P' $ 8# 4" 0 ,2S 5@05%+%4i@ P i4 z7z7 p-LM@? ?PP?  3nPP ̠ L P5bpP pI 꼚3z7{7 -P?pLP@`X4\1TE P1T 0 04P 45@%% = S =@S @ 8C830%3  `S `3 `F @ ?5050 R0I i i -LM0/pWǯ `@0P``/#40(K P ( 1S4<{7 -00%P-@%LU` 7PPP7P<`PpP4P(`PpP PK sxC(cE4srCpz7 p-AMLAO0P `0@ P  0/"-C4? 0@ \X  `P 30 3pv Fp3 7 -LM@? R5+Q P 5;5Q 0S110C1DP5 ;%5 e -L M0p5P@` /@υ 0@/ 005  00 @ 7Pp ]7P 2S %@ %5;5i`/ P  bz7z7 p-LM@? ?OPP? F/nPP ̠ L Pp 3p 3z7{7 -P?`LP@pW/X1TD L1T 0 04P /5@7%$ = S =@S @ 8C82E%2  ?  I2 ?  @ ?505%0 R0vD i i -LM0/pWⷯ `@0P``.0(K P^ ( K1S.<{7 -0 5P=5U@LPPP7P`PpPP`PpPPr=br=b=P P02 S M'P P02 x= d7P PR ,( "T{7t{7{7{7{7{7 0-LM @P0PP 0@  ]PP 0S 06 -LIMpᘂ `0 P P;P?MOKKVP ɏ0$S LPz ,@P(0!R@T2SX 02 @TPP 0@S 0T2s pPkpW"{rv 2so -Yp J_KNK 0,PIK@L? `ß`3(KJKO @\ K<8,#44 < QKD1 \?"P [ 2"0@5p!2"l1|!` 0`V2  9- :0 0 00A SA ARa0A7ASWA? 2@0 T0ڡO cP 2@ ""0PT "r 2stpWiP 0 S00S"0@T00S" ,  00S0"2-PP 0 S ,(0!0"(1220S SY  | 00S0 0S6,7D7*y7 3x33&h7777 Z67 -PL,Pp`00@S 5@ F00s,m& -LM@? R5+Q P 5;5Q 0S110C1DP5 ;%5  - !LMOPp `0-=?  P  ||  ̿0S3030K# p c['83 -0 5P=5U@LPPP7P`PpPP`PpPPHru;cBro;bP TP02e _ P >P02O x I d P (PR: , 4  ,7T7{7{7{7{7 -`?PLP@p0|+0T 0T 0 04P j+ @ *@ W5050 R0A i i p@-0? R( p`@0P``p@@ <{7 -LM0`5P@ )+2s 2SC 7P< 7P@4 ?? Pp  i+->? Pp .N0  pl噾%@ %5;5 p*>υP? PPp j z7{7z73z73|7 -@R80P`+pL  0 < @8P@ ; 91+(   3:7 z7 0-0.^@ L07P  0S 0ӾP 7  P7  0-.N0 SL$ , P 0嶾P 7  P7  -LM`0,0 O0pSP0,5@) R2 RR$ 3S% U 2`]0 3 S0 33 00A0  @嘾Ž$ 4 #,0K ;? ,00C,0 , R b,0 S0P@ 00K@0 ,  ) 7P DP ) )  㒼 0@ꠁ737 -LMP?@pT`0 )5V;E5 VV  0@< V )墾(K 0P P(0S00P@ 1S w)9 `pz7Q Q? -RLM R0K R i Aq- $0A0 0!q "` -LM 0S4 0 0P 00<6 -LMp@8`+  PP#?Pt#xC娻29.P3C0 KJPP000400 [4 ?ͽ080@0<0 `Uk80se <0sb @0s_ (,`K 0PPJ *X t@,1tp!51l!!p11o|!!4018  <0 !1pA  0Pv1$ R "0:"ci P<T0 `3( 㐺 (0d34ZP  0S 0S 0PU0S@0S80S0S<ddP Z6`y7373<673H3333t3(333h~7y7@7`7 -@`3LSPotP0ⲷ0⯷+(h3p0CSh35@ 1$0`3(0 c -PL M@`P dP`^EtF(K hÔ?00(0K%K#pK!K'K&KhÄ$PK"`Keh3P0CSh3[ -PLM@p` dS`pUFG,K h@00,0K)PK*PK+K'K%K(`Kh&pK8h3P0CSh3. -PLMK dC KT0  P00[ -PLM@p` dS`UGF,K h@00,0K&PK+K)K'K*pK(`Kh%PKh3P0CSh3 -LM@`dS巏Ub`'p0/y 0 5 L  |7P= S7P5 m} u m 0H0S D0SP 5@05%+%'P]&D z7z7 p-LMdCPT p5 H. @4`%0@  ,Tph,'Q Qd -LM┡d3 S`( tp5 U  <5    (0S (0K U)[ 0)KRU@ P5<5  0 k0S ?0 00U@P5 ,d7 p-LMd3`SP4h#8 h#4D0 JP&4<H0 CPOD0|  `宺۹h30CSh3p ,(` p3z7{7 -@R80P`+pL  0 7 @"4P@ ;  51+(  57z7 ?0-LP $@7P  0S 00$P(7  P-7  -LMO0 S  ( 0P(7  ѹP7  -LM@d3S"$3S 5+Q P 5;5Q 0S110C1DP5 ;%5 6 p-!L!M_0@ `0[6 @;\< l1L0 H   ȹh30h3h3@0CSh3TX30 X3p 890▴ ꦿ T<37 -PLdC`Ttp %5X;E5" XXm%B 0@ X h3H0h3h30CSh3g  0@ |4 1S :pz7 -L$M`pd3S@tP RA R00RPPU h0l0h0P(T AD0  @*h30h3Th30CSh3h3D0h3婹h30CSh3.h 08hP,0K J 04 C, > R 0P@   ]00K@0 ,  P[$0 C7P DP  0J$  0@3Pz7 -`Ld3PS@pW.$X1T0 #H1T t 014Pp $5@pO5050 Rt90T 0T/05 - R @R @8 K0 @ 2i i 5i 6i( -L M `@0Pp```#0 $KP}$ 1S# <{7t -5@=P5LUP@DP9HP H`PpP@P4`PpP,P0$3,s34c@s3HcWP HP0H0 pm \gAP D߶PDP $X R{7{7{7{7 0-Ld3_S$3(0S0h,$@T V.0@T0 0-0Ld#RPO 5@00"000-000,  0Pd3S0s P-L@" d3t`S_ "p,$#R PLh",0 00 0S $#1S Ah3/0h34 -LM@Rh30CSh3hF 0-PLM@P d3 SQ 0 @       K0  [0[Ă p-PLM@`P d3SQ p @ FĠ0 K K`K     0SH08 #\ 08S0 S ` -LMPp@ PR!1 @/@( K}P ?(P0@U52S 2S 2S\"0@;H!h0D1p!@!l1>`|!5`0p r1 Pfeh1dP<0P! (϶P 0 S00S" 0PU00S"00S"  0\y7y7y73(33 3|7 -@L!`p`00PS 5@ 00! 㭳!Q Q0 -@R80Pp+`L  0 @/P@ ; 01+(  17zz7 =0-LP $@7P  0S 0寵P7  {P帵7 -LM M0 S   呵P7  ]P嚵7 -LMP0,0 0`S0p 5@ R- R00R@@T 2 02hPV ˠ : 33z7z7{7 p-0LM@PQ00 5@ R R00R``V p303Ҷ0SUph| "0 pc0z7 -0`@LQPp+T0T 0T p H505-h0T  Rph  @ p@ 'i i i -LMp\0 TR `P0@ 1S i<{7 -0 5P=5U@LPPP7P`PpPP`PpPPHru.bBro.b궳P TP02e _ ꠳P >P02O xI dꊳP (PR: ,4 T{7t{7{7{7{7{7 -PL@`!1pR001S@!A !A/  fl-101[7 -0Lp< , ! , ! 1 @aPA0S. :9 0R000Sp0p00p'| 0@  000 0@000 0@@0ffze -LM 0S4 0 0NP 006 -LM@` ᲼pPP0,#?Pt#xCg39.P3C4 K PP400400 4 ?ጲ080@0<0 `Uq80sj <0sg @0sd 0`K.0PPLM  L t@1tp5!1l!p1!1o|! !4018 <0 !1p  0P1&$ R "0"j$ PH0 `3J KM @0d3E4P  0S 0S 0PU|0S@0S80S0S<h ꯸ P\y744746y7 4P444(4$4,444d~7y7<7\7 -@`3LSPotP0j0gh3p0CSh3A5@ <&Mᚶ0`30 Ȯ\ -LMP`P p d3S Q?0@0$0Kh300h30FGD$K#0K@K!KK"`K KpKh3@0CSh3 0-LMdCPT 0K K 0PP[ -L MdC T0K @K@KP [0[ -LMdÐ 0K\ K  P -L MdÐ@B$\ K0K K @wP 0-LMdBL^B$L K0K PK@KK 0[PPP -PLdCpT㷯]o @T|lp | 5J r 5 ; h l7P- D7P% ]> j %H0S D0SP 5@05%+%P8, ' /z7.z7 p-LMdCPT pLD <`*00@  !T ph!.'Q Qd -LMd3`Sp`t5 X  <5  o$  RU@ P  =0S- P  0@pU@P5<5 Y   H@ o 5 &* p-LMd3`SP4h#8 h#4D0 P&4<H0 PO̠D0x  `_匮h30CSh3pRr (`k p4z7{7 -@R80P`+pL  0 , @(P@ ; )1+(  7*7z7 ?0-LP $@7P  0S 00֮P7  P߮7 -LMO0 S  ( 0帮P7  P7 -LM@d3S"$3S 5+Q P 5;5Q 0S110C1DP5 ;%5 p-!!LM_@ `0+ @@;T<d+ H  @儮h30h3宭h3@0CSh3TX30 X3p鎵 40R b;I<@ 47 -PLdC`Ttp 5X;E5" XXmB 0@Z X h3H0h3微h30CSh3$  0@ 9) 1S Cpz7 -LM`pd3SPt RA R00R@@T h0l0h0ְP(U ̠AD0  @h3 0h3h30CSh3ٳh3D0h3fh30CSh3̳h 04Qh@00K  00 Q00S,KA Q+0[0P@  0@00 @0C00 0 0 N7P DP a  ʫ 0@4Pz7 -`Ld3PS@pVT1T0 #D1T t 04P 5@Z5050 Rt}.0T 0T/05 - R @R @+ U# @ 2i i 5i 6i( -L M `@0Pp```0 $KP<$ 1Sk<{7t -5@=P5LUPDP9HP H`PpP@P4`PpP,P0$3騬,s'4cꢬ@s'HcP H崫P0H0ų p,꿳 \&P D垫PDP갳 $ꪳ {7{7{7{7 0-Ld3_S$3(0S0h!$@T #0@T0 0-0Ld#RPO 5@00"000!000,  0Pd3S02 P-L@" d3t`S_ p!$#R P h,0 00 0S $#1S Lh3/0h3 -LM@h30CSh3h p-PLM@`P dQ pV pU UPpU] U 0ll lP`P`0U  XU Q_0UP꜂76B7F p-PLM@P` d3SQ pUUphU] U 0h h,`P`0U   U Q_0UP67B7F -LM 0S4' 0 0QP 006 -LMP`p ᵵP@ KP@  1!P!1 pt1t!pp1`@h!h1@@璫0PT 叫P> 0 S200S1+ $0@T 00PPP0  dh0 ㆨ00S|0 00Sh0  Px\y7y7''' '&D.H.\.'.z7z77]'44''y7 -LŸ2 RP0p  0  0SXb0S<?(? 2@BO:!@00CS0 0S A ` 00C! 0Pa0 S AP?AP#xAP d1 ުX |P00ꌱ ᅱ ƪX dP00t m ꮪP LP00\ hV T?iX.\']'؂7X'..,'$'(''{7{7{7{7T{7t{7 -0L'lMSp  !0`B!@%=?ZDP U@@T,0 @ D eDD0    ީ P00, L\0WU76.(.7..$'',4<7 -LM?pH0 \`,0 H \(A0S Q00C!010 S1 @>'\00P p0pᴠᶐ,0@000_D0@ .|@  p @u CD0P@@>oE&... .$'@+4' -2LM 2Rp` l2R `2R '\0PH".<p 0 00@0D2@ BŸ   @'., 0@? SO 1 R 1R" ʌ1R 1R Tx1 @l1 p p 0 00 0 1R 01R0AS#4#4#4#4#4#4#4#4#4#4#4#4#4#4#4 0P 0S0S? 2K"K,pKsD0 ,pK2K"Kk#& .$'@+4'*D&( -L@M`83? Q@ (3\ 3Q d3QA  '\ C0?p0P% W@-00 00 RhQC2  .lŸ ` ph 6l2P@ @    B3C%-( 0""K0 2K"K 1 R 10S SK,`K1 R\1Q 1Q0S2K?,`K2K "Kd!P0p2`TKPK&BV?G K5KB]PpPW 0"K0C "K S'4'4'4&4'4'4'4&4&4&4'40,`K2KT0000000S:T0,`K@KBK&# $''@+4.P7(##& -t0tPL @`T0 0 q @ ʐ40P 0(00C ` 0@ &..(. p-QLMd@ P L0L 0 S `]B`p0` \&(... p-LM\@`P+  \$ \ 0 \0 P 0S|0 \p0 d 0 S Bpp=P 0P&..(.<. p-LM 0@0 0`PPx Pl0uP-|墣P 0 //0@X?s ?s|2|"`A 0?`h @ 0B  ?DO Z 2* P> ? '17GG gF FO$N>X0@ڈ1!51t!p1|!|1 |1l!0 pF  P1x"|2H1x/ x2<e | fpEAá0? p- 0LMP00`@_|坡P`T iP@ Vp(> phl 77 p-LM@`PPPUo@Zp酡o -LM@|OgP 4P +P ;/1 0?,  7(7H7l7 -@`PLPp?Sr?o -LM@%4P 5A0AS 00'RM -0PL@7QB4B4C4C4C4S /x` WT S7p81A 010aS7p7p'wR .'4'RRP`  P |hk L'R 'RM 7sJ f(8gfff77 -@L^Pp|`ẛA 0B |oᗛ -LMpR@`0 RR鹧 V 0P@  PT `  B  0@, `5;5Ai ̅7h -L`KMp0R,0 @ 0 RR,0 S ,R ˠB0@  @B@oΠO?K 0Ÿ c:<1  24 "^0P 8!  e'0 0PS<1'><1 ;<1 Db0S;00 080``   `墜ϛP@   ?>0 c P,0 S X,E @@ 7p  !4  07KKp$ .4 01   0[0͠   i x [x0x PPdd0`p/`p0C-  0C- <0  -L`@0@ cTdTDP@p  @mTP v607 p-LM`PuV@ V@@|0 L\R@ IT@  8, @ ph 0-L@PDT T 00CS 0h -LMPc0@1 @T@z0>S @+ cTdT  "bP7p0'OpGB-0$ NwH p 0o;~@pm !0@T`p|PS 1> 0 㴕PU1>0 㪕PEKPX8P@1. 4A0 @3P Q 5QN n   ,5;5%@ %7 S  xk   `a LDY|6"VSP7t77E4D7؇777 0- @PP5L=05U x  x P?S ?S/0h嗕_咕_s_D02 B-0-0@L$ PN? [0CQ  X 00HSAQ B00HSB 0h2 -LM`?|(K$K(KB]T@L0p 'K$P#K @&@K%@K"pK!@KIa|n4 -RL?-΁Mp℀   o`0d @ 0P0@H0 @@ χOB oܿD7 0-LM0 @00P<@0vTT@T@ l0L00gD0000D0GP h[0 40Pm40h# F6k7k767,q47 p-LM00@@P+0`SD00D0 0@@0ph 0-00@L@P0S R000H0 0  0h -@ML40@ @,@剏0S hh`7q4؈7 -`LL0PS"DpD@ 0T  R0000 0  PL0S ꝵD@Tl7 -LM@0<@0D0 -0`0CLPpS?r4 s4xs4s4s4s4`t4 0 S00 0P S0C40rP@  0$0R  0 4P  0 S00 0I AP / 00 0 0  00  00  @ 0 S00 0 S0C4"P@ 00@PPQe ㏐PP 0 $}/P00P00 =gdD p-LMH@PT0`Q4& U 000SHPp@T 0 R @Tp000SH@ pPp p-LM0PR `@$0 $R Z RR 9R3 4P 00 K`V 8C@8Ÿ<8N0 @@<p0$  ^``00 @8Č0`` `@u1R 1RH 0\$  ; 04 <|Z(1R0  R 1R KL   R # 00S0##400R R   R  00S0C4H\0`H 0\$q  ju4 7 n`p`l` P-0L 0 N<7Ggd6 -PUp`L e dP@ U 1R@PK.0SPP p-LMPK`@3. 0` P4p 0-@4PPL 80S0e00h̏6 -LM@e pP`? <08SP 00@Ps s0l0ML@P \00l m0n@o@P80X q@r@pPP@'N0<0J0<@0P SV8ey 8N0@@<P@ <@@>8ea -` cP@ou4 -L MP `0 Ƞ(,@0 , @P`p0Z ,)( < 0R)< 0 Q0  "< 00S RP K R D -LhMؠ0@(0 PPK` (0xK(0 e@b@ @e FPp0T  @@ (0 S (岿,d7,7Pe̎ -QLM@p* 0S' 0S$ *`P~U~P#0 P 0f0  0 SR*000 0SR: 00 Q 0S3 : AQ0A Q0A <0<  $0 0 JhdLgd 0-LP@T 0P 0T0C?0D RR1*00 RR1:000 -LM , Pe㒍@T e % \ᔀ `ep 00 ?0`0 ``p @0, 0R0@   -Lp` PU030#\Z0 @pT0 8,%4X0P 0p -L M P 0U`e , 00 ,&@T e $ \ ep 0 0 @P P 00,0000P0P@000 @ 韍 -LM00 `00 0 80 V(8Pe , 40 )܌@Te ! Ԍ\ p(e 80 000 ,00000400 `@000 @ X -LM 0`Sp(PU! $K <P`e? @$0T0  -P`e0$00@TPU0 0sP 0AQP0000 p-L M`@P{P 0 KP  0R 0  0$0  $00 p -LM0`P4 ep) P@0 0P 0,p` ( 0  0 00PU0e@0鮌 0-@LP0 P(0  00P000h -LM@00  0e0C 0h邌 P 0 RP\ P 0 RP\ -LM("HP0 T 00 -LM("HP0 T 00 0-P0L00@T80  (P۸00 -LM,0@0(00 001 0-L'M@PL@ K @ 0 PS ޼0,d@7k 0-(0@00P L00P,00 0,0 00 -,0 0(,00 L000 -00, 0 0 0 0  , 0-00 00, 0 0  , 0Q0-0R00\00^00 0-0L0 @PP,00,00,0 0-@PLq0$00$ @  @R00@b0 -LM0@S 00P 6Z000P7 p-LMP@(`V $0S00S 0R*1 00 0S0  1 V 0S 0Sph`ppᦰ  -LM00@ P00H p-LMH@ P0`S ph000 0@@0 -L$M4p̠` ß 0 @@@2\00 ᇷ4PP 408 PP 8< @0P PUp(@K(08$ (0K0' K&0K 04$0KPP4EPPZLWL0PP0TT0XS P@o8H pPD PU|PHX0͠ pP pPPP@QO01P*K 2K( (? 1 E0 x@5p!0 l1|! x`呠@02$<!8D "P 8@ @0Ph fp7|7T@7`477Љ77 7(7D7H4`7*ľdx7Е4l44 - L 鈊7 -LM5@+-Q* 2S 0 S 0S1! 10C1hqgP 5;5Q 0S110C1DP5 ;%5 ~ -LMx`Pp5@;5EtPWCυA @0 1\SiW@0 %t@ 0-Lx@P0hz -0LMRP`,0 xp, RR2S S02͠AHX0  @ PPTYHU+ 0N22"S02,0KP,0S S0P@ *5@ #*P ,00 0X, u'p@0D \ `  ʊ0P@ H4777 0-L P@; 1P+    0w -PL@`p0T 0T x 0Ӛ4P  @ 2@ j505'0 RxZ i i -LM `@0P`p`45 ;%5@Di<{7 - LMx@5@ t5@05%+%hk 0-LM@ T0P\ T0LDHH  L0S(tP0T0'X47 0-x0%P-%Ut @RL0tP -LMpzsP`Us 0 0$  0Q< $P< <800S`P 40PP<00S<0   Zz ` <4<8  4  @h h0@K4@ , @P 0 P $000S$ 0040$0$40H`(00(0 44Ȋ7 sr-LP`p  0 $@T uv u 80U 0@Tv H0VW WnP b ^77<7 p-rqLMP`  0 $ R uv0@ u 80U T pv H0VT404040@嫼/\7 -QLM@8 0C?. B"0a ^鄋77 - 0L0\ s0 00 0-$@0 TLP,00 P0 P0@T0 0-$@LTP P0 0@T0 0-$@0 TLP,00  P0 0@T0 0-$@LTP P0 0@T0 -TPL0@& 00 1 ` ^{'i$8 80$8T 8X0@8$0T 8$8 4  X0  hs67 0-X L0P@K `  0 @0  P=$8T 8$8T <8T @ $8T@40 }T00X0 00l@X0 )0(0 X00X0 5)\ <#3  `0 + ;8#(0$8T 8X0@ `0  ,  R,,$8T0 ꀠ48܋7 0-P(0L0#X0@08X0$T0 4TP0 0h p-LMTP 5* 0` p8 $48@T0$ 4@@ ph R0h0 d00Sd0 P0d@0ppp p-LMX0@![Y$80 T8}`$8T0 4P ` cVL0S X0  p8$;T8 X0lXH -LP  -TP 00LR`p @$<0 T ,00@ốhz, \00Q0S p-LMT`,0P0@ 0@ 0@@g0t Tt0g@`S `p0S 0-X0L @TP \0  v k _ U`0   B 1   \00L  00h齜X 0@ X h00<0L 00㭜X 0@ X h00<0L0 0㝜`0LX  0h0X 0+ ㎜`0X L 0h0X 0+ 〜`0L( 0wL0& n\0L0& e\0L0# [\0~L0# R\0sL0"JiLT(Q- -LMX0@l@0S 0 ?C5A0P 0S0Q  0-X0@ L08T0 $4T0P8$ 4X0Q0    ; S 0@0 40+0   P00@@@T  (RL#R!&R$0RA0R#& -LMTp@ 0`00,@8T0 $4T0P8 $4P,0 0,0T0$84 00 0,   00300 000/ 000008T0 $4T0@8$ 4X0@@ `0 <P   006    0060000 0S  <A00000  006 0060 0060@006 000 00608T0 $48PT0$ 4 -LP 6 p-LM@P`  |(0tL0 P8 T`0 X0h  $8T4 00 \0pph676 0-(0PL@ F 0ES L4l44 4 L0"S 00 L0"S$p L0"S 8T0 $408$;T 80% 8T0 $4V>8$0T 8_0 -LMTp@ 0`00,@8T0 $4T0P8 $4P,0 0,0T0$84 00 0,   00300 0 00000$8T0 4& 8T0 $4T0@8$ 4@ 006 0060 0060@006  0060T08$ 4@00000000006 0-@L8T0$ 48T0P $4$0 S8T0 80 -LP 6 p-LM@P`  te(0lL0 P8 T`0X0 $8T4 00 \0pph676 0-(0PL@ 7 0ES 꼰4ܰ44@4 L0"S 00 L0"Sp L0"S 8T0 $408$;T 80% R0 -LMTp@ 0`,@00 8T0$4 P8T0$4T08 $ P4,0 0,0T0@8$4 00 0,   00300 0 0000000000000000066 -LP 6 p-LM@P`  t(0lL0 P8 T`0X0 $8T4 00 \0pph,676 0-(0PL@ 7 0ES Գ444X4 L0"S 00 L0"SBp L0"S 8T0 $408$;T 80% I0 -LMTp@ 0`00,@8T0 $4T0P8 $4P,0 0,0T0$84 00 0,   00300 0 000008T0 $48@T0$ 4@@@DT4040404404040404040404404040440404044006000600060006006 -LM@8$T 08 -LP  6 p-LM@P`  t(0lL0 P8 T`0X0 $8T4 00 \0pph2 67 6 0-(0PL@ 7 0ES 꼷4ܷ44@4 L0"S 00 L0"SHp L0"S 8T0 $408$;T 80% O0 -LMTp@ 0`00,@8T0 $4T0P8 $4P,0 0,0T0$84 00 0,   00300 0 00000T08$ 4000  00000000000066 -LKP d 6 p-LM@P`<  t(0lL0 P8 T`0X0 $8T4 00 \0pphgd 67X 6 0-(0PL@ 7 0ES 444l4 L0"S 00 L0"S}p L0"S 8T0 $408$;T 80% 0 -LMTp@ 0`00,@8T0 $4T0P8 $4P,0 0,0T0$84 00 0,   00300 0 00000T08$ 4000  00000000000066 -LP  6 p-LMP`@t  (0$L038P0 0T@?>C2@0 0 X  8@ R R T0$8 40 \z8 $T04@+Ql &Qj X0` ` 0A$S%|4444444|444|444444444444444444444444444)&Q,0T$8 88T0 $4 p 0$8T 8@0&S 8T0$ 4*98$T 8p$8T0 4Px!$08T 8,0 $8T0 4`|X0 n 8T0 $4T@8$0 88T0 $4 -0$8 T8$08T 8P0EX0 @T0 $840 S  @ 4)0$8 T8P0 67 6T 0-@L8T0 $408$9T 8P-$8T0 4 P }U0 p-LM(0@`PH 0BS 4444 L0"S p9=p L0"Sp L0"S 8T0 $408$;T 80% 0 8T0$ 408$9T 8p p-LMT`0 P0 ,08T0 $4T0@8$ 4 ,00,0 00300 00000pX000 0 000 00000000 00600000S p8T0 $4T0@8$ 4@ 00<000006 -LM 0T@eP  @%#,00R0S ? p7Z p-LM@P`,(0L0 P8 T@00X0( `R ph $8T4 00 \0ppht7x!67 0-(0L@P0  L0"S0ES44440%>B0p0)0Ď7 -LM@8$T 1<8 0- 0@ L|PP  0?.C5BBT@ 0ɒ0S$ ÒP!6xN67 p-LM@P`0S  ( |L 0PT`8000X0 $8T4 00 \0pphn!67!6 7 -(0L@pPA L0 S?0BS4 4h440% ` V 80T$ 8 0$8T 88$T0 4 q 5l47 -$0Tp @0 `0 ,@L8T0 $4T0P8 $4P,0 0,0T0$84 00 0,   00300 0 000008T0 $48@T0$ 4@  006 0060 0060@006  0060 ёP x ̑P8$T0X 4000000060008$T0 4 7xN6 -LP !6 p-LM PL5 3S@`* L5 3S?  k(0L0 T`8 0P X0 $8T4 00 \0pph\,0P0? 0P0 !67!6!6 0-(0PL@ 7 0ES 444X4 L0"S 0{0 L0"Sp L0"S 8T0 $408$;T 80% L0 -LMT` 0P00,T08 $@4 ,0 0,0T0p8$4 00 0,  00300 0008T0 $48@T0$ 4@ 000 00000000 000066 -LM@8T0$ 408$0T 8 -LP !6 p-LM@P`  t(0lL0 P8 T`0X0 $8T4 00 \0pph!67!6 0-(0PL@ 7 0ES @4`4 44 L0"S 00 L0"S'p L0"S 8T0 $408$;T 80% .q0 -LyP  "6 p-LM@P`j  t(0lL0 P8 T`0X0 $8T4 00 \0pph "67"6 0-(0PL@ 7 0ES 04P444 L0"S 0$(0 L0"Sp L0"S 8T0 $408$;T 80% 0 -TP0 @0 ,0L8 T0$p4T08 $4,0 0,0T0`8$4 00 0,   00300 0 00000 00000000 000066 -LM@}$8T 088$T 1<8 -LP \"6 p-LM@P`  t7(0lL0 P8 T`0X0 $8T4 00 \0pph\"67P"6 0-(0PL@ 7 0ES t44@44 L0"S 0SW0 L0"Sp L0"S 8T0 $408$;T 80% $0 -LMTp@ 0`00,@8T0 $4T0P8 $4P,0 0,0T0$84 00 0,   00300 0 00000T08$ 400000000@000066 -LP "6 p-LM@P`  xs(0pL0 P8 T`00X0 $8T4 00 \0pph"67"6 0-(0PL@ 7 0ES 44T4 4 L0"S 00 L0"Sp L0"S 8T0 $408$;T 80% _0 -LMTp@ 0`00,@8T0 $4T0P8 $4P,0 0,0T0$84 00 0,   00300 0 00000T08$ 4 00000000 000066 p-LM 0`0@P 0?.AB"(0L0 P8 TP00X0T0 $840  \ \0 `0  ph8,ph$8T04`T77"67 0-(0PL@ 7 0ES 444T4 L0"S 00 L0"SCp L0"S 8T0 $408$;T 80% J0 -LP "6 p-LM@P`  $ 0?>C2@0( L 0P80T` 0h0X  $8T4 00 \0pph"67"6 0-(0PL@ 7 0ES 444\4 L0"S 0:>0 L0"Sp L0"S 8T0 $408$;T 80% 0 -LMTp@ 0`00,@8T0 $4T0P8 $4P,0 0,0T0$84 00 0,   00300 0 00000T08$ 400000000000066 -LM@@0 S 8T0$485T$8#8 88T0 $486T$8#8 88T0 $487T$8#8 88T0 $4 0 08$T 8 -LP @#6 p-LM@P`t  x(0pL0 P8 T`00X0 $8T4 00 \0pph@#674#6 0-0BPL@ S 4444 L0"S 004 L0"Sp L0"S 8T0 $408$;T 80%  -LMTp@ 0`00,@8T0 $4T0P8 $4P,0 0,0T0$84 00 0,   00300 000D 00000$8T0 4( 8T0 $48@T0$ 4@  0060 @  006000600600068$T0 4     -LP #6 p-LMP@`  $(0L0 P8 T`0 X0h 8T0 $4X   0\\0 pphL'㌌L' 0ㄌ#67#6 0-0BPL@ S 4(444 L0"S 0-1 L0"Sp L0"S 8T0 $408$;T 80% -LMTp@ 0`,@00 8T0$4 P8T0$4$08TP 4,0 0,0T0@8$4 00 0,   00300 0 00000 00000000 000066 -LP #6 p-LMP`@  N(0L0 P8 T@0 X0h T0 $840  \T0 8$4 0\ ; \ @0\ : \ \0 `0  php$8T04`#67#6 0-(0PL@ 7 0ES 44l4$4 L0"S 0HL0 L0"Sp L0"S 8T0 $408$;T 80% 0 -LMTp@ 0`,@00 8T0$4 P8T0$4T08 $ P4,0@0,0$8T0 4  00300 0 000000S$ S000 00 0, 00006 0006S00 000T0$84 00<000 - LN5 Ó0 ?0 0 qP 0007 p-LM`@PF0 R %( L 0P80TP0 0h X0( Rp ph, $8T4 00 \0pphꀒ7t`7 $6$67 -1`LQPp@V(0Q 0GS 4`4p44 L0"S GKL0,S 5 `8 T0$48@T0$ 4@@ d0h 0Sd0P0d@ p L0"S0%  t`7$67 -LMT0T`SPJ 000,8(!T0$4T0@8$!4p,00,00S ,0 00 yT0$8 4 0008T0 $4T0@8$ 4@ 000 00000000000066 Lt`7677,$67 -0LYP p-LMP@10X00 04 8`H`H0XXX00`xd@h0l0|@00@ ppho64 54 0-T0 SL@P XPၗ0  ȕT0S07 -@MLT ,0@(@mo0Sh`74؈7 -L`_P0PSXpX@T 9X@PT0 H 劕P0S 80@T@2foȒ7 p-LMP@00`X  0@0 P0ph 0-@ PLU y 0R0 0000\0 0 0hj0h0S` -LM@004 P 80 8 h80 8 h> p-LMP@ uo80 080TP PP`x80  0 80phSoA80 80 В77+6 0-80L P  080VHP @T H00H D < 0 8080 0-@L004004PP(400PPPP80 U 0400<PP80ⲿ7a7 -LM@x004400 -L 00 RQ400P -LM@ o  @ !!up -LM80@ H0 S( \ 8007 0-H@LTP 80  @TH@T 0 @T0 0S4 /0S80%L7d7 -P0LM@@\0  hޓh,8@B|74 -LLM` l@KP'nLG;p00 705KPp @T L0     @nnn p-LM`P@ m004@@E mp 0-LPM`@KPL 0$0 04K0 p-LLMdPK`@L L0L 0S<0#0H0 0( 4KPD0[#Sp0 p-LLMdPK@`L 80\0(0 04K ;(0 (04KH P 80 4[0p0 -LLMP `@m8    @TlKp rmL 0P0 +00 5K0 @_m\m- p-LLM@0PS@ Q S 0R d`KLh 0T4K0 (T;0H (0 7TP@@p@@p 0-0LS P* K @G00@ D@(0 -L M`F 1 0S ,2*@RP нP0@00TppWPd T@ 3T PX(P@,p P p, 0P0 P1p, Y0@S0PC⇽!TXPXP04P0P04P0T  0 Oo77ܓ777 -pL` 0<8P@Q UP-U@t(0 `" P Q @,h0T7O76`76 O7LO7M7l7 80R00  ( ,100 !0 $1(!(!46777 p-LM80@080 KP80  80080">P<80080p400 40 ` )PP @忼p Pp 屼ꔔ77 -L@%0P0P 坼000DPHp 0 P aP<0`V0 00`00  <0`V tؔ77 0-@0PSL  0u0S< Z0000L0 R 7` -LM0 S@0D0P0 -P@PLDp`@ Sku0 ! | Dk\0(,, V`FېV<TexM6 p-LM0 `S@DPpkA 0 !H phk p-L MH@`T PK0S# $ $0@ ۠ @Tp5D5 p-LM0`@@ PւP0 p00A7 -pQ0LD0P< P? 1@S  `aT0!T@L呻!T01STD0 aS 0S T {Q 0 S rQnl0T ebX 1@S  0!X0T|@HP1T 01ST DAꈃ668646T67L7L7e67L7L7 0-H@LT PP @T0WP -LTM␠p@ P@j `DV Hx` W0tK0^0LTPM ;tK80 405KXP "T0[`0x  j -LLM␐`@ pP jX0D0^H++LtKTP ;40 80 505KD XP @p W0U<0 80tK@080 @ i0040 -L M@0K @c @~[ -LM K [ 0K c m -L M0K Cc @[ -L M!K [0K!Cc @~ -L M0K C # @m -L M0K!C # @\ -@SL M`pP0@@ @HP@`F@P@V 0@; -@SL M`pP0@ A@'P@`F@P@V 0@ -LM"à -LLM␠`  iPtpKL< 080 05KX` @TPd T0V  ?cU<@0Y0T00ST0 0 h0' p-LM0@`DP h0 !  phh p-LM0@`DP h 0 ! phh -LM0`^p ) i@T#  iPUP# ߀ €  `Y0崀SP 0  0@JD400Nj p-LMP@00  Rp0 `R0000 0 R  -jph)j400Dt00 R0xSn p-LM` @PT   @PT400 ph p-LM80@080PK3 vP 8 0S8  080pp004P 4P`PQ OPp -LLM`plKLt100 05K<P' P%80PH@T @08T#X @PLK P3D0pSD@H0  cW@ H@T L 05K0,8P0 0 0S LK 000 @T0S *P X0$7 -80L0p`Pv@ Pv@?>11LcQ aR#^T@ R P6 @? R $0P00(@?>11LcQ aR#^T@5; 0 400@PDT 0Q 0 400?>11LcQ aR#^T@:#:Pp'@?>11LcQ aR#^T@003P0H@?>11LcQ aR#^T@00?>11LcQ aR#^T@ 0BSP rࠓ@U?>11LcQ aR#^T@0P06 @?>11LcQ aR#^T@:#:Pp'@?>11LcQ aR#^T@003P0H@?>11LcQ aR#^T@ʍ<7h7 -80L`Q Pp@?>11LcQ aR#^T@0P0`@?>11LcQ aR#^T@8#8P0X@?>11LcQ aR#^T@pPP@?>11LcQ aR#^t@P pH@?>11LcQ aR#^T@p P@@?>11LcQ aR#^t@ p8@?>11LcQ aR#^@0P 00@?>11LcQ aR#^T@0p0 @?>11LcQ aR#^t@ Pp @?>11Lc QR#a^T:@#:04!RD5D5 5 5 5P`@?>11LcQ aR#^T@4P0X@?>11LcQ aR#^T@pPP@?>11LcQ aR#^t@P pH@?>11LcQ aR#^T@p P@@?>11LcQ aR#^t@P p8@?>11LcQ aR#^T@p P0@?>11LcQ aR#^t@ p(@?>11LcQ aR#^@0P0 @?>11LcQ aR#^T@0P0@?>11LcQ aR#^T@40 P @?>11LcQ aR#^T@0VPp@?>11LcQ aR#^T@0P0`@?>11LcQ aR#^T@8#8P0X@?>11LcQ aR#^T@pPP@?>11LcQ aR#^t@P pH@?>11LcQ aR#^T@p P@@?>11LcQ aR#^t@P p8@?>11LcQ aR#^T@p P0@?>11LcQ aR#^t@0P p0 @?>11L cQaR#T^@P?ꔕ7 -`p@PL cT0S ` cCP -LLM␠P  c`tpKL8 080 X  )05KO@T` T0X  ?'cV<@0Y0T00ST0 0 hc05Ka0' p-LLMdPK`@Lw -R0 0c BSR48 R p-@P`x BRpR0 BRRR` `!  O- Y I* Xb$\(  O-`Q* @@ P@ @Pp$DL%T\ @pP$HH @ PpD%\TP ` RPbϮin4_cksum: out of mbufs p pgQMW@PФP``$($,Q@Qx       x         @Q@ Q x        Q0@cA@0  0  0  Q@A 0Q@Х@PP484<  0  )?) 0  )?)^18#811 d R R q000 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 2 R 2 R 2 R  2P00 R@A0P0A Rbs_notimpl_%s: args at %p-(O g@mmap@r_1@r_2@r_4@r_8@w_1@w_2@w_4@w_8@rm_1@rm_2@rm_4@rm_8@wm_1@wm_2@wm_4@wm_8@rr_1@rr_2@rr_4@rr_8@wr_1@wr_2@wr_4@wr_8@sm_1@sm_2@sm_4@sm_8@sr_1@sr_2@sr_4@sr_8@|c_1@yc_2@vc_4@sc_8`2-@@Pr?0RW` <=5=5$=50=5` B`p Bp` B`RE0C`R9`=5=5=5=5=5=5=5=5` B`p Bp` B`p Bp` B`p Bp` B` B`p @R B`p R BRR `x>5>5>5>5` B`p Bp` B`p RpPP2-B@P00O0RW` 4?5?5?5(?5` B`p Bp` B`RE0C`R9`?5x?5?5?5?5?5?5?5` B`p Bp` B`p Bp` B`p Bp` B` B`p`p@R B`p`pR BRR `p@5@5@5|@5` B`p Bp` B`p RpP2-D@P?O0RL` A5@5A5A5` B`p Bp` B`R:08`R/`A5dA5pA5|A5A5A5A5A5` B`p Bp` B`p Bp` B`p Bp` B` B@R BR BRR `0B5TB5HB5ZJJJJJJJJJJJJJJJJJJ }J xJ sJ nJ iJ dJ _J ZJ UJ PJKJFJAJ=Q:Q:Q:Q:Q:Q:Q}:Qx:Qs:Qn:Qi:Qd:Q_:QZ:QU:QP:QK:QF: QA: Q<: Q7: Q2: Q-: Q(: Q#: Q: Q: Q:Q:Q :Q:QA ? QA ? QA > QA > QA = QA = QA < QA < QA ; QA ; QA : QA : QA 9 QA 9 QA 8 QA 8 QA 7 QA 7 QA 6 QA 6 QA 5 QA 5 QA 4 QA 4 QA 3 QA 3 QA 2 QA 2 QA 1 QA 1 QA 0 QA 0 \aBC`B0QA 0 Q@-: R (2 R R -PPPP RrPP B PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R- RP1P P1P RrP1P  B P1P B  R010 1  B R0q0`0q0`0q0`\0q0`0q0`0q0` R 0\6 R B0-81, Ġ%̌T$\D#L0P  R0 Ġ01#̌  R R B0-81, Ƞ%ȌX$XH#H0P  R0 Ƞ01#Ȍ  R R B0-81, ̠%Č\$TL#D0P  R0 ̠01#Č  RLidHidN  0O   ! -- -i?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?Ѫ?????????????????????????????յݯ????  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~Uq&|&}&}&3$}&x&3$0&&7&3$&d n;0&AvQkkXaMq^h,`@yFgKrޔԘJk*OņךUfϊDx%K]?!HpcwucB0 mL5&/ᾢ5̈9.WUGz+2ўfD~T; ʌ)k<(yv;VdNtے lH]nCĨ917Ӌ2CYnڌdҜI%ϯʎGooJr\$8WsQ#|!>ݖa B|qؐ_jiX':'8+3"p3-"< IxPzY e1ƄÂ)wZ{m:,Pieee80211_node_attach  0  ^/  f  ^/  ^/ ^/ f ^/ ^/PP6666̂6؂66666 676 606G$6:67H86Zć6E\ȇ6:^P7V̇6wЇ6ԇ67؇6Kgpqrstuvwxyzo))))ccƄ||ww{{ kkֱooTőP00`gg}++Vb׵櫫MvvEʏ@ɉ}}YYGG 쭭AgԳ_꯯E#Srr[·uᮓ=j&&LZ66lA??~Õ\44hQ4qqsثS11b?* RǕe##F^Ý(07 / 6$=&i''NͲuu t,,X.4-6nnZZ[RRM;;vaַγ}{))R>q//^SShѹ,` @ȱy[[jjFˍپgK99rJJLLXXJυkл*媪OCCMMU33fEEPPD<KKܽa ppB>>|ĵqffHHaa_55jWWйiX':'8볘+3"iip٩3-"< I·UUx((PzߥY  ڿe1BBhhAA)w--Z˰{TTֻm:,ccƥ||ww{{ kkֽooޱőT00`PggΩ++V}׵bMvvʏEɉ@}}YYGG AԳg_Eꜜ#Srr[u=&&Lj66lZ??~ÃO44h\Q4qqثs11bS*? ǕR##FeÝ^0(7 / $6=&''Niuu ,,Xt4.6-nnܲZZ[RR;;vMַa}))R{>//^qSSѹh, @`y[[jjԾˍFg99rKJJLLXXυJлk*OCCMM33fUEEPP<!KKݽa܋ pp>>|Bqff̪HHaa£55j_WWiІX:''8+"3iiһ٩p3-<" ·IUU((PxߥzY e1BBhhиAAÙ)--Zw{TTm,:cƥc||ww{{ kֽkoޱoőT0`P0gΩg+V}+׵b׫MvvʏEʂɉ@}}YYGG AԳgԢ_Eꯜ#Srr[u·=&Lj&6lZ6?~A?̃O4h\4Q4qqثs1bS1*? ǕR#Fe#Ý^0(7 / $6=&'Ni'Ͳuu  ,Xt,4.6-nܲnZZ[RR;vM;ַaֳ}γ)R{)>/^q/SSѹh, @` yȱ[[jԾjˍF˾gپ9rK9JJLLXXυJлk*OCCMM3fU3EEPP!KKaܽ pp>|B>qĵf̪fHHa£a5j_5WWiйX:''8+"3iһi٩pَ3-<" ·IUU(Px(ߥzߌY  eڿ1BBhиhAA)-Zw-{˰TTmֻ,:ƥcc||ww{{ ֽkkޱooT`P00ΩggV}++bM櫫vvE@}}YYGG A쭭g_E꯯#Srr[u·=Lj&&lZ66~A??Oh\44Q4qqsbS11*? RFe##^0(7 / $6=&Ni''Ͳuu Xt,,4.6-ܲnnZZ[RRvM;;a}γR{))>^q//SSh,@` yȱ[[ԾjjFgپrK99JJLLXXJϻk*O媪CCMMfU33EEPPxD<<%K㨨QQ]@@?!pH88c߼wuBc!! 0mҁL &5/__5DD.9WU~~zG==Ȭdd]]2+ss``OODf""T~**; FF)kӸ(<y޼^^ v;dV22tN:: II Hl$$\\]½nCשּׁĦbb917yy2CnY77ڷmmd՜NNI੩شllVV%ʯeezzG鮮oպxxJo%%\r..8$WsǴQ#|tt>!KKaܽ pp|B>>qĵ̪ffHH£aaj_55WWiйX:''8+"3һiip3-<" IΪUUPx((zY  eڿ1BBиhhAA)Zw--{˰TTmֻ,:cccc||||wwww{{{{kkkkoooo0000gggg++++׫vvvvʂ}}}}YYYYGGGG𭭭Ԣrrrr&&&&6666????4444qqqq1111####''''uuuu ,,,,nnnnZZZZRRRR;;;;ֳ))))////SSSS [[[[jjjj˾9999JJJJLLLLXXXX着CCCCMMMM3333EEEEPPPP<<<>>>ffffHHHHaaaa5555WWWWiiiiَUUUU((((ߌ BBBBhhhhAAAA----TTTTPQSeA~ä^':k;EXKU0 mvv̈%LO*ŀD5&bIZg%E]u/LFk_zmYR-!tX)iIDɎjuxyk>Xq'Of ɴ:}Jc1`3QESbwdk+XhHpElޔ{R#sKrW*Uf(µ/{ņ7(0#j\+ϊyiNeվb4ъĝS.4U2u9 `@q^Qn!>=ݖ>FMT]qoP`$C@wgB谈8[yG |B| H+2pNrZlV8ծ='9-6d !\hT[:.6$g WҖO aiKwZ *C"< Nj򹨶-ȩWLuݙ`&r\;fD4~[v)C#hc1cB@" Ƅ}$J=2m)K/0R wl+pH"dGČ?,}V3"NI8ʌ6 Ԙρ(z&ڤ?:, xP_jbF~Tؐ^9.Â]|i-o%;ȧ}nc{; x&Yn쨚Oen~ϼ!ٛ6oJ |)11#?*0f57NtʂАا3JAP/MvMCTMўjL,QeF^]5st.A ZgRے3VGmaךz 7Y<'5ah,4$8_@r %⼋I<(A q9޳ ؐVda{p2t\lHBWЧQPeA~S^':k;EXK0 Umvv̈L%O*D5&bZI%gE]u/LFk_眒zmYRڃ-!tXiI)ɎDujyx>Xkq'Oᾶ f:}Jc13Q`SbEwdk+hHpXElޔ{Rs#KrWUf*(µ/{ņ7ӥ(0#j\ϊ+yiNe;b4ĊS.4U2u 9`@q^nQ!>ݖ=>ݮMFT]qoP`$֗C@̞gwB谽[8y |GB| +2HprZlN8Vծ=9-6' d\h!T[.6$:g WґO aKwZi *"4$8,@_r% I<( A9q ؜Vd{a2p\lHtWBQPA~Seä':^;kEXK0 Uvm̈v%LO*5&DbIZ%gE]/uLFk_mzRY-tX!I)iɎDujxyXk>'qᾶO f}:cJ1Q`3SbEdwk+HpXhEޔl{Rs#KrWUf*(/ņ{7ӥ(0#j\ϊ+yiNeվ4bĊ.4SU2u 9`@q^nQ!>ݖ=>ݮMFTq]oP`$֗@Cgw谽B8[y|G B| +2HpZlNrV8=-6'9 d\h![T6$:. gWҖOa wZiK *"$8,4_@r %<(I A9q ޳؜Vd{a2plHt\BWQP~SeAä:^';kEXK U0mvv%LO*&D5bIZ%gE]u/LFk_zmYR-X!tI)iDujxyk>X'qOf }:cJ1`3QbESwdk+pXhHElR{#srKWf*U(/µ{ӥ70(#j\+ϧyNieվb4Ċ4S.U2ኤu 9@`^qQn>!=ݮ>MF摵Tq]o`P$֗齉C@gwٰB8[yȡG ||B 2H+plNrZV8=ծ6'9- dh!\T[$:.6 g WҖOa ZiKw *h8,4$_@r %(I>>>KKKKyyyy xxxxZZZZݨ33331111YYYY''''____````QQQQJJJJ ----zzzzɜ;;;;MMMM****뻻<<<m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxqg jgrn<:ORQhك["(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDl؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHGɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~[Z H!x-ML.RN8D( `hz=Skc|j9{Б/Uڅ?AZX_f ؐ53eiEVmv° GJBnI[#Q")yq~ ruo7ӎbwO$26󦻬^lW%㽨:Y*F?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@0*G+@ +G+F+| +L++D++++LG+ +G+<+G+F++(+4+(+++(+LG+vmmapbsyBUSYWANTEDTABLEDCLEANCLEANCHKRELEASEDFAKERDONLY ZERO PAGER1FREEINACTIVEACTIVEENCRYPTPMAP0PMAP1PMAP2PMAP3(/4/#6C66C66C66`Q6 4^64^6 64^666 66666666 66p 66p 0 66p `(66p p066P 866P <66P @@66P PH66 P6T6\6T6P6`6\6`6H67@67h67p67x6767  X6O7X6O766@6666 66 66/67o660/67p 6:6 66 66 @66 `66 [66 66 66 66 66 066 @66 `66 66 66 66 666 66 6 6 606 6@ 6 6P$6 6`(6 6p,6 606 646 686 6<6 6@6 6D6 6L6P6X6P6 \6P60`6P6@d6P6P8@6P6`h6P6pl6P6p6P6t6P6x6P6|6P66P66P66P6 66 666666 66066@66P66666666666666666666 6666 66 66 (66eqnecsccmiplvsvchilsgeltgtlenvdaiadbibedeafdfalsllsrasrrorpmzsdep0.01.02.03.04.05.00.510.0////`#66666666666666 6666$6,646666666666 666<6D666666L6T6\666 66l6666x6666666666 66666666(6<6666666 66l6P6x6\6h6666666666 66l6x6666666666666 66l66666666666666 66l6P6x666\666666666 66666l66x6l66666666 66l6P6x66\6t6t6|6666666 6666666666666666 66VA865PVAL65VAX65VA65VA65 VA65pA65qA65qA65qA65qA65qA65rA65tA65tA65A65A65 A$65`A ,65A865`A @65`A L65`A L65PTX65A d65 A p65D |6T5D 65i 6Ե5 i 65 i 6T5 $i 650$i 65 ,i 650,i 65 .i 6Զ50.i 6Զ5!i 65 !i 65)i 65 )i 65-i 65Ai 65 -i 65Ai 6Է5Ai 6Է5Ai 6Է5,68646@6H6X6T6d6`6p6l6|6x666666666666666666 606@6P6`6p6666666a/6,c/6a/6,c/6c/6<6c/T6t6c/66c/66c/66c/46T6@````` ```P6p666666686T666p6666 6@6d6666666,6\6666$6X66 6 6 (6 d6666@6\66666(6 @6 X6 p6 6 6 6 6 6 6 6 $6 T6 |6 6 6 6  6 ,6 L6 l6 6 6 6 6 <6 X6 |6 6 666686L6d6|66666747 L7 \7 p7 7 777<7X7x7777 7(7<7\7t777777<7l77777(7X7t7777$7X77 777P7x77777(7D7X7t777777707T7l7 7 7 7 7  7 P 7 \ 7  7  7 7  7 , 7!P 7!t 7! 7" 7$ 7$ 7$P 7$P 7$ 7$( 7$D 7$X 7%x 7& 7& 7& 7& 7& 7&4 7&L 7&h 7& 7& 7& 7& 7&  7& H 7&l 7'6' 7' 7' 7' 7'7'(7(D7(|7)7)7)7)7) 7)87)d7)7*7*7*7*7*7*7*7*47+h7,7,7,7,7, 7,@7,`7,|7,7, 7, 7- 7.07/P70x7070707070070\707070 70 70 71$71<72T72x73747575757575<76`777878787879 7:,7:@7:d7:7:7;7;7;(7;P7;7;7;7;7;7; 7; 7; (7; D7; h7;7;7;7;7;7;7;(7;D7=l7>7>7>7>7> 7?87?d7?|7?7?7?7?7?7?47? P7? `7? 7? 7? 7?7?7?7? 7@07AP7Bx7C87D7E7F7G7G 7G,7G\7G7G7G7H7I07JH7K\7Kp7K7K7K7K7K7L7N(7PH7P\7Px7Q7Q7R7S7S 7S 7T< 7Ud 7U| 7U 7U 7U 7U 7U!7W8!7X\!7Yx!7Z!7Z!7Z!7Z!7["7[("7[@"7[X"7\t"7\"7\"7]"7]"7]#7]D#7]x#7]#7]#7]$7]P$7]$7]$7]$7] %7]P%7]%7]%7]%7] $&7]!\&7]"&7]#&7]$'7]%<'7]&p'7]''7]('7])(7]*D(7]+x(7],(7]0(7]1$)7]2`)7]3)7]4)7]5*7]6@*7]7|*7]8*7]9*7]:+7];T+7]<+7]@+7]A+7]B0,7]Cd,7]D,7]E,7]F,7]G0-7]H\-7]I-7]J-7]K-7]L.7]PL.7]Q.7]R.7]S.7]T /7]UT/7]V/7]W/7]X/7]Y07]ZL07][|07]\07]`07]a17]bT17]c17]d17]e17]f$27]g\27]h27]i27]j27]k$37]lT37]37^37^37^37^$47^H47^Ap47^B47^C47^E47^G47`57a 57a857aP57b`57c|57c57d57d57e67f67f467fX67f67g67g67g67g77g877gX77gx77g77g77g 77g 77h87i887iT87it87j87k87k87k87l87m97n897oX97o97o97o :7o<:7ot:7q:7r:7r:7r;7r@;7rx;7r;7s;7s;7s<7s <7s@<7sd<7s<7A7A7A7A7A746>7>746>7>7>7>7>746>7>746>7>746>7?746>7 ?74646?746?7(?7467?746?7?7?7?7?7?7?7?7?7?7?7@7@746@7$@7464@7<@746D@7H@746T@7\@746l@7\@746t@7|@746@7@746l@7@746l@7@746@7@746@7@746@7A746 A7 464646464646C74646464646464646464646464646464646464646$Q70Q7z680~9o:k;lL|=>@ApD FPQSTXY] 5 ["$&'X4gklrdK25<1<1܀1   !"#$%&'()*+,-./0000000000:;<=>?@00000000000000000000000000[\]^0`00000000000000000000000000{|}~00000000000000000000000000000000000000000000000000000000000000ABCDEFGHIJKLMNOPQRSTUVWXYZvt100C2D2(W2p2E2G2  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^%% $ $ $ $ $%% %%<%%$%4%,%%d"e"`"  " %" #!#%# # # # ""*#d"`"e"+"4"""""<"C"!!a"""")"*"'"(""!!!!#@[\]^_`{|}~@[\]^_`{|}~|^_`#@_^_`#_#^_`^_#@^_`~#@^_`~^_``#_888@ `P0pH(hX8xD$dT4t L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}C#cS3s K+k[;{G'gW7wO/o_?T222X2n7,n78n7Ln7Xn7`n7hn7tn7n7n7n7n7n7n7n7n7n7n7n7n7XBBp@m@m @m@m@ f(  pt""(4I@@@@1` #U3UCU4QFb '  w@          @     >@X@W@0@@ Q@ Q@c@c@d@eaQ@@^^^@@@<3$3 3 3t$333|3 3 3!3!3    (434353-3h23 33+3$,3.3L.3abcde f g h i jklmnopqrstuvwxyz1!2@ 3#!4$"5%#6^$7&%8*&9('0)( ) *!+ , --_.=+/[{0]}1\|2\|3;:4'"5`~6,<7.>8/?9:;<=>?@ABC D E FG HIJK,L!MN-OPQRS T/U*V-W+X Y1Z2[3\4]5^6_7`8a9b0c.etuvwx yz{|}~ mMqQ@zy2" 3#6&$7/{%8([&9)]'0=}-?\./0+*1#'2#'345 6,;7.:8-_d<>| .'`0+*~5^2"@ 3#!4$#6&$7/{%8([&9)]'0=}-+?.|/01'*2'*3456,;7.:8-_d<>\ .'`|0^~-+?\0345d<>| .'`|0^~.\0345|d<>.\`0^~q,?azw&12~ "3#!'4{"(5[#-6|$7`%_8\&9^'0@-)].=+}/0$1*2*3m4%56;.7:/8!d<> bBeE hH iI jJkKlL|,?nN~aArR,sSzZyY2 "3!'4"(5{[#6$7%!8&9%!8'0-)}].-_/0$*2`@#3mM4%5@#7:/\8=+g= aAkK~xX}iIpP& eE ,; c d tsrqQ'?ljbB|oOuUv.:yY{!\"12< 3>!(4[")5]#@6$+7%-8&/9'*0, _-=^.%`/z0w123n4m5$#6gG7h8fd/ 2" 3"5%#6&$7/%8(&9)'0=-'?.^/{[0+*}]123@4#5\|6,;7.:8-_d<> 1!2" 3!4$"5%#6^$7&%8*&9('0)--_.=+1#~2#~4'@5``d\|2"#6&$7'%8(&9)'0--=.^~/@`0[{1]}2]}3;+4:*5\_\|1!|2"@ 3#!4$~#6&$7/%8(&9)'0=-'?./[0+*]1}2}34{5\6,;7.:8-_d<> eE !1@-2_ /3#!;4$":5#,6^$.7&%=8*&[9(']0), -?+'.xX%/{0wW}1qQ|2qQ|34"5`~67fF8\ q,?azw&1|2@ "3#!'4"(5#6^$7%!8&9{'0}-).-_/[0$*]1`2`3m4%56;.7:/8=+~d<>\ xje.> u i d c htnbrl'"poygk,<qf;:-[{.]}//?0=+3s4-_6w7v8z9: ;<=>?@ABCD E aAbBcCdDeE fF gG hH iI jJkKlLmMnNoOpPqQrRsStTuUvVwWxXyYzZ#6^6,$7&7./[{0]}3;:4'"6,<7.>8/? aAbBcCdDeE fF gG hH iI jJkKlLmMnNoOpPqQrRsStTuUvVwWxXyYzZ#6^6,$7&7.--_.=+/[{0]}1\|2\|3;:4'"5`~6,<7.>8/? eEzy1+|2"@ 3*#!4#6&$7/%8(&9)'0=-'?./[0!]1$}2$}34{5 6,;7.:8-_d<>\ -'?.^`~0!]/[34{2"@ 3##6&$7/{%8([&9)]'0=}-'?.<>/+*012345\|6,;7.:8-_d<> .+*/2\|4qQ@1!2" 3##6&$7/%8(&9)'0=-'?\./0+*~1}]2}]34{[5|6,;7.:8-_d<> 1!2@ 3#!4$"5%#6.=+/0[{1]}2]}345'"8;:c.d\|/? IqQ@2' 3^#!4+$"5%#6&$7/{%8([&9)]'0=}-*?\.-_/0~1,;2,;34i5"678.:d<>| /1,;`2,;`3'aAcCeElLnNoOsSxXzZ bB{cC& fF[ gG] iI jJnN}qQ\vV@wW|xX#zZyY>1'~2" 3+^!4!"5%#6/$7=`%8(&9)'-./QP01qp2qp3$4506,?;7.:8-_*d< bB{ fF[ gG]kKlLmMnN}qQ\vV@wW|zZyY1!~2" 3#^!4$"5%#6&$7/`%8(&9)'0=-'?.+*/0123456,;7.:8-_d<> mMoOpP1!2"@ 3/!4$"5%#6?$7&%8*&9('0)--_.=+/[0']1<>}2<>}3;:~4{5#|\6,'7..8d /^^[0]4``{8aAcCeE gG iIkKlLnNoOsSuUzZ cCmMrRsSxXzZ1!2" 3#!4$"5%#6&$7_%8({&9)}'0'-/?\.'/0*|1<>2<>3+45@6,;7.:8-=d][ .~/"^4'`%5R5 r5]5R55I55J5R\575 (5 T5 d5 5K686@#B686868686 8686H@86 Nn5 _666\6 :6 R6 :6Eh6 6m 6K 6A6["6606 V 6f 6jt 6H 6?h 6n 6 607373<3=3|B3A3D3I3|I3J3(  v      W 1 Q `  O3@  0 2 A@ A   @  @ @   P0 P  A   h }  } } } @  85   O3  L+ L $P3L2 D   O  {P3o  A F  @@@ @ @AA@:F:FP 43W  !      @ @ @ @ A n@n n@n @nn@0Df @  Q k k"k"k"k"k @^z BF 9 |^3p^3b3c3 B  w W UP  <1b0 0{&"79n=F@W wn a- D|3|3܀3 3x3ԕ343ܘ3@ 'W W@ @EEE }WQ  k"BFFeeeZZ Z 0$3Ȯ3332V{%1" `"'`~%ZP `(3x33t3(33433hF F hF fF  x33(33433T4D4@@9WP P Q@url_int_miibus_readregurl_int_miibus_writereg:5g hahh! !(3P@3vK #(-2>'()*+,-./@ABCF'()*+,-./@ABCF'()*+,-./@ABCF/@ABCDEFGHIJKNMNO`abcdefghik*++,,--../-@@A&''(())**++,,-;4`;4?4@o4,6k7k7k7k7n7,n7Ln7Xn7`n7hn7tn7n7n7n7n7!A  !@@@@ԫ4447D4P4ԡ4707D7\4h4(4Q``7D4P4ԡ4|7273717p4|4ԡ4Ԍ75Ԍ7`444CP7CP7CP 7CP87CPP7CPh7CP |7CP 7CP!7CP$7CP"Ѝ7CP 7CP&7CP 7  7 87 P7 |7H44444ԡ4 7Ð7\4h44\444d7x744ԡ47444}7}ď7}؏744ԡ477744ԡ4987X44ԡ4`4l447Ԑ767!7(7307D72\744ԡ4n`|7@`7n`7n` 7̑744ԡ4!777(444ԡ407H7`744ԡ4urlphy_attachurlphy_serviceurlphy_statusOpenBSD4.5RAMDISK#225 @(#)OpenBSD 4.5 (RAMDISK) #225: Mon Mar 2 15:54:50 MST 2009 OpenBSD 4.5 (RAMDISK) #225: Mon Mar 2 15:54:50 MST 2009 deraadt@zaurus.openbsd.org:/usr/src/sys/arch/zaurus/compile/RAMDISK dackirqtargetlunsizeintrcontrollersocketfunctionchanneldriveconsolemuxconfigurationinterfacevendorproductreleasereportidphywsmuxloopbpfilterbiodrive at %s channel %d drive %dwdcspl%s channel %d: reset failed for drive 1 drive 0atapi type: %s c_bcount: %d c_skip: %d missing untimeoutwdc_probe_caps%s(%s:%d:%d): using PIO mode %d, Ultra-DMA mode %d, DMA mode %d using BIOS timings%s: transfer error, downgrading to PIO mode %d %s: transfer error, downgrading to DMA mode %d %s: transfer error, downgrading to Ultra-DMA mode %d wdccmd%s:%d: %s %s(%s:%d:%d): %s physio split wd ioctl request... cannot proceed user_strat: No ioctl IBSSwiLucent WaveLAN/IEEESony WaveLAN/IEEELucent Embedded WaveLAN/IEEEPRISM2 HFA3841(EVB2)PRISM2 HWB3763 rev.BPRISM2 HWB3163 rev.APRISM2 HWB3163 rev.BPRISM2 HFA3842(EVB3)PRISM1 HWB1153PRISM2 HWB3163 SST-flashPRISM2 HWB3163(EVB2) SST-flashPRISM2 HFA3842(EVAL)PRISM2.5 ISL3873PRISM2.5 USBPRISM2.5 ISL3874A(Mini-PCI)PRISM2.5 ISL3874A(PCI-bridge)PRISM3 ISL37300PPRISM3 ISL37300P(PCI)PRISM3 (USB): unable to read station address wi_attachaddress %sWaveLAN/IEEE node%s: received packet on invalid port (wi_status=0x%x) %s: received packet of unknown type on port 7 %s: oversized packet received (wi_dat_len=%d, wi_status=0x%x) %s: Error decrypting incoming packet. %s: oversized mgmt packet received in hostap mode (wi_dat_len=%d, wi_status=0x%x) wihap: failed to copy header %s: wi_cmd failed with %d %s: timeout in wi_cmd 0x%04x; event status 0x%04x %s: wi_cmd_io: busy bit won't clear %s: init failed %s: invalid data path: %x %s: failed to allocate %d bytes on NIC %s: unsupported crypto algorithm %d wiscan%s: wi_scan_timeout: %d tries %s: mgmt. buffer allocation failed %s: tx buffer allocation failed wi_do_hostencryptwi_do_hostdecrypt%s: wi_do_hostdecrypt: iv mismatch: 0x%02x%02x%02x%02x vs. 0x%x %s: wi_start: dropping unassoc dst %s %s: wi_start: xmit failed %s: host encrypt not implemented for 802.3 %s: wi_mgmt_xmit: xmit failed %s: device timeout Unknown PRISM2 chipSymbol %s: %s%s (0x%04x), Firmware %d.%d.%d (primary), %d.%d.%d (station), %s: Firmware %d.%02d variant %d, %s: %u (%d dBm) put_rateswihap_init: sc=%p whi=%p Sending disassoc to sta %s Sending deauth to sta %s wihap_shutdown: free(sta=%p) wihap_shutdown: sc=%p whi=%p wihap_timeout: disassoc due to inactivity: %s wihap_timeout: deauth due to inactivity: %s wihap_auth_req: station %s short request wihap_auth_req: returns status=0x%x wihap_auth_req: algorithm unsupported: 0x%x challenge: 0x%x 0x%x ... wihap_auth_req: new station wihap_auth_req: station %s algo=0x%x seq=0x%x wihap_assoc_reqwihap_assoc_req: bad ssid: '%.*s' != '%.*s' wihap_assoc_req: capinfo: not ESS: capinfo=0x%x wihap_assoc_req: returns status=0x%x wihap_assoc_req: already assoc'ed? wihap_assoc_req: polling not supported: capinfo=0x%x wihap_assoc_req: WEP flag mismatch: capinfo=0x%x wihap_assoc_req: rates mismatch. wihap_assoc_req: from station %s wihap_deauth_req: unknown station: %s wihap_disassoc_req: unknown station: %s wihap_data_input: no TODS src=%s, fctl=0x%x wihap_data_input: incorrect bss: %s wihap_data_input: dropping unassoc src %s wihap_ioctl: i shouldn't get other ioctls! wihap_ioctlwihap_mgmt_input: len=%d MGMT: unknown (stype=0x%x) assoc resp: assoc req: probe req: reassoc resp: reassoc req: ann traf ind beacon: deauth: auth: disassociation: probe resp: ftype=0x%x (ctl=0x%x) : where did the card go? ne2000_attach: setup failed ne2000_detect%s: remote transmit DMA failed to complete ne2000_write_mbuf: negative len%s: %d silo overflow%s, %d ibuf overflow%s comcomprmcomstartcomcninit: mapping failed: unknown uart %s: console : ns8250, no fifo : ns16450, no fifo : ns16550, no working fifo : ns16550a, %d byte fifo : st16650, no working fifo : st16650, %d byte fifo : ti16750, 64 byte fifo : st16c654, 64 byte fifo : pxa2x0, 32 byte fifo (SIR)comattach: bad fifo type%s: can't establish soft interrupt%s: probed fifo depth: %d bytes version %d.%d%s %s: unsupported OHCI revision ohci, legacy support%s: SMM does not respond, will reset %s: reset timeout %s: blocking intrs 0x%x %s: unrecoverable error, controller halted %s: resume detect %s: %u scheduling overruns ohci_add_done: addr 0x%08lx not foundohci_rem_ed: ED not foundohci_abort_xfer: not in process contextohciabohci_root_ctrl_startOHCI root hubohci_setintr: 0 interval %s: isoc TD alloc failed ohci_device_isoc_abort: early return rd%drdattach: device name too long WARNING: no memory for cfdata struct RAM diskfictitiousrd_idlebioioctlAll breakpoints used. Already set. Too many breakpoints. Not set. No breakpoints set Map Count Address %s%p %5d %-12sdb_commandCount missing Bad modifier Ambiguous No such command the kernel did not panic procscalloutmountsallbreaksextentsmallocobjectpanicpoolprocregistersuvmexpvnodewatchescrashhaltrebootpoweroffmachineexaminesearchwdeletebreakdwatchwatchstepcontinueuntilnextmatchtracecallshowboothelphangmandmesgddb> Bad function db_fncallArgument missing Too many arguments ELF[ %s symbol table has bad start address %p ] ELFbad magic[ %s ELF symbol table not valid: %s ] bad e_machine.strtab.symtabsymtab unaligned[ using %lu bytes of %s ELF symbol table ] symtab corrupteddb_examine= 0x%lx \%03o%-*ld%-*lo%-*s%-*lu%-*lx: db_print_cmd%*d%*o%*u%*xAddress missing Value missing Syntax error Symbol not found Divide by 0 Negative shift amount ^R String too long Bad escape Bad character Bad character in number End of stack trace. --db_more-- -%*lo-%#*lo-%*lu-%#*lu-%*lx-%#*lxFaulted in traceback, aborting... Starting stack trace... %-12s%s %sdb_show_regs+%s[after %6d] bsd[ no symbol table formats found ] No slots left for %s symbol tableUnable to find symbol table slot for %s.invalid symbol table name%s %s%s Sifting table %s: db_printsym [%s:%d]After %d instructions (%d loads, %d stores), Breakpoint at Stopped at RUN AT LEAST 'trace' AND 'ps' AND INCLUDE OUTPUT WHEN REPORTING THIS PANIC! DO NOT EVEN BOTHER REPORTING THIS WITHOUT INCLUDING THAT INFORMATION! radixmaxoffmaxwidthtabstopslineslogUnknown variable No value All watchpoints used. No map. Too many watchpoints. No watchpoints set Map Address Size %s%p %8lx %lx Unknown size %s = %s db_write_cmdNothing written. () Score: %lu/%lu db_hangman/mnt/etc/firmware/%s, address %s dp8390_initdp8390_start: no header mbuf%s: NIC memory corrupt - invalid packet length %d : failed to clear NIC buffer at offset %x - check configuration %s: device enable failed extract_entropyarc4_stirarc4random_buf_largerndrdRRIP without PX field? RRIP with incorrect flags?RRIP with incorrect NM flags? IEEE_P1282RRIP_1991AIEEE_1282SPcd9660_mountroot: can't setup bdevvp'scd9660root_deviceCD001%/@%/C%/Eisoinodefhtovp: directory crosses block boundary %d[off=%d/len=%d] fhtovp: bread error %d fhtovp: crosses block boundary %d fhtovp: lbn exceed volume space %d cd9660_strategy: spectag VT_ISOFS, isofs vnode elf32_load_fileOpenBSD#!/dev/fd/%dswapperfork initcfpendcannot mount rootcannot find root vnodepagedaemonfork pagedaemonreaperfork reapercleanerfork cleanerupdatefork updateaiodonedfork aiodoned/sbin/init/sbin/oinit/sbin/init.bak/dev/consolewarning: /dev/console does not exist warning: /dev/console error %d initexecinit: couldn't allocate argument spaceexec %s: error %d init: not found no initinitclocks: unable to register softclock intrfileplfdescpldup2: fdallocfdlockclosefkqueueplknoteplkqreadinit died (signal %d, exit %d)cpu_exit returnedwaitppwaitWARNING: thread `%s' (%d) exits with status %d unable to allocate kthread_qlockmgr: make up your mindlockmgr: not holding exclusive locklockmgr: non-zero exclusive countlockmgr: locking against myselflockmgr: draining against myselflockmgr: pid %d, not exclusive lock holder %d unlockinglockmgr: unknown locktype request %dmalloc(): allocation too large, type = %d, size = %lu malloc: allocation too largemalloc: out of space in kmem_map%d,No KMEMSTATS compiled in physiophysbuf%-16s %-8s %18p %s %5d %5d %5d %d %#10x %-12.12s %-16s COMMANDSTRUCT PROC *UAREA * PID %-10s %18s %18s %18s VMSPACE/VM_MAP PID %-16s %-8s %18s %s EMULWAIT-CHANNELWAIT-MSGFLAGSWAITPPIDPGRPUID PID %5s %5s %5s S %10s %-12s %-16s usage: show all procs [/a] [/n] [/w] /a == show process address info /n == show normal process info [default] /w == show process wait/emul info procinit: mallocprocplprocessplzombieplucredplpgrpplsessionplpcredplchgproccnt: procs < 0idlestopzombiedeadonprocADVLOCKCTTYNOCLDSTOPPPWAITPROFILSELECTSINTR SUGID SYSTEM TIMEOUT TRACED WAITEDWEXITEXECPWEUPCSSTEPSUGIDEXECNOCLDWAITNOZOMBIEINEXECSYSTRACECONTINUEDBIGLOCKTHREADIGNEXITRVSOFTDEPSTOPPEDPROC (%s) pid=%d stat=%s flags=%b pri=%u, usrpri=%u, nice=%d forw=%p, list=%p,%p user=%p, vmspace=%p estcpu=%u, cpticks=%d, pctcpu=%u.%u%, swtime=%u user=%llu, sys=%llu, intr=%llu mawn%c%5d %-10.10s %18p %18p %18p plimitplidle%dfork idlecpu_switchto returnedstunrsensor_task_unregister: unexpected state %dcoredump%s%s.core/var/crash/sigaplpauseissignal hashinit: bad cntsysctllksysctldlkkern_sysctl%s,%s%s(%d)sysctl_tc_choicedummyTimecounter "%s" frequency %lu Hz -- Insufficient hz, needs at least %u Time stepped from %ld.%09ld to %ld.%09ld sysctl_tc_hardwaredenied attempt to set clock forward to %ld denied attempt to set clock back %ld seconds nanosleep?%9d %2d/%-4d %8x %s ticks now: %d ticks wheel arg func syswqwqtasksunable to create system work queue threadwqdestroyunable to create thread for "%s" workq boredsmashed stack in %spreempt: cpu_preempt not yet implementedsetrunnable not configured unsupported >>> %s probe returned %d >>> probing for %s* mapply: no match function for '%s' device>>> %s probe won >>> no winning probe root device %s not configured %s at %s%s at rootconfig_make_softcconfig_make_softc: allocation for device softc failed%s%dconfig_make_softc: duplicate %sexpandcreatconfig_make_softc: %sing dev arrayconfig_make_softc: device name too long%s detached config_detach: forced detach of %s failed (%d)config_defer: can't defer config of a root deviceconfig_defer: can't allocate defer structure (default %s%s)can't figure root, hope your kernel is right setrootroot on %s%c swap on %s%d%c dump on %s%d%cnetboot%s%d%croot device (%s) not foundinvalid geometryno disk labelinvalid label, partition count > MAXPARTITIONSinvalid label, d_secpercyl == 0invalid label, d_secsize == 0invalid label, incorrect checksumdisk label I/O errordos partition I/O errorbounds_check_with_label %lld %lld writ%s%d%c: %s %sing fsbn %lld of %lld-%lld (%s%d bn %lld; cn %lld tn %lld sn %lld)%llddisk_attach: can't allocate storage for disklabeldisk_detach: disk_count < 0disk_unbusy: %s: dk_busy < 0 filesystem type %d not known.. assuming ffs dk_mountrootcannot read disk label, 0x%x/0x%x, error %dcannot open disk, 0x%x/0x%x, error %droot filesystem has size 0bufq_default_alloc: no memoryuse one of: exit %s[a-p]parsediskroot device (default %sswap devicefindblkmajorextentplextntextent_free: start 0x%lx, end 0x%lx extent_free: region not foundFLWANTEDWANTEDNOCOALESCEFIXEDextent `%s' (0x%lx - 0x%lx), flags=%b 0x%lx - 0x%lx extent_print: NULL extentklogphpoolpool_init: too much uptimepool_do_get: %s: page emptypool_put of NULLpool_do_put: %s: page header missing page %p, nmissing %d POOL %s: size %u, align %u, ioff %u, roflags 0x%08x alloc %p minitems %u, minpages %u, maxpages %u, npages %u itemsperpage %u, nitems %u, nout %u, hardlimit %u nget %lu, nfail %lu, nput %lu npagealloc %lu, npagefree %lu, hiwat %u, nidle %lu empty page list: full page list: partial-page list: no current page curpage %p FailReleasesPgreqPgrelNpageHiwatMinpgMaxpgIdleSizeRequests%-10s%4s%9s%5s%9s%6s%6s%6s%6s%6s%6s%5s db_show_all_pools %*u %*lu %*d %*s %*lu inf%-10s %18p %18p %-10s %18s %18s Allocatorusage: show all pools [/a] %s: pool(%p:%s): page inconsistency: page %p; at page head addr %p (p %p) pool(%p:%s): page inconsistency: page %p; item ordinal %d; addr %p (p %p) kernel %sassertion "%s" failed: file "%s", line %d%s: table is full panic: splassert: %s: want %d have %d spl assertion failure in %slogprikprintf%llx%llobug in kprintf: bad base0123456789ABCDEF(null)0123456789abcdefaddchangeddbdisableenablefindlistquittimezoneverbose--- more --- 0%o*UNKNOWN**FOUND*%3d free slot (for add) Unknown devno (max is %d) %3d at disable %s flags 0x%x ???%3d %s count %d (pseudo device) %s [] ? Unknown argument %3d can't change free slot change (y/n) ?%3d %s changed flags changed out of memory. already disabled Error unknown state %3d can't disable free slot %3d % already %3d can't enable free slot command args description [count] number of lines before more enter ddbdev add a device8|10|16 base on large numbersdevno|dev change devicesattr val|devno|dev disable devicesattr val|devno|dev enable devicesdevno|dev find devices this message list configuration leave UKC[attr [val]] show attributes (or devices with an attribute)[mins [dst]] set timezone/dst don't know toggle verbose bootingUnknown routine /%c/ Unknown attribute Unknown pseudo routine /%c/ Value missing for attribute %s ? Not same device type No more space for new devices. No device of this type exists. Clone Device (DevNo, 'q' or '?')Insert before Device (DevNo, 'q' or '?')Device not complete number or * is missing Argument expected Dev expected 8|10|16 expected DevNo or Dev expected Attr, DevNo or Dev expected timezone = %d, dst = %d Unknown command disautoconf verbose %sabled Unknown command, try help User Kernel Config UKC> Continuing... sys_ioctlselectpipelkpiperdpipewrpipeclpipeplttckoutqttwritettyrub: would panic c = %d, val = %d load: %d.%02d not a controlling terminal no foreground process group runningrunnableiowait cmd: %s %d [%s] %ld.%02ldu %ld.%02lds %d%% %ldk empty foreground process group putc: required clalloc b_to_q: required clalloc WARNING: mclpools limit reached; increase kern.maxclustersmbplmcl%dkunknown type of extension buffermbuf prepend length too bigm_copym0: null mbufm_copym0: m == NULL and not COPYALLm_copym0: off %d, len %dm_copydata: off %d < 0m_copydata: null mbuf in skipm_copydata: null mbufm_copydata: len %d < 0m_apply: len %d < 0m_apply: null mbuf in skipm_apply: null mbufm_apply: off %d < 0m == NULL in m_pulldown()unixsockplsoclose: NOFDREFsoaccept: !NOFDREFsbappendaddrsbappendcontrolsemi-panic: sbcompresssbdropsbcreatecontrol: message too large %d acceptuipc 1uipc 2uipc 4piusrrequnp_attachunp_bindunp_connect2unp_disconnectbremfree: lost tailbufplgetblkbiowaitbiodone alreadybufinit: can't reserve VM for buffersbuf_needvabuf_alloc_pagesbuf_alloc_pages: overlap buf: %p page: %pnchplvop_generic_revokealloperation %s not listed in %s. vfs_op_descsvfs_opv_init: bad operationvfs_opv_init: operation vector without default routine.nameilockfpllf_findoverlap: defaultrelookup: null namerelookup: lookup on dot-dotvnodesvfslockvgetvclean: deadlockvclean: cannot reclaimvclean: not cleanvgonemissing bdevvgonel: not cleanmissing aliaskinfo: vp changed WARNING: some file systems would not unmount retrying unmount of %s failed with error %d syncing disks... giving up done %d softdep vwakeup: neg numoutputvinvalbufvinvalbuf: flush failedvinvalbuf: dirty bufsvflushbufvflushbuf: not dirtybgetvp: not freebrelvp: NULLAGENEEDCOMMITASYNCBADBUSYCACHECALLDELWRI DONE EINTR ERRORINVALNOCACHEPHYSRAWREADWANTEDWRITEINPROGXXXDEFERREDSCANNEDPDAEMON vp %p lblkno 0x%llx blkno 0x%llx dev 0x%x proc %p error %d flags %b bufsize 0x%lx bcount 0x%lx resid 0x%lx sync 0x%x data %p saveaddr %p dep %p iodone %p dirty {off 0x%x end 0x%x} valid {off 0x%x end 0x%x} VNONVREGVDIRVBLKVCHRVLNKVSOCKVFIFOVBADNONUFSNFSMFSMSDOSFSPORTALPROCFSAFSISOFSADOSFSEXT2FSVFSXFSNTFSUDFtag %s(%d) type %s(%d) mount %p typedata %p data %p usecount %d writecount %ld holdcnt %ld numoutput %d clean bufs: bp %p dirty bufs: RDONLYSYNCHRONOUSNOEXECNOSUIDNODEVASYNCEXRDONLY EXPORTED DEFEXPORTED EXPORTANON EXKERB LOCALQUOTAROOTFSflags %b vnodecovered %p syncer %p data %p vfsconf: ops %p name "%s" num %d ref %d flags 0x%x statvfs cache: bsize %x iosize %x blocks %llu free %llu avail %lld files %llu ffiles %llu favail $lld f_fsidx {0x%x, 0x%x} owner %u ctime 0x%x syncwrites %llu asyncwrites = %llu syncreads %llu asyncreads = %llu fstype "%s" mnton "%s" mntfrom "%s" locked vnodes: %p %p, %pall vnodes: %p, %p,syncersyncer vnode sys_mountmount: lost mountunmount: dangling vnodesys_getfhsys_fhopensys_fhstatsys_fhstatfsvn_lockvop_islockedvop_lookupvop_createvop_mknodvop_openvop_closevop_accessvop_getattrvop_setattrvop_readvop_writevop_ioctlvop_pollvop_kqfiltervop_revokevop_fsyncvop_removevop_linkvop_renamevop_mkdirvop_rmdirvop_symlinkvop_readdirvop_readlinkvop_abortopvop_inactivevop_reclaimvop_lockvop_unlockvop_bmapvop_printvop_pathconfvop_advlockvop_reallocblksvop_strategyvop_bwritedead_read: lockdead_write: locktag VT_NON, dead vnode dead_badop calledchkvnlockspec_read typespec_write typespec_ioctlspec_fsyncspec_fsync: not dirtyspec_close: not specialtag VT_NON, dev %d, %d spec_badop calleddos2unixtime(): month value out of range (%ld) denodedeget(): pcbmap returned %d detrunc(): can't truncate root directory, clust %ld, offset %ld deextend: file too largeextendfile(): attempt to extend root directory extendfile: pcbmapmsdosfs_lookup. .. doscheckpath(): .. not a directory? RRaArrAamsdosfs: reducing max cluster to %d from %d due to FAT size msdosfs_sync: rofs mod dev %d, %d, %s msdosfs_createmsdosfs_write(): bad file typemsdosfs_renamemsdosfs_rename: lost to startdirmsdosfs_rename: lost from startdirmsdosfs_rename: updating .. in root directory?msdosfs_mkdirmsdosfs_readdirmsdosfs_strategy: spectag VT_MSDOSFS, startcluster %ld, dircluster %ld, diroffset %ld (LOCKED)bpf_detachd: descriptor not in listbpf: ifpromisc failedbpfbpfwritebpf_mcopybpfattachtoo many interfacesif_attachhead: mallocif_attach: mallocif_clone_listifioctlifconfif_getgroupif_getgroupmembersegressif_group_egress_buildifpromisc%s: can't handle af%d lo%dlooutput: no header mbufifmedia_add: can't malloc entryifmedia_set: no match for 0x%x/0x%x ifmedia_set failedrn_addmask: mask impossibly already in tree Mask for route not entered Non-unique normal route, mask not entered rn_addroute: t->rn_p is NULL%s %p at %p rn_delete: Orphaned Maskrn_delete: inconsistent dupedkey list rn_delete: couldn't find our annotation rn_delete: inconsistent normal annotation rn_delete: inconsistent annotation rn_init: radix functions require max_keylen be set rn_initrn_init 2next == NULLraw_usrreqrtentplroute_init rtable_addrtfreertfree: %p not freed (neg refs) rtfree 2ifafreertrequest deletertinit: wrong ifa (%p) was (%p) rtinitrttmrplrt_timer_init: already initializedrt_timer_queue_destroy: rtq_count reached 0 rt_timer_remove_all: rtq_count reached 0 rt_timer_add: rtq_count reached 0 rt_timer_timer: rtq_count reached 0 route_outputsysctl_dumpentryroutewlan%s: bad channel ignored; freq %u flags %x number %u %s: invalid channel freq %u flags %x %s: invalid channel (NULL) ieee80211_media_initUnexpected mode %uBad IBSS channel %u unexpected mode %uieee80211_prfieee80211_kdfPairwise key expansionieee80211_derive_ptkPMK Nameieee80211_pmkid_sha1ieee80211_pmkid_sha256ieee80211_eapol_key_micieee80211_eapol_key_check_micieee80211_eapol_key_encryptieee80211_eapol_key_decryptieee80211_bip_encapieee80211_bip_decapieee80211_ccmp_phase1ieee80211_ccmp_encryptieee80211_ccmp_decryptieee80211_tkip_decrypt%s: Michael MIC failureieee80211_wep_encryptieee80211_wep_decrypt%s: %sassociation failed (reason %d) for %s %s: received %s from %s rssi %d mode %s %s: station %s deauthenticated by peer (reason %d) %s: station %s disassociated by peer (reason %d) ieee80211_ioctl80211scan%s: tsft offset %s%llu %s: no memory for TIM bitmap! %s: no memory for AID bitmap! unable to setup inital BSS node%s: begin %s scan passive%s: creating ibss %s: end %s scan ieee80211_end_scanfreeing bss nodenot in ap mode, mode %uieee80211_ibss_merge%s: rates mismatch, BSSID %s %s: sync BSSID %s -> (from %s) %s: ieee80211_ibss_merge: bssid mismatch %s %s: my tsft %llu beacon tsft %llu %s: sync TSF with %s %s: failed to queue raw tx frame %s: sending %s to %s on channel %u mode %s null node%s: no node for dst %s, discard raw tx frame invalid integrity group cipher!invalid group data cipher!management frame too large: %u%s: station %s disassociate (reason %d) %s: station %s deauthenticate (reason %d) ieee80211_recv_4way_msg14-way%s: received msg %d/%d of the %s handshake from %s ieee80211_recv_4way_msg2ieee80211_recv_4way_msg3group keyEAPOL-Key frame too large: %u%s: sending msg %d/%d of the %s handshake to %s %s: sending EAPOL-Key request to %s .5 channel %d start %u%sMbshortlong protection enabled %s preamble %s slot time%s %s: bogus xmit rate %u setup assoc_reqassoc_respreassoc_reqreassoc_respprobe_reqprobe_respreserved#6reserved#7beaconatimdisassocdeauthactionaction_noackreserved#15INITSCANAUTHASSOCRUNauto11a11b11gturbo0x"%s: open authentication failed (reason %d) for %s newly%s: station %s %s authenticated (open) %s: no recent beacons from %s; rescanning associatedsynchronized%s: %s with %s ssid APL1APL1AAPL1_ETSICAPL1_FCCAAPL1WAPL2APL2CAPL2DAPL2_ETSICAPL2WAPL3APL3WAPL4APL4WAPL5APL5WAPLDAPLDEBUGETSI1ETSI1WETSI2ETSI2WETSI3ETSI3AETSI3W,ETSI4ETSI4CETSI4WETSI5ETSI5WETSI6ETSI6WETSIAETSIBETSICETSIEU1WFCC1FCC1AFCC1WFCC2FCC2CFCC2AFCC2WFCC3FCC3AFCCAFRANCEMKK1MKK1_FCCAMKK1AMKK1A1MKK1A2MKK1BMKK2MKK2AMKKANONEWOR01WWOR02WWOR0WWOR1WWOR2WWOR3WWOR4WWOR5_ETSICWOR9WWORAWWORLDaeamarauazbebgbhbnbobrbybzcacncocrcyczdodzegf2fifrgrgthkhnhrhuiliniqisj1j2j3j4j5jmjojpk2kpkrkwkzlbliltlvmamkmomxmyninlnzpaphpkprpyqarorusasgsisvtntttwuaukuyuzvnyezazwarp_rtrequest: bad gateway value arp_rtrequest: malloc failed arprequestarpresolve: %s: route without link local address arpresolve: %s: can't allocate llinfo arp: attempt to add entry for %s on %s by %s on %s in_arpinputarp: attempt to overwrite entry for %s on %s by %s on %s arp info overwritten for %s by %s on %s arp: attempt to overwrite permanent entry for %s by %s on %s duplicate IP address %s sent from ethernet address %s arp: ether address is broadcast for IP address %s! arptfreerevarprequestrevarp[NULL][ ifa_addr= ifa_dsta= ifa_mask= flags=0x%x, refcnt=%d, metric=%d la_rt=%p la_hold_head=%p, la_asked=0x%lx rtentry=%p flags=0x%x refcnt=%d use=%ld expire=%ld key= mask= gw= ifp=%p (%s) ifa=%p genmask= gwroute=%p llinfo=%p (NULL)Route tree for AF_INET (not initialized) in_controlinvalid argument to in_lifaddr_ioctlin_ifinitin_addmultiin_delmultiin_pcbinit: hashinit failedin_pcbinit: hashinit failed for lportinpcbplIPv6 pcb passed into in_pcbconnectinterneticmp_erroricmp lenicmp_reflecticmp_mtudisc_timeouticmp_mtudisc_timeout: bad route to timeouticmp_redirect_timeout: bad route to timeout%d.%d.%d.%dipqeplipqplaeshmac-sha1deflateip_initip_savecontrolip_outputip_setmoptionsrip_attachrip_detachrip_usrreqtcp_inputm_pulldown malfunctiontcp_pulloutofbandsynpltcp_outputtcp_output REXMTtcpcbpltcpqepltcp_inittcp_respondtcp_ctlinputtcp6_mtudisc_callbacktcp_set_iss_tsmtcp_timer_rexmttcp_usrreqtcp_identudp_inputudp6_ctlinputudp_usrreqipip_input: should never reach hereetherip_inputMD5FinalSHA1TransformSHA1FinalAES_CMAC_FinalHMAC_MD5_InitHMAC_MD5_FinalHMAC_SHA1_InitHMAC_SHA1_FinalHMAC_SHA256_InitHMAC_SHA256_Finalaes_key_unwrapfile system fulluid %u on %s: %s %s: write failed, file system is full ffs_realloccg: bad blocknodev = 0x%x, optim = %d, fs = %s ffs_realloccg: bad optimdev = 0x%x, bsize = %d, bprev = %lld, fs = %s ffs_realloccg: bad bprevmode = 0%o, inum = %d, fs = %s ffs_valloc: dup allocfree inode %s/%d had %lld blocks out of inodes %s: create/symlink failed, no inodes free ffs_clusteralloc: lost blockffs_nodealloccg: block not in mapcg = %d, irotor = %d, fs = %s ffs_nodealloccg: map corrupteddev = 0x%x, bsize = %d, size = %ld, fs = %s ffs_blkfree: bad sizebad block %lld, ino %u bad blockdev = 0x%x, block = %lld, fs = %s ffs_blkfree: freeing free fragffs_blkfree: freeing free blockdev = 0x%x, ino = %u, fs = %s ffs_freefile: range: dev = 0x%x, ino = %d, fs = %sffs_freefile: freeing free inodebno = %lld, fs = %s ffs_alloccg: block not in mapstart = %d, len = %d, fs = %s ffs_alloccg: map corruptedffs1_balloc: blk too bigCould not unwind indirect block, error %dffs_update: bad link cntffs_truncate: newspaceffs_indirtrunc: bad buffer sizesoftdep_flushfiles calledffs_mountroot: can't setup bdevvp's ffsWARNING: %s was not properly unmounted WARNING: R/W mount of %s denied. Filesystem is not clean - run fsck WARNING: soft updates isn't compiled in ffs_reload: dirty2ffs_reload: dirty1ffs_mountfs(): obsolete rotational table format, please use fsck_ffs(8) -c 1 ffs_statfsupdate: rofs modffsinodino1plffs_write: typeffs_write: nonsync dir writeffs_fsyncffs_fsync: not dirtyi_ffs_size too smallmangled entry%s: bad dir ino %d at offset %d: %s bad dirFirst bad Second bad ufs_direnter: newblkufs_direnter: compact1ufs_direnter: compact2checkpath: .. not a directory chown: lost quotaufs_linkufs_renameufs_rename: lost to startdirrename: EXDEVufs_rename: same fileufs_rename: lost dir entryufs_rename: lost from startdirufs_mkdirufs_readdir: lost in spaceufs_strategy: specufs_makeinodemode = 0%o, nlinks %d, inum = %d, fs = %s ext2fs_valloc: dup allocext2fs_nodealloccg: block not in mapcg = %d, ipref = %d, fs = %s ext2fs_nodealloccg: map corruptedbad block %d, ino %d dev = 0x%x, block = %d, fs = %s dev = 0x%x, ino = %d, fs = %s ifree: range: dev = 0x%x, ino = %d, fs = %sifree: freeing free inodeext2fs_mapsearch: block not in mapext2fs_alloccg: map corruptedext2fs_indirtrunc: bad buffer sizeext2fs_readdiri_size too smallrec_len is smaller than minimalrec_len % 4 != 0reclen is too small for name_lendirectory entry across blocksinode out of boundsbad directory entry: %s offset=%d, inode=%lu, rec_len=%d, name_len=%d ext2fs_dirbadentryext2fs_direnter: newblkext2fs_direnterext2fs_direnter: frag sizecheckpath%s: typeext2fs_write%s: nonsync dir writeext2inoplext2dinoplext2fs_mountroot: can't setup bdevvp'sext2fs%s: file system not clean; please fsck(8) ext2fs_reload: dirty2ext2fs_reload: dirty1ext2fs_statfsExt2 fs: unsupported first inode positionExt2 fs: unsupported optional feature ext2fs_rename: lost to startdirrename: linked directoryext2fs_rename: lost dir entryext2fs_rename: mangled dirext2fs_rename: lost from startdirext2fs_mkdir: blksizeamap_lookup: offset out of rangeamap_lookups: offset out of rangeamap_add: offset out of rangeamap_add: replacing null anonamap_add: slot in useamap_unadd: offset out of rangeamap_unadd: nothing thereamapplamap_wipeout: corrupt amapcownowpagecownowamap_cow_now: non-resident wired page in anon %pamap_splitref: split at zero offsetamap_splitref: map size check failedamap_pp_adjref: overshot targetamap_pp_adjref: negative reference countanonpluao_set_swslot: uobj = %p uao_set_swslot: attempt to set a slot on a NOSWAP objectuao_create: kernel object already allocateduao_create: hashinit swhash faileduao_create: malloc swslots faileduao_create: asked to enable swap on kernel objectuaoeltplaobjpluao_flush: strange, got an out of range flush (fixed) uao_flush: weird flagsuao_getuao_getpageudv_attachudv_detachudv_faultfltamapcopyanonget1anonget2flt_noram1flt_pmfail1flt_noram3flt_noram2flt_pmfail2flt_noram4flt_noram5fltagain2uvm_fault_unwire_locked: address not in mapscheduleruvm_init: page size not setuvm_km_init: could not reserve space for kerneluvm_km_suballoc: unable to allocate space in parent mapuvm_km_suballoc: submap allocation faileduvm_km_suballoc: unable to create submapuvm_km_pgremove_intrsafe: no pagekm_getwait2km_allockm_alloc1wuvm_km_alloc1: non-released pagevallocwaitkmthreadkmallocvmmaplkuvm_mapent_alloc: out of static map entries uvm_mapent_alloc: cannot allocate map entry# uvm_map() successful calls# uvm_map() back merges# uvm_map() missed forward# back merges skipped# map lookup calls# map lookup hint hitsvmspplvmmpeplvmmpekpluvm_map_clean: weird flagsfork: encountered a submap during fork (illegal)fork: non-copy_on_write map entry marked needs_copy (illegal)MAP %p: [0x%lx->0x%lx] #ent=%d, sz=%u, ref=%d, version=%u, flags=0x%x pmap=%p(resident=%d) - %p: 0x%lx->0x%lx: obj=%p/0x%llx, amap=%p/%d submap=%c, cow=%c, nc=%c, prot(max)=%d/%d, inh=%d, wc=%d, adv=%d OBJECT %p: locked=%d, pgops=%p, npages=%d, refs=%d PAGES : <%p,0x%llx> refs= PAGE %p: flags=%b, vers=%d, wire_count=%d, pa=0x%llx uobject=%p, uanon=%p, offset=0x%llx loan_count=%d [page ownership tracking disabled] >>> ANON DOES NOT POINT HERE <<< (%p) checking pageq list >>> PAGE NOT FOUND ON PAGEQ LIST! <<< page found on pageq list anon backpointer is OK checking object list >>> PAGE NOT FOUND ON OBJECT LIST! <<< page found on object list uvm_page_bootstrap: no memory pre-allocateduvm_page_init: lost %ld page(s) in init uvm_page_inituvm_setpagesize: page size not a power of twouvm_pageboot_alloc: out of virtual spaceuvm_pageboot_alloc: out of memoryuvm_pageboot_alloc: pmap_growkernel() faileduvm_page_physget: called _after_ bootstrapuvm_page_physget: out of memory!uvm_page_physload: page size not set!uvm_page_physload: start >= enduvm_page_physload: tried to add RAM after vm_mem_inituvm_page_physload: unable to load physical memory segment %d segments allocated, ignoring 0x%llx -> 0x%llx increase VM_PHYSSEG_MAX uvm_page_physload: bad free list %duvm_page_physrehash: WARNING: could not grow page hash table rehash: physical memory config [segs=%d of %d]: 0x%llx->0x%llx [0x%llx->0x%llx] STRATEGY = RANDOM number of buckets = %d uvm_pagealloc_strat: bad strat %dpagersegpagedaemon: deadlock detected! pgdaemon%s = %d Current UVM status: pagesize=%d (0x%x), pagemask=0x%x, pageshift=%d %d VM pages: %d active, %d inactive, %d wired, %d free min %d%% (%d) anon, %d%% (%d) vnode, %d%% (%d) vtext pages %d anon, %d vnode, %d vtext freemin=%d, free-target=%d, inactive-target=%d, wired-max=%d faults=%d, traps=%d, intrs=%d, ctxswitch=%d fpuswitch=%d softint=%d, syscalls=%d, swapins=%d, swapouts=%d, kmapent=%d fault counts: noram=%d, noanon=%d, pgwait=%d, pgrele=%d ok relocks(total)=%d(%d), anget(retries)=%d(%d), amapcopy=%d neighbor anon/obj pg=%d/%d, gets(lock/unlock)=%d/%d cases: anon=%d, anoncow=%d, obj=%d, prcopy=%d, przero=%d daemon and swap counts: woke=%d, revs=%d, scans=%d, obscans=%d, anscans=%d busy=%d, freed=%d, reactivate=%d, deactivate=%d pageouts=%d, pending=%d, nswget=%d nswapdev=%d, nanon=%d, nanonneeded=%d nfreeanon=%d swpages=%d, swpginuse=%d, swpgonly=%d paging=%d kernel pointers: objs(kern)=%p swplkuvm_swap_init: can't get vnode for swap deviceswapmapswp vnxswp vnduvm_swap_init: extent_create failedswapdrum_addsys_swapctlswapctl: copystrswapctl: miniroot copy failedswap0x%04xswap_on: miniroot larger than swap?Preserved %d pages of miniroot leaving %d pages of swap swap_on: unable to preserve minirootdisklabel regionswap_off: swapdev not in listswstrategy: vnode type 0x%xsw_reg_strategy: swap to sparse filewarning: resource shortage: %d pages of swap lost swapmount: no device swapmount: no device 2 swap_deviceswapmount: copystrsbrk: grow %ld failed, error = %d uvm_coredump: user process with submap?uvm_deallocate with null mapuvnsyncuvn_attachuvn_termuvm_vnp_terminate: io sync wanted bit setuvn_releasepg: kill flag set on referenced object!uvn_flush: obj=%p, offset=0x%llx. error during pageout. uvn_flush: WARNING: changes to page may be lost! uvn_flushuvn_cluster: offset out of rangeuvn_getuvn_getpageuvn_iosyncrd%d: fixed, %d blocks NULL pointer passed to ip_ecn_ingressNULL pointer passed to ip_ecn_egressNULL pointer passed to ip6_ecn_ingressNULL pointer passed to ip6_ecn_egressin6_pcbconnectin6_pcbnotifyin6_ifloop_requestADDDELETEin6_ifloop_request: %s operation failed for %s (errno=%d) in6_controlnd6_prelist_add succeeded but no prefix prefix ioctls are now invalidated. please use ifconfig. in6_update_ifain6_update_ifa: addmulti failed for %s on %s (errno=%d) in6_update_ifa: failed to remove a route to the old destination: %s in6_update_ifa: the prefix length of an existing (%s) address should not be changed in6_update_ifa: valid lifetime is 0 for %s in6_update_ifa: prefixlen should be 128 when dstaddr is specified in6_update_ifa: a destination can be specified for a p2p or a loopback IF only in6_purgeaddr: failed to remove a route to the p2p destination: %s on %s, errno=%d Couldn't unlink in6_ifaddr from in6_ifaddr in6_unlink_ifa: autoconf'ed address %p has no prefix invalid argument to in6_lifaddr_ioctlin6_savemkludge: no kludge spacein6_addmultiin6_delmultiin6_are_prefix_equal: invalid prefix length(%d) in6_prefixlen2mask: invalid prefix length(%d) in6_prefixlen2maskin6_ifawithscope: output interface is not specified get_rand_ifid%s: interface identifier generated by random number %s: ifid: %02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x %s: failed to get interface identifier %s: borrow interface identifier from %s %s: got interface identifier from %s %s: got interface identifier from itself in6_ifattach_linklocalin6_ifattach_linklocal: failed to configure a link-local address on %s (errno=%d) %s: no ifid available in6_ifattach_loopbackin6_ifattach_loopback: failed to configure the loopback address on %s (errno=%d) in6_nigroupin6_ifattach: %s has too small MTU, IPv6 not enabled in6_ifattachin6_ifattach: %s is not multicast capable, IPv6 not enabled in6_ifdetach%s: didn't unlink in6ifaddr from list in6_cksum: mbuf len (%d) < off+len (%d+%d)in6_cksum: out of datainternet6icmp6_mtudisc_callback_registerENOBUFS in icmp6_error %d icmp6_input: unknown type %d(src=%s, dst=%s, ifid=%d) ICMP6 checksum error(%d|%x) %s icmp6_notify_erroricmp6_notify_error: in6_embedscope failed icmp6_mtudisc_updateni6_inputicmp6_rip6_inputicmp6_reflecticmp6_reflect: source can't be determined: dst=%s, error=%d ../../../../netinet6/icmp6.csanity fail: off=%lx, sizeof(ip6)=%lx in %s:%d (src=%s dst=%s tgt=%s)icmp6_redirect_inputICMP6 redirect sent from %s rejected; must be from linklocal ICMP6 redirect sent from %s rejected; hlim=%d (must be 255) ICMP6 redirect rejected; no route with inet6 gateway found for redirect dst: %s ICMP6 redirect rejected; neither router case nor onlink case: %s icmp6_redirect_input: lladdrlen mismatch for %s (if %d, icmp6 packet %d): %s icmp6_redirect_input: invalid ND option, rejected: %s ICMP6 redirect rejected; redirect dst must be unicast: %s ICMP6 redirect rejected; not equal to gw-for-src=%s (must be same): %s ICMP6 redirect rejected; no route found for redirect dst: %s icmp6_redirect_outputicmp6_mtudisc_timeout: bad route to timeouticmp6_redirect_timeout: bad route to timeoutip6_initip6_input: packet to an unready address %s->%s ip6_savecontrolip6_nexthdrip6_nexthdr: m == NULLOpenBSD-currentcannot forward from %s to %s nxt %d received on %s cannot forward src %s, dst %s, nxt %d, rcvif %s, outif %s ip6_outputassumption failed: hdr not splitip6_ctloutputip6_getpcboptip6_setmoptionsnd6_init called more than once(ignored) nd6_setmtu0: new link MTU on %s (%lu) is too small for IPv6 ndopts == NULL in nd6_optionuninitialized ndopts in nd6_optionndopts == NULL in nd6_optionsduplicated ND6 option found (type=%d) too many loop in nd opt nd6_options: unsupported option %d - option ignored uninitialized ndopts in nd6_optionsln->ln_rt == NULLln->ln_rt->rt_ifp == NULLrt_llinfo(%p) is not equal to ln(%p)dst=0 in nd6_timer(ln=%p)nd6_lookupunspecnd6_lookup: failed to lookup %s (if = %s) nd6_freend6_rtrequestnd6_rtrequest: bad gateway value: %s %s: failed to join %s (errno=%d) nd6_rtrequest: malloc failed nd6_ioctla router(%s) advertises a prefix with non-link local address default router list contains a non-linklocal address(%s) ifp == NULL in nd6_cache_lladdrfrom == NULL in nd6_cache_lladdrnd6_output: can't allocate llinfo for %s (ln=%p, rt=%p) nd6_storelladdr: something odd happens nd6_storelladdr: sdl_alen == 0, dst=%s, if=%s scope error in prefix list (%s) nd6_ns_inputnd6_ns_input: src=%s nd6_ns_input: dst=%s nd6_ns_input: tgt=%s nd6_ns_input: invalid hlim (%d) from %s to %s on %s nd6_ns_input: bad DAD packet (wrong ip6 dst) nd6_ns_input: lladdrlen mismatch for %s (if %d, NS packet %d) nd6_ns_input: duplicate IP6 address %s nd6_ns_input: bad DAD packet (link-layer address option) nd6_ns_input: invalid ND option, ignored nd6_ns_input: bad NS target (multicast) nd6_ns_input: NS packet from non-neighbor nd6_ns_outputnd6_ns_output: source can't be determined: dst=%s, error=%d nd6_na_inputnd6_na_input: invalid hlim (%d) from %s to %s on %s nd6_na_input: duplicate IP6 address %s nd6_na_input: lladdrlen mismatch for %s (if %d, NA packet %d) nd6_na_input: ND packet from non-neighbor nd6_na_input: invalid ND option, ignored nd6_na_input: a solicited adv is multicasted nd6_na_input: invalid target address %s nd6_na_outputnd6_na_output: source can't be determined: dst=%s, error=%d %s: starting DAD for %s nd6_dad_start: memory allocation failed for %s(%s) ???nd6_dad_start: called with non-tentative address %s(%s) nd6_dad_start: ifa->ifa_ifp == NULLnd6_dad_timer: called with null parameter %s: DAD complete for %s - no duplicates found %s: could not run DAD, driver problem? nd6_dad_timer: called with non-tentative address %s(%s) nd6_dad_timer: called with duplicated address %s(%s) nd6_dad_timer: DAD structure not found nd6_dad_duplicated: DAD structure not found %s: DAD detected duplicate IPv6 address %s: NS in/out=%d/%d, NA in=%d %s: DAD complete for %s - duplicate found %s: manual intervention required nd6_dad_ns_input: ignoring DAD NS packet for address %s(%s) ifa == NULL in nd6_dad_ns_inputifa == NULL in nd6_dad_na_inputnd6_rs_inputnd6_rs_input: invalid hlim (%d) from %s to %s on %s nd6_rs_input: lladdrlen mismatch for %s (if %d, RS packet %d) nd6_rs_input: invalid ND option, ignored nd6_ra_inputnd6_ra_input: invalid hlim (%d) from %s to %s on %s nd6_ra_input: src %s is not link-local nd6_ra_input: lladdrlen mismatch for %s (if %d, RA packet %d) nd6_ra_input: bogus mtu mtu=%lu sent from %s; exceeds maxmtu %lu, ignoring nd6_ra_input: bogus mtu option mtu=%lu sent from %s, ignoring nd6_ra_input: invalid option len %d for prefix information option, ignored nd6_ra_input: invalid prefix len %d for prefix information option, ignored nd6_ra_input: invalid prefixlen %d for rfc2374 prefix %s, ignored nd6_ra_input: invalid prefix %s, ignored nd6_ra_input: invalid ND option, ignored defrouter_addreqdefrtrlist_del: negative count on %s defrouter_delreqdefrouter_select: called unexpectedly (forwarding=%d, accept_rtadv=%d) defrouter_select: more than one router is installed nd6_prelist_add: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_remove: negative count on %s prelist_remove: failed to make %s/%d offlink on %s, errno=%d prelist_update: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_update: nd6_prelist_add failed for %s/%d on %s errno=%d, returnpr=%p pfxlist_onlink_check: failed to make %s/%d offlink, errno=%d nd6_prefix_onlinknd6_prefix_onlink: failed to add route for a prefix (%s/%d) on %s, gw=%s, mask=%s, flags=%lx errno = %d nd6_prefix_onlink: failed to find any ifaddr to add route for a prefix(%s/%d) on %s nd6_prefix_onlink: %s/%d is already on-link nd6_prefix_offlinknd6_prefix_offlink: failed to recover a prefix %s/%d from %s to %s (errno = %d) nd6_prefix_offlink: failed to delete route: %s/%d on %s (errno = %d) nd6_prefix_offlink: %s/%d is already off-link in6_ifaddin6_ifadd: failed to make ifaddr %s on %s (errno=%d) in6_ifadd: wrong prefixlen for %s (prefix=%d ifid=%d) in6_init_prefix_ltimes: preferred lifetime(%d) is greater than valid lifetime(%d) rip6_inputrip6_outputrip6_attachrip6_usrreqrip6_detachudp6_outputcompat_43_sys_acceptcompat_43_sys_getpeernamecompat_43_sys_getsockname spsrr0r1r2r3r4r5r6r7r8r9r10r11r12usr_spusr_lrsvc_spsvc_lrpcund_spabt_spirq_spFaulted in DDB; continuing... address %p is invalid address 0x%08lx not a valid page framedb_fetch_reg: botchbranch_taken: botchscp=0x%08x rlv=0x%08x ( rsp=0x%08x rfp=0x%08xBad frame pointer: %p Bad user frame pointer: %p %sr%d=0x%08xtrace: pid %d at %p not found frame address = %08x frame address must be specified spsr=%08x r0 =%08x r1 =%08x r2 =%08x r3 =%08x r4 =%08x r5 =%08x r6 =%08x r7 =%08x r8 =%08x r9 =%08x r10=%08x r11=%08x r12=%08x r13=%08x r14=%08x r15=%08x slr=%08x mainbusmainbus_bs_alloc(): Help!mainbus_bs_free(): Help!cpu%s, #0x%03ximbimbrangeswiblxblmulSnmsmlaSnmsdumullSdnmssmullumlalsmlalstrtdaWldrtstrbtldrbtstrldrstrbldrbstmYnWlldmXnWlldrsbldrhstrhldrshswpdmoswpbmrsdpmsrpFmpF2bxclzdmbkptSdn2eorsubrsbadcsbcrsctstDn2teqcmpcmnorrmovSd2bicmvnadfPRfghmufsufrsfdvfrdfpowrpwrmffmlfdvfrdpolfpbopmvfPRfhmnfabsrndsqtlgnexpsincostanasnacsatnfpuopstfQLvldffltPRgdfixPRdhwfsrfswfcrfccmfPRghcnfcmfecnfemcr2#zmcrmrc2mrccdp2#ycdpldc2L#vldcstc2stcund%s %08x %s%s#0x%08xp%d_f%d#%s[r%d]cpsr[%c - unknown]%d, c%d, c%d, c%d, %dr%d, c%d, c%d, %d, rrx, %s r%d, %s #%d{r%d-r%d}^[r%d#0x%02xf%d, c%d, No support for this CPU type (%08x) in kernelcpu.branchpredictcpu.cachecpu.nocachexscale.branchpredictxscale.cachexscale.icachexscale.dcacheUndefined instruction in kernel WARNING: not updating battery clock Warning IRQ's disabled during boot() real mem = %u (%uMB) avail mem = %lu (%uMB) cpu_startup: no room for system tables; %d bytes requiredcpu_startup: system table size inconsistency_bus_dmamap_load_raw: not implemented_bus_dmamap_sync: mix PRE and POSTunknown buffer type %d _bus_dmamap_sync_bus_dmamap_sync: ARM32_BUFTYPE_INVALID_bus_dmamem_map: size botch%s: SA-110 with bugged STM^ instruction rev 0rev 1rev 2rev 3rev 4rev 5rev 6rev 7rev 8rev 9rev 10rev 11rev 12rev 13rev 14rev 15step Jstep Kstep Sstep Tstep Bstep Cstep Dstep Erev 10step Gstep A-0step B-0step B-1step B-2step B-3step B-4step B-5(IXP1200 step A)(IXP1200 step B)(IXP1200 step C)(IXP1200 step D)(IXP1240/1250 step A)(IXP1240 step B)(IXP1250 step B)step A-1step C-0step D-0step ?step C-5step 0ARM600ARM610ARM620ARM700ARM710ARM7500ARM710aARM7500FEARM710TARM720TARM740T (8 KB cache)ARM740T (4 KB cache)ARM810ARM920TARM922TARM926EJ-SARM940TARM946E-SARM966E-STI ARM925TARM1020EARM1022E-SSA-110SA-1100SA-1110IXP1200i80200i80321 400MHzi80321 600MHzi80219 400MHzi80219 600MHzPXA250PXA210PXA27xIXP425 533MHzIXP425 400MHzIXP425 266MHzunknownCPU_ARM2ARM2asCPU_ARM250CPU_ARM3CPU_ARM6CPU_ARM7CPU_ARM7TDMICPU_ARM8ARM9TDMIARM9E-SCPU_ARM9EARM9EJ-SARM10ECPU_ARM10SA-1CPU_SA110XScaleCPU_XSCALE_...wr-thruwr-back**unknown 3****unknown 4**wr-back-lockwr-back-lock-Awr-back-lock-B**unknown 8****unknown 9****unknown 10****unknown 11****unknown 12****unknown 13****unknown 14****unknown 15**%s: IDC disabled IDC enabled WB disabled WB enabled LABT EABT%s: %dKB/%dB %d-way %s unified cache %s: %s does not fully support this CPU. %s: This kernel does not fully support this CPU. %s: Recompile with "options %s" to correct this. %s: %dKB(%db/l,%dway) I-cache, %dKB(%db/l,%dway) %s D-cache branch prediction enabled DC disabled DC enabled IC disabled IC enabledunknown CPU (ID = 0x%x)%s %s (%s core)Processor failed probe - no CPU ID Vector ExceptionAlignment Fault 1Terminal ExceptionAlignment Fault 3External Linefetch Abort (S)Translation Fault (S)External Linefetch Abort (P)Translation Fault (P)External Non-Linefetch Abort (S)Domain Fault (S)External Non-Linefetch Abort (P)Domain Fault (P)External Translation Abort (L1)Permission Fault (S)External Translation Abort (L2)Permission Fault (P) uvm_fault(%p, %lx, %x, 0) -> %x UVM: pid %d (%s), uid %d killed: out of swap Non-emulated page fault with intr_depth > 0 data_abort_fault: Misaligned Kernel-mode Program Counter kerneluserFatal %s mode data abort: '%s' trapframe: %p FSR=%08x, FAR=r0 =%08x, r1 =%08x, r2 =%08x, r3 =%08x r4 =%08x, r5 =%08x, r6 =%08x, r7 =%08x r8 =%08x, r9 =%08x, r10=%08x, r11=%08x r12=%08x, usp=%08x, ulr=%08xssp=%08x, slr=%08x, pc =%08x Fatal abortInvalid, Fatal %s mode prefetch abort at 0x%08x trapframe: %p, spsr=%08x badaddr: invalid size (%lu)mmrwpmap_enter: no pv entriespmap_enter: failed to allocate L2 bucketpmap_init_l1: can't get PA of L1 at %ppmapplpvepll2dtblpll2ptpplpmap_bootstrap: WARNING! wrong cache mode for primary L1 @ 0x%lx pmap_bootstrap: WARNING! wrong cache mode for L2 pte @ %p pmap_bootstrap: No L2 for va 0x%x, pa 0x%lxpmap_bootstrap: out of static L2spmap_bootstrap: No L2 for L2 @ va %ppmap_alloc_specials: no l2b for 0x%lxCannot allocate L1 KVMCannot allocate L1 physical pagespmap_map_entry: no L2 table for VA 0x%08lxpmap_map_entry: can't find L2 table for VA 0x%08lxpmap_map_chunk: no L2 table for VA 0x%08lxpmap_map_chunk: can't find L2 table for VA0x%08lxpmap_map_chunk: no L1 table providedxscale_setup_minidata: can't find L2 table for VA 0x%08lxuser pmap (%p): pmap_kernel (%p): domain %d, l1 at %p %08lx: %c |0000 |8000 |10000 |18000 |20000 |28000 |30000 |38000 pa 0x%08lx: krw %d kro %d urw %d uro %d %c va 0x%08lx, flags 0x%x dumping to dev %u,%u offset %ld dumpsysdump device bad aborted from console i/o error device not ready succeeded area improper area unavailable dump to dev %u,%u not possible vmapbufvunmapbufThe operating system has halted. Please press any key to reboot. rebooting... reboot failed; spinning Attempting to power down... %08lx -> %08lx @ %08lx cpu not recognized! OpenBSD/zaurus booting ... initarm: Configuring system ... physmemory: %d pages at 0x%08lx -> 0x%08lx Allocating page tables freestart = 0x%08lx, free_pages = %d (0x%08x) initarm: Failed to align the kernel page directoryIRQ stack: p0x%08lx v0x%08lx ABT stack: p0x%08lx v0x%08lx UND stack: p0x%08lx v0x%08lx SVC stack: p0x%08lx v0x%08lx Creating L1 page table at 0x%08lx Mapping kernel Constructing L2 page tables freestart = 0x%08lx, free_pages = %d (0x%x) switching to new L1 page table @%#lx...bootstrap done. init subsystems: stacks vectors undefined page pmap initarm: out of memoryglassbootfile: %s bootargs: %s ffuartbtuartstuartunknown option `%c' attempting to switch console to lcd screen %sCheck Condition (error %#x) on opcode 0x%x AT BLOCK #: %d (decimal) SENSE KEY: %s off INFO: 0x%x (VALID flag %s) SKSV: %s FRU CODE: 0x%x ASC/ASCQ: %s COMMAND INFO: 0x%x %c Incorrect Length Indicator Set%c EOM Detected%c Filemark Detectedscxsplgetxscannot allocate scsi xs scsi_sizescsicmdscsi_execute_xs: invalid return code (%#x)unknown error category (0x%x) from scsi driver scbusyprobe%s(%s:%d:%d): No Additional SenseSoft ErrorNot ReadyMedia ErrorHardware ErrorIllegal RequestUnit AttentionWrite ProtectedBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare ErrorReservedNo Additional Sense InformationFilemark DetectedEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnCleaning RequestedErase Operation In ProgressLocate Operation In ProgressRewind Operation In ProgressSet Capacity Operation In ProgressVerify Operation In ProgressNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Not Ready, Rebuild In ProgressLogical Unit Not Ready, Recalculation In ProgressLogical Unit Not Ready, Operation In ProgressLogical Unit Not Ready, Long Write In ProgressLogical Unit Not Ready, Self-Test In ProgressLogical Unit Not Accessible, Asymmetric Access State TransitionLogical Unit Not Accessible, Target Port In Standby StateLogical Unit Not Accessible, Target Port In Unavailable StateLogical Unit Not Ready, Auxiliary Memory Not AccessibleLogical Unit Not Ready, Notify (Enable Spinup) RequiredLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorLogical Unit Communication CRC Error (ULTRA-DMA/32)Unreachable Copy TargetTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureHead Select FaultError Log OverflowWarningWarning - Specified Temperature ExceededWarning - Enclosure DegradedWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedWrite Error - Recommend ReassignmentCompression Check Miscompare ErrorData Expansion Occurred During CompressionBlock Not CompressibleWrite Error - Recovery NeededWrite Error - Recovery FailedWrite Error - Loss Of StreamingWrite Error - Padding Blocks AddedAuxiliary Memory Write ErrorWrite Error - Unexpected Unsolicited DataWrite Error - Not Enough Unsolicited DataError Detected By Third Party Temporary InitiatorThird Party Device FailureCopy Target Device Not ReachableIncorrect Copy Target Device TypeCopy Target Device Data UnderrunCopy Target Device Data OverrunInvalid Information UnitInformation Unit Too ShortInformation Unit Too LongID CRC Or ECC ErrorUnrecovered Read ErrorRead Retries ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block ReadNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite The DataDe-Compression CRC ErrorCannot Decompress Using Declared AlgorithmError Reading UPC/EAN NumberError Reading ISRC NumberRead Error - Loss Of StreamingAuxiliary Memory Read ErrorRead Error - Failed Retransmission RequestAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRecord Not Found - Recommend ReassignmentRecord Not Found - Data Auto-ReallocatedLocate Operation FailureRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorData Sync Error - Data RewrittenData Sync Error - Recommend RewriteData Sync Error - Data Auto-ReallocatedData Sync Error - Recommend ReassignmentRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data Without ECC - Data RewrittenRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With L-ECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteRecovered Data With ECC - Data RewrittenRecovered Data With LinkingDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationRecovered ID with ECCPartial Defect List TransferInvalid Command Operation CodeAccess Denied - Initiator Pending-EnrolledAccess Denied - No Access rightsAccess Denied - Invalid Mgmt ID KeyIllegal Command While In Write Capable StateObsoleteIllegal Command While In Explicit Address ModeIllegal Command While In Implicit Address ModeAccess Denied - Enrollment ConflictAccess Denied - Invalid LU IdentifierAccess Denied - Invalid Proxy TokenAccess Denied - ACL LUN ConflictLogical Block Address Out of RangeInvalid Element AddressInvalid Address For WriteIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBCDB Decryption ErrorSecurity Audit Value FrozenSecurity Working Key FrozenNonce Not UniqueNonce Timestamp Out Of RangeLogical Unit Not SupportedInvalid Field In Parameter ListParameter Not SupportedParameter Value InvalidThreshold Parameters Not SupportedInvalid Release Of Persistent ReservationData Decryption ErrorToo Many Target DescriptorsUnsupported Target Descriptor Type CodeToo Many Segment DescriptorsUnsupported Segment Descriptor Type CodeUnexpected Inexact SegmentInline Data Length ExceededInvalid Operation For Copy Source Or DestinationCopy Segment Granularity ViolationInvalid Parameter While Port Is EnabledHardware Write ProtectedLogical Unit Software Write ProtectedAssociated Write ProtectPersistent Write ProtectPermanent Write ProtectConditional Write ProtectNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedPower On, Reset, or Bus Device Reset OccurredPower On OccurredSCSI Bus Reset OccurredBus Device Reset Function OccurredDevice Internal ResetTransceiver Mode Changed to Single EndedTransceiver Mode Changed to LVDI_T Nexus Loss OccurredMode Parameters ChangedLog Parameters ChangedReservations PreemptedReservations ReleasedRegistrations PreemptedAsymmetric Access State ChangedImplicit Asymmetric Access State Transition FailedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedCurrent Program Area Is Not EmptyCurrent Program Area Is EmptyIllegal Power Condition RequestPersistent Prevent ConflictPrevious Busy StatusPrevious Task Set Full StatusPrevious Reservation Conflict StatusPartition Or Collection Contains User ObjectsOverwrite Error On Update In PlaceInsufficient Time For OperationCommands Cleared By Another InitiatorIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledCannot Write Medium - Unknown FormatCannot Write Medium - Incompatible FormatCannot Format Medium - Incompatible MediumCleaning FailureCannot Write - Application Code MismatchCurrent Session Not Fixated For AppendCleaning Request RejectedMedium Not FormattedMedium Format CorruptedFormat Command FailedNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorEnclosure FailureEnclosure Services FailureUnsupported Enclosure FunctionEnclosure Services UnavailableEnclosure Services Transfer FailureEnclosure Services Transfer RefusedRibbon, Ink, or Toner FailureRounded ParameterEvent Status NotificationESN - Power Management Class EventESN - Media Class EventESN - Device Busy Class EventSaving Parameters Not SupportedMedium Not PresentMedium Not Present - Tray ClosedMedium Not Present - Tray OpenMedium Not Present - LoadableMedium Not Present - Medium Auxiliary Memory AccessibleSequential Positioning ErrorTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyEnd Of Medium ReachedMedium Magazine Not AccessibleMedium Magazine RemovedMedium Magazine InsertedMedium Magazine LockedMedium Magazine UnlockedMechanical Positioning Or Changer ErrorInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetLogical Unit FailureTimeout On Logical UnitLogical Unit Failed Self-TestLogical Unit Unable To Update Self-Test LogTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has Changedcomponent Device AttachedDevice Identifier ChangedRedundancy Group Created Or ModifiedRedundancy Group DeletedSpare Created Or ModifiedSpare DeletedVolume Set Created Or ModifiedVolume Set DeletedVolume Set DeassignedVolume Set ReassignedReported LUNs Data Has ChangedEcho Buffer OverwrittenMedium LoadableMedium Auxiliary Memory AccessibleRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorData Phase CRC Error DetectedSCSI Parity Error Detected During ST Data PhaseInformation Unit iuCRC Error DetectedAsynchronous Information Protection Error DetectedProtocol Service CRC ErrorSome Commands Cleared By iSCSI Protocol EventInitiator Detected Error Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorInvalid Target Port Transfer Tag ReceivedToo Much Write DataACK/NAK TimeoutNAK ReceivedData Offset ErrorInitiator Response TimeoutLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureErase Failure - Incomplete Erase Operation DetectedCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedSCSI To Host System Interface FailureSystem Resource FailureSystem Buffer FullInsufficient Reservation ResourcesInsufficient ResourcesInsufficient Registration ResourcesInsufficient Access Control ResourcesAuxiliary Memory Out Of SpaceUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change InputOperator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedFailure Prediction Threshold ExceededMedia Failure Prediction Threshold ExceededLogical Unit Failure Prediction Threshold ExceededSpare Area Exhaustion Prediction Threshold ExceededHardware Impending Failure General Hard Drive FailureHardware Impending Failure Drive Error Rate Too HighHardware Impending Failure Data Error Rate Too HighHardware Impending Failure Seek Error Rate Too HighHardware Impending Failure Too Many Block ReassignsHardware Impending Failure Access Times Too HighHardware Impending Failure Start Unit Times Too HighHardware Impending Failure Channel ParametricsHardware Impending Failure Controller DetectedHardware Impending Failure Throughput PerformanceHardware Impending Failure Seek Time PerformanceHardware Impending Failure Spin-Up Retry CountHardware Impending Failure Drive Calibration Retry CountController Impending Failure General Hard Drive FailureController Impending Failure Drive Error Rate Too HighController Impending Failure Data Error Rate Too HighController Impending Failure Seek Error Rate Too HighController Impending Failure Too Many Block ReassignsController Impending Failure Access Times Too HighController Impending Failure Start Unit Times Too HighController Impending Failure Channel ParametricsController Impending Failure Controller DetectedController Impending Failure Throughput PerformanceController Impending Failure Seek Time PerformanceController Impending Failure Spin-Up Retry CountController Impending Failure Drive Calibration Retry CountData Channel Impending Failure General Hard Drive FailureData Channel Impending Failure Drive Error Rate Too HighData Channel Impending Failure Data Error Rate Too HighData Channel Impending Failure Seek Error Rate Too HighData Channel Impending Failure Too Many Block ReassignsData Channel Impending Failure Access Times Too HighData Channel Impending Failure Start Unit Times Too HighData Channel Impending Failure Channel ParametricsData Channel Impending Failure Controller DetectedData Channel Impending Failure Throughput PerformanceData Channel Impending Failure Seek Time PerformanceData Channel Impending Failure Spin-Up Retry CountData Channel Impending Failure Drive Calibration Retry CountServo Impending Failure General Hard Drive FailureServo Impending Failure Drive Error Rate Too HighServo Impending Failure Data Error Rate Too HighServo Impending Failure Seek Error Rate Too HighServo Impending Failure Too Many Block ReassignsServo Impending Failure Access Times Too HighServo Impending Failure Start Unit Times Too HighServo Impending Failure Channel ParametricsServo Impending Failure Controller DetectedServo Impending Failure Throughput PerformanceServo Impending Failure Seek Time PerformanceServo Impending Failure Spin-Up Retry CountServo Impending Failure Drive Calibration Retry CountSpindle Impending Failure General Hard Drive FailureSpindle Impending Failure Drive Error Rate Too HighSpindle Impending Failure Data Error Rate Too HighSpindle Impending Failure Seek Error Rate Too HighSpindle Impending Failure Too Many Block ReassignsSpindle Impending Failure Access Times Too HighSpindle Impending Failure Start Unit Times Too HighSpindle Impending Failure Channel ParametricsSpindle Impending Failure Controller DetectedSpindle Impending Failure Throughput PerformanceSpindle Impending Failure Seek Time PerformanceSpindle Impending Failure Spin-Up Retry CountSpindle Impending Failure Drive Calibration Retry CountFirmware Impending Failure General Hard Drive FailureFirmware Impending Failure Drive Error Rate Too HighFirmware Impending Failure Data Error Rate Too HighFirmware Impending Failure Seek Error Rate Too HighFirmware Impending Failure Too Many Block ReassignsFirmware Impending Failure Access Times Too HighFirmware Impending Failure Start Unit Times Too HighFirmware Impending Failure Channel ParametricsFirmware Impending Failure Controller DetectedFirmware Impending Failure Throughput PerformanceFirmware Impending Failure Seek Time PerformanceFirmware Impending Failure Spin-Up Retry CountFirmware Impending Failure Drive Calibration Retry CountFailure Prediction Threshold Exceeded (false)Low Power Condition OnIdle Condition Activated By TimerStandby Condition Activated By TimerIdle Condition Activated By CommandStandby Condition Activated By CommandPower State Change To ActivePower State Change To IdlePower State Change To StandbyPower State Change To SleepPower State Change To Device ControlLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackPacket Does Not Fit In Available SpaceIllegal Mode For This TrackInvalid Packet SizeVoltage FaultAutomatic Document Feeder Cover UpAutomatic Document Feeder Lift UpDocument Jam In Automatic Document FeederDocument Miss Feed Automatic In Document FeederConfiguration FailureConfiguration Of Incapable Logical Units FailedAdd Logical Unit FailedModification Of Logical Unit FailedExchange Of Logical Unit FailedRemove Of Logical Unit FailedAttachment Of Logical Unit FailedCreation Of Logical Unit FailedAssign Failure OccurredMultiply Assigned Logical UnitSet Target Port Groups Command FailedLogical Unit Not ConfiguredData Loss On Logical UnitMultiple Logical Unit FailuresParity/Data MismatchInformational, Refer To LogState Change Has OccurredRedundancy Level Got BetterRedundancy Level Got WorseRebuild Failure OccurredRecalculate Failure OccurredCommand To Logical Unit FailedCopy Protection Key Exchange Failure - Authentication FailureCopy Protection Key Exchange Failure - Key Not PresentCopy Protection Key Exchange Failure - Key Not EstablishedRead Of Scrambled Sector Without AuthenticationMedia Region Code Is Mismatched To Logical Unit RegionDrive Region Must Be Permanent/Region Reset Count ErrorDecompression Exception Long Algorithm IDSession Fixation ErrorSession Fixation Error Writing Lead-InSession Fixation Error Writing Lead-OutSession Fixation Error - Incomplete Track In SessionEmpty Or Partially Written Reserved TrackNo More Track Reservations AllowedCD Control ErrorPower Calibration Area Almost FullPower Calibration Area Is FullPower Calibration Area ErrorProgram Memory Area Update FailureProgram Memory Area Is FullRMA/PMA Is Almost FullDEFERRED CDBParametersError in %s, Offset %d, bit %dProgress Indicator: %dActual Retry Count: %dASC 0x%02x ASCQ 0x%02xDiagnostic Failure on Component 0x%02xDecompression Exception Short Algorithm ID OF 0x%02xTagged Overlapped Commands (0x%02x = TASK TAG)host adapter code inconsistency unknown error category (0x%x) from host adapter code User command with no ioctl User command with no buf scistrcmdlen too big physio split the request.. cannot proceed DEC RZ55 (C) DECEMULEX MD21/S2 ESDIA00IBMRAID 0662SIBM 0663HIBM0664H3171-S2KZ-CDFRSS2FQUANTUM ELS85S iomegajaz 1GBMICROP4421-07SEAGATEST150176LW0002HPC3725SDCASSONY SDT-5000 3.WangDAT Model 1300 02.4Model 2600 01.7Model 3200 02.2CR-2801TE1.07CREATIVECD3630EAC101FX320Sq01GCD-R580B1.00MATSHITA CR-5741.021.06Memorex CRW-26421.0gSANYO CRD-256PSANYO CRD-254PSANYO CRD-S54P1.08CD-ROM CDR-S11.70CD-ROM CDR-N161.25UJDCD87301.14scsibusscsibus at %s: %d targetsscsibusattach: can't allocate target links%s: unable to register bio scsibusattach: can't allocate lun links, initiator %dPLEXTORCD-ROM PX-40TS1.01MICROP 1588-15MBSUN0669vendor-unique targ %d lun %d: <%s, %s, %s> ATAPIremovablefixed %d/%s %s%sscsibusprintSCSI%ddirectsequentialprinterprocessorwormcdromscanneropticalchangercommunicationenclosure servicessimplified directscsibusprint: device type T_NODEVICE offlinescsibusprint: qualifier == SID_QUAL_BAD_LUscsibusprint: qualifier == SID_QUAL_RSVDscsi_probedevscsi_devidNEC CD-ROM DRIVE:260cd%s: WARNING: unable to establish power hook %s: not queued, error %d cdioctlATAPI CD-ROMSCSI CD-ROMdvd_authdvd_read_physicaldvd_read_copyrightdvd_read_bcasd%s: WARNING: unable to establish shutdown hook drive offline%lldMB, %lu bytes/sec, %lld sec totalsdstartsd_ioctl_inquiry(unknown)SCSI opticalSCSI disk%s %ssdgetdisklabel../../../../arch/arm/arm/softintr.csoftnet_intrhand != NULLsoftintr_establish: unknown soft IPL %dpxaippxaip_attach: failed to map CLKMAN: CPU clock = %d.%03d MHz pxaip_attach: failed to map RTCpxaip_attach_critical: failed to attach INTC!pxaip_attach_critical: failed to attach GPIO! addr 0x%lx intr %dpxa2x0_probe_sdram: impossibleWARNING: using filesystem date -- CHECK AND RESET THE DATE! pxa2x0_io_bs_alloc(): not implementedpxa2x0_io_bs_free(): not implementedpxaintc: Interrupt Controller stray interrupt %d intr_establish: bogus irq number %dintr_establish: can't malloc handler infocouldn't establish interruptirq %ldpxagpiopxagpio_reg_read: not bootstrappedpxagpio_reg_write: not bootstrapped: GPIO Controller %s: Can't map registers! pxa2x0_gpio_intr_establish: Pin %d not GPIO_IN%s: failed to hook main GPIO interrupt %s: unhandled GPIO interrupt. GPIO#%d pxa2x0_gpio_set_intr_level: bad level: %dpxaost%s: Cannot map registersclockpxaudc: cannot map mem space : USB Device Controller : unable to establish interrupt usbc: unable to establish connect interrupt pxaudc_read_epN: ep %d, no xfer fifo full when trying to set short packet ep%d: fifo error endpoint %d already used by %c%s: init failed, error=%d %s: cannot establish powerhook %s: unable to establish interrupt at irq %d: failed to map registers %d%s: Unknown depth (%d) apm%s: battery life expectancy %d%% %s: AC on,off,unknown, battery is undecoded (%x)highchargingCRITICALbackup power,%s: failed to create kernel thread, disabledapmevpxa2x0_apm_attach_sub: failed to map POWMAN apmlk%s: failed to map CLKMAN %s: failed to map MEMCTL %s: can't map GPIO pxa2x0_apm_sleep: can't map OST bogus new frequency 0 for rate %d maxclock %d manufacturer 0x%x%sproduct 0x%x function %d "pcmciapcmcia_card_attach%s: error %d detaching %s (function %d) (pcmcia_function_init: function is enabledpcmcia_function_enable: function not initialized@ %lx%s%lx%s%lx; iomask %lx, iospace %lx%s%lxunknown (%d)multi-functionserial portparallel portfixed diskvideo adapternetwork adapterauto incrementing mass storageSCSI bridgeSecurity servicesInstrumentSerial I/O Bus AdapterPCMCIA 1.0 PCMCIA 2.0 or 2.1 %s: CIS checksum failed %s: CIS version PC Card Standard %d.%d unknown (major=%d, minor=%d) %s: CIS info: %s: Manufacturer code 0x%x, product 0x%x %s: function %d: unspecified, ccr addr %lx mask %lx %s: function %d, config table entry %d: memory cardI/O cardcard type unknown; irq mask %x;%s: %d errors found while parsing CIS audio readonly powerdown irqlevel irqpulse irqshare io16 io8 bvd_active wp_active rdybsy_active mwait_required; maxtwins %d; memspacepcmcia_parse_cis_tupleSVECFD605 PCMCIA EtherNet CardV1-1%s: using CIS quirks for AmbiCom IncAMB8002TPMX PE-200DIGITALDEPCM-XXPCMCIAUE2212D-LinkDE-660DE-660+RPTI LTD.EP400CISV100RPTIEP401 Ethernet NE2000 CompatibleACCTONEN2212ETHERNETW89C926Seiko Epson Corp.P/N: EEN10B Rev. 00CNetCN40BC EthernetNE2000FastEthernetLNT-10TNNDC004743118001TAMARACKGVCNIC-2000pR01Ethernet CardiPort10/100 Ethernet CardFast-EthernetETHER-C16Fast EthernetPCMCIA LANCF10Base-EthernetLinksysEtherFast 10/100 Integrated PC Card (PCM100)Ver 1.0DE-650I-O DATAPCET/TX-RDFE-670TXDLINKSYSE-CARDPCLAcorega K.K.corega Ether PCC-Tcorega Ether PCC-TDcorega EtherII PCC-Tcorega EtherII PCC-TDcorega FastEther PCC-TXcoregaFEther PCC-TXFcorega FEther PCC-TXDSMC8041TX-10/100-PC-Card-V2XircomCompactCard EthernetCFE-10: no suitable config entry port 0x%lx/%d, %s: can't match ethernet vendor code : can't map ASIC I/O space : can't map NIC I/O space : function enable failed : can't get subregion for asic : unexpected I/O space configuration %s: can't map mem for enet addr %s: can't alloc mem for enet addr %s: can't alloc mem for LAN iobase %s: can't map mem for LAN iobase Digital Mobile Media CD-ROMPortable CD-ROM DriveNinjaATA-EXP PnPIDEF1SHUTTLE TECHNOLOGY LTD.PCCARD-IDE/ATAPI Adapter: can't handle card info port 0x%lx/%lu: %scan't allocate memory for command queue ,0x%lx/%lu: can't map second I/O space : can't map first I/O space %s: couldn't enable PCMCIA function %s: couldn't establish interrupt handler %s%s %s: couldn't establish interrupt : can't map io space : can't alloc i/o space Wireless LAN PCC-11Wireless LAN PCCA-11corega_K.K.Wireless_LAN_PCCB-11WL PCCL-11ISL37300PWLCFL-11INTERSILHFA384x/IEEEVersion 01.02SMC2632WNANOSPEEDNECWireless Card CMZ-RT-WPVersion 01.01NTT-ME11Mbps Wireless LAN PC CardAddtronAWP-100 Wireless PCMCIACabletronRoamAbout 802.11 DSIntersilPRISM 2_5 PCMCIA ADAPTEREval-RevASymbol TechnologiesLA4111 Spectrum24 Wireless LAN PC CardPLANEXGW-NS11H Wireless LAN PC CardD-Link CorporationD-Link DWL-650H 11Mbps WLAN AdapterAllied Telesis K.K.WR211PCM: %d slot%s pxapcicpxapcic_mem_map: bogus kind%s: unable to create event thread for %s pxapcicevpxapcicsspcic_attach_card: already attachedpxammc: can't map regs mmccd: MMC/SD/SDIO controller sdmmc%s: can't attach bus : can't establish MMC interrupt : can't establish card interrupt %s: unsupported bus frequency of %d KHz %s: data not a multiple of %d bytes mmcmdmmclklcdzkbd: unable to establish powerhook : PCMCIA/GPIO controller : failed to map %s Unable to establish %s powerhookwd0%s: failed to map memory %x for scoop%s: invalid CF slot %dscoop_pcic_read: bogus registerscoop_pcic_write: bogus registerscoop_pcic_set_power: bogus power statescoop_mmc_set_power: unsupported OCR (%#x) zssp: can't map bus space %s: can't establish power hook zssp_ic_send: invalid IC %d zssp_read_ads7846: not configured apm_acapm_bczts%s: enable failed wd: <%s> %s: %d-sector PIO, LBA, %lluMB, %llu sectors %s: freeze lock command didn't complete wdattach%s: enable write cache command didn't complete %s: enable look ahead command didn't complete CHS, %lluMB, %d cyl, %d head, %d sec, %llu sectors LBA48, %lluMB, %llu sectors %s: IDENTIFY failed __wdstart: bad return code from wdc_ata_bio()wddone%s: soft error (corrected) , retrying device faultdevice timeoutST506/MFM/RLLESDI/IDE diskwddumpwddump: try againwddump: device timed outwddump: unknown error typewddump: %swddump: drive faultwddump: DMA errorwddump: polled command has been queuedwd_get_params: bad return code from ata_get_paramsST506%s: flush cache command didn't complete %s: flush cache command: drive fault %s: flush cache command timeout wdc%s:%d:%d: not ready, st=0x%b, err=0x%02x BSYDRDYDWFDSCDRQCORRIDXERR%s:%d:%d: timeout waiting for DRQ, st=0x%b, err=0x%02x %s:%d:%d: bad state %d in _wdc_ata_bio_start _wdc_ata_bio_start: bad state%s:%d:%d: intr with DRQ (st=0x%b) %s:%d:%d: read intr before drq %s:%d:%d: device timeout, c_bcount=%d, c_skip%d %s:%d:%d: bad state %d in wdc_ata_bio_intr wdc_ata_bio_intr: bad statewdc_ata_ctrl_intr: state==RECALrecal%s:%d:%d: %s drive fault error (%x) %s:%d:%d: %s timed out piomodedmamodeno media/write protectedinterface CRC erroraddress mark not foundtrack 0 not foundaborted commandmedia change requestedid not foundmedia changeduncorrectable data errorbad block detectederror not notifiedwd0aboot device: lookup '%s' failed. boot device: %s raidwsdisplay%s: screen %d-%d added (%s, %s emulation) %s: screen %d deleted wsdisplay at %s mux %d: console (%s, %s emulation), using %sdmuxwsdisplay_common_attach: no memorywsdisplaytty() on ctl devicewsdisplay_switch2: giving up wsdisplay_switch2: screen %d disappeared wsdisplay_switch2: not switching wsdisplay_switch2: invalid screen %dwsdisplay_switch1: screen %d disappeared wsdisplay_switch1: not switching wsdisplay_switch1: invalid screen %dwswaitwsmoused_sleepwscons: copybuffer memory malloc failed wsevent_readwskbdwskbd at %s%s: attach error=%d : console keyboardcannot load keymapwskdetwskbd_detach: %s didn't detach %s: event queue overflow %s: connecting to %s %s: disconnecting from %s wskbd_get_mapentry: %d(%d): bad entrywskbd_load_keymap: %d(%d): bad entrywskbd_load_keymap: %d: recursion too deepwsmousewsmouse at %s attach error=%dwsmdetwsmouse_detach: %s didn't detach wsmux: attach out of memory wsmux_getmux: no memory for mux %d wsemul_vt100_output_c0c1: ESC in kernel output ignored \[>24;20;0cP0!u%5\wsemul_vt100_handle_csi[?62;6c[%d;%dR[?13n[?21n[?27;1nP2$u/wsemul_vt100_handle_dcs: bad type %d[11~[12~[13~[14~[15~[17~[18~[19~[20~[21~[23~[24~[25~[26~[28~[29~[31~[32~[33~[34~OPOQOROSOpOqOrOsOtOuOvOwOxOyOIOMOD[7~OBOCOA[8~[6~[3~[2~[5~[4~[1~OjOkOlOmOnOorasops_init: couldn't lock font rasops_init: font table is empty rasops_init: fontwidth assumptions botched!fontwidth not 8/12/16 or RASOPS_SMALL - fixme!wsfont_unlock: font not lockedpre 1.01.12.0usb: USB revision %s, not supported usb_attach%s: can't register softintr %s: root device is not a hub %s: root hub problem, error=%d usbtaskunable to create event thread for %sunable to create usb task threadusbevtconfigusbtskusb at %susbreausbreadusbd_add_dev_eventusbd_add_drv_eventusb_add_eventusb_detachusbdet%s: event thread didn't die usbpalockusbsynusbd_transfer: not doneusbd_start_next: error=%d usb_desc_iter_next: descriptor length = 0 usb_desc_iter_next: descriptor length too large usb_desc_iter_next: bad descriptor usb_detach_wait: %s didn't detach NORMAL_COMPLETIONIN_PROGRESSPENDING_REQUESTSNOT_STARTEDINVALNOMEMCANCELLEDBAD_ADDRESSIN_USENO_ADDRSET_ADDR_FAILEDNO_POWERTOO_DEEPIOERRORNOT_CONFIGUREDTIMEOUTSHORT_XFERSTALLEDINTERRUPTEDXXXvendor 0x%04xproduct 0x%04x%x.%02x"%s %s", class %d/%d rev addr %dusbd_devinfousbdly0 lengthout of datausbd_fill_iface_data: bad descriptor(s): %s iface descusbd_set_config_index%s: device addr %d (config %d) exceeds power budget, %d mA > %d mA %s: port %d, set config at addr %d failed %s: No free USB addresses, new device ignored. usbd_new_device: cannot find HS port configuration %d interface %d port %duhub%s: hub depth (%d) exceeded, hub ignored uhub_attach%s: bus powered hub connected to bus powered hub, ignored %s: no interface handle %s: no endpoint descriptor %s: bad interrupt endpoint %s: port %d power on failed, %s %s: cannot open interrupt pipe %s: no ports, hub ignored %s: port %d reset failed %s: device problem, disabling port %d %s: strange, connected port %d has no power %s: illegal enable change, port %d %s: port error, giving up port %d %s: port error, restarting port %d hid_start_parsedefault bType=%d Local bTag=%d Main bTag=%d Global bTag=%d BAD LENGTH %d , %d report id%s%s: no memory %s: no input interrupt endpoint %s: unexpected endpoint %s: could not read endpoint descriptor uhidev%s: no report descriptor %s: iclass %d/%duhid at %s reportid %duhidev_intr: bad repid %d uhidev_set_report_asyncuhidevwiuhid: input=%d, output=%d, feature=%d uhid_do_readuhidreauhid_do_ioctlukbd %s: attach failed, %s %s: was console keyboard too many modifier keysbad modifier sizemultiple key code arrays key codes not on byte boundarytoo many key codeskey code size != 8umassCBIBulk-OnlyRBC%s: using %s over %s %s: atapiscsi not configured %s: command protocol=0x%x not supported %s: bus attach failed %s: isdata not configured SCSIUFIISD-ATACBI with CCI%s: got polled xfer %p, but %p already pending %s: BBB bulk-%s stall clear failed, %s %s: Invalid CSW: sig 0x%08x should be 0x%08x %s: Invalid CSW: tag %d should be %d %s: Invalid CSW: status %d > %d %s: Phase Error, residue = %d %s: BBB reset failed, %s %s: BBB bulk-in clear stall failed, %s %s: BBB bulk-out clear stall failed, %s %s: transferred %d bytes instead of %d bytes%s: Unknown state %d%s: CBI bulk-in/out stall clear failed, %s %s: CBI intr-in stall clear failed, %s %s: CBI reset failed, %s %s: CBI bulk-in stall clear failed, %s %s: CBI bulk-out stall clear failed, %s umass_cmd: large datalen, %d %s: Unknown status %d in umass_scsi_cbaue%s: EEPROM read timed out %s: MII read timed out %s: reset failed %s: setting config no failed auemii%s: getting interface handle failed %s: missing endpoint %s: address %s %s: couldn't get endpoint descriptor %d %s: no memory for rx list -- packet dropped! %s: %u usb errors on intr: %s %s: %u usb errors on rx: %s %s: usb error on tx: %s %s: aue_send error=%s %s: tx list init failed %s: rx list init failed %s: open intr pipe failed: %s %s: open tx pipe failed: %s %s: open rx pipe failed: %s %s: watchdog timeout %s: close intr pipe failed: %s %s: abort intr pipe failed: %s %s: close tx pipe failed: %s %s: abort tx pipe failed: %s %s: close rx pipe failed: %s %s: abort rx pipe failed: %s axeaxe%d: read PHY failed axe%d: write PHY failed %s: media change failed axe_setmultiaxemii AX88172 AX88772 AX88178%s: couldn't get ep %d %s: usb errors on rx: %s axe%d: usb error on tx: %s axe%d: rx list init failed axe%d: open rx pipe failed: %s axe%d: open tx pipe failed: %s axe%d: tx list init failed axe%d: watchdog timeout axe%d: close intr pipe failed: %s axe%d: abort intr pipe failed: %s axe%d: close tx pipe failed: %s axe%d: abort tx pipe failed: %s axe%d: close rx pipe failed: %s axe%d: abort rx pipe failed: %s cue%s: read MAC address failed %s: cue_send error=%s kue%s: warm boot, no firmware download %s: failed loadfirmware of file %s: errno %d %s: cold boot, downloading firmware %s: failed to load trigger segment: %s %s: failed to load fixup segment: %s %s: failed to load code segment: %s %s: loading firmware failed %s: could not read Ethernet descriptor %s: no memory for multicast filter buffer %s: kue_send error=%s cdce%s: no data interface %s: could not find data bulk out %s: could not find data bulk in %s: no descriptor for bulk endpoint %d %s: interface alternate setting %d failed %s: no descriptor for interrupt endpoint %d extra ethernet descriptor %s: close interrupt pipe failed: %s %s: abort interrupt pipe failed: %s %s: open interrupt pipe failed: %s %s: too many errors, disabling %s: usb error on rx: %s udavudavmiiudav_setmulti%s: udav_send error=%s upl%s: upl_send error=%s urlurlmii%s: couldn't get endpoint %d %s: failed to get interface, err=%s %s: url_send error=%s %s: %s: bad register %04x wi_usb%s: open pipes failed %s: already detached %s:%s: invalid packet id sent %x invalid packet len: %x memsz %x max %x %s: %s: error=%s write_record buf size err %x %x wiTXsync%s: %s error=%s UGH RX UGH TX wi_usb: received USB_BUFAVAIL packet wi_usb: received USB_ERROR packet wiIDLwitxlwiusbthrural%s: could not set configuration no %s: could not get interface handle %s: MAC/BBP RT%04x (rev 0x%02x), RF %s, address %s %s: no endpoint descriptor for iface %d %s: could not allocate tx buffer %s: could not allocate tx xfer %s: could not allocate rx mbuf cluster %s: could not allocate rx mbuf %s: could not allocate rx buffer %s: could not allocate rx xfer %s: could not allocate beacon %s: could not transmit beacon %s: could not transmit buffer: %s ural_rxeofural_tx_data%s: could not allocate protection frame %s: could not read EEPROM: %s %s: could not read MAC register: %s %s: could not write MAC register: %s %s: could not write to BBP %s: could not read BBP %s: could not write to RF RT2522RT2523RT2524RT2525RT2525eRT2526RT5222%s: timeout waiting for BBP %s: could not allocate AMRR xfer %s: could not allocate Tx list %s: could not allocate Rx list %s: could not queue Rx transfer %s: could not open Rx pipe: %s %s: could not open Tx pipe: %s %s: timeout waiting for BBP/RF to wakeup %s: could not retrieve Tx statistics - cancelling automatic rate control usbf%s: can't establish softintr %s: usbf_new_device failed, %s %s: can't create task thread set config activated %s %s, rev %d.%02d/%d.%02dusbf_devinfo_allocusbf_allocmemusbf_start_next: %s cdcefOpenBSD.orgCDC Ethernet Emulation: usbf_add_config failed : usbf_add_interface failed : usbf_add_endpoint failed : usbf_add_config_desc failed : usbf_end_config failed : usbf_alloc_buffer failed : usbf_open_pipe failed : usbf_transfer failed : address %s cdcef_do_request %s: usbf_transfer failed encap error mii_attach: phyloc and offloc specifiedmii_activate: phyloc and offloc specifiedmii_activate: DVACT_ACTIVATE%s: config_activate(%d) failedmii_detach: phyloc and offloc specifiedOUI 0x%06x model 0x%04x rev %d at %s phy %dmii_phy_setmedia: MASTER on wrong mediamiiautnsphyDP83840 10/100 PHY: %s, rev. %d nsphyterDP83815 10/100 PHYDP83843 10/100 PHYDP83847 10/100 PHYqsphyQS6612 10/100 PHYinphyi82555 10/100 PHYi82562EM 10/100 PHYi82562ET 10/100 PHYi82562G 10/100 PHYiophyi82553 10/100 PHYeephy88E1000 1 Gigabit PHY88E1000 2 Gigabit PHY88E1000 3 Gigabit PHY88E1000 4 Gigabit PHY88E1000S Gigabit PHY88E1011 Gigabit PHY88E1111 Gigabit PHY88E1112 Gigabit PHY88E1116 Gigabit PHY88E1116R Gigabit PHY88E1118 Gigabit PHY88E1149 Gigabit PHY88E3016 10/100 PHY88E3082 10/100 PHY88E1000 5 Gigabit PHY88E1000 6 Gigabit PHY88E1000 7 Gigabit PHYexphyxl: 3Com internal media interface %s: ignoring this PHY, non-zero instance exphy_service: can't isolate 3Com PHYrlphyRTL8201L 10/100 PHYIP101 10/100 PHYrl: RTL internal PHY rlphy_service: attempt to isolate phylxtphyLXT970 10/100 PHYLXT971 10/100 PHYmtdphyMTD972 10/100 PHYicsphyICS1890 10/100 PHYICS1892 10/100 PHYICS1893 10/100 PHYsqphy80220 10/100 PHY80225 10/100 PHY84220 10/100 PHYtqphy78Q2120 10/100 PHYukphy: Generic IEEE 802.3u media interface, rev. %d: OUI 0x%06x, model 0x%04x %s: no media present bmtphy3C905B internal PHY3C905C internal PHYBCM4401 10/100baseTX PHYBCM5201 10/100 PHYBCM5214 Quad 10/100 PHYBCM5220 10/100 PHYBCM5221 100baseTX PHYBCM5222 Dual 10/100 PHYamphyAm79C873 10/100 PHYDM9101 10/100 PHYDM9102 10/100 PHYDM9601 10/100 PHYAm79C875 quad PHYacphyAC101 10/100 PHYAC101L 10/100 PHYAC_UNKNOWN 10/100 PHYnsgphyDP83861 10/100/1000 PHYDP83865 10/100/1000 PHYDP83891 10/100/1000 PHYurlphy: RTL internal phy %s: %s: enter down%s: %s: link %s mmcdiemmctsk%s: can't enable card %s: no functions %s: can't supply bus power %s: can't supply clock %s: can't identify card %s: mem init failed %s: i/o init failed mmcdlySpectecSDIO WLAN CardSDW-820%s: bad CIS ptr %#x %s: CISTPL_VERS_1 too short %s: bad CISTPL_FUNCID length %s: bad CISTPL_MANFID length %s: CIS parse error at %d, tuple code %#x, length %d %s: CIS version %d.%d wireless network adapter%s(%sat %s%s: can't supply voltage requested by card %s: can't send I/O OCR %s: can't set I/O RCA %s: can't select I/O RCA %d %s: can't read CIS %s: can't set mem RCA %s: unknown SD CSD structure version 0x%x %s: unknown MMC CSD structure version 0x%x %s: unknown MMC version %d %s: can't attach scsibus %s: can't allocate ccbs getccbsdmmc_scsi_cmdSD/MMC Drive #%02d%s: out of ccbs Hfd'(3 p@@ @ @ h[6%6$%6(%60%6e64%6<%6o7D%6P%6X%6d%6l%6t%6|%6p7%6%6%6%6%6%6%6  +-+'& !$%E " 0O`O`<88P`P`H8N8q`q`<8,8q`q`|828r`r`|828@r`Tr`H8N8\s`ps`T8R8s`s`T8R8s`s`t8R8t`x88R8t`x88R8t`x8d8R8t`t`T8R88u`8T8R8(w`w`|868 L}`D8|8:8`}``|8:8~` 8|8:8~`~`T8R8 `4`T8R8p``T8R8p``T8R8`0~`T8R8`~`T8R8``T8R8`lu`T8R8<`P`T8R8h`|`|8>8D`0`8B8``8&8``8V85`<8Z8 5\`<8b8 p`\`<8 8!5`<8 8!5`8J8/p5`8J8/6 `<8 8!L64`<8 8!6H`<8 8!6h`<8 8!6|`<8 8!6`<8 8!(6`<8 8!h6`<8 8!|6`<8 8!6 8<8 8!60`<8 8!D`X`<8F80t``<8f80``881``881``881`0`881D`X`881l``881``881``881``881 ` `8814`H`881\`p`881``881``881``881``881$`8`881L```881x``881``<8^8:%6%6%6Y7%672'&t7!hB!d   `   D (6B F I P TN N 9 Tj v 8p@8D9' dX@8@8@8@8@8}E#(D<8Q @X,dA8pA8xA8A8>8>8>8>8A84A8`A88A8/dev/null 2>&1; then echo "FAILED.\nYou must fsck ${ROOTDEV} manually." exit fi echo "OK." echo -n "Mounting root filesystem..." if ! mount -o ro /dev/$ROOTDEV /mnt; then echo "ERROR: can't mount root filesystem!" exit fi echo "done." for _file in fstab hosts myname; do if [ ! -f /mnt/etc/$_file ]; then echo "ERROR: no /mnt/etc/${_file}!" exit fi cp /mnt/etc/$_file /tmp/$_file done hostname $(stripcom /tmp/myname) THESETS="$THESETS site$VERSION-$(hostname -s).tgz" ask_yn "Enable network using configuration stored on root filesystem?" yes [[ $resp == y ]] && enable_network manual_net_cfg cat <<__EOT The fstab is configured as follows: $( is found, and the fstype is not nfs. Non-ffs filesystems will be mounted read-only. You can edit the fstab now, before it is used, but the edited fstab will only be used during the upgrade. It will not be copied back to disk. __EOT edit_tmp_file fstab munge_fstab check_fs if ! umount /mnt; then echo "ERROR: can't unmount previously mounted root!" exit fi mount_fs install_sets finish_up  . .. bin@ dev etc mntAmnt2JsbinJƢ tmpB usrvarinstbin.profile+ install.mdupgrade install  install.sub ARCH=zaurus md_installboot() { } md_prep_fdisk() { local _disk=$1 ask_yn "Do you want to use *all* of $_disk for OpenBSD?" if [[ $resp == y ]]; then echo -n "Putting all of $_disk into an active OpenBSD MBR partition (type 'A6')..." fdisk -e ${_disk} <<__EOT >/dev/null reinit update write quit __EOT echo "done." return fi cat <<__EOT You will now create a single MBR partition to contain your OpenBSD data. This partition must have an id of 'A6'; must *NOT* overlap other partitions; and must be marked as the only active partition. The 'manual' command describes all the fdisk commands in detail. $(fdisk ${_disk}) __EOT fdisk -e ${_disk} cat <<__EOT Here is the partition information you chose: $(fdisk ${_disk}) __EOT } md_prep_disklabel() { local _disk=$1 md_prep_fdisk $_disk cat <<__EOT You will now create an OpenBSD disklabel inside the OpenBSD MBR partition. The disklabel defines how OpenBSD splits up the MBR partition into OpenBSD partitions in which filesystems and swap space are created. The offsets used in the disklabel are ABSOLUTE, i.e. relative to the start of the disk, NOT the start of the OpenBSD MBR partition. __EOT disklabel -W $_disk >/dev/null 2>&1 disklabel -f /tmp/fstab.$_disk -E $_disk } md_congrats() { val=`ztsscale` case $? in 0) grep -v '^mouse\.scale.*$' /mnt/etc/wsconsctl.conf \ >/tmp/wsconsctl.conf echo $val " # see ztsscale(8)" >> /tmp/wsconsctl.conf cp /tmp/wsconsctl.conf /mnt/etc/wsconsctl.conf grep -v '^machdep\.ztsscale.*$' /mnt/etc/sysctl.conf \ >/tmp/sysctl.conf cp /tmp/sysctl.conf /mnt/etc/sysctl.conf ;; esac } md_consoleinfo() { local _u _d=com for _u in $(scan_dmesg "/^$_d\([0-9]\) .*/s//\1/p"); do if [[ $_d$_u == $CONSOLE || -z $CONSOLE ]]; then CDEV=$_d$_u CPROM=com$_u CTTY=tty0$_u return fi done } ELFa(d4"4 (00000,c,c88444OpenBSD -LP@0! MP@ -ؠ0 p `p0@SLP0 N/#P000 h0S 0P *0 0 0 R P: 00 p  0S S 0-``LM  0@S @1S@D0Q@Dt @Dt0D0 -880 0 LR@ 00SԐ$ -TLML 0S 8800(00lK2| -(( 0S 00  -LM`pQ 0S5/㒡p@PPPQ Q P Q088 8-Q  1 p-PLM@@P` ph 0-@L PP \gg] 0OSP8  (00SPg1x` -䢟䒟<LMP000ȂS09 xpP=v @T` 8K0  \ Xn TŸ8 / R<Ÿ8 0a 08 Z0000S0A  10S000 B ,g 10S0 S+ 10S 1!0!0Sx!p1  !h 7000D81810(10S0 `R PpU K00SRU!K0p( @0S 0S  0<{( @0S 0Sp K,d H( 04<l%  -LZ 00,d -LO0頠 -LG P00霠 -L<0<4 -0L000(,0, -0L00(d0d -Lp0鄠 -Lh0L -L.K 0-LMK Pfp@81 0P  R@ 0b0CS$ꄋ0D0E0J0AS00 0xS S *S 0S ", 0 $J0 J0  60 p-LM KP[ qr1 P PY 0b0CS5 8P`P$K4`P%%K5 `P*%F:`P!%O1 VU00 0xS S *S`P0E" $ VU " 0 0 (`J0 [Jp  60 0-x0LP h0   aAq 0A0q08@0P 0R0 : 0騠,d0 R0 ,d - L  J 63 - L J 63 - L J 63 - L J 63 -LMdS-\P-TW/P00s D@00Cs0 00Cs0c딚<4 -8rLP,20  c0P ,10S0q QP1000 A0! 1D0P0 1!900P00 t^OLQPa` \10S 0@SP4 $A0P 0{SP 0tSP5O0  Rp: P 0 0; S0`@%,"GO@0h0Q XMIPhu,<4 dL( 6Tdt̠ 0-LM@KyRP tN0: S\4 KP+P0000 0=pq%0S0000 6m @ 0-L1 R 1 0Su*Q  1Q   ZA )P 0!0  tN l0 0=80 0 0 0  P0    00 00000 0000 @0  W00 \D L000 N0 0 00(00霠(, 6d -0LM 0RE0RQ0R_ x00 l@ R R*T bQ jY00,00S h餠40(d -`1LMP``p@Q fP@  . E0S@ M0/T0V000 0T0 0 0 0S00+c 0pd  tHP@0 fR `!* 00 0RbW0 00d 6$ -pLuM0d yK,0 !t 1b1 P a!  B=9! = 1 >. CP@>0 Cr/ p`D*Pno JP PoOK 0!dPPA X R  x1 RtVOKd0`!A X  R ,1,R@Kd0!w?KAXv?K!00/C#b10 *# YC0 nD됀K p`0d wKPg뉁X @v?K n000 ,0SD,b.A?0̠ 4MbH -LMJ@NG@ -LG+ -0L0-P0 `@%,"0;p7q / 30p`0-  EP 0 pWp@0P`p 0S0C0XFT00  Z <  L0,L<4( 6 -L Mȡ00 `@%,"0;pbq`C 2[ 8c8d0 K00 , -)PQ4 `0pSI 0SF PQ4"`0 K03K,` )p  @0 pR' 0S$ 5e0`PP  l:L@0 pR<0 0S@0p R 0Sdm 6 -MLM2 P` p( 堤 h"nrp?@Y 4PDꌟTL\dlppppI.KL1 BH BbT(JK L@1*$Rp *0 PbUa=B^KPEPE@P 4 04 04 I>K0C 0CD $ 0t , JPۍ0-S  TE0HE <|K0$,wK㛾0Lb -L0B ㇾ -LM`PP( @(K,pK 0  (0@SKPAK -L M0@p00 0Si PP 0S nSZ =P0`0@Q P QLQJ  0V0P 1 0* Y0  0000V 0`0C00 ,K%, ?R0S@p @10"Sl 0EY000 LPH00D 0oSP D8Tlt -霣圃LxMP@`p#qpA P0@$S3ꔤĤĤĤĤĤĤĤĤĤĤĤĤĤĤĤĤĤĤĤĤĤĤĤĤĤĤĤĤĤĤ̤`p2`2`p222 R2l2|"0QAPc<2 R 82 RpK=P`,r 0Sp PP g `P? pKPΆPX0: S SK MPB1 R 0 5 |P) `^0SV pW P@UWp@T^ W p0 R  V% L  | Q_M_E:P!PI`L2_ty< DH6Lb 68\ -LMp Kz<@T` P P@ T^ 00 0-x0L0PS0@Q  P 0S(0 R00 R0H6Ԡ P-L` 0SCnS 0@ ,6P@Ol0PP@p` ,$Pp@0oS` GIԠH6 -蠟L0S 0 R0 R ; X @ Pp`0|S 0 PUNvP D0\.0 5Sn~LH6 p-L M `K P@0s  動p鉕pT -LM, P 0`5G"%$,0@"#!, 0`@"#!o -L 2 R\ ,@PK, `$0` W L  0 (P3  /P K0 P#P`K0 h?o/ M>P@ HL00嶔,o鱔 `P?@0 > `P?  @P0K0 =PPK@0 匔 `P?  @0 =|4P<`0E" $P@X(P0I" $?PP@K #"` "@ &, CY@ -0LMPpP`)0 R @;$0 %S 0 @-0 R 刊W@ $0@T^\ K$K8@@@S$00 $4LT -2L\MP, P"Ÿ8 8 @,;840  24 T`  0XP 0@ L P T0 X@ @D@ X` pPm/ @@K 8RpXWH T 4WQ*yOD0 0!W< 4PW9*kO 0 LW" 4W*\O 0P@PX ,H00@@K0T0 $勓0PXPUΌ0P X 4%P` P P P %P`|= pC0@Lb< L |d7\T X ` <_t         \ -PLMP P` @ pKO 80S@@ 00S00nH8 0-P@ 0LSP  0S0S0 h7 -LMMß KH`H , P@Ps #T@U h`P 0S@IPP K@ApA <0Az 3* 0QA:  埏:@W \HH2 ,0S ,D刏:@TOZp@R P. GG KA A qP:#4 2 R OKLFPP 㦱0Pb$($LbD$$ %% -L0. 㐱@% -LM`PP( @(K,pK 0  (0@STCJ> -L M0@p00 0Si PP 0S nSZ =P0`0@Q P QLQJ  0V0P 1 0* Y0  0000V 0`0L00 ,K., ?R0S@p @:0"Sl 08Y000 LPH00D 0oSP 88Tlt -L% -ML M.0~`P,0 .dp B0@3S񟗦@h Hdp0Lh= D>L?P :P$<0P  .< = =`LP l =4LHP D d=4<-$< < < < ; ;; ; ;;,; ;;,;;,;;,x;t; d; \;vX; H;D; x4; ,;e(;,n;q; g;j;+`:c: `b0FSQ0:M>KQ0C0C ` p  I~KpGpG0@P@ $p<Y0S 4: S L QMKHHؙ@ $ GPz9艟@9Tx9D 9^ P\ R$ U9 PT ^ \ R U$0 ܤ0J   X3Z H0380S5 0S  8 R 8 R8 R % 5 Sl8 x8 Rp8 R U Ue  H8 Rk i e V80|[6 X00R00S7 P 0@ ,P 10135:3P SD h7 R 0B$ 70S4 l7 R R0$ 70S4 ,7 R 7 Rl$ 60S4 60S4 6 0 S4 0  Se4%S04 RPؔ6Y> AD Д0AP(  C6X@JP CdV000TU 3 5#:(P8 C0CV00X@6h1h ? C6``U 0#5 %* % U UU 4S X0 4  \ P  @Cؔ  YRJ^   C$X T \% P ؔ PY, <U U%1 ATE Uc ccCXe 00S.K,5 \px \ IC6<0S@#/Q 0SKoP\0@  TS,50P5 P  P$L%  QL #%*LUdUP4 射 05 0@R8 Q5.8 q0nJ  0 % RP L 5S3 p0# U Ugg Ug gg CL\0@.L   %8b BL5`J 0P@V`!LUU: X X V ^ ^42 v Pb 2Pb`$"#00C4 O4R 00UV `P4SQ004 e$ V04 0S03$ 54 5 X4 $4 $ t<Qp ,0 S ,儭0Lb<P'''''' $((( $(,,'0&40(8XD(<T(@\&Dd(Hx(L 6(((<*)()L)x)))* *D*h*Ȇ%d&&LTX\dhltxTgfff8&@&H&4<|T&&&&& '8'D'NK@K`NK4@@4 | =P  4$S440 $ 5    ^ % Ue0Vf*0U U00R00SU $0R eVU:PU L U0#03RQ $p ܤ P%0S^  Pd \0#03\030"S3  `QAP,<"(PK0d1P ^ U * X  PQ ܤ .Rp 4P  5$ UP2Q 4( Td0 25P%$P ܤ0 0 P B24P%40P$(3R ^3  X4LS \ R 0\J>Kܤ0C@R0 00aAU0!|rP!d0B!U0PBBBB@B`BBpB0BPBBBB|4(KM.KP B4`( Kp$(0K4(K4(K-K0 B$<5 (K 4@% 0K.KD5 4 B#4 `5 4H% $D PT"$`lK``V! ` pK  0Xp6BNKx6Q%̠%4%(@D@D0 P5&s 0S66TQ$0 N0o00  e T 6BܤU0 U 0A AH7(KJ.KP BX7(K`'(0K$"$d% $$PT0!l |! D! `0 @ p lKd`V,Ġ@ `000 q%0$C]  0&> 40Q7V>d8 \ \ʠ 51 V:%V#MU8'L40S@.cc?T5h ?P0!01S03,S345)*Q$H9U! $UT  h9Q eVPR 9U  T 9R UP9R R/5 !PBNK@D@D*5 P p  e :Pa4: S ܤEnK`F `F @P0   %a1`\d4S: 8j\d4S0 P$Z44 D D zc -LM@(K)P`5  WPpp0W0* R00S 0rS`Fv (P@ >P@Z`F (00T P P (0v>(0 6(0 00* * -PL`p@~PDP @T:T @2 0:* -LPgM/, `勅PBp  Q q00  R P\ 8Ÿ q00  RP 0`SpSapCP 0S.S  000Y00S ,0S 0S 0S $0S5MK  pI w8pW0SH00Y00S(0 0(0,0S0,00S' 0S $0S ?P $0 ?c02 $00 ,0S ,K0 {$, u (l oX rP@ <4200*edA*A+$(x('$+<+L+ -LMp[Q5Q/RQ& K,Q0S hN4 0><`8|@|PP3h1<Q@,L)D&<#4 +++++H++++,, Q-0L $ Q*  /,$, -LM`@pw $KJPw0S0S 0 /$0 UR#U4, p-LM`PU@ T<PP UTUpT@,- 0\ \8 0000ӑS^ 0 ^0؏ Br0 BS 0r0 -0L 0T, -LM00`Kq@ 00 pPPS 00@TH 0uS> <S2  0BS^Q 0( 0 0 0 ?R(0  -R   4K P@ 40 R0 0(@I IlP0 0( dbP 0LI< 0p6PPx-p55555\. P-L ..56 0-LMt@ 0PdQ R~@8~ 80h0(0 ހ 0Sx-(6T6l6 -LM0:(0 P0( 0S(0 0 (K  ᧀPP) 0S& =P`u 00,pK 0cSb iSI lS> oS& A0S 0S 0S(0SP0AS, [0 0S0 eP,00 0oSP P,0(0P,0 0 0P,00 0iSP0 T0,0$0XP,00 00.(0p.t6x-gx666666g -LM `P0p-S000P(K 0(P 4P@  0S 0 Q (H{Hv @l=5$7 D0h0S $ "-,0 0$  -LM@00$0 C 0+ 0 -00 $0 0 0+ -0 D0- -L M0KS0@0,0  K 0 0 0`t -LM@|0 00S 0 $: 00 $ 00 $: 0S00  <<  00 0 -LM@|0 0 -LM0@S  hI 0 << 0 -LM@g00$08  0 0(0-K 00 $ 0g@+$"<7 -Ll|h  -LM K00"*Pm2tD7 - LP_2nt P7 - LPQ2ot \7 -A0 LR`P pPJ RDA R p P3 RA R pP R@ R pP 0S 0   0 p  0$  $ 0 p $ 0   0 p  0  0 p .01 4 -LMx \, P`p 0LSEThpx0 g~{@{T 1  [~W%X  @}W $8W8}W $8tWp8kW P8bW $08YW00 QW $7HW@ $7?W  76W  7-/W00SW $ \7W <7W 7 W 6W  6W $ 6@W  6W $t6W@ $T6W 46W  $6W 5W  $5W 5W 5W00 tWX5W $85W $5zW 4q@\W00fW4]W $4TW@ $t4KW T4BW  449W$40W 3'@W 3< S S 3$W  3W $d3W  D3W  $$3W $3W $ 2W: b0S Q KdeW " @ ^ 00K0 X"% XK 0SXT1 ,0S ,#KrKrrKra0S @K00!d 0Sqi S  SetplhrI H H.|<)|0 %|$ 0;;;l:\:9T9d9999:0:9::::;;;8888889$9H9L8\88l8|8;;T;4;t;d;D;;;<777887(8<8x-<<<h7t7p7l7|:$<<<L<X<d<p<< 0-0P@0LS 0@0>H00hl 0-|PL0@S d0d{0:0 0HS@{4{${0000hl0< 6x -0L0CSQ tM00-  Q^00?  Q^00@  ,00 0 `5 -LTM\ X3XSp`| , xp p <R|0x |0@E:0T #|Upa@ Phpp0| `Kx| ZPxt KM PJ4K|x D P}W H|0S0t  | l h 0S |`KxPKP& |0 | Ql0Sh0S,0 S ,嫡x P{ x&3PlF.WPP|0 |(1  0P @x.x0l0  P|0|0qC.t  d{~pA|@Px :p7 P-H4(0<<t@<ht@dgt<<<<<Lb 6< -0L 0= -qLpM@P`!,TpF@9 -PR8@LLT`1`00 00Q @` 0T Q" T 1@KP0: S 0`S  0`SሠT 8  (T-t=px |m 6 -NMLM@@0S( `Ppt 2 "2Q0UNINK@D@DP4: SA 2P0S 1 R zP1P dz(0 S h(UQo0SKAAwP,%4R%4R0 R ABP@ B^KPEPE0 @ PINK2@D2`1@D2:o?00 !zINK@D@D?PX0 R4: S{o000x p| 6===>t -0L 0X0$> -LLMP`0 4 0%Rp ?0@8S񟗃l8HP0S$00, % 0S 3  0S  0S#00 #000#0S d3000 X#LCP0P 0 R 0040 s# o #0S "0S0Pa0Ua00S 2 R @堢ŸQ  0@Pp Z0h"0CSD   U P O ޞU P 00 U P@ 1 R * 40*0ESt pl@ PP pP, n s+X 0 R, K P#0Q0ESU . i@e/y5 Pp ?. (PL?+@HYLb `Y <_ 6mdhY p-LM@P`Fg0Se/ C50U $000 0 phRBp H%|Yp0 0-0008LP@C D0<\  00S0WEV gdY -LM@2m00CSl#############|#######0h"@$ xYYY 64Z -LM`P @ Br,2 h 4+ 0QK, P * [)0[4" 4@ 4jK02 <10"R I20X 0SXp,2S 0S+ 0S S 0 P 0  0P S h \P T t H0 00 (j  , UZZ -LM  K0K rP  0 S |? Z -0LM R@t0tp \ PX LL@ P8)P$sd rdA8[edAL[`[ -LM( R,@:( 0e/*5eT *0 SR: $t[ -L M0Ss0S 0% . R|3|!x n( h j, \ f0 P b4 D ^8 8 ZG<PP@ 0 P4S "Ir4S  Ar4S4SP0ST0S{ @\0 S@ oXں Xp 0@@0   Xp  > o a  0, 0 @@0P`0,  `0 @@0P`0,  ` 0S S! 1,  x 0S S 0 S1 0 38,  0P 00C   m10,   ~ pu tpl \pc0  0 l[[?@\H\[[[[[[\\\$\0\?<\D\T\\\d\p\|\\\ -LM0 pPd(`pVP@R0 B0JP@SAt,x,0-0-0--0-0-0--0-$-0-0-0-0-0-0-<-V0 8@p|T`P0  j`P d  | H NP@ `P?@70 >A>P?>p= -LK0C 0C0<0  :wP-W4 ` 0S44<X0DXpd0S44@044 `W 0SU0S  440D40D4 9DP0W`k 0Sh BKHH0 #04P@Sx  4D <44 !\0P`J Z00R00S@9BKJ J P 4WpP<$ g;'P<4PBKH0H 044 S;;S<$(  04 Y9DD PBKH0H 044 S<,  0 :9D40D4 PBKH 0H044 S<$8  0< 9DD ,PBKH0H s044 S<0 (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x   ` h p x    ( 0 8 @ H P X wPBKH 0H]044 S<$4aPO0BKH0H  G04S<0O7<x$HPBKH  2H.044 S㰠<$1PBKH1H 044 S㰠<ctPBKH h1H044 S㰠<$kPBKH1H 044 S㰠<5P<BKH 0H044 S<$P>``'LXapX?aL@aHaPahataa$W8'ax(aaaaaabb b,b?@bpb0bbbbbcDP> a0BS50S2<$8a AR:R<`0A8̑"<W @$  hB>K0CH4 H@O0`L0p H o04S@$0O0W LLO0`H 0p X04S@$00W@4 p1 4A`XPTp *0S P0h@C1 0 @T:q10  00S044 04S44S ( 7044 0@$ 0@4 @TM TOW> `H p@0E.KXX< W2 `H0 p@0X44 ~*` do @@aoA@W  H <3@$`L e7D$ D$ h ^7"W `H p0E.KPX W H0 @0P44 5*` o @@oA@ H0 4 e  t 7DD 6 7DD <F4D ,0|S ,  7DD  6D$ D$   6  6BKH0H P044 S<T440CS㰠ڑ<} 6D$<4 D$ s -LM, (0S4 D  ,,0S  , 00S4  ,40S , Q ,80S,00 8,7<@@0 , 48,R37<,P ,0(y)P,P ,0(p)P,8S R0 a,)(8@P`@00@p00a 8  0@@ {, 0@w@<0P ` 0@V U 8pJ64 , w<4 Y 0@`@0`P0 @p  0@TS8&640040 ,08Q0 Q2, 02 )8@p@00@0 a P` @ )(0 @P0 P@ 0`p 50  R0 4((00 085x 5,8S5K54  4 D58t54  4 1`5 4T54 5448cHc\ccccdTdddddde -L3Mp0moKPe/OK 0 ^*e/Z* KK?KH2 01 2e/$1 ( T 0S n0$e p- ALM< 0 C 0}2 0xH 0sP`5 0l2 0g 0 00 c || 5 0hKB 0XFPP 0epeee4fK0C(Kⴠ0S04@@  Wb(K0S (K G.K B0P@@`p p4T p 徐\4t,S:\4 X4(KS:X4 0S(K@ .bNK KAe/U)(< K@,㰼P+00CS00  ä0+0(Kq K0@K@P@ P 0@pS񟗿Q]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]TT]]]]hT]]]]]]]]T]]]]]]]]]]U]]]]]]]]U|VVWW]WTT]]],X\XX]LYYZ[]l\] ]\Z]]U U [OKe/K(NKAe/ K(N.K B|2Pt9  G h k K@ 0PD 8 (P@ 0S$IK@@ \/p ehP` 8 0hO# kȟ8 R@@R@jOKe/KW(NKA Ke/R(Q  r  o NK @#NK@Ke/IP )R    P   X  Ke/-(OKKe/'(NK KAe/"(NK@ NKK@e/$P KOKKe/(NK KAe/ (NK@OKe/K(NK KAe/'9S     NK @eNK@Ke/P \ Ke/'OKKe/'NK KAe/'NK@OKe/K'NKAe/ K'NK0(@UNK0A)$^OKe/K'NK KAe/' P     NK @NK@Ke/P QV Ke/')R     NK@ CC7 5"NK@ Up` NK0@p4 RU9S NK(9@ \4 R> D$PP  R0000ӑ yS0 R000ӑnSU P$00ӑyP ß,0 S ,VN.K BP@ V2NKAe/'NKAe/P_NK@H  0 S+    0@P00`Vp 2 0  0SNK@T 0 m 0 SU @)P` NKA01iTie HHPP^ 0S[ NK@Ke/PQ  POKNKe/A&NKKe/@&e/ K&)R  ]_2L1 R9S NK@(9 N.K, BDP 1NK0Ae/KKe/`&NK KAe/[&NK@* ,W50hhihAK4d7< @P@d `0`d@bS>4@D( bP$ 0060@D0k O K<E~K@4 kS gS4$(Q P @DmS4(4( Q0a#5P4  4t8pPt h1(K R-K,Z(K0?S X0 ` BR X0  äX0X 0 -AML Ml0 0,0 4 P6 4$P0S0 04<4 84 Y$ 88 0@ @P0  0@`p` 0@TS8$41SK0C0C4 000 !hP@0@@ > 噰PP 4S JnKⴀ`F10 "\a0@|$嶾Tʄ1S/BKAA  0*0,*8`0A4 -ML─, ` Ƞ,8@p@00@ 0,@ @ P\"0Pjpp`w vn !0Sh0Sd0S 0S0 0X@ P @, P(0SD  0@S 00 0S( 1# P0S0S0S000  @` @`0 0@PU`TS0OP0 0SDw 80<w 0$p^Hlphl -L$MBp500K0`K`蔀`0@@0P` ` 0 @PSSpp!0Pp`PK uB : 0. 0@   0 S:0S*.0 0 R00葽,V00U0PK |僽0OP0X0\ .v 40<v 0$ n\<phl -1L$M Rᔐ 0S  @P\ 00C W  pǏTJ   B020 K`0 K @`P!0` `Pu 0 uv 0, 00B","0@ \ @@0\A0 0\0seh @T P ^0S8 @pUP rdAedAL[ S-Lpo UP* %DP " 1Z 7<@@0 (`,048PR3O<(`,048P7\ L1mdP uPW 7<@@0 (`,048PZR3O<(`,048P7 ( (0R, ,0R0 00R4 40R8 80R7<@@<0P  `  UV@2 44 4wP0$ 4hhlp-0  R0Z7<@P@`Pp -RLMP` p `K0 p @p@RP@+  0`S  00 0S00Kp0S0S0S00Kp0KpW0S -LM` P@L p0S 0BV0 `%Yi"Y M-X LM00 0 ӑ`pP Y 0-z% 0X P0tX0 ``` X8PU0D 8PU؏(4@ np^A2 -L M0U@p'  55 u  % 5P88آT$4@  $Pp 4Q 0SDP Ppd{P(D0: S  S  S0 0p{ 00 R000Sg RꈟLLTL?;#003 <0S c#?;0P@ ?#LD T@ ;00S  ?+83 0S,3@T c ?2"@@ 0S H2 AR;;S" ":00S 0S 2Ql2l"d2T"H2D2qM0S0||D K1Ps1 @C  00 ~M!0!@4  00 oM0!@g0*{M0d!@T P!P00p 0Q  `M0!y@0 0T PJM0 c@0P 0<0  H0,B D@ @B0B      LB 8B  m @$@Ll -LMc0Ss0S 3 R S0S3 Rt3 R hCPñT P,K 7W0S 3 R| 0 0R  R B 0 S "000 R2 R0S㼂 00CS00  ä0N00`V xx20 0hP@2`DBH,P(@ 0S 0+K0 a000+ P !1aA0 @@AP|۷ F#@ 0X$1 v@e0A PR0: SN8 @TI0W@D0 R㬀 00CS00  ä00 堷( #808 $0,B 0B@BD DB  D4B  D ,t\ X   -?MLMt0t` R   0S P |Dp0S?KK@D0P@D?+{P0B0 8B,B p- LMP|Ut`0   p@0T  PࠡK >0B0>0BL@  , 0-QLP) 0S-````0  zP@ڸ0 T ;;S0@0T@|0 tW>0cK\ 0T {>00  zP@0 08B0B,B  @ 4B -b0LP@@xr !PP PX"000SQ0ȬȬȬdUڅ;;SNU8U0011 U00R@@T U 1 Q P=J!0|!>l1 h=\=,J0S J0S J0ES U0P0 0 R0Q/PUJ0 S J0S J0S J0S00PX=00 0008B,B0BP0Sy B0Su t"00CS00  ä000g T*B %K(JPJP@ 5  {B0!5t0x1d1 0Q+ڍ0S$1$! (Ka=!$ -0S 00S a=(K0Q0ՠ 30Q/a=t (KX00S`0` A0l 40 С    H    DL @ -LM⬡0P,P @1`pD3P P00SP` PUD1 R 4]4P 1@ V40$P$ 0S U0 R >4P  @0| ,0K8P P)0ST 000 08PDD Dhܢ   -!LM0S|@ a1@11 WpQPpA\PX@T PZ\A1 R 33@0S`P111P 1 110@1SZX0 R H3HX,@\ӯ 9\h @DBD D4\D 0-@0PQ00L ? Q ?;#ʁ P!~ Q ~<Üʘ0 0P 0x 0t0p0 0P0U3 8< DD D  LBH L    -0LM @0R0 0P 0 0 0 P`0 R ? RL?;ʂ;;S 4<3DD D  L H   @p0 0? D D LB -02LM R"0S "00A0003P_䡟 A00b@_ß 0 dp#4'YX`pPB`V pWC`QP0 H S0 @ *$! P-0 0S0A:00cP@0 000  0S @ @0P0 pw2V8@ 0, 000f2   LBL H D   DԤ -q@0LS" 1 R8 P-`PP0S@T ʵP @P0 @*2pd0/X0@P00 $2PBDD LB H L 0 00b0L  -Lp` M0 0@K  !夡0 0bO TS0`V p00P1@_0 0 d0 Kp#4'P50 K`Vp Y*ڴ@ 00b`W  W V 0X0Y0XVt`WXH L    0-H0H@L 3XB -LM\q0`SN H!3#c1c0cAT R$0S8 Q0S. T :P T $`P S00T 0$`00  XPl0(&PC3dAd@d@f000XRPdB\B -Lp1PP 0S ,0SP!&0aV 0S aP0S$0 0@0S# V (P00 0$ 0 T %P(@`PP0x000hB=XB -LpPP 0S ,0SP %0aV 0S P0S$0 0@0S# V P00 0$ 0  %P(@?`PP0000lB\B -LM@(¯aMP@ 0S 鴧 -1LM 0 bM@ ^0 - ! ^  ^ a0 :#:900 P \0  ^  ^ ^  ^    0-LbM(MPbMK@D$@D0p 0 d0 KX0P  0 @0 0 0S i00\ D 0A0- SPL@ 0]0S8  R0S+ 0+̧ -a- `L0Q!0p@[ P20P d 0p QL c+4 $Z+ PP <X0 KS- Lm0P 0逨 -PL@LPgb=0  R|1  Kd1  DLq0 =41  61$  /1*  (00   !0A0a-  xam` ;P0@09P0: S `0  ,h 0S HP (,$0H8 W! -LTMr0 $0 @"P2b- 0LS`P2`  0L`pPKS񟗞4t44a=0A 0mPP2 HD 0 P,2 0 P 2  v*$0 S $h1  0 P1 0 P1 0 P1 0 Pp1$ 0 P$1* 0 Pa=0 0 P; 0 PLPP00S S S S  Pd0 *@0l A 0e Pv A00q (,$0 mS- L 0P 040 mS- L0P 0<0 v  -2LM pR@ nPb0   2  l"0 T2  <2.  $262a-  am` & 1>  P F $04 4!N0 P V $04 4`!f0 ~ L1^  w P@:0@0P3n000cBP) 0: S `@0 0S@P0 ` `,o 0S P `@0 0S@ Pn#R  (,H8$0 |0   -H$L|M0 ,0 U P $00CS 4   4圐K R 0  < P3=6K 04 P7#00CSa=0p`P@00S@b-P ``06  P03 ($3 0 P3 0 P 2 (2 ,0S ,f2 0 P2 0 Pa=. 0 P`2& 0 PDR>0 0 PF 88# 0 PQN0 0 PV 88# 0 P^ 0 Pp nP/P*Pn000cP@P00S S S S  P<00cPy0 (sq0b= 0P@60 0Y PL [b=0P@06\  0I P 00 qD l(,$ԩqQ-H0 4S Q 0 S  qP  -LMPpPb@03 R 0#400"400"40 0"40  0"40  0"400"40 a͠$ 0 `48 0`  !H8 0Da=$"$2T:0D0P300cPP*!0: S `@0 0S@P1 ` `,o!00 P `@0 0S@ %P0 400 400 40 0 40  0 40  0 400 40 a͠$ 0 `48 0`  !H8 0yP  (,$08H P& -%L0M0 (0 H +P4H@ AR4  0AS 0 0 0 HPa`%<%8.K-0K.[- [%<$,0KP0K+K(,0[+[pPPČ%H8 0P`KPH0`P@P`b- 0^ H3 w&S(0 S (d0LS#H@4B0KAKB [A0[4Pq 80D KC0K 83H@@ 4#H0 4@0K?K@ [?0[4P#H@ 4>0K=K> [=0[4P" 4<0K;K< [;0[4P" 4:0K9K: [90[4P" 480K7K8 [70[4P8"@460K5K6 [50[4Pa=@,@8@4 K30K2K1K4[3 [2[10[ $4(PpPE400K/PK0 [/0[4UDKP2P-000cP@P#D1H`0S S S S\H  ePH<00cPLH0 %EC0HP H 0 @@,@8. K-0K,K+K, [.[-[+0[ 4H0P@b- P0@/HP b=0+ K. K- K, K#00$0 (,$\ -0` LK$KP P0`P| Pn2d 0QpL0L {P0, y%  (, 0-QLM@P&0 R00P0 R0S 0;0 R0 R0 R a= 0P02\ 00h5%40 |000 0 $  DD8(, p-LKtM @`KP9P   \L0  Fp$p10 00$- 0P ) -LpM`@KPP X0PpWH0P 0R ,0 ^$P 4 -LtMpPK@P1 R* 0R5 0: S,  =PIP }1 0Q` P X 0x @$X`10L y$P 0R >$  d -MLP4M H4p , t * $00C S<3姧P3 RIKII 4S+P) 1#0@P \ `3 RT3T P00#$3 ,0S ,a3P 2 Ro 2 BQ R0P0 R0Sx"0;0 RQQ B0S|2 R p2a  02L5P P0SBB0S1 R  9IKAAP!0S$\1  !}04t!#11  BnKP`F`FU!B4: S>p@ PpO0 0f#00 ;,  %x %#B pX 0,X (,ԫ$ DD8\0(\ p-LtM`KPQP 0@T0: S ;Pp/L 0#pPVp/ p  -LtM0@/SP @//S`@pKT/ `0S0S ĵx0\0S0S! Dx $ -@LpMS` Pp0S 0 R KP0Sl00d0 Rd00HPt/00 "m/ 0"BDD -LtMp@W0 P`0S 0 R KP0Sp00d0 Rh00H)P9/00 R"2/ 0K"BDD -LM@10Sl`0垥P /0S /04 *"$0 RPT,  -LM@ 0Sl`0qP .0S .04 !$0 RPT,  -LM@0Sl`0HP .0S .04 !$0 RPT,  -LM!@P. 0h!( -*0LM"*@tNP. 0h!( -LMRp, `1 0S00000SPP0e0 peR  V@*0S@T*0S T00- x@ x@@T P`W,0c=. 0 V!pWP  0p\!x/0Q`. 0 40H`p p-RLM`0 Pp@0T<  P- 0ph !- BH 0-0@SLP 4 0R0a 0h2 8 -ML4M!0QP,0 pG`1 KK`(@D@D V k#  \P p R0 RPa- 0S0S 0  0 ,0S ,^K(A4A P a=(K0Q p0| 0DQX0Po-4 0@  g- 0$ 0`̭ -0 0R00000L R0000 R0@00x0 Rl#h0P PP0 R P$ T (B X  , p-PLM@` 0SpPP ?@P0/S00L 0S< @ `0 0PPPPp \BBxd0 R00T0T QH0  \80 R,0 P0B  ` BB0 R00B 0-0P LRx0@T 0S@T00S 0SU0 ((P BT} -QLP=aq R1 0S  0S0! @ 0S00 0 CP 0P 0P^, 0` vU,P oP00BBX B T Ю  -L#L M0PS44sP 30C S8('('(`''((''((2 R 0, K@00KfP0,0 0n0  0l"0X" 0@"bMb=0@`l `0 @p 1؁ * RY 7 R$00  +P0 `ç 0! P;0\1 x1+ 0\!  R8a- 00 R0 !0 R  R00 R0 00S  0a @0@00{+0SPAr+h 00P2` BB  <  P8l -P1LMP`U; pP@5*(P00CS00Ӥ0(p  T:0P0D@00CS00Ӥ0 P p NT pCPH IP  ㅡP@P0  P  hx -2LtMxŸ@0pŸT S, Pp$T U0 CR 00H2 ,0S ,[0R Y @K1 R@(08&B`P0 \*L-S0!^ *\ ^ *\^0305 -$$q0LS`P P: 0-S00 00 0S&0@T0  6:TP 0 0:S l R1 0 LP0 ?0C0 h d Lbh 0H p-LM0@P/@5|P00l00SP`ph;<0Sph00ph,X\T -LTMptp % b p 00@JS񟗈78888888888888888878p8|888888888899888 98988P9\9h98888887t999898899998::(:8 ;;,;8;D;P;X;8<p04q$D$T\0S`?0@0w,0S 3wCWPv ,4 u<4Podj<3V Pvd<3u43u,3 3t 2 Pt2 Ps2s2r2rBp2P: |2p2pP2p 22 p|"|2x2@pzp2pwh2|t2|P1@ 0S `Pa0CS":::::::::::::::;1` 0S{1P1P1P1P1 (>x1t1{0[PznX1z*P1y'H1y$xP4a0AH0pK @p |<1P@x  0'P@ PiUH@ 02 v Lb ܰ (       0    D$ D8   BOPhxf4n9DHDDPB 0 DBXL0@0t0 X X0 t0SI0S| |0 0Sh=h===> 0S@0cP0 0S0 0S @0`P 0$!0S0<1 wP1 RH!d1 pSi+e Q ! R 1R B Q XA1A0t0 001A0t0 01A0t0 02B0t0 0 - 0PᐨLM@, 0 4 8 0h(?p 00@JS@@BB@@B@ABBBBBBBBB@? ABBBB0A50 :5%55<5P.g,d (T0$d%00X5085D5,0S85  Q@b% $%$5 00CSTY 0S@C@CPEPEYpP. Ym 8I` < 8 VL ᖛPD;P< Pp\ᅛP(P4 RYPW 3 , RC0S 0S P 0S\30 ᾞP@ IP P 2 P 2Pp,2P `P 2`0P<0 20H CQ0"Q0~ `2PtYPN Ya 8 I`0 @0 8 V; @Q aP1@P4B PP SPP1 RY0  JmAᅁP@ ;]ʚPP 1 KPP 000FP定P `P`P@  P.3P|(z `0S  DLb ԱD ( DPB0D $  4D:hl HP<_hHDD -LpM`@pK\+@# 00RPPRP0: SU/00 0D #00SgP  Ȼ 6 -5L$LM4$섟P4 $4p $p 60@DSpJKKKKKKKKKK KK(KK@KlLKKlLKKdLKKlLKKKIKKKKKKLKKKKKKJILLKLKKLLILLKLLKMIM M(MKKK0M33#000l3+ `3{P3HcHTP@ P 3 R - 'b帒ŸH0pK  p b2P@l  2` @ xx`PVH@ T2XP2b 0-S 0!0S 2"2!02911100!101z1!0$H!1p1!0QShMhMMMN RePP R0S01 (]P `0 R e R 0 PPQ $   D D  BD Lb<_l PhO̲xf (C 0 CD 4PBh p-0LM` |@Pᒍ-d0 P0R4BDL S00CS00  0p ph,B@劘 P00B -L0L R0 R  UBHp P-L 0SP1 0PS$ p,EPp`=?P@ P  ppP0VPPS0  U  0S( W |BB p-LM KP qd R0\4P0 0b0CS#4RlRlRlRlRlRlRlRlRRlRRlRlRlRlRlRlRlRlRlR S`P$K4 V U  0xS S *S p`P0E" $ VUp`P%%K5`P*%F:`P!%O1Q0r 0-LMKP}P @"#  0 S R PP   B0 0 C 0 0 l  -L 0Q먳7 -L 0Q -L 0Q1 -MLML0P`(0  0S ,(0 S (Q @Rpx 0\S@ S  R R PP`  PI000S  \R 0R 0S 1P 00@0@0S PS" GS0000S 00P 00PPP 0 0gS pS00BNK@D@D ;%D 0.z(v 00LTDDtȸ -@TpL 0S `PUP PM@@0`S 0 p`PPP PDD 0-\0P@LT 0 @T0U$ SPDDT} -LM0PS x@T l1P0000 <1`V0S`" 1 R @T 0T @T 0TT 00Y 0 ⪀Pp  R/00` @0/S`0 0@4o R/00pD  p p-!0LM0PP@ 0 R 0 R pp0 " 0/S @T|0 RpYyPT @`H0@PpUP00D   p-0LM`0@P?P6 *P *P 0S p*P P Q  P Qp*P Q P0 R /QPpQ @PQ @-0 !S@@T0]P P 0-S P]P ^ \ ]\ P Q0 -PRp0LS@ 0/Sk 0S 0/S6 2 R2 RPp10SS S !Z 0(Pp10SS S +0  \Pp@!00CSk `,1 R.000S S 0/S 00CS00=0 <0C<`0S.000SlS 0/S 000c 00C0D D  -ML M\\1 `P$ ^KPE840,0S/~0S+0 S0 K0S( .S @ Wp  P;0W$0 S x$Nd0 K@TTH0,Lp |   p-LM@P` 0P D0 L\ 0 pPࠣ -P`L/Q@@e Tp Q@:0Q Q0@*0CQ:0QQ0@*00 0N0 -LcMZK MpKK K(@DKK( @DN*K", 8_KWLK KPH0`K: bK(J,J 0P'02(K  UT1*00UT1:T3 0 PPi1!(K(K0@cTP 0S 0Y pWp,0 S l,MT *0S 0TP*0S0T0* K\ 0 1(K R K(80(K RK*K:K(ZKX:KZK(80S  KP KZK(8TKQ :K(0D0 T\LXp| -LMpXP, @ *0S &S  \S 0T*0Sh /R9R,00`BVP"0S 0S0 `bV0dV C@\S R0P -LMp㾺1PU|PP 0S`QiP@ 0 S/R< 4aP2 T,/00 1  bPP 0Sggggg{00 R0 h@T0 0S/S @ ,mĻ D  ̻ X0X P -88L(0 RL  @h  p-L,M(@KP P P Pt <f8828Ÿ@@4`K@PK$Ÿ0 0 ,0 4 PV PF P6 P& P0  40 ~P xPpZX!tp@0S fP@0S \P@0S RP@0S HP@P ?P 0K   0K  w 0K  k 0K  _ꄼP h -x0LM @R`0 R P0 RP PaPDDD p-PLM@3 R0 (a0S= 0#S4 \S. *PP$ 0"C12d1@cP 0S PP P0! 0px  ` 0#S@ P,P  D/>3м=X0X P#3!"c1 0c!R 0S R(/>3D p-PLM@3 R0 (a0S= 0#S4 \S. PP$ 0"C12d1@cP 0S P!P P0! 0px  ` 0#S@ pP,4P  D/>3$H=pX0X P#3!"c1 0c!R 0S R,/>3D -PpL`@ 0Sd /&PPp0 S 00C S0u 0SP@j U 0SE000S1W 0S !0 0P!10@ @@P000 RH 0 G, ~ @y P 00000 0S MS CS000 0S 0T cS mS00dv,QW0p0@ .QT@}  (: ꤽDD8Tx@-0\ @a 0S)  S   0R  0R \\  0 S0S 0 S0S  0R DH -LMP10pS@ q 20  00S| 0SJQT`q @P_0 1 !.B=R pGV0G SRuuuu`uu uuuut 0!0!>C111v>C 0C0 !0!>CP00 1 !.BR00 R0S P&0B00 1 !.BR00R0S P0 1 !.BR P 0 1 !.B;R MUp010!.CDR Pk?C@.PT @}꼒 0-LPL@DT  0s0S0 > D Ⱦ -LM⬁PPe 1 R 1 R|1|!11a11acAT pP0 S @T0 0RT 00O0hL0D$qv -dpL0S ` AT@0`V01P@P-+UD p-LMP@T0 p0Sx`t 0 h0h.ĝX0P"0L00 e 05 DG @EP -ML0M (R04 ,0  2 ,0S ,'H4! L!8 0AT ~KpGR0pG8 @TP@, Q0 0Q  P D! T4a=  8,1008 A  0`PS 0S0E0S  pPT 4a=0 S0ń8  $ D0tGE 0-LPL@DT  00S0 { D -8L@T`j !0pAT PP! @T NP@ rwP mwP 0! 0Ah; T  ɌP  OwP & DHt -@L0`SpP` N0AT ៌P @T 0P:0G0D 0-LPL@DT  00S0  D= -0LP -p`LP% 0Ƃ"S12e1PcAT 0S @T 0ST Q P@ 0`0 10 AD/>3 -1L M@\, `p? ̡1 0, @R@\`0 PPI P 0S: Pda00S0@P! 00S00S RP 00 0 0   FC0, PhPP 0p p00  ` WPP 0X0@ P 00  DED 0-LPL@DT  020S0  D=| p-LML`0S P0AT  0Y@TPOUpD -LM䀟pPP, / 0"c12f1`cAT 0S @TP@ uP pP ,000! 0Am(o0ST D/>3 0-LPP 0A"#12b1 cAT 0S @T00 ST 00 00530D/>3 0-XP@ @LT0 000 0S00S0Dp  -MLM,Q,0S, p`* 1 R 0/S BKAAP % `Ѐ@0Q P@EuBP 00(00 徠 000 ,0S `,ET P 0 D0DEp 08 -`L0S$ PPUJp0"S@0S A 0RH Q DPUZ000DE DD p-@Q0@LM@C!1`@P  KP*0P0:0 R@U K0P0,*0P0:0@p z -P 0S\ \P00S0 BS0DL܉00L\:0000L \*P\:000L\*00L  L 0 00L 0@- 0P@CR00L\ :1!P@00L \*0\:000L\*00L  L 0 00L P-  *0 R: R$0 R:  Q0-LP0 S\  m0S @T0   0|  -LMP@ kPpfP \ 00CSP0 @ ($ 0tD  -LMP, P, 4#, ,(3(cpp0K0CS d, B, l0  , ,2  t , ,2|   a,  ,l2a-d2bb0  00 02R(0 ` >0R 2 "00<(@ /R }   @<0S@P `1`) (@0/S  00C0Xl1 @1) @1  5R K0BS` 0@Q KP0  @P00 9p 0 0 :0 d@0, @m, 0PT , @b, B$ (,H8  04 -3LCM |3 B, Rܐȓԓ83 R  3 ,0S ,BBP0SPdU <"K d2K0b S Sy 0CSV+2 Kd1KK 0P>KdP2 0P >Kl,20 P  2 X>Kt10 Pa=.K0 PK&K 0P|KP P@!0S Sa]P K@ 0K@P `p@< 0S@P``0  _+0 Kd2.K@/K N@KPt0h0x\0pP0hw 0:~PA1 [Kll! R0d00g0`!00 00\00Y,AL1 [KP @ll!P1R 0B@ˌ0 [_KPll!O?(KR0,0<-|@1 [_KPpll!0R 0p/A?{Gz?0X8EDLbd 6(,E<$E|,TEHxxLPE<, D,'<\x@ ,.A0 pbW0`0pppȼ圹0 ᦾh O 跾뽼 P 0 p p0 pp vcPP Hq00St~ xQ1 01 P 0 0 R* 0 R : 0 1  0<2S!000 0 0p1!@  @@<P` hB@vj ^  0<2S";0000 B>BS$  #0 $ 0<2S (@'(PKdA (KPYoK P0 `A \A XA TA PA LA HA DA @A `PdC000 (3>K LPVXCX_K#^?K@|A 僫PHx!1RS@$0,P0;CS040@4Q0S|  `Cd=l:A 4!r 10C1 =At0\ T0 02P@T00< KcK0 ! 墼`VKe/K:1 o < K eKg R x0S:^ A {:  0S }5  1 刡  00Ì bK 0Pʱ 0<~D$&r464\&=K@劳PpOd&Y?KP0C P|P Y?KP0C PnPw}2F]?K Y0(PK0@00  O? K ^ 300 0p1  000+]?K3 W ]?K) 7 ]?K ~#P@ 00 OOK,@@H 0-LP:'0^  x0\*$P0\@ PL0@ Dw@P@4 ,D|<,E8E< -LM@@ -MLMXXb0PpH,0 pp03*0* 201 0 2 1  Q P1@ԡ`0 810 @@f0P0?P P$JKx!(@D@D0h!`PJ 0P ,0 Q  ,C9 x|`8#8P#$0$ @JK(@D @DZK<:(<2: !<(K0<:(<2:(LL!<  00E<xEHE@, @d!Elx -L4MD 0K`#D 0P@K0 Z L7  @  ,D h0S '0S0 0R0; 6"   R000 0p 6F 0 B0p0 \Ɵ0 ` @DX@0S #S $0 0c@BHX@000CS00  ä0 LS7 S@PHUp|0 ă ā Ă< 4 <( "4\,<PEU, pH'W 00CS00  ä0PHpWp!pW T0W6 'W00,pP|0 ă ā Ă< 4 <( "4\,<^pW0 PH 'U00CS00  ä0F pD 0T ΌPhß0/0p@gU0#DHL;$H 0 \DP0S.W)4S4#0pW@ *0 @S0pW:0pW@ *0Sp 0W:P@K0/GPKP@0/魜0 \ 8K\48 < ( 4" <( "4, ! 0,< `Rc@0 , =9 A0 0 0 =,0 2a, 3c#0OPK< LH0`KqPK@ P K`KPKH 0@PK\,!L@0SPK! !H0Sh0L@Sd*PK`T0 A 0010Z1P7  \ p|xHE E8< EE(<\`h@EHE0E8E|MQڲ0AQQ00  8#8LȃLȌ 00Ѝ -ML$4Mx4Q (K @, \ 0 CR 004,K(IITK(JJT$0 t埌 * Bq0# ᖌ* 9q#0S`V* XFVP@@X0 H - YP@2V0 f8#0 d *q *qQ 2 R   ,0 S ,U62@2@P0 Ÿp`0 6@PK0L X0/0)K@ B0/H0/P@@ә0/P@@80/Ù0/P@ @(K0LP@0/@岙)K0 BP@0/@KP@P!<0 @ *p 薸i 蒸W 莸P@M  ̋f  Nj *jp3K (JJ0 㹋 *\p 0RK(II l*OpY@A0<\gH@EHE0E8E D Xt -L0 K M00, 000K 0 6 p/? 0@ @ _` Q @0 RQ   -LM@㤟T (0P0P"5 -LM@Qs ,408@HPX`hQp $hZ0S #!Q Tp'>`XPLHDh84q0#$(,"(h0S S0Swusqo0("#x(@dx@d@Xh(h p-L M0@0a P0 !P ))  0  孮 娮t VP`F `00CS00  0p ph (w V`FTp| -0L M0 K0 *P@ r0888 (g0 d 6 -LM@0 01R4 R(  0 $h)  -LxM0`S qP10  0D0SJ 0S TKPKLKHKDK @KK0C4 01PßPoAJD  \ $  0 B00S00Y X 6#1@% "X`P$R`1 ,0S X,;, 0@82P @" Q 70$ :  0dPPd 0hƑ(0CC1/|x0Pw00S  n Q<;P904$,P` -MLM0tC\d#, 4 <(  P@\434 #A6T8 4 ` #140\F" $p`B6# AV#1%Y X @0 0 : p2Re L 8(LH0PS@*KAAD R& 48 S <8(000 @XT:8H000,0 S ,d+ 4 0 |00S00YX   D0TPDHGPH @7 Q L 1HH@8H0006#!P*8H0L Q@T *BKAA@ 0 S@@T:08/|0 @P0088  <  +0|4 ,P` -0LM PU@p$`` #T*U0 R  0喃" l `▂#0U<0 R 0 0喃" 4 -0P0 P00LMS0 P܀ R0 P.:p$60PP5`@2:(P`@ሿ,F0Br$倿|P0 R0`@00-$Fp00$Z@0 p T4T -!LM0\00 \pG\(:`(P``>,F0B($60 ƚ \$Pt0t0l h d@d0 A0(00004P, - 6 8`0(@ 0L 0SĠP`묀pp׾P3@00 00`PS P@0Ss0S宺P,D4TP -LM@P00] -LM@&B ?; Pa({PUp* 0А倾0 T00P00@ 000p@0 (($`Fd0 dS D 0 Q009P 4h x -P0LM@A<0 P 0S P h p-LM``0S TPT 01@CT*ںغ000pҺ0T*  0  T -LM`P@aUpᰀ 0SP 0S 00C0$d ¿\0 iD80  \0   >@ll4 0-(0@ LRP 0 ,唿, 00 0-(0P@LT ,2nP  T00T0S 0 T @0 0-LM@0T0 T00S0 T0P7@H:0S|tp0 Rd T0K0 1 8 (A -0LM@ 0h \ 00CS  00 00  l -PLM@ @1 Q (P0P*0ES;PU:0U z W/ , Ẁ0 0V`P( 00@$K6^$ @0 0 /&`$ 000H0G  W00 Rl4h 0- L8M00 H0 <0 80 40 00 ,0 (0 $0 0 0 D PK@ HK@4 ၾ$0$  00C00 %ll -LM@Pr0 `0"pM b0@SB Xlt1 b 0`ip1 h \!000`01@ m0U>0(!S 10`00!0`00 0@TQ yP t0 R T@DG  0;T@Dl`zX T0 R &` ,Lb8~XE\RR| p-L@M P`KT0S 0S  j p -LM`t`ğ QS, @ DdI 0S 0Sm p P0S 3 ,0S ,&s 0ṢģL0S/ PV먓0S 0SL0\CS 0S 70S 0S @C 0&@0T0uP/iPIB; 1~$ 04dX|tldȻ8DPp(HlS -0L `h%0 -L4M6`V h ,6 &,0 R:(6@T pP2,& 00 0# (6@T,&lB2 S:` 020,&0 R:0 020L0Se d0b V`0SQ tVV1U V!bR SQRV  V@ 0 @2 T06`VX!X1X!X0 T1@<@@0,@ \@ ,0KT@ P@ L@ H@ D@ @@ <@ 8@ 4@ 0@ 6`TP (0@T*0U U@\K (0PT*0U6`V 1"p 0X20 & @Y P  0 20 &@TڗRڔ4t  -L M0 b0Z0 Z00S70E 0S 1St5  d50S`P<5&0O @0 V"U 5 RD < 0 0P 0  IZg D0S Y [`4&B ?PPp` Y YP Y  Y! U@1(@Q0 T PEU@ #6#aBPP@T1X@QcT P #0001 01S@  YD3  , \3)&T3 0@L#0?$ 64$0 R  "0S  P0@$00 Pq p2l2    7ĴP x2 d` P~ 2 RA @>1 R,9 Qh;Pe@0 ! PPZ @@TP|6#1@DT PM\1 R 0  | P+ h1 !0/o (K0 ,@0 ,?0S "0St P 00S(< FxP0S X] P D +<I ttlx4@lXdhX\hdC(LT} -LM@P4Ppc`VWW1 0S>000 0. $0`F0V$0@X L0 S00*޳P (@ R00  0R 0S R0R0S P 0 R nP` gX0 S00Dŏ<</t\Xdl|XT} -La8M0&0Q 0  p 0KL P H D @ < 8 4 0 , ( $ @0(0PU *0T0 T00SP (0@U:6pW<0P 40H@ PK0S  4d`l -LM`VPڴp崀S@PT 0S  0T @T R 0S `FVP 0  0P 00`X -ML M0,0   BRxt P d$ PTDT$E>K0C4  L44 {$0ß 3 R( K#d `$ *B>KMK0CL0C L4 p0 R X:p# X*pCp\  X:_$3 ,0S <,! 0S 0 S s S # P"   00C0 " P  000 00C0  TR0S-@<2Vd@Z P  O2(K_KK@$ (@0\4  X$ sM!Q& B0O0  0lz 6`X!0SV Eo0 ἇ5@"%$1 R0 P P. Pd P D0:90|f0l,D <"dPXhl4DT}\ -MLM$p\0,0 (`; R 0S  L0 S8(K 4  `0 A?(K  A?(K D KKⳙ0((K0Q 0@^^>KMK V P$ $\ 0S  R0.S $0'$00Q0Q0 Q00SpG h'dY X (,0 S <,M 00 00CS񟗳xx88$0S&&L0S6 `03  00C SKh@hHhPhXh`hp 0S 00C S'000 0(0800&c P%00C00000000      0S $\NK @D@D0, S^K PE0 0%z5 R \$\00 PO$0SL0 R$ 4 RO$\ P; 0: S0   4$009$\R  0.S  00q PS L0S|3(K4!  `0A?( K A?(K KK r$\0 0 Q0hNK0ᴀ$00$03  0`0C0 1@@Q @T; Q 0S+ 0 SP $00$0P "00C0"t>KMK  PH"dD000.S "X HP00L Rm `0j 0Sg <\@P^>KMK @dॵ$00$0@1  0`0C0 ἶ崀=@t?P;dP( j50.SR 00Ph L0S# `0 0S 0<0P$0  04mhlhd<HT\tX<p ((0c -!0L1pCW:@`V QЀ Ȁ0 R 0pGW*0 R PQ 0 R x0 UP`@H000<0 00C000 lhd 0-L8M`Q QT!00 @D H0 @0 <0 80 40 00 ,0 (0 $0 0 0 K0DS0@T0@@ 00CS.#D$$D$$$ 0QP 0S P0  00倯dHK HKtHK4 00  9x %ld -LM`VP$Pq 0S8 @T 0S @T0 \( 00C0`FVP 0  @00)Ttd -LuMĆ0,0 M p! H1PW1 1 1  6 \pP  (` ,6&BPq !,6"! 0&6& 1&- rK) f?KP4 Z(1P*P0Q0 Q00S 0`F' 2 0P:6P P0ş 0P1!5% Q5@!0R# 0<0QK0S   1, 0S  0h` K_KH$1r,6 1R rK P0S#1r& qPl0SV1#r&{qP<6 PA0S 0S ) `1 0S DrK} P / -Ÿ,0 S ,rC1! 0 000S  ReKW P !&(001&)qP dPeK6 P & !00! &qPq 1z ue,6KQ01,&K `,6xAQ000L0SD1 S@D0S!1 S* 0Q15021 5:0Q 0ׇ 0@0CS',x,x,x,,101 0`F4,6 0 ,6! yX@0 L;04t<\l -PULp`:4@$@TPZ OU:08 0 4F10@|3PL rx3PTChG gT3P= _P03$- 6SR ,@!0@T00 "2 =B0070"S P x2TlPP\He,(PPP@ពT J/ 輛{1  LPP?, 舛&R0S&#0!S$  pv9PL=S ,5S  뚙?A0` |p8@`|(<4`tlhdh ,P5  T} -L M, Zß ?{3弃 ;mP c+ #x3R,p / pW,P  0bW@%0EOa.6 0@Ɔ& 6F@V3 ( &$6 r 0(& 0D00 B 0+00 0S02PU D2 00  0 0 00 ,0,0 00000 330330 33033 @0L@0 D0PD00 550550 55d00d0d0d 0 d  ` d0 1 R,d0\ +blP 0 R,w6 P@kU*0 Q@tPU:aA ,0 p4S4HX@-@0 0   0 0 0$  (@$, (@0@, 0000 D@0HD LH0L 330## 330## 330%% 4 -PLM@ 00 R$hl7< -LMp@\\`@vm Pa0@S p1P  0PUZ c qh10  00S 2WnC` `F R R010!,!mc.㪮 0P3 00C .  ᷫp_%[EUPvᝫ0GOa.U&`n  0 6 & `@⇫0PV6@ p$*P꼒FTLX -0LM@H HP0T UP dedA-L0(&S  d0 P0S\P P1 Pa S\Q 60Q4 -L: S  S  S H0 R4U S S  S S -1LM `Rew[P@@ 㬻T|1 RRp1 RNd0ST D1 R <0QXp(>00CS0X0@ӤX0,FT& T 00CS00 R0 0  yTYT nTNT gYT00yTP ^ P00XG^@4(F $h0<H -0 @LM̀@@0 ` @@``優PUPTp p L@IP00TQ  p0WD0@@W4\T4h 0-PL@T 0&"0S @T@T# 0 @TT  d 000X 0000 0 @P@044 p-l0LM@Ɠ0\S` @088 000 0 `Pp4 p-LM0@S` PU 0 0U P 0 PPt0T p 6 Ul`P6@ S6& "," Z 6T p4 0-L0P LR @  (C$P 0C  -LM8pP(2G 2 R b  ? @_xTo 1 RP a@T T rPUp@ U QW!0Z00 lQ3L1 R% PZD1 R 1ѠoΠ 1 !@P40 b@C@0P P  ?w@0@ 0P PPUgHlp4T\48 -L$M0 !0P@`_ᖄ@K &" $"40 D @K0, 劏Qd4 ,4 P[ 0@0K,0yQM@4 8@ 堫H4P8pT54 , R0,# @K@_@K0 U 0`Q 00Vs# ᑨ@፨0P 88 x 4@0pW %8@w0@80 0pPX -PLM, 00 ]@_l!@K0/a,@@K,< QG 0 ̸0PP< ,@`K 0Q.e0pZ oԸ ᱸ@ 0R  @@K0 `@0PK_tp ʎ ,\?0 Z<,S00 ,Kp|p@-l@00CP XPX`  Q2 00CPp02 0  pt -L8M 0@K0 ,0  -RSL4M@ Ppl h\\1  BRH ᶋT 0, P \0 , K X T L H D @ < 8 4 0 `HH\KP@ 0 P0 X T0 PP 0p  0U0?00f f>៪`` 6/00f V:TPU L0L X0 0 TP  U \KȻ8GlW -L } 0-LMMpPANK@D0@D` 0 hc Ʒ80 e| 0S 00  -LM 0@M|J|@ -LM0@S TpThTpT00S lh0 R \P0008<W 6 , -L`Pk똡嘁q@!pb@1 PHUlUlUTUlUlUlUlUlUlUlUlUdUlUlUlUlUUUUU@@1@@@0 Lh00:@0 0QQ0 R|0 R 0 R|0 RP0 R XUZP LH0ML0TL -0`P0@LpP VPxP00U0`00 Z0S8`=PP$/ 0 h:<_ 6 -sL` P00CS00@Ӥ0tE U T T 3 R^ T0M CR `o000- CR 8^00@t$3 0 0 0S= 0^ CR /000T C@?R 00p P0@0@|2|t"0`000R P, Ⴖ0R}p0 CR 0@0R P0Rcp0R\p1 R 0^ CR X000I CR 0000R0R8p1 R 0$ CR 000R"p0 R T 0 R2 0T0Q0S* Dl J0@" eX`SY@0Μ 6xL -0p`0P@LP UP@ 000T0S p}P@ 0 h: 6 -LpM` 0Rp䠟%   p@ PP  fPP p @TiPl0ld0 KPL, P 3勠P$GL 6  -PLM@ 5  sP@0 -SP0 `SpE 0A0C&S7^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^ 4` $00$`0`~ p0SV PEU@r tJP dPEU@PPd0S TPPE@ $0S4 4 4 X U30S CaY U   #0Up0t0 |iTPPU 03QU<XTPU{c0S JTP 0S0S20S p ` 0pGS D W R0SP 4Q0S 0XrS TP 0SX 32QP    0PE03@1QP Q T 0PE03@h 0030PEU@U81@T5 00S 1Q 10S  T0 wP +01S00S00S @ ;0 |wPt GG%%G,#%8%%0G0(#%%LGX 0-TPL0@S s<0  0P@0000G% -<1LM00qP0SxA Pr000000S  wP`X@  wP0@ wP0t0p vP0X 00 HvP0< 000G%X%i zi %i $#~i x& -L,MD0P`K@p,0 (w$ d ᄆ vp \0S X0S T0S%@PiP<   vp<@TU  @00PEU00Sp<ߞ,0 S,% 0%i$dpd p-L,M`0P@@K0 $   *`0` kv0sHD F,8C 㷲 0S  p0%i$@\ -L8M0@(0 LKPp`$ Ԥ U0 @ PK<P @Rp0h-S`@d@RP8@ D0D vp0] (0S ( 0%i$ -3L M0pSP0 ` <P`  ĤP 0 Sr200000S0p,K;P t,PU V" X 0 Sr8200000S QP n i5Ph0 r1000P^ 00S .;  AR #  0  xAR # hI E 00S CP2  p,Z  QP% 0 00RSY 0@T 0R @0S 0 0S$0S 0p0SPUx,;VW@@, EF G $$,#<#%% -L0 ,(0( "upg %,#%zi 0 -4L ,˄(0( upQ %,#%yi @ p-L M$@K DQ厣8 tp$ $增P`  $0 0 ` tp# 0$ PS 0@UU0  CR 0 R001h 0PU@H00CS00  ä0 p%xi Pl 6 -P0LMH@D0  \ (0$0  %%%G(# -0L0 % -0L0 % -<0<L00, ct0Sh%,#i  -80L4000 0Mt0Sh%,#i  -L 0000 0%G(# -0LM0@S/ h00S00S P00  ↡,0T, @00 0 0 0%%%(#GG -$$ 0L00  %% -L(Mp0@PK` @ 0 Vx s0S 3[x DT 0 T KsP@  0S, Y 0%,#i %%i  Qd0d0A00d0% ( -L M Kp0,` O:$P@\  0 c@t0p00dS XO0SHD p@h O$ P0t@l0@B$%(8%  p-0LM0`0S ِP ^P!K8P@T 00S YOP 0S 00S` @TV8㭐09p%8&0\T %x -PLM`@Kp| `$Ƃ1 @`9@0 DP 00 ,(0r0S,#%i % -PLM`@Kp| `$嘂1 @`9@0 DP 00 ,Q(0r0Sf,#%i % p-L,M`0@PK@$ 0 F f0S { P0r00000Sp  ,KPPX PH0rp8ѕ 0S( p0%i$%(8 p-L,M`0@PK@$ 0  !0S 6 P0r00000Sp  ,K PX PЏH0Grp8 0S(p0%Di$x% -LM@0Pp`P  R0@r1000xSY@Qg W %NPY r10000D0S  rt10000D0SX0UYDDY 0- qP100000S00B R00000ӑW0C q000000S00B R00000ӑW0C0@00W0\R00S MP@00 `hV f:`鴒 p-QLM@P` 00S R00000ӑxS T0S r000000S r000@000STT T00P0SPP  ph<8@9T$@3Tp鴒dD  0-L0MPQ! @0K  <Kϟ0@0  ; K@ P \@@0[X <0KH0H <0K0"qP0 0S 00,#%%i   0-L MP0Q 0 @!K  0Sp ᡩ Kh0@KL ᭀ@0@ pp0 0S 00,%%i@P -LM䁟0\pK@8 P`K$0 d@ `0tL0 H0 0L0 Q |0P L0H ZP@[ T @`>OKU[Q p5Ql) ?KV " CPKK XP< ?K K♁nOK| jK q | mP 4(K@Q O?( K`V LDLMTPPEhlf`Xmx0SjH>@~?K2lpK1p`K01@Tڸ3 lp=QtPP@1@SPTUpPl r300000S 0:SP Pdl ,PPU Ht@TŸ0, CR 0 R00p0K1S=U@ T 2S0S T=0S@l=K \*,1S' L~=(1D 8w=4(1,G$o=$1  h=$18`= I|[=D"R0S&2S1PKx!\ 0 2lP 1S  0 CR 0R00ꐨ0,00CS00  ä0 |00S <00S,0 S,0,#%%i i8i4iiiii$i|CB\(84<HTdxi %% -LMPq04@KHa  0 T0!P( $` o{1 kP N2 0P!@0S$ 0  z-0 CR 0R0000CS00  ä0 \P U 0S@  0%%i  0 ->MLDM1圑0 ,  ^ >KK(@DD@D d` {P BkP` 0S;,}8>{KL@K(pG $pG>[ř  8P 4p z !kP@ <0S[ <0TP( 0 0CS00ä0w<0@T|PZP ,0S<,%0%%i Di|\px| -x0L`! @ T @: 0 CR 0R00;x0 &!tSpRW` LDL~TP@嗀P~ $址idd0S |B0S 0Bs 0 CR 0R00505P 2d 0 CR 0R00ݦx07< hCB| 0-0L0MP0@@K( 0 ٘ y|0| :jP0SX{0 P0 H00<$  0S(0%0%%6i($ 0-d0dP0LX@X  L0L00 00y00 $i0%,#$%%$%5i p-PLMP@0S00pd00\`TH <X@P$NP^Ppt&%$( -Lkd0d0`pT;0@#nPp@@Np0 + 0%$X -LM@ED004 ( 00%$% -LM@'D004 ( 00%$$ -L M0p$0  @pp`0h\φ$KP`@0$0@@S %$Ht40S 0S0SP-L0S 00  S\0S 0-@PL0 Np0 |0 0-@PL0 9p0 g0G8 -Lp/PP`@ld0p0`@0 @H8n@T( T8p p-LM0@S`P 00  SY(Pp@0Sp -QLMPp W@icX0$` [ A0S 0 0 SP @0S@0S$ 00 S0P QWl`||Xt+ H' H00p@0S% 4iApx8Gp8x -LBM MLCNK@DP0 @D/㋏KKoK,0 PP嬖 w1 hPp2(K 0Sc 0( K @<PP@tP,w(0K 0(K 0QpRKH K <P@PtPP,w 0D ,0S4,l0%%Ki|X -LM0@(0 4$4Q4QT00CS00  ä0 T 0S 0SS{Xpp@K Dd =w0K( `0 }gP`0SYP@K^(  &w hgP0PPp 3 ,p RgPx㖊p. @4 @0R0 0  CR 0R00ꧣ0( CR 0R00꘣ 40) CR 0R00ꅣ`R00CS00  ä0 8y80< LH20@S& 4Ÿ0S @0 0R 2!0S 2^ 80 00 0S1@1S^0\0CS00  ä0 89p10S P00@T`10S V8` 0  00@T PUX0@T  @0S 0 0$0S^ (0S(0%%L$#x&%i 6i( HP8LXt&x%,#H5 -LMX0Tr$0 0S0+S (啉$B$ v4PK =w! Du D6fP 1` 01S 㽔A0 x! fP 01S D娔\4 0uw< 14 8#"0! 40K@  DeP 01S {| uP v00CS00  ä0 d> $0ST$`0%X<#%,# %i %%"i (8@#i P`p -(0L00S 0 %G0S 00S "48<#80  -TLM0H@,0 )0S0+S È`p㓏Kpp <qP, uF30: SOK. uO_K0t JeP01ST@ ԓ<3 (K @OOK <PqP,tSOK.ᵓ tOK0 eP01S xMK`.ᓓ, tO_K0 dPp01S <1<1<1<1<1<1@Y 10SB .U4 ut0P dPF01S) ,J&81S<1S ~1@8P PdurpP Pdfc נ0 ,0S,0%X|%%"i %i Ii  $GQi 4Ld 6X`l$ -LMPP1@q`P4K $ ؒV00V@/P 0 K0p@ 8PK 0PP #.00`Z"PP@ 0 ᧄP  <Kj<004 ㅁ $0S$08Hx| p-L MK,` 0 AP*0S |aV0000 P00P0S 00p0P@0P0P0 `20p8H p-LMR@!X` 0S   TZ p@0< CR 0R000S7 0CU3* V ,0 CR 0R00` \0 CR 0 R \ 00ڟ \0 S0 S0SD>0 CR 0R00pph齟p Q-L@ x`B @0S> 0CW31 V ,0 CR 0R00ꗟ ` R"R000ӑ0 CR 0P R  U 00z R0 S0 S0S -LMMp0UK,0 d1`@ Q|0VP1 L />P MK!rAP />00>0@` V?K P d 0BX1 R  :!0S 00S Q0S !"4 40X  ,0S$,10HHGd0 -LMK,p0 Q`:) 0@S W0000T00TQP   T@D0T0T0 d20HH@-^@ 0S\\  P2  RR P2 R\ 0S\ -LM@  '3 -L(MHq0D@K$ 4a 0 垐, q bp0S5 0S1 4P%ᨋP0   ap,0@`TU=PPE V|` p@00U00SV 0 0S, Y0%%i$( 4 iD x(  - @LM0 6N! 0-LYv@TlPll 0h>Pq 00e404 a0S 0h%0,#P %%i p DD=D0D=0@-@@@((0P\ P, ,0PRP0@00@-@@@((0P\P, ,0PRP00@0@-@@@ 0P\ P$ $0PRP0@00@-@@@ 0P\P$ $0PRP00@0@-@@@000P\ P4 40PRP0@00@-@@@000P\P4 40PRP00@|@-@@< <0@R8 80R < <0@R8 80R@`@-@@< <0@R8 80R < <0@R8 80R@H -LM`pd P8 8&00sP$6$$ P@ &< Lp< 10@GS񟗳$P\ (@X4$P@4$@@@@4P4$P@|4d$@@t4d4`$PX4 L4L$PD4,$<48$0 s3 4 #3@@@@n43 ;8 0d#003P#3@@l#3P@@h#l3P33333D#00B@38#< <; #3@@"2P@@#0$#s"00"q0`aS'2 R2 R 2 R2 Rx"0ST"0Sh2 R@2 R$"0S`2 R 80S4Z 0/;40("0S: !0S4 &S " !0S!1 R! !0S!l1 R!!1V   z11 S81 R! 1 Rx!x!t! 0S SX!S0 R@!0 R0!0!,!4K< &s< 壌P D0T 000~0 K+_P"[R0 &&&& &&&&&8I&&&&&&&&&&&&&&D|&@I&&DH 4Iht@ -1LM1\0@ SPpm su1 Ra0S1P@P 30CStD0T00TD0.S( 0Q0S X G`I0PE0SU00V0S  $|00v3S 0 R Dx-/D0 SDT#P0 0S0㺁&&&&  & 0&  -LM H 0R,0 0 0 0 $5 R5 R 5 R @@ ` 0KV㼐 嬐 娐 夐 堐 尐 崐 帐  @  QQ \  D0.S (0^1Q o @p0 D0S@@@P 80 @T@1Y1Q@ 80S @K 3 R E 3@T PPK0 #\@K|J0 #wJP @ 庌P巌l QR P   RP@ 0 0m0 0 0zm0: S S 00R0 d@ `Vw R 0@S |@ p2KL"0 ST2  `V `V2 ,0S ,#D@K"0 JOx !0t p IB! 0l I91h R0d0  ` `!0I&d  000 m0-S ᐅLp 0R@@@  P [岀  ?0 R0 0p Q0 R A.D `底\0 ]U0&&&&H&|&& &n:&&0& -LP# \ \ P  \  Phg P 3S40 RP \ 0&& 0-@LTP 0S@T0  , 0 0CS00ä0 -L MԢ ( 3S 2 R2 R 2@0ppQ[ 0SU l2@` RL2 Ry<@K؄$ 00@W(2 Rf  O2 RY0: S SK 0SC (080c!0;1 R 1 R0(D1 R&1 R# : S : S h00CS00  ä0 pW (0S (( 喘80([ "88 #$ , xX@ 0B ?EV@0 hu  Xl0&&&$ &0 &8 & &&&&      0-0P R 0L0x0 R00d0 RX0 R H0 @Tgc00&&&&4I -LM,K0 P| lR0 0 Q{00P4 U 0S 004!4  R0 P,@418 4P80080 3S 1 R1 R 01@G80 R< ;a -h0LM$pK\P@`  L0s,  0 &\   p-LM@`0S Pq00  00S|0 R?0X CR 00`0Sp0R P۔& -0L a)0d  -LMp W@P<  0S刔判` p1@T <PLx`< 00H3``8#`$3 3 Pb0A QU 0ŸS2  0S "0S}  2Pp PP"S000 8 KP`d"H0SXT PCbP:5< R P 2 R 00S P0S RR P 1/2a@#b! 8KoPڲ3[ h0S (T0`![<P!VTP@ 0S0 !E{@ኢ \P XP |/P  =l00Sb0@:\0PdS T0<0 0 IIIIII   |-Mb    < d  -LpP`H QPP=\~P@0 \ P⑅ `偑MP0`  (`7(0S<0 0P0` P0000$| 0S0@ LL ,0 00  |- l   00P 0 RP|- p-LM`]PP@0  0T0~\0dh  z00TXPPPPPPP p?epb    -LM,K62嘢@ 4pKT ' D,0DPQ h2 R00Sl 44*P0 P0 000D40Q9 @T40Q& , Q ៵00 0cP l  1 Rʄxx!=9 B = 0 0R 0S(,! 0R`IV `0 0000 R  Q $0< 0bS$0$0000Q40STd 0004000,@ m 0Rd|-II& @ X l I   0-LM0 0@@0<0RF0h800 S807ڐ0l` g0/STR `Q0.SK R pG׷e#< 00,  00-<`8X|0 -D- -L(Mlq0@PKda @ 0 垌H RPD3[1 ,,!0CP"P  0 S  00 0 x 0x 3KQPh"8T 0`"8 00D-i  i $ -LPM␡0H@Kp℁P `(0 HP DP @P  D0D 5  0$ 0 Ji(d  \x -LdM┑@q, KⲠP0K0`0 ` p@ 0K K` `0P` 0 R  )0.0 PPPP0 R /  \ K[`l`K@ ]0 ,0p P ,0S X, \@ĴR 0 0H-t xt- -SML 8 M4% @% L% , 7 )( ǟx,   8 < D H P  ' 嚘p: H0@/S    $   0<             |    ( 8      0  < \  h     0Ɵ:;;@00S VA0C2SE0<00S|090;0:0;0:080g4şD0:4 D 07 kGKLL4,EG.K B :  B0| x P 0 {5 5 09XPX k0:;8갳$TNKA A @ 夳0S 0 R 4%RQ #NKA A vP4Pڌß0 R 4 R hx 0@0vP00L0 o<0 8 "NKA A G23 R 4 R0 S  "NKA Aqt2`P0S2 4 R./ i^P"e@a0 f{/ feT  2P00#%10 XOvP P FvPx!NKA A P( P0 R 4 Re ,do\}PP [080 00P00NKA A 1Pڠ0 R 4 R Pø4d0 0:;7I(0<0:;:?.A0..LbN4Tt''DN` OXt8N.  ,Hd|N.. NNJN(TNN'u`J< 6J\.|NJO.OxN 1  bZ Z0 % 1PGKL@L@@@@@GK@Ia@ I : 0| x P 0 R11 P0Q(  xy2)@P(<0 M8%R/ IKL@L@@@@@@O>K8 @:0C D PP$0S p0 $00 )[PB "0  ONKH2@D@DP)`' 0T `[PT2)( 0`[P|t Rp X 0S Q0S33 0 $.0$% >$5 $nsP0  #0 $5@T,@$@T, `Td$0 00000000@v@Tt@0E @T4 @0RO~KpG5 pGt PPc 8)* 0 \[p$u HKNK@D @D0P% R44:0  4 $: 0 8[PQ0 DTP<0 < s<% <% <5SD%R @5@ 00) .00   ,0S  H @ 4%R ZH5P4%% 0s @00) /0 $  0Q@ Z~&0) %R X0SLKt&@D @D0'P0PZPH6'0PZP&@)$ 0 @ZP7)% 0@ZPH(@F @Һ, ̺ (50C(5 &(| (@( A(qK K8(0` \x00KNKMK thtQKL@AI L@A 0I\ T X PUd@T]0SV(0 N\@0 5 @cP> T8X04 8\5 4 0$5 4 TC>K0C D 4 UP X%0  R 0SXP0   L0S Y0S  @PuD(KL:EK0E>KL0C L0C 0 0#Z: Rg]e Ժ: Ѻ.tm ςT0 S lO>K0Cɠ@0C* @Y 廂05 ɄPP$;$@H\@+0@0 )H5. YPx0s ); YP0s ); YPLP 0)3 ~YP%,bP4,K B BlPXlPJOK@%@ 0 L% 0) 30  L0FKPL J @TflK`F`F  0P@ 5L 0S2HKP TI<'KDRpP=PX `<@ h=@K0C0CT Xfdh.00$ ,忁$> _P  1 PPe2 cJJP 00 0<5 P$ L-K8%0wf/PXP0  P$ 000P .N. -LM8P |0 R 0 l00 bL Kc9`P 00 @4 @ @ @ I K X@@NJL;<00    0 NJ -3L$M R 0SS@@@@@@@@@pp3  t\\!00j0Kvg_3 3 .$(," \"(!̠0!0 `.2 p22@80K8P  0 0@ ,@ 4p 0P0?@ P`2 X00P 8 `,ĸ@K<@@<4 Ġ̌(<"4!Č ̌$1 1LQⰀ\(0pW `Ѝ@-A\.b 2l20@\@=B\2a20\0 -0LM`pP@000s 0s!,K $P,00CS (P P0P0P@@iI?@{Gz?~@",O","$O0O%W AdP$W ,R(OJVJMhP|PN<"!`"x"? O NS|Q( O \ FStQX XTd ͠` \0N @ѩXP@Xp`%] -0L  90" -LM`0X"XB00P0H0PPE 0S00(2( rP000=b22 .0S D,B,@,>,P u@0SPE .,U 0+S-S0S .P.P .U@PE PiU`@PE0SvPfP wPr P ~00S 00SQ1 1)t<;RPBPcj_ff@$0ffL$T$X$\$`$d$l$Pgp$ p-LM@gP `Hp -LMb@T00.0$0 S S0 S S0@-S@  TAN Ra0NS\ 0RAC\ 0^0 S -d0LMP@@L0 ;<00S 000SJ/;TPfPf -L0MԂԢ 0Pp(0 PTPK 2b<0S @@ṥPH nP6 2P- PD2[KP) XP/ P) RP, KP- M P< 1P/ KP) CP, K P- > P3 K P- 8 P0 1P0 21 .1 +|1 (p1 %d1 "X1 L1 @1 41 (1 1 1 1 0 0 0 0 0A[?[0HP @@[0G @0H P 40K9K3K6Kd<@T K`rp (0S4(P0gPXPbff$g$ p-LMP`0,@KHP 0 G  G 0Sdp0$% -LM@P  00R0R  00Shs.U -LM@P h00ShQ.U 0-LP@P $00S0hU. 0U -L M Ky7P@![A[R0 ʐP xx0td P00TT0@LP d400 PP00ht@f%%g  % -LM 000000000000 0000 `0`圢0A> 06 pIpq QcPa 4S4S 4?0  EpP@u|*`0A>@t 0 001 0*l(pP|[*?T A.0O0P000B>0,10S 4PU/0K000 z*A040 00S 00S" 00 0000000`0` 0 0 0 0000000 0000 `0`0 $4SY*0 UtgP%P%(g 6g -pLM@ 00s)0@P%@-`@? 0"00\ 0S0S000\ U -LMZIp q  Z0Y0:H!O 4  6y†04 S4 S* P%0 4 S4 S0 4 S4 S*p 00 0 4 S4 S:T0O YA. P ` `6& 0I6Y$ Ug -x0LM@ 4 BN@Ap@0t hz 00Np Ug 0-LgP" 0P0Q  0R 0R Q(00A> 000 $$0 U(00S00B>0(g U@-(0A> 0$Đ6I  U -LM@$0AR 0  0R0$$R 005:| L0$$R0$4 A  0@0 0$4  U 0-PL $4S0C! 4S4S 4 A> 0@0P0 A 0@d0 $4T0$0AR 0  0R$$0R* 000hc U5=?0/9P6 0S000P p- LM 4B>0 pQ 0P@00QP`@BN@0 A>0A> 00$d0(@K B>R0  40 40 0Bpqph(p U & -LMYPx 404@0  0000 0 00 0 U0 00  0?\00 U -LMX@ 0S 00 0:X @0S0 04h U -LM@0 >Bpq @ -LM̀p`(P@TC@!vYA>B.A 0 0$D4 dD P  40 40 4stoP U 0-tP@0L 4@ 4@R 40 04TW0@0h0 UP00  UpD0 00000Sp00000S ἒp0 000 ἒ -p000L00 0S0  Pt tP@ qL0 0000 0S8 0(0$  鼒*&U &$&(0 $ 00 0 (WU WW$W -L 00 0WW p-LMP%]$`$@000]000pWW]U -`Lp00S 0P@]x 0 0S %]0 0 00(`S@0S0S WWg 0-L@LP 0LR0 0CS00 00 00WW$WU W -鐠p0 刀0b? |`PUL@0S 2R]0 P0b?U0S( 0f0@mgW$WU W -錀p0 儠0b? x`@TLP U u&]0 @0b?TU,0@ 00c0m^gW$WU W -PL0`0pS @] 0 R \ 0 0CR00S 000$\000 WWg p-LM|` x0RR@\`0`P0 0R00C0\00`00S c0Sp WUWW 0-p@LP\`0P0\D P:00@P*0P0U W 0-t@tP0LS 0S 0S0800 P0S00 WU,W - 0L00S W W 0-xPx@0LS 0S S0S0S S 0S 0S S 0S0S S0 WU -LML@00 S00 S S 00 SS W -H0LM0@S ,0@$ 0@]00U$W W,W 00P,W 0-L@dPꤏlt؎|Txď̏0h0hlA00S S y00S SLM0.0?.00e=@]@0 S=@= +=0S?0SeXC`0SeX@e dM0S P P 0S#0K$`K$K P P 0(K(0 F@(P]T0DcS&,|DxD<ئpĤDhD̟PTTDܧ l\4\xt DDH 0Lg,+0S0S ; K0S0S-:0S:  *0S0S : |J0S0S  4g -L M@000 p`P00T,0  300CW 30SW200CW 9B2 R 200CWUV T0S x20S R,UVP i; R Ry <20S pWWJZZ`P#p`Pv0X,0 p@q>P ,PL1AP-00Y000 # 1 00S0uv   00S00S0   00S, 00S 00S#pWZ00S0   ,0S 00p 000 00SYk 0 o~ fpglg8gS(T4ggg(g0gg -LM@`PpTW 000CT0 @T Jp`PvY Z@@TZXZ!o7 f0g -01L M0pS` 10S P; i9pP@+u)V 0AP 00S PP@ 0pP@u l0 000 0Lg0gf(g -LMp`pP@uV iE 0S<00S,00S 0 0S00CSPglg'fI( P000PS -P0Q0L00 00 000SS - L00 00C0S p-LMP`(!@0  000p P0-L@P@ 0TTD0hQD0P0PPS0PPS -LM@0S00S p-DPLM@`T Pp@TpS 0-LP@P000P0000000000   -pLMP@u) 10S1!00`Q0 #P+_p@ LP@< P00 P8p0t T 4  P 0`V00S100 P``V0P@` P@@P@Fx00S00 S 0 P@ P p:P@gS(gggPC <P2 10S ST0 )0PB0 @@0@0@0TP 0 PX 000P 0 yP  000gWWPSSTgPWg 0-@1@LP T00 P0S1b Q 1 Rb\0 00R 00S 00S00S 0 000 00000 00 p00S d00S *00 00T000WW8gpPfg,gpT00C p p000C 000C?001fZ0@-H 0\8001000\0 010fZ0@-<00 CR,0010 BR0 000fZ0@-8 0R (0P@0100 R0fZ p-L MP` 0@R$K0S ]/0 &00$0s 0s 0 01$ KpfeZ0@-P 0S0S0X@0^! 00S 0SN00^0Zf 0AfP<00 r0s  PZ@-p@0\`0 0r0s 00000\0 fZ 0P PPB@f -LM\X@TLD@0 840 ,{(0"g" ##Z#Z,$ Z p-LM@T5@`P8 0S BPl   @0  pff -0LMK0K00K 0-L M8P0@K 0 . 0S 005 0-L M8P0@K 0 N 0S Ӝ006 0-LM8P0(@K 0 n 0S 00 6W -LM@u q0r00T00S 800T@qr f -LMB@6P񟗓+,*,,,,,,,*,,,x+,,,,,,,,,,,,,,,,******,,,,,* +4+,<+,,+,,,,+t1 p1RDT10SD1@18B01$1@0S, lpq' P0mp@q XQP@@ K0 SPO@@=p q  (0\Pfe0SX 1*L0SH@0S%*0P(Z$Z46f -LM@PH0 $Z(Z p-LMP `@ (0K l0 0"T\`PP (0 00 pf(Z$Z 0-DPLP @)T000  00Zff@-p`P@Q|0s 0S 0S tu' 0S$\!:00SP00S0Q 0S 0S tu 0S0S*Q\gPPgfZ@-0S  0S 0R0S ^ 00S0S:@T 0S 0S 0R 0R@8)@ -LP@ M`, K00 p`PWY Z 0S0 S` M Z  0 S0 Sp`A , 0S? 0 S, @0 P`R @0P`, P,0S, 0S @0P,`00 ,  0S0S , @0 QP`R0QSW -LM\S\p`@0 :< P @0RV@00hï @ 00 0hï @ 0<K%0SP0PS @K 0P<K 0O<\ 0 <0 <\Z00S0 0 TfHgf -LM@K=0s0s n0 c -Lr 0 0S0 hgf -LM@P  pP@udP@0pX W``0P@,0`(WP@  hpP@u|0`0VpP@u p u `VJpP@u g@gf -L,M@@K `Pr@K` ph200 <q8 r 08@ T<\  Q R`( 0@0C 0, K  `P @0 8 ` P @0puv R@0KD10S D@0dS0c S0 P @,0K4 K0,m@K,#0"0P00S`0P00S Q   H  4  , 00@z00CS0uH00So4, 00  @~@THghgg -QLM@P` 0S!-P 1,0<R A0S* 0S!0S001 &뀁p0S  PP1Wp 0S  01A 0S 1 0S{  0K(0s$@tm K>0 ` PP` h P00 R00SH0  0K 0P 6fD6gfHgffd6@g -L4MP@pß00K @KP  R0S `  D `VD r0s tu h20S R0S0S *tu $200@_0 K0tu 0S0S*100@_10!0S0S00 ?SRp00pWÏ0K D1t u  y0z 0 U T P @t u  U0T0 " 0 @0K@  Pl q0s  ,0S00S0K@0K0 K0@ K 0ffSp@-`^@P  \\ 0S 0\ 0SP@Up^p 000g 000g 000g -@LMTP oDl< gdah]KKL -81LMXH @@ K}sC@bgj:eK0  @`Pp0S0S 0 0?00`0  X 0S L0DS$0   igK,ggffThgx6 -LM0$ KK 0 0 |P$ - L P00lg -LML0K Ap@T0[S00KT[g -GMLM7GnK, 7ǟ`F `F@0pxX D D )d'+Fp 20@FSPPVVVVVVVVVVVVVVVV\OVVVVPVV\OVVV\OV@QVQQVVVVVVVVVVVQQ RRVV$RV|RVVRVVRVVTU UVVlUU$6 R6 6 R0%<0UK1 L4S 30(8UK1 L4S d <%tT5  n@5k$UK0 L4S 08:$000S000;ꬤK0 L4P@S 604@ 00@008<4 R$ , KJ @ P@DJ PE,$ 0 Pv /P* P P#0004SP0;000@P Pl3 Rd3 PP`3080@0 P;  PD3    P 3   P2 R0"<P P070$H P P060$T 060$P 070$L 0H70LPT00RK1 L4S >0$000QK1 L4S (0,0dQK1 L4S d0 0QK1L 4S000 `1 bXq$B^KPEPE@kP  3P $0P S`0-S 9| 0'hZH8D[H[l8Lb888[<[84[868@[ 9$9<9T9  6 -L4M0 4 00[ ,0 ? ZP@K0@P@P 0L0ᲸP 84 R 0@ D0  @ D t0H0 0D S ;0 oR04  0S00@ y8#8L0 T3 M 00CS0|S0 004P@75pnl@- 000< 0SC0S #0P _00=0 2{L< C444 00 0hBD@0px>d2 R  4@ 0SZ ,K00D 聟PPJ 5D080 ` 1B< @K0 00!P@$ P 1 xZ2q@ R xdP2`1 RH@4@0t0@Y.@P?/@@B@DRPN`,0 @H`VP$@Z -@L MX  &>opn00uX$`pZ p-LM&> @`@Wb NP PU$@pXZ -LM@_d0q,' PQ P@   ,` v  V  W0 0H^ -LM4@_d0q,' PQ PP    ͆p00P0S@,0  ,m  ,0^P @@t  T @ W0 0Q  .@H^sd -GMLM⼀0p`,0 MK@D@D 0P^0 )K oOn@P0 ` QPU@$`Z ,0S ,>0lZ -LM堐WZ>,0 }nP 0  @hP@ka,0X H0]S ,0 ba,00XP`p,0  -xZ:ZZ8 - 0 S]R:^ -LM P@ ?0 1<00 ! 0! 0 QQ?  0 1<00@/0* o0S 0<?S 0S 0S0?S0S  M-LMPT00\,0 `00S S00\ ,0 !0SS:P% 0@0@ 0? <#! 00!  00 0? <#! 00g,0S 0@0 @   !0$0   VpZ -L@11Tl^mT t @@o! 00@^!0!P`꼒X]]z] -LM`|0@ 0 0p0S$ 11.QQQt@0SPU`,TP]H]@ ?_0]꼒X]^^^^^ 0-@LP]>0X -LMⴠ0`(0 @K _] 0sp  (0S <(/+S0(@0^$S@0$_@_H_ -L 0-@L0S P0  PP]0S0\_ -0LM@  &> SUh_ -`q00 L 0p0S2 @N PSP#Uw 11>p ]11>.QQ$ D\<]S ᔱp\꼒__]_ 0-LM Pg R|@|K  0S@ ;!pX DZ@0TD  <Z/ 0litii0B(S p-MLM`@0 0 P-p* AK@@+0PcP! T*AKAA 0r00000S  r\00000S 0S@\:ᨯ0 S/p0(-Q* rh000000S  r@00000S0S QQ:伒 p-PLMU`x x0d X) 0@0DPP0P0p_h` p-LM 0@Px 0`0X0S 00 0 0@P @j p 6h -0 SL0S S h0 hr ` -0LS S hi hr ` -LM0@S S c  ] h"` -0L м80T` -2LM0, S Q 10S 1 0 RA000Z ,  00S SJ10S? t1 R;,00 ^SZ 00S$S0000 0 a@!T@@@@pPL0 0`Y P00QP 0 Q`,  i pa Pp P`lPd0`@%P 0, 00 0!0 0 000lnnln0o oo|2,`0`4`x:8` 0-LPcP <@Te0hU 0-LMdPP@ 0 SEKိP0@  I0<_ 6 -9LM䙟 000`fS0  eS gS )))000P@00GS񟗲hhhhhhhhhhܙܙ8  <(\hЛ(0D<LT\dlԜT u6 0 00 R5 5 5R95 ! 0 B 5E ,K`0, R( P00R0S p AW`5 `EPH%00D%6 ,KC0, R P00R0Sp44t44  44 4 F$4 4<$$000jxx0 0 0' \4\XX 0ぺD4R@4P4AOA30000E3 3<3   83 33/3)3 |3$3"3 333,C[P83dSP LLP 803 M 3P0@S@ # 302pp6L20 P2U0!0 `c PTPV00 S&V00 S00`F00 1h0dS"0T00H2 0@T03 0 h1R0S040  00CP \1 q%P !<-x!304@T<10S\UV00S0  VTP0P 0 p `Fvp 0 `F0 ?vpW~0$oo ool lLbtb@oo8o onnl^bnnolono4ol0olababo^^l00S_S:   P0S r200000S(0_S% 0S! 0R rT200000S0_S0 Sr200000So00S_Sk  Uv 0b00S10PcUmp]0O00O0SO 4SL @0 0 SrT100000SA00S_S=   P0S r000000S+0_S( 0S$ 0R  r000000S0_S0 Srh000000S00S_S@,@  0 S 0 b10PU,鼒 -L Pn   -L Pd 鸨 -L PZ 0@-@TP* ^ \00S.^ H0 0S \4000 ӑ^ 0@T:0 oo؏-\0Q 0\ a p-1LM0`S@PܳP10S U t0 CR 0R0 S 0@00',RP$10S U 0 CR 0R0 S 0@0 0vRPU 0 CR 0R0 S 0@0TL@0 300CS0 ph0  0poonn -LM@P H됁q`!+pa@. P&ꌸиииииииииииииииииظ`1' 0`00 R1R0 0 @b0Q T00S B|0 R |0 R V @PD0P@S@, {LoLbbPoXaHo \ p-LMKP @P` J2dRhZ ㈡P@T^EZp|XP P` Ȼ -LKM MCNK@D0@D,0 pRKKPPPM.KAAnvP@4: S  S L?8,0 S ,,+xmK`F`F P@ P P  ,P@d 2 R[BPQ P4S 0G 0@$<@ 8@ ;0K4@ 0@ CK08K ~KKNN$ 0<K @P`! 04 1D MNK !0P ձ0 0tQl P@'P p @aD@0 0Ph :P $$  pna:0P 0 1P Taa 'P@X Pd9mK`F`F P<0b$c HoPo0c9 6K 0CePDP P| D$0$\z-PPL 60<1 Uu0Lbddc"$td %%d -LM@P L  q0@0  R\͜ A뼒d -LM@P L  q0@0  R\  뼒d 0-LM0P00CSK @ 0$ ϓ0 R  00@dLb -L0Q +td -LM`PP( @(K,pK 0  (0@S -L M0@p00 0Si NPP 0S nSZ =GP0`0@Q P QLQJ  0V0P 1 0* Y0  0000V 0`0C00 ,Kz, ?R0S@p @C0"Sl 0kY000 LPH00D 0oSP T8Tlt -L$M<@K`PPD R P40KPsC圃 -0,0K * K#E'pr ?0L:Sl4 l0000S  @@Kp| @ ?@K2000,K +K.0Se D 00|!0`VQF `Fv  ȜPPp   0z`Fv UP@ pP P  P l&P@D0S  Dp\0l 0 aqM#40K`XK f4f\sTsaaLb`fpfa*|\T  xf@\ -LM0@S\ PH 弸P8P屸P |\T  -ML M0ß0`@( ,0 @ᙸ3P`d088 B~KpGpGP"04 0X 048"qP0 T  TPP KA >KA B0Ck048\480   82X4"@ ,0L08@Tn p@` P- Uy4wX@ 1 ,0S ,rKAA KP<8#4P   \PL010!!PU  Jw{PU \!0!SD0!S0PU 0PU  0K@?0@0  R< } !yzyx0!S po0$ OPU^ f{dl0!S0|Z0hv`ny wvdj4#jw4w(zwv4 xl(jjTjkvkk(kHk`ddkwzxkddkkkk p-@@LMTP`% 0-S3@P*d`@DTL0ph'`40 ``!`hdw-P000 R b0P P51:P13:4S<4<,!4$ <,0!$d.,0 00 0rS R0l008#8S  w,z 0-LM@0 S  0S 0S0S0SP 00 S 0 S |h00 K 0 (0 $0 0 PDPU <ክP , 0000dn0n w -L$MğP`P4 4E @ Qt3 @ 8PU U ß 000U000DSHpHKLK 0D@ H @ < 8 4 0 , !xP7L R/0S ,-Lˎ R R H0S U  00S S0S 1#$0$0 0 00S  0H wP X00U @ OP PP X0 XP1Z@ 0I P P 0 ( "# m P P0 R   $00ft ldp `p \pXp@PLpw`d wz$b(zdnn4wno(ov,zvwPov -LM(K0@` pῖ(P(<x,Ġ"$Č$U `@. ,V00H@0<00 !0 0  0b wPzz`o -LMPލ@00S p SpBT  0ϒ005Q^` ^ T0 U   ;V40S My0vyo -8LM#8P,0 4XpH/aZ cZ gZ  4@`ğ@PPP@ `4Pd@l4, d4 0X $P0  @T <44T0 S0C0@@ 0S0 30S0C0@@ 0S0 30S0C0@@ 0SH#0 `30TS0C0@@ 0S0 30 S0C0@@ 0S0  20S0C0@@ 0Sjd"0  20|S0C0@@ 0SS0  @204S0C0@@ 0S<0@gS@31 R Q Q PZ a/bP@P 0R 0Rt hd>\1 R H>,,v rnjyfbbK^4Ztx 1H0`h0S( 0  00wts w8wwvddhdvzv,zvwvhwPzyywvovop p,p4p CR 000Rh 0 R \0R \ 0 S0 S 0-,@LP0S P@0b 0-LBMP0\0 @ \ xj 0S d`0Q L4:\F/K  !P( T0 T0   0 80 R0 R00xxtll dttt t0t8ddd@ `00\@8uuuuuuuluw vv$v0v4vpvxvvvv@-@T<0 1  0B0R \ -L@Mq X@ 0PS \ K 1 R X0 R 0S  _ 0S X\@T`T B 0^; 0<0XS0;  O( <:84@Q3800  B LR 000K  80|0CS00  ä0 T0R P4<0 R000wv8fvvvv:ww p-LM@0`SPK& mL@\P XH@XP NTQ@@P 0w <p000K 0CD <$ @$ 0CC>K0CH4 0CS1 1 KA KA@!.P L4 1-1 \L4BK 1@ 1@@@E1Px] pP h冿8 RH1 3 <10S/ BKAA61P1 #L4/P 04D R 0 0S0 0@CKAQ 00S L4n/P000L \/P@P㩿@0@ ,0 ST,[U0Pb{ {L{\C\{fk0z{0 S\6 -LMHCD\ <<3|8#0 ,喏 囏30S$0S 2 像刏w$2r20 \0l2 eŸŸ"2\2x2`l2P`2@ L0F<242@ 0 :2 321@{ 0'10S !1#10S !11`X1@T10 |p1pqHh \1AT1T \|00<0S(0@T Q َ0@TP0 鰿{{{{{||<,|H@|ş|8p||||}0}@}X}пd}l}x}}~`_ p-PLM@P`0S00P x8}P00 \0}P L0 DqpV 0 ep\6~(~ -0L 00~ - 0L0 0 x<~ -0L 0P~@ 0-PLM@ !0S000.P 1 !|P |P0 K1 ă\0 0  |0 0T0 HPH@DX 0S40 80 ꄻ`~\6~~~ -0L ? 0~| -0L 3 0~ -0L ' 0~п -0L  08 0-PLM@P\1 T坍 NP@!0S000!P D|P  ?|P0 T&0P @,*0@0 @0S 00S 0Sh0j00`0@0 P\04@N0 00 0\6tz<|| -0L 0t -0L 0 -PL M   KKk+P 0S0 00 0P|@0}S t00S\0h0\P H0R@0 P,0  |& -MLMp0P 0 00P0P 0 Ȍ`-P0 PT, ANK @D@D-P X0 \娌PA, 80 V 0S( .R0Df(4LX -PLMd   KK*P 0@S 8080 v(0 0QPz\d -PL M0 , ,K0K!*P 00 1U0 00 0 0 "4 巻 R0  0S 00+0S Q x00S 00+P000 +P0P@4@{|\C\ -PLM   KKS*P 0| SKKJ*P 0\S T0T0 D0 00S$0 销Ѐ -P0LM0P01@0P1 ‹ٖp 0\``ϖP +P0 PP 00|S +P ,+Pp0  X0E,0叾PU h:؀ 0 -PL$M0 , ,K0K!)P ,0S ,K0K!)P00 1Z, 001 4  4@ hP 400|S 4K+P 4D*P81 00( $1 1 < 塺1P0S( ,00CU$Uw0a050K00@!450KPQ 00S 00*P000h00S ,00CU<غ4@0 P,0 ?{Dz4:\C  -ML Mq0$0 巺`㳺PP@C@@ T㥺㢺H)PP 0S,Q/ ,P@q@BnK-0 K@`F!0bĕP+0 K0X00 ' '1*0  OBK@Pa^XPt00H*@ $0S4$ P00``Ŀ` 6Xh -L`Mq Px t `tKxKt!ի(t0x 0CS\1 TOP1FH,P1t0S0Yx0t00t0 x0P!t0S@P9p@K3P yP0`00 `x0 @t00t0 x0 `P \0 Vt0Sx0X  T0 0S@ O0p|hā\gЁ؁U 0-L@0LDP0P 0000}S$0P0| 0-LMMlPANK@D0@D0 *P DD @0廉V) 0S$0 FO00 4< -PLM   KK'P 0S |0|0 呉l0 0lPH00}S <0<0S 00$[DT\|x -PLM   KKʶ'P 0S |0|0 Xl0 03PH00}S <0<0S 0M0$"D\| -PLMX   KK }'P<800 #(0  ' -PLMX   KK ['P<800 (0  0 -LMM(BNK@D0@DP+(0 U)0`P00V00S B.KQ B B 0BNKp0@D@DQ+a w`P00V00SBKA0A@)0KP6P (0S(9N0 68 -PLM   KK&P 0d SKK&P 0DS <0<0 },0 0X~@T 0-0@0P 0 0RLCP0|lx 0-0@0P 0 0RL0P0| 0-0@0P 0 0RLP0| -LM4@0S $0SM밿 0-T@L0LPSH P㕖40,0P 00鰿kl P- L<80 ,0  h꼃ԃЁ -L,800S (0( 0S00Sl -PL M0 , ,K0K!&P00 1廇=00"p4 tAt幇崺d14  40SDAL 4  0S$A0奇堺 Pm`4  0S 0PU @匇出yW0 PP@? d ,040@ L0 P0R  U3   le{` -0L 0< -0L 0L -`VLt Pl@lph000*000H000V ,00hh@-p0@S @ T00R00S0S `P0S  0SQ0ѷ  Q00R00SU000S 00负t{ 0-PLM  1A00dž P KK%P 0S 0 0嫆 0 00 P0 㯑0@0S 0 S  @壑@00D0HD 0 S , , 0xĿ p-LPlM@ `K01 R R; 0S8 0$S \S0S@+0^ 0R 1N 10 1<0K  R 0S`0K  0R@T 0S0 SR 0S0S0K Ac000S 0[S@ $S \S0S0$\( r$300000S 00S 0 S 000S1C0K 1SQ <0K`K ! 1R 00 1R@D0 S,S : ]S8 0\S- $S' rP200000S 00S 0 S 000S1C0K 1S <0K`K ! 1R 00 1R0S 0 0S,S ]S0SU @@T0 0 RK ]R \S0S0 R ]R0S2:0,Sq ]S@n) r000000S 00S 0 S 000S1C0K 1S <0K`K ! 1R 00 1R000S1000S(0(Qppt -$0L \000|<Є -0L 0 -0L 0 -TL P D00}S8080S00 ( P 0  |4 0-0LMS0 lKzP@tPu @0 \ ,00ӄ000<\xk  -L MTr0$ S( D P8"$K(K #P $0S (0 2嬄 2 10S1(0a N0S1 0 1嘄1@0 P00E0X1 `1!!00 00T11 PU @!00CS00@Ӥ0,@t0 S@  1 0U UP 00PUP00CS00@Ӥ0 @ T tt 00CS0 P0 R0@07lȅ8Xh| 0-PLM   KKe"P 0S t0t0 d0 00n$pP@0<u   P0@0 -PLM   KK0"P 0Sp0p0 ҃ 0x$0sK0  PU( 0   心 0 Ć 0R ̆Ԇ -LM00 @]P  0 0h霃0܆ -PLM0 ,  !,K0K!P ,0S00 0偃0 8 #P0 P  0S 4Kp `0 p吀@ 00 h04dP_ 400080Slik|8{ -MML M<ğ P,   % OKAOKA$@u!P4  S0X C4 qP@ 0X30X 4 33 NKI I tt#1Tß5 01 PU  r@300000SP0QcL 0$S \S0? = r200000S@ 0 r2000!0S00@C4PE0CS 4At"0 ff4@iQ4 Z% P 4("  fT4 k`000SP0S0q000p`1匂1`CP 0S 10SX1{P1 1h10S ,A0o "0 t2SPKPPh4P `4  R  DŢ<MT4(/KDP  !RU 00S S S  B0! 0!R0G 0S S S 1S@  mP"-N0`0K  t2S|3 k2S < mPT3B0 `SD3 ~(RU 2|1s|x$ "  Ut 巉P201  t!婱 1Std,01 P 1S( \$,X02P@,2 0! pǏ  P0 1 ":(! b0@PP  p` P PUd10Sv X10SrX!0Sk0Sg:D1# 0C\0\M00J0LX\,Ћ$Ld:8Ȑl0X 6ČȌ،Ԉ,8Ldlp|3tЉп@T|hȊ0ND0<0 pÏR0S*\0װ1Sh00S3 00S/P*0S'00/P0S*0#0 CR 0R001 00CS00ä0H1地1Sp-2|p0s 1S!0S 0R 10S 1}10S1w}FP R  t (\ ֋|1s|x$p",0 S,B -LM$@("?}:屬8 -LM$@"-}(埬8 -CML M60H ,0 0L P$ D4 倬P@ `60SD4@٬8 ֬0]PX  0SX SP\  0 S \$ D4H`D S^D4L$:PW D4LT {r P @ O  kP x kPd5\P$ P kP`bX$R P$p`/ṇ:Pᵇ@@᱇PT. T,*P0#03U0S% Td `@ជ@@ ᙇPTT*l4!T4S 0SD4L$@gTT V :z/@vTP P@3T U  R0305@1:@:aPV 0S U ppU 0S /PpP30S43 0T@4 10S 1U!  0{V BNK@D@D0|!?p1 @4 < 8  TACKP1APA@4 IPP4CKSAA4$ 84 D 1 !0?2cS D40`4 D4`$0RD4 D4HSD0`$0SrX` ,0 S, A0 ,,tkT0hd$|> 8{Q P-L`7 P@ 0pSP' +Q 00 %Q r00000D0S  r\00000D0S PP0pS@00g鰍p000000S00@ p0 00000S70@W0@ 20rP000000S00@r$000000S70@W0@ἒ -LMl @i0SX  i0S<  i0S$ L0P 0鈋,؍ -LMP0  ֞x -PL 0 )   -P- L0  0 -$LYM0@,0 4p@` [Kt   `4Kl  0h d `A PpP$" L@K|P wP#LK 0mP#LK P0ԕL0[S LK 0PPU u  l x3 p1Q,,TLݸpA@#@3T Q p10S S_K <2P,ø20S2 zP`* cPP0S U 0S S_K <PH,<zpPl$P`@TV j1 p f\Q -0pt1 @f]/KpA PQC0S x ^?K XPlAh`A00X0LQS P83 00S 0 0yPPP  _?K| ,#p0\0 0 ,0S,>0\lLXЈ܍0x|X 68 <_X0<L` -LMd@( 0 0CS00ä02((0 0 S kkT --Pp@L0T0`0   @tyh0 `P~0PSTĨkhx 0-LPL0 H@ L ׫0$S0 0 00 llk - 00LS t0kl 0-|PL0S l@lx宫X 0 00@P@0T&0@T0 0 llk 0-TPL0L@S 0S \t0 0cS0hRt0kl -LAM M8B>K0C0C0 +,  %@$ 9 p< 8 4 BK J4`J U0@S񟗾llDP 0tDPp 0P2x6u04S@440S (D()x$$ U; #0SS5V4X24UV 4V00V00S30S#30S X X0Sp3|3 wX30 CR 0R0 S 0P0KXu3 00000S "01000C0W2 0BSpRdppW00X00S u2 00000SpW)0U0 U00S@$p0 @<2QP4@ 5dW(UpX-U848S1  8 V-0K`ZP4A PP210SS5V4Vڐ10StA0 CR 0R0 S 0P0h4$RB>K 0C c R+#$ 8Q 00 S Y44044 1V 0  < 0 YRT 00S <$`0RR0F<,0 S x,<< 0 08|t@\7Xk؎ -LM00 (@(0 wvk\ -JML M͟@͟KK`͟VSpx=x͟N_Nh=,p 0P@004 L=P@0@= 0 $ 4  Q 0-S=$vTU< v<@T $ "< <R< D D D D 4 P`# <0S $<0SxLP004Sd4S _4SZ;S 04 N04 刁P; 4 R`T0|S 9$0@4  4S ( $+0S\;`4 2@h 4S 0 |;IK4 4AAP4: S :$v嗄`E>K0C 0CD*00P 4S ݥ4 SL:T 9Pq jPp,$J 0S= P P39`0S 0CS0g` 4901pq `v` b4S97P9X P 4$S8 +094 4S   P& 〥}4DSx8@{P ol4TS48P d4S 4  4S  P7 0S) 0CSpU7/4 Pp``@V70S> L70S 870S6$'4S.ʸ4S 4S'46# 0C\0\00K.K6 B BƟ0O4Sʸ4S 4S`6BNK4@D@D+8P`pw  |60S7 50S 50S/şP*0S'50/P0S*5#0 CR 0R00DX5 00CS00ä09,5ΧVt xaW P tXX4 ! VO4#0 CR 0R00 x4塧K.KH4 B B0O40S 440S 40S $4Sʸ4S4 S440@3 0 CR 0R003P@ 0 CR 0R0 S 0`0(3P@ p`40@40@  D30S2 20S 20S*"4Sʸ4S4 S4t2#0 CR 0R00{42 00CS00ä0p240@ t L40@ 0 S t1P@04TSx1P4W`㬣㩣4S2  㣣.㟣㜣4S0 10S$1 "@P004S&/4 S0  4S4T 0S0S ,0 S,9|0п ,pD0\kX:h<_ 6D(8kzzP8@\lx -LMH00 (@(0 YsTˢk -LMhϟ@`0 _X0K, 0` 4` <` 0 0RS ,0S X,00-S >, sQ> r>0S H0S , \.0 80 R@0  D0 H0 S 0L VP! >0S f>0StNP00@0S@<0S<|= p |=p*㗢0@0 咢< X,l}PS ,00|SO ,$P@80S 40 S , 7@r<ol= ,/P00,0@T  T, T/0p0W<0S  0 S, Ph<0S 0 S D<0S ,} , ,0S HQ<0S X ; ;RP;RP 岡PH0S  0S  P>0S  t h P@T 4 40S pW%,/}P$;00 :p) ,00|S D ,U0 00S,  T*0ST:: ,c0 00S:,L 80 00KP0S;0 LZ0 SyP99a?B1cSQ Z  Z@ 'jKiKKgK Kx K|n/Ko?KmOK@埣 PW1S_1S\1SY \!1 (,10$10 < ȟ4<K^ 4"<  0jKiKKgK fKeKKcKbK aK$K(_K,^K0]K4K8[K<K@K n/Ko?KmoKHD`GP 1S1S1S  lQ0 81 1A<1 P1Xt\@1HLx1ap1!0 l1 TD|!0  <P@!4<1  90+11b00b+, +'+" E0S00 k@\8XDp -LM4`@00CS00  ä0 =, 0$0000嫙TTk -DL$M0D ,0 H 00 @ 3uP4@ 3#3Q040 3@T 30S 30S@@S0SP 3it30S \3diT3 0S44P(IPP7㫙c0@H ,0 P@ ,㞙,00000 4D P`B00073,〙82`D H0Pis4"0@0tP 20S @tP10S {Q0S 0@T4D XPK Q0S1Pb0S0@T 4TD @P T0S. +0A0S1PC0S 00<K0  <0 K᧰P00S0  I00S" 0,0S@0  {zzDp̐Ld8TT@klX'WT 0-h0LM0 0PK!K0  ]@T0(0 qT0X$ -/L`, PPU1 1UIU/0p0W `0h@+l.0PW0PdZ 9X0l000Pp 0X0U.S100E 00EPEW Ȼm( -LBMAq0 S P 10S1  RAnK `F`F0X!P0 09aP0, ]ha10U B>K 0C0$  0 K(4 0BK @@ 尯Pʰ00S0  RU 0K0 ++PP@00S 0S8 -0TWГX'ܓ -BML M\7X'X70 P'P7P L , `@'P  0 S 707+ 7PP 7@P7wP7gP6@6@@PP 6 6@6@4P@ 0S rPP rP rPP trPPP`O\6\rP6  D@&P 0S(60U0S 60@T1@PP@ 0S rP rP rPPEa5P85  5X VP UP p40NBS񟗠$0P HXdlp|  04V#00#0S4H33 I|3CKL1 \H3\  +6 <3033 rP#h3% '2 2T3 2DCKL1 \H(3\  f 3  l2 0"L\pR2202 2l0 2L L HP ZlP BNK@D@D+CP2@^ @b04SBL4P 10L [P4P@ +F CL@1 0@$ D4 < 8 4D 0CK`AA A0QS| R  1d1 Rf嵤0S 1 $岕P@@T  @0Ј܍8h<|пx`0H%08@hlԿLbkD:t`@xDfl -L h p-LMvP0` 0S @0S Qt00@P00000S T@0S 5t00$0 $ 00>`p鰿k p-PLM 200CS00  ä0 10S Ae勘AQ OUPE IP^ @0 SP00U1P`1tqe0X!0CS00Ӥ0"t PB p?0a0S Q00Np@ P 0S 00S0Fe0  00S 0S d00 CR 0R00 \0R TL phh̿ {Pp@-& @`QP 0R0S  0R 0S 0`S`PQ^pppf p-d d0LM\` X0X PPP0@T000p鼶ؿ̿p@-AaP0$S!S0S S001  00 h!h1!Qp0 S S8  S0S00 S0000 S S S "S \S0S 0 0S "S P00P p4 0S00 S000p舿Ŀx:<+ -PLMp(c1@ 1QQ! a#d0p2V*Q 0S 0S ^0`2V:uioP@U@p`0` l P \<c0< cPEU$k,f\x -,0ML  0c9)0 -LM C@ T 0 oP鄖 0-0 L0C@R PP 0 Q000鄖 P0-L@ 0S Q 0PU*0Ϻ0PU:ɺ0hƺ0 -L M S( 0$ S 22 P$K(K"չ$ 0BS (0 2]c2 B0S22R(00S(0 2P 0Sd¯P 0S (0DP420S 1$ 2 +c@ @ڡ2 @ԡ1 @Ρ1 @ȡ1 1P0S1@1P(0 v\0`0PV  nP@ph mP@ 0T.S@DpP0<0!bTp(( QP10S11  V  `0 b R00 V   eQP0b `鰿\ 0Ht|Hş$ȿahpDؗ8y -L`M"0pVQ@,0 #20S *^K"_oK,P@8PlB@yO0P"}X`100ZQ  44 \0 0 1P0S 81\ |00`SX1X!0?2cS Z<100Q 1PBNK44 @D@D0R0SZ000` P wPP@"o@$00,0 Sl,(&鴶0Ļ|0 "Q<_<\gd -LM0l -MLMX0Qp$0 ` @20S420S W 2  0Q`2 K`AQMBK@ PP[ 1 K R10000ӑ?0C:SV 0 _l0  _ 0 `00h0 X_~$0 S@$g%08pxh(\ 0-0L0M0@PKS@,  C0 㲷0S\@0SEڻ 00CUP۱ λ 0鄦z -0LMp@00fP`P jP $KU$0`P R r`000000S`PT 4@(i_ |d -0LTMqԑ`PP'PA[ 0r10000S@ Prx1000PU@\ MP H1H+_000 00200`KdKhK\0KX K T@KlK Ҕ, ᛼l0X T0 h0\P0 d0v.BL0 `0A BH0 040 D @ ]0p00V00S00PP `0hH ^V @@0^ u|ltxؚ -MLMBNK0@D+p$0 t`iP ^KPEP@Jt0 K0/S s@ JMP0S/S$0 S$&$0m  0-LMH@0Psr0 Kvp 0SPP0lwt@ -LM@P00s@п -LMH H0q,0 F6&6K 60S |&Qp6\Ɵ  d@ ( A@ _P$ g@T@dTd@K0 %y50PCUڔ5 raڻ@ ׻ş@ş`g0%yp `P`Pp%5VF%T5UWPT  ᱻ@ ᮻ5@` \ B0%@P[y0 04bQ c<" =9 B =<" $8 82 0 S0S*<#NK\<8" 0 T< 4020bS aD"  BD" @2 =9 =D@2 P@@/ 0 ե%KHP;%.K3/C0ur Q@ N@`0#y E@ B@`t#x%KݣT3OK0ua2g 2crB.0@* #? 2cc#aw0S0S%NK/ PڄŸ0 S 0S* @ @" <2S @ @d"`xN !PV1P@Q%K 蘦0 ᓦ%K d~1Po0uv Һ@ Ϻ@`0!x ƺ@ ú@`x!wxd1OK0uf2g2crEഺ0@఺8!?` 2cc,! G]xOK᡺Q 0H~㡌HP 00CS00  ä0 !巏(,0 S,@".A0kп,Q4,yųh8ĖԖ  -x3LMp 0@@,0 KAH3H0b0P a  B=9 = 0 P@嬟/ 0 ៤K葄 KP@/ eP @K ͥsQP0吠KS0SLŸ HŸH2@K00 eY~/ ~/ "ŸP@Y00 d!pw\P 0SL0SI@K]/ ՚PBڜ R>1 P@@PR50S1:P*P@ %K l0 @Kf 8R 1@o0ef2f2c BDहP ᡹0Ϡ#PE0l 2lADd`0 @Kw@Kᏹ0 S00<@,0 Sh,F!.A>P?|0ȆCkų -LM0`V *0X0`YV@: H1 'PUP@`VA0S,0 :p0AT0m[ 0S :000CS00  ä0#   P@| 0 @0 C\0\00 T,0p0S,0 `V -L MD00 K4@p( P0 1[SP00@ht@ -0L M@K 0 K   -T4LK0C(3 PB\1 05RI )PC810S? 0V</ a 5R50& 0TS  R+ 0R  \@$T0T0S 0 000Sd0 05R d H00QPf   $0S4$0mm̤x -5LM@P  ^N`aN'P#h(x((((((((((((((((((|4 x4 t4 `4 d4`X4 CH$pc@040@cTQ6X֯tP bίP Ư䣟P  㿕P0S00#Ap V3  C#PR ~0000\3``C<P0PPP U2  V.㉾Ή0"P0U.@C0ST0 UڠV É2pxl |坸PPlh喸PP\_ 0K pLZ ,030ͨ,02" 埉p@a H HH1P> ᳨ 0QY   Ap) 4ʌ4 40K p| tpl hOp`  ϗpH  p4  ҋp ø0T0S H0 00G 0Lbmmm4Шm$ 0@mmL`hl0S̩m(4Ȼ<HT8 6 -0L UP0` p-LMP 0S 000` ph `@,0OP0080 04 ,0 $00800<`phm -t@LM0 \D0,000 0000 04 $0 0080hHm -Lq0P@T Ut` ,`\ 0SP0 UV@ 0U0A 00h1S`P 0 = 000 00}=00  00'<0 0 00h|00 00 04 L0 D0080 D0,0h"L/\<m Mp-L$MDbK0C0C@^d F l6 zό< NK0 ,6 p@ 00K?0S q 066KSK?6 0@00 0A00 0B00C ,0D0000L0P0T0X \p< p-LMP$P㼥(P㹥@`40S8`V@Zph魥 p-LMP0S `^^@0 @T @T0PK0 ᰠ0phӷSh -QLM`PDB0S00`00@r0S  %N00 N1  N 0 N( RN$ RM, R M`@4 Q 0 8h!0!\M`V@  0 @ v> 0M  0 v>  0M 0 v>  0\MPMh飀Sh|ԮT8` p- LM0Qq`P$0  L$ 0 0 G$0000 { K@ $K $ R2(K0 (0 ( { 0p -Pd 0`&@L6Sp06S B0 6h 060S 0P&00D0D  V $,$ h$T\ -MLM P, p < 0BS8@<Ke<0@pK@0 @G 00T`K0T0 S" Dn 1 S@KHK0hPK0h0 S XS ( R h{$ R XvT` Pg D@ QN 40S0@L 18SGSS,SS8@4@1 0@冡940!1ZsNK@D0 @D1804 04 1`1Z\H1X!lsNK@D @D8ר 1 40!Ψ0 04 R8@Z ZK'P  0s 7`0V P7 {NK@D @D0h g  T,0 S@,0د`T$4HP -LM( 0R@40 ,0 00  ک, $P թ0 X Щ4 , K 04 (pK0!=0 ( $0  `40`V0 ZG0  P  ,K (, 0K $0 4K 4 `4 84 `V@Z04 -LMG0 @ 0$0 @ tp$`KP 0 0 $0 $4QQ 0( SM (K(l -LMSG0p 00@00f$@ p PP+(p  (KlP00P@@TP D(@ $K $'[$ -L M q`0P60S 0 6 9P@0610=S 0`61SQ0&P _0AV2p|P@0P0(F0F0F0v0 61 p 0V¨@ Ῠ0@໨@@e061S @0@$S `Sᤨ0Td : ᝨ@ ᚨ0@0@6@ 0 Dfа,T p-LMd`0P60S 0@60&010P61S 0 06p-00S ^0 0-S_0 000S0 0 p-0LM0 S@PTl`d0P@pT, 0s |y喜00pmmm\ -LM⁁@P4 8 0k 4 8`@U``````````````````````````````````````````````````````````````aaaaaaaaaaaaaaa`aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa`^@Th0*0pW 0< 084pk000dm -LMP@T. p, .T`% .V00.R0SV t0000PtX0000P-T_T _TW$pV @鼒̱ 0-LM@P@ .R r0\00000S0S0 S0 S K5PP 0鼒 -PLMp Qi@h0T3* Rr000000S 0RQ 0 dV``P0'S"S $S `S \S`F\000`F0@0T:V00``0 p-L M`Pp P 1Np 0@`]Zwu PK0  ` 1Kᜏp@0DST 0 pHȻ<mT` p-LMa 1 1<  1  1P1K/ 1@P 1@ 1!1 0 ,00 ` 0 00,000 0< 0 0< @  0 ,00P  0 00,000 ̃0< v9P@ PKl 0s ?4 VD0Ppm (l$<_ -LMp@W dF9P@ K r 40R ,gUm<_  0-LMP@K  @@%P񟗮ijjjjjjjjjjjhiij$j00 0 0 j 0sM }S _/ X10SWt 0#S 0S 1[ X0 R T0S (0s1[ 0S 00S 0 SS m -LPM q0D`K0K 0 pAP%(B  L00L00S H0S L0S0 ( 0(P0P,K TK X0 DP0K[X0K   ` 0S _0̶S -L(Mp0P 0 kp@v @`K > ^ ppP #[A0AS 0l 3KppPϓ˓Ǔ 0 S 0i i 0 -L(Mp0` 0 'p@@PK1  t \p0s 3[X  KOp0s ና 0S 0i i H -LLMT0` $0 pP0 D@K ᾞ  pP)3[A0AS%p0HQ$l@K( ᣞ  pP 0S 0StC 0H0T0 /+$0 S$$~0i d6i(< p-!LM@`TP 0S0P0 @TT P0@00 6P@y Pt` R 0S @p@p0S  0S0S0@0pST Q0S 0R00Q$ 00 QS -L0Mp0` 0 "pP- H@K(   Wop 0S 0S\ኒᇒ00 0 0 S 06i(ȷ -L8Mp0P 0 T`K0 2[ :sP@P0`S PPP0D oP 4 0 S  0lB 4 0-LMdP0  ( ,  㧩p@8  0K~p 00@0D\ p-LMQ0@ 0 (0( KnP1[S1[Sh0 @K(X nP8QH~0@( nP0v0(($ KnPn $080@8!4 40S8a 0@<@0 @@0D0D0,`K, ( ( nPL0< 0, Q0( <00( tnPt:0l( lnP\2pqB@xpBȸyBfB@$Dm@ngBtDnn?wBvB Ĺ -LQM0Pps`KKWK, KK\q  @@0@Ɯ WKD\1@< 81 4 0ƞs`OK VK0 0 ,t 겜0 T1 0XQ P L1 0VK ڷp@0  0 ,0S,0Թ -LMp`A< @0R 8 (4P`i 0<0 00@0 Q@<0lS<W44K  G"[<0,@0 R!(0P0<0 <43P<0 0<0,0 `, <408P<0, 000<0%<00<0,0` P,  <0000<0h@-@+0< 4@, , <0000<0,V  -L M0\S, `Q*\ 0H , Ypӕp0, 00 0S 1 \ZQ0S40 P@0  ᷚ4  pP@p0|  ᤚ 0 00 v@0 0, \S:T(Ld -L M, pᥛY0  x`, 匁00S" P0 0a00 SU0`  U@@`@, `0  4 RPU`4\ V00Ƿ0` 0鰺 -L4Mlǟp, XP T Xp @gY@8Z,\    \ !00 S T0S 0 X 0LKX 0 0A0C3Sg̐|X 0 BT0 X 02 QP0 0R r50000S  Q QT  x0: p 0\ T 0T0 t0 0 K0K p pp0  &!0 0Sx W4  0T|00 W00S4 g TP ᵗT TQڗ Q@4 aLT R ZT Xp WL K0B0C6SꐔT<PP"00 0PET3* Rr200000SP 0RQ 0"XbP``0'S"S $S `S \SPE\000PE0P@ 0T:Q"00PE00P 8 #" _| {P` z0!WpPRP`@/08C808#8d!WpPP`@:0K0C 0C1 BS 1S⍒@T ,0SH,0158L;,0P0-H0@0 80840400,0 TX -0 0CS00LӤ0I ^00# P 0 000t0 00p PPQ8 00C 0000hXT p-LM@T1PL1`P p001 0000S#Q"Q0P0`pQ q0 00000S-Q0P0`pQqt0 00000S T0PL0`p408 P,0`(0 00pXTl 0-PL0@S| p0 h0R`0 X0 T00040 ,0 T(0 000d`\l -LM℠0SxpxxPx`0 0 Z@^L0 D0 @Y(000d\`l -LM@p P p-LM@`Ppp UP\PP "P H0D0@T80T0s@D0   0ppl -pL`P@xP000PP px0000D0SX0 L0@T<0T49@D0  0ph(l -pLPBo@P -P_P p0 00000SP0 pt0 000D\0Q`T0@TH0T@@D0  , 0h ph 0l( -LM$@" 0>iPHD --LM @0| 35xp 00S \T UH Q<00S ,,9$lxLmL 6\g<H --Ll i0T T5LD /D080S $ ! LL 6m\g --Ll C0T T4LD /D080S $  LL 6m\g --Ll 0T T4LD /D080S r$ գ ѣLL 6m\g -L`@P! pR %R0mS80L Tp` PD"@`PT@D ń R00 6 --L@ 0C<0 2/P@\H+P@`@@T 0@@0 /P@5 P@.T 0D0 P@#Ty 0H0 :P@P@Tg 0L0 :P@pP@ T;TTO `0P0 0` 4` ;P@ <@E0L!!!?!C!c,B^ B^DHL@PP 010000012c12c1 C @00012c12c1 C @8lP|$@pȲo 0-LP㡋P@4 f0S0, P0 p-RLMP@` 0S(0 4000p p-LM`@ 0 cPPhx u 0 0bU *Ho=0#S 90S uc ph -Lp`P LP@TPtTF;t 0S 0#S h90 -MLM$0KA ,0 `hQR Q Q d8 SKAA ld8 S:qX lPP PP0 l(KA Al K+B 0d(0Rp8:spP@ ЊP@ p(~ZX>K0C0C`#8 嗏d8! SD5;<#fKA A`t(d8!M@S:rtP 㙊P t( GKA Bxd(0@R:q|xP {PT x( )KA A#|(d8@S:rv|Pp ]Ppk |( PゎKd8H@ HS( ];KA A01(81(Rd8@ST:rG10P1(> (PUڈ< 8 X ᵈ ᳈᱈P(1S>K0CPU!d8PS 0 ( hX d8 XP@t KA hKA A bx40 ,0S ,0@t4\ 1 P-L`( 1ȁ 0@Qd 01 00)#PVq` Qxh!0 PTP 9@ 0O  Q0 Q@L00SP 0@0CS0@0 09 00CS0p@0 09< 0R|oxopp -LMPPpB 0@ S 0 S`ev 0S耟萟0 L0 R0 0ρc8  00To  0-l@L0S0X XP@000=0S40(0=8Y 0o( -,0LM@P=no -LMHH P@000 00@@ThXp@-@@`@Q 0PA0UPEpo\ X X0-0PPL0000000000@"@T0oo 0-T@TP0 SL@R00 00000 oo  0-`@ 0PSLLH  0S0, Pç000y 00o o 0-lP@0 SLXT  0DS ^P00W 00o o p-L M`00 峅P@ 0$PKS 0S @"p 0 0 $0 0@L P-L he.0@6PZ(8888888@P`p88888888888888888888888888@P`pQQQQQQ Q Q  Q  Q  Q Q QQ -LM `0RP  q0XSxS00@PGK GKk0p1h@  T00R00ST01@T@FK!1 020@T0 90R0BSbS0@PGK GK40p1@  T00R00S?T01@?T@0! P @TXp -x0LM0Sd@ 0 R<0<0^,P ho Q-L@Pp`  a崉@@0 0#0@T` 0 P@ 0hGtd@0 0#0@T` 0P@ 傉  -LMp 0( PP`30K f 0P$@0 0#0@T@ QLp@ (0 S \(m`VDT8PP,K0 -LMQ0@ T< T: LP1 0S0@0`0PVpoP`@ 0 \0 pȺ0S00 S 0PVP@cLh@T  -PL M@0 P2y7PR1P@ 댂PvZdBP0S P & P 0 RP0 P BXP, 1 0R S0`00\Hd \Z \L ,KPP= q, Qᐑ xPtal0 Q@L00oP 0@0CS0(A0,10400CS0@0006PUlxP0<6Pc ,P,KRPPXL\gLh<(p$ppp(,@ -Q00SLp0 q00`Ԡ0L00P 0@0CS0@0 w0E4da00CS0D@0`0$(ppPA- @0^p`P 1S \0 A\ ^@p P01 0 0CR  (@-tt@ R `0!R 00S01S 0P 00 ( -P0 @ | |`@@t0t @L@;0\p0CS@00h%0p ($p -0L!SPp+ EP@! /P`0!S ?9P t0 l0Phh*`0 g3Lw3,<_p Xp -L M@vp"Phh"0 `TS, @2@"0 p(2@ P`<B2  P PWP 00CS0A0T0 Pp00CS0`A0~80X00 S 0 ,0RS 00S Y 000 D 0S 0 0)R00SX`00PY0H H, S00 (0 00cw\p0Tp,p -LM`0S00CS00@Ӥ0t TG "PUʜŸ0  @2 ꀂtŸ0 Up|00&P <2 Bp42R ,r0 0p200CS0A001 Q( Tx0 @ 0@Z P1 0 0T1  00(! 00S $1 RZ J /2Kp0 QP\00征P 0 BP0R P0 :02X$00CS00`Y 7@R!p4,Tpp0 -LMP!\@`- P@#  /Pp0!S 7P t0tp0P d(V0f1D1$ 1p 0 -L@p`0PS;T00T00S 0S00c`^ 0 T 0 0 `P @00T00SP,0 R 0 Rkp\T0 -PBuL`@ Xp0S PPEuA1]'p -L MS , 0 0 S@`T,x3@AP , 00L3TDդ 嫄00 @D S 00B @DPPx 00 S R"pWЂ W`l000匀Pp 0"0C`"S0b0_Z rUAfP 00 @G S 00B  Q 00, pQ Q@L000OP 0!0C@!S0A0 00X00CS08A000{000CS0p夐0 T`l00P 0l0CS`0E``0? <0N0,j00CS0Ldp`p<pp@ -$LM` ,` 00CS00@Ӥ0xtV 聟 0R,0 !0@1   T`0 00 00qp0 RP\00P 0<0CSP04Q0 d0/00CS0@0M0 @,0` Vp0 ,` Vdl 0P00\/X08`0 0  5@h`<TLpp -PL`@pPEuȂ `V 2p W\0P0 @^R00S$ 0t CR 00PEu@0@0CS00  ä0 0R P0\ CR ^00 pQ=0"#CQ0!-000 80 B1R0 \00 0 B0R0 ,00p0R P‘0R P庑0Q P岑긠 Q1P  0 jC0Q| 000Q P0RH ,0@p_0 CfpIq$0<X d'P3VU00GUX $ 0nS` lS0 P 0 R0 ,000gPc `0pS`0  qX QX} 0qD=0  00Sn _Pph L= R|QP=- PT 0nS` ElS0? P 0 R03N0S!\  +Z\0S \>TTTWU 0d HP0P > R > RqXG ?;`0pS`0+? `|? R$! 0nS` lS0 P 0 R0s|?`0pS`0? ? NPD010CS0 0nS` !lS0 P 0 R000  Q0 P|`0pS`0< =pP0000  Lhq\ -`0` LRTLL0<SS,0 0Qڄ0D@h\ -LMܠPp@* W* 0 0S@@T0TbU`APP l0 R   0坨P 0!T 0EE@\T -LLM0 R8Ÿ" 0 q00  R 0  R1 A0 Sd KP& 0!S] 0SWʬaQQڌ 0  Q @0 0 0 S 0  }P,q$Q0L00brP 0@0CS0@0 &0"00CS0@00`00P @@0@LXqqppH -6LM PR,P l,K6\@Pp P,0 Q@i0! ( P0 S 0 !R %R  Qd 00P0\ST 0 R Rʤ5 u5 P %Q00!Q`uTş0 R`l00qP 0 0CS`0e0 ~80""00CS0D0g!0 0 Pdt Q`l000}qP 0$0C`$S0d0 ?|00S? h@v3 , Q@p,  0 0,0P0Cs,0 0 00@b\s Q`l000;qP 0#0C` #S0 c0,0T5 2`V0 0 P-ꈂ Vp|000qP 0@"0Cp8"S08r0 0P!l00CS0HPI 0SF q0 Qʠ0 0@T*0 0P T:0@00Pa Q@L000pP 0!0C@!S0A0 z40!00CS0u`匐0 QP\00pP 0T0CSP0PP0z Nw0pLqqHdppp, -鼁LMⴑ崡`0SU !@PO 0 SdP? pqP0001@T V T (1 BR A0 0 ] P`00CS0@000.S0 S&P 0 S R@ 0 P0`00<PLp8ph -43L M0 00,  R U,R P@` :PpX آ 0S2s0@` T QڐR2 Q@L000oP] 0P"0C@H"S0 P4 000 S/ S- @PP pP `0S iP@` @@ ~P|0p p0Zvj@T,@P0 $ LdsqY6 1 R,0  !0S 0\.\P 利K_P  0R|1 !VP H8p P\\  !^80-\@Kp qL[[j\gKl庩0S4  Tl,X !L1`P8[$ th 60 (  -LMMpA^K PE0PE` @ 0 .Hp 0T0 {Pxph5QP\0P 0 S @ @(0t,08D -QLM@l M0S\TH0S@4 40 0Rh.긨0t,P0 -QLM@p &0S`X H0S@4 40 0Rhꐨ0t,\0 p-LM0AP: #:0$ h?`L3c0(  ,0D?B3c 0IP@BV;  (P X0S [@0<0V$ 3P M@B0V0 LP 80-S |l;@pL0S LDJ4Ar /Z$$@Mbtht -L 8KP0 R  t 0-,@,PL $^ Z0 -ML,M::K@(L:L , @0gS*K:KpKHLP0 `KDZDH00800($AP 00*K00L0 0uS 0nS0 0 000JK(@D@D P P>K@@ F\9hYY(K00T RdJK(@D@DP jK0(`F(K`F$ 0<P@ ?hZKK0T(PE(LPEL #% *01<P@0C0*K( B BS1p@ 10DES񟗽gggggggggiiiiiiiiiiiiiiiiiiiihiiiiiiiiiiiiiiiiiiggSd$0sX40S000 PX pꀄ00:KL0d$0P0-S 0SKPDT0\00a30C SItktltlPltlnPltltlk30Sn  0S'.ç:K(0C0CP KAAP NK@DK@DLLh#0! P *@P@00: SP Wpl m@00: S S0S2"2P  4B0S 0SP mjKP^+H20S BK@\+@D 0BK@S@ +P10SOmGNK@D!@D0@}! P! !%*xA0S ڐ10SP10S  0@BK1PAK| AH0 P P 10S0S00SإP 0SSWpp P``00S 00hl\4<@X`tLbdPTt`@xL:Xp 80<hLDpo - LmH -LMK %P @0S  [0R 0[S 0S -MLM% R pK9K, $ C J8P@850S"(Ȥ ş0S 8P 40SK KP 40SlGW[K`+K0(PE,`BPE0`K 0|  PD40S8)WW80S  K,0PS /3P `+ +C3 30S`G30S C K(AAP3p(K0 : SKR SAPV< 7P`20S9K  0v oP 20S$IK(@D@D9K) 4P Uʥ?Y00S 020S 0S@  (l0SKK(@D @DK 0P Y10Sk0S 1Q 1(K R9K4d1( , $ Y9K$Y v cVP Y00SY$10S (K0SK(K(00)K 00S +K( B0 0C00(K B0  K4Y00S ,0 SP,{p0T 6dd<_hXtx0P p-PLM`P@O <10SK010SG$10S y0@2yp00 0 ~P :0S>0;0P4LQ ᬟP|+$, l0Ϡ/ (@@#bCl(K( $ @  AP(pXtp Mb 0-@LPS6P!  PD|_00CS00Ӥ0 Pp@ 0@ 0CS00Ӥ0  PpyT0 h -pLQ  ᅤP@ XP0@S AP`PD1SQLx -Lp@`PU 0 A0f0@L0Sr00a000 Pr0000D0 -L$MB0, S`20S||x0, P P2c 0S 0 S0 00000 堡0<0 <0  P0K *m/ K0 *P* @0 ?@*0 J0 L,P@0K040 pb0 0@<0@ 0@0S(R&SŤoˬ0000P*T JP@*0 K0P@ @0p!Y@LT<p4<D M-LM01, 0p`S  o*00S PQ* JP@ I*0 K,0 txp `0pS  0S P@P@0 ,0oY@tpl  0-0LM0PS :S X@_P0 HH ,08 ,0 *\0, -`QLMY0rSwS ?RPPU X100G HZP@@ 1,PP10PP4PPPPPPDP 0p000wS  @0P` XH0090`0wS  0  P  0 @X@H@L@P@T@ -PLM@Pp`(0S 00wS` rS"`U |0 0 0l000d0000  FVPS`MSXXT@H@P@L@ -LM 0K# 5lP p-LMD0@S PH`U P)P0 D0` 0C00  p 0-LP@@0D0HL0 -RLMP` @10@P]T@TSQT1Tq 00 @0D00@Dt p000 V@O@0P00 V4|p V00 0P00 lpX  ec8 000DP  O0 0\H@L@ -L Mp@  T,KPt $+K*K < ^' K)K&K%0K(K  ^  $ K` 0# KT, K< 080  4@ ]0000 T  <K5 0 pS 0L@ -LMD0PSp RRP @T @H@)P0D0@ p` p P.  gsp0P f 00P ] 00$ 000 P@D`  L`VD0S0S$@  g<0 cP@L@ȠR0@-,ȠP @ 0"\LL ^NNQ0RPBu 0PEu |2\x2LL7&c2c0T2RCV]EH0PE0 0  0  0  0   0   0   0  P @l1'7c2Tb"U cbUI U30 0  0  0  0   0   0  0  PE U @PEu 0PEu 00'7cb2" cb0q[ -`PL p@z).0(Ã$H7c"( 2'H@`c\@^B^BN00QA>AAQAAq 0S 000  b0 QŒ00 , P080!Q,000Shx^Pdx -0L0SdxP p-QLMP@`p00SV@+00$0!0$D"0$0!0$D"0$0!0$D"0$0!0$D"0$0!0$D"0$0!0$D"0$0!0$D"0$01`FV$D#V 0 0$01`V$D#pdxPQ  0 " p-LM`P@@Tp -`PLCM p4 7 0 (1 0JK1 R0ڨKKK 0SK p ?@`PK  R p ?@`P4!' P@-P $ RS΂@ 0p`809 PL0  (,08<lPP- $P Q <01 Q0C 80<<ࠓ80 p-RLM@` @0S01RPPU pPp(0 PS00P(0,0S00,0| (PpVF20`f$00FPS0,0$0p040$`phdx0%0 0X00L0 0T00P0ll -$@L40pS` $P0 (P4(Q$ 02(0,00( `cV:4bqY(0,0000004PcUP!f bY`V 4f [Y(00` 00( 0S00,00`S*0,0 -PL,M4 8 ] $`VZ 0SW 0S0SQ0 S 00440@  < 8 0JpWh: 0 Q7h威pG:hQ D*00 0Rh S.0L T0l pl0T/ PP0L 0Lh 94 094 000`0  h0S*T0 #L B ,K W+[0SZ0Jp[PW*Z 0JpW:+0[h pc8 VP0W*Z  0JpW:h +0[Rpc8 00P(pG*P0W*Z  0JpW:+0[8pc0P⨁pG0W*Z  0JpW:+0[8pc0 P⨃pGh` 0S|PEu PE0u h ` h0Sw:0S+ S 0l@LT0l` T/^p0PPL Gl0`P00X0d 0XpPP0L 0 64  03T 02L0C0,@K W+0[SZ0Jp/,0[S ,000 /[0 [0 20C"[0L3  V/ [+0[0SZ0Jppb82[+ [@0,0[pbS80  0@54 00H000HQ W*Z 0JpW:01@ 0C0 @ pa800X 02P0C0,@K V+0[SZ0Jp,0[,000 /[0 [0 20C"[0P3  V/ [+0[0SZ0Jppb8,0[+ [@pb8&2[ D0,0[ 0H0HQ W*Z 0JpW:01D 0C0 D pa8H,0@D 00lR0034 0f@Qt H D0PaS<@P c 0 PeU(0@Pb40e0eU P@@0UP!0ee@0@ 0<PU0< @0S @ RK @0< B0< @ 030S4 WZ< 0JpW4H@ l0@H 0Q00 < H0c 48(4<,(<4 <@SH  14 000p00 L 0L0 <4@(08SR :%<,0RP0 e0e 0L P0l0W0e0l0 $0 4#4T4p$`0% -L|Mp t x0 p0pLK W R *t0  0 Z00: LK00SP Y!Q | x ,@K0P00@0,0K0 2K+PKSx0 00SP|00SP| |pY100pcQWWQڀ p0R0P0SKKplK 0p Wj0K Z*t 00S 0 000峠 Z:p\ \   T#T3̠ 0 @@  9x0 p [S\!`0|p  0 0 l0 Q0+K,0KK `0,0KպKځ 0,0K0 "K0 | BPPd06 ,K NSU G0B @T0DLK `0`0C`0 W< 00t 0p W0^ \ l0 R|00  *00cQ0 R:p [QR! C x0  00 0bC10@0 V,0K+K"K# \ 0S x  p +K06  ,K R G0B @T0D```Vx010 B 0`@L -LM -L4M@P&v0oS000 gR   0尖mS000 0fR   `X0 T0 P H p&npH0@ 0S񟗇,8DPp\pdppppppp```H  P 0SB 8 1 -R1 0@cTQ6H0SL P R/V``X00L` L0 @T 0 000CS/00,K 0~]@'0S0 t,0 R0 X@ 4@ PL oPP `pP@ 30C SDdttH RI 0S 0S @ R4 @4 L00L0@8 L00L0@ L6P Dݔ`0S @0SD ^P Z 0S0SPQ TX y8P ZTX F@0<)? q1 l`\0S% <`\0SP 0!R0ꅉ0Ss /G4K8 K0Kn7P0 #80@ 080 Y`V+ `000CSh,K@ KP@_0S ,0 R D@ @ = P >A@ FL"00?P< @@ +0S :@P` _X 2T .P@ 'pT IX 0S0S0L04]@@0|x 0 60 DdX -LM0@Sp UVdP`^0   K R W0@ -L M0@S oG^ 0 K R 0@ 0-0LP0 R PP|0 0tt p@0So LTD@H(PP<0 00x~0L| $7 -Lp x@0 `P 0000\  00S 0S 0S ( -LM"40Qp,0 w0Ps_`0@0 P`O 4d[$K4(@0 4 PN,\P4 T勏K` O0S 0 0P  0S0Q00,0@ fO 0 0 0'P 0S d0 ,0S \,0S 0QO!04D@ -l2LM (40p  f,;;S0SQR0SJ, R, 0,0 ,0++PR- 0\ )0S(dP!,?;?00c$lcQ/\,0 8g/ ,0 X0000 000S0S0.P@$0S0 >/ ,0 X@0@@@ 080,  0,0S}z\0@-@,0!?;?0c\<`?* Q< R:8\0P0S000 0SP P Q! 0/S0S*U 00SS 0 S /S R0S004  -MLMp0P@AnK 0 `F  `F }] 0-U|0 U l 0S X 媷@U)P 0 : S$$$ 0Ap|4 -LPH$HH0D(Sq`: !0Q1 0: S E 0DaP8C 尐Q0 R TQ 0S 0D8C0h |$)P l ]\\ P 8h lx4L -LCM0`$0 @^OA/ K0 0R00P00 P0eS&0eJ/K0P 0 0p 0S  0 K#20A?    MU 0SD0 R0 0  $0 S $04(D 0-P L@  P  (0 0 S0 0#2004( -LMM$E~KpG pG 0,            d$ `$ h `08: S(4X@i 0S4 R 0#\Q  0@0Sl #0S $븓0S3 3(K 3PT4 L HT @D40 @Td 0@: S: Dj@&(P2 ,0S ,K3 @PP 2 PJR 2"(KT$ HD @A 00P2Vt2 8R00S X'BNK@D@D P@9 r X00C0 h~ !$0@007 00  h$r t h4 0000S [<8pq, 0S'PV 0 PN 0 TP@ d0SB N?< @0S7 X[4h'PA 04LT@lx<\hpxpP* (\g,4 -X0L8M40 0,  ( $ 0KD @ < 8 0    DK` -MLMԡ0Pp,0 @ 1Q  0P1#\Q:,0 S x,8FKI001( K$!PD X$ H D h d L S!0\Q00`0@0 0 \Q0@;D$kT`I BNK@D@D` 0"+!P  0PT -LMhh0,0 \%X6R00PP p`WpW,0 S ,屴 V0%\Q11( p R 0%\Q 0  0S 08*0O#K X5 T5\Q!(0,0 1p x00 %\Q41( #K1p04\%0R/4\%R$ 0 $0O@00@T000p$\Q1,  1x0 8 0SMOK,K0#K0 8 0S?,K 800L0T:  8B0R 0i000#\Q1,  1x0 8 0S TJHD3 R 8奃82@ @H=%P0"\Q!,0(0 1x 0p000"\Q!0,0 1x02\%0RS/\2\%R 0 $0PO0#^K8 )00h4/@Q_h@ Q@P \%1R 0S:0S* 1\SL-P%K&.K `"0%K0h 0S:0 `( OJ80 0L T:J S@P \%0R 0S: 0S* 0\SL-P K%.K P"0 K0 0S:0 00hĠ/ 0h00Ttx\Lp| 0)-Lp}H2H"D2Q@@ pP(("0`\Q(0p004 0PS I1 L40 T^:0 000EXM A 000CSglpp 0 0  00S$  0!000`\0Q\ p@@QtPP0 \`Qp@@0 \QtPP00 000h 00$@ lI0 4L T:4xxT(tx -@LMT 00C0h@-p0\ ` L00n^@` 4KR>K0C0C @@_`0 K~KpGdPpGPU0\%S>R0(5 5^ p$=L0OT f(@$0\%R !040US  Z#08 3( #00\0P1Q>KR>K0C0CE.KpW B04% 0 45Po0C45 t0\%l3Rg 4!0- @#0\%83RM>K0C !? 41 @ 0 0t/1E $pWZ`P2 ,0S ,u40 S00X' @BNK @D@D0L'Dp@,#P"0\% 2R   0S@1 WM>K0C !RBNK @D@D0j'C"PXb`1 \5S0000 /LƀH1 iD0\%R0S>P0p T$ P -LM@P00-? -LM 1\0P00 L` @_0  P``V1$,>>P@] 1DBt1 X00@00 000\% 1R   V01 0#^ `*p쀟P$p \5S(0 ? ^ : VP` \5SX0 ? ^ ZlPlp0Q`` 0 A00@`d?P T40, -P0LM@A<0 P 0S P4 p-LM``0S TPT 01@CT*q>o>000pi>0T*0 0   -LMp@PT, @0ShP 0S 8| @0`P``<0 0\Q| x,NCh 0000i0: S88 8 9LxT`$(@4 -L 0 R0   C0 0-@P0LS PP0 P 0 0-LM@lT1 T0SP@_0 \QpHP# SP0 R0 \Q00C0p \KQ0(00 1 \6L10$ \8QpTAL -LM@ 0@ Qt 000CS $   0000 0000( -X$L MP0  0QZ 0SC0S? Y1 ɟ0S Y  90\ @Q@PK0OPo000 @PK0J Qp@T Y Y@ Y& TPȟ \5 S(0p 0S P U @DTP 0t`:P@PUp8\%RX0  0SPUP ` 0@H(000S Y| G 000000)40 7\ETM 7'P@000P0 0404d70 @_\P/ 0 S' 00'\0Qh  00X:<0S DtN0&\pQ0 00h0 0@ 00OWP 0Sh0 ?R6 R 0s &0p\%R00p000&\Q00t00)0%\Q@0P(0SEE  0000000Fn5P 5 \ PVLLU 0H    sPh 00000$\Q ,e;45 R 0$\Q11X}4 R 0\% R1p(0\$\QE  H4\(Q8 0S:0S : (5S4\%Rh0  0S0#\Q  0@> S@ PCU@0t0PEU @ 0@#? 0S:0 3 R @  R0SR0;S0"\Qh0 0S 4c0\"0Q0# cP 4 d (p0h0 4YP2 R 0<"\Q004P4  00 2\Q 0`0l4 `} 0!\pQ  4(:0!\Q0h0 0  J@`1 R 0X!\Q000|@uP 1\%pR4040 O l100 \Q 0S0s 1 R 0 \Q00| 0S0 0S0 0S0 ^{= 9 0TT( L`$Lx,dCD\@,\t0X 6 -L M`( p0P0 ,0 |(X00Sk8"> R,A2   00 PH0 `X00,0 %! 0 @Q6 P3 3P' `| R0pl0  0R 0S R0R0S 10S0S P+  0 R Zr "P0,0 0  0@YTn Xl<<i 8$lL| 6 -80LM, ,0  @`P -1L8M1q 1 !00( L (0K\ X T P H D @ < 8 4 0 , ,0@Q 0PU `TP@  @0U ,0X00bP D0@@ \K00S  $y  ( -LM, (pW`!ؠ؀ z@PT 0S 0T @T R 0S @0PpG`W DP0 ,0 `0  -LM$$ @0 @P -LM88 00 @0Sh9 -MLMF0,0    BRm   8 L  D @]P] 0&YP 0000 &6 \FKL0%ş `% `@5( Kş%5 VX$ 0h d *0P000Ss` V:$5D%`0ş0 V0 *(E0P00\'` V:ğ0 ` S00*PP  V:t4 ,0S ,0S %0 P00S 0 S s S H$)8P0$   00C0 #P  000 00C0  `S;;SRVKH,8p3ɠ \5`S00U.K @@ B @ R01 0#T*sp$#0\%R$0(0   @ R01 0#T: Rr@"0\%R0X0  @TZ0FKL4  AH$ 32BNK @D@D0,(2 R) 0̠ { B0S0?0?00 R*P0\%R00  @yo0̠ |hZ hc<(0Pej0\%1R(( 0 4 PP& PP A0:0090R|0(,D0% y|   PXhlT PLH 6\ -MLd8M \8Rp, `  Q 48 Q*(ȟ 0#200\C0S 6P W0 41 R77 (K(K  (K0AO0KK,0S7(K (K ( K(K0 00RP^^>KMK P6$JP0 0\0S$  R0.S 00&000\ &# 000CS񟗕    L L 00SX @,0 S P,A00 0& d(6 R 0 "Q %R% 0#20P%00C0 %0S$ 0\NK @D@D0\7S^K PE0@008%405 R $nP 0\0000Sڤ 00S$ 4 R4 R$ |P{ <$@0: S00084 0 0T0\FR( 0.S?00rPSS0 41 R33 (K(K  (K0AO0KK,0SD3(K (K ( K(K0000\P000 Q0hNK0ᴀ000002  0`0C0 T6@@\+0SP 00000P p"00C0|"i>KMK  5P<"Y8>00@P \ P !B&0t!00S 0S /0L0P>KMK Pe400000$1  0`0C0 5崀k(m@cPV c0S 00Pd0 RS 0SP D00D 0 D0(m4h<LpT\tX<p@- 0$ $00S@T T S -LM$$ @0 @eP0| -|!LMt0l!1pCd1W0:X000@`V Q0 ( 00S 0pGW* 00 00S PQ 00S 0 UPC`@eP|000p0  00C0*0 @0 0 0  0y% (4 -LM$$ @0 @P -!L8M䁟䡟0L  (0 ( K\0 X0 T0 P0 H0 D0 @0 <0 80 40 00 ,0 , `Sq 0!PUT 0P!@U `,0V00(@@ 000CS7( <) ) <) ) ) 0QP 0S P0  00B.\K \K0p \Q  0  0S\KH D0 4LP* y' (\T -LM(p, W`1 P , "冞0奡 0P @T 0S @T 0 (  0@@0PpG`W,0S0@00-T$8 -LM$$ @0 @P -MLIM0 K0!,0 K $ ϟK0(IKI41 3t?h_ R?K0X^K0$ET@oT2T0,oV- (K0!K000P%P 0/>/1(K^00!1\$ł0W`0U30/>1 10S8K01$E(K0!Lq Qa<P.0\Q0 T (K0!K010X00P%0\0(K0!\0K0/>( `000/> (K,dK0$5S A h $5! l `0S10>!d d0 `8K=K !0K(A0A(K@1 D3K =(@0@L S X8 ZK(AD0A(KD1@ +3K0848 00C bPX 0 2X0\,8K01,H0-BKK4H(KL!00(K!K 0,00CR8K01;1 K<K f0$5S8/p000$08K41K( 0,R0 Q 0( Q,0,00K0 :\%R KK04 x00Rx x0(K0!Q0t0Q0 ɟ0 RP04080<0@0D0H0L0\08K !W2K0tL5(Ks K00! ! PX*4 000CSp<3 2 2 2 2 2 000  0(0CQ 0\0 0 020K 1PX(K!R 0R\0 0020 X B K8\*K08PUԧ0O!> 00R# PU^ ^ $0'0Q$0.`0!008K01K8 > b0Q0cP4 005K088K`81SK<\K0$5S,l p@h0PX`P  ^ 8K01$%^ࠡ101p@0SX^ K0$%^ࠡ101K(@,@$K0O(LPK$KT1 (KK,1̠A/08K(K0 !P5LDA0S`j P 0S |K0KP%0 00@K/0>$1/01^ K0`0T30/>11K0=8K01L 0@KPo002D P Q$5SlB0S xk0S PK0X K$10 $52 X^[0  0 xx0x0x --L  p-PLM@P`l0l R T D0 Rp80Dp < 0  ;pŖxx0@ --L  --L  -LM@e` h --L 㖖 p-LtM/Pwr@TK P0: S p0`rS. 4- 0-/L@XrPU+D0 00/00(+%+!00p -LUMpPKP奔P@lK8ប0S(0: S  SU !P U@P P@0 R000K@zP h1: SD oc$^exȻt P-L 'P " -QLM@ (P T "' -LP " -_MLMx/t?@, @h? d__K AX? A`PP5: S ,$PQ ]P0S > R 0 S> o0S} .@㸞>@ .@> @ @ @@&0 0&0dS PP.P(04.4<00uP]n0S@T = ,0S ,凕=-K B BP LP]10MP \54 S Xd5PUt%x $O2,% @00.Pd5PU̟̟,< nd5U `U< R0  V0S  C>000, 0x,0 t010C@_aK0Po0E" $`PaNK  0X Z0S0<cQ0K QQ  000S d0Sr\ Pn  00H0cQ  000cH00S \ d0STP PP  40L0cQ ,  400cL00S gd0S6 P2 0P0 PR @0n@P0S Nd0S qP 0P4 TR p @4n@T0S 4 5d0S( XP Y,5S05 FS.S  0a.KS>0S d0S :P 0)\(5Qx@<@S  w0(E0S T c0SH P  hH080@_Q 0 ^ H0S.0O 0S c0S{Pw  \hL0@0@_Qj @ L0-0O0S hc0SU\PQ 8 dX0S0,%R0S0L%rx P%0 0p/>1/$E0ࠀ1TPo`0W30/>11=L 00@UOM GP%0 0P/>1/$E01T`0U30/>11=`L 00S Vc0SyP 6\%R0000#DC0xQ 0x@0S H:c0S<]P T6\%R0000A#A0tQ 00t@0S c0SAP dE 0S d5 R @ & |&L L3S 0X%48 p= 0000`d 0hLCV`@0 `P FT 00 X@0`P`/>0@@!~ pāO_P``5!?VAQ!o*&|4PpP D&PP4DC &P(47 0,&4P0,, 4#0#?>T(0 3S  %3PC %3P  5 t3  *dk<"S@0@<F yPq}Rh u)52 2 '1 Q0 0 0V0S8 "0p00Lu 0P5?T5 V>X5P%0 0P/>1/$E01T`0U30/>11=`L 00 p0 pJP 0S} ]0 00,%0aKS><0(5 H0S.0O P L00O 0HL0@8@D`|(<, DPhtT 8\ T($H40,p D,4Hl5H   6TP1 ~\0 0 0D5S0 0 0<5Sj~0P Z@0 0 0;45S#6H0S0O L0-0O 1~(1 P,1 P<1\,rd0OSh" #&% ?H2Ÿ`V<, 0 B0_@|r h0/l0S ("P! <2 R,,(`1P@h00`T*0 QP@T:aAi!1\%R  1  0COL1H $0C.O (0O 0-O 0?O 0/O0O 0+O  S0LRK,!T't0lȟ 0 ʠlP@8 <0\%40RR ,$@4TT4,,h -PLM@ 00 R$hiL< -L$Mp`;P@u Pa0@S pt3@  0@T , q830  00S, ,2WC H R R2!" "' 0P 00C   $4 0C^Q0 0C#0 0 4`0080P40 00pp, (k$@|f$,000, 80D 0,  ?U$0 @ P$00P8 H $@ 04 < P U 00S  0E000D0@@$ @<$`06$"$@$ T0,d 0S d H08/>/1@ 01R`0@\30/>11< 0SU0 0Ŭ ũ,P0(  <0Q`,P꼒yLXd -0LM@H H,P0T ]K edA 0R  0R 0R 0R 0R 0R, ,0R0 00R4 40R8 80RH H0RL L0RP P0RT T0R` `0Rd d0Rh h0Rt t0Rx x0R 0R 0R 0R 0R\5\%R -L: S  S  S @0 R8g S S  S S, -1LM `RjP@@ 3T1 RU1 RQx0ST X1 R PNgDQXp<Ggm00CS0X0@ӤX0/FT) T 00CS00 R0 0  0 yTYT nTNT 3YT00yT  R  P00XG@@g40@,LHt$h0<H - 1 !@@@L0PP: 0p @ @ pp0 "`V`T$l0@0hP00T  RP0 X  p0 @@X=Ph -PLM@Tp` 0d 0S' @T @T% 0 @TT  0h 000 00 0  @ P @0S 8 -P@LM `d pw0P@S T0LL 0000 p[0p0SH< -LM 0@Sp `V 0!V `  `` T 0 V0 `8 = 00d  Ls p0@0 j T@ŭ, 00 ZH p-X0LM`\ P@ 0 ($SP p<2 XL -L0 M(K0!0 K 0pS좟2\%R PHbr2 R 2 ?0St 2 R\ Bb\ @T T R PUp@ UQ~ " 0Y00 0 1 R+ 8Y1 R APP0K P1!@P!0 |Ce0 ( TPDP 1 ?0P@00 00S04PJ 0 84$0@4(0 H4030 3040 40000WX@Z00K 0gHHTLP,<88 -L$ML"@`_@0K< , )"0$"@@K< NQ}, 奉pPt  @K,0<Qd 8 c#d8 0` Q4 J40@`KOA0 ,倉 R0,0 @pK@`K0@P` q$ 4R- @_dXy!?'% @K`pP@4@ `0 pkd80080 @4`00p`V4` 0 08H # /HRd@ o$ hPX0, -LM@@K  P, 0 eQD`/ᖁ0㒜,@) QQ,0 w00 PF @0K8:, 0Q6`4` d0pV o|0  ,Y0@ 0R, 4pPo@pK`p`@_ r4@@KlP/lc4`0p`V4` @PK@40 @pK -x2LMP`"08 PHb0SOT(2 800jP" 1S2 1 800jP!80Q/0ORQ \ 0!0R#S \`1`D0 0 p_B 0/ 0!S 3S * 0  \@0 0 20 0 R!0`000 2 \0t\  /80Z0$00C0j0$0 \ SuPU 8 0-LL0KP@8M0$ f0 -RSL0y<lyp\gA-P8@T`p T ?>00c0Q3@T TX0X  0S  R1 018Ġyp@-8`PL\ z { z T{ z z z z 0 Rp!>0  ARp" @0O0 \p @0#O1A-8pL\ { | { 0| { { { {  00!> ,A "`P?HA0?`P@0A-8pL\ | | | } | | | |  00!> ,A "`P?HA0?`P@0-8Lp\ } } p} } p} p} p} p} 0 R!>0 R! "A"!?`P0HA01 ?0`P@0 -LDM@PP @ <mVP (  㻸PP fY sY !1 1 !F:p10S  i P| 0 @PX0P @PP8 L  8K0` p  $( @8 4@Kp`,PL    0P ,P 4`  }00ᦆt zzH h p -p-L M$`K 0P$0 P @ P00 0 P Pp -0-L0PS @ CQ0 1Ñ0U000S0 --L Y --L ڷ --L M((K0(K ߷H0 R z -LM@) -LM   K 0KK Yp@6U, -LM @ \K0   K4pU0 T -L -LM@@0S  h" -LM@Rgp$ pQu̩ -LMM B~KpGnK0pG`F+`F(0 +rPÏ)PP"KAA NK@D,X b 4h 0X T]|,`4 0X ]`L$qBpDa008 ^P6KAA ^p@}T0S' T 880S@%\T 0S 0@T8800 |  Spl-T(0 SH(K0`hCzDxz t  p-L$MI)P`*4@K 'P 0` ,` 4P ; 7*10AS1 0K(0 $@ ` (KhG]d\ {p H<0! B^P8K 9^p@ S0S  gpRT80[S [@[T80SS S 0 0R0<0 <K`!40LLL Dphz ``8t pz D 0-LMP0@S P S"P 0@#PS 00H -l0LM@ 0K $0  K$ K 0P bS0 H -X0L M00 0@0 K P ESӾ H -\0LM K"@ 0$ KK@  P (K0$(0H p-LM@U3PP` H?P@`p3P`pd -LM@0S 0S  h - 0LP`p 0S 0S,@, 0ll pv!pXr PPV0(0 0$`$`@(@8*@ p-LMP`P US 0I!pE rP@ ?@p0S P6味P@PpUP@ ,"@pp@(H` p-LM`@PT 0SR(0@VT00P <pbP@0PS p@t L -LM@I' r`RK !P0 [[ 0  -LM@R 0`p`(Kpj 'pPP V $(K P( 0[ 1S00 0V% (!ZpPQ0S Q0S Q0S$ h($l) $a($ecW0`S|10S p0 ,K,0 VZ0  2dXjP p-LM`0S+ JP@'  # 0P00 $0( S ( ( R$0$0phoUp, ,0 pᦸphp@ z@ P) , , , , , , , , , , , , ,  , , $ , , , , , , , , , , ,   00,00$0 000z @ p-LM`00P 0@T PU 0sp00 0K(@T8@0S ?[pd0S 0pz@ -LM`@pT? 00 0(@T8@pT`/ YP `(@T$T" 0 0R 0 0Ap 0 0S 00 0P / 00 0bX PPR80@T 0  MX (@T @x(L (0 R 00 0( R@L 0 D 0:0z p-1LM@T 000 0X(@T4!?p6 j%p`2 P#$@K FP  ` ` $P Z V8I K $! 1`X  0(K oZ(0#40S 0:0@0WpP0S P0 0D QZpv0SP0 SO0 S @TDx00W4p@4 h``zhDt 0-L'40 R 00 0( R @0WpO0S P0 0 Zp*0SO0 SO0 S @T ,0@4tDt 82 P*0P!: -LMp`៰P@ P6  0 K$K  0PS0 -L Mp0@00 0Sh YP` 0S nS0oS` =P0P00 @S* pP 0S!0S  0U0P P00 -0 X 0000X000  U 0 O00 ,K, ?R0S@p O0"S< 0@P08ltT -ML M8 8`0 ,0 勌P` l tj  878CPh h|(7'Q p* N?0@5S[( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( 8 ( ( ( ( ( ( ( ( ( ( ( ( ( H ( 8 ؟ ( ( ( ( x ( ̠ ( T ( d 7)KFL L0 姯T:Sd7h)KTFL L1 哯T6\  6 6)KEL L8 {T6\  )KEL L1 gT5\  tv)KTEL L1 ST6\  (b)KEL L8 ?T5\  N)KDL L1 +T4\  :)KdDL L1  . .. catchmodychgrpy cp dd df edexpr]yhostname9 ksh sh ln lsmkdiry mtejecty mv pax tarcpio]y rmstty]ysync]ysleepy ... ... . .. tmp dbŦ runEemptyJ ... ... ...T\4\  L&)KDL L1 T4\  )KCL Lc0 Tt4\  :C8ğpC0S ##9:P $00$0.`/P33% @!2 O0r)KL L0  贮T|3\  2PY p*1p2Y0a c 20 0cS )MK@D@DP)=K0C뜒0S2X ]P' P" ^KPEPE!0BNK3@Dt@D!1P)toV!1 tfV t 0S d PzNK@D@De/>K0C\J d 1 (K 1(K 1(K <9 @09 ;9 99 p@9,9 0 (K   0 0(K (00"{(LbH`x{{{<X{{Dp@!!X 8 **$+0  Dp{{{{{{ /]YPl  0KAA{p 0}ܠt00S0d: C Pd {L   K@PpmL  X\  zP pWJXZ @o0Sr0@00S PX*  X:pW>X: Z0S BP FP\  | \pk P` 'L嵷  \lKAA` T PL姷  ^0S 8:: S U 8:: S ~Pl  P`Ph`0P p3000P(6` \ l  rL300000S\*\2W~Cp pG0 @@00@0l:  0 Sl    Q0 @@0@0Ƞ, 0@  0 S0SL40S ,lP@  P0|PD0S\ (0S0դ0/;`4O% "4\ 0@P 00C   ~0S\(0 S;30(0S R1 0 # 0Sʀ501 S90%0S501050S ʼE0S 50s>00%0S50S00#1ѣ10'MK@D@D Vd: `*0S  P \*d10Sd  ` { 00-x Lt@]PdP \RX 000DP@8/ 0U )0LedA<+$+{ p-d0LM0`S@P8&8 )0S Uphpgddt -0-LPP@ 80   o{0 -000 0LS    ^{08 p-LM`0@K0 zJp0P h0 \0,0T ` !eJP 0S`{p0,<X -LM p , gdP `h4P$K‱0S! <4+P@U,J0 4 E3p  \ 80S3p3 ʔ#0S0s  }ß0S L#0 SO0 H0@S 0pT0 0pLu3DS 0$2 0$2 0B0A  뜂0Q  R: RÈ8R0t00 04 000cH0 400cL0 H0S.0O  L0-0O@0 P@4 T 00TS180@8P004 Ϡ΃h `@ȑ4?  d@d CN@40/;4|00Xp0Pu0p $1\50 SS?  00#1t0 003x00 S<0(5(5  00,50 00 84$00@ <0D0 0000X80! $`{{{{,X{0P|({{{0,50 ? 001t0 00#4x0 x0(5pPJ4 B ?8P0Eo0 5Р0P4 ?8@@00# 0 0800 00S.090CO000pǏtSΌ/1`G P$p`Y`Z11嬁 T0xR#R ` <4/S84S*8dq x00P`0xQ08@@0 0S`P@x@@0P`0xQ~08@@v0 0S`P@jx@@e0P%00@/> 1$0.1^0 `0T30/>110SQ:0 40 c | R -3 r ?CPY @8 0`00P夀<@x@@0@PCU ?% ?WᣎVP%00/>$Ŕ101\0 `0U30/>1 10SQ8 00b0P @ x@@ l00 Qźˀ50弐U@C B ?P,``0xQ 08@@ <4pǏS 84S*C>0( @l`C>⼠0 ?@0XW0 80 0c0P @{ x@@v 0Ħ0 Y bF0S 0|  00 00 ,00P%00@/> 1$0.1^`0T30/>11=L 000@W`0xQ1 0 00 0-O  ,@5L 2000# P P@5LV>00h0 ph0 S:h0`8 0<0l8 0\ x8 0 0R0E>0XT0P0P0HU0р 00@R 0PP40@  ,C> `0]0SO0SOP=` 7p`8_@ 0VO 8C>0LP@+P@_  0`@_0 ,0+0C@0?> -0SO0 OC.0S 04 0 @4(0 H40 30 30 40 40*0S=PC>0 %@4q/ &d p` X3P@0 @0P@p,P4Q/ `P8A 0 lP C0S9 P@'*0\%2RxŸ*0\ń0R*Ϡ (",2Q0 08`YI<  YI:`[~ [~YI`@@<@TU YI``b YIAYIk "YI(]"YI(]4HAYIYIYI A CYIYIYI auAYI04YI2e YI2e CYILYILYIL -MfAYILYILYI2e fAYI2e YI2e YI2e 8̠%+V,T|`X٬5` BKz܀R~ޮkhsW랓H;EF޲ddCG%x5"EYlVm8\<R7KU~6 hQ"1_.mSwq?1gT){gA8Tڸa>P:X73;*&| yTTw^PiIfu?S*A?s1tWwm% ղi73WXǯkrAi­ 60g$s AHUYw@<4?zJtZρ*|ߠ6!QfW43Ԉ$WG'$0J&m`̀SE/'fbBwvRVy`0dԘp^;q[Z[a&Lk>T [\g;FL?=vG)4Q:݈f/[))d'9@;\sŢ9;Op K<{WOp` ,"S5 'R>2"yd r\50SF P@P )1圐K0 00! S0:1A01P& 1*0`,0V<h1D`p吀KW,d1尠K 00@_0A0K d  P@0dP@cTc@#t0  PSNO0`0,0VT00S < p00S! 80PIv>TT{Lĭ t, 6{(0$p0SP D@ 30 30 40 40DP  $`*0Ϡ 00YP=T0Ypd 0 0 i R 000 0Y00 ,@ @K00@_0,A@0K d 8ɟ9P@ ɟ0/S0S*(t\,@P0 00 #  h04 h40@  9 Y 0,@280 000 /8 00h @0 0娀t0 x0 0Sx0x 00S0\& ,0p`0CT+ ! 0ȟ0000wq0t0x0T T0 1X0 X0 0\0ǟ00\0/>`00`0/>dd 0R%h˸ 0,0^ 0,p4G4'0S\0ρ0 0! pW 00C 0,Pk4XgF`V8 6 R`0 10   p&0SG0d D6 RT000T000`6 R 0d  @XPd P5P5p`PYd @P 0  0P  p000 508040XU 08@ P# 4` !400400800`ZD$0S`0ρ0 0 ! $0Z0$0l4 80 0S 4j`@8y 0T04 R`0  00030SG0d` 3 RT000T000`3 R 0dI  @XPd@ P5P$3p`PZd @P. 0  0P ! p0002 80 0SژŸ 0X!0h14  4 0X0`" S!0`0@Ÿ0 0! $00$00X8@0a0 00 S 0x 00 Rpp@WP 0\%1R1l@-P\pW,Q,` 00O1d `p 0@00S080Ճp&.ࠟP0U@l0Px0@U`,P0 0 O2d 0O00 0080p `0x@`TtW(U {T -LAMK@Pp,`> 1Y0A SA A Pp ` 005 / ,K01B00S{FOK004P0  x0F?K-0L@P/ d@004 0A{4~$| -LAMK,@ _0K0Q 0`004 00 080^,0@ d 0 000KU $L({ -T"LM0, Sʑ,0l,PPbR@ d s 0 1Q) 00C 0 q0S\0000  10@ d R 0  0@`1 00C0帠,0Y ! #4%+  P0@o%,p"P`@0 `  x`0P@`pd p0 0`P$l0@ d0R0x , x ,,`0 00 o/{U (x -p`LtM\Ġ P0 @4i:80D P0PP0 "  -LMp`\ h0K4iL0Ġ0S <0D[0PP0 $$ -8L0@S" 0S0 R00 #L10S0 #1 -8L0@S! | X L 00 R0  00B0  20 10 -8L0@S!X < t  t t t 00 R0  00B0  20 10  -L M@H K0s4 A[TQP @TP@ht@  - L0R PV$  -LMP@p1儑儡`px!d"pP@4 "P-8 X ` X X X X X X X X X X X X X X X X X , X @ X X L X X X X X X X X ` 0`0``p0 PbUA60Sh0ncX0W 0 Ri@0<D 4D8 -(bp0LS2 R2 pRpW #PPr ԡ$P@b #0B SO $ \  O 0p0S@ bP % 0S P 3  0S R R 0 RIP 0SH=0Sw<0S@ #P #Wl=0Sm# 0<8D0@ 6  -LpMP@T `KP 0 R F=0S IH0S@: S p0S : S 0 RHP 0S P (0 RD0 6@4L  -L&M쁟0Q@(0 Pp`i 0: S (0 S (m 0S  ap` K"p 2 S!3 PpE 8@ IP P Gg0  o0  ,P P0 p P P;FOKP  60` p  6D  -LM@`P  pVp@0V U@0 @PPU`VUU -1L$M━PUp$ `Wt1 R 0: S !P$0 S 4$0m,<0 S4K@>+[ Q003 Kp@`D00CS00Ӥ0 PpP @00CS00Ӥ0 PpYU00yU ,R<08  h  p-LMP`P @K@P0/S+ /HP0.S P0S@p0S .S0S`V d 00 Q P0S0P,  @@P0/S D  -0L ]l0  -L0M0`@/7Hd#P000LP< CR 000Ri0 Rd \0R R R0R -40L R(0$0$   .j넂P4 L  -Lɚ<0 R4   0 VLH H - L 6t  -Lt  -LMhq0S \\DPPL @@!PD 4a@P!@0P P00FP@ @3 0 0@@Pp@K;0$!  P 0jP 0;C 0 0d@d @^ˠ$0K $ @V8" j묂!h L H  -0LS \|0H0  00S_\-\0S  鼒  p-LCM``GOK0PL  80 Y 0S ip0   -LM$@0 S A00ꨂ`  0-D0L R 4410P@@T00騂H5 T 0-LBMdP0FOK\0 P 0嚿4 0S i00    p-LM`@,0 *PUphH p-BMLM`0<@KP0 B<0[ES FS AS  R0r S00xl ;KА0 S XWipCNK@D@D 0W <0[FS 0  0 L 0 -$0LM K _gP [H p-QLMP`@00H/ @, ph0PE S U@00pX   -LM`P|xဋᨋ\! pLq mP pP P@= g!0AT0 T`4 V@P0/S Z  .P0S@B`z XP#   @@P0/S U@  {h Lb 6d -LtMp@ᘐK?@7 00 RPPf0S``0 0: S U 2P X*U /00 P V 0: S \70 0Ȼ -0L 廢#h0  -\@LMo80(0( 0,$0( -LMp  P( :   Qq00  R(  R00#R@@T;Rp 0P00 p  (0xqP`@@(X0S 0DH00S (S 0S(0 0V0 S񟗫,  D 8 L  d (0\(   Qq00  R( 0000((0\( ,  Qq00  R( 0;Sp( \ pSg  \b(0\(   Qq00  R( 0\S  dA(\( 8  Qq00  R( 0S / $(0\(   Qq00  R( (0pS0Z00 0PX(0\(   Qq00  R( 0S 0(0;Sx  ( KO (0\(   Qq00  R( | ( K6 0S P(0\(   Qq00  R(  s(0\(   Qq00  R( 0S  3 @T00pp#(%p}5.( 0Hnt8j(( ( 0\SS, (tP(  L( (  P( t  Qq00  R( 0;S @l6(\1(0 ( P(   Qq00  R( 0;S S ( ` _QZT(@(;P( `  Qq00  R( 0,S00\(   Qq00  R( ( P( `\  Qq00  R( Z ltx\,Dp8 0  @ 0-LM P@U W \UXQ UM  0S 0[S: \S1 0\S \R 0S 0 0 0S000 00\S  0S  0\S0nS 00  0[S KP@ 840@@-@000^S00]S00 R ]R0 0[S \S 0 R ]R00]S0nS 00.^ =^:^00 ]P P 0]S0PP p-LM`PE@CPU 0S0  U  P  80S5p 0p -L M@Z, 0< ,0 `1 ,0 0  0fS*0fS:0d0 0 0PS4P  \S  R: YQ@D0S4 0b`P@lP \00, 0 S0pB 0W, 0SpQ\Q&Q\00 S SLB 4 00b` @, 0| -MLMr ` 0 $ P0 $P`Ÿ  Qq00  R$ 0gS{ 09S,1SUAK AA pP@P@$S S $0$4 0 S x d;SpSD wSP$ 4  Qq00  R$ 0ANK @D@DS  S $ 0$0S0R0 0PU $ Kp 2T 0td00U0P0$0,\ 0 -LM0P\SSpN '`PP" PEpPP 0Qq0  00SP@T : 000S0S   0S$ -Lp M(K`p*P0K P@0 h 0fS*P0fS:pT - Qq00  R@ P \R 0 R 0hQ`,00 0S S@꼒 0-LM0@9SP$0S$S /S  0P@  00D 000 K \S@d R-`L@ ( 0pS S ;S p0 0 0 S S ;SR 0gPV@$ @ \Z0pS S 8p0 0 0 S S00꼒 p-PLM@P& `0a0CS                           000@Tp 0S0 C0S40  , - P LR` 2P R 01@pT 0S @T0@00` 00 僧P  p-LM PR` 2P RT0 AT 0S @Tp0 ZP0 0p -\pL`AT 0S<P rU@`V0  -4rLMP@`"p?@R 6PEt t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t t 8 t t t D \ t t t t t t t l t t t t t t  1`1`0a 0u&a70 0AQ0S 0S30hP-0廛P @Lb d -LM0pS`00S[ N:SK삟0SRR 0#S; @( (0S' R R 0 0 (00C(0  00 0 0 0LŸ 0Q00 00 00n0( ˂;( @b00nS1  QP 1 0SL S4 Q(K僌P@t 00利@LQ(000 \* e(0  R0#S0nS0 2(  (@0 bP0@ P0 0Y |双`0P@ 0T 0O/ݚ0 0 op<_0 -LMb0S!lRhPdr 0SX2X0{ 00CS0r2  p0 QG0S 00,K0@ @C,  0+!刁000 00CS0 0Ӥ0,pXqHQ$ШY@00* B P 0 0c0@ 0p0 0S D3 R 400 30"0S0S B2P0020Sh2X"0S 0S02(R(Ÿ0 SB !0 0 !0@0 A0000A0E0A000!0S 00@Tp &0P , 0<N ,,!pp, 0>Ԁ0S P R" 0pW ` 0@ ,0 S0 ,[*0S Py*娇PJK(@DP@D *0a;\ 40 J0|0$d<_ -LMr0@s `\R R0V QPqh20  00SG \PD 04 CR 600`0S0$ CR "0000CS00  ä00@*0S ) d0R0R P0 \ 0\ CR #00XP 0 C0 b\ 00`0\ P 4`0Rta*`tdP "dL$ KP2[S<00XĄdh( ht@ -PLM؀`pP@) T 0 S R@D @00U00  0 #P P $D :0S/(0p -LMP, Up & &U0 \Ud 0SDb p9  0r1 P`0@0S*,0   000PU@0S*00K@ 0@ @K @ 00s0s\U @0S*P000K@ 0@ 0&S\SPq(00  00S00@( -LM@P P`p W00 H 0 0  U P0-L@P 0wS! sS @T0 p ;P 0 0(0 dY{Sp !P00s( 0A0Zc00 0-PLP @T000 0-LP:P@0 0R0 @@0HP! 0-SL@p  P` P@4 U@@V@H hP! P0-LP 0@@S T 0S L0H R0000 R000hS0l! -L,MS @P D #Bmp LP ?PPP|#0SA l@Hd嗉H \唉L Q 0S 0S0#0S$ aeP0 #PPe2p D 2`J"P  tP0@ n|"@ fPPd2d ; 00 , -00 0<80 4 DV = = = = = = = = = = = = = = = = = = > = = = = = = = = = = = = = = = = = = > = = = = = = = = > = > = > ? = $? Dpppp8KtHPT8FpPP 8 KGP8 F0#0P0a3 0 ,0 ( ,0Q040 0 . P@T" 400c R4Kf00\T00S @fT yaTu l0T] ZTPE\@ \00@@TQ 00Q 00320 0@bS S% TP ` ]PP@`TV᱀V %0SiV ꢀ`ꂀ0 pŸ00 0000wC0(j\T@0!00CSQ0@BPڛbT cTp@@rT @ nT @tT @ vT @ @$P000F00C0A0 `R P: ϛPp`4PU1 0-S.0S+  0S nS eS ES 0SPpU 0-S0SR \"d%%d"l"<&%%:%x" -LM0#3pwQ@@`wQPPt Sjp pP ?P VPvPp 3U 0a,0 X0?0,0 pX,00,0 0*W0S9 @T6 0(Y00SP0(U00SU W 0BRShE 0BSEE E F pF (F E pF W,0*W0S 0*W0S 0S@ EEW 0 1EW E0  EQ {ExxE0ltE0`W 0$D1DfEY j$^E0 W SE0S00IEWBE,6Pt{ \|PP 00Pe{ dO|PW|""d% 6"""""""""###0#<#D#\#%% -L$M `0pe0C4` 8` 弇@` S4H 1 LPl 0S0@  $0 S  1SqQ0S 1M0Sly> @P@^c?0P0P00S` 0+0 0K@KKV0?0 0K00K?V000@ ;0 QX K+0P@@ RV  0)  @, 00a>(d%%%<&L&%%%&& -PL@p` bp lP ?PmPp`t 0P0 PP =0P0  0PPSd%0&0fP p-0LM` P@b?P 0AT K03\0 S0 1 !0l p$=p=<&d%&& -LM0@P,0 #bp ?P SPP,0 S ,N3 AT #0 P 00LS!00LS0B \L vi=ppn\ p]  Qf` hXIP@PR  Q8 \P3 0X0C Sd 40  W,2P,'PAK 0*P000BK 0*P 0FS Ѕ < P h !1RKCP@ KCPd 0RP@!1R!1R!1R!1R!1RKtCP@KnCP 0R 0R@@K_CPP KWCPd 0RPP0)%%IC p-LtM`PP@P0 RKp4CP@ : S I@@% 0-L@0P 0 0S(  0U0L) -L@P0pWP`  0S@ PW @ -L@P0`VPp  0S@ P @V@ 0-0PL@ 0h  0S P0 -LM0@P`  Pp 0`  PP D! PP  P  ` 0 P"  PP 00p `  Pp(  h))))) -LM @R:Q0ASQ <0wPP000  R04 5: 0Q0XjMЍ@-1S70#@0\  0 @-3 @)30 6 -8LM0PS` H00S00Ca  0 S # 000S00r"Wp?@- "P$ h h h h h h h h  h h h h h h h h h h , h h h h h h h h h h h h h 4 ``0!R 2W!Wp F ?0B"S"$         d           d              d AQ 0S Q 0SQ Q  5P y2pXQ |@Qt3eQWH@Q  P Q4d%t*** -LM@p^P P`0@K` 0K`P0S M}x&2l"24K 0 (P 4P08 0 0S***l&* -LM,pKP`ٿ@0 s  ?&@0,2t }2 K4* -`@LM0P! L0 il0 P303 0 h# +l(P0 P 0-LM0PS 0 0P KP 00囫PA[T| 0 p T @3P@vP[t[\D 0 wvP [tPH&%ht@ % 0-PL@hX 0S0S @[00S@ z% 0-LMPK WP@ 0S 00 R 8j4T[0&{[d$-, 0SC00a]d$ p-LM@P HP`0S C  0  0Pp@E]d$ -!LLMt 0t,0 QH PQ `pPK @TXK01X0L=E[C@[@P[?`[Hp[D[X0 0bX K70K0L 80K@ P`p:K9K0pKS0S 0S0 S0S0 S 'P tD,0 S @,=A 0 L0#,+ -LM/`HPDp`@QMP@T iQX@-\0#S" R@0 S@ R0S \ J#0 SA0A R0Z# 000  R0S0 0#S 00 S00 R -RL Mp Z0z%Z10 P`WZ Z PMUV 0 S/R `FV00S/S,A9P@@U,@ 0 4  4,0\*1P00U4 4,0\*004 0 @`DA -A@,@ 0 4 0 @`DA A@,@ 4 0 PPU `<& -RLM 0SP  \SR00  Sp㰁pA`C0PP0J< P t`/`P1@0K@!( 0@ ,@ $0(0^4*p, ` 0 `@P @1ST T`V ,@gP 0 R@`K>P, @`DA A@(@ , 0 <&% +8&  0-@P  L6P 0c0 -RLMp80  @j #Px34`K9"0,0 0 4 """0@T  L@T"0 3x2pDqp2P 0 (4 K 0B0`CY | 0X 2 Z P< p@10W 0 P9 pPU @< 1PU<  01PUX!<4,0^ *00,10 ` 4 8  00@` DA A@,@ 0 4 hP PpI  CSU@1 14 1sP11P @T<080  <&%%&$(+  -LR  ì/` P 00U0S0  'P "P `P =P :P PEU0\\S @T0 'P "P `P =P :P \P0 @0S0XE Q  p00  RAQpPP U0/S QQpppePl&0+ -LMp`@(K 0 {0P(0 U(0Sl,0K  P X(00,00 0 (0S꬚ $ Q-L`p90  Mp0PS@   \R% [Q*Q ?Q $Q 0(S /Rp RQ0~S  *00W 4dP  0S@<&8+ p-PLM`P@ TQ 0RQ@Tpp -@TLP`@p8p@PTh<& -QLM@% T! AP0Q/S P /S @P0/S0S1d0/S@P0/S 0 -L M0K` e e 0pS  OP P0hU`5*00M@ @dDA A0@P0<& -L$M@ @D k2  000 , H 00T0`80 4 V :4@喂Ppc W 80  cRP8KL@V*0 R 0PU0:/00H0 80 cR8KL@H D@B4  0BDACTP`0<0 < KP@ 1 1 P@T10 R` W4,  O<0S 0p<& -@LPp"n|n`T@X00V00S0S P 0SD@P`d@@V@+D+h( -"LM2"2"22"@2@x"t2p"00dRd2d,KC,0DPD"`0e<088"Pp@@A0c00B"0c0C0 C0STA^ 1!10n 0cCPB00p<_ P91 R p|t!0@ 4@`01 !06S<1` h` -D0D L0\0 P H lh P-L`N \ RT LR0S0f0QE$@F0t0f0Pp F@Dtp 䀟 ` 700H0 0 c@BTT@@DtP @D tu@ @Dt00X0 0PPu0Uhlx -L -L -LZ 00h -LNy - 1 LP@8 `00Cs0䠟p- P P r0 0  R0_S $S@@PP P  q00 0  R_S $S@@00Cs0Swh` -1L @\7 `00Cs0ࠟp- \  r0 0  R0_S $S@P\ q00 0 R_S $S@00Cs0-hl p-0LM@P: 00P:p0@ph`P0`P* 0B0R0T:pp00U0Tph -LM@@t @Dt 0-@PPL 0PS0 P0 p(0  0 P00ἒ -hP@L` P Lp0T*0V  0S 0T*0V |t - PLM@ pH 0 0  R ^T@?hh꼒\8 -D0D 0L0Q0 P`0Tyh` -D0D 0L0S0 P0<ahl -p0 @L 8`P00Cs0 U0 T M~ @R 00Cs0(0=~P@/lh` 0-0PL@00Cs0 tϠ Qd0AQ 00S 0S0@0Cs00h`l - L 0   l -$0L; # -0L?% -0L6@& - 0L0@* - 0L0 -D0L R80000 ,00@%%@& -0P LU:0` pUh0P0@  `* p0 ?` `01 0Rh?$ %@&`ldph-000 0 0 bL1C 00N%@&000 0Q 0 R Ll` -LCM`0JK $0 @ PTJ P/,1 P0' )S S1 S (0KU*0T0`pP@ g0^S@ (@T$0 S `${7U 00eU@  0`P.`. -pQL@@0 @dT` :%PP 0@DT*d0 XD0@s@0@^S@D} %@&` 0- L^RP@ CP00d0S +`P0 -p0xP @L@b\`00YD0 <0 40,0 !l`htp -0L,l -0L#` -L -lpLMP\r\`  P3 0Rs 4"42@PT 0c0@0d0CS01 1E D 0RI 1`V# 0@S0P0cPcTp!h0 0CR& 0R 0R>P*Pt @Dt Q@0T 00t0T 0R P

R0@D?R0 00p\0 T 00 0S< ^00,P@0 ?00 00ἒTU P0-L@P T $|0 0h S`0 ! XT0h$H0<$40 $.dT}.̄ 6Ȅ -LM⠢pQ, S |,@01Q 0` 0@:TW$Pp 0B,a dP00S S YS 0S@ WG@01 R;0@:T;T 01  l#00 RPq 00@ ,0T1 ?> 1 @  ?>1 @ p 0P ryP @, 6 ,Pd00@TTPUXxWT$1#dT}<&.\. p-LM<K8!00( W$A 0 PP Ġ00 PPUP` 0P4GU  0@PĠ 0PPU5P@ DxP80  p,xP\(%.@-?>,1@LQ 00 -LM@Q  Q Q Q Q$ h0 h p-LMP` R @0@0R@PcPbS3@pth -L0Qh0 9h - LM0 0 p` P0@@cP0 PP t 00p 0L0L H0@ @0@p`ET T`dplh  -Ls -Lk -Lc -L[ -LS -LK -LC p-0L$M` 0K K$K a0a(@K @PP 0@ 0K @}T$0$0P 0S@@TPphlh`  -h1L M`` 0(K n0n4@K0K,K @P@P? X04 D?0P0,0KpC*P00T0S`T XU U 04 $P00  0R/S \P(0+ 00( ) PFlh` -\0\X0X T0L0 L08\000 5 h|`hp0Є -T L0LS00P0 S  0S0Єl p- P PP0PLM`0 0@R 0 R R00CRphp0DS L \ \ \ 00C000x p-LM@,`PP 0S 0U p| 0-L@Pp0p0  0!0S 00@C_ 0 00000t0 @P꼒 -LMPp0` ` K"`@T 0 0@0@ &T f``ldhp p-1LM `Vr 1 RPC0S S S "S 'SP0S0C00 R R R "R 'RP0S S S "S 'S00S0C0`@0S S S "S 'SP00@Y@pP@U0Օ 0  R R "R 'RPEU  R R "R 'R0u0 S S "S 'S /P@&ULC -,2,B L^P r00Cs0e b^  q00 0  R_S $S0^ LUT  r0 0  R Qp!B00X0^2  r0 0  R0_S $S#UU r0 0  R Q 00000 r0 0  R Q 00Cs02000 r0 0  R Q Dhl؏ -LMtQlh0h @ PT *Tp0Q`ITP*0U@00tpl -tt`0@0Lp2@@PP+ P40pf0mM<&%(/8& -LM0@S`p P$ ( +*(0  (0 P (PK x0S( 0Q *00 $0 `(0 $ @`DA A@ @ $ ( ` $ ( <& p-L Ml`0P0@0 $K 0 $0 9$ K 0B #1P Pp<& p-L M`0@0P 0$K0 $ $ K 0B C1<@ S@  @ p<& -PL`M@ ` `   /0S 0S0S @0  00 , h00p(0p 80 4 P@ Lp p p p  `K 800c R8K>PW񟗩d < H ` V񟗜    (   , `X 00 "" " V  R X V X 08.0004, `$@[0T. @0T* @(0V0 0 0  00 , 004 080 PL=@` DA A0@0@0@0T * 00 [  < @`DA A0@0@+ 40 0c0 0C Vm Q 0 R00S 0S,0[W 剐Q   l!0F]Sh                      p                                                                0   0 00S 0  0 0 0 `0S0000 > S<   0 0  00 @ {V @ 0000W(  0 8K KP eP 0 UPuX p=40U-]P  @0T*  0@8@` DA A0@0@h0`0  `   $00(   0 S 8  b R8K<P00 0S )00 HKPp Cr  000  $00(   0S 8  b R8Kڛ<P00 0S )006 0 | dK@K 0r000 ^^0@S 8  b R8Km<0P00S00  00@0 q KHK 0KPp~ WX  PJ ([ 3[0cഠ00@ 0 R00#0C S-p p 00 ?00A `@0  (CXUl4pLZ C0  0A 0  00#0CSO 8 00)  000p 40P]  H R000 0p 40P"@A 0 ]g]0p00 0 40@U  l  X 0 ` t0|`0 r)` np H0`VH0 f R 3[SD0 RD0 H p00C0 1`VQ 3[S ` RD 3[S0p0 >QA ` :D  0SC' D 0`0V V    0Svv  D xD3[Sp0DhF `A BF`pN 40 U B GH0`VH0 `Pク , %<&l&P!.0h&. //@D@ +Y@P08 @WPL -L MPpQs 0#S  `P@@:T 0ş00 `@ 0`S VPT`0@@T*TQ%XJ K#XG (5  0S8  @T000@ ğ0 @" 0 R +X 4 R 4R 00 @T+X l@-X=X ?X @4R44@T0@@[0=X[oP 0@S*S0]S =X Z \@00  #0HS 2 0,0 0 4 |bZP 0/Z40 0`CA 2020@S@@^,0\ *000 4  @0@S000MŸ  10,0 0 4 4,0\* @ 4 [0 @` DA mA@,@ 4 0 0 T`V T0S@`@@T 0`SFP[oP 0@S*S0]S( @T*T0 @ T00Q00S V 00 90190&Z8[l0`P`@aZL0 0`S`Z Z l&<&%4/ -LMxP+,`aPP@pNP UpH 0S ,K ,A@n`(P  T(幵 2yi00@0 R0`V 0S 00S 00P&AP@`4!0( V<&%L/h/l/ -L@PKn@%Tp? #T U@` :P`T`T TU@ :P@T0e  m{8P@:p`p :P`DT*P@: :P@DT*<& p-LM 0CP`CA)P @0T *00 TpX0 @`DA A0@@0@`Adph< <& -0LMpH`C 8 1S p880!1P00>8 @1Sx<,8KfK\\ P&$%<&X/ 0 1 1 %%/h&(%/d$ 680 -L,MHp\ , 00 L 4 H  0S 0@S \ <V lT,0`S ,0 R V 0S ,0S ,0   0D0 8@ RD  D  1S4 `0 7# ̗RP Ts 0ǟ0 ^7 0V>0 0 R` 0D `5VL0@S D L 0L 0!RPU(7 ,0S 6 R /6gP2H, , 00CS 8 p H  H H  , 4 0044 6 r/, 0@3,0 R,0 R L ,0\<0 ~040 0,0 0-P9H P 0, , 0 @@ ,0  005 p0S 0@SXUD0 ,0  bğ#080 , ,0#20#0 ,< ,0<0 00P@> @48$,,#0< <00, 0< S 0DS         @4 4 c0/ <\)/a,0 , 00, 000,,0  P,00  s3@  00 0@(j\[, 0\ E,0  ,0 R (9 ,0F[-B\ 00 Ÿ,0  0  0p00 0S B @JJ <(T,0 R \0T-:>QPR( <xPV ,0S ,0 R 1[, 0 D L U ,0 0H0 1RC ,0! Q6 ,0! Q5@4!4pP@ p( TH  0 R0 0H0 01` Q H , ,0S ,0 R 0`u0S00p000 PU  , ,0S,P |=%@3d$/8@h&$//0%<&$0L&00z`0x(x0 6T} ,{ G d%'00 p-LMP`PQP@ 0ST 0S`@0 0@PZ0 $ 0 0@0`0$ 0-L@rF 0FPP$ 0h A&0 -0LMp@`T P FP L 0V0R00S@R F 0 0 <& -LPp`-F  @0;` 000W 0M0  0S;0FV0 0pN p-LM@`P0=S\ *SZ +SZ@E sF 0 ` p& -LM`pE3/dPP` @0T00SV 0 S PTQ 0S 0 U @2 Tx2x2 0P@ T2U  H.T  82000 OP2P 0 PQ0@00Y @ @ Q0000 E0P9U&10T00S 0 PU10T00SPPU00S U EPP 0 dP 00000 O0 PP 0d&O8P\0P 0 d4 zE@G%$`%%<&(+$&& p-L M PK`pEEP@  V 0 /R 0(00 0p$&% -LpMPK`@CPpP@U WV 0Sp : S  S pp@Ip -SLM0@< /0`cP < P  H1  000 , t00PT080 4 4 :4@?cpW7 `eW 80 0c S8Kڧ-@ @ჴ/0080  cR8KPڕ-@  s<4 zP 0SPU4,o4`, Fp<& -x0tp00lL @`0PPF60D01 @70000T%4$%&d% -LM0X pP `ጣ $ Q 6PMPN8 @ <0KI P^ 4%<&d$,{ h/011x0 0/(1 -0LMP8 ,0 < p AF/ @ 040 4 RO  Ὁ, ,0SG1 0 F*P@3<0S48 810Q800E P  10  487*4l5p ,,嫨V@0 U 0 |04 *,器}V4@ \P0P  L< 40S 4?5(3 <&%018&@1X1x1 0-0LSP@ @1SQLM0S9zLMt lh(PHmLM R CP00P00S10001 6 0-LMP@ 0701 -LMpPP`@ 0V`SP U@P0?Bc P@,, (0K(p $` @ 0gfffd$- -LM@ 07 6 -LMp`PP@ m0UPS` 00d$. p-L M8a0@0 PR Q0 S  p0S 2 0AR  SR $K0S 0 0PU000PKP*00 R^:QP RP 00X`PP R 01 -LM0\ R@A 0 T  MЍ0L 1 0-L MP  04K@4 0@ (000 -L$M@L H 80KD , <@ 0@ (1?P@ 0 R050( T+,0S&HK@0(S HKpHK@0(SL 0  8 [LM(-L, LL'0@0 4   (HK <& -LM0@00Q33 3 3 3 3 3  &0BS 83 l3 x3 3 0 0z 'x0 K`0K 0 K0K < 4 , $  111242L20 -QL MP L@!0DTS.T, #T T&0DS``Q 0`T P 0`G 0`$S$ ; *!T 0`0 "T T 00c 0 0S00 A0 @`pDWX$01 RT,`  `0D S40 TT T 00DTST W! 7 87 9 6 8 8 8 8 L7 \7 8 8 8 L7 \7 l7 7 7 7 7 ,8 6 8 8 8 8 8 8 8 8 9 0 4  R,  0   ,L`@0DSp`"01 R Y, KT  0R 0R 0 0R 0R 0R 0R 0Rô 0S 00 00n 0 S 0 S 00C 0 0S 00 00V R 0 S R  ǭ 0x 0ct 0p 0"l 0h 0pSpW 0 0 0W 0`0C 00%S %W 00 0 W`\  C 0S 0S0 0( ,  t222 -LMPXp@ t00  RPTP(0 00+  @0 [T 0S 040&00PA ` &(` IPPl!7 P 4 _T 00#T0S @_T0 000#T0SA PE `'`{0<000 ` hKP '0 0`V T  0`V )00 ,0 @P,0VP꼒l&<&$) -LM`p@FT 0 0@ 00C 0 00P@   KX @ lJ -0LS  0 0!   0! Z -LM4@ 9?0000 <& -0LS@ P0 R  pJ0S0e@050@I0 050`  -8LM$ `Rᬀ `ᰀ pᴀ 帀 开 r ا'+p{ 00ACSX@ X@ X@ X@ X@ X@ X@ X@ X@ X@ > > > > > @ > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > @ > @ > > > > @ > @ > > > @ @ Pv\Pp%|6@  & `zQ Px3PPP  RP  (<   000 |0WaB YX@00 P 0S R P0S R  Pp  0H0S0 `=\PP 4L&00cP@@X 00P0 P S R  Y PP R Y Z 0 S P Y? pR p W00W030"#P``S( 弃0 gA!B2@ [P\ d0xx 2@ d2 RpGp W00W030"S /2F/pP`U pR p W00W030"ScO/pY eG 3HRX@"P@  0.PP= K P`0 2 (00 k0@ d w0Pڨ@ 0dSʤ00c0l SKڟ%@ /00`+i$+P x.dPL $1 RpGp W00W030"SwP Y "Y  0S  S0 0 R00%2d%2:<&92!23XZ@&4$$3T}@3%,3D3d3333 -`LVP |p ZP@  0S@00 T 0P0DP@!@T}% -QLM@< @0 W 7D <4\1  000 , 嗻00p0@80 4 !`g0PP 0*8K @\0S 800c S$@D0 @pࠫ< ᜫ@Z+80`P cR8K$@P ძ4, `gr0m$<&3 p-LMPK`@&P* P1 000c0 PU OppPU )pVP pp0dP?SX0 b@@0@ vP 0p@&%33 -H0H 0 SL4:QSC @&%4 -,0,  LQ@&%4 p-h0LM`@ XPRT`: 0DRC 000C0 p%@&Ԅ%0D0D  0aC1P  / 00 @&% -LMЀpPQ@Pl` EQT00? @AT, :0TZ,  <P 0 AT:0T00cCM P %@& -X0LMP 0 cBA ; P0 P @ P  @&% P-Lx@0lpPh 0af0lCQT a8 ,1@0PD&%@&% p-0LM @R! 0S`0PSpphpX0XPP#H08 <0 B PPXPp%%@& -LM8@04S} $0}/ Ź0 @ %%D&@&0 -LP@" `XP000 RTpP@01Q*`Pѹ010CQ*00 010CQ:%@&%D& -1L M R!001CDP "-<P@ QPZg 0x`aPG : 0ªp@ 0S 10SQ(pA60 P SP0 h B 00pP o|%4% D&Aq  RR R S S S S 0S Aq 0S     -GML M,q,1IKL 0 $ 4 @HPP" P 쀟BnK`F0 .-P@ 2P$᜷4P ᝞y$0 S h$\0IKAP$ᅞ0D&H&$4,4@-@@ P0S @ P0S P ^ @ P0l0c0 -RPpLM@` PER hU U V V $V 4V 0S  U@PE0S0 0Q : 0FS   `` `0 l0 h0 d0 `p@&% p-d0LM\@00cC1@QP 0`Qa0(S!p$@&%% -LMl`4 0 DP@P+ n0 8 p`Dp`  0䠟S8   400C0W000 `坶@F̠F00K FD00K/K.K-@K,`K哶4* 4 ⌶ 0㳌@00嗍 -LM@勍y00 - L iP؄ --LMT0T @0S4e*o Z- P,&$d$ --,@L^ I- ?,H*d$ --LM0 @0 S4*0 |0 R   h0  L0L0L 4R$ - ,,&$d$%%T% --L@<<, ,,$ +)T84d$ P0-L@ 0P PP |0x-S ,T T@Q R 0<S08, 000PUP %%d$L4 --,0L \,)d$ --00L R   ,&X44$ -LpM|KPt0: S  -H@LM I(0 E(0@D @( 0 4$ 0-LPBP@00 S Up4 - PLM @ ˗ȗP@0 S p4 P0-@L@P UT  0h$0-)d$ -L M@KN{P0P0 R4 -LM@h p-LMPq 1@ 0 00S  R pP0S T00ppho0`@XP 0%0P00S %10P00S00P00S T 4 P0000ppT0꼒44450     % -LM,@0SP 叛00% -LM4@ P0SR {00% -LM$@0SP k00%$0 0PQ 00%5 P0-Lp@ h@0S 0SPH000,PP@00P:00% -0LM`0V`PỦ@@$pP,@d  0Pp*cP &$0  00%$5,5H& -1QL@P` @0Ǡ) Q8Vpp 0S00 &0 S 0S `P@†0 0 018@TZ0S40 Rh=hi4&%*} %l( -\1LM@`THQHqH 8Q8q8 0R @TV 0R 0S00i;@Q0e㷆 0S S0 0S 0S0R`P 0SP نֆH&%%܄ -RLQ 0SRX㜢 0S2 R0SClrlb@ 7@TZ0S @b@B0S P"zP 2 00X P Pmz`G 1 VG 00}`1P0S ` K74A咆 R0R 3G 00)G ~00<x 0 Sp`@ xpx`@ 7@TZ 0Sm= 0# @TZ7%,l(%܄,555 +606 -L Mp40 0  k|, K㋠p` PDP D$0``0,$009PհP@ 0#SUP3 RTPPU @0S @Q 0@0 3 RT  40S '30030 4*U3C ,K .    8 000  0S  (0`V (`V '&" L,K 0S  DbDR@ B6@TZ0S@ @2!@@@ @@!<5 0T 0S 6 6_yP@  AᦘIL1e81 J(1 ` A 0,  0(  00008 P0P 0`` |m,K qh%TB&%%d$P6;X6l(h6p6((mH&6$$W6 -LM@K @K8 R C000"% 0-LMPK 1x0p\ 0d 0 P }0 @0%666 -L M$`K@  pTpP, (KP 0PS  @ T0d0 ߞ ٞ( R p0!h`0\ @0 0S \ 0S\%H& 70 -L M$pK` P媞(KP@$  R 0S P 㔞jE hAUU  z(0! +%0 -L M, KDe0K PPP 0S X0@ pT `0ŸS0``pS" @T>$W0 0qX 0SB0S  z0S pB hsPW00H0 U00 0S X 2 R0">0,K  mPIX`A00 R  0S AQ8P ,K D X &D 0,x1!墛0  ,KĝD0 h 0 p 力0< ㄛ}9K,K 㡝lV,K 㚝T00 !H%784$7(7D7,l7770 0-0@ LR# P0\$ 0S 0S0Q RT p0phTd  0X00\ 0S@ 0S@H&%%<5D5L5T5 0-LMPK@ 780@0S 0@S *0% -L M,K`PD pV`pUF 0KP@3 X XT ,40#00 V  @  00CS0<0U@T@T 0 t@T  ݜ ՜000!(@%4$70 -LM pK` ẜ@T P0S 0@  00CS0<0@T@T 0 H@T0" 㓜%%d$7 -LM@K 8〜00 \000v 0% -LMQ@P 0= S< 06 @`쀟40 0Qp@Q Q 0  T  0R@QT t3 0R0   0S 8@,i$777 00 000S  0S$4 0S000 H& -LMP00좟000 SQr`党0 SV Q  Q  00. 00 R} `2 Ry 0Sv QDbj @BPY 0SN P 0S? "匙 0S0;004 S 0S# ( 1 1`@ 0S Q !|! Q 0S V PP 412  w00S0  +u 0  <#uAB0 `P0h;0l`0P@j 0`00@0000@00Za Q_M%%4&,$$d$l(8 -LMv0` V 2 0S{ `VpK)뼠K  PPhڸpK`V 0@T 0S @T`VH V (0\Q=9A =C 0(l0c (( Q=9 =p 0( 0b @(( Q  =9A =C0d0  ch  Q=9b @ =  0H ڝ00 0S0 0SS0000000 H&?B p-LM P 00S QT 0PS4 0S 0 S0000 00CS A0Sa 8 R 0RS  @ a 0S0 * 0SD 0S$ 00S D1 R 0S 0S RA g C? 0 0S 00S p 0S 0 U  ,00 000ppphP00CS0x00$ph%%<&7(848 -L`\MD0V ,0 x 0 #@003# Q Yt +0 0Y 0-0p0 0PU5 0@S\ L ą lK@ :V 00Ul t "Va VR tŸTp"p Q0l KPx o"U 0S UxQ1 ,0S ,X"0 SVt  V  PU 0S0 S t\h109"x 0P@LDT."l0[S (!T100l Kx` !" " p0"V 0SlK~ lK@ "{0l0Kx @VT0 SS 02f 0lK2a R4P x X!0X8d8l8 6t8888888888l(  -8#0L` %^0?Saꨇ 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Ї 0 0 0 0 0 0 0 2P Z0010S P j,1 @T 0S @T!p1@PT 0 -PX@TX Z 001@T 0PU pbP XPU@TZ 00Q00,p @T 40S 0S @T@T 0S S @TZ0l& -p LP00 X R 0S R 0SRl% -L,,0@ S00  %0SS 0SSS  000Q  0Q0 0  ` 0ST 00C0H0H < P000P008H&- RR  RRR00Q00Q <R 0S  R 0S  p-LM0@`TP 0S@TpPP -/LM0尟,0  ?@ 0@ t2 |" 0K/KH" 2 x pB b|20 2 ϟ? @p@嚯K`!200`d"  `` P\P ,ϟ 0S   X X #X  $0 0$0.0S 2   hb  P\P Ο0S00 X V V0D.020c RKKp V긎 Ğ  L p d = R $010!X00Sx P\P ͟0S0P0 P U00UP` U^ !UK u ,00 P -U u ,00 PF u,00 @KQ PK P\P ̟ 0PS  m PU U U U P-0KT:"0R0 K5P; AT 0 !R 0(000 < H [X @X*X ?X+X !X 'Xk V"XE \X \X$X   - P\P D˟0S00  (X {XJ [000@* 00X  " b RKvp P\P ʟ 0S  00   00X    20c RKMp00X  @00 00$0000K p P\P ɟ0S00 :X %X#X~ 2 Z 0`0 K o 2 Z 0 K    P\P ȟ0S00  P\P ȟ0S00 q (X > 2 Z 0 00 0`d K 2 Z  0 2`0c 0{ K `X2 Z 00p7 ` R< R 0S BR RB B+R ' Kc  P\P ǟ0S00  $X "X 20c RKtpX 00\00" 00\X `X00" Z@ `@ K# \X P\P Ɵ0S00 X 005 2ş Z  0 K  P\P ş0S0P0 P(U 00 r h2 Z 0 K "`R 007P )K P 0@S " b RKp  00 R04ʧn0(20 00 < b K0& @)X (X0000S0C P\P ß0S0P0 6 P)U0020c RKp/KZ V`>X<XBVPW U V00W00SZ xn)X O&X+  X"t2 ,0S x,z(XT2 R P\P lŸ0S0P0 P(U  P\P Ÿ0S0P0 PU |X&UF ;X |X 1&XK;X |X0x"`|q0FSGLAz@T *Xl (Q dX0A0EA0US2 " / AE&2`A2&  1'P@ 0 0S 0S <0S 0( @ 0, <0Ŧ `0%<&%%81$%%% l&<&8& 9(AE &P@  P0R }R\ ◦ 300T*X 0S0 0 0FU0`00C >X000 P\P 0S0P0 PX< <X>U&P 000 0xWl1E` P\P 0S0P0 P-U0 0 0&U >X00  |U00S @0<X00>X'X2 JZ H ` 00C0 K "X|2 JZ `00 K}X`2 JZ `0 K0S ꨟ ` (X( "X 'X @TV2 JZ `@ K p 00000)X \X  00C000"X \X0 0C'X0000C`X  " \X P\P H0S00 6$X "X X\0:20S\X `X2 JZ `# Kr(X000 )X00CS0 P\P (0S0P0 P)U b@P a000( `p 2 JZ `  K5\X 'X "X 0 0m2 Z   &`000 K"X \X P\P x0S00 $X "X X  \00\X `X 00` )X |X (XO 00  2 Z 00` K 0 00T}X |X (X3 00  '000 P\P  0S  [X X'00C0D p-LM0P0`0@V:`p0T:0&,% -LM 0, !B0001 < 40 0 J408 0<0 @ 80,` pcP\P 1 R0P0 PUR W U p0U <00c R<Kk @P`S UU( P\P 0P 0R0 P U<K U$ <  b RE @P<00c R< @P8 0 08 @@0 `0 00C00, %<&9 --hLM 00CS0< 00CS0$@@ G%d$ p-LM@@`ᨣ0DSp0P B    $ < (`8 , 0 4 p<408`卣400, p-LM0`0T- X 1 R$ R 00S  RXiz  0S 00S 0S 00 B(1  tX0001, dP  0R@ S 00@,0c aR, ,@@D0S L   $0S R;T 00S $<0 0 ta%$%X%l&&& 0-0LPp@P0@0<9 -0@L MTP@ T ,,-0,'- 0, 000 X e@TP0H , c 0 0X%<&@9D9&% -!MLM4ʟ` ,  PT( X8 \ d  @ 0 S\ @0S 1 !KLLl dQh S \SP p\Pc !P@3 X00 SH X\ h R$ 0 B 0d h(R`80`8 0S X\ T8Q ,0`S ,zm@!P@ 8!mK `F0`F(0 1XPX\d h(R`80 0(XePh` @Q 8 R!0AVS񟗄L  D h 8 T x   @ l Ķ 0 X | ȷ  B^KPEpPE0K,0A+K0+0Ba`XP@p86B^K PE0PE0& Pp6B^K PE 0C00AS00@SB^KPEPE%0 0 B^K1PEaPE0%Opl40lWB^KPEPEl%0.-l'0lJB^KPEPE<%`}S? P00{RPPU B^KPEPE0$O~KpGpG+r}7?PPl/lB^KPEPE0 ,}&?@p}B^KPEPE'!l/lB^KPEPE0$B^KPEPE +rwR*d+uB^KPEPEB^KPEKpPE,LSB^KPEpPE\0HB^KPE0+K pPE,0BDl/lB^KPEPEt#{B^KPEpPE0K K,0L+ A0B^KPEPE .>P0p0"3B^KPEPE0)}P tP@ B^KPEPEB^KPEpPEB^KPE pPE 0` 2B^K PER$0#0pPEB^K0PE`8 pPE 082B^KPElT/lwB^KPEPE "B^KPEPEo |>P  w>P B^KPE@PE+r )*@)* `g>P l)*_>P B^KPE~0KKpPE,0L+A$)* !P0/S)*B^KPE0PE 0B^KPEPE0 N0 S Sh8`8  p S \Sd80#pd8 h Y`00`8 0d$H9%%T9*X9h/\9 h9%%TB$(Ȼt9 0S 0O -LM䡟䁟p@`P\P 1 R0P0 PV(t Ȼ ܻ #U` 00``` 00c R5@P000  V[U(K8P/ P(0PS  b R0@00S(x0P\P L0 R0P0 P0 `%l&<&|9 -1LM  0((0 $ 厞(0p000 , P`P\P 0 R0@0 Q@000c R0KP[T@` ]T`FTV T00,$ `uV00<&% p- LM0`S0C0Px0U  Q@@T0 AQ 0p( P@ 0<0% p-0LM R 0 0P 00pphP0S`  0 0R@0 \T 0 0R0 P 00plj@(0  0P 00p % 0-8 P0@0L ם @=00<& -LM0@=C0 0 ]<& -LtMT- 0S00cS0P@$ T P0 0@TK Px0: SH K 0S 0X S `0S X ,'P 0@@$(90( 0-LpMP0@S|0lS`0 TK  P|0: S\0 0 00邝ꀝ% -LMp@:``[PP :<`PP%;P@ 0T\S T 00U0L0 R T?;@Ꝏ D%% P0-L@ P@(T ,T0'% p-LtM@PH08`KdP0: S`0 0 0p% 0-L@D' Pm(,0Pv0h+@39T} -LM0S t " 0hQOK0`哜G/00 K⋜<( ?U< [U) ]U" |U )UX IyWpGY00X00S |2P X pX Y X R0!S@ R0]S@/ -RPL MP@p`R *0U5#SP QT:U0S d?S^ *S 0TQ T PE0 P0PS:< S P, 1 0TPES% ,0 S Z0@00  00\ , 0Z,0XP , 0P,Q vP@QSSڿ0CS P, 0TPES,   U0@00  00U\ , 0Z,0XQE\  D0x U ;P r, 03Pk sP, PEU0  g 0@ P ,0X , 0PGZp@-@^P`D R6 R0 ^ R 00 Q00S @^0]STp0-S0S \ Rp0 \0]S[Qp0  R   R( !^` P-L@Pp`*0S @T: `)\ 0W0|\00S V  =1P``Fv/0 G61 0 0     -LM@\`p 1  PU$0Q-P0 Q -P 000#0+P0SPU00 -P  0  0 0:U?U0 ,U00;UX{#Uy 0Pt :P? ;P= ,P4 #P 1 pW !0p !0 00 0PpP 0!0 00!p p0P 001  10 R 00%1S00! ;P :P 0 00 PR 0?\00P000:S00P 0X LH0P0-SG\D0 00 l&*p <(< 0-LP0 S@5 0  0S0h0S 0\@ 'Se U 0S C  0  00SU0<0h4PP0l& 6=4$ -LMh4 4  , 00 @4q8 }PPP@vTX` U`V`P40cfp0S0W<0 ^ ~,@\8   00@T pWP8o, 4 0, T < 0<&>> -QLM@ WPp `PP*PU e*0S W0S0@e PᄀUp:0h0 -L`p  PPZ ظ0#SԸ0@P͸@ -LM @qP 00 qP00 p-@LMTP` 9TP pU ׁP0  UP00p0[1`<& -`<LVM`0 0 /Q40 8 , P80 0D .Qq 00pW8p  8 R 0 S:S0 0S:S0S0g0 080YS 0/S , R 0S38 0RY 0c0 0 @ cR+P @  0 SP/R/00040 b @0 bRP 8 R00 4L0 cR@P ,,  P0 S/R/000.S0S/S  8 0@-S`G /SppW @/P/R7 ^/ .^ QP R/R0 00S/S /^^  .^0/SSQ000 QP@ Q AQ0/SQ.00 /R P-Lp@` ӀP0 Ulp cT X0T L0hbP<0P@@ &\%%<& -LM@᥀|0     00 K 0  P 0P/0000 ` <& -MLM0ܑ0c0SpP, @ *PT? 0/Sb S: /-P`dU VO V> 0/ c 0 0c R PBNK ` P@D~@D` 5aP0`(K P/R P PP X@,0 S ,0S 0.S0.S U0u/S U0.S `0/S 0 > -LM@p|0`]00 0,0< (p0P )UP@20 P00S 0`` S`` og op4tW@,g<& -PLM`lp@82 T& V`0 0,0$ (` p ` P oꘀ[x0\00@0P goP PP PPPP<&> -pPLM`l@*$ T P (0S0W< 00$  `  %o\ oP P PPpPPP<>\> -L^M\pP`@)T0㠀 0WB , 0 E 00p(Ppp PPP $0BRU@PQkplJ@E<&|> 0- 0PSL@FP 8sPP0 , 0,c 0- 0PSL@ +P s 0P 0 P0 0-0L@P  0S0 0  00 0,0 0- L @ 0  0 0S[ :Q0a0 /a0 P0    0h #$0 0 > -@L P 0 Sw p   0:0@ #  = S , 完@0  d0d@0 0 90   0p``V  lPp``V@ 90 00괴0S@ ;0嫴 0W$ 0  3|000@ꙴ$008@> -LM @   0S9 / &:0  P s0S0 0S0:00;0_0 00$ 0:p  K$00 > -LMP `p* V# @T T@ |0 `d d0V0 pX f0;p @T >> -P Lp7 WpG2 @Tdp) @T!  RP @0a@T@` {pW00 V dP  X@g> -LM @T 0S  0C 0 P 0S G ? 0-L@P8 50u  0 Q)  Q000  0QS 0*A0 0 00: A0 PA 00 00Np  0S $? p-LM @`A v" + 0`KS" PK  P P90S   ;000 $0p  &$0 0\  R 0 B `0p   P@d -LMp, PP0@07 T`( U FT&T &T 0PX W  0pV000 ;T`,0S U(0P P@% p-LM@0S( 0 ER p`0P0 Q@@Q$T00 0h 00`S000 L0RP4 5*p000EP8&$0&T%? -LML0@S 80  Q 0P -LM$`Kp@H P  0n -)L @0,0 0 4 Q0Sq00] (P0a0 4,0QC*00 4 R007 |P 4,0`Q`Q *@@ 00 `40 )}0S 0 S q `v P0 @`DA A@,@ 0 4 d0@ @dDA A@,@ 4 0 Q p<&8& -LP 0@S x0  V=QT 0SdH1@P U0`0?(0 JPp Z 000F@㌂0@兂 P0P0 :00 0p0 p@n 0p P{  0 l&%<&$@ -LMq@OQ@0 0 R|a0$ ( 0P d1PH0S00?  P( 0\*,1  ( $ @`DA ?A@ @ ( $ ;0P0 P@@T,($ 0`CQ 0\*@ $ `( "  10 0 $ ( 5|;P00 s`4<&8& p-LMP`@@P`p -LMl@ll P 0S0S $l0 00 0 0%% 0- 1LM!1P@@ \ 3 )\0@S0  - P 0 S P0LSPKKK PK 0t TPE\X K0P <@ 0 0@@%@@8&h/ /@@- 000%0 -@0LM@ A  @     <& -4404 LM,@~0,%0&% 0-0L R@0x SP 00SXP0S8 0S$ P%p##9P 0S $0<P 0S -LMPR0@SD2Q00@AQ2p Q`z T1s Tp Te T_ TY 0DSLTEQ;1  0BS51R1Gp`0T0 W P@0T*0p0@1@` DA ⤀A000 000P0 pP P0`p V P 0CP`)Q``(Q``P H0`1PL0Q``,0 R8&<&  $  p-LM@0`S0@ %  R 00P0Q* 00p@t0 @dDA +A000 000P00 0 8&<& -0Q0L0 7(0 0 08&0S  0S R   -PpL@T`01@T 1?A1cX0P`+ @ TmQU 0   @ T0A0 S R 02SP00C0gfff -pLP` 0@01@PT  0R U0Q@5T;P0 -LM0Sp@0< 8C80C01P`U  0R' V0aP6U0Sсd0p@$000 P@ 00 Fo00C0PP 00 0000CS 0 0P0 000CS0 p-LM0P~0`P@ 0T S0 0 R@0P@fDA c01p<& : -LMaQ @ Q1!0 dT Q  0  褀T@tPa4p0 @0 P@`|hT@tPa4p L @< ol(@@X\g> A((L*(0 ) l(< p-LMⱦD`0@TP PpPP 00@ P& -LM0!0Pp@ `0P W P oP`V @Z PPP oPT zP KaP PP0l&l(A p-0LMR@F`\0 @ P0  0S800 0S/`pl(&&%0 R(&4 0S 0 0 R CZl(T 0S R 0S 0  R Q CZl( p- LM@`T P0@0@ x0 P0S V 0 0SPU @Zp0 0&&&l(% A - p WL` 0S XX P< 0@ XX@0  p 00<~}0  @ 0 i$% p-p0LMd `0`@` P0` 0S 0SPU @Zp&&%l( 0-8@L P0#0 @ PUZ0bl( 0-@ LPP.0U< 0 0R0 00Q00S` 0h7 <0 R 00Q00 0000|%> % 0-\@P0L  0 S 0P 0 *0S  * -LM@p PPP0 "  ` 0 R$V` p0ppS 0p(K (p $0 0 Q`( K0Q(0 S  00 0%>  0- @ PLt 0 0 S pE XE tE E 0  000 000000 3 (A -LMp`XP 8C80C S?DF G G G G G 0H DH H 8I TI 4J I I 4J J J K $K TK `K hK 0SU @0S %o0S0SB @0S $a0S PU0 @ T&@PT 0P0S 0S@Z m0S  0$0 '@T 0#"#0#0#t0##P 0 p#\#T# @0S4#1(# @1S R 0S0"""@0S"d"0S0""0 0\"PU @"@0S \)|"0S0 !PU!i! P10!!0!0!yd!0S\  P 0w0DS L (M HM PM `M hM T \ 0  0  0i 0S|  @t t ` X X T L L 30#0P pBHAAtBxB|BBBBB `0-0L@P^$@0hS^$? -LP`p@ TN N N N $O |O O O O P P $P W@ `T"T $T \$(P 0S)P$((P 0S)"p"p${P @T }@T}P(|) -- L 0 -- LP4M@@K B 0 0b -P LR`p %R e R ;0B:SQ P P P P P P P P P P P P P P P P P P Q P P P R R R P P P P P P P P P P P P P P Q R P P P P P P P P P P P P P P R P R p0  ;R   Z @T @DTʜ @DT  pa@p  p@P 0Sx ?dRX`X@-00dpPg 0S` -PLM`G x p 0 S P 00P @0S`x@PP200P @0S`x@PP00 P0 00000SP p-LM`P@eSx ph~h p-LM@`P0 SU U U U U PU PU U U U U U 0S Td.p@P0SVU@ PEP0TVU SB 0-L0MDPK@ B 0 PV V V V V DV DV @W W W W V 0$(P 0S)$((P 0S)${P P P}P(| -Lp@PUjw0@S Pw`00 R 0S0S1SP01  p-PLM`P5 P0P 0@S wPwP 0@S w0S~w P phqwmwp -P@LTp` P 0S0S Sw0S@hKwJwHwFw -LMLapP]00,Q, p=P@, wXPP pXP XWi\=4  ㉿\00( x }@@ T so=Ppj=P@ if,l,BB C4C -LM@0S\00 p-LM`Pv0 0Pv0@0S000 L000 D@H@ 0 L 0Pp<&  -pL `L0P0A@TJ0S 0 @TZ 0 (HCvhvj  ~<&L& p-LMd`dd i0PSpAR ,P1 S0 0 % -LM@pP` 0[S 0S@┐ 00  ;@ᵟP3v g . p,K0ᡴ,  R*  vw<&C -L MB0( K!KP` 00Po![P`r00000  0   !0 0B0\0;00  H10 R 1! L0R'` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` 1 P 0?00 00<0; 0@ PpL0PS !0[pS 0002P0<0(p!0[S(Ž<&l&%$/ -LM@0, K%K@p`;00  Q ! 000 TP 0@L@T " {P  0 00  0000%0[S 000P0<0,\P\<&l& -L0M\0 p(0 N@a<    0`7 (!(1+`K @ 0O#ODP0U0f Pb00fcP@ U 0 UBa1#  f0E  f00f 0S-00f  d`(0 S @(400CCgfff D<& -LMK @p & -L@,50 R00SP`p@K B 0Q0*vt0 V0   0 00 0W 0[t>0 00p`e 0V0 H 0 0òP 㪼T 凼<&(DLD 0-@0pPL  0 000hI80/   v0<& -L@ P`rM    RG  0 !@Up0 00SB Q/ \Q\-Qp% #Q, 0 % q0  0  R0Aq0 0  RWAq0 0  R7AQ00?$QW@d@T00S$T@` R XRxR00  0R `00S _l& 0-0LM @KrpPh  0 R  R0P  00 [s0 -L M`@d0P  0S082sp   ` P P q00  R@PdU0n@P 0!0!!0eP@ 0S pL10  00S Q8!0000ӑ0Q 0S p00  00S Q 0000ӑ00S q00  R@ 0P  0L @\00S  b<&l&`DlD؏ -LM0p c` c0P00]r@ b@=  0 0c0 }bZ or -LMP, 00 AP` 0[S =S `@3 R  %0U p[0  , RV0 x᩺V h3Gr,  Q 0X40 @L , 4 @ )80 <   0T0 V0 S   v ,0   k 0 00 008 0 R00S@0    0T0V0S  <0S0  Y%@T4 R} V 0   W0S0 ?S 0S ) A <P 4  00 00400Z  q q ONDHP CPI<P ,0h  `@P  @QL@00  Q 0 ͹%LD<&C<;x00l& - L`p%60W00S PU 0@POqU 00WD0<0 0h> @h0 Ru M00 pW-00Ĵp k  0pWurH % p-LM`@PT# 0dR 0@P0@pdv0S0C0 \vt 0S00Rv0S00<0 P bPBv0S00 -PLMpA0S_ PWa$K@0 (K,K @yPPB H1($01 $0T00 (0@cT  R 0000 0 0@@,0O,0 z0S @TYP p300(Q 0pp,H l  -PL$M@`P㼒 r0S㨒 T0S PV0 ,K0K4K8@K @yPs Ve `FVV80S940qO`@M,03,0!0zP00SP 1T0 S/R  P4ky|1|!x1l1l!@@4@Ppy1UpU 4@fy0P PU48 +v49y540P``pyx0 @ x00qQk D0@@ P[  000H  l -L$MK0 K @KK @WxP@ ux6 0 RPP% -T0LM @R 8 TT^htt@@$t@%D0P00 & -Ltht -LM,@0(S6]0000% - L4MPp4 @ 0 `P8 < D H L P Xdd%Fip C0@3S񟗖 t t t t  t t t t t t t t t < t t t t t t t t t t t t t t \ t t t t t t t t t , t t | 080 @0P`&L4@ 0 P`08 L0 @ 0P8 `0@0 P`0< D0 @@0 P`q30  00S00P0  3 P @0p3 {@0 @8@  H p$1 ,K@, 3R0_ \ @0P< `022 pbW0@0P` P@ pQp x"t2pl\"u `B` ppZ H0ST@0QLUE U< U3 U0, 4 R00S#@@0p0  0@0 p)< 0@0 4 RP@tV00V 8LV4<D V844 0;4 R 00K 0p4 A+MPup40  0P4 hLbE.E-8rE.BEEEF(F -0L 0-㕴0@F -L`M 0xpKP `(0 -:)P@ PP. P|K< |\ (0 S l(却< |P<|K  |0S0lGG -H%LqM0<%@4% ,^/K, x tA pA lA hA dA `A p2 d1TA !P rKJL4ğ01 .%BHHH -LM40EK ,0 $! FP@~ rK0A 1 $11 1\1L1\.K1LWP,0 S ,0H KH0 D@ @@ <@ 8@ 4@ 0@ @p|R 40PTP KI0T K0 P -p8? Y xKCP 40PU S|0@TBoKp I0 @ 1 P p@ K \1R |0T0 4i80.$B H BE"BPGH!BpIEH -LM`pPp@0 K ,` 0st( K 0$0 00 P (0 rK0s =0 =   0.8=EB$B F(I -"LYM0Q` H,0 P\  BPpHT +IT T 8PPCTn 1!0P1 !a?KCTQ (0K@ |Q xQ tQ pQ q cK[OKaK&  V@ H0tp1 1 1 1 1 |1 x1 t1 B 1 ,0S 4,װP |=K ㌐`H H0 x1 pA | p t1S ^101 Kp! 0 |1 x!  HPT CT cT}P04ILIpII.&B III I -L\ M 0  ^t PP X@T :E F7C7IJJ(JLJ p-@L M4PT` 0(0L0,` 0 00D00 `p7I -GMLMX0PP(0 `@8 0@S ,S  B~K0pG hpG,SS $ 0 @S\Q ! 0Q0P00S Q\(0 S p(d6)IKAAp 41` V$ <0hJ|JJJJ 0-L(M@0P0 $ 0S 8PK,S  0 a,SS0fS  nS0 S0 S 4垯0$6 (  ~60JJK 0-L MP@0 (K 0 00 ,0 (0 $0 0 (H0H0 KP 0S $n0 T60'BK$K 0-@PL8 B\P 0"0, -0LSM⤀ YOK0p $0 0s `IKPK@dK 0<r $0S $$#;0td@AP;2Q F3P2 R2 RVP,0 S ,IE{0S  |G6: S" KAAv>P 6: S ᱆P $/6: S Y (LK@D@DᜆPNK9<PKP N2P KAA!PaNK@D@D= |8 Px91( K ! Q@10 `?P00CS00Ӥ0 Pp @00CS00Ӥ0 PpyZYZf`2PRL 80 6...tL|LLLL h  -0L$M@  H0 < H@PPD@ <_@-Pp E`Pb[0S| t ᓩ@T QP @@e@P77@ Xa7D0SF/P=Bz00LÁP)$, 1ϠA/ 0(@@lN#b8K@80 4 0@ , &P7P @L)<壅P0< $@z0-S @L0S @ zH@@ 0 R@@0;0<lH0\0;P@q@yH D ^@ۄz .. 6LMbLLL.MM -LM0 4 zP= ,K p# ,00#4 qzP ,K p ,0 #4 LL|嗄|@0xx x0$hኄ@40(@4,8 ,0LMXM`MMMMl$ 6M 0-,@,PL $ -0MM -LM@4;P 06 0-@L&;PU J0S6000 -LM0@S h;;p@-0PS00p-\@@T \ P`r00 P 0 R0ATap輒 -LM0@SK P ; 00 -LM@08SK  Gp 00  x6 0-0PSL@0S00 RP0P 0S 0- L0@T  0P0Q 0S =S Qh0 `0 00S<Q  !Q >Q  PP e$. .(.N -L]0N 0-XPL0S S 0@ S0 00(. . -LOM\0X,0 0P S ,0 S ,,@OKKK`VT OOP W?K+qPW?K \!QH1SD1 L1@SY0P S Tb818S <* /0(.(N 6 -Lp`@T TT#6P0S! P T0  0S T =@T TT =/(.0NDN -Lp`PU U @0S P U0 0 00b0bPU U t/(.DN -L MP`p@T T T TT T$KPKP@ (KFP; 0D S  $ (0Rpp`$ (0Rpp$ (0Rpp$ (0pRp$ (0Rpp$ (0RppGE0D S  ^!PppýW!PppP!K!pPpE!PppӤ>!p(. p-LM^`P0S p.T@0S 0S uP0S (. p-LM``@0S pP0S {@0S t(. 0-@LP|VTp0 \0@ R0S<πX+wPP$.(. l$ -`L8MpP@ M\l2@ N\X2P L"mZp5&LKTpKPH P K0T LP f=P@P00P0 &8P`%. P 2?0H P0 T @@I=P |3<K =`800 pS080 80W@:0T@Z >\)<\00S#\! DPK 0  \C0[SD[0 CR 0R P 00xLl*0 pW@X D00CS00  ä0 LLbhNpNNN 6 -0L (㐦0N p-0LAM @P` Yp sP` /0 @bTQ!P >"PpdGOKPP V.v.PP)30ȆNN -0L >0O -LMnQ@0,T  hrQu00000 0 000  -LM0p (0 P@/UoKK/TPKU  S?K\ 50SKK,L1 H1 D1 @1 <1 81 41 01  >,KRL0! K2(0 S (0 O0O -LaMb>K0C 0Cp( @Pv$6: Sg  S>PW(0 S (ΥGBnK`F`F|!|1=0S=@aD3PP$[NK@D@D  PL22W>C R0 RW W72t0S =@PPW dBnK`F`F+aI0)0KW 08OPO*edA\OO 6 -LM@X 0s YYYT01at -SL Mp@P3t00!1/P`!  Vx t0S@ 0P P* W@t?00 \@a` X0P P* rW@s?00<_,.(*O -LM@ K K 0K @@:P -LM8 < @ P`pm 4KP@h 4 0R SB 5P`Z 4 ;40@#!P0PS ,KL PP 0 P@ U10  PP 00S0 KP 0 R ;;S PP 8P PP 0< @0T PP<V 6O<_T<*OOO2 -ML M0$ , pp< P`:1s?000!1 ,0S ,$AP@ 4HP 0 !0P s0S08s0S !0YBKHH F:0@C:^PP- ߢ0@S" l0S f0S+ 00Lq \ 0$ 0:r?000, 0"]$0OOOOOPmP -L`S$Mp0K,  Qq00  Rp0+S-S-S +S 0+S-S QLq430  00S.^A0.S7 Z0PC Z04 "O1@K00K @0KD@H L P K 00K\ 10(O @/Ir "00Z @r 0V 40OSl,0`( &"0K`PP, P0 Q!000ӑP PUr"00 pL1  0P81@@K1`E% 80 ,,8 p0@0KX0 4 W0K J40K5 B"0@Z$$ `JPU *0 K0 P00KU:@ K00K ,@ }V`-V`8@ -L00K,M,P0K?Op#$pW4 @@K0 PX @P Oß$ 4Be!5P[ 00Sq"0 0 /";0@@De#%P[0SY8<!!O1@K0@ oP P`O$  !5;B S<0 8 N 0,E @,P00Q 8 0,Puڼ!@@PK0 4K !0- 0d|8^,Q@00 KPP -$0LM KnP,2 -0L: ^jP,2 p-l0L M0@ KP K0KK@KmP`+ 0 000p,2 -@PLp|cP p3 R %R XV 4 * R00cPE: UcU pP/02p2p2Pbb$gfffQ p-PLM@`PC ph10  00S H100PC r0 0  R1.\P' *\\ 0SU 0B8 S('08C?P3PPڌ@PEUp pT00  0<0S000PC r0 0  R꼒bxb -"P@2L MR0@K0 p` UsLz\Ō\pG   a 0a>Ìp4G6pGƃ??p`F R bЮ?Ф@A P 00Q00S Q b`.^L2a?@ C_`0 Px 0 P0x0Ńƌz(p , 0 KV10U0 | 0 P@u 0 !0 0 U ?Rp@- b@0`P \02l`1^1b\@0pRp@- b@0`P \2lPnR0l@0pRp@- b@0`P \02loQ^Qb\@0pQP:  -P@Lh ' \ $ p`T<  0 p`@A -0P@0@PPUL  t  0    x P@Xp`X 0 P@(p`@A? 0-L LP@\4 00A -LMO@jl0S -L M. p\G/ `P+P`0 `P8@0  KR70 P p0SP`$PU` K?@0 = 0-H LP@0S0h#p0 -LP@,M⌥0KQ0 @ ,@ WSO@S`8 RPRI*R4%0 0 0 s 8 0b038 b&x1@"1(8!8HT*@@*TI2@0@b0P 18@8#8XU*P@*U@2 ȀP-@ 8#8xW*p@*Wp0@2pbD Ȁ,&8(8"!8S4P00^00S LT#3 -L`P4M✥@K@S`0PK 4P `@ pRRRK*RT%0 0 0 0sH0  @H 0c<3qa@ &,P,x'x@@$8XU*P*UP0Pb,@,@P8#8HT*@*T@04`@bV@@ @H << 8 @0KP0`KR#3R,`Vf*V#6 0 0 0sH0 !Ƞ,Ƞpf&X ,P,X @@$8XU*P*UP0Pbl,@x,X H Hb a@@7&41D XrXP V,P b,X'8,Ƞ HXAUX @@ L *P*UP0Pb <, @H,L 8#8HT*@*T@0pbV#3T< 8 @@K00`K0|T*T"4 0 0 0sH0 @PWU:Up@ 4Qe @ 8p < @0KP]HPH Pe@ 65L725|$8 T0 DP P +P +TPH%X @'8XTP l@ *@*XI20bP+PP+T 8#8XU*P@*U@2P0Pb 8#&Ƞ ( Ȍ"!Ȭ\@ 00^00S 0^4@T H D@@`Q p6247r<0 8p @PK`4`T#3w<66U**Q** p-PLMP 0S 1. @ p.0 CR 0S/S- R0/S  BR0/SR  BR0/S 0e` V*p@ 1-00Ve@?008 /P0.(@00 BR0/S z21 xB 02 #4xB 024=> 0&)@-O@d4xB 02d @-M0Ѝ@4=> 0x) ;Q -L MQ@0K00#  0 0T0P00S00#0 -LM K K!)P -LM K K!y)P -L 0KM# ( -@@L0MP0  0 L0  00S00 K( KP(d00 b -LM`Rp @t%  P`F @pT`P0AS3 Q)0 0  00    p-LM @0`SPR0 S    0100p 0S Q0 S  0S0 .R@- P@0@ .\Q00Q0S@@ 0S0 .R𠁢Q00á?P R-LP`@p0V  :,00@@@@@@ 0@-@TP Ž0P000 -LMp0 S P%0`0! @!<+ V@2CP0@KPUN 0 S  吔0Q0S 00Q -0S 0  0\\00 PJ J J J J J J J J J J J K J plhd`\XTPLHD@<8QR R@RXRtRRRRRSDSlSS'*Q@-@Q*\?\ [\#\ q 30  00S+.10#0 \00S#10#0 \00S.20#0 \00S  \  0LS00S qX2  00S \\ 00@M \ JLM M M M M M M xM M M 0M M M M M M M M M M M M M M M M M M M M M M N \00n  0000D0\  S00000\00a \00b \00t \00v \00f \00r  R   ?\*\ #\[\ 0 \ #3 00000 00@\00M0 0qL00  0 0S-00 ^0\0?0@0\00s 꼒 p-LM@QP`0 f0p0  Q -LMP4 Q @pB8 | Pz*QP*Q?Q [Q#Q p10  00S+'10#0 Q00S#10#0 Q00S'20#0 Q00S : Q  0AS00Sp1  00S( \Q PQ T:`4P00 V Q 0K0  jQ@80c@ T4:@D`0K0  j` VPE  {)@`꼒 -@TL P`p T0g0 0l 0 e@DT ;&* -AMLM#0,0 3 㩼P@U ;PPYBnK`F`F sP 0#S | l P2 TP D P4343 0mP BKH H 0 P4TU WP@ 0  @44S O$`2 ,0S t, B^KPEPE\ 74rP 0#S 0 ,  '  "P ``` P BKH H 0 @4dV P 0 @44SBNK@D@D + 8 P@ )a0S  P@0S0T %0S㤐 0S  0S  0SP P<  `0|:|6`n:SS#XST<8\T | -40L R4P P00|:: 0-LP$P P$@ P00: 0-LPP P$@ P00: -LtM@0SK ᔽ0KP H K 0S x0L: S< `O00 `0:P0|:g<_ -LM@0S00|: -h0L,M80 \0 00 T0@4 , (0 $@ o )00 8K 0  Sgp\g :P0@-@P  0S ^ 0S^0 @0S SS00@00P0 -QLM@,0 pR {!P4 i 000 h 0p` V Vᘦ%j:$,0P  0\0 p` V000S00 YB080 4 0\08 0\0I` Vp Vᘦ%.:"0\0p` V?`Wpᘦ%$ 4,0P 0\04 0\0Y4! @,0PP`@,0PP` _0 0#*//#*#*#*yy#* -4LMQ<@ 8#8Q8:0Q 4 %*0 0K Ġ̌.Č#̌ !f& -p-LM`P@>KC/JK X1 0Q ,Q '_?K A xA 'D0 bKd1 t DQ k 0S 姏p0\ SQQ^#*vvZ#* -LMP -LMl"  2 ,  " !H p!f0P2 0H&PP 0Ss P (P 0S w^$481!`)!]0`X0 `0ᕯKS/K ڜ1S9 @T  0(KQ QMK0SMKP"3@(K0SS SQ v& 3p& 3j&OK @D3 PP-?(K R!  E0S 3?(K R2S "RK !K!\0 4X  MK0kPMKP P+ 1MKF P\\ 4b \0S \N L&* 41`\?LD K3 h\0#S \/  R@]K 0@,"|@B"2@@6P 0S"2P0Th!HT TT,T \*00 S S SP\P 0S ``#Pz0+Sd -S D 4zP0+S0 -S 5PPUb ?? UP[|,0 S t,國0S @S P K?K/-`0S @S K?K!-0SP @S  4.P`8~ 81S  K?K - 4t8 0SP @S 8~ 81S  K?K, 4\8 0U -LM8KKPp <, PP `P@ ,0 S ,"P/K%>KH D LB @B KH L @B 0VP  - 0P"`0S00 @  P  PHHH  10BS0)00 00 0 -LMp @GWT`P W6Y4UP00h00C0@` @ @0P00 R0pp Ph 00@` P 0h1 0C 0 -LMP @EUTp` U,Z(V`00h00C0@` @@`P `h 00 @` ` 0h1 0C 0 0-0L)SP'010CS#\ 00 \:0@S0 0P*KP0000@P000 -0L)S`p%010CS!\ 00 \:0PS00@T *0S P@ T:00@P000S  \00 0S00 Q-0L AS  00 P  1Q0C 0 -0LMS,0 p`@2Y00DTST* T( 0PP` PU00XQW Z@@ Z@0 J0  0@C,00 0@ -R0B0LM@@^ T lR0 0 R B0 0  0-L@ Pq@0 -QLp RP@@T*`0S@ S CP@ T:00 6P `0g0 @  -LMQp` RP@@T *P 0S @T:00 0g0 @  0-@L P @0*bb**** -L0S  I "00V:` P@ `8%0==0` 0  @ a0AS"                   , @0>0@0 @ C. @ @00p+WP -W=W@0D =W << D @0 0X0C S񟗖 г г г г г г г г г г г г г г T г г г г г г г T г г  , T г  IPI< @\  @ R  @0<@0 X V:H   ₑ H / P@N  j 0`@C80@ `< D0R0+W00=WSD  V:H   ₑ H P@(  j 0`@C8@ <0X~ `< V:H0 0⃑ H0 P@  j 0`@C8@ 0c` &XD =WRD0=W0VD0 :H ⌑ H P@  j 0`@C80@ =`< R V:H0 0qH0 P@  j0`@C8<0X@ !`0S ,S 00 Y ꒀ;I9 b H 0@'͌@ H 꼒@-gQ@ =Q +Q -Q \ XQ0R0- 0+oQ uQ\00@ ! 0 00 0 +^00 -^00 =^000 0@-P 0+S -SXS S5 0+S -SXS @ 0-S" +S XS00 T-00@P^+00P\ X00P0  @0  @0!! * --LM p-P0LM@`P8 4iT  | x0 - 0p@L` GPP0S @TP@ -L 0SJ,b 0-0@SPL(( 00 00&<_@_ 0-0PS@LY PPU  PP0P -LM0`Sp (KkPP (QC 0#S@ S> 0 S RA(  #GP0e(0 (N P@} ( D(0PP9P@ P0 S S0 S S *P0P0,K 6,0S ?R0Sp0PB U 0@S  R00 RZ@ T 0S 000 ! BX @P@  PP 000  bG0@NF0@ P0!P 0V`@_<_,b0,b -L>0S,bJ\\ *;; * -LM,4C8̓ <.K #h, ?KKK@D3 0# p @ @b -p`LFPP ቞P @P ၞP 0S0S @b 0-@P@0LS00x$ 0000ᰡO<__@b -LM(@0S0 00O@b -LM0St (K Q@`Tg ( 0 S RL0L(  S * (0#` @Rq {PU`@3 0S0T`ÅŢPP `0 S S0 S S ᶢP@00TP@ 0U ` 0S  R00 R@@TP U 0S |00x0V:\剢PP 00P P@Ņ,,٠POOS`S8T_<_@-Mp` @0\@X\x\@ Q $Qq0 0  R#0C'  Q .Q0V42:ЍQ q00  00S 0gC R17 1RTq00 D R q0 0   Ra0LA0L꼒*2*2 -PLM@` )C00P,K0K 0, ( PP6 p VT000Pp  0 PP p  B0@B@* 0-! L0TT- !P@BT @@ T 0B0 0DTL0`X XKK, PGK %K !K K K K K  K  K U0S =E0S. 0CS*V w@1 ,0S @,n=`q KOp=0S [ TWKP1KXKL00L0 60[S0X K60K#4=00HPP = 00do ؏8`\gl 0n0do -L0Mp0P 0 `@ LKL@KD00D0 Q Q U=00 0 S 8 Mn, Q0<t,t,t,: Sb0 d Sc0 ] Sp0?0 0r0-00w0-00!=@SL CS-0> X! r0-0 0w0-0R00 &R-0! !r0-0 0w0-0R0 R-0 00 0 R 0Rt0T0x00 R 0Rs0S0x00 S ! Ss0S0x0 Sd0 Sl0  S-0 Ss0dd*}*%y*%KKt*p*ook* f*R0S 0S0S0  R00''O* -MLM00  0PP S`k@T T 0T,S 0S P   0PU  0PP  0PPPa p-LMP0 S0 `@0 P P0Sy0X S0L@0Sp00h e b -L M̀0`Sp(` +P@# P\  0*P x$ K10wP(K╈ᔎP (80  $(al&L@-0S@ @ 0 0 0  -LMha ^( @Pp$ < 0ڷPD ( K10'P= (P8U00T00S*0U0T00SW 0P` P 0 $@A$ 02P $ 03$Kal& --L 0-<0@ PL,,LT ` 0h0 0-0L@P 0SP0 CR 0P0 00R P, 0 0 -L M, ,P0 `@ t00  R-T0@40  +T4 @VV0TP V0T ``vp$t0 0Q0@Dt0 0Q t0 0Q7 DW D@T\ W00 T00SG' N,p"00@40S\00pgS \,00E0XSxS@`P꼒 -PL4MPL p` 0 SZ@P X 0 S Q@P L0@K”P\!H0KQ, < 8 4 0 p4@HP D `` @l>l>9l>==l>l>=l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>=l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>=>l>8>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>l>x>> R*0D  D D@ T 1   R*0)S )' T 1H   R*0)S  E R*@*0D?TS{T 0S*q,40  00S 0W0+T 6*T  R*@*0D?TS{T0S*q30  00S  h 0 f   f  f 0  ft?TJ {TF pR*0,S) @ 0D R*0}S00 \  *0}S  R0 *0}SR*  00q(20  00SL W@  0 f :  f  fU"  AL    f 0  f sJp  (00(000000 0     R*@ tK  p(00(0 ,00,0 R*q000  00S  )꼒 -LM @R *R: < R: -LP@\p`P*0^S+ \0` *S*0S -PP0SU0 S 00C0 b (00(00000000 T (00(0,00,0 -LM @P`\U  L4U .U *U  Q**P^ 0S*\P $U 0{S00 `R*0,S+ P 0Q*0S*0\S  Q *R*0R\S 0}S k g0}S000S0 *q20  00S\VP H 0 h00   h  h 0  hVy 'u[U< JUq0D  D D` V 1   R *0S*0\S \) V 1H  Q*0S*0\S C0)S00>0)Sn6 0  1/ `+0U# >E0CS <0pCaH0S  M H 1 D 0H0 L0U 0R*0 0\){} 0-@PL0\*ql0  0!0S T000@CT00^00S 0 x꼒 -LP0SPp:tP` P\&*0^S00p\*0]S -S \0* ]R S*-R P0]S-Rx \*0]S ;0SS 0 0@SJ0  t0d2  00SH@TZ 0S?W"  0SJ 0 @@000l 0\0Z 0  00 0 B 0SP u hp hHP  000  00 -00-0 -  Pz00 -00-0 -  h00 ]00]0 ] h }P & P0S.*8  }P( 000鼒LgTg -@PP050#-SL [S0 :Sa =S1  pR*0-S `WW  0 00 \  X\*0]S -P0`0 `0S0%*00-S]S P*0S*0=S .0]S00$P*0S0"*00-S]S 'P *0S*0:S 0]SP*0S05l:o h -LM @$Ap\ *P q00  R@ `ePi |P0S PP PP  000   PP0S 0PS꼒 -LM@=>0 00  0- LR@%*0S*0[S 0 0.Q00PQ*0S*0.S [00]S00Q R* -PL@  R)* P*0PS 0]Sp`ePV , Y|P0 R 0S鸋px0   0 R PX 00p , 00  RP 꼒؏ p-LM0K KP` 0 ]0@K0K KeP`p -0L `@8pP Put00  00S P h =0S04  4 鼒 p-LM0K KP` 0 ^00K K]0 @0K K!P`p -LMP`@p0SGT1 T00W0 W00SiQQQQSSSSSXR\RRSSSSSS,SDS` f 00   f  f"  A   i f0   f  f"  A   @`pG f 0  f  w@D q@D`q0 S  - L @P0 00T`%^  R ?>1&,1D #@0 0000@@ 0@ 001P 0 P 0^ ?>1  ^0 f p@-0`@  ^R *0 00  n^ :0E\  00C 0p -L M, p0 0 S@"* 00T0R00S P*`P0 00 R0#S P: P @ T:`@ T*,,0p-0 R*0 R:@-0@P*0  \: -LMP@pe0 000`V@  ` g i7 0S  `i- 00/>\ 0S0\ 0@- 00>Q\@ 0R0\00 -0LS8p`0S PU`P 40PU040@0 S @TP -`RL@PpR 0!q000 p-LM0@S`P 0\ 0  !p/ p-LM`\P p@  A 0S0 0H0SHP Z  e! B 0A0S 1>3 01 0-0@SLP0 0S @ 00h 0-0P0@L 0S 0 0 00 0- LR@00>#R0 (R" R @0Q@PR@P0P< @Q >3SAQ 00@0QLR RRL>31>#R R "RR R(00(000S0 0>3S S S\(00(0 P L -LM 0R  @T p0R000PP P<PhLKIGEeEJ*<<F* -LM@|P0 @uP0 -LMa`Pp @`@e@wTP Qi !1\1!@T -L MŸ, 0 =`40 帔PpPhp @Ql  ExP @2Sz` B  0W0R00S H2 R 0 0:S  $ 0S 2  0 0:S:?0BSW1p+ 0 R 40SQ 0 01 R|1 R 0 0:S h 0S H1  00C000 :RR000,0!1  R0 R 0 0:S 0 ? 0 0C0P  U00R00Srzo L0 R 0 0:S  <ePS꼎ĎjLbjkj -L MR, 00 `[ Epp P,0j,0 +Re -R`-S+S, 0 , S00 0Rx%00pp%000T0ST0 RR,5 \ u- ! 5 -Q* %5  Dp00 Tq 0 0 a0b 0 000000!` 0S,冓P @T0s ,$0s00 4 0S 0-S 0Q# 3 1P -Q  -Q3   :Q ,XP ,0 0p@ l3d0X#0P@:T0w -T ,=Pp 0WT00Q00S 0;S> 0:S "0 R00 02"00 R2 0:S 00 S0!d2 l2d"X2Q  ,0:S D<",@0:S:?0 "0 0 R00 S0101! Q , 0:S h!,@0 ,0 0@|-TT0 R, H1 R , 0:S 4H$1?@0 R0000Sg0S4@0 0q0  0 0 a0b0000d@h d0qTP0 @P0s0`@PЎPbLb̎ȎĎtjk\C -LM 0c -L M@@Y -L M@@O*tt**PP*|*x*33t* P-L h/00 -PL`0\p \=|# 0 0  R3 @ h P1@rT%0\ \|`3  00SWpG3 /\00\0S@.\ \|3  00SY0 0/\@- \ V t0j T ڊ>j1!W pG T :(00 0S @S@S@@@0j!T@QQ10  00S VЁP@ ኑh1 P@ T0\ \|x1  00S`\!\1g0XSxSSQPq$10  0D0SG W0P 0\6 \4|00  0D0S+ |  0 0  R \ 00ӑ@ 6dP`a\ h000X0 WpGm 0002XpGJ꼒Xkdk0kkDkk -LM0  k -L M@ 0@kRR7*ZZ3* -QLM  0K  0   0-LP@qp Pp U T 0\ ʸpP U϶mȻ{{*MϠ4* -0LM@`(<PP0 0$@ $0 P tP@5 bP, 03pP1XY(ʐ QP p 03$0 Y   < bP$00$0Z   p0S $ @TD0 003$  z3S03Xpp 0SW,0p@,@ ,@ 00q0 0m -LM( Dp$ ` /@&PP P P@ (@00 00 0S -PpPL 3@S0S0@ 3S$0``PPv p?@;@ -@LT` $0* 0QP3 Q# R 0PU@G 3S3 3S S  $00 S/0/R@0( D  P 3S 03$0` kP3ա 03š0 #0$0@/P$0 :>$0P3s7 0$ @Q$0@ 0 S003 P $0 :P3 $0p P K 0@E@$0 @2 zC @@_Q $@ 0 0R 3 P0 3L00 P  *PP$0   30P0K0 =PO3 03 PU 0  PU:$000# 0B8S 3S  $0H ᥶P3ԡ 03ġ0 #0 m R-#L 0 0 :Q0-Q@@TLP`?p@$0 5C T TP- U$0P:$03PS0 /R $0@ "p MPp Pgc900m -L,M , 4 `PX , R0H0  $ 0S0H0 L A ,0H S@@PRP < <0@0 4 $$00 S/RA  0T0 /00TT 4 4 Qphs P 0 D 8 Z VGPP $0 0.S  P@y Qc*D #  00S$0H:<0S HQ 0 03#40000Q08 8@ @0@ 8@ H R L0S P P $0 0D00$0D00 H Rں#0B8RSH00CH0 0( 0 DT0| 40$0:$0?00pvP  W $0 P T 0phTP0T 40$0:$0P 0S[ 040. ScU P0SA$0 0YXT0AT T 0@0S ,YQ4 3S#$0 Y 0SY00 0 ,0S4 # P 4 #$0:$040 0a0( 40WP @   4 <3@ 03a00 <0 }@Y400420#4 0 BH  L ,0S V4 #B400 -LpM$0@0PK@P0J \EP10: S S 0  S00D00.S, 040  3S,0Q  3S000P0 E0S D040. S00`6Pp` p 0 0p%P 00 -0LRP@` V P  0X @T` 0@T000(00PpPppZ -LM$0HPPp`P@ 0 $ 0I00D @0(`X0 -PLM@ @*T 0-00L@ :0S00b?0 0003PP 0S P R D0P00c00 R3 SD0Q00c000S0 3S 0-@PPL0X0UP1S -LpM$`@P R K<Pp 0 0R, 0R p00V@@>p  dPP -P@0$pSL$0  0` 0SyhiK 0S G C , -LpMp/p`  KPP0: S G0 0 p# 8zP@ (0 0P (PP 0 P偲D0@000gP `p$PPPC $ -L4Mp, &$W, Q< , R0, & BX 0BX0 嗃#(R@40 T P?4 P0`Y 00  Y 0AQ0 X`P&TP @0P UR PUJ P"0Y<0 00  Y 0L\0 `g@g' 0L\0 Y 00  Y 0L\0 P@g< ' 0L\0 < RV 0 b0hP,0P㗃#40 Y0`; 0@P0 4@d0fgP!P Y0` 0L\0 ^ T4 , d/  0  0L\0  0@P0 ʿ,0T`P0 0V*@T%Pg PY 00  Y 0AQ0 @' 0AQ0 P`0V: 0Y<0 00 0 0  0 P Y0 0L\0 0' 0L\0 ' 0AQ0 4 4P4 P4 40P01@80  8P@ Ph PZ 800cD0 @ 8PP? P10@4 ` aH 84 HPa P4 P4 k4H H 4P4 PH4 40H P D D0P0 PD D0P0 P   P P  `0VL *@T%Pg PY 00  Y 0AQ0 @' 0AQ0 L`0V: -LLM` d d@` @d@ h0 \`K$ h0 PpW:` <Q U@ * 0dR @T`05<5:T 0 00` 0 0Pp$0(0,0 0LPP d0S`@H0SW 0 P0P00 d\ Q D0^ "0D0^`H0S0 t `0L R0Sf R0S]  0_P@ E U 0 CPU 0; HP@ d\ 0hc/0cOdP^*hP@pD0^ 0  d0^p@P:PPTPP\ 9`@L  0%0D)Pc`H0S[`@0\  PP]p -L M@0TP 1>3S S 0P>3S ? S S 0@U S SS S 0P` 0 P Fp, @E  0@ PP, P , 0@S8 S !S 0P` 0 P Fp@E  0@P 0 S S 0>" 0c O 0 > 0c" 0P` 0 P Fp 1>30@C0  @P @p1>3@!>#"R@D 1>3PLSJ1>3P!># RA -L$M@ ,@ 0 p RP`A>3S S  S PU00^ PE0A>3S aSV 4S1>  0 0r% 0 @Q00dS0  0dV0  P   1S P1S 0sS ,1V >3,@0ca0 0@P@D ,@  ,00C ,0 ,01 , `{S@ S > 0  0cO0K ,@00 VP000 KS>30@C 0,0 @>P0!@># R 1>3@!>#"R@D 0a @ K> B000 K@K ,00Ps000,00 P>30 z V  VR  0R MS S  V`EV V@*0 S=090 0V V0V5:-0 SX S&S- S V$ V*  R rlA 00  R _Q 0VV r, 00  R_Q00  V V*0V S VV r@ 00  R_P V5:00 PA >3PA>3 S>3 2 V  0|꼒 -LM0Q, `Q0 AϠ lp 0 4 00XP40`l ^0p U40 @  U V  Vs T e42W  U' u "0 0Q_U  V v 00QF_VD  U u!0 0Q%_U# A?G0CS >2,0X  R 00  @P4  0  @0W  V v 00Q_V pp0  @@DTʎ0 00\@\ d0Wpp~ 0w0r ,@pn 0g -LM, 0 0Q0 `Q0AϠ l040 0PX`lp U@  U V  Vr T d02W  U' uŸ 00Q_U  V v!0 0QE_VC  U u 00Q$_U" A?G0CS4 ><,00  X^4 00  @P40  @E0W  V v 0 0Q_V pp0  @(@DTʏ0 00\@\ d0Wpp 0x0s ,@po 0hG-Q0`A $ P !>3Sy < S7 S S S Q@3"Zp0   S S0ZS S S0>#0S S S S "S>0!># R0p !>3 S >3 !>3 S&S S\0X0>0400 S2 aB0L~ -LTMd h h@d @h@ l0 ``K$ l0 PpW:d <Q U@ * 0dR @Td05<5:T d @@Pp0P$ 0 0( 0 0, 00 000  4 + 0SPP h0Sd@H0SX 0 +P0P00 h\ Q D0^ "0D0^dH0S0 y d0L R0Sk R0S`  0fP@ E U 0 FPU 0> NP@ h\ 0lc/0cOhP^*lP@pD0^ 0  h0^p@P:PP$IFDTPPY:$8 gd@L  0'0DWP^dH0SV$d@0\ 7PPp -L M@0TP 1>3S S 0P>3S ? S S 0@U S SS S 0P'` 0 P Fp, @E  0@ PP, P , 0@S8 S !S 0P` 0 P Fp@E  0@P 0 S S 0>" 0c O 0 > 0c" 0P` 0 P Fp 1>30@C0  @P @p1>3@!>#"R@D 1>3PLSJ1>3P!># RA -L$M@ ,@ 0 p RP`A>3S S  S PU00^ PE0A>3S aSV 4S1>  0 0r% 0 @Q00dS0  0dV0  P   1S P1S 0sS ,1V >3,@0ca0 0@P@D ,@  ,00C ,0 ,01 , `{S@ S > 0  0cO0K ,@00 VP000 KS>30@C 0,0 @>P0!@># R 1>3@!>#"R@D 0a @ K> B000 K@K ,00Ps000,00 P>30 z V  VR  0R MS S  V`EV V@*0 S=090 0V V0V5:-0 SX S&S- S V$ V*  R rlA 00  R _Q 0VV r, 00  R_Q00  V V*0V S VV r@ 00  R_P V5:00 PA >3PA>3 S>3 2 V  0|꼒 -LMp, 00 Q,(P4 0 8 0 Y0000AϠ0 P0P 4 < 0Y04 `<0P 0 V<0 @  V X  X T sp2Z  V' v\ 00Q_V  X x$"0 0QT_XR  V v 00Q3_V1 A?J0CS$0, Y00R0S0 8'0 4"0 80P1P<  0P00 P P0Z  X x 0 0Q_X 긠00 P@DTP0y 00\@\ d0Zo 0h0c ,@_ 0X -LMp, 00 Q4(P4 0 8 0 Y00 000AϠ PP< 0`Y V @  V X  X T 00 P@DTP82Z  V' v$"0 0Q_V  X x 00QU_XS  V v!0 0Q4_V2 A?J0CS$  0<S 4< NP ,Y 0 8:0 450 80PDP< 00 P8P0Z  X x 00Q_X |0wX0X `0Z@n0h0c,@`0YG-QM@p(,P >3 S C S> #S S S P@Ѝ3"Y0   S S0 YS S S0>#00 000S S S +S "S 0>00 1>3 S 0   0S0 `>3 S >3` >3 S 0&S Sy`0\00 >00`0 S00h0S0`@Cca@-M ^@ P`pX\ Ѝ(@ \@Ѝ@@Ѝ@eE11* -4L|MHK0 @K0PԤ1e/ @ \ \ R *0S0\  \ 0|S :S 00hh$@``$@X: @PX0D0L K@X0pL0<P K @(0P0T K @00T0X K@,0X0@\ K40P\d K@p00, d0h K@80}p408 h0l K@<0sp6[>dp K@4kp7[0Ht K@4cp7[0,x K@4[p7[0| K@4Sp|00 K@P0Kp00 K@T0Cp0: K@0;p0,K: 0嗯 0K⓯ 4K⏯. 0 XRxR @@00 :S0-LP 0:S0@0v@0- 0 Sn@STb -LM K"[vtOO**$$* -LM0`=S`pP,KlP@; U P:0P00@S=S 0S=Sg! P,@P 0 ,0RA 0=S 0S0 0=S=000P0 @0S 0S` `00cC QaP@ 0 0S T0 @0@, 0a p-L@`M@PKP 0! 0S0 pa 0-L԰@ 0-L M@H0P (0 $ 00K K(0@  0  ,P 刚P 0\g BB*A``* -/LeM0p @ lK,0 p0l p `b?!0@?PP@ ei@Pn ?0S:@P?0S: -L M0pP,0   b!  %4 KPU ~P`0  R `Pp 0  RS4K (,0 S ,)S0lll 0-PL@U 1  b!1P\ 0hw0##6*@-@0S  S 0Sd@( *(*Q0 R 0R$hh *$%%* -LM< 08 rSwS@T 30 0 , ,0S| 4KPv1 Rop@\ P/ 1 R(< 0rS <0rP4崵,0aP, @0S h, 00,0Q0 @4~4rP0v1@T 0ድ@T< 0rS 0債4P 80piU4r0@4nT JP0 R4a0_,j (<8,` x,Џ``` p-LM`0PS4 @T 0S  @T0SpT R00000Sfq`K pPq0S !up ,Џ -0-LMP0 S@   R1 00 cQ  R!,0 e 0S /(00al -0-LMP0 S@   R1 00 cQ  R! 0 0S '00l -0-LMP0 S@   R1 00 cQ  R! 0S '00l -0L a -BMLMh#0P,0 0L4  0S 00,3 ,0S ,'/mPL$H$ Kb2P@@ǿ00 cBK J JH 墠MK@DPpP 0Sr᭿`0CK0A S A P2D4 H2@ K0C0C0  A  tB00C=S񟗗<<<<<<<<<,<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<0 S  1S!00 c0Ɣ pC0L4 d PnL$R 060S3/0lC2mlla``@-@^  0 S SS00N0Q --L 2} 0-LM@Pl0S 0n0S l0S  l\ 0 @@P -LM@`PlP pWqW0S `U @YT :0S  000@0PTP:@T TW PP  - 0M{l -PLUp`@: PP@ U:` `       --L p-LM@P\0X T`L`T < _|000 zc` ph:`0pT}P 0000ӑ؏ p-LM(0`S/ <   P00 00 @T_Q <0@T_ p R 00c@_ 0(pP@ u0 0 -L:* 6* -2MLM#0@,0 g0/S  P BKAA 吽+ qp Y W3*WY 0P/S00@83 ,0S $,;%/ jP<P"P@aTnK`F`F 0Z0pd  寻 0 S/R  Rm/0 0 x2(K RW\jP LjP@ Y 0C/0h@+_!PBKAA'P@L<: S< S0< ?nK`F`F!PP|1@(K /R@ Y!Z 0 S/R 0 S*>K0C0C/  +J_ Pp* +ɝp?00^ 0@C/Z0@h>00SZ I, D\+㤝>00S8 B>K0C0C+< 啝!0om p-Q00P00LMSP@`P #0s pp[4P@`E00p 0S S* --LM  -LM0P\04#   R,0 p 1S018 `< @T1 tT?   0 R 0S0q?  0 0S 0 0C`0AmP %T 0S 0S0 0C` 8,0 S |,##mP 8P@pzT|$   8HTp`t|iz 100Cu@ <# 0Sq 0q;  0 0S 0`0CS0 rlP MTx(`x$Z  @ T *000YlP d X2 `0 j 0 0 43 0P4#83 04# `83 Z  KK @0S 0 0CZ @ S0 RT `lP T4#0KK@Q4C @ 0Z0C0   0S 0 R@X 0088 kP XZ @&43@4 0qL9  00S 0Z0C0   0SkP 8#0d` 08# 0\0q8  0 0S0Z0C @0 SʪkP x8JZ!3Kg @+0DMSa8888888888888888888888888888888888888888888888888888<3S<  @00CS0000TZ I@XXTxT@ ;6 3K<#G -43@ 4C  43 43 8C@8C 3K0``@  43 @4C  43 43  43 @4C 43 43 3K<#5H3.KXXjP  <D%00<3 <,00S<3 ʔ<# R  &3K 00X< y4JZ!3KL @+0D:SFxxHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx@00CS0000?Z  /@xeTET&N 3NK0d@3K0 =K43@ 4C  43 43 K83083 43@4# 4# '@x3KXx3.KX'jP    9 S9jP @< |KKp@u@r@phP@0<3 f倐lP  43 @4C `z 43 4 `r43 4 !@43 043  43@ 4C  43/43 W43 4  43/@4C `H"@ 0@@ < @" t00  0@P@o0o܏ @-^R  \R n-\ @\00]\0S  R\ A]\ -LMP pR0 0V@ Ŷ000:iP`dp@V ᵶ 0 f0 0  fڴ -L|MD`h P  / @@Kp p@,`  @ ,0 -SE000000 , 0S@@ ,` hP,00Q @ K@0K00SI p/Q|p 9Q10Z0C10Z0pC, /Q9Q0x Q EQeQt 50 ,`P, +Q -Q 00A S,` $0Q 10AS,0A, /Q 9Q , 1, 00C/Q9Q,0H!0nPSUt ` t Zl  p0SI0A%S񟗅L  L  ,@KX7PY ,0DC, /P,040, @0 D MNS@o`8||,@K0P5 ,0 (R 0@0 D0 0`L KPH0L46|KR  at x Z ``LX@@K V0 HLbK;WP@ K0 -@0K@Z@ t 0f`Vl iP \@ K @@0K`B MVb@!"0T0@ D 4yw usqFbVl@qqP@` @K @ KVP@056C@0 @@K  @K @ TrT2pW`2Wd256@0 D @0 x 0$ @ @   ! @ KT0KP KG040 度t0P St@lTpdp@l``R0p`b4#PCUCN6@`@l``pVPPUPUepe`eQ 4ᘦ@44@ W4<4 Zڌ ۦ Vڌ0 X *4t0  0YPP+  / P@ԗP- wZP@( d`KlP/ B@ 刃l3X ljX00\00S / ᫗Pa00hk60@ K0 H@K0 @ Kl0@`rSpX 4傥倥 ~|>4 0 ZP@D0S46S$ / sP/ rPl@T 2 X0 \ @K\K DK!@0 R#"00e/ PP,PppƚWP@Zᖤ O/ 负P@@K\0K5&B@ @ Kj0 ̟@K0 蟟@ K@0 0S56@0 { X0S 0@ D0 {\0svZ @0d`K0@D R@046S2 R# p@0@d`K/@?A5?55?5?AP9|o??@0SO@ K0S"00=T O ƖP p O cP@@O0Z@ @ 46S! D@ Z @@K@K0 @ K3@0K@@K0 &@KG/O  P@ԅP"l DR0 ljX (:k0c Q@ 106@0 D s@046SDQl0S @0kP7Pʊ@0 " B ::ZD0S@ 46SP20kS0S0Sz  尥P`fP @ K @0KFb VT@j@Vl@ B` @K @ KV@l0S @<30#:k@cT TD0 D 4T0 D762D @0 @@K/O ?P!ꖑPHt\? &\Pjt0\=C@ K t et 儞`PtDKA `z@ K!t0<@ K p@@Kt0sl@@KL |@K *. 6P@/ 0,0, 0Q BP 0, 60PS  0PS0S ,  Zp 70Q- 10AS ,0|@ 0A@0 ^@ |T| PDZ!₀1ZpPUZ1⃀Z1Ѓp@ , 00A S 0, @0Q 0A ^0XS xS  0, 00S S@40K,K0 K0P S  4 R<@KDK0 0{<@Kc4, 3ғ 'PҫP  @@ A-0S 000000000001000  80 000C.0 6: -RL(M8KDKPp`T@ 8@K00,P  <0Kʉ@ < 0(M0 t00 C\0l 00ЍCʠ\7S< 0Ll \!0 0  -LM, ,D0 ` v00  R-V`<  +V< `YY0V Y0V <Q +. 0@K  0O@K 0 K@@K T0KP@@K }<00 KSP T@0PiPepv$B 00Q0`Fv  00Q[ v 00Q7 FW F` VM\< R& 40S 8@T80 W V00S N"00`D@ 1B"@$$pSƏ4X004 X 80W8@<0W V00S pD@ 0B"@$$pƏ4 X000Q \,0 J00 K\0XSxS`I -LM, ,`\0 4 P u00  R-UP8  +U8 P4 RR0Uv 4@T0U 4 4@0K/0 @K O@@K< pu 00Q0PEu P!0 0Q4 u,A 00Q7 EW EP4U%\ X  W W0 < U00S p"00PD@ <B"D@p$$ŏ X008Q\pw0 R \,00F0XSxS0P40 `꼒 -LM0 @0pP `冀ὫPP @ ᱯ00@P0  㸩PP 00_0 ;0P`0@  `VZP p0-LP@H l1 RV 00S  R 1S010 :000P0S  0S 0B0PB0000P 00 0R0 P0PS 0@ <08 0B0 0BP00 @0 0P0000%8f 0-P@LT a DA0DSR0D@TP0 \(]P.T.Q0xo -EML M@H$ 0r/, n'H4 YL h Pl4 Y 7 ,0S ,!4 $pǟ8(<,"(S\$ D ` 0 l d9PpDP 6 0YY`  \4`$ P T  S\4`$0Cd$ \4 V:6 D 0 l 09PpDDPLd$ d$ \4CS\ d$R00V0#02S`4S T PY? L ""`$00R00S Y! 0S L0 h CKA APh%H帯D4@ cTH喐D4 0D$ `V*^:` VX *V:`V H*O:`V x*X4.SS`TYYX^ X$ YR X$ R .A@ &Ax X#Ax0%(H$H Y\ YY d^`` jD?@PD3 WX^/ `P" D4 0b3 RD :dd Mt3TP:hQh DT4  T4 ʄ`D40D4 D40#D400D4 <K 㶭<0S80S40s2 D4%*HYDl?P%D4H$D 0 l *8PpD^Pdd ``QD4!0 2P^D45p#04P 5wy DٮpC>K0C0C t4 8Ppt5P tĮD4@ cT`dd t坏D0l D4 L1PP*CKAAp 0 p47Ppp Pd40d4 D4P0P 吮D4 00pD4 剮D4@ cT`pfD$T0D4 D4< 0u,00H4 D400D4 OY0jDf|o\t:*po@P@P7 P 8:0 S S0 S S Z@P`@ 0 SP P`+U`T 0S  R00 RPPU@ T 0S PX000 R X0W@4&@P@ PWP $0W`4꼂(Ђ `T<X -L(Mp젟0 S( P&<P 0@`8PK P@hP00TXΞ    t@@0p!lL0\S@0 !$ 0^A(Dk[{p(hG-@M`@<T8 40 ğ0,`0#0c0, `0cC 7?04 #/(00 ( ~- 0 ~ " #~5 ~ !~7   ~9 / 00, ,: "#:0 :"&!* 1 !00H,x P `@p` Ph%%),%\P0!ē @ 1 )Wh _)| 0* 0 ` 0+p0 `08000 @`@1p0lPz0p[0ˌ0 00400@Ѝ(hX; -LM`0(K\p@P.  ᆤ($ 8 ( #"., K00K, `0@,<4 Ġ̌(<"4!Č <.̌ (0 $ _sD -LM0`$S@ 3 R (PK0000e@SP0m _Rl zP `P;@ ZP@P5@9P-P.@0zS `S;0C ZS@S50C9S-S.0C0p 0@SW, K00KTPP2,pŸ * =? 0 7?0  ?0 4 [,  9?0 &?  3?0 ? 000  6?0 #? ?00P 0zS `S;0C ZS@S50C9S-S.0C0 Rp 0zS `S;0C ZS@S50C9S-S.0C0 Rq0S  0P0S 0 e0#R0L@0SP0SH@ ᾅ֤@a 01S 0DpH@-!P.*@0 S0ԧ S ԧ RQ 00C210P*0SԧQ <0 C120P *0 S ԧ R 030P:s p-@L$MaP2 ` 0( 6bX%X@ phHt -LMp0@P 0 0`K 08#HT UPUP#08  0 S   铠0pPt -BMLMs0D`K@P  ,0 բ02S0$S aS@ ,0 S , @0$SY3P 0KZ @ P TKD AK`X0(I K:K4I  (K@ TK 0 Th:B]KAK1 (PE(J(K @PE6J @T@  @?T@CK!"41"",!1AKB K1@TX$ $ @20@0  @*K0 ha0TK 6姣  .  _00D @ < 8 4 0 T P L H ZK  @ TK  T:S0`t|tHtH(0@-"Q*|@P0#!0\ "0'*0#" \ ! *0##? 0 \0:00000sE-0``&&&C&̠O 1t@X 00#0P 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 0 0#0 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1@x 0 0#0 0#`&&&C&̠O 1@x 0$0#0 0#P%%%C%̠O 1@x 0(0#0 0#`&&&C&̠O 1@x 0,0#0 0#P%%%C%̠O 1@x 000#0 0#`&&&C&̠O 1@x 040#0 0#P%%%C%̠O 1@x 080#0 0#`&&&C&̠O 1@x 0<0#0 0#P%%%C%̠O 1t@ ̐0@@0#D 00#P%`&P`E-D0``&&&C&̠O 1t@X 0@0#0P 0#P%%%C%̠O 1@x 0<0#0 0#`&&&C&̠O 1@x 080#0 0#P%%%C%̠O 1@x 040#0 0#`&&&C&̠O 1@x 000#0 0#P%%%C%̠O 1@x 0,0#0 0#`&&&C&̠O 1@x 0(0#0 0#P%%%C%̠O 1@x 0$0#0 0#`&&&C&̠O 1@x 0 0#0 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1@x 0 0#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1t@ ̐0@0# 00#P%`&P` mtH0@-@P!0\#0 0(S"Ƞ0 -L0M($@KP"h0dp 0 8#x "W 0@2K,0 00 p,K0K  H,0 0("x00W0p@d  608 0#H,0T108#xW -L M((KⴠPp@"hh   0 8# "Y 02K00 40  z000# 00 s40 0#0K4 K40 00 0("04 Y @  X000# 00 Q40 0#0K4 K40 08 4#H00T108#Y p-LMH`P*$H ph? (-"xPUL`@: 08#XU@: (-"xPUL`@: 08#XU@: -pL MW`,*0K0 8 Ƞ<̌ Č40 ,K ,0 0 a,00 ,@[0P[p#Ġ"#" #8"(W0@ P`: -pL MW`,*0K0 8 Ƞ<̌ Č40 ,K ,0 0 d,00 ,@[0P[p#Ġ"#" #8"(W0@ P`: -pL MW`5*0K0 0#0P0 8 Ƞ<̌ Č40 ,K ,0 0 ,00 ,@[0P[p##Ġ"" #8"(W0@ P`: -`CL0V Mp@CPC,K0K6,K0K08 <40,0   Ƞ0̌Č  0 )0[0"[ ,0#40, [ -0[0"[ 00#400 [ 0 0#0Q`FVPE@D08 <40,0   Ƞ0̌Č  0 )0[0"[ ,0#40, [ -0[0"[ 00#400 [ 0 0#0QR-D?0 \ !Z䐐 -LM@t@ğ0 8`, 匞 d/P 00 0S$S 00R5:0PK c o i K \  R 'D\@ @'(`@ ?0(LX\ @c@@ '<@<@ (H<@ [H@ @D@ - K(DH [P@ @L@ . K8DP [X@ \/ KX [@@30K`0T@ 0 KP@ L40K, 1K2PK 84K ,0(S(h ,ؐ0 0-PL@U !", 1#80!"$ 11PX 0h鉜0 -LDM@@ hKZ p0(h0 0'00 * 霠 d0  (  ly 0)pgz p`00* 00H '臠\  )  $0( jX 0 0'00 * 霠 T0  (  x 0)pgz pP00* 00จ '臠LP  )  0( jH0 0'00p * 霠 D0  (  Lx 0)pgz p@`00*00)COH臠 0'<00) 00 ( j8  '  ܗ0* 霠 40 0(00w )pgz p0  *  0'臠,00)00pd  j0*00(00LP 靠 0)00*00(w< p{ p 0'0 0)00hh0(0 0'00টT  j0*00(00༖X 靠 0)00*00vD p{ p 0'0 0)00th0(0 0'00T\ j0*00(000H  靠 0)00*00 vp{ p 0'0 0)00셟4h0(0 0'00ȥ`  j0*00(00कT 靠 0)00*00uH p{ p 0'0 0)00\h0(0 0' 00< j0*0#00 < i 0)0#00ud pz p 0' 0#00Xh0( 0#00 ꤠ0*0#00औ4  i 0)0#00thpz p 0' 0#00dh0( 0#00H ꤠ0*0#00,\  i 0)0#00 tPpz p 0' 0#00샟D h0( 0#00̣` ꤠ0*0#00ଓ i 0)0# 00spz p 0' 0#00t h0( 0#00T ꤠh0  (  0 0 i *s pg{ p00)00舠T0  '  ̢0 ꥠ( ଒\ i 00* 00r pg{ p  )  l 舠d 'H0 ꥠH00( 00$ i   *  r pg{ pP ) 0舠400' 00༡ ꥠX0  (   i <* tq 0pg{ p`00)00P 舠D  '  (  0ꥠ    xjVp $ν|*ƇGF0FؘiD\"kqCy!Ib%@@QZ^&Ƕ]/SD!7Ç ZEogL*B9q"am 8D꾤K`Kp~('09|eVD")*C#9Y[e }]O~o,CN~S5:*ӆ*#*# -L P @ 0T `  p0S# @T 0R 000 00 @0p|P 0p 0 0R @ p-LMD`0@S$ 0PS$p, -QLM@# 0Q`Q p 0R /0,}0 0 0R PK 0S  0R0Q -00L pP`@ T @ T0  R 00d0R 0 V SP tP @  0-LMHP0@S$ K 0$S0, -LM`0@Sp$$K PP 0S$e$Q 0S$0S000$U  ✗$L,}*Π0y* -LM0p@ LP ৘00 00B S0`Ba0B\W`BA0B0S7`B R Q\S P Q'$(P44<PPP0U0P:0`d00c0CV0`ąrppp0d0C0pp -LM 0@Q`pPT*.X0 R0""00 0PT:400  n0 SP:00 -LM@ulk 0-LtPM@KT 0K 0 %  @@Vp 0 S 00 0@0@0 p-0LTMP`XK <@KhK0 0h0 嗓0XK< KP1@0 dK`0 \0 d0 {jk00 S0 R0 S0 R -LMP LL1R00 ^m@` 0@T1@0pT^ mP` 0@11 T!@ 0T p`PDP_00 0@T0@Tlpk0@Pᤗ0SHp0TDP00\TP+܅ -)ML`|M 0pV K,0 $* P 0:S( /S .DP `V 0:S0/S XU  c@`@@ T*BNK@D@D+;xL+9+9.DP` Plp@H )K(JdJ' & *K់P :K4S! K *K $(`2V ,P\ \^K^P2P :K PP K0P0 P@@T00>"  &# K *K0 K$ja0QT` @X `VP`V @0 0` QmV` Vl@P 0^- S`@0Z00 SU V`V 0`V0 5Q`M@X= P0`VP@` V"^- KQ  0S 0` V ` V^- KP 0S0 ` V ` NV 1 R```VT4(K R K0j c` KV$00 :K4`VXʈX KQP3(K RB 0^002`VS@0 P` P00@V`^APJ@3(  P 01nP00`V@DUZ,0 S ,0^ S0 S3K0(AA 0N;P2(K Rp" 002Sn-K( B B`0`V00Z,2( K0`V{KL@L 1` V ࠱1(K`V3K0(NN1 R `V1Sڄ1( K0V p \3K]K(N(PENPE A :K 0 K`$ V0@ Q0nK0(A^ A0 0nK^ 00(A ,dO Kwt`V/BPT P00ȻHq+[[$, p-?P0LMS`?QPPU1!1!^^M\@ 0`R p 0R 0R 0R CBP``0S0 C,S R-S+S0SS0SSP@-@  00L S 100C^00L S^ 0-LMPK@ 0P 02c2c20 :R 0 ;0P 0 2c! 0:S<0 P0 00 0-0P-SL@P +SP  U0 0c00 -LM0@JS: MS 00C S00 0P 0/S00    00  0qP 0.S 0fP 0.S 0 0 00 m E-P@p "22a11\3a11\p0Sl S  W02c2cZ@]E ;RPS J^P WXa  102c2c^S,! 1?0c0AZ1`L ` !Ϡl  B 111F/N!b  !@!A! B 0C`aR0B S B^ W 00T` 010S^ 02c2cS002c2cSQ,*gfff$I -RLDM P\ ` N\0<S< \0@0cd0 0S TKP@ P00 `R <R `@ ~` @ bh 0S,S ;S XKP@ 0V0R00SD ;Q,Qv Qr@Q`PP001 R44 `b \\(0011 R\\̃ṣ01 3  RT0 0f   0R`c\Th3d Xa\3`T#L3,#<3  h0 Sh00 0 0 SM@ \sd h0^@ `s@<K^P@ 0,SPKUP@ @Td0X0T8"0,2`$"$2nK}"2`p@@@0< K {X0@P K uT00@0000@01 2` 1 !3`1X1XT! 102c2c3 S}00KSTwT0>CX0 @>`@ 0@>S`@nh  T0h 0c0h 0d U>\ f0@>S\ @ bd  dE\@P0` ^!@d T <HQ -@LM $0S h{( -L@08S 00Ph\ -@LM h 0- L⇐P@< P0S3?P2 PP%^@00 , r0hl :P 0:S H P 0 ,r00hX\( -@LMᮑh髑 -L MR0S@(  \ 0S` 1 \[\0$ 1 l bH2A<a!/0C,b `11231113c\$0$000a$0 $Q01 Q$K P  (0S10&O@#/ 2!Nc10&O@#/ 2!NQ (0^& 0S@  RA 0@ 0S@A^M@0t (Kt 00=01(0\0!0^\ 0  A\Q"T p-T# 0ST Š ŖP@@TPZ@တK?0/0S0 P S@ ňK 0P0SÈ0S S UP@P0CS0 @0S0 Pʶ TKP4^C`0S@ @<<"\0@S1PQJ0 R @TJ4UZ0`S1PQQJ0pS KPE`V4UZ10 00n0  0S TK P` 40R00 ?\0#S a0 K P00:TKpPT;0 T0 _ JnPEDP0\  “2a1H`3a1R1R@0!^H PPKTK< RP lnQ,Lt\ -LMp@P`\ 0 u -MLM 04( S0 0ł>K0C0Cp0 D8 ,(RJ 00S1 ^8 8 8(0QBKL !80Q80@ SJBKL@8( 1SA0@(K@1 @( QZ@0S<8 <K@1$188 P 0S <@(Q< @XH KN18(1aH\ठ04(D8@X P @dUPP P_,8S 0 0`cR   Lt\ 0-4PL@nh  W@g0L0 0 Iȹ 0 0Cȹ@0  R J1 0Q R@Z\ -LM@K$0c -L M@K$w0@K 0 `RA 0 `RS  0 `RS A -L,M0P,0 P0p А R0<@K0 ᨠ&ڋ0` PP   0@T P`I00P@@T 00 ,0S 8,}W000[ wlІ -LM0H @0$寋PH  h -P`LV@ኋp0S  S\P@D -``LMPp !0@ `0`VQ0@JDX 0P00SC/`VX@E_Z 0-0L R, P0SJ R 0SX@ZP P P000     D 0 PH  C/ۊ0!8fp -LM:L@0cP0S @0cP0SPpi`Q -PLM\\`p@P0SpC/0p碊PUX`EOZI_0 D8f 0- LhMPh } Pw KPF P d P 0 0000 ,0 0Kd Kh0K合pd $KoP$P P P0 00 , 0 00 , 0Kd Kh0Kmp d0S  $K0 0 P%  P 000  P P0 0 0P 0,0 00 P P0 0 0 0 000 , Pr *P% P P P0 0 0 0 P P Pm00 0 0 0 eP  P P000 $ ~0( 00 = sdPL+NgP K I}P 0P@P` K@00Kh0K, h @0P @Ӈp4 3@pPK@0 0Kh0K , h @@p0 ^ ?LU*0! >0 ;  M-L@M@ 0p`nP{ 0 p`ddPPk 0`0`KX0妤0S   01 R 4 40  1@ 0 (@\`$@TpPԅ`8@ X0pX L H T` Pp /XK /P* <0 0PS` 00S.0 @d@ H P=0 0d KZ@@ 0000UƂXÂ0 D0D*F ,0$@(#F 0000|~fb M0-LM00 0 PS0`" -LM,ş `,  (q 0  0  5 $0 K0 0 0 8K 匠K┐K80P800X0K00 P  0P   P 00 0 X 0`P0S0S 3`0K KP L 季 32a/@#b! DrP pj `@jDf -(!XL"x H` P x hxU Hp@-h`0S 4@?P00 =0  \@@Pp蘒 -LMw1Aqw! 89 0iw 80l!0pp00 c\1(0000 c( ,w(a X@0w08% #HT @0 Q" sP "Ww$K֕$ 0  S0 900Tp 0?A7c%c!c1cW XyH -LMp$K㢕 0R0$ Rj`0 P@0E.>? B7c011N0 d 0!T 0L0   '40 锒/uEن0ᬒ0ᰒP 0-0PLr/8hz4@0, ,bzB@0S0jDfHfh@fH -0PL4r/Mz0`Sp- S  0@W0 0 R@ 0T0\ 0S 0S0S0S 6Pp 0@W0 0 R@ 0TP 0PjDf -AMLM,48 <#h0V,0 4  P`F&B~KpGpG 00PSP@ ZH00$H T00S4P 0S`F00 ,0S $,s P0P -AMLM,$p(. , "h  V, 4  P 0 ,0S ,HP`F%BKHH 040PSP(@%H $H( 0"(lP0P`F S0d -LMH p L ld r/0, QyH` $p 0 1d" L"0 R0t2 0<Sh2 l |2 p2 0^x xD R" P P |x0,X0S @KoK%KDK 0@P񟗢T)TP tQ$ ȟ 0pSp" 0S WD"0S 0@SD2 庄P00D"bbPpOK?K@DH2L42  870 S TV*00, bZ00`F@T@Q*@$?#<-"-0 0c`0, bP *0S  P*0SPlR Pp4 0 0  RP 00ӑἒ -RL M00 , *,p `PU 0 S0? 4` PU0S 00X: iPUJ0.S \S@TpPUZPU0S .U -.0Q .Q .S \00.\^ A Aa0ARS00A S\0 A Aa0ARS00A-Q S_Q 0*S 0.S S0S !0B]S.R000Q\R R.R0S !0C]S0S0 0   < 00 , 0 ( Ġ P 0000ӑᴒ -OMLM@,,0r/ , u05 . 0uUT U U U 0l= K AA !pT To!4oSG I>K0C 0C000S000@S0005\ =000@Q asY/0`00n0`A ` UP@ Pp|  U< (K OKAEPPa $ R*EnK`F`F2s4@@`) P<P@(K R < aP&(,(K0 S S %R0P S S \ \ \00\``V`@,IU P`e  4P1t+(@K0 S S+Pn/Y 0 SS S S ,S PPP 0bSyS fS P 0bSyS fS} PW*(PK0 S SQ\n0P S S \ \ \00\@@T\`, T =!P@`0DS PH` \ V!* \00 \PYP\ V: P P P 0S S S D P0)(@K0 S SUU 0 P S S \ \ PP P 0 r0 0  R  0S@L@K0[SQ L@KL0[SG MKL LN.K B0@ B0C D D P0S  RT r4 REP2PPPP P 5q,s D'500P]} P @0:SL@K TP P&(K0 S S P Pv111.5 % \ \ \ \ 0 SSd ;S`a 0 S\ E P ;Q Qq6  0P NKJ0 J0  SPF E4AE @h1  P`4  Q;Q Qq00  RP   -P4 l1 %005 Eh1@ E 0l!$  $ 5 S@hl\@K P00EτpO`  Q;Q Qq00  RP &Y ! /P P PP0`30E R@ %$$   %  LP| %Ph#(@K0 S SPUY?U P   " "`0S= ^`0` D HSEH`P 0.\@SPpVP *T.@DSPPV:00rP0:0 000,0 S D,8pPP (ENK@D@D6P.'PP ,`RppPP# `p,R`0e SDpPH` \V!* R R00 R0SY P\ V: P P P P 0S S S S000 4ST1o/S0S1S0jDfHfh@f5<__XT<H9<̋؋ -0LMP0r/iq0pSD Y@ S S@0TP S S  #P`3$K P$Q |h1  00P0S0 ^00 0 0 00T R R R @0TP R R R0S P  P0:0 P0; x P0; \ P01 @ P00jDf!<4<("4 <1QS0 p 0-L@PP@2jT0.j 0-LM@ P K 0K  P @@np0 -LMKPA-M `p |20  00S3 0\ Pt A\ |0  0  R#0CU\|0  0 D R |0  0   Ra NA N.\ 0V54:Ѝ\ \| 10  00S 0hC10S x;;;(<X<^*0S쎑W <4<("4.<0^* R0S8<^P0S R8<4X\x\PP꼒 P-L \hB껦/00h -LMP@`T,`K,pK !P 010jP VX`@TX ,K an0V0.T00S` X  -$"L$M0P@ <K ,0 io0:QZ ? " P0` 00PUoS <0PUoK  0p  0S 0aPo 0  p`P v ; 0}8fP0-@_0 0-\ @0S  S0S\ -L M, ,P0 `@ t00  R-T@ +T@VV0Tg V0T ``YqqfgYp XfphX t0 0Q0@Dt0 0Q2 t0 0Q7 DW D@T%^Y \ 00T00S  d "00@\00T00SL, 00S ^,00E 0XSxS@`P꼒 p-LM`K$P PP@ 0S 0S @TU pj00P 0Pp -LDM@@KDPKH @  0P < 0 8 4 , cg PPL T D%bP` P0 PgPDP0V*0S 0 PU:L 0 0S 1hAL aP   iD\ 0 V` \pT P*0S 0 PU:b\pG W0#0%H%%:H00\b0 S5 S 00T0  0`@T0  00  `g` 000 0 0 `0 g0Pp S000  BR #g D pḀT\ 0 STP 0 P@ 0 0  0X p 42@ Tp@04@ T  D p0S0T T p QX lhX0 ?g T  0ST pX  bH@@b0 S S 00T0  0T  R000L 000⸐L0 T0S 0T S8TQ  0 pX @4 @ Tp@4 @ T0S T pQX0 0S T pX jca p-LMP"h@`P`0  f0p M-L(MPP@0P HKɞ0D0 Ş Up` T LKP:L0P p`R 0S  0SH K1 0D0K!X p`PW UTv W Vw0"Sꃞ0"Sԓ -LM, ,D0 ` v00  R-V`<  +V< `YY0V Y0V <Q +. 0@K  0O@K 0 K@@K h40KP@@K 2<00 KSP T@0PiPepv$B 00Q0`Fv  00Q[ v 00Q7 FW F` VM\< R& 40S 8@T80 W V00S N"00`D@ 1B"@$$pSƏ4X004 X 80W8@<0W V00S pD@ 0B"@$$pƏ4 X000Q \,0 J00 K\0XSxS`I --LM 0 0 -- L 0 -MLM@P, pT< P 4Q( #$0K$K0 S24 ,0S |,`\X 0P$@U KHH 00$?$,4PP4 `U \ Q\ #0S0 0 ##$P PJ `0S ZJZ:00 00J žKIIR `K %R~ T @D R@T<@ v 0P PJ >K 0C`cV RN K0 A .P@+t U~ @@y 0  Z;PpK> @O>K 0C1Kc@@2AlA H D< L @L =gZ꽜07S  K A 0P@07S  0\KclA18 A 4< 0 < =mQ T00%Q00S  p@Dtp pU!X< l#PPD@``cX  0z 0 X#P PJ `61 K@@ 0| P PJ ` 1 K@@#@ 0(40 6hx\g<HP\ -LM0@s Y0000 -LtMp0|@ $0 " 0jP`KS  $0S $ eth KPK叀K!F NpPYPqp U|0 -PLM@R  ?  000 -LM@qY 0 0 0P0 -LM< -LMp@`=P0T@$K P,0 P00g Z@* -L\M`\, p Px 0%S U 000S,0 S ,s@zT liiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiliiiiiiiiiiiiiiiiiiiii_ 0@800FY P@ 04 +_  00頲ܒ -EML M0l  p h$ ,0 5pp@pt Dp+0#S T ş,0 S ,T*lP0s S T`V `0SF@Y`T %00l4PSl00h$R- 0S* `V u P& `Vh$lXP` l _0 \0h p h@T 0S1`$`0Q?p$@\@\PH00 P`h@\ Op pP#00l4`S` 0BKßN N8 ß@(K< CK @E>KtP(K@0CP@ 0CT d H P@o 43( K!$(,"( R`*R^ 2Kp3 0 IF>K0C"P pt0,^0S 0t t h wh$0 K@P@ @^D"(0K!48<#8 S*S 0H T H0L P J I@^  L]h@hA ?@Hp\ X0p4Smp PB^KPEhPEl!l1 P/*|4p@' CpP0#SEKEKALK 0 LAIP4 \ X T /_X4P$0P ShP|SySh@p$R|XV000lܒ<L\ -LM` @0 0\ `0P -pp`@LTP  P `@T` 0V0000h-Xl -LM$@0 S TW0 -LM@`PP|B ,K0,np!0Bp   P),0|bPS)8888888888888( 0pP,P  $(0p p  P(PpbhP04 (00  0(\g 8LX 6| -Lh\P0 -L  hBT} -LM`VPpP 0 S S 0d  0 0 @0$ @5bT -LhP0 --LM  -LM@$ ]0$0KQ \  0  K 1S01/ -@LM O  0-LBP|@ 0S L| 0SPeT 0S \00LS `000x]0 -LDM@ d VP dVP`} 0Sh 0S0J0@ @@`KJxYLpP dP00 H XP L T@ fXKP0SVVXV QP0P0H0STTA 0@81H  hP FP0@ 00Ó00p0d  N X%4 40dVbV  `0X@\ 00墓00 00(@, 00喓00čb -LTM` `\ h0 0Qd 0p KLP0|0 pK0 0Rx0  x 00$0L< 4 U,P -RL4M`T  12l/A#b08KQ0 2KvHKX PpK 0K7E@^0@Kv<04 8 c@0Rc=9H =  AH 0X H0bQc=9 @ =P P 0 0P/2a@#bQU@T/ t+0S (0$0 TJp P0$06  ( 0 $0T2[  00 00Mb -RLMp`P  hp@P`` U 0$0(  p-LMP@@T$ < 0R P0`K( p   1.,0<,00S UP@ b -80L0S ( < 0  0-L@P  P@>00h  0-LP@P0  P 0S SP 0h0 0-L@P P 0S S 00h 0S 0h 0-LM@P0S0 P  \0 0 0-0 0 0LS@P 00S v 0S 0S  0S 0hP8@HPX000 0 0 0 0 0 0P0 P 0 0 00 0-0LS@P S 00  0S S 000  0 S 000 000 P0-  @ L(@-0@SC @<4(<"4!<0  -0S C   <4(<"4!<0   0-LM@0 SKCP0 *X<4(<"4!<0  -LM0@SK C < 4 P@  R 00RP P0 0<0P0P $0, H0H `(0  p 00 00P|PP0Q -0LrS aS 0 0 Ϡ0+S bS 00 0+S wS ̠  -pLpMW@` wHPPN 0X1A  E#p  =KEP`O\ K 0SJWH  P`P5 Z Q' X0a0 100410$1$|FP@ 1!01 ! 01 !01  P0 {0`v`r`UB!Gk`Z 0S 11 !A/决@t AT O` 0R00CS  @0P0(UJP !D010CS1!N1 'M(`%00t8$a P0-PL @F0 -PLM0 0At 000 -X1LtM@0 00 8p̠ 40$18p` DP L@ LV KP H U P0S400S 10SQ l `0QQP驃00 00S 0 p-LMP@4IP @0 H$0D @0P`D 6R@D0C ,0P0320<00@(@I0  03S0php -L4!`PpGP/eP W& 1PU@8PP@UPP p@EW0-0pEEE1"pE10Cs1 1!0C1E10Cs1E p -QLMP @4P  P P0 0 0 -LBM`4P0 0  NKQ@pV0A/p p AP@18!0R@T,COP 鯂O00嬂0,1a -LM@S0 h;ꗂ00,1 -LMSS@0  \h!}00,1w0 -LMR@ 0 hd00,1^0 -LM4  4< 0 @ 80  0 PpZ 0@00P`V R0b<0lP @`V0Pt<<t 4 80hMP00000@ < P 0Q[4tl@ 0S 800 0 c 000  80P  oKP 4 80$MP  aKR   R< @0 P`p(Kp! K  ,  0%Pp @ P`~,p~'F -LMSS`p@ S$!V00/ 0(1 !$! \] VL (0 RP0 0P 0 (Q0S R$1 !0$1^ 0S J?P0S 1S 0Q00 0P 00b0  000 0 c   0P (10(1 S$1 0 ! $1(!$Q( UU0$Q $1Ś 0P 0S( P0U(1( 0 0,1 -LM(0 p7b00VP(pVAv %P! @A EP 1!0 1!( 0P1D!D, W00  ,0iJ -L`p@BPP  SH dIoCP -0LM@ ,0( P00 0-@LPDP UQ0DP Q0!311Qꁀ0@|@p@-0P0 @ 0`0  00  00  00 0 0 0 0 00  00  00  00  00  00  00  00  00  #0 0" ! !0"0 # '0$0& % %0&0$ ' +0(0* ) )0*0( + /0,0. - -0.0, / 30002 1 10200 3 70406 5 50604 7 ;080: 9 90:08 ; ?0<0> = =0>0< ? C0@0B A A0B0@ C 1 G0DFEEFDG ` 0V0pG-M0 咀 0P0呀 @P`pL吠叀 @P`p0P0 0 L0 0 0 兀H儀0D僀@@傀P`p0 <偀8 0 @P`pH0$0D @00<8000tw|04vx 0u0 ~}|{@zPy`xp,t( 0 @!P"`#p40$00%,0&0((0'p00 ,04h jl0r s0pon@mPl`kpdq$i hgf) *(0+,-@.P/`0p$0< 10 @2030405080\ \`0be0a`@Xd c_P^`]p[ ZYX9:;@607 8p0T@?0 @0A0B0C0D0^T0 0TD E0FG崌⾉0 0 ZЍ -LM@p4 00 , 08 40L0 Ƞ< S,ȠL 0X0C8#Ƞ3 X0 08\<#X5 0<0e8#h < FFX0` 0n0C 00,`0 0X00 00C8#Ƞ XJPp@00 0E8X#X4  R 0("X0e8#h 8F0`0l0C0 , ` )J8040 ePp80 4 4P㌠!\/ X0 08#X\< " 0<0e8#h< E`Ie00e0 `0@040\ 00C8#ȠQ00X @ -LMP @p`0B8S`RE 00Q 00lU@KPT3 V  0S 0Q S0ò000 B0 00C0C0 0 00T00 KUU800C80K0 R -LMP`  a("H T p 0 ʲ0S T0 |P  `pQ0 Ppd`P 0 0b8#H Tʲ0S  0- LP@0S 0\P 0Q 0S 0S 0S00 -LM@ PQpl 0 RX 00 P) @Y 00d0 0S 0S 0P  0(1 P$1 0$1  $1 0(! @0 d Ƞ Q`ἠ,kP   04p  0 S {D1 0|0 00 0S0GP 张@`0 0S07P 0S @ -LMP`  Q@ n, $ 0 0S0P  0Pp 0, S 0 &D |0 0  pP!l>P Y 0(10S$1 0 ! 0S 0P  0P$1 0$1? 0-LMP @p 1 00 -L M`@ A nQP, p'P">P 0 P 0, S 0 C |0 0 >0 0S0|P  0Pp -LMP<0 80K0 Kp `P@Q0, 10 <KRp8#80CY 0@00PP08#X ("X 0 P L 00< 0@00Q<Y0A  P00<iGPP< 0P -RL M`Pp 0 @T 0S @RT ͅ0! A0@ &P@ V00 ]GP V, 0 10 731 B,0  1@01S -L MQ 1U p, 0 0Y0Q00S0  R R01  RQ}@`z 1Uw 0  P0G 0S00S00 Z 0 0<3Q B K  1F 0 10S' @0`00 0 \\\0 # 0 Q10  @0 @, Y00 P 01-0Q0 P0@GP 00 `4GP@ <PP  C <P@ C1S0C1== ͇0! Q0PQC 0 AQ=Q10 -LMPpPmP@ R0 X 0W@ P  0<AT ;C<0FP @-0@0 @0!00  RCA 0\R! BQ'  0R! 2 2 2 2 2 2 2 2Q 0S !0S: p-LM@ P$K, ,0K $0 (` ` P `?p Mp-LM0`0 @`"[p Mp-LM0`0 @`[p -LM0K *P - LMK0P -LM 0@P@ -LM 0@P@ - R QPPLpMUp@ Yy00BPT@*0Pd`EV 0XS``FVV@ 4 ?PA0G0@TW -P-y0S Z &P y0SKZ<P y0Sy -- L`^M@pTA0TPC/M_K 0 KKM?KPE@`1 4a 0a Ad0K?aK@D 0KQ |A Q A g1` 0S  ۩0 -LM0@S 0000 -WMLM0@P=KC/NK, h5 @A  K0KP@ڰ1%SJZ PZJ10lUP$! 1 0R 1 $! p=  T(  ,KRL>( K  KP0@!1 "  0IZS 4Th0 @L< 0 X<X<< ,<DK0\S 0 K0@! !  00A S@ h0̟1  T@b T0@B00@ S $P< !R/ 2 11 !RR b! 101 ckw 00 "RP k?KP M01 <; ,0S 0 ,Q1 01    R\ AA  R kKm/Kn?K n\101 101 +0K0L*Y 00I S@ X1T@!i 0T0@C00I S$YA 1 B SfkKm/Kn?K ;^ 00A S@ >ɟ0! T@c0T0@C00@ S $P P 2 A " 1@ 20 2 0T@A  R\ A R n?KkKm/K \1@   @1T@!i 0>T0@C;00I S$YA 101  D 1S9 1`  V,P! £! 000\0S㴀K Q :Q ܇?P K7P(K UQR`%!@iT!T00t7@D0$! 1 0RJK 1 $! pT4ǟ@$! 1 R0$! 1 ,KpRՑQ F?K 0C0 $ 10Q 1 $ pz6(K R [/K0000 $! 1 0R 1 $! p`ʀV- @eTT%Tf00`$! 1 0R@DJK 1 $! pT`@$! 1 0R 1 $! p! ^P$! 1 0R 1 $! pL!! 1@iTTڀş00$! 1 0R@DJK 1 $! p.T8$! 1 0R 1 $! !1 Q 0bQ R 1 S! 0ZK$1 uJKP 0@ CJKP PZK JKPZK1S1S1@h1T@T @$! 1 0R 1 $! pT00 @cTTc00`$! 1 0R@DJK 1 $! pqT`@$! 1 0R 1 $! p]P! 0010$! 1 0R 1 $! pA1@h T @T @$! 1 0R 1 $! p(T00@cT?Tڠb00`$! 1 0R@DJK 1 $! pT`@$! 1 0;PZK [(bJK2PTZKJK+PMZKJK$PFZKPZK ?aJKP8ZKfa@`@$! 1 0R 1 $! pL\ @$! 1 0R 1 $! p3ʼ@aTT00`$! 1 0R@DJK 1 $! pT`@$! 1 0R 1 $! p! ! [JKPZK PZK JKPZKJKPZK0Г ?8TX\`Ql0K0LK F?K A 0 $ 10Q 1 $ pQ!0B0 !1p $1 B0S ! $1 ; @`TT2`00`$! 1 0R@DJK 1 $! pT`@$! 1 0R 1 $! p ʴ0K0$! 1 R04JKMPoZKHPZK haJK?PaZKJK8PZZK!00$! 1R0JK%PGZK PZK @Db@iTT(db00`$! 1 0R@DJK 1 $! pT`@$! 1 0R 1 $! pJKPZKPZK cJKPZKJKPZK}JKP KPZKe PZKP % >&B`Ph( K0hPCdU1!`P0h! 00S00 0hV0 n 0h0  `PV P00 U-0 K0@Pu`1 `  ! 1  1S 1` 1 `   !! !  1S 1 1    PoPo!@ !R 1 Po 1  P !  1S QP 1  P1S "1 " 1 20 2 Po X! K   1S "1` " 0K0LD1` 20 2   1S 1`  1 "` 0 " 1  1S 1   1  P`  ! P`1 !  1S 1 1  P`   !@ !R 1 P` 1  P !  P 2Q`0 2 1 P`  1S 1  1 2P`0 2    1S "1` " e1` 20 2   1S 1`  1 "` 0 " 1  1S 1   1  P`  ! P`1 !  1S 1 1  P`   !@ !R 1 P` 1  P !  P 2Q`0 2 1 P`  1S 1  1 2P`0 2 $  ! !  1S 1` 000Sx;( K1 `   !! !  1S 1 1    P`P`!@ !R 1 P` 1  P !  P 2Q`0 2 1 P`  1S 1  1 20 2 P` aY  =X (K  P ! 1S01 \   1S{ 10  sK"1oK0KqOK@[!R10`1 q= (K  1S-0K0Lq? !1,0hGYgY1 ! $q1Q0aa1  !R0 1 !QPPR1  0P _! 1S AK  \ PPKH 0NS / ?`YP :,?,/`Y K@1 "0 0 " 1 1S 10 sK"1oK0KqOK@.w1 0   p 6! (Kx   F1FKS 1  10   0,K0P0B P  101 !R ! \  ! 1S 10  sK\!K0o?KqOK@ /1 "0 0 " 1 1S 10  1sKS1 0 oKKqOK@45 Q 1  0  ! 0IP01  hQ1; @  8lQ! K 10v  !R 2!  1 20 2 0O !R 21 " "  10  !@ !R 2 1 ,K.R g 10   1  !R 2 1 ,K R O 10   1 1  !R 2 1 ! 5 10   1  !R 2! 1     0O!R 2 1   !1 0  ! 1S 1P`  1x 2 1(K Y1  P`  !  0P 2  1    ! <1X1S  PQPh0K0L?8PP F AY 2":c600W00@ W0S Y@@D0T0:0  DT* 0#e 0pS@pG@0TS 1|0  ph1  00K@ 00K0#2:: ,0<C, P,00, 40 T@Xp000h\- ^040 0R  Â0040 @040 ^"0000P 4 ,@KP T0 40 X0, 0(ST 4 T@lp 0pf0S n lp 4 @   S Q   0Z S@pK Y0 HLK UpnK0 @ K|0p5SZӰp l\N 6l^pjl0P 0i@Tp @K @ K@1 DBTڼR8465680 @0K,ʈ L@D@pKTH8#4 6"*5B6T80 H H KL0K HQ2.\@0`T 01\ 0vh0 0^C0 SʈpP 00h@0C0 @0t@ 0C@ 0 @0 t0SL@@K0P0\0^00S* / ` KP@/ Ep` 0 P0 P 0 -pK0 Ph\`  ~|zx0` 40x 040 hP D0|@cT P00 @00d@0 @0X 0ZXVTRT0 @0ST@ 00S/ (S 0CTX00 02Q040 0 0*  S:T0 @00 d320d00 4 ["00VS\ pWd0?V瞯<`@A?0K0 Ps40x@0D0 Ch D + A0g@PcU! T0 0 CYh\ D0|0S\D0 h  0F@0h 0 @0 A0<@P8Ua-@a0@00 0d@0 |0D0 000p0@0 P000|0N @0 D 0 '0xU\0\@ 4 WW /O pPlڅ/O 1@KU@Kp%.O \ x PnpK% K0 KP! P  W@K -O Ppxp0lp x Q\^@K/O UP\pW K/O U@ hP(0hp|40 W00 Y00S00 UYr 0 0 0D 1  b@PD0!0D 0DP |0p\@ 00 B@p00hp @!0D@ @ 40 Y!0\4 p0R |@@000d@0 D@ D0!040  Ri0S0 eU00!  Y0S4 [pph W00^0SQ\  ?P040 F0ScBDe'@000 P0pX40 ^D d0~h00D @dp @ K T@0K@ DBT@< TB T80Ql 080 w0Q :p00S !P@ `P  Pm -Lp B/ bR@P`0ڃ0R V0P0 P @@ 0 BP9U@UPe 0 B/PU98 -LMP K`,pK@0$K 0 KP N0b4 KŒ\(000 : :C(0 00  \0  @RZR R\000A  R*0 R0:P!00P:0 \ !21R  P00SP0@-0PP!A 0\3! a*000 \2!:R 0e0CC1S000\*0\0: -LM0 R@ *0S R @*0S R:0K0 \@-0S! 0  00 000 0$0(0)0*0+ 0,0!-"0.0#00/D80S40 00 00 ܓR- \ 0S0 \R0Sa@\0-P@0 0 b @-@ l 3. P: -L M, @00S 0 2qp04 0',`@0 R0  R@0 R R0S  R 42PUq R\0  RD0 S@0 S0S3  RZP00W0#02SW`0 W000 V `0SV`F0040S 40 ` 210 0XSxS0 S@P00W0#02SWP'0 ` c0Z0)R00S, 00)R,00  RPW00' 0200XSxSs0 S@o Om-\0 0\ -8@LM,    hm dc0 -L ` -L `R b-  \ 1<20 0 \ ?\"00 0QS@-@0c  \1<0   \ ?\0 @0 @\ PT0 0 -RLM@8"x8S,0 `mhȠ,Ƞ*H&$!PQ # 3(!( '#P020cY ! C2R `0 !8,0S&hhI` 0 Q 2RhF0P13P1 <2 8-(0(   -P ;;( ;S0 0P0 -LM`PP0@ KpD0 K04 4K00M00Ѝ -LM@Pp`EUW 00-_u@T0-`P\9p T0 R @  S$0 -LM`PpP%J6 K`P`,K0 0K00CM-00!OO$P`0"&pЍ -LM`Pp, H0P`pY ,0 p-LM`P@@@`@p -1LM0S``V$ P@pSS PpR SN $8?S @ U=|:JUT!0000à@T  RP;?$ $  u00Q0SpJe\0 \03  0<$0 00P@ $0P0?45WCpSpp p-LM`P@l@P@` ph -LMPP@`pW P `034 `RE0E0BUPU0H @0`043P 0 00` -LMdß@TXp, 00 ` T W 0^0T3("S*2V ,P0;,P02S|5P3 T T00W00ST00W\ /O0`PP#>`P`P`0O/ <`PP`V%^!000P 0\P2 000 ,P 00 0O/O0`*0`@0@ P` 0``!v00Q0 S  P (1U:  |0#03  ,K0f0K "Y` ^X,P0W T ,P0^,P0T^,P0{0^0TD -RL@M@p $0 0 $ ` `AG P@U0e $ e0(0 21%$ `e( $0 K(K$K$P0 P O4  b p-PL Mp_@@` P0Q S0 U UJA>`o0OoPJ0P` P 0 `p0`S  0 S43"?S04# 0 0 p-;PLMDUEoJP V 0T0U00S pp~UPD 000p5 D" 0a4000V`p -;L,M\< 8 * \PoO 0^8K< K`P80C8 <=PoOoPJ  0P` P`PD @ `Po4KO0^`P,0P`$+`P -;L`p45gSM 3^@$P 0 )V! W2 0 KN0^0 ^0n03  1>0$0 2 A$0 AB B0Q0UzW V2$0 n$Q0 Q03  01$0 0P0S;V V ?"0!P -;LˠP` 45fMà3^@p $0 $U V1$0 N$^0 ^0n03  1>$0 0$0 cAH0Q0\U UP` S:\: 0S00 lp'V U Kn<Q0 Q 03  010$0 1$0 0P0S ";Ϡ\  Ϡ\  y -;@T;LM/UT`ᠯ", (@ 4P 0 H X9 T^(K, KV0X4P 0K4 KM0,4sL'h$H X!1"4 R0#038"8(!,6.(0\ ! 2\ 0C QCR ,p 5U`; i^0U0X00S; -;PD;LM0/EU"4 0P ,@ (0 h Sb ST P ?45(K, K0PU4P0K4 K0P,0454( S b4 ࠑ}~ ,0 4 p?0S`,Ƞ,Ƞ(XB[ 4!Q0#038!8 5"40P 20bP  CR`P`  0P0!02S `FT ^S ;T -;0LMS@ ;0S P  00 45S P{P c45S;0 S-L# ;0S ?S S 00 P *S S 45S 345S;0 S-L# ;0S ?S S0 0000P *S S 45S 45S -!:**@LAB14LM\?@(0R\0l0&03  T`PT P TQx 000T`0R@L0R000 000 l>"0   -p`':@ナ7DL⨊ MXO<0KP  @KX@0H1@0 A@ 0?48@K5 0 ( -LP@K4MH)JJp,jP@ 冪 #T # 3(l0 $(h0.%pH(N.l # R2^P2t 3#S#3t@p#8$0 (, PP@2`3`#\ # 3(t0,( Ƞ##!@ Q020S ! 24`h@^ ! 2ldxY00RKAH D L0 *L`H0DK HKLK0D @T0 0` 0O/ l0T Y 00` 0O` -LP@KlM`K PP<,JXJ@ ,Jᄪ@|40 X%X "| t #[,Hs[2,.\0#03^#38,8 Ƞ&.x 8 "# V2R02 3#h00c bVQ0C2Y0C2S`h0 fh  00|00|0 H0 DK|D 0HKLK>L`dD H0h`Pxt@030# 3# h \|L| h|H ph0l@ 3 #030#0SPLh P DP t ` 0/O PP@Z ` 0O/A?O`PP` -p(  LMP`P' &:::S@ W @0 O00X64460 PP 20460@ -p(  LMP`P3 &:::S@$ ?S@ S@0 O00W VUS S X64460 0460@ -p(  LMP`P3 &:::S@$ ?S@ S @0 O00W VUS S X64460 0460@Q0 0aQ03000100P0R b0@- @P 1<\0 0 ?\4 00-b1R"  @-Sc@#0 401  00S20@-  3#@3@# 0  0bQ@2c0 0@-Pc0 @R#3 e d \@2 n0Q@20p@-X h%X ! $ T#3 Ƞ$ȌH.@!Q2pG-(!X  "(!& ' V#3W#3 Ƞ&Ȍh$a*'x%p,Z@2\P2 3 #P$ PG-ȠM!h,Ƞ !#8() X#3 Ƞ"( X(ȌPA*% ᑌ,Z@#@3H*H F' ᙡ&,QP2 Vp2` P@3@#\#3P, Ƞ%".p RP2 3#^#3@ .,$<0\@2@PTP28 40@0 PЍQPP  :Q00SP  :Q0#02SQP@-0 ! - 0pRpLJ00 a@P(8#8"( !8 #( 8^#Ƞ:0 0ba^ *0("( ( #8"( ^"Ƞ:\  0R 0!0  !  8 -`L0PS% AT01 0S0 00lRd0u!T0 0c1S1@0@ mR,D  P0-LLP@ 0@S 4, 10 AR00hQROR, D  0"108#8S2 "$"""!    -L M, 0pǏ00 ɯ 9A 0 $`PP`^Pp ,0 0R0 ,1 p ,Y,0@ ! <,,@ 88S00000P0  -LM@/00@ -LMpPX, Pp0``Z 1  R, 8 40 *00 \:`qV0p 8p*PU 0 @20@\0:0 pV:804 Z0>SJZ0>S ,0, -PLGEQ% ,q`V@*  P @Tp `0S@W 0S UQ@pJQpy@p0S `T 0S P4QH[`@,*Q@$0 1$,q -LM0b 0PUp@ڂ Uk R0  R00@ d 040 Q2 :RP 0E00Q0: P!0 <01R\3# -LM@`PP? @ `PP0 P, P@p` 0S Q 0@  ^P@:, P*p`0t ,0@P0 P@:0<S0<HS  00P -LM0pQ`5@ 0` P0U 5 P56 0 $  `21056U 0 ``610$0 0K `6256 0 U0032 2 -LM0K( P1$#j&(0 64 40 ,0pS00 ' 0KP4 00 `104 002 4 040S  @0 V 0C>C5 `0C0 C>@0C!0"B@`@4K40 0 @ 0S00S0 0-0L(M P< 08 x@4 000 ,@ 0(0 $P D0 <K0  P 0 R00P@4\g@ ->0>L M0R, "P0 0 o$"00(SwX0c0pQhY4  !(0W*(040C  A\0\`SCYp (0W:Y7!p(0W * @\`V X!p(0@W:<1( W X0S w ( 0S0S,0\00`X00X0 ,% , Z0bP0\0 X0Y0b bl X000h0A,JP0 00e04t@̮ P -LM─(0PUp` *@\0PS (0@U:`0 P8 \`0X  cX `00j0@̮ P -LM䒟p,0,P!, 0 4 >0>0XX00 R2 P@0m p`"000 4(0Q9* C00A\`V\P 00 SE 4P (0Q:4P% 0 S00 cA 0S4P0 , a X0P0aX0    K  R <1 4P@0 p!000X (0R v0S" 0S\, X00@R0dX0   |P0S 0S     0F80\RS@Ԯ P -LT 0 PP -LM(@ Q* 00PP -LTM0T,0  @0 (0 `V V @TR 0SO p<0C>S`(``````````@`````````````` ````(08`@```@`H`P`````X`t(00 S(0<_@ 0S`V 0S00P, `P2 p`1 P@.  W   S vJ 1` p` p *000 ,:!#: S(@ ,0 S X,r<  8Y00(0(00:$0  pp$p pp}p{pypw1 :r pplpKh? P@`kVD0@(IPc,Q @ 0@ P@0nD -LM@Pt r(1 ,  넠p@`J  000N pW%*\ 2#8#c,> 0S 0B 0S 0pW:P 01C0 0 @00,   P̮ -LMP@U  0 0           p0 p` p D 0:00MQ04P P00 p-LM0@\P`2#8#c%>L 0 R 0C 0 RP  `00C0p9P p p-LM0P, 0,R@`@ +N@2#8#c$>0 . RQ 0C0 . RQRp80\@Ԯ -0L@CpP/0 l00 0`0倁 @1  P2#8#c!>Q0 S # 3P00V#3 T - L`pp\ PPQ VE0`0@0@0008311p i P'@P" @0d!ST 21 @!T !0`0P  p}   *02&60!`!p *l -LM, 0 R@q R0DS@T 0D# 0`VV  0R;0@S00S PpPp P8ڲ1 f0C BpW @PpPBQf":0@P0#0! B8#! 0 0!pBSq R0 `\_?0 00fP` 80P@Ԯx -LMP0pQ@`00C*"*2 |[2<1S1 01R!1R, 1R  R 0S  S00 R *i%0 R K>00 R \ 0S * R 0S  0S: Pidx@ȯ - PLM@bq:$ 0bPW*@>0^P Ip`K  P @$Q/0S $0` S*0S`:`0X` 1 R  `$0S X0$0$ c d baPt$ 000` )g> 00(0XP` T  @P -X L0PS HH 00CQ0C> 00000P, -d@LMP @0 R 00S!> 0 0s@, -LM`>p0S0P @0T $ @00S0 ,0 0CRP0U =T0 R Ty= 00<P 1,@PP -LMq`PPe *"*R@ R B0B@ TC$00c S`1:Q i@$0pSN@ T.:0SN@ H$ 00b00S. Vi0S.$0  cN@$a P 0pST0S V PP  iL01 \h\( N@ P( -L`E=Vp$ P0S#0 0R0Sxhh@00S0 hR0 0CR0=ptq,@HPTP -PL$M`< x< $ :0bV*0Z%ZU@ U E0B@ TP$0T:Pc V$0pp00 U00S 0<Q, VV0S 0SV<< fV Pp VU<V 1 !<0S  R, >.0 >.0 R00 4 ,$0S00@04pph8p 1p Pp p 8!`80 0R0<`8 q'*!$Q<4 @004 h&<p<00 aP  <04$@a, P Vp0S $ 4<0 b f9L$0I6< 00`, \<o[@ P( -LP` UV3:V P$:@0Q0 0CRP0U ; 0S :; 00M 0S 0S; 0 0<$XP  ,@PP 0-LMPK 00%0 @+ 0ST 0S @S 0ST 0S 0Sp;C  f; C00 m100*2 Tb -@LM8 0R,0 (  0  R 00 㬐K0K@ % K @@2#;0 0C0p000@P`0@00 p 0W0`@@TZ,04 ,0S(0 ,k`0`aj a-H 000000` -LM,@0S0Sh, - LM0, S)0 R# p00C000 0, P`@0@00  0X0`( 0SoI,`` 0-PL0S" 00CS0|0 R1LHD0S@0i: 0 R, a`a -pL0`S@0 R P:t0 R @Dt XP00CS0 Q@Dt0Sh,`a a P0-LP0P@``@P:0@-M Ѝ@-MЍ! !P: ZŒŒ#! !P: `B!,aB 0>ZJJJJJJJJJJJJJJJJJJ }J xJ sJ nJ iJ dJ _J ZJ UJ PJKJFJAJ=Q:Q:Q:Q:Q:Q:Q}:Qx:Qs:Qn:Qi:Qd:Q_:QZ:QU:QP:QK:QF: QA: Q<: Q7: Q2: Q-: Q(: Q#: Q: Q: Q:Q:Q :Q:QA ? QA ? QA > QA > QA = QA = QA < QA < QA ; QA ; QA : QA : QA 9 QA 9 QA 8 QA 8 QA 7 QA 7 QA 6 QA 6 QA 5 QA 5 QA 4 QA 4 QA 3 QA 3 QA 2 QA 2 QA 1 QA 1 QA 0 QA 0 \aBC`B0QA 0  -LM@8h@ -LM@\Pp` h^\QU0SD R 0S=W00  00CST,TT`lx0 0800 1 0 0 ;00 0 0 R 0;S< W  4 w8 00r8 0, @-DP@-@p `0S0S=S 0S=S PdP U 0S  0R^ 0S ^0=S P00cC10a -LMK@-Q:@- R (2 R R -PPPP RrPP B PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R@- RP1P P1P RrP1P  B P1P B@  R010 1  B R0q0`0q0`0q0`\0q0`0q0`0q0` R 0\6 R B0@-81, Ġ%̌T$\D#L0P  R0@ Ġ01#̌  R R B0@-81, Ƞ%ȌX$XH#H0P  R0@ Ƞ01#Ȍ  R R B0@-81, ̠%Č\$TL#D0P  R0@ ̠01#Č  R-R0 0c BSR48 R p-@P`x BRpR0 BRRR -LM`@ 0pP`70S  0Sb22x*p*xxl*JJh*^* -p@L00l8#hP 08#x `0 0c8#h08#x 0b0C`p`0 -LM@p 0S `;W0R F0`8W#X 0  bPʀ 0S0 0 A0AA0AP(1W0G(1 0000F000A8  B8 000o -L4M@ 0< 开@ 剺PD p <0်Px D0@ 00  0 ZH P L *P0<S`R0000 l , 6@0g\0KH8 K8' 0080 0 c4 ?P08#8P0 0ZpPP0n0 a B 00ഀD   000#8ᲀL  L 08# aAL0 00`0ᲀPD  0<@ D   000 -LLMT X PpP 0L8#hL \\P ` h [00C8S 0@TL s \d `E0S@@KHKd0@ @ b 00H0 0L c@d@ 圴P P3 0S 0 00S L Pp   00008#h\0 0S\`0S L'\0S 0 00S\  TLPT \ \  dT 000 0a0C0 h 0b0C 0X L0YPX L` X0@QPh  L X` eX 8K TP X0LP˸P4PT 8pW\ 0 RL0X P X -LM@p0Qs P`0 R=V0e S0 0RS 00P U*V0 00Q *^ 0P@  0Y008 8(40PoZ P0 00S"P@ 0S 0 00S 0YP  Q p-LM40@SP`$ 000`!H 0 Pp0000000 0 B@ 0p00S40040 -L M`pxQ  0 0C0ppSa <0R@W M P@0Pp  P P>Y 0S00C0pp  ,1R Y 0C\0K 1 00  0 !0  00[\002K)0[* [0 0\ʌ0 0"K+ [,[ \3O0 0⟹@0@0<  JPPBJ@ @00@ -L MPx`p@ `  1R TI 0CP0K100  0!0  00[P0Z" <0W@  P@0P凹p  P .3O0 0A@0@0< J PpBJ@ 1@00@0Tʀ0 0"K) [*[ Pڸ5P  -LM` 0H20APP p0 101  d 020 0  崜8Q0 00P -L M  !4 0pD $0@SQ!P40 BU00 ,P 18aV U 0, 1 CU@  T pb @ TPU00ZD0 $0@0@@c TD ZF !4 0@  A@ D@ 010CY ?=2!I !U08#X&ʊU0 aP`40@ D0 T0D0Z 1@@ AU@ D 1 @2001 72d@?=2D  $0!E!P@T$ U D0T P U D0TU1@ \0@bT5У 0$10C@/-"@dP`S꠰ -0p8#(=1@0@A0C$0^^ 18a!$ BVLP ?=2!E.!h霷` -LAMq0P 0 e9AnK `F0@S `F@D3 \0 0᥸AK0 A SA *0$4 [0s1 $=  K1s 0S 8 b1?00S0$5԰ -L MⰀ0ሐ` 0cV8#Ƞ, F0@p P0 00 0c8#Ƞ 0 밀,000 0Pc PEP00@ -LM1@QPap "0 Rp8! ,,P8q8p -L%s: %s not compiled in instbinUsage: %s ..., where is one of: mount_cd9660dfmountmount_ext2fssyncnewfs_msdossttylndisklabelpaxtarcpiofsck_ext2fscatifconfigrtsolping6ztsscalelessmoremount_nfsfdiskgrepfgrepegrepumountmount_msdosfsckmknoddisknamesreboothaltmount_ffsdhclientcpgzipgunzipgzcatchmodchgrpchownfsck_ffsnewfsrmmtejectmkdirksh-shbioctlsleepmvexprdmesghostname;Tx|x ̉@@ 0d t@@cbsconvfilesifobsofskipno value specified for %sunknown operand %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationscbs cannot be zerobuffer sizes cannot be zerobuffer sizes cannot be greater than %zdseek offsets cannot be larger than %qdconv option disabled%s: illegal numeric valuefiles is not supported for non-tape devicesstdoutinput bufferoutput buffercase conv and -DNO_CONV%s: end of device%s: short write on character device%s: short write on tape device%zu+%zu records in %zu+%zu records out blockblocks%zu odd length swab %s %zu truncated %s %qd bytes transferred in %ld.%03ld secs (%0.0f bytes/sec) summaryskip reached end of inputDP|\`ht|userquotagroupquotarwautoaccesstimeatimedevexecsuidrdonlyupdateegjo:Rs:cd9660%s: Filesystem not supported by kernelsession number is %s: %srealpath %s%s on %susage: mount_cd9660 [-egjR] [-o options] [-s offset] special node %s: illegal value '%s'needsdoes not need-o %s: option %s a value-o %s: option not supportedhiklnPt:retrieving information on mounted file systems%s mounted as a %s file system%s is not a local file system-h and -i are incompatible with -Ponly one -t option may be specified.empty type list %7s%-*.*s %*llu %9llu %9lld %5.0f%% %7llu %7llu %5.0f%% %s 1K-blocks%-*.*s %s Used Avail CapacityFilesystem Mounted on iused ifree %%iused Size%-*.*s %s Used Avail Capacity1024-blocks 512-blocks%-*.*s %s Used Available Capacity Mounted on %-*.*s %*lld %10lld %11lld %5.0f%% %s df: %qd: %s usage: %s [-hiklnP] [-t type] [[file | file_system] ...] ffsext2fskerberos uid mappingNFS exportedanon uid mappingexported read-onlynoatimenoaccesstimenodevnoexecnosuidwith quotasread-onlyroot file systemsynchronoussoftdepasynchronousasyncexported to the worldAadfo:rswt:uvforcerqnoauto/var/run/mountd.pidsignal mountdgetmntinfo:@nfsunknown special file or file system %s.root_devicecan't find fstab entry for %s.%s has unknown file system type./usr/sbinexec: mount_%smountfsstatfs %s%s/mount_%sexec %s for %sno mount helper program found for %sforkalready mounted%s on %s type %.*s: %s %s on %s type %.*s (%sunknown flag%s %#xv2v3udptcpsoftintrnoconnrdirplus%s%s=%dwsizersizerdirsizetimeoretransmaxgrouplistreadaheadacregminacregmax, %s=%dacdirminacdirmaxprmounthardmfs%s%s=%lu %smsdos%s%s=%u, %s=%u%s%s=0%onowin95direxecnorripgensextattprocfslinuxversion %d, ctime=%s%s,%s-ousage: mount [-Aadfruvw] [-t type] mount [-dfrsuvw] special | node mount [-dfruvw] [-o options] [-t type] special node ufs%s: fstab type %s != disklabel type %s%s: fstab uses outdated type 'ufs' -- fix pleaseDP|\`ht|o:mount table fullspecified device does not match mounted device%s on %s: %sfilesystem not supported by kernelusage: mount_ext2fs [-o options] special node $FreeBSD: src/sbin/newfs_msdos/newfs_msdos.c,v 1.9 1999/08/28 00:13:52 peter Exp $%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) %s: can't read sector %u%s: can't write sector %uNO NAMEFAT%uBSD 4.4%u clusters too few clusters for FAT%u, need %uwarning: sectors/FAT limits file system to %u clusterstoo few reserved sectorsno room for backup sectorbackup sector would overwrite info sectorno room for info sector/boot/%s%s: inappropriate file type or format160180320360720120014402880%s: bad FAT typevolume ID%s: bad volume label%s: bad OEM stringbytes/sectorsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorsfile system sizesectors/trackwarning: %s is not a character devicebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %u-%c is not a legal FAT%s optionblock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: FAT type limits file system to %u sectors/dev/%s is mounted on %s%s: unknown standard format%s: can't figure out partition info%s: partition is unavailablegetdiskinfo%s: unknown disk typeioctl (GDINFO)%s: can't read disk label; disk type must be specifiedbps=%u spc=%u res=%u nft=%u mid=%#x spt=%u hds=%u hid=%u bspf=%u rdcl=%u infs=%#x bkbs= bsec=%u spf=%u sec=%u rde=%u%s: no default %s%s: illegal %s%s: bad %s"*+,./:;<=>?[\]|usage: %s [-N] [-a FAT-size] [-B boot] [-b block-size] [-c cluster-size] [-e dirents] [-F FAT-type] [-f format] [-h heads] [-I volid] [-i info] [-k backup] [-L label] [-m media] [-n FATs] [-O OEM] [-o hidden] [-r reserved] [-S sector-size] [-s total] [-u track-size] special [disktype] 55 5`,5|9!9$5,505 85@5 H5P5 X5 9P8`5h5:h7l7p7t7x7777777 7 7#737#737273737#7@8@X@8@88 8(848<8D8L8T8\8d8l8t8|8888 8 8@8@88888888&889 999$9,949@9 H9 :T9\9d9l9x999999999999999:@:@:@:@(: 0: <: H: T:\:d:l:t:|::@:@::: : :C$:C:C$:C:::::; ;;;$;,;4;<; D; L;T;\;d;l;@t;@|;;;;;;discarddsuspeofeol2lnextminquitreprintstartstatusstopsuspflushrprntoption requires a numeric argument -- %smaximum option value is %d -- %sundefoption requires an argument -- %sillegal gfmt1 option -- %sillegal gfmt1 optiongfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:ispeed=%d:ospeed=%d %s=%x:%lxoflagospeedlflagiflagispeedcflagcbreakcolscolumnscookeddecekeverythingextproclcasenewoldostartostoprawrowssanespeedttyillegal option -- -%s%d %d TIOCSETDTIOCSTARTTIOCSTOPcs5cs6cs7cs8cstopb-cstopbcread-creadparenb-parenbparodd-paroddparity-parityevenp-evenpoddp-oddppass8-pass8hupcl-hupcl-hupclocal-clocalcrtscts-crtsctsmdmbuf-mdmbufignbrk-ignbrkbrkint-brkintignpar-ignparparmrk-parmrkinpck-inpckistrip-istripinlcr-inlcrigncr-igncricrnl-icrnliuclc-iuclcixon-ixon-flowixoff-ixofftandem-tandemixany-ixanydecctlq-decctlqimaxbel-imaxbel-echoechoe-echoecrterase-crterasecrtbs-crtbsechok-echokechoke-echokecrtkill-crtkillaltwerase-altweraseiexten-iextenechonl-echonlechoctl-echoctlctlecho-ctlechoechoprt-echoprtprterase-prteraseisig-isigicanon-icanonnoflsh-noflshtostop-tostopflusho-flushopendin-pendin-crtnewcrt-newcrtnokerninfo-nokerninfokerninfo-kerninfoxcase-xcaseopost-opostlitout-litoutocrnl-ocrnlolcuc-olcuconlcr-onlcronlret-onlretonocr-onocrtabs-tabsoxtabs-oxtabsonoeot-onoeottablet disc; ispeed %d baud; ospeed %d baud;lflags-extprociflagsoflagscflags%-8scchars%s = %s; %d rows; %d columns;speed %d baud;#%d disc; slip disc; ppp disc; strip disc; nmea disc; -aefgaef:gTIOCGETDTIOCSWINSZtcsetattrgfmt1illegal option -- %sTIOCGWINSZnot a terminalusage: %s [-a | -e | -g] [-f file] [operands] @(#) Copyright (c) 1987, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: ln.c,v 1.17 2008/05/28 19:31:38 millert Exp $Ffhnslinkit%s: disappeared%s and %s are identical (nothing done).%s/%susage: %s [-fhns] source [target] %s [-fs] source ... [directory] @(#) Copyright (c) 1987, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: disklabel.c,v 1.138 2009/02/15 21:07:00 krw Exp $``8rhX@rHrTX(TXLrXXPrXTrXrTr\ysƕOJjNrUD9ZTDN1h W>CJ=^wy7/uy~upoT;unPuryBً7ٛJjMљ**sՔ]gz*nZmt}rr]=;P.foEv~lUdEߴY_gu\gJz뮳O8Cf1&kh,x:u \RIx'oH>BWYuWL =6 ]gRDO}ü$R/px 3~xH%~x6۫(q*_1gC^e`KOp2%|;虆Ԧ?j˼i\z{7^4!dVL[n\+;sRt~Odu`^ئW@W۫;|ةNM3?u_<9#OhU"RPY殷.|Mt].8>憏b[Nm8Jmۛ=,K73nm .LR7}ꓓ(hӹrye޹?i!f}w}Z`[+(IV^PVfym$Qbbg;Wcb|m!$9nR]Wn!+nL+YrtzUk%OQGVNr[ڡD1>(%_G۬%bǂ$3dz(X_/@c̶̀& Xܩ64GdL6T;݀jL87; P +PvXtV۽PPϮ^]],._//` \Q8V1  %. G@lEߌW W@\љ OOp%l.8qQH 3/_usk:6oUgwf,7UFS䒍= }OV nV`g9AiVphnLp7;F&9;>Ą\xbR[U;"l?wtQ䃧U5c1D%`couMr8 ɍS% T{`G5 8@z9N37Fsj-K[)]'&z3lеi)CŘq͑%ڪrG70fppg{2&nȲYz2/4v#z/## PI lB?JN ^iJHNj}D_;ϒc\n"4;M@*y; h5= 3^ީ[_\ȟ{)\6^Al@dP*$/6Ց&h`4cN"5$:#_N@$iB@HO9td XBFZ&-zX6f +C)4|hm()`6~#@GCHRr@ڐAl+GR]Mo"D ~\.[uՅ)|n,qw_7#(ZU@x){ϥ8ښי\B@?h¢[;cɏcBM3Y="%Fx*͸4L Qyl*A,~H?V,C \k` n V-d. ̂_A`WH4WǶ= jeg6EV~ 4X1!TW6jn=h8(v'l-p񠚶A\}P GC >[CwUGL֛S:e*|]'@i\{q]d寷>:@?X(F+aqI^.$ dg 04]%KPPMa2l:^op}QSa4C2r-? x,s-v~g_3.MKb>E8^sg,WF[,VK[ KgQpJ: `5| :WLVg\^;#Ӎs}*TѫL.FG ?8HY1GKaKBR.sYj0v jŕWƖJh  #}=\MKaukj63.ed6Rͼ{p[sO7{q׷oay`JU˼kvVڷͶO59q|׌;kʀTnm$Ҭ|qL{GX[FeX _ԔI G4:45܉ 1ѝMfY物x"7>ɥإ>)һHfb;_4<8@suYN9{iΗ"hzĕ0?}78n0\[7.9|jg;L7E% | 9L+%נFlEC5jM_Gy&T٬F3@Zl[, Q2'hq.:5iF5գ6}2ͭI:Ҥ#\ ݸ.f[,]iGE*3(sOO_i{tԹFg6-czHi&`.scՍS Gw 8z U8nsV`e c(`Ν Hhp qNV^I3v(+ԀoB} V>6|O:)EF3dCҴhJKӥ=8ߒ 4nP_PHq{w8KtoD5 O1X&xOvPhd%h4:zo89^'!V}y6}vXpnLLT08.659cq's\L"g Xss@\Eci5wn4ϵqT94IeU^kֳ+Sꪴe;  2!4m/iեO|#DWP,^+r:6[1VAum@C9Ѻ~O tmRp~O's/׏:O+}Ij#i9ALL[Po8n-t(@PnKFiLҜXo2Y2䬌+$Gn2ߵxVb;+Ȏk7nboߡGQD} 8F'SIyMB-%^i،G¥Y7amg(1ГSΎFMܑQن?5vNΏYC8 g&6ݵ) m-j 3q N|ޒǰ{?P mʷbYL~<;=z4>I}-ÉTp lIDj<'qQ%SpH"LKDWw [, 0c|ߎ[q˛R!qkԔrC՚֬& L^8yhTJ$Ox&?(~c |t> d ę  -P2t$ IL i˩Gj\2M⬔\͕{>ઘ/ZF9Sxb-oÆ!ثqU -k G_ߥV~uO. >f#:gfwsC 1|䓟r}p&~XLB a78!D:]|~>Z+NdPO'ڕ}SNI8[m @ɧ=Em7pxVwSO;l`CVnx?ߟnɳf#9pNs~>o% ivd:,8RaD bAl-?ԣ8FVg)Χ# Z v)C<}qP=гFJ䨜^|_(S\] s_&z0fj|. kk (2h- G^ eb0SqGT:5p&yB Ǡ'p!K~'?*{\i8 O]1B>U t<L&Kz-Z^l\ql@la+ E6)TA\('&"8=}VxDVR'IOfb58f:PP $`]D*Xeo 2Te[ʳp։M]g Y^3~^Aw Uxf=ynj~ZZ&>D{`#!%{ p'}yq'J76bR Nhh8DjX7a)5<~}uWY|aXyyy>NTmVsBl¼ (tV7pxU;F.?/dR ?r>S 2gˤԵ1']P7MfeΠ~fqw SCRX{c X[L ."P*pX@C!#c|c#qp'FT ?y^EH3i Emly$YS\ث{ ]9BSӌrqzt܉6VRD|Bމ<`ɸܑ I>@Q_LbNt8^q'@Cٳg_揾8LTNKadosudfunknownSMDMSCPold DECSCSIESDIST506HP-IBHP-FLtype 9floppyccdvndATAPIRAIDunusedswapVersion6Version7SystemV4.1BSDEighth-Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSHFSADFSNTFSUDFBEf:NRWb:cdenp:s:tvwbckmgtioctl DIOCWLABELunknown disk type: %sioctl DIOCWDINFO%s: No disk label on disk%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of disk%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)# Extended partition %d: type %02X start %u size %u # Inside MBR partition %d: type %02X start %u size %u warning, DOS partition table with no valid OpenBSD partitionioctl DIOCGPDINFOioctl DIOCGDINFOioctl DIOCRLDINFOBootstrap doesn't leave room for disk label\ :Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:nc#%u:sc#%u:su#%llu:%srm#%hu:%sil#%hu:d%d#%up%c#%llu:o%c#%llu:t%c=%s:t%c=unknown%d:b%c#%u:f%c#%u:%sts#%u:%shs#%u:%scs#%hu:%ssk#%hu:%.*s| %c: %15.*f%c %15.*f%c %7.7s%7d%19.19s# %s %5u %5u %4hu %c: %16llu %16llu # %s: type: %s type: %d disk: %.*s label: %.*s flags:bytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total bytes: %.*f%c rpm: %hu interleave: %hu trackskew: %hu cylinderskew: %hu headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %d %hu partitions: offset# %16.16s %16.16s fstype [fsize bsize cpg] total sectors: %llu vendor badsect # Notes: # Up to 16 partitions are valid, named from 'a' to 'p'. Partition 'a' is # your root filesystem, 'b' is your swap, and 'c' should cover your whole # disk. Any other partition is free for any use. 'size' and 'offset' are # in 512-byte blocks. fstype should be '4.2BSD', 'swap', or 'none' or some # other values. fsize/bsize/cpg should typically be '2048 16384 16' for a # 4.2BSD filesystem (or '512 4096 16' except on alpha, sun4, ...) re-edit the label? [y]: editNo changes.-cVISUALEDITOR/usr/bin/vi/bin/sh # line %d: syntax errorIDEline %d: warning, unknown disk type: %sbadsectvendorline %d: bad flag: %sdrivedataline %d: bad drivedata %s%d partitionsline %d: bad %s: %ssectors/cylindertracks/cylindercylinderstotal sectorsrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: warning, unknown filesystem type: %sline %d: bad partition offset: %sgetasciilabelline %d: bad partition size: %sline %d: too few fieldsline %d: bad partition name: %sline %d: unknown field: %sline %d: bad # of partitionssector size %dtracks/cylinder %dpartition %c: offset past end of unitpartition %c: partition extends past end of unitwarning, unused partition %c: size %lld offset %lldwarning, partition %c: size 0, but offset %lldwarning, number of partitions (%d) > MAXPARTITIONS (%d)warning, super block size %% sector-size != 0super block size %dwarning, boot block size %% sector-size != 0boot block size %dwarning, revolutions/minute %dcylinders/unit %dsectors/track %dcmplabelusage: disklabel [-c | -d | -t] [-v] [-p unit] disk (read) disklabel -w [-c | -d] [-nv] disk disktype [packid] (write) disklabel -e [-c | -d] [-nv] disk (edit) disklabel -E [-c | -d] [-nv] [-f tempfile] disk (simple editor) disklabel -R [-nv] disk protofile (restore) disklabel -N | -W [-nv] disk (protect) %sdisklabel -B [-nv]%s disk [disktype] (boot) %sdisklabel -Bw [-nv]%s disk disktype [packid] (write) %sdisklabel -BR [-nv]%s disk protofile [disktype] (restore) `disk' may be of the form: sd0 or /dev/rsd0%c. `disktype' is an entry from %s, see disktab(5) for more info. /etc/disktab`packid' is an identification string for the device. `protofile' is the output from the read cmd form; -R is powerful. For procedures specific to this architecture see: %s fdisk(8)You need to specify a type for this disk.No 'c' partition found, adding one that spans the disk.Initial label editor (enter '?' for help at any prompt) unable to get default partition tablePAGER/usr/bin/lessgunzip -qc|%sunable to execute %sEnteringExiting%s expert mode This option is not valid when run without the -f flag. Write the modified label to disk?Write new label?editorunable to write labelNo label changes.In no change mode, not writing label.Free sectors: %16llu - %16llu (%16llu) Total free sectors: %llu. cannot open %sFilenameName of the file to save label into.Nothing to undo!Last change undone.Unknown option: %c ('?' for help) can't run when there is partition overlap.No space left, you need to shrink a partition Partition must be between 'a' and '%c' (excluding 'c'). Partition '%c' exists. Delete it first. partitionThe letter of the new partition, a - p.Command aborted Partition '%c' is not in use. You cannot name a filesystem of type %s. partition to nameThe letter of the partition to name, a - p.partition to modifyThe letter of the partition to modify, a - p.partition to deleteThe letter of the partition to delete, a - p, or '*'.Partition %c is currently %llu sectors in size, and can have a maximum size of %llu sectors. partition to change sizeThe letter of the partition to change size, a - p.%s: [%s] %s: [%llu] Rounding to cylinder: %llu getuint%lldhas_overlap Error, partitions %c and %c overlap: Disable which one? (^D to abort) [%c %c] Changing device parameters for %s: What kind of disk is this? Usually SCSI, ESDI, ST506, or floppy (use ESDI for IDE)."%s" is not a valid disk type. Valid types are: "%s"label name15 char string that describes this label, usually the disk name.The Numer of sectors per track.Invalid entry The number of tracks per cylinder.The number of sectors per cylinder (Usually sectors/track * tracks/cylinder).The total number of cylinders on the disk.number of cylindersThe total number of sectors on the disk.Not enough free space to shrink by %llu sectors (only %llu sectors left) The rotational speed of the disk in revolutions per minute.The physical sector interleave, set when formatting. Almost always 1.edit_parmsYou may want to increase the size of the 'c' partition.failed to sort partition tablesdrzFLOPPYxdhdCCDVNDsvndPossible values are:"IDE", Disk typeWhat kind of disk is this? Usually SCSI, IDE, ESDI, CCD, ST506, or floppy.Starting sectorThe start of the OpenBSD portion of the disk.Size ('*' for entire disk)The size of the OpenBSD portion of the disk ('*' for the entire disk).Treating sectors %llu-%llu as the OpenBSD portion of the disk. You can use the 'b' command to change this. The 'p' command prints the current partitions. By default, it prints size and offset in sectors (a sector is usually 512 bytes). The 'p' command takes an optional units argument. Possible values are 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, and 'g' for gigabytes. The 'D' command will set the disk label to the default values as reported by the disk itself. This similates the case where there is no disk label. The 'M' command pipes the entire OpenBSD manual page for disk label through the pager specified by the PAGER environment variable or 'less' if PAGER is not set. It is especially useful during install when the normal system manual is not available. The 'X' command toggles disklabel in to/out of 'expert mode'. By default, some settings are reserved for experts only (such as the block and fragment size on ffs partitions). The 'a' command adds new partitions to the disk. It takes as an optional argument the partition letter to add. If you do not specify a partition letter, you will be prompted for it; the next available letter will be the default answer The 'b' command is used to change the boundaries of the OpenBSD portion of the disk. This is only useful on disks with an fdisk partition. By default, on a disk with an fdisk partition, the boundaries are set to be the first and last sectors of the OpenBSD fdisk partition. You should only change these if your fdisk partition table is incorrect or you have a disk larger than 8gig, since 8gig is the maximum size an fdisk partition can be. You may enter '*' at the 'Size' prompt to indicate the entire size of the disk (minus the starting sector). Use this option with care; if you extend the boundaries such that they overlap with another operating system you will corrupt the other operating system's data. The 'c' command is used to change the size of an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. You may add a '+' or '-' prefix to the new size to increase or decrease the existing value instead of entering an absolute value. You may also use a suffix to indicate the units the values is in terms of. Possible suffixes are 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, 'g' for gigabytes or no suffix for sectors (usually 512 bytes). You may also enter '*' to change the size to be the total number of free sectors remaining. The 'd' command is used to delete an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. You may not delete the ``c'' partition as 'c' must always exist and by default is marked as 'unused' (so it does not take up any space). The 'e' command is used to edit the disk drive parameters. These include the number of sectors/track, tracks/cylinder, sectors/cylinder, number of cylinders on the disk , total sectors on the disk, rpm, interleave, disk type, and a descriptive label string. You should not change these unless you know what you are doing The 'g' command is used select which disk geometry to use, the disk or a user geometry. It takes as an optional argument ``d'' or ``u''. If you do not specify the type as an argument, you will be prompted for it. The 'l' command prints the header of the disk label. By default, it prints size and offset in sectors (a sector is usually 512 bytes). The 'p' command takes an optional units argument. Possible values are 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, and 'g' for gigabytes. The 'm' command is used to modify an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. This option allows the user to change the filesystem type, starting offset, partition size, block fragment size, block size, and cylinders per group for the specified partition (not all parameters are configurable for non-BSD partitions). The 'n' command is used to set the mount point for a partition (ie: name it). It takes as an optional argument the partition letter to name. If you do not specify a partition letter, you will be prompted for one. This option is only valid if disklabel was invoked with the -F flag. The 'q' command quits the label editor. If any changes have been made you will be asked whether or not to save the changes to the on-disk label. The 'r' command is used to recalculate and display details about the available free space. The 's' command is used to save a copy of the label to a file in ascii format (suitable for loading via disklabel's [-R] option). It takes as an optional argument the filename to save the label to. If you do not specify a filename, you will be prompted for one. The 'u' command will undo (or redo) the last change. Entering 'u' once will undo your last change. Entering it again will restore the change. The 'w' command will write the current label to disk. This option will commit any changes to the on-disk label. The 'x' command exits the label editor without saving any changes to the on-disk label. Available commands: ? [command] - show help n [part] - set mount point a [part] - add partition p [unit] - print partitions b - set OpenBSD boundaries q - quit & save changes c [part] - change partition size r - display free space D - reset label to default s [path] - save label to file d [part] - delete partition u - undo last change e - edit drive parameters w - write label to disk g [d | u] - [d]isk or [u]ser geometry X - toggle expert mode l [unit] - print disk label header x - exit & lose changes M - disklabel(8) man page z - delete all partitions m [part] - modify partition Suffixes can be used to indicate units other than sectors: 'b' (bytes), 'k' (kilobytes), 'm' (megabytes), 'g' (gigabytes) 'c' (cylinders), '%' (% of total disk), '&' (% of free space). Values in non-sector units are truncated to the nearest cylinder boundary.The 'z' command zeroes out the existing partition table, leaving only the 'c' partition. The drive parameters are not changed. mpsave%s%c %s %s rw 1 %d Starting sector for this partition.The offset must be >= %llu and < %llu, the limits of the OpenBSD portion of the disk. The 'b' command can change these limits. The offset must be in a free area. Size of the partition. You may also say +/- amount for a relative change.The size can't be more than %llu sectors, or the partition would extend beyond the last sector (%llu) of the OpenBSD portion of the disk. The 'b' command can change this limit. Sorry, there are only %llu sectors left The size must be > 0 Size of fs block fragments. Usually 2048 or 512.fragment sizeZero fragment size implies zero block sizeSize of filesystem blocks. Usually 16384 or 4096.Error: block size must be at least as big as page size (%d). Error: block size must be a multiple of the fragment size. Error: block size must be at least as big as fragment size. Filesystem type as a decimal number; usually 7 (4.2BSD) or 1 (swap).FS type (decimal)FS typeFilesystem type (usually 4.2BSD or swap)Unrecognized filesystem type '%s', treating as 'unknown' noneWhere to mount this filesystem (ie: / /var /usr)Mount points must start with '/' Can't stat deviceYou must enter either 'd' or 'u'. BIOS geometry not defined. Note: user geometry is the same as disk geometry. Enter 'd' to use the geometry based on what the disk itself thinks it is, or 'u' to use the geometry that was found in the label.[d]isk or [u]ser geometry%llu%.*f%cOpenBSD area: ; size: ; free: # %16.16s %16.16s fstype [fsize bsize cpg] $OpenBSD: ar_io.c,v 1.38 2008/06/11 00:49:08 pvalchev Exp $$OpenBSD: ar_subs.c,v 1.32 2008/05/06 06:54:28 henning Exp $$OpenBSD: buf_subs.c,v 1.21 2005/11/09 19:59:06 otto Exp $$OpenBSD: cache.c,v 1.17 2004/03/16 03:28:34 tedu Exp $$OpenBSD: cpio.c,v 1.18 2008/01/01 16:22:44 tobias Exp $$OpenBSD: file_subs.c,v 1.30 2005/11/09 19:59:06 otto Exp $$OpenBSD: ftree.c,v 1.28 2008/05/06 06:54:28 henning Exp $$OpenBSD: gen_subs.c,v 1.19 2007/04/04 21:55:10 millert Exp $$OpenBSD: getoldopt.c,v 1.8 2003/07/02 21:19:33 deraadt Exp $$OpenBSD: options.c,v 1.70 2008/06/11 00:49:08 pvalchev Exp $$OpenBSD: pat_rep.c,v 1.30 2005/08/05 08:30:10 djm Exp $@(#) Copyright (c) 1992, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: pax.c,v 1.28 2005/08/04 10:02:44 mpf Exp $$OpenBSD: sel_subs.c,v 1.18 2004/04/16 22:50:23 deraadt Exp $$OpenBSD: tables.c,v 1.25 2007/09/02 15:19:08 deraadt Exp $$OpenBSD: tar.c,v 1.41 2006/03/04 20:24:55 otto Exp $$OpenBSD: tty_subs.c,v 1.12 2003/06/02 23:32:09 millert Exp $Cannot write an archive on top of a directory %sFailed stat on %sFailed chdir to %sFailed open to read on %sFailed open to write on %sFailed open to read/write on %s%s: unknown format, %qu bytes skipped. %qu blocks %s: %s vol %d, %lu files, %qu bytes read, %qu bytes written. done. %s: Waiting for tape drive close to complete...ar_drainUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specEnd of archive volume %d reachedFailed read on archive volume %dWARNING: partial archive write. Archive IS FLAWEDWARNING: partial archive write. Archive MAY BE FLAWEDFailed write to archive volume: %dUnable to append, trailer re-write failed. Quitting.Write failed, archive is write protected.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Cannot allow updates to an archive with flaws.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to seek archive backwardsReverse position on previous volume.Unable to obtain current archive byte offsetUnable to backspace tape %d blocks.Tape drive unable to backspace requested amountget_physUnable to backspace tape over %d pad blocksUnable to backspace over tape filemark.Unable to locate tape filemark.Cannot determine archive tape blocksize.Unable to backspace over last tape block.ar_next ATTENTION! %s archive volume change required. %s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot open %s, try again Cannot save archive name.Quitting %s! %s ready for archive tape volume: %d Load the NEXT TAPE on the tape driveReady for archive volume: %d Unable to restore signal maskUnable to set signal maskcould not pipe-dccould not forkcould not exec %sCan't fchdir to starting directoryCannot chdir to %sextractUnable to open %s to readCannot mix current archive format %s with %sappend%s: Reading archive to position at the end...directory name is too long %scopyDestination is not a directory %sDestination pathname too long %sCannot access destination directory %sArchive I/O error. Trying to recover.Archive I/O error, cannot continuePremature end of file on archive readInvalid header, starting valid header search.Unable to append, archive header flawCannot identify format. Searching...Sorry, unable to determine archive format.Write block size of %d too large, maximium is: %dWrite block size of %d larger than POSIX max %d, archive may not be portableWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximium is: %dWrite block size %d is not a %d byte multipleUnable to rewrite archive trailer, cannot append.Cannot append to an archive that may have flaws.Archive read error limit (%d) reachedUnable to append when there are archive read errors.File changed size during read %sFile %s was modified during copy to archiveRead fault on %sActual crc does not match expected crc %sUnable to obtain block size for file %sFile %s changed size during copy to %sFile %s was modified during copy to %sFailed stat of %sFailed write during copy of %s to %sUser specified archive volume byte limit reached.Unable to allocate memory for user id cache tableUnable to allocate memory for group id cache tableUnable to allocate memory for user name cache tableUnable to allocate memory for group name cache tableTRAILER!!!cpio_endwrCpio file name in header is corruptedCpio file name length %d is out of rangeCpio link name is corruptCpio link name read errorCpio link name length is invalid: %qu070707File is too large for cpio format %sCpio header field is too small to store file %scpio_wrUnable to write cpio link name for %sUnable to write cpio header for %s070701070702File is too large for sv4cpio format %sSv4cpio header field is too small for file %svcpio_wrCould not write sv4cpio link name for %sCould not write sv4cpio header for %sFile is too large for bcpio format %sbcpio_wrBcpio header field is too small for file %sCould not write bcpio link name for %sCould not write bcpio header for %sUnable to create %sUnable to close file descriptor on %sA hard link to the directory %s is not allowedUnable to link to %s from %sUnable to copy %s, file would overwrite itselfCould not link to %s from %sUnable to remove %sUnable to link file %s to itselfCould not create: %snode_creatCould not access %s (stat)cannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCould not unlink %sUnable to remove directory %sAccess/modification time set failed on: %sUnable to obtain file stats %sUnable to set file uid/gid of %sCould not set permissions on %sFailed write to file %sOut of memoryFile seek on %sWARNING! Major Internal Error! GNU hack Failing!Failed seek on file %sFile changed size %sset_crcFile %s was modified during readFile rewind failed on: %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:Can't chdir to %sFile system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %snext_fileIgnoring too-long pathname: %sIgnoring unterminated pathname at EOFls_list%b %e %H:%M%b %e %Y%s%2u %-*.*s %-*.*s %4lu,%4lu == -> %9qu %s%s %s ls_tty%s: unknown option %c %s: %c argument missing bcpiosv4cpiosv4crcustarab:cdf:ijklno:p:rs:tuvwx:zB:DE:G:HLOPT:U:XYZ0Write limit is not a %d byte multipleInvalid write limit %sError count value must be positiveInvalid block size %sbzip2Invalid -p string: %cUnknown -x format: %spax: Known -x formats are:Destination directory was not suppliedb:cef:hjmopqruts:vwxzBC:HI:LOPXZ014578/dev/rst0/dev/rst1/dev/rst4/dev/rst5/dev/rst7/dev/rst8Unable to allocate space for option listTAPEProblem with file '%s'Unable to open file '%s' for read-C-Iwrite_opt=nodirabcdfijklmoprstuvzABC:E:F:H:I:LO:SZ6Unknown -H format: %scpio: Known -H formats are:Problem while reading stdin%s: Invalid combination of options: -%cThese format options are not supported %s = %s Invalid option nameInvalid options formatusage: pax [-0cdjnOvz] [-E limit] [-f archive] [-G group] [-s replstr] [-T range] [-U user] [pattern ...] pax -r [-0cDdijknOuvYZz] [-E limit] [-f archive] [-G group] [-o options] [-p string] [-s replstr] [-T range] [-U user] [pattern ...] pax -w [-0adHijLOPtuvXz] [-B bytes] [-b blocksize] [-f archive] [-G group] [-o options] [-s replstr] [-T range] [-U user] [-x format] [file ...] pax -rw [-0DdHikLlnOPtuvXYZ] [-G group] [-p string] [-s replstr] [-T range] [-U user] [file ...] directory usage: tar {crtux}[014578befHhjLmOoPpqsvwXZz] [blocking-factor | archive | replstr] [-C directory] [-I file] [file ...] tar {-crtux} [-014578eHhjLmOoPpqvwXZz] [-b blocking-factor] [-C directory] [-f archive] [-I file] [-s replstr] [file ...] usage: cpio -o [-AaBcjLvZz] [-C bytes] [-F archive] [-H format] [-O archive] < name-list [> archive] cpio -i [-6BbcdfjmrSstuvZz] [-C bytes] [-E file] [-F archive] [-H format] [-I archive] [pattern ...] [< archive] cpio -p [-adLlmuv] destination-directory < name-list Empty replacement stringrep_addInvalid replacement string %sInvalid replacement string option %s%s while compiling regular expression %sUnable to allocate memory for replacement stringEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern list inconsistentPattern select out of memoryRemoving leading / from absolute path names in the archive ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Processing continues, name changed to: %s tty_renameProcessing continues, name unchanged. Skipping file. File name %s/%s, too longrep_name%s >> %s >> %s Replacement name too long %s >> %sReplacement name error %sTMPDIR/tmp/Cannot allocate memory for temp file name.Can't open current working directory.can not gzip while appendingCpu time limit reached, cleaning up.Signal caught, cleaning up.LC_TIMEUnable to set up signal handlerUser selection table out of memoryUnable to find uid for user: %sUnable to allocate memory for user selection tableGroup selection table out of memoryCannot determine gid for group name: %sUnable to allocate memory fo group selection tableEmpty time range stringUpper %s and lower %s time overlapIllegal upper time range %sTime range format is: [[[[[cc]yy]mm]dd]HH]MM[.SS][/[c][m]]Illegal lower time range %sBad option %c with time range %sUnable to allocate memory for time rangeImproperly specified time range: %sCannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %schk_ftimeFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryFailed ftime table readFailed ftime table seekCannot allocate memory for interactive rename tableNo interactive rename table, links may failInteractive rename table out of memoryCannot update rename tableCannot allocate memory for device mapping tableDevice map table out of memoryUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryUnable to allocate memory for directory timesCannot canonicalize %sadd_dirUnable to store mode and times for created directory: %swrite_optnodir%s=%s is only supported when writing.Unknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format optiontar_wrFile name too long for tar %sTar header field is too small for %sFile is too large for tar %sTar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for ustar %sUstar header field is too small for uid %lu, using nobodyUstar header field is too small for gid %lu, using nobodyUstar header field is too small for %sustar_wrnobodyFile is too long for ustar %sLink name too long for ustar %sUstar cannot archive a socket %s/dev/ttyFatal error, cannot open %s%s: @(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: ping.c,v 1.78 2007/02/06 15:25:18 jmc Exp $setresuidDI:LRS:c:dfi:jl:np:qrs:T:t:vw:number of packets to transmit is %s: %sbad interface address: %stos value is %s: %s%s: only root may use interval < 1sbad timing interval: %spreload value is %s: %spacket size is %s: %sttl value is %s: %smaxwait value is %s: %s-f and -i options are incompatiblebind-R option and -D or -T, or -t to unicast destinations are incompatiblesetsockopt IP_MULTICAST_IFgetsockoptCannot set the receive buffer sizePING %s: %d data bytes ping: recvfromPING %s (%s): %d data bytes Could only allocate a receive buffer of %i bytes (default %i)setsockoptsetsockopt IP_MULTICAST_TTLsetsockopt IP_MULTICAST_LOOPping: record routerecord route not valid to multicast destinationsunknown host: %sping: wrote %s %d chars, ret=%d pingerping: sendtopacket too short (%d bytes) from %s unknown option %x LSRR: 0.0.0.0 (truncated route) %s RR: (same route) NOP%d bytes from %s: icmp_seq=%u ttl=%d wrong data byte #%d should be 0x%x but was 0x%x%x (DUP!) time=%d.%03d ms%d bytes from %s: %ld packets transmitted, %ld packets received, %.1f%% packet lossround-trip min/avg/max/std-dev = %d.%03d/%d.%03d/%d.%03d/%d.%03d ms -- somebody's duplicating packets!%ld duplicates, --- %s ping statistics --- Echo ReplyDestination Net UnreachableDest Unreachable, Unknown Code: %d Destination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF setfrag needed and DF set (MTU %d) Source Route FailedNetwork UnknownHost UnknownSource IsolatedDest. Net Administratively ProhibitedDest. Host Administratively ProhibitedDestination Net Unreachable for TOSDesination Host Unreachable for TOSRoute administratively prohibitedHost Precedence ViolationPrecedence CutoffSource QuenchRedirect Network(New addr: %s) Redirect, Unknown Code: %dRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostUnknown ICMP type: %d Echo RequestRouter Discovery Advertisement(%d entries, lifetime %d seconds) Router Discovery SolicitationTime exceeded, Unknown Code: %d Frag reassembly time exceededTime to live exceededParameter problem, required option absent: pointer = 0x%02x Parameter problem: pointer = 0x%02x TimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask Reply (Mask 0x%08x) Vr HL TOS Len ID Flg off TTL Pro cks Src Dst Data %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %s %02x%s (%s)TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xpatterns must be specified as hex digitsusage: ping [-DdfLnqRrv] [-c count] [-I ifaddr] [-i wait] [-l preload] [-p pattern] [-s packetsize] [-T tos] [-t ttl] [-w maxwait] host $OpenBSD: fsutil.c,v 1.16 2007/02/17 15:57:14 grunk Exp $lost+foundwrong type to dirscan %d DIRECTORY CORRUPTEDNAME=%s fileerror%s=%s DIRLINK COUNT %s COUNT %d SHOULD BE %d (ADJUSTED)ADJUSTLINK COUNT INCREASINGUNREFmkentryUNREF %s RECONNECTSORRY. CANNOT CREATE lost+found DIRECTORYlost+found IS NOT A DIRECTORYREALLOCATElinkupSORRY. CANNOT CREATE lost+found DIRECTORY SORRY. NO lost+found DIRECTORY DIR I=%u CONNECTED. PARENT WAS I=%u SORRY. NO SPACE IN lost+found DIRECTORYNO lost+found DIRECTORYCREATE (CREATED) (RECONNECTED)makeentryNO SPACE LEFT IN %s (EXPANDED)EXPANDLARGE FILES UNSUPPORTED ON REVISION 0 FILESYSTEMSSETTING LARGE FILE INDICATOR SET LARGE FILE INDICATORTRYING TO SET FILESIZE TO %llu ON MODE %x FILE ckinodeDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDSiblockPARTIALLY TRUNCATED INODE I=%ublk %d < cgdmin %d; blk + cnt %d > cgsbase %d blk %d >= cgdmin %d; blk + cnt %d > cgdmax %d bad inode number %d to ginode bad inode number %d to nextinode Cannot allocate space for inode buffer cannot increase directory list cannot find inode %d CLEAR (CLEARED) I=%u OWNER=%u MODE=%o SIZE=%llu MTIME=%12.12s %4.4s %d %s I=%uBAD STATE %d TO BLKERR b:dfm:npyAlternate super block location: %d ** lost+found creation mode %o bad mode to -m: %o -%c flag requires a %s checkfilesysCAN'T CHECK FILE SYSTEM.** Phase 1 - Check Blocks and Sizes** Phase 1b - Rescan For More DUPS%d files, %d used, %d free ***** REBOOT NOW ***** ***** PLEASE RERUN FSCK ***** ***** FILE SYSTEM WAS MODIFIED *****The following zero link count inodes remain: %u,The following duplicate blocks remain: %d,%d blocks missing %d files missing ** Phase 5 - Check Cyl groups** Phase 4 - Check Reference Counts** Phase 3 - Check Connectivity** Phase 2 - Check PathnamesINTERNAL ERROR: dups with -p** Root file system** Last Mounted on %s starting usage: %s [-dfnpy] [-b block#] [-m mode] filesystem ... UNKNOWN FILE TYPE I=%ubad size %llu:INCORRECT BLOCK COUNT I=%u (%d should be %d) (CORRECTED)LINK COUNT TABLE OVERFLOWCONTINUEbad indirect addr: %d bad direct addr: %d bad size %llu ndb %d:HOLD BAD BLOCKINODE I=%u HAS DTIME=%12.12s %4.4sPARTIALLY ALLOCATED INODE I=%uDUP TABLE OVERFLOW.EXCESSIVE DUP BLKS I=%u (SKIPPING)EXCESSIVE BAD BLKS I=%uBAD STATE %d FOR ROOT INODE DUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYCANNOT ALLOCATE ROOT INODE ROOT INODE UNALLOCATEDALLOCATEpass2MISSING '..'FIXBAD INODE NUMBER FOR '..'DIRECTORY TOO SHORTDIRECTORY %s: LENGTH %lu NOT MULTIPLE OF %dMISSING '.'I OUT OF RANGEREMOVEpass2checkUNALLOCATEDBAD TYPE VALUEIS AN EXTRANEOUS HARD LINK TO DIRECTORY%s %s %s (IGNORED)DUP/BADZERO LENGTH DIRECTORYEXTRA '.' ENTRYEXTRA '..' ENTRYCANNOT FIX, INSUFFICIENT SPACE TO ADD '..' CANNOT FIX, SECOND ENTRY IN DIRECTORY CONTAINS %s BAD TYPE VALUE FOR '..'CANNOT FIX, INSUFFICIENT SPACE TO ADD '.' CANNOT FIX, FIRST ENTRY IN DIRECTORY CONTAINS %s BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'BAD STATE %d FOR INODE I=%d ZERO LENGTHBAD/DUPsummary info for cg %d is %d, %d, %d,should be %d, %d, %d SUMMARY INFORMATIONS WRONG FOR CG #%dBLK(S) MISSING IN BIT MAPS #%dINODE(S) MISSING IN BIT MAPS #%dsummary info bad in superblock: %d, %d should be %d, %d SUPERBLK SUMMARY INFORMATION BADpass5ino_bitmap:ibmap:blk_bitmap:bbmap:BAD STATE %d FOR INODE I=%ld %u: %2x %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. /r%s is not a character device Can't stat %s Can't stat rootmalloc failedrealloc failedstrdup failed%s is not a character device (NO WRITE)cannot allocate space for superblock setupLOOK FOR ALTERNATE SUPERBLOCKSLOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ext2fs(8).SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO FSCK_FFS TO SPECIFY THE%s %s %s %s %s %s USING ALTERNATE SUPERBLOCK AT %d WRONG FPG=%d (BPG=%d) IN SUPERBLOCKBAD SUMMARY INFORMATIONcannot alloc %u bytes for blockmap cannot alloc %u bytes for statemap cannot alloc %u bytes for lncntp cannot alloc %u bytes for inphead cannot alloc %u bytes for typemap IMPOSSIBLE RESERVED BLOCK COUNT=%d IN SUPERBLOCKSET TO DEFAULT** File system is already clean %sile system is clean; not checking ** Fstate = %d NO WRITE ACCESS** %sCan't open %s: %s Can't stat %s: %s MAGIC NUMBER WRONGBAD LOG_BSIZEINCOMPATIBLE FEATURE BITS IN SUPER BLOCKcompat 0x%08x, incompat 0x%08x, compat_ro 0x%08x VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEsuperblock mismatchesoffset %ld, original %ld, alternate %ld BAD SUPER BLOCK: %s %s: NOT LABELED AS A EXT2 FILE SYSTEM (%s) %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION ioctl (GCINFO): %s %s: can't read disk label PARTIALLY WRITING %sZERO'ED BLOCK %d TO DISK bad file type 0%o %s? yes %s? [Fyn?] %s? no INTERNAL ERROR: GOT TO reply()cannot allocate buffer pool deadlocked buffer pool CANNOT %s: BLK %dProgram terminated MARKING FILE SYSTEM CLEAN cache missed %ld of %ld (%d%%) MARK FILE SYSTEM CLEANUPDATE STANDARD SUPERBLOCKSPanic: lost %d buffers READTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %ld (%ld), %ld,SEEKWRITETHE FOLLOWING SECTORS COULD NOT BE WRITTEN:returning to single-user after filesystem check catchquitSALVAGE (SALVAGED)UNKNOWN INODESC FIX MODE %d benstuvusage: %s [-benstuv] [file ...] %6d q̤qXqXqqqqqpppp xvw`o$u,u0P|8P|@(}H(}P}X}` d l8t(܀(@@ohp rrrr r(r0s8 m@qHqP qXq`@qhqpxl~`غoo p pndq$i i@L#"8i ixl#%T`hpx  ``### #$$ $($,%4%<%D%H&P&\'d'p(x())**++,,,---../ /0 0,040@1H1T2\2h2p3|3344455666ccdd e e $(04<DLT\dlt|<  $,4<HT  \ d`l`x|  ` trailers-trailersarp-arpdebug-debug-aliasdeletegroup-groupnetmaskmetricmtunwid-nwidbssid-bssidnwkey-nwkeywpa-wpawpaakmswpacipherswpagroupcipherwpaprotoswpapsk-wpapskchan-chanpowersave-powersavebroadcastipdstpriorityanycast-anycasttentative-tentativepltimevltimeeui64destroylink0-link0link1-link1link2-link2mediamediaopt-mediaoptinstanceinstlladdrdescriptiondescr-description-descrinetinet6interface name '%s' too long%s: bad value'%s' requires argument'%s' requires 2 argumentsSIOCDIFADDRSIOCAIFADDRprintgroupSIOCGIFGMEMBSIOCGIFGATTR carp demote count %dprintgroupattribsinvalid carp demotion: %scarpdemoteSIOCSIFGATTRsetgroupattribsstrdupgetifaddrs%s: no such interface SIOCIFCREATESIOCIFDESTROYSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesSIOCSIFDESCRNote: trailers are no longer sent, but always receivedSIOCGIFFLAGSSIOCSIFFLAGSsetifflagsinvalid %s %s: %s%s not allowed for the AFinterface index is already filledcould not determine link local addressmetric %s: %sSIOCSIFMETRICmtu %s: %sSIOCSIFMTUsetifgroup: group names may not end in a digitsetifgroup: group name too long SIOCAIFGROUPsetifgroupunsetifgroup: group names may not end in a digitunsetifgroup: group name too longSIOCDIFGROUPunsetifgroupbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"0xSIOCS80211NWIDsetifnwidmalformed BSSID: %sSIOCS80211BSSIDsetifbssidpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEYsetifnwkeySIOCG80211WPAPARMSSIOCS80211WPAPARMSsetifwpawpa1wpa2wpaprotos: unknown protocol: %ssetifwpaprotos802.1xwpaakms: unknown akm: %ssetifwpaakmsusegroupwep40tkipccmpwep104wpaciphers: unknown cipher: %ssetifwpacipherswpagroupcipher: unknown cipher: %ssetifwpagroupcipherwpapsk: invalid pre-shared keywpapsk: bad pre-shared key lengthSIOCS80211WPAPSKsetifwpapskinvalid channel: %sSIOCS80211CHANNELsetifchanSIOCG80211POWERpowersave %s: %sSIOCS80211POWERsetifpowersave ieee80211: nwid chan %u bssid %s %udB %u%% nwkey %d: wpapsk wpaprotos %swpa2 wpaakms %s802.1x wpaciphers wpagroupcipher powersave on (%dms sleep) (auto) %ddBm%sHIDENWIDNOBRIDGEieee80211_statusSIOCG80211ALLCHANS %4s %-8s %s freqproperties %4d %4d MHz passive scanieee80211_listchans no permission to scanSIOCG80211ALLNODES none restoreieee80211_listnodesnwid chan %u bssid %s lladdr %s %udB %u%% powersave %uMESSIBSSCF_POLLABLECF_POLLREQPRIVACYSHORT_PREAMBLEPBCCCHNL_AGILITY SPECTRUM_MGMT QOS SHORT_SLOTTIME APSDDSSSOFDMDELAYED_B_ACKIMMEDIATE_B_ACKCACHEBSSAUTHASSOCCOLLECTSIOCGIFMEDIA%s: no link type?init_current_mediaonly one `media' command may be issuedmay not issue `media' after `mode' commandsmay not issue `media' after `mediaopt' commandsonly one `mode' command may be issuedinvalid media mode: %sonly one `mediaopt' command may be issuedmay not issue `mediaopt' after `instance'only one `-mediaopt' command may be issuedmay not issue both `media' and `-mediaopt'only one `instance' command may be issuedmust specify `media' before `instance'media instance %s: %sEthernetetherFDDIIEEE802.11TDMCARPautoselectmanual10baseT10baseT/UTP10UTP10base210base2/BNC10BNC10base510base5/AUI10AUI100baseTX100TX100baseFX100FX100baseT4100T4100baseVG100VG100baseT2100T21000baseSX1000SX10baseSTPSTP10STP10baseFLFL10FL1000baseLX1000LX1000baseCX1000CX1000baseT1000T1000baseTX1000TXHomePNA1HPNA110GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10GbaseCX410GCX410GBASE-CX42500baseSX2500SX10GbaseT10GT10GBASE-TSingle-modeSMFMulti-modeMMFCDDIFH1FH2DS2DS5DS11DS1DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72t1t1-amie1-g.704e1-amie1-ami-g.704t3t3-m13e3e3-g.751e3-g.832e1-g.704-crc411a11b11gfhmasterfull-duplexfdxhalf-duplexhdxflag0flag1flag2loopbackhw-loopbacklooprxpausetxpausedual-attachdasadhochostapibssibss-mastermonitorturbohdlc-crc16pppframerelay-ansiframerelay-ciscoframerelay-ituunknown %s media subtype: %sunknown %s media mode: %sunknown %s media option: %smedia mode %smediaopt instance %d physical address inet%s %s --> %s phys_statusno carrieractiveno ringinsertedno networkbackupUPBROADCASTDEBUGLOOPBACKPOINTOPOINTNOTRAILERSRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST metric %lu mtu %lu lladdr %s description: %s %s: no media types? media: status: supported media: inet %sSIOCGIFNETMASKSIOCGIFDSTADDR --> %s netmask 0x%xSIOCGIFBRDADDR broadcast %sin_status inet6 %sSIOCGIFDSTADDR_IN6 -> %sSIOCGIFNETMASK_IN6 prefixlen %dSIOCGIFAFLAG_IN6 anycast tentative duplicated detached deprecated autoconf scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime in6_alias%i%i: bad prefixlenin_getaddrprefix %s: %s%s=%o%s=%xin6_getaddrusage: ifconfig [-AaC] [interface] [address_family] [address [dest_address]] [parameters] getifgroupsSIOCGIFGROUP groups:malformed link-level addressSIOCSIFLLADDR1ACFLRSTacdfghiklmnopqrstuxCOLUMNS%s: %s: %s: directory causes a cyclefts_readdisplay%*s%*qd printlong%3d, %3d %-*s %*qd %*u total %lu %s %*u %-*s printlink ls: %s: %s %*s usage: %s [-1AaCcdFfghikLlmnopqRrSsTtux] [file ...] mainifconfigmake_packetrtsol_check_timerrtsol_timer_updatesockopensendpacketrtsol_inputinterface_upinterface_statuslladdropt_fill)get_llflagprobe_initdefrouter_probesendprobeadDfFm1O:failed to open a socketfailed to initialize interfacesselect: %sfailed to setup for probing routersfailed to initialize %skernel is configured as a router, not a hostkernel is configured not to accept RAsadDFO:memory allocation failedinterface %s was already configuredfailed to get link layer information for %slink-layer address option has null length on %s. Treat as not included.memory allocation failed for %sNew timer is %ld:%08ldthere is no timer%s status is changed from %d to %dNo answer after sending %d RSstimer expiration on %s, state = %dset timer for %s to %d:%dstop timer for %sillegal interface state(%d) on %susage: rtsold [-1DdFfm] [-O script-name] interface ... rtsold [-1DdFfm] -a usage: rtsol [-DdF] [-O script-name] interface ... rtsol [-DdF] -a <%s> %swarnmsgprobing %sreallocmultiple interfaces foundff02::2inet_pton failed for %ssetsockopt(ICMP6_FILTER): %sIPV6_RECVHOPLIMIT: %sIPV6_RECVPKTINFO: %ssocket: %smalloc for send msghdr failedmalloc for receive msghdr failedsend RS on %s, whose state is %dsendmsg on %s: %s@ . ..FMAKEDEVGconsoleH ttyI memJkmem}yKnull}yLzero}yMstdinyNstdoutOstderrPksymsyQklog}yRbpf0}ySwd0a}yTrwd0ayUwd0b}yVrwd0byWwd0c}yXrwd0cyYwd0d}yZrwd0dy[wd0e}y\rwd0ey]wd0f}y^rwd0fy_wd0g}y`rwd0gyawd0h}ybrwd0hycwd0i}ydrwd0iyA ...B . ..C binDmdecJsbinJshareJC .B .. ftpgrep]yfgrepyegrepygzip]ygunzipgzcatyless]ymore]y sedP disknames9D .B..E ...@ . ..FMAKEDEVGconsoleH ttyI memJkmem}yKnull}yLzero}yMstdinyNstdoutOstderrPksymsyQklog}yRbpf0}ySwd0a}yTrwd0ayUwd0b}yVrwd0byWwd0c}yXrwd0cyYwd0d}yZrwd0dy[wd0e}y\rwd0ey]wd0f}y^rwd0fy_wd0g}y`rwd0gyawd0h}ybrwd0hycwd0i}ydrwd0iyewd0j}yfrwd0jygwd0k}yhrwd0kyiwd0l}yjrwd0lykwd0m}ylrwd0mymwd0n}ynrwd0nyowd0o}yprwd0oyqwd0p}yrrwd0pyswd1a}ytrwd1ayuwd1b}yvrwd1bywwd1c}yxrwd1cyywd1d}yzrwd1dy{wd1e}y|rwd1ey}wd1f}y~rwd1fywd1g}yƀrwd1gyƁwd1h}yƂrwd1hyƃwd1i}yƄrwd1iysendpacketfailed to get receiving interfacertsol_inputinvalid icmp type(%d) from %s on %sinvalid RA with hop limit(%d) from %s on %sinvalid RA with non link-local source from %s on %sreceived RA from %s on %s, state is %dreceived RA from %s on an unexpected IF(%s)invalid icmp code(%d) from %s on %spacket size(%zd) is too shortfailed to get receiving hop limitrecvmsg: %schecking if %s is ready...interface_up%s is duplicated%s is tentative%s is readyget_llflag() failed, anyway I'll tryioctl(SIOCSIFFLAGS): %sioctl(SIOCGIFFLAGS): %sinterface_statusioctl(SIOCGIFMEDIA) on %s: %sioctl(SIOCGIFFLAGS) on %s: %sunsupported link type(%d)get_llflagioctl(SIOCGIFAFLAG_IN6): %sgetifaddrs: %ssocket(SOCK_DGRAM): %sshutdown: %slo0defrouter_probedefault router list contains a non-link-local address(%s)ioctl(SIOCGDRLST_IN6): %sprobe a router %s on %ssendprobeTTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftinvalid namelen:%d/%luno nameunknown qtyperefused???unknown, type 0x%xrefused, type 0x%x%d bytes from %s, icmp_seq=%u hlim=%d(DUP!) time=%g ms dst=%sfailed to get receiving packet informationa:b:c:dfHg:h:I:i:l:mnNp:qRS:s:tvwW-R is not supported in this configurationinvalid source address: %sinvalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit -- %sillegal hoplimit %stoo small interval, raised to 0.01illegal timing interval %sillegal preload value -- %sMust be superuser to preloaddatalen value too large, maximum is %dillegal datalen value -- %sgetaddrinfo failedsetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetsetsockopt(IPV6_USE_MIN_MTU)setsockopt(ICMP6_FILTER)%s: invalid interface namesetsockopt(SO_SNDBUF)PING6(%lu=40+8+%lu bytes) %s --> new path MTU (%d) is notified recvmsgpollsetsockopt(IPV6_RECVHOPLIMIT)setsockopt(IPV6_RECVPKTINFO)setsockopt(SO_RCVBUF)you need -b to increase socket buffer sizeUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP setsockopt(IPV6_RTHDR)UDP connectgetsocknamecan't initialize rthdrbad addr family of an intermediate addrcan't add an intermediate nodecan't allocate enough memorysetsockopt(IPV6_RECVRTHDR)setsockopt(IPV6_RECVPATHMTU)IPV6_MULTICAST_HOPSgateway resolves to multiple addressestoo many intermediate hopsgetaddrinfo for the gateway %s: %sping6: wrote %s %d chars, ret=%d sendmsg\%03odnsdecodeinvalid peernamepr_packunknown code 0x%x, type 0x%xNodeInfo NOOP HbH Options: Dst Options: Routing: nxt %u, len %u (%lu bytes) Received Opt %u len %lu Jumbo Payload Opt: Length %u Router Alert Opt: Type %u nxt %u, len %u (%d bytes), type %u, %d segments, %d left pr_rthdr [%d] [%d]%s segments unknown, -%uNodeInfo Supported Qtypes, compressed bitmap, raw bitmap %s(TTL=%u)pr_nodeaddr(TTL=infty) no address truncatedpath MTU for %s is notified. (ignored) --- %s ping6 statistics --- round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms %.1lf%% packet loss+%ld duplicates, IPv6 addressDNS labelIPv4 addressSuccessRefusedNo Route to Destinationpr_icmphDestination Unreachable, Bad Code: %d Destination Administratively UnreachableDestination Unreachable Beyond ScopePacket too big mtu = %d Time exceeded, Bad Code: %d Parameter problem: Bad code(%d) pointer = 0x%02x Erroneous Header Unrecognized Option Unknown Nextheader Listener QueryListener ReportListener DoneRouter SolicitationRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sBad ICMP type: %dNode Information QueryNOOP, invalid, oldfqdn, subject=%s(%s), no subject, subject=%s(invalid)Supported qtypesDNS namenodeaddrIPv4 nodeaddrNode Information Reply, %sVr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->pr_iphHBH RTHDR FRAG ESPAH ICMP6: type = %d, code = %d Unknown Header(%d) DSTOPT IP6ff02::2:0000:0000nigroupusage: ping6 [-dfHmNnqtvWw] [-a addrtype] [-b bufsiz] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [hops ...] host ioctl SMODEmmapWSMOUSEIO_SCALIBCOORDS/dev/ttyC0open /dev/ttyC0/dev/wsmousemouse.scale=%d,%d,%d,%d,%d,%d,%d WSMOUSEIO_GCALIBCOORDSopen /dev/wsmouseusage: %s ?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for dataLESSSECURELESS-E-G-L-mMORE--WARNING: terminal is not fully functionalCannot allocate memoryticdcmsomdmbvbbc|^srget_termraw_modeLESS_TERMCAP_ltget_envLINESlicokrklkukdkPkNkh@7kDTERMhcxndadbsgpcNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketseek errorread errorch_ungetchar overrunseek error to 0ESC^%c*s<%X>Non-match First-file EOF-ignore Keep-pos Regex-off (P)+ [Press space to continue, 'q' to quit.]less %sungetcc overflowPattern not found help(N-th) No %snext fileNo %sprevious fileNo such filemark: goto mark: Command not availableBrackets: [Press 'h' for instructions.]Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableeditchar"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)LESSMETAESCAPE\LESSMETACHARS; *? '"()<>|&^`#\%c%s%c%s%s%sHOMEbin_file%s %s %sLESSOPENLESSCLOSE...skipping... Cannot find help fileCannot seek to end of fileCannot seek to beginning of fileCannot seek to line number %nDetermining length of fileDon't know length of fileCannot seek to that file positionLESSANSIENDCHARSplinenum~ Calculating line numbers (press RETURN)Invalid mark letterMark not setMark not in current fileLine number is required after -lless Copyright (C) 2002 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less Tab stops and then every %d spacesopt_x-" must be followed by 1 or 2 charsquotes %sUse "h" for helpThere is no %s option ("less --help" for help)There is no %s optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric option-%sValue is required after %sNumber is required after %sfakeSearch includes displayed screenSearch skips displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by clearing each lineRepaint by painting from top of screenAssume intelligent terminalAssume dumb terminalDon't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backward 08`YI<  YI:`[~ [~YI`@@<@TU #YIqppb#YIqqA YIĴ#YI .~#YI .~p <+)*AYIAYIAYIA H4AYI YI?tYI04 AYIp9"YI~+"YI~+ /uAYIp9YIp9YI- s8AYI2e YI2e YI2e +r#YI,"YIOu"YIOu` h #?!#YI_t\#YI_t\#YI_t\!#YI_t\#YI_t\#YI_t\I>:!#YI_t\#YI_t\#YI/";c!#YI_t\#YI_t\#YI`#Sի!#YI_t\#YI_t\#YI_t\l!#YI_t\#YI_t\#YI_t\ N!#YI_t\#YI_t\#YI_t\x۱!#YI_t\#YI_t\#YI_t\D>!#YI_t\#YI_t\#YI_t\!#YI0#YI0#YIt#!#YI0#YI0#YI0!#YI0#YI0#YI0oa#YI0#YI0#YI+!#YI0#YI0#YI+va#YI0#YI0#YI+c-!#YI0#YI0#YI+a#YI0#YI0#YI++!#YI0#YI0#YI+]Gla#YI0#YI0#YI+V!#YI7v#YI7v#YI+a#YI7v#YI7v#YI+]!#YI7v#YI7v#YI+Za#YI7v#YI7v#YI+>0!#YI7v#YI7v#YI+56a#YI7v#YI7v#YI+ٹc!#YI4W #YI4W #YI+L{Sa#YI4W #YI4W #YI+E]!#YI4W #YI4W #YI+Эz a#YI4W #YI4W #YI+Ʈ!#YI4W #YI4W #YI+DIa#YI4W #YI4W #YI+ !#YI4W #YI4W #YI+ &Ba#YI4W #YI4W #YI<+ ֮!#YI4W #YI4W #YI<+ F;a#YI #YI #YI<+ $G}!#YI #YI #YI<+ a#YI #YI #YI<+ eu!#YI #YI #YI<+ Na#YI #YI #YI<+ oA!#YI #YI #YI<+ Ra#YI #YI #YI<+!#YI #YI #YI<+oa#YI #YI #YI<+ə'!#YI #YI #YI<+9a#YI #YI #YI<+!#YI$ #YI$ #YI<+g=a#YI$ #YI$ #YI<+b!#YI$ #YI$ #YI<+^a#YI$ #YI$ #YI<+qf3!#YI$ #YI$ #YI<+U[a#YI$ #YI$ #YI<+!#YI$ #YI$ #YI<+#a#YI$ #YI$ #YI<+O!#YI$ #YI$ #YI<+-xa#YI$ #YI$ #YI<+]^~%!#YI #YI #YI<+w{a#YI #YI #YI<+ p!#YI #YI #YI<+<2~a#YI #YI #YI<+:Hm!#YI #YI #YI<+ٟ֡a#YI #YI #YI<+!#YI #YI #YI<+^&xa#YIlR #YIlR #YI<+C!#YIlR #YIlR #YI<+\Ƒa#YIlR #YIlR #YI<+ !#YI( #YI( #YI<+l_a#YI( #YI( #YI<+,?!#YI( #YI( #YI<+,a#YI( #YI( #YI<+]!!#YI( #YI( #YI<+qx/a#YI( #YI( #YI<+a!#YI( #YI( #YI<+)a#YI( #YI( #YI<++!#YI( #YI( #YI<+-a#YI( #YI( #YI<+ !#YI #YI #YI<+7a#YI #YI #YI<+02!#YI #YI #YI<+nZgra#YI #YI #YI<+)s!#YI #YI #YI<+SQa#YI #YI #YI<+e2!#YI #YI #YI<+a#YI #YI #YI<+t20!#YI #YI #YI<+]`,a#YI #YI #YI<+%2!#YI #YI #YI<+Za#YI]*#YI]*#YI<+3 !#YI]*#YI]*#YI<+xa#YI]*#YI]*#YI<+LJ!#YI]*#YI]*#YI<+5a#YI]*#YI]*#YI<+s!#YI]*#YI]*#YI<+Q"a#YI]*#YI]*#YI<+[!#YI]*#YI]*#YI<+-Jla#YI]*#YI]*#YI<+ B%!#YIo#YIo#YI<+ d˿na#YIo#YIo#YI<+ 7l?!#YIo#YIo#YI<+ 䄹a#YIo#YIo#YI<+ =7y!#YIo#YIo#YI<+ ia#YIo#YIo#YI<+ 024!#YIo#YIo#YI<+ Xa#YIo#YIo#YI<+ >!#YIo#YIo#YI<+  ya#YIo#YIo#YI<+!#YI5,M#YI5,M#YI<+rga#YI5,M#YI5,M#YI<+Y !#YI5,M#YI5,M#YI<+I!#YI5,M#YI5,M#YI#Z& Hs?Bu!#YI5,M#YI5,M#YI0N' ++ Bua#YI5,M#YI5,M#YI<+6!#YI5,M#YI5,M#YI<+*/tra#YI5,M#YI5,M#YI<+_~!#YI5,M#YI5,M#YI<+H!#YI5,M#YI5,M#YI5,M?78u!#YI5,M#YI5,M#YI5,M?Xa#YI#YI#YI<+:!#YI#YI#YI<+&a#YI#YI#YI<+!#YI#YI#YI<+Zca#YI#YI#YI<+H!#YI#YI#YI<+X.`a#YI .~#YI .~#YI<+BUO!#YI .~#YI .~#YI<+u!#YI .~#YI .~#YI .~<"!#YI .~#YI .~#YI .~=O!#YI .~#YI .~#YI .~"?Dm!#YI#YI#YI"!#YI#YI#YI41U*2q8/ Dt\۸N{24m2>#У]~ sZh/rzME;>gs|90y=p#n4Us scroll limit is %d linesAllow help commandDon't allow help commandCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: Position target at screen line %dDon't display a status columnDisplay a status columnDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numbersprompt: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directlyDisplay control characters directly, processing ANSI sequencesDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linesDisplay underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: Horizontal shift %d positionsUse keypad modeDon't use keypad modeBe less helpful in promptsBe helpful in promptspostoalinenumtoainttoaiprint_intiprint_linenumap_posap_linenumap_intNo previous regular expressionInvalid patternPlease re-enter search patternNothing to searchLine numbers turned offDP|\`ht|L (8 8! 8 "@(808!!X <8@D8h"t"""bgdumbtimernfsv3mntudpresvportnfsv2ac23a:bcdD:g:I:iL:lo:PR:r:sTt:w:x:U-2 and -3 are mutually exclusiveillegal -I value %s: %sillegal -R value %s: %sillegal -a value %s: %sillegal -g value %s: %sconflicting version optionsillegal -r value %s: %sillegal -t value %s: %sillegal -w value %s: %sillegal -x value %s: %sNFS Portmapcan't access %s: %sbad MNT RPCCannot MNT PRCcan't resolve address for host %sno : or @ spechostname too longusage: %s [-23bcdilsTU] [-a maxreadahead] [-g maxgroups] [-I readdirsize] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-w writesize] [-x retrans] rhost:path node unused DOS FAT-12 XENIX / XENIX /usr DOS FAT-16 Extended DOSDOS > 32MB HPFS/QNX/AUXAIX fs AIX/Coherent OS/2 Bootmgr Win95 FAT-32 Win95 FAT32LDOS FAT-16 Extended LBAOPUS OS/2 hidden Compaq Diag.OS/2 hidden OS/2 hidden OS/2 hidden AST swap Willowtech ThinkPad Rec Willowsoft $NEC DOS 8Theos 9Plan 9 @VENIX 286 ALin/Minux DRBLinuxSwap DRCLinux DR MQNX 4.2 Pri NQNX 4.2 Sec OQNX 4.2 Ter PDM QDM RCP/M or SysVSDM TOntrack UEZ-Drive VGolden Bow \Priam aSpeedStor cISC, HURD, *dNetWare 2.xxeNetWare 3.xxfNetWare 386 gNovell hNovell iNovell pDiskSecure uPCIX Minix (old) Minix (new) Linux swap Linux files*OS/2 hidden Linux ext. NT FAT VS NTFS VS Linux LVM Amoeba FS Amoeba BBT Mylex BSDI NotebookSaveFreeBSD OpenBSD NEXTSTEP MacOS X NetBSD MacOS X bootMacOS X HFS+BSDI filesy*BSDI swap Solaris CTOS DRDOSs FAT12DRDOSs < 32MDRDOSs >=32MHPFS DisbledCPM/C.DOS/C*Dell Maint SpeedStor SpeedStor SpeedStor BeOS/i386 EFI GPT EFI Sys SpeedStor DOS 3.3+ SecSpeedStor Xenix BBT ZYo9~-W .pƘg d]XeGC6G"Ͼoz4;J_.T"ne*W*?qg λ.o~F^==qȼ(KE"PL%6yerpp}>z(Oaʭ#̽܋^4ҹ=55yLKX kbef:{ ]2l젾 3a:8 ]}P=ϩ(JDD4r!`*(\RHȲB.b%2E'*)u!,-Z6M Px6 ;;JWb$tg`*R e@Z+Mdk(3{8^a=+Qdb.'a*p0I4{I@ӃB|q&Cb"xD%YgG'V"yjcVQ 9r,xl0BY>fbZ Hv}Ywi(L; Ъ d4h"x*+ɩ:FlND7<{Wsܻܻ{ׂ0z= (hoCBh^wH! R+b!yKdw,*pLI, %)P49W'wHHP"p3 !oxkMȣOP)hs1 4X$zS8، zi{çסfYM!\BH %qEFȔQ6FZ~>Fm`*%l*B\4^@Q*]OhH;Z*RAjݨt6(D5u'}woULq{4lѐ kRB}w-mXM5d\%Q,sԘW'z@Oz'P!^!`Z=ؙ.-T(YTq۵.1TZ8:/a Mx|U!p|]W9rc7F۶~ ގ-$YLkZ4UwEOV48xjRhjE(Q1D}$Eޯd6;zk3Ǝ܌wVZZ|T9!W6L X2#^Bߎ\-']r!l0&Cu:G#CϬ-wݞ=>?O.Ɩم[Ӆ¿X,NZO_<6 Ó䃴 F_ԟl&[c&yN^hI|:UC:ߦws28EBWSI4`6ކ8Njl4u>'o}p:I{Oy%y ƣZx!|Ր}l;ߦ~?=u `%8c7jzx!p`RG}g#Hf<δF uےL ӆ|8Q.ڲ-b?768,"lYjof"t՞K3_]"8+͟Yg|mɚ_eo-,SZdf YϬV ӛ+[Kλy5gud(ރGNEYjg5O\:&#e`%X_mQ!ѱiKwWs;JUdG9ǖmtPlM!lmjamkQV` ':)qtŧvDrb+x. L.>飫i9VY̴vQZMr͝QݙwuqujG)q3}#Twsr쿉e*V}jg7tU3'ZW_tm{m= ;j^ENFzJmZwX5D -o/ΚTvBeIURYw4 J킯`N&ܢ0E|-Wo^Q7#-(ڜH-(~A*c:ţDf;A~\a19{ VmknFO\.I\;& ]G5d.,FBF-]^7@T_XеBrD@hW8 ĂKxnK)k\8}d3]v=X"{b3gt/M/usage: %s [-eiuy] [-c cylinders -h heads -s sectors] [-f mbrfile] device -i: initialize disk with virgin MBR -u: update MBR code, preserve partition table -e: edit MBRs on disk interactively -f: specify non-standard MBR template -chs: specify disk geometry -y: do not ask questions `disk' may be of the forms: sd0 or /dev/rsd0c. ieuf:c:h:s:yCylinder argument %s [1..262144].Head argument %s [1..256].Sector argument %s [1..63].using builtin MBRCan't get disk geometry, please use [-chs] to specify.Please specify a full geometry with [-chs].error initializing MBRCommand help listShow entire OpenBSD man page for fdiskreinitRe-initialize loaded MBR (to defaults)setpidSet the identifier of a given table entryEdit current drive statsEdit given table entryflagFlag given table entry as bootableUpdate machine code in loaded MBRSelect extended partition table entry MBRSwap two partition entriesPrint loaded MBR partition tablewriteWrite loaded MBR to diskexitExit edit of current MBR, without saving changesQuit edit of current MBR, saving current changesabortAbort program without saving current changesDo you wish to write new MBR?Do you wish to write new MBR and partition table?Enter 'help' for informationfdisk:%c%d> USER_modifyAborting changes to current MBR.Invalid command '%s'. Try 'help'. Offset: %d USER_print_diskBytesSectorsKilobytesMegabytesGigabytesask_cmd%s [%X - %X]: [%X] %s [%d - %d]: [%d] (? for help) ask_num'%d' is out of range. '%s' is not a valid number. %s [n] %s: [%u] Rounding to nearest cylinder: %u %s is not a character device or a regular fileDISK_getlabelmetricsDIOCGDINFODisk: %s geometry: %d/%d/%d [%.0f %d-byte %s] geometry: Signature: 0x%X MBR_pcopyChoose from the following Partition id values:%02X %s %02X %s %02X %s %02X %s Warning CHS values out of bounds only saving LBA values Starting Ending LBA Info:%c%1d: %.2X %6u %3u %3u - %6u %3u %3u [%12u:%12.0f%s] %s #: id C H S - C H S [ start: size ]-------------------------------------------------------------------------------Start of partition #%d after end!In memory copy is initialized to:Use 'write' to update disk.XreinitChange disk geometry?BIOS CylindersBIOS HeadsBIOS SectorsInvalid argument: %s Invalid partition number %d. Swap with what partition?%d same partition as %d, doing nothing. Invalid argument: %s Invalid partition number.Partition id ('0' to disable) Partition %d is disabled. Do you wish to edit in CHS mode?Size of the partition.BIOS Starting cylinderBIOS Starting headBIOS Starting sectorBIOS Ending cylinderBIOS Ending headBIOS Ending sectorLoop to offset 0! Not selected.Selected extended partition %d New MBR at offset %d. Partition %d is not an extended partition. Writing MBR at offset %d. Xwriteerror writing MBR %s %s Machine code updated.Partition %d flag value set to 0x%x. Partition %d marked active. Invalid argument: %s [value] (standard input)(fd %d)invalid file type^\((%s[[:<:]]%s%.*s%s[[:>:]]%susage: %s [-abcEFGHhIiLlnoPqRSsUVvwx] [-A num] [-B num] [-C[num]] [-e pattern] [-f file] [--binary-files=value] [--context[=num]] [--line-buffered] [pattern] [file ...] 0123456789A:B:CEFGHILPSRUVabce:f:hilnoqrsuvwxybinary-filesline-bufferedafter-contextbefore-contextextended-regexpfixed-stringsbasic-regexpbinarytextbyte-offsetregexpno-filenameignore-casefiles-without-matchfiles-with-matchesline-numberquietsilentrecursiveno-messagesrevert-matchword-regexpline-regexpunix-byte-offsetscontext out of rangegrep version %u.%u without-matchUnknown binary-files optionBinary file %s matches [[:<:]][[:>:]]afh:t:v%s: not a directory or special deviceumountfsBad MNT RPC%s: unmount from %s %s: not currently mountedusage: %s %s umount [-fv] special | nodeumount -a [-fv] [-h host] [-t type]DP|\`ht|sl9xu:g:m:o:not an MSDOS filesystemstat %sunknown group id: %sunknown user id: %sinvalid file mode: %susage: mount_msdos [-9lsx] [-g gid] [-m mask] [-o options] [-u uid] special node $OpenBSD: fsck.c,v 1.26 2007/10/20 18:11:17 sobrado Exp $$OpenBSD: fsutil.c,v 1.16 2007/02/17 15:57:14 grunk Exp $$OpenBSD: preen.c,v 1.16 2005/10/28 07:30:35 otto Exp $start %s %swait %scheckfs%s/fsck_%sexec %sCan't get resource limit for data sizeCan't get resource limit to max data sizedvpfnyb:l:T:t:-b %s%s: unknown special file or file system.fsck_%snoInvalid option stringusage: %s [-dfnpvy] [-b block#] [-l maxparallel] [-T fstype:fsoptions] [-t fstype] [special | node ...] UNEXPECTED INCONSISTENCY:THE FOLLOWING FILE SYSTEM%s HAD AN %s %s: %s (%s)%sCan't open checklist file: %s/etc/fstabBAD DISK NAME %s pass %d, name %s Unknown pid %ld%s: %s (%s): EXITED WITH SIGNAL %d done %s: %s (%s) = %x disk %s: %s in fstab more than once!mkfifom:invalid file mode.non-numeric major number.non-numeric minor number.major or minor number too largenode must be type 'b' or 'c'.usage: %s [-m mode] fifo_name ... usage: %s [-m mode] name [b | c] major minor %s [-m mode] name p  ` UGHRBD M@dmCXLS1@2 3cJP0123456789abcdefassuming route to if old usage of trailing 0entry in usenot in tablerouting table overflow: gateway %s (%s)netmask missingold usage of trailing digit, assuming route via gateway-in requires -mpls-mplslabel requires -inet or -inet6-pop requires -mpls-push requires -mpls-swap requires -mplspriority is %s: %sblackholechangecloningdstencapexpiregatewaygenmaskhopcountifaifpjumbollinfolockrestmpathmplslabelnetnojumbonostaticpopproto1proto2pushrecvpiperejectrttrttvarsasendpipeshowssthreshstaticxresolvebotched keyword: %susage: %s [-dnqtv] [-T tableid] command [[modifiers] args] commands: add, change, delete, flush, get, monitor, show dnqtT:v/dev/nullroute-sysctl-estimate%-20.20s donewrite to routing socketgot only %d for rlen Examining routing table from sysctl(address family %s) actual retrieval of routing tablemust be root to alter routing tableking bula sez: set_metric with invalid keyinet6_makenetandmask128%s: resolved to multiple values%s: bad address%s: not a network%d: bad address familympls labels require -in or -out switchinternal errorbad label: %s is %sprefixlen is not supported with af %dactual retrieval of interface tablegot message of size %d on %sread from routing socketwriting to routing socketso_srcso_labelso_ifaso_ifpso_genmaskso_maskso_gateso_dstRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics or flagsRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_RESOLVE: Route created by cloningRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_IFINFO: iface status changeRTM_IFANNOUNCE: iface arrival/departurerouting message version %d not understoodprint_rtmsg%s: len %d, if# %d, link: %s, flags:name: %s, priority %d, table %u, pid: %ld, seq %d, errno %d flags:metric %d, flags:if# %d, name %s, what: departurearrivalconnectedospfis-isbgp route to: %s destination: %s mask: %s interface: %.*s if address: %s priority: %u (%s) flags: label: %s use mtu expire%8llu %8u%c %8d%c sockaddrs: gateway: %s RTM_GET: %s (errno %d)message length mismatch, in packet %d, returned %d locks: inits: sockaddrs: sodump%s: inet %s; %s: inet6 %s; %s: link %s; label too longinvalid table id: %ssysctl of routing tableRouting tables Encap:sysctl of spdspd-sysctl-estimateGatewayFlagsRefsUseMtuPrioIface%-*.*s %-*.*s %-6.6s %5.5s %8.8s %5.5s %4.4s %s InterfaceIn labelOut labelOp%-16s %-10s %-6s %-18s %-6.6s %5.5s %8.8s %5.5s %4.4s %s PortProtoSA(Address/Proto/Type/Direction)Source%-18s %-5s %-18s %-5s %-5s %-22s p_rtentry%-6.6s %5u %8llu %5u %5s %2d %.16sInternet Protocol Family %d: AppleTalkInternet6EncapMPLS%-*s %-5u %-*.*s %-5u %-6u/esp/use/in/out///acquire/require/bypass/deny/dontacq/ah/ipip/ipcomp%-*.*s p_flagsroutename(%d) %s%u.%u.%u/%d%u.%u.%u.%u/%d%u.%u/%d%u/%d%s/%dnetname6illegal prefixlenaf %d: %slink#%dPUSHPOPSWAP%-16s %-10slabel_print@(#) Copyright (c) 1985, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. KMGTP | Using %s mode to transfer files. %s: unknown mode. TYPE %s %sTYPE %sasciiimageebcdictenexusage: %s [internal error: unknown type %d.We only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. local-fileremote-fileusage: %s local-file [remote-file] APPESTORSTOUlocal-filesusage: %s [-c] local-files %s: not foundmputa+wusage: %s remote-file [local-file] RETRgetitremote-filesusage: %s [-cnr] [-d depth] remote-files can't get cwdSkipping non-relative filename `%s' mgetand logged inConnected %sto %s. Not connected. Connected for proxy commands to %s. No proxy connection. (none)Gate ftp: %s, server %s, port %s. Passive mode: %s. Mode: %s; Type: %s; Form: %s; Structure: %s. Verbose: %s; Bell: %s; Prompting: %s; Globbing: %s. Store unique: %s; Receive unique: %s. Preserve modification times: %s. Case: %s; CR stripping: %s. Ntrans: (in) %s (out) %s Ntrans: off. Nmap: (in) %s (out) %s Nmap: off. Hash mark printing: %s; Mark count: %d; Progress bar: %s. Use of PORT/LPRT cmds: %s. (disabled for this connection)Use of EPSV/EPRT cmds for IPv4: %s%s. Macros: usage: %s [on | off] %s %s. Bell modeEPSV/EPRT on IPv4Packet tracingusage: %s [on | off | size] bytecount value is %s: %s Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeusage: %s [on | off | host [port]] Disabling gate-ftp mode - no gate-ftp server defined. GlobbingPreserve modification timesremote-directoryusage: %s remote-directory CWD %sCWD command not recognized, trying XCWD. XCWD %susage: %s [local-directory] local: %sLocal directory now %s getcwd: %slcdDELE %susage: %s remote-file usage: %s remote-files from-nameto-nameRNFR %susage: %s from-name to-name RNTO %susage: %s [remote-directory [local-file]] nlistLISTNLSToutput to local-file:usage: %s remote-files local-file Try again latershellusernameusage: %s username [password [account]] USER %sPassword:PASS %sAccount: ACCT %sLogin failed. PWDPWD command not recognized, trying XPWD. XPWDLocal directory %s getcwdlpwddirectory-nameMKD %susage: %s directory-name MKD command not recognized, trying XMKD. XMKD %sRMD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendusage: %s arg ... arguments to SITE commandSITEquote1SITE CHMOD %s %susage: %s mode file SITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITusage: %s [password] Account:usage: %s command ?Ambiguous command. ?Invalid command. ?Invalid proxy command. Case mappingCarriage Return strippingNtrans off. Nmap off. outpatternusage: %s [inpattern outpattern] nmap: unbalanced brackets. Passive modeStore uniqueReceive uniqueCDUPCDUP command not recognized, trying XCUP. XCUPrestart: offset not specified. restart: invalid offset. Restarting at %lld. Execute get, put or append to initiate transfer SYSTLimit of 16 macros have already been defined. macro-nameusage: %s macro-name Enter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4K buffer exceeded. usage: %s file %s %lld %s %sSTAT %sSTATLocal file "%s" is newer than remote file "%s". |%sCan't allocate memory for $PAGERr+waccountbellbyecasecdupclosedisconnectepsv4formgateglobhashidlemacdefmdeletemdirmlsmodtimemsendnewernmapntranspassivepreserveprogresspromptpwdquoterecvresetrestartrhelprmdirrstatusruniquesendportsitestructsuniquetraceumaskverbosemacro name'%s' macro not found. domacroUser-Agent: OpenBSD ftpGET %s HTTP/1.0 Proxy-Authorization: Basic %s%s %s GET %s HTTP/1.0 %s%s HTTP/1.0GET /%s %s Host: Can't allocate memory.[%s]:%s %s%s Writing HTTP requestToo many redirections requestedError retrieving file: %sContent-Length: Location: Redirected to %s Can't open %sCan't allocate memory for transfer bufferReading from socketRead short file. Successfully retrieved file. Auto-login using ftp URLs isn't supported when using $ftp_proxyReceiving HTTP replyWriting %sImproper response from %surl_getExtra `@' characters in usernames and passwords should be encoded as %%40Can't allocate memory to parse URLhttp://ftp://url_get: Invalid URL '%s'Invalid URL (no `/' after host): %sInvalid URL (no file after host): %sInvalid URL (no file after directory): %sCan't allocate memory for proxy URL.Malformed proxy URL: %serror in base64 encodingCan't open file %sReading from file(unknown)Trying %s... r+Requesting %s (via %s) http fetch aborted. file fetch aborted. ftp_proxyhttp_proxyCan't allocate memory for auto-fetch.Invalid URL: %sCan't connect or login to host `%s'*?[]{}Retrieving %s/%s auto_fetchCan't allocate memory for URL decoding:/ftpgatehttp%s: bad port number `%s'connect to address %ssetsockopt TOS (ignored)fdopen failed.Connected to %s. hookupNo control connection for command.%c%c%c421 Service not available, remote server has closed connection. getreply send aborted waiting for remote to finish abort. sentlocal: %s remote: %s %s: not a plain file. REST %lldlocal: %s: %snetout: %ssendrequest receive aborted waiting for remote to finish abort. receivednetin: %s%s: short writeWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %suse of scoped address can be troublesomeEPSVwrong server: return code must be 229 PASVLPSVPassive mode refused. wrong server: return code must be 227 %u,%u,%u,%u,%u,%uwrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode AF mismatch. Shouldn't happen! %c%c%c%d%cparse error! setsockopt (reuse address)setsockopt IP_PORTRANGE (ignored)setsockopt IPV6_PORTRANGE (ignored)listenEPRT |%d|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dinitconnacceptdataconnproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s runique: can't find unique file name. Lost control connection for abort.%cABOR abort_remoteNeither $FTPSERVER nor $GATE_SERVER is defined; disabling gate-ftpdumbemacssukeep alive amount is %s: %sretry amount is %s: %s46AaCc:dEegik:mno:pP:r:tvVRetrying... FTPSERVERPORTFTPMODEunknown FTPMODE: %s. Using defaultsgate-ftpFTPSERVERftp> sorry, input line too long. Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous help command %s ?Invalid help command %s %-*s %s usage: %s [-46AaEegimnptVv] [-k seconds] [-P port] [-r seconds] [host [port]] %s [-o output] ftp://[user:password@]host[:port]/file[/] %s [-o output] http://host[:port]/file %s [-o output] host:/file[/] stringlist|%.*s%*s| %5lld %c%c %2d:%02d:%02d --:-- ETA - stalled -%02d:%02d ETAprogressmeterAlready connected to %s, use close first. usage: %s host [port] gateserver not defined (shouldn't happen)PASSERVE %sConnected via pass-through server %s non-printstreamRemote system type is %s. 215 UNIX Type: L8215 TOPS20Remember to set tenex mode when transferring binary files from this machine. anonymous%s@Name (%s): Name (%s:%s): Login failed.$initftp_loginsorry, arguments too long. (%s) unable to create temporary file: %sftpXXXXXXXXXXunable to create temporary file %scan't find list of remote files, oops.can't find list of remote files, oops. remglob2%s %s? Continue with %s? ? help a answer yes to all n answer no p turn off prompt mode q answer no to all y answer yes Prompting off for duration of %s. Interactive mode: off. ?, a, n, p, q, y are the only acceptable commands! confirmSIZE %sMDTM %s191Y2K warning! Fixed incorrect time-val received from server. %*s %04d%02d%02d%02d%02d%02dCan't convert %s to a time. Unable to determine real path of `%s'fileindir %3d%% *************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************%lld byte%s %s in %.2f seconds (%.2f %sB/s) ETA: %02d:%02d:%02d ptransfer/etc/rcWARNING: some process(es) wouldn't die(can't restart init): SIGTERM processes/dev/consolesetsidrevokeSIGTSTP inithalted (with powerdown) by %shalted by %srebooted by %sdlnpq~usage: %s [-dn%sq] DP|\`ht| @(ОL  reloadfilesystem must be mounted read-only; you may need to run fsckusage: mount_ffs [-o options] special node p"Td$bltl%` $ &pT=м#ؼl$ %sFAILalias_routehandlerc:dl:quifi callocclient callocconfig callocInterface name too long%s.%s/var/db/dhclient.leasesasprintf sleeping %s: no link ... got link cannot open %s: %m_dhcpno such user: _dhcp, falling back to "nobody"no such user: nobodycan't open and lock %s: %mcan't open %s: %mPREINITsocket(PF_ROUTE, SOCK_RAW): %msetsockopt(ROUTE_MSGFILTER): %m/var/empty/chrootchdir("/")setresgidsetgroupsusage: %s [-dqu] [-c file] [-l file] interface ARPCHECKcheck_DHCPACK from %spacket_to_lease failed.dhcpackBOUNDRENEWREBINDREBOOTold_new_bound to %s -- renewal in %d seconds.BOOTREPLYDHCPOFFER%s from %sARPSEND%s isn't satisfactory.%s already seen.dhcpofferdhcpoffer: no memory to record lease.dhcpoffer: no memory for server name.Bogus server name %sdhcpoffer: no memory for filename.Invalid lease option - ignoring offerpacket_to_leaseDHCPNAK from %sDHCPNAK with no active lease.dhcpnakTrying medium "%s" %dMEDIUMDHCPDISCOVER on %s to %s port %d interval %dNo DHCPOFFERS received.Trying recorded lease %sTIMEOUTbound: renewal in %d seconds.bound: immediate renewal.No working leases in persistent database - sleeping.EXPIREDHCPREQUEST on %s to %s port %dsend_requestDHCPDECLINE on %s to %s port %doptions do not fit in DHCPDISCOVER packet.options do not fit in DHCPREQUEST packet.options do not fit in DHCPDECLINE packet.lease file not openlease { bootp; interface "%s"; fixed-address %s; filename "%s"; server-name "%s"; medium "%s"; option %s %s; renew %d %d/%d/%d %02d:%02d:%02d; rebind %d %d/%d/%d %02d:%02d:%02d; expire %d %d/%d/%d %02d:%02d:%02d; } script_init: no memory for environmentPATH=/usr/bin:/usr/sbin:/bin:/sbinip_addressnetwork_numberbroadcast_addressserver_nameprepend optionappend optionno space to %s %sexpirypriv_script_write_paramsunexpected msg type %ureceived corrupted messagefork: %mwait: %mexecve (%s, ...): %mscript_set_env: no memory for variablescript_set_env: no memory for variable assignmentillegal character (%c) in value '%s'%s%s=%sdaemonInvalid IP address in option: %sBogus Host Name option %d: %s (%s)unknown dhcp option value 0x%xwarning: hostname %s contains an underscore which violates RFC 952option_as_string: bad code %ddhcp option too largecannot fork%s [priv]poll error/sbin/dhclient-scriptCorrupt lease file - possible data loss!expecting a statement.semicolon expected.expecting string or hexadecimal datastring constant too long.expecting hexadecimal constant.hexadecimal constant too long.expected option name.expecting semicolon.%s: unexpected option name.%s: too many options.expecting interface name (in quotes).expecting left brace.unterminated interface declaration.no memory for lease.unterminated lease declaration.wrong interface name. Expecting '%s'.expecting lease declaration.expecting identifier after option keyword.no option named %sexpecting number.expecting identifier.truefalseexpecting boolean.Bad format %c in parse_option_param.expecting string.option data buffer %soption data buffer overflowout of memory allocating option data.parse_option_declExpecting media options.no memory for string list entry.no memory for reject list!parse_reject_statementexpecting IP address.getifaddrs failedno space to remember ifpNo live interface to poll onpoll: %mreceive_packet failed on %s: %sInterface %s no longer appears valid.got_oneCan't create socketinterface_link_forceupinterface_link_forcedownioctl(SIOCGIFFLAGS) on %s: %mioctl(SIOCGIFMEDIA) on %s: %mCan't allocate timeout structure!interface_link_status/dev/bpf%dCan't find free bpf: %mCan't attach interface %s to bpf device %s: %mif_register_bpfsocket(SOCK_RAW): %msetsockopt(IP_HDRINCL): %mCan't get BPF version: %mKernel BPF version out of range - recompile dhcpd!Can't set immediate mode on bpf device: %mCan't set filter-drop mode on bpf device: %mCan't get bpf buffer length: %mCan't allocate %lu bytes for bpf input buffer.Can't install packet filter program: %mCan't install write filter program: %mCannot lock bpfsend_packet: %msend_packetDHCPACKDHCPNACK%s from %s rejected.do_packetoption %s (%d) larger than buffer.rejecting bogus offer.Can't allocate storage for option %s.Can't expand storage for option %s.cScpretty_print_option: bad code %d%s: Excess information in format string: %s%s: garbage in format string: %s%s: expecting at least %d bytes; got %d%s: %d extra bytes%s: %d extra bytes at end of arrayUnexpected format code %cpretty_print_optionDiscarding packet with invalid hlen.eof in string constantstring constant larger than internal buffernumeric token larger than internal bufferbackoff-cutoffbootpdenyethernetfddifixed-addresshardwareinitial-intervalleaselink-timeoutprependrebindrenewrequireretryscriptselect-timeoutserver-namesupersedetimeouttoken-ringexiting.exiting. %s line %d: %s%*c^ subnet_numberbroadcast_addraddr_eqpiaddr%d bad IP checksums seen in %d packetsip length %d disagrees with bytes received %d.%d udp packets in %d too long - droppedaccepting packet with data after udp payload.%d bad udp checksums in %d packetssubnet-masktime-offsetIAtime-serversien116-name-serversdomain-name-serverslog-serverscookie-serverslpr-serversimpress-serversresource-location-servershost-nameboot-sizemerit-dumpdomain-nameswap-serverroot-pathextensions-pathip-forwardingnon-local-source-routingpolicy-filterIIAmax-dgram-reassemblydefault-ip-ttlpath-mtu-aging-timeoutpath-mtu-plateau-tableSAinterface-mtuall-subnets-localbroadcast-addressperform-mask-discoverymask-supplierrouter-discoveryrouter-solicitation-addressstatic-routestrailer-encapsulationarp-cache-timeoutieee802-3-encapsulationdefault-tcp-ttltcp-keepalive-intervaltcp-keepalive-garbagenis-domainnis-serversntp-serversvendor-encapsulated-optionsnetbios-name-serversnetbios-dd-servernetbios-node-typenetbios-scopefont-serversx-display-managerdhcp-requested-addressdhcp-lease-timedhcp-option-overloaddhcp-message-typedhcp-server-identifierdhcp-parameter-request-listBAdhcp-messagedhcp-max-message-sizedhcp-renewal-timedhcp-rebinding-timedhcp-class-identifierdhcp-client-identifieroption-62option-63nisplus-domainnisplus-serverstftp-server-namebootfile-namemobile-ip-home-agentsmtp-serverpop-servernntp-serverwww-serverfinger-serverirc-serverstreettalk-serverstreettalk-directory-assistance-serveruser-classoption-78option-79option-80option-81option-82option-83option-84nds-serversnds-tree-namends-contextoption-88option-89option-90option-91option-92option-93option-94option-95option-96option-97option-98option-99option-100option-101option-102option-103option-104option-105option-106option-107option-108option-109option-110option-111option-112option-113option-114option-115option-116option-117option-118option-119option-120option-121option-122option-123option-124option-125option-126option-127option-128option-129option-130option-131option-132option-133option-134option-135option-136option-137option-138option-139option-140option-141option-142option-143option-144option-145option-146option-147option-148option-149option-150option-151option-152option-153option-154option-155option-156option-157option-158option-159option-160option-161option-162option-163option-164option-165option-166option-167option-168option-169option-170option-171option-172option-173option-174option-175option-176option-177option-178option-179option-180option-181option-182option-183option-184option-185option-186option-187option-188option-189option-190option-191option-192option-193option-194option-195option-196option-197option-198option-199option-200option-201option-202option-203option-204option-205option-206option-207option-208option-209option-210option-211option-212option-213option-214option-215option-216option-217option-218option-219option-220option-221option-222option-223option-224option-225option-226option-227option-228option-229option-230option-231option-232option-233option-234option-235option-236option-237option-238option-239option-240option-241option-242option-243option-244option-245option-246option-247option-248option-249option-250option-251option-252option-253option-254option-endpadvalue %s%o exceeds max (%d) for precision.value %s%x exceeds max (%d) for precision.value %s%u exceeds max (%d) for precision.Unexpected integer size: %dfilename must be a stringno memory for string %s.expecting a network hardware typeExpecting numeric lease timeno space for numeric aggregatenumeric aggregate too short.Bogus number: %s: digit %d not in base %dBogus number: %s.numeric day of week expected.numeric year expected.expected slash separating year from month.numeric month expected.expected slash separating month from day.numeric day of month expected.numeric hour expected.expected colon separating hour from minute.numeric minute expected.expected colon separating minute from second.numeric second expected.buf_open: %mbuf_add: %mbuf_close (connection closed)buf_close (short write): %mbuf_close: %mbuf_read (short read): %mbuf_read (connection closed)buf_read: %mcorrupted message receivedreceived unknown message, code %ddispatch_imsgcannot read temp filecannot seek temp fileline too longcannot write temp fileinvalid address/tmp/ed.XXXXXXXXXXw+cannot open temp filecannot close temp fileEnter key: get_keywordbad hex digit in keybad binary digit in keydes_setkeydes_ciphercbc_decodedecryption failed (block corrupted)decryption failed (incomplete block)cannot read fileinvalid pattern delimiter& no previous commandunexpected end-of-filecannot close input filecannot open input filenewline inserted newline appended cannot read input filecannot close output filecannot open output filecannot write filecannot read stdin \abfnrtv\\ warning: file modifiedinvalid filename@(#) Copyright (c) 1993 Andrew Moore, Talke Studio. All rights reserved. usage: %s [-] [-sx] [-p string] [file] p:sx ? interrupt? script, line %d: %s number out of rangeinvalid redirectioninvalid destinationno previous substitutiondestination expectedcannot nest global commandsno current filenameunexpected command suffixinvalid command suffixunexpected addressno matchfilename too longshell access restrictedinvalid mark charactered.hup/ed.hupno previous patterntrailing backslash (\)unbalanced brackets ([])infinite substitution loopnothing to undoHLPRfiprthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s%s: name too long (not copied)%s is a directory (not copied).cannot overwrite directory %s with non-directory %s%s and %s are identical (not copied).overwrite %s? readlink: %sunlink: %scopy_linksymlink: %smkfifo: %smknod: %schown: %schmod: %schflags: %sutimes: %slchown: %susage: %s [-fip] [-R [-H | -L | -P]] source target %s [-fip] [-R [-H | -L | -P]] source ... directory ~`\ `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @      inflate 1.2.3 Copyright 1995-2005 Mark Adler  #+3;CScs !1Aa  0@`@@\l 4D%s not a regular file%s%s already has %s suffix -- unchanged%s: unknown suffix: ignored%s%s: name too long%s: input: %sdeflate.gz123456789ab:cdfghlLnNOo:qrS:tvVcfhlNno:qrtvfghqrzcatzipunknown program nameGZIPGZIP is too longoption -a is ignored on this systemillegal bit count -- %s-o argument is too long-o option may only be used with a single input filemay not mix -o, -c, or -t options%s is a directory: ignored: unchangedcompression not supported%s: won't read compressed data from terminal%s: unrecognized file formatcrc errordodecompressfchown: %sfchmod: %sfchflags: %sfutimes: %sZgzztgztaz.-_method crc date time compressed uncompressed ratio uncompressed_name%-7.7s %08x %s %10lld %10lld %4.1f%% %s %10lld %10lld %4.1f%% (totals) OK %4.1f%% -- replaced with %s %lld bytes in, %lld bytes out usage: %s [-123456789cdfghLlNnOqrtVv] [-b bits] [-o filename] [-S suffix] %*s [file ...] usage: %s [-cfhlNnqrtv] [-o filename] [file ...] usage: %s [-fghqr] [file ...] 1.2.3put_headerfile errorstream errordata errorinsufficient memorybuffer errorincompatible versionneed dictionarystream end@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: chmod.c,v 1.24 2009/01/21 16:05:39 sobrado Exp $HLPRXfghorstuwxinvalid flags: %sinvalid flag: %sthe -R and -h options may not be specified together.user is %s: %sgroup is %s: %susage: %s [-R [-H | -L | -P]] %s file ... %s [-fh] [-R [-H | -L | -P]] :group file ... owner[:group]usage: %s [-fh] [-R [-H | -L | -P]] %s file ... $OpenBSD: dir.c,v 1.23 2008/06/10 23:10:29 otto Exp $$OpenBSD: inode.c,v 1.32 2008/12/29 18:06:10 otto Exp $@(#) Copyright (c) 1980, 1986, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: main.c,v 1.33 2008/06/10 23:10:29 otto Exp $$OpenBSD: pass1.c,v 1.30 2008/11/09 15:54:54 chl Exp $$OpenBSD: pass1b.c,v 1.16 2008/06/10 23:10:29 otto Exp $$OpenBSD: pass2.c,v 1.28 2008/06/10 23:10:29 otto Exp $$OpenBSD: pass3.c,v 1.13 2008/06/10 23:10:29 otto Exp $$OpenBSD: pass4.c,v 1.18 2008/06/10 23:10:29 otto Exp $$OpenBSD: pass5.c,v 1.37 2008/06/10 23:10:29 otto Exp $$OpenBSD: fsutil.c,v 1.16 2007/02/17 15:57:14 grunk Exp $$OpenBSD: setup.c,v 1.40 2008/06/10 23:10:29 otto Exp $  @$OpenBSD: utilities.c,v 1.35 2008/06/10 23:10:29 otto Exp $?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@dirscanexpanddirbad size: blk %lld, offset %lld, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock.fs_fpg %d cannot allocate memory for inode cache cannot increase directory list%lld %s I=%uCG %d: BAD MAGIC NUMBER dfpnNyYb:c:m:conversion levelusage: %s [-fnpy] [-b block#] [-c level] [-m mode] filesystem ... %lld files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %lld,%lld blocks missing %lld files missing phase 1, inode %d/%dcheckinodeINCORRECT BLOCK COUNT I=%u (%ld should be %d)bad indirect addr: %ld bad direct addr: %ld convert symlink %d(%s) of size %llu cannot read symlink phase 1b, inode %d/%dphase 2, directory %d/%dphase 2, parent directory %d/%d%s %s: LENGTH %ld NOT MULTIPLE of %d%s %s: LENGTH %ld NOT MULTIPLE OF %d (REMOVED)phase 3, directory %d/%ldphase 4, inode %d/%dphase 5, cg %d/%dCREATCANNOT %s CLUSTER MAPS FREE BLK COUNT(S) WRONG IN SUPERBLKBLK(S) MISSING IN BIT MAPSALLOCATED FRAG %ld MARKED FREE ALLOCATED INODE %ld MARKED FREE SUMMARY INFORMATION BADCREATE CLUSTER MAPS%sING CLUSTER MAPS DELETING CLUSTERING MAPS DELETE CLUSTERING MAPSUNKNOWN ROTATIONAL TABLE FORMAT %d INFORMATION; SEE fsck_ffs(8).IMPOSSIBLE NPSECT=%d IN SUPERBLOCK (FIXED)INCORRECT BMASK=%x IN SUPERBLOCKINCORRECT FMASK=%x IN SUPERBLOCKINCORRECT BSHIFT=%d IN SUPERBLOCKINCORRECT FSHIFT=%d IN SUPERBLOCKINCORRECT MAXFILESIZE=%llu IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%lx IN SUPERBLOCKINCORRECT QFMASK=%lx IN SUPERBLOCKINCONSISTENT CGSIZE=%d INCONSISTENT INOPB=%d INCONSISTENT NINDIR=%d cannot alloc %u bytes for cylinder group summary area cannot alloc %u bytes for stmap cannot alloc %zu bytes for lncntp cannot alloc %u bytes for cginosused cannot alloc %zu bytes for inpsort cannot alloc %zu bytes for inphead CONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATIMPOSSIBLE MINFREE=%d IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKclean = %d NCG OUT OF RANGECPG OUT OF RANGESBSIZE PREPOSTEROUSLY LARGEILLEGAL BLOCK SIZE IN SUPERBLOCKILLEGAL FRAGMENT SIZE IN SUPERBLOCKVALUES IN SUPER BLOCK DISAGREE WITH THOSE IN LAST ALTERNATEoffset %d, original %ld, alternate %ld NCYL LESS THAN NCG*CPG%s: NOT LABELED AS A BSD FILE SYSTEM (%s) WRITING %sZERO'ED BLOCK %lld TO DISK CANNOT %s: BLK %lldUPDATE STANDARD SUPERBLOCK %lld (%lld),catchinfo   init: %s init: already running initial setsid() failed: %mrootsetlogin() failed: %munrecognized flag '-%c'sfignoring excess argumentsfatal signal: %scannot get kernel security level: %scannot change kernel security level from %d to %d: %scan't get %s for controlling terminal: %m/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bincan't exec %s for single user: %mcan't fork single-user shell, trying againwait for single-user shell failed: %m; restartinginit: shell stopped, restarting single user shell terminated, restartingsingle user shell terminated.single_userautobootcan't exec %s for %s: %mcan't fork for %s on %s: %mwait for %s on %s failed: %m; going to single user modeinit: %s on %s stopped, restarting %s on %s terminated abnormally, going to single user modesession database close: %ssession database open: %sinsert %d: %sdelete %d: %scan't parse getty for port %scan't allocate windowcan't parse window for port %scan't fork for window system on port %s: %msetsid failed (window) %mcan't exec window system '%s' for port %s: %mcan't fork for getty on port %s: %mgetty repeating too quickly on port %s, sleepingcan't exec getty '%s' for port %s: %mport %s changed utmp index from %d to %dcan't exec %s for %s %s: %msome processes would not die; ps axl advisedinsane maxpartitions value %dP:T:b:c:e:f:i:m:o:s:NO:S:T:b:c:e:f:g:h:i:m:o:qs:t:%s: invalid ffs versionsector size is %s: %sblock size is %s: %sfragments per cylinder group is %s: %sblocks per file in a cylinder group is %s: %sfragment size is %s: %saverage file size is %s: %saverage files per dir is %s: %sbytes per inode is %s: %sfree space %% is %s: %s%s: unknown optimization preference: use `space' or `time'.file system size is %s: %snewfs_%s%s/newfs_%s%s not found%sr%s%s: getmntinfo: %s%s: block device%s: not a character-special device%s: can't figure out file system partition%s: `%c' partition is unavailable%s: `%c' partition overlaps boot program%s: maximum file system size on the `%c' partition is %lld%s: no default sector sizewarning: changing optimization to space because minfree is less than %d%% ioctl (WDINFO)%s: can't rewrite disk labelusage: %s [-b block-size] [-c fragments-per-cylinder-group] [-e maxbpg] [-f frag-size] [-i bytes] [-m free-space] [-o options] [-P file] [-s size] special node usage: %s [-Nq] [-b block-size] [-c fragments-per-cylinder-group] [-e maxbpg] [-f frag-size] [-g avgfilesize] [-h avgfpdir] [-i bytes] [-m free-space] [-O filesystem-format] [-o optimization] [-S sector-size] [-s size] [-T disktype] [-t fstype] special %s: initializing cg %ld/%d siginfopreposterous size %lld, max is %dpreposterous size %lld, max is %lldblock size must be a power of 2, not %dfragment size must be a power of 2, not %dfragment size %d is too small, minimum is %dblock size %d is too small, minimum is %dblock size %d is too large, maximum is %dblock size (%d) cannot be smaller than fragment size (%d)fragment size %d is too small, minimum with block size %d is %ddensity reduced from %d to %d bytes per inodecan't honour -c: minimum is %dfile system size %jd < minimum size of %dreduced number of fragments per cylinder group from %d to %d to enlarge last cylinder groupcalloc failed%s: %.1fMB in %jd sectors of %d bytes %d cylinder groups of %.2fMB, %d blocks, %d inodes each super-block backups (for fsck -b #) at:cannot allocate I/O bufferfsinit1 failedfsinit2 failedmkfsinode table does not fit in cylinder grouppanic: cylinder group too big: %d > %dcg 0: bad magic numberfirst cylinder group ran out of spaceinternal error: can't find block in cyl 0fsinit: inode value %d out of rangerdfs: read error on block %lldwtfs: write error on block %lldisblock bad fs_frag %dclrblock bad fs_frag %dsetblock bad fs_frag %dilog2: %d is not a power of 2 dfiPRr%s: is a directoryrm_overwrite%s (inode %u): not overwritten due to multiple links%s: malloccheckoverride %s%s%s/%s for %s? remove %s? "." and ".." may not be removedusage: %s [-dfiPRr] file ... bsfbsrdensityeomfsffsrofflinerewindrewofflretensionweof%s: illegal count%s: unknown commandf:ioctl MTIOCGETWriteProtectMounted76543210%s tape drive, residual=%d erblocksize: %d (%d) density: %d (%d) %d: unknown tape drive type usage: %s [-t] device usage: %s [-f device] command [count] Lost connection to remote host.shell/tcp: unknown service/etc/rmtwho are you?invalid user name: %sO%s %d rmtopenC S I%d %d ioctlrmtioctlProtocol to remote tape server botched (code "%s").rmtreplyProtocol to remote tape server botched.(rmtgets got "%s").m:pusage: %s [-p] [-m mode] directory ... $OpenBSD: compile.c,v 1.28 2008/10/16 16:34:32 millert Exp $@(#) Copyright (c) 1992, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: main.c,v 1.15 2008/10/16 16:34:32 millert Exp $$OpenBSD: misc.c,v 1.8 2008/10/08 17:26:47 millert Exp $$OpenBSD: process.c,v 1.14 2008/10/07 21:51:37 millert Exp $0123456789/\$invalid command code %cextra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandunexpected }branchempty labelread commandw commandfilename expectedunterminated substitute patternsubstitute pattern can not be delimited by newline or backslashextra text at the end of a transform commandcommand %c expects up to %d address(es), found %dcommand expectedunexpected EOF (pending }'s)\ can not be used as a string delimiternewline can not be used as a string delimiterRE error: %sunterminated substitute in regular expression123456789\%c not defined in the REunescaped newline inside substitute patternnumber in substitute flags out of rangemore than one number or 'g' in substitute flagsbad flag in substitute command: '%c'compile_flagsno wfile specifiedunterminated transform source stringunterminated transform target stringtransform strings are not the same lengthtransform pattern can not be delimited by newline or backslashexpected context addressunterminated regular expressionwhitespace after %sundefined label '%s'duplicate label '%s'unused label '%s'ae:f:nuusage: sed [-anu] command [file ...] sed [-anu] [-e command] [-f command_file] [file ...] stdout: %s ..."sed: %lu: %s: \%d not defined in the REflush_appends\ \abfrtv%03ofirst RE may not be empty4$<$4&P <&7 @&G := L&G X&t> \&^ h&W p&Z x&,W = 4< |&G &G &U &C &X &X xa :p(8g t(b x(\} |(q (T} (q (|n (,{ (\p (b (\p (r (b (u (,o (h (0i (\} )b ) )b )s { -a-b-c-d -e-f-G-g-h -H -k-L -n-O-o-p -r-s-S -t-u-w-x-z===!=<>-eq-ne-gt-ge-lt -le!-ef"-nt#-ot$<#)<+4`|2)t)f*c*d(*s8*lL*m\*n\p8 W$ X+, p+ +l + +( +0 + + + ,H , ; J , Ժ ,, <,p L, X,l d,L p, ,` x , ,X ,l ,\ ,H ,8 ,̷ ,` - - -4 (-$ <-l D-8 P-, `- |-ļ -L -( - -L -( X - x. - .P .H $.@ 4. @.t H.hb fd'(! ! %"#)< >g  0y7#-1 1= ?2*?* /&.&_606162636465666768695U5u4L4l3C3c[O%A"BCD10++--==!== *= /= %= += -= <<= >>= &= ^= |= <<>><=>=<>&& || */%+-&^|? , ~!():l5x55IFS= ${PS2=> } ${PS3=#? } ${PS4=+ }91C<;0@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mknod.c,v 1.1 2005/10/06 06:39:36 otto Exp $<a<<c<8<<e<<<iPkl<Xm<Cn=f==7b =u(=4=<=p0r`sH=hv4;T=\=h=x==xlet@@H@P@X@P \@ ?  d@ l@t@mA.x@{|@}<+@@@@@@- ||&&!()]]<>  @+TCC\C4 lC ` ` 9xCCCCCC@(#)PD KSH v5.2.14 99/07/13.2 AAA  Q AA A QBunable to allocate memoryafree: %p not present in area %pLPrestricted shell - can't cdOLDPWDdon't know current directoryCDPATH%s: bad directorytoo many argumentsno OLDPWDno home directory (HOME not set)can't get current directory - %sRnprsu,-p: %s-u: %s: %s-npvVpv is a reserved word special is a%s shell builtin is a function undefined (autoload from %s) tracedn exported%s is *GOK*exported is an %salias for alias %s= is a tracked %salias for not foundL#R#UZ#fi#lprtuxfunction %s %T %s() %T %s: not identifierexportreadonly%s[%d]typeset -U -u -l -Z -R%d -L%d -t -r -x -i only -t, -u and -x options may be used with -funalias-tadprtUxalias: -r flag can only be used with -t and without arguments alias %s alias not found adtno argumentslpnzjob control not enabled%%%*d %*s %s%*d %*d %sls:bad signal `%s'usage: kill [-s signame | -signum | -signame] { job | pid | pgrp } ... kill -l [exit_status ...] %s: arguments must be jobs or process IDsmissing name argument%s: is not an identifierarguments changed since last callOPTARGc_getopts: no argvmissing options argumentlm+alias+cd+command*=export+fc+getopts+jobs+killlet*=readonly=typeset+unaliaswhence+bg+fg%s%*ldm%ld.%02lds%snothing to shift%s: bad numberc_umask=+-rwxugoXsbad maskaugo%#3.3o ugorwxprsu,%s is read onlytrap -- bad signal %s%s: can only %s %d level(s)%s: cannot %sfv%s%*ld.%02ld%sreal user sys system user real :ptime: -%s requires an argumenttime: -%s unknown optioninvalid file modeusage: mknod [-m mode] name [b | c] major minorusage: mknod [-m mode] name p*=.*=:[*=break=builtin*=continue*=eval*=exec*=exit+false*=return*=set*=shift=times*=trap+=wait+readtest+trueulimit+umask*=unset-tmissing ]internal error: unknown opunexpected operator/operandmissing closing parenmissing argumentmissing expression operatormissing second argumentexpression expected-atime(cpu-seconds)file(blocks)coredump(blocks)data(kbytes)stack(kbytes)lockedmem(kbytes)memory(kbytes)nofiles(descriptors)usage: ulimit [-acdfHlmnpSst] [value]ulimit: %c%-20s unlimitedbad limit: %sexceeds allowable limitinvalid limit: %sunlimited x_modefileglob: substitute errorFPATH;|&()`*+?@!IFS\$(){}[]?*&;#|<>"'`beginning-of-historycomplete-commandcomplete-filecompletedelete-char-backwarddelete-word-backwarddelete-char-forwarddelete-word-forwardkill-lineredrawend-of-historyeot-or-deletegoto-historymacro-stringauto-insertkill-to-eolkill-regionlist-commandlist-fileprefix-1prefix-2yank-popbackward-charbeginning-of-linebackward-wordend-of-lineforward-charforward-wordnewlinedown-historynewline-and-nextno-opup-historyprev-hist-wordsearch-character-forwardsearch-character-backwardsearch-historyset-mark-commandstuffstuff-resettranspose-charsexchange-point-and-markcomplete-listexpand-filecapitalize-worddowncase-wordupcase-wordset-argcommentx_search_hist I-search: nothing to yank yank something first%s = '%s' %s: no such functioncannot bind, not a ttyPOSIXparameter null or not setexpand(NULL)%S%s: bad substitutionsubstitute%s: parameter not set%s: cannot open $() input%Rfunny $() command: %s*+?@! coprocess already existsPS4%s: can't find function definition file%s: can't find function definition file - %s%s: function not defined by %sCFUNC %d%s: can't open function definition file %s - %s%s: cannot execute - %s%s: restrictedcommand -p: restrictedbuiltin: %s: not a builtinEXECSHELL%s: %s: %sshcomexec: %scould not finish (dup) redirection %s: %sdupcannot %s %s: %s%s%s herein: yylexerror writing %s: %scan't %s temporary file %s: %shere document missing-rPS3%*d) %sdbteste_isadbteste_error: %s (offset %d)%s: unexpected `%s'end of expression%s: bad number `%s'%s: expression recurses on parameter `%s'%s: %s requires lvalue%s: %s applied to read only variablemissing )missing :zero divisorhistory functions not availablee:glnrs0,1,2,3,4,5,6,7,8,9,-%c%scan't use -e, -l, -n, -r with -s (-e -)can't use -l, -n with -e%.*s ${FCEDIT:-/bin/ed} $_error reading temp file %s - %scannot open temp file %serror writing temporary file - %scannot create temp file %s - %s-16substitution failed%s: not in history%s: invalid rangeno history (yet)HISTFILE%s.%dhist_shrinkinternal error: %s[%d]: shl_stdout not validtoo many files open in shellcan't create pipe - try againillegal file descriptor namefd not open for readingfd not open for writingbad file descriptorno coprocess/tmp%s/shXXXXXXXXstoppedrunning and You have %s%s%s jobs no such jobambiguousargument must be %job or process idwarning: won't have full job controlj_init: tcsetpgrp() failed: %sj_init: setpgid() failed: %sj_init: tcgetpgrp() failed: %sj_init: getpgrp() failed: %s[%d]jw:last procchildexchild: execute() returnedexchild: XPIPEI and no last_job - pid %dcannot fork - try againwaitlast: no last jobjw:waitlastwaitlast: not startedjw:waitfor| jw:resumecannot continue job %s: %sfg: 2nd tcsetpgrp(%d, %d) failed: %s1st tcsetpgrp(%d, %d) failed: %s[%d] job not job-controlledjobsnotifyzombiej_async: bad nzombie (%d)j_async: job not startedj_waitj: tcsetpgrp(%d, %d) failed: %scheckjobcheck_job: job started (flags 0x%x) Running (core dumped)%-20s %s%s%sj_print%s%5d %-20s %s%s %s%s%s%s %5d [%d] %c DoneDone (%d)remove_job: job not found (%s)no closing quote here document `%s' unclosed \$PS1PS2dopprompt\%c%r%l:%M:%S%a %b %d~/%smissing ] MAILyou have mail in $_typesetKSH_VERSION-xPPIDOPTIND=1evaltypeset -i RANDOM MAILCHECK="${MAILCHECK-600}" SECONDS="${SECONDS-0}" TMOUT="${TMOUT-0}"hash=alias -ttype=whence -vstop=kill -STOPsuspend=kill -STOP $$autoload=typeset -fufunctions=typeset -fhistory=fc -linteger=typeset -inohup=nohup local=typesetr=fc -e -login=exec login-tUccdatemailmakeprviwhoENVSH_VERSION$ /etc/suid_profile/etc/profile$HOME/.profileCannot determine current working directory-c requires an argumentUSERinclude: %dUse `exit' to leave ksh shell: %d%s%s-`%c' requires argument%s%s-%c: unknown option |&;<>()*@#!$-? =-+?#% "#$&'()*;<>?[\`|0123456789ABCDEFallexportbraceexpandbgnicecsh-historyemacs-usemetaerrexitgmacsignoreeofinteractivemarkdirsnoclobbernoglobnohupnolognounsetphysicalposixprivilegedtrackallvirawvi-show8vi-tabcompletevi-esccompletextrace%-*s %sCurrent option settings -o %sgetoptionsparse_args: `%c'%s: bad optionA:o;sgmatch'\'%-*s%*sdo_phys_pathshf_fdopen: missing read/writeshf_reopen: bad shf/buf/bsizeshf_reopen: missing read/writeshf_sopen: flags 0x%xshf_flush: no fdshf_emptybuf: no fdshf_fillbuf: no fdshf_read: bsize %dshf_read: flags %xshf_getse: flags %xshf_getchar: flags %xshf_ungetc: flags %xshf_putchar: no fdshf_putchar: flags %xshf_write: nbytes %dshf_write: flags %xshf_snprintf: buf %lx, bsize %dshf_vfprintf0123456789abcdef(null %s)too many <<'s for%s: bad identifier too many redirections %s: invalid function name thenelseeliffiesacwhileuntildo{}[[&&||;;((|&unexpectedunmatchedsyntax error: `%s' %s ?%dsyntax error: unexpected EOF ERRError handlerEXITSIGtimed out waiting for inputsetexecsig: unset signal %d(%s)%S #no-args# #no-vars# ( %T) %T| %T%;%T%s %T ]] %Sdo%N%T%;done in %;for %s select %s case %S in%N(%S%c%;%T%N;;%Nesac %s %T%;doif %Telif %Telse%;%T%;fi then%N%T{%;%T%;} %T& function %s %T%s() %Ttime %T%T|& < >| <> <<- << >> <&>&wdscan: unknown char 0x%x (carrying on)j_ttyinit: can't set close-on-exec flag: %sj_ttyinit: dup of tty fd failed: %sNo controlling tty (open /dev/tty: %s)Can't find tty file descriptorOPTINDPOSIXLY_CORRECTHISTSIZEMAILCHECKMAILPATHRANDOMSECONDSTMOUTLINENO%s: subscript %ld out of range0123456789abcdefghijklmnopqrstuvwxyz0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZstr_valsetstr: %s=%s: assigning to self%s: is read only%0*s%.*s%*s%.*sy$%s %dfc -e ${VISUAL:-${EDITOR:-vi}} --grabhist: bad history arrayM-%7s %-10s %14s %-7s %-6s '%s' %14llu %3uUnusedHot spareScrubbingBIOCDISK%7s %-10s %14s %-7s CRYPTO%s%s %u secondsDevice%-7s %-10s %14s %-8s VolumeStatusSizeBIOCINQa:b:C:c:dH:hil:qr:R:vu:Number of rounds is %s: %s/dev/bioneed -c parameterneed -l parametercan't use sd deviceCan't locate %s device via %sneed -d or -f parameterusage: %s [-hiqv] [-a alarm-function] [-b channel:target[.lun]] [-H channel:target[.lun]] [-R device | channel:target[.lun] [-u channel:target[.lun]] device %s [-dhiqv] [-C flag[,flag,...]] [-c raidlevel] [-l special[,special,...]] [-R device | channel:target[.lun] [-r rounds] device target not specifiedstr2locatorBIOCVOLbio_inq %d%% doneBuildingOfflineDegradedOnlineInvalid%s %u%7s %-10s %14s %-7s RAID%u%s%s RebuildFailed%u:%u.%unoenclunknown serial%7s %-10s %14s %-7s %-6s <%s> alarm is currently %s invalid alarm function: %sBIOCALARMbio_getvolbynameTarget %s: %sinvalid device %sBIOCSETSTATEbio_setblinkDisk %s does not existDisk %s is not in an enclosureBIOCBLINKno devices specifiednot enough memory for dev_t listunsupported raid levelnot enough disksbio_createraidIncorrect passphraseBIOCCREATERAIDnot exactly one disksinvalid KDF infoinvalid KDF hintunknown KDF type %dnumber of KDF rounds too low: %dKDF hint has invalid sizeinvalid device listbio_parse_devlistduplicate device in listtoo many devices on device listcould not stat %sbio_createflagsinvalid flags listinvalid flag %sbio_deleteraiddelete volume %s failed%s: <%s, %s, %s>, serial %s bio_diskinqDIOCINQInvalid keyInvalid saltPassphrase: Re-type passphrase: Passphrases did not matchderive_key_pkcspbkdf2 failedunable to read passphraseToo less rounds: %dhmac_sha1pkcs5_pbkdf2usage: %s seconds %s: destination pathname too longdo_moverename %s to %scan't remove %scannot resolve %scannot rename a mount point%s: remove%s: set times%s: set flags%s: set mode%s: set owner/group%s: set owner/group; not setting setuid/setgid%s: waitpid/bin/cp%s: terminated with %d (non-zero) status%s: did not terminate normally/bin/rm-rf-PRpusage: %s [-fi] source target %s [-fi] source ... directory |&=<>+-*/%:()syntax erroreval5division by zeronon-numeric argument_msgbufpM:N:sysctl: KERN_MSGBUFSIZEcouldn't allocate space for buffer datasysctl: KERN_MSGBUFusage: %s [-M core] [-N system] sethostnamegethostnameusage: %s [-s] [name-of-host] /var/run/utmplogout%s: not a device nodereadlabelfs%s: bad filesystem type in label%s: couldn't read disklabel%s%s%s%c/etc/fbtab(null)%s: bad entry: %s%o%s: %s: %mlogin_protect/*%s: chown(%s): %m%s: chmod(%s): %m%s: opendir(%s): %m%lld.%1lld%c%lld%c0B/var/log/wtmplogwtmp\\#TERMPATHtgetent.termcap /usr/share/misc/termcap/usr/share/misc/termcapTERMCAPOOPS?Ynlongjmp botch. inet6_rth_reverseno errorunknown/invalid errorresolved protocol is unknowninvalid value for hintsmemory allocation failureaddress family for name not supportedservice not supported for ai_socktypeai_socktype not supportedai_family not supportedno address associated with namenon-recoverable failure in name resolutiontemporary failure in name resolutionname or service is not knowninvalid value for ai_flagsxxswfstabscanfstab: sscanfrcmd: socket: %s rcmd: socket: All ports in use RSH%s: %s rcmd_afconnect to address %s: rcmd: %s: %s socket: protocol failure in circuit setup. rcmd: accept: %s rcmd: select (setting up stderr): %s select: protocol failure in circuit setup rcmd: write (setting up stderr): %s iruserok%s/.rhosts.rhosts lstat failed.rhosts not regular fileiruserok_sa.rhosts fstat failedbad .rhosts owner.rhosts writable by other than owner/etc/hosts.equiv__ivaliduser__ivaliduser_sa__icheckhostrcmd: address %s not listed for host %s__gethostloopgetnameinfoip6_parsenumeric/usr/bin/rshlocalhostrcmdsh: socketpairrcmdsh: dup2 failedrcmdsh: fork to lose parent failedrcmdsh: execvp %s failed: %s -lrcmdshrcmdsh: setuid(%u): %s rcmdsh: fork failedrcmdsh: unknown user: %s dWWWWWResolver Error 0 (no error)Unknown hostHost name lookup failureUnknown server errorNo address associated with nameResolver internal errorUnknown resolver errorrresvport_afABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/=%u.%u.%u.%u%u.%u.%u.%uinet_ntop4inet_ntop6Y$Y(Y,Y0Y8Y@YDYHYPYTY\Y`YhYH%pY`7tY|YYYYYYYYYYX[YYSignal 0HUPINTILLTRAPABRTEMTFPEKILLBUSSEGVSYSPIPEALRMURGTSTPCONTCHLDTTINTTOUIOXCPUXFSZVTALRMPROFWINCHUSR1USR2``ZZZZZZZZZZ[ [[$[nosappndnosappendnoarchnoarchivednoschgnoschangenosimmutablenouappndnouappendnouchgnouchangenouimmutablenodumpnoopaque ,%ld%s-blocks%s: unknown blocksize%s: minimum blocksize is 512maximum blocksize is %dGBLOCKSIZE%02x:%02x:%02x:%02x:%02x:%02x%x:%x:%x:%x:%x:%x/etc/ethers+ ethers.byaddrether_ntohostethers.bynameether_hostton*** unknown regexp error code ***REG_NOMATCHregexec() failed to matchREG_BADPATinvalid regular expressionREG_ECOLLATEinvalid collating elementREG_ECTYPEinvalid character classREG_EESCAPEREG_ESUBREGinvalid backreference numberREG_EBRACKbrackets ([ ]) not balancedREG_EPARENparentheses not balancedREG_EBRACEbraces not balancedREG_BADBRinvalid repetition count(s)REG_ERANGEinvalid character rangeREG_ESPACEREG_BADRPTrepetition-operator operand invalidREG_EMPTYempty (sub)expressionREG_ASSERT"can't happen" -- you found a bugREG_INVARGinvalid argument to regex routineregerrorREG_0x%xsecurertsctssoftcarwindow/etc/ttys/var/run/dev.dbttyname_r/etc/protocolsgetnetanswerIN-ADDR.ARPAgetnetbyaddr0.0.0.%u.in-addr.arpa%u.%u.%u.%u.in-addr.arpa0.%u.%u.%u.in-addr.arpa0.0.%u.%u.in-addr.arpabfgetnetbyname/etc/networks/etc/groupgrscangroup.bynamegroup.bygidreadpassphrasealnumalphablankcntrldigitgraphlowerpunctupperxdigitglob3g_opendirg_lstatg_statmaster.passwd.bynamepasswd.byname__YP!__has_yppw__yppwlookupmaster.passwd.byuidpasswd.byuid_pwhashbyname/etc/spwd.db/etc/pwd.db*(%s,%s,%s)netgroup.byusernetgroupnetgroup.byhostnetgroup: Cycle in group `%s' ,/etc/netgroup.dbyp_first: clnt_callauthunix_createauthunix_create: out of memory authunix_create_defaultauth_none.c - Fatal marshalling problemABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ !"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789ABCDEFabcdefABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789NULSOHSTXETXEOTENQBELalertBSbackspaceHTtabLFVTvertical-tabFFform-feedCRcarriage-returnSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBIS4IS3GSIS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfivesixseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDEL[:<:]][:>:]]Y\hdhphxhhhhhhhhhii i,iDiXidipiiiiiiijj0jDj\jY\hdhphxhhhhhhhhhii i,iDiXidipiiiiiiijj0jDj\jHangupInterruptQuitIllegal instructionTrace/BPT trapAbort trapEMT trapFloating point exceptionKilledBus errorSegmentation faultBad system callBroken pipeAlarm clockTerminatedUrgent I/O conditionSuspended (signal)SuspendedContinuedChild exitedStopped (tty input)Stopped (tty output)I/O possibleCputime limit exceededFilesize limit exceededVirtual timer expiredProfiling timer expiredWindow size changesInformation requestUser defined signal 1User defined signal 2option requires an argument -- %coption requires an argument -- %sambiguous option -- %.*soption doesn't take an argument -- %.*sunknown option -- %cunknown option -- %sinet_net_pton_ipv40123456789abcdef0123456789/usr/src/lib/libc/net/inet_net_pton.cn >= 0 && n <= 9n >= 0 && n <= 15assertion "%s" failed: file "%s", line %d assertion "%s" failed: file "%s", line %d, function "%s" gb0b1ncdtscilcshssbpxbxfxoxtxdxgetenttc%s.db:\|:cgetnextSHA1TransformSHA1Padexeclexecleexeclpexecvpexecvp: : path too long xdr_array: out of memory   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~realpathvfscanfؗҜ<3#I9=D2[%Cod(hinitygethostby*.getanswer: asked for "%s", got "%s"-_/getanswergethostby*.getanswer: asked for "%s %s %s", got type "%s"gethostbyaddr%x.%x.ip6.arpa/etc/hostshosts.byaddr_yp_gethtbyaddrhosts.byname:2*" <4,$ >6.&@80( 91)! ;3+# =5-% ?7/'91)! :2*" ;3+# <4,$?7/'>6.&=5-%      )4%/7(3-!0,1'8"5.*2$                                                                                                                                  @ @ @ @ @ ./ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz01234567896789:;<=>?  !"#$%&'()*+,-./012345%2.2u$bcrypt_gensaltOrpheanBeholderScryDoubtbcrypt 1Ѭߘr/Ḗ~&jE|,G$l iciNWqX~=t XrX͋qJT{YZ90`*#`(yA8۸y:`l>w'K1/x`\`U%U攫UbHW@cj9U*4\̴ATr|*oc]ũ+1t>\3֯\$lS2zw(H;Kkē!(f a!`|H2]]]u#&܈e>#Ŭom9BD . Ji^Bh!la gӫҠQjh/T(3Ql n;zP;*~ev9>YfCoEå}^;uos D@jVbNw?6r=B$7H ۛIrS{y%P;LylO`@ž\^c$johSl>9oR;Qm,0DE ^J3(fK.WtE9_ ӹyU 2`yr,@%g̣饎"2u<kaP/R=2`#H{1S>W\o.ViB~(2gsUO'[iXʻ]=!lJ[-ySeEIҐK3~ˤAb Lw6~д+MەqՓkю%ǯ/[{AI~-%^q h"W6d$ cUYCxSZ٢[} Źv&ϕbhAJsN-GJ{RQ)S?Wƛv`+t恵oWk *!ec.4dV]-SGjnpzKD). u#&İn}ߧI`fqilRdVឱ¥6)L u@Y>:䚘T?eB[k?ҡ08-M]% L&pc^?kh >\D}W7: P tAu8/;21>8TNmO Bo ,y|$ryVw.?rU$qk.P̈́GXzt}K:zfC cdG27;C$CMQe*P:qUN1w_V5kǣ;< $Y,n<pEㆱo ^*>Zw=Ne)։>%fRxL.jxS<- N=+6&9`y#RnfE{7(2åZl!Xeh;/ۭ}*/n[(!pa)uGa0a4c\s9pL ު˼,b`\ndi#PZe2Zh@*<1! T_~}=b7w-_h)5ǡޖXxWcr"ÃF T0.SHُ(1mX4a(s<|J]d]B> EꫪOlOBBǵj;Oe!AyMjGKPb=bF&[$ti GV[ Htb#*BXU >ap?#r3A~_;"lY7|`t˧@n2w΄PU5ai Z .zD4Egɞs͈Uy_g@Cge48>q(= m!>J=+hZ=@&L4)i Av.khq$j 3ԷCaP.9FE$tO!@MpE/f m1'A9UG%ښ ʫ%xP()Sچ, mbhiHפh'?Oz|Ϊ_7әxB*k@5 ٫9N;VmK1f&tn:2C[Ah xN جV@E'H::SU kKмgUXc)3VJ*%1?~^|1)p/'\,(H"m?H܆AyG@n]Q_2Տd5A4x{%`*`lc´2Of#k>3b $;" r(-Exb}doITH}'>AcG t.no:7`L knU{7,gm;e' )̒9 i{f} ϑ^و/$[Qy{;v.97yY̗&-1.Bh;+jLu.x7BjQ满PcKkؽ%=YBD n *Ngd_ڈ鿾dW{x`M``FѰ8Ew63kBqA_^;Z4ٷ,Q+:Ֆ}}>(-}|%rZLZq)GW;()f(.y_xU`uD^mm%adâW<'*:m?!cf&(3uU4V<wQ( gQ̫_QM08bX7 z{>d!Q2Ow~㶨F=)iSHd$m-if! FEdlX [@X̻k~jEY:D 5>ʹrdfGof,ҏ"W##v215VbuZ6ns҈bIPLVq z2E{Sb%ҽ5iq"|˶+v>S@`8G% 8vFšw``u N˅؍芰z~L\HjiԐ\-% ?2aN[wߏWr:j?$.Dsp"8 1).lN!(Ew8fTl 4)P|ɵՄ? Gy$1$%s%.*s$md5cryptMD5Padstack overflow in function %sGMTmnabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789 :+-._Local time zone must be set--see zic manual page/usr/share/zoneinfotzload/etc/localtimeposixrules,M4.1.0,M10.5.0TZSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec%.3s %.3s%3d %2.2d:%2.2d:%2.2d %-4s %.3s %.3s%3d %2.2d:%2.2d:%2.2d %s asctime3clntudp_create: out of memory clntudp_call8L4H!!!!!!gethostby*.getanswer: asked for "%s", got "%s"explore_numeric# _gethtentipnodes.bynameres_querydomainNres_query%.*s.%.*sres_querydomainHOSTALIASES__hostalias __res_nameinquery__res_queriesmatch__res_send  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~/&/etc/resolv.conf;#lookupsearchnameserversortlist_res_initRES_OPTIONSenvLOCALDOMAINndots:insecure1insecure2edns001234567890123456789abcdef0123456789ABCDEFinet_pton6  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ď̏\Џ܏ (8<PT\` tx    Аؐ a $8@TXdl^|AxK̑ԑ$48 \d!"ȒԒ d8@e`df|#̏INCHAOSHSHESIODANYname serverMDmail destination (deprecated)MFmail forwarder (deprecated)CNAMEcanonical nameSOAstart of authorityMBmailboxMGmail group memberMRmail renameNULLnullWKSwell-known service (deprecated)PTRdomain name pointerHINFOhost informationMINFOmailbox informationMXmail exchangerTXTRPresponsible personAFSDBDCE or AFS serverX25X25 addressISDNISDN addressrouterNSAPnsap addressNSAP_PTRsignaturePXmapping informationGPOSgeographical position (withdrawn)AAAALOClocationNXTnext valid name (unimplemented)EIDendpoint identifier (unimplemented)NIMLOCNIMROD locator (unimplemented)SRVserver selectionATMAATM address (unimplemented)IXFRincremental zone transferAXFRMAILBmailbox-related data (deprecated)MAILAmail agent (deprecated)UINFOuser information (nonstandard)UIDuser ID (nonstandard)GIDgroup ID (nonstandard)NAPTRURN Naming Authority"any"/etc/services,/T^"<"too small ((((( AAAAAABBBBBB syslog_r: unknown facility/priority: %xvsyslog_r<%d>Error %d[%ld]%h %e %T syslog: unknown facility/priority: %xconnectlog_r/dev/logPTX\`dhlptx|`ȖЖܖ (4<HT`ptxJanFebMarAprMayJunJulAugSepOctNovDecJanuaryFebruaryMarchAprilJuneJulyAugustSeptemberOctoberNovemberDecemberSunMonTueWedThuFriSatSundayMondayTuesdayWednesdayThursdayFridaySaturday%H:%M:%S%m/%d/%y%a %b %e %T %YAMPM%a %b %e %H:%M:%S %Z %Y_fmt%Y-%m-%d%H:%M%2d%03d%I:%M:%S %p%e-%b-%Y%04d_conv-0vsnprintfyp_match: clnt_callyp_next: clnt_call/var/run/ypbind.lock_yp_dobindclntudp_createfcntl: F_SETFDYP server for domain %s not responding, still trying clnttcp_create%s/%s.%d/var/yp/bindingЙ(Lh0Llě0Ld; errno = %s; s1 = %u, s2 = %u; why = (unknown authentication error - %d); low version = %u, high version = %uRPC: SuccessRPC: Can't encode argumentsRPC: Can't decode resultRPC: Unable to sendRPC: Unable to receiveRPC: Timed outRPC: Incompatible versions of RPCRPC: Authentication errorRPC: Program unavailableRPC: Program/version mismatchRPC: Procedure unavailableRPC: Server can't decode argumentsRPC: Remote system errorRPC: Unknown hostRPC: Port mapper failureRPC: Program not registeredRPC: Failed (unspecified error)RPC: Unknown protocolRPC: (unknown error code)%s: %s - %s Authentication OKInvalid client credentialServer rejected credentialInvalid client verifierServer rejected verifierClient credential too weakInvalid server verifierFailed (unspecified error)clnttcp_create: out of memory bindresvport_saxdrrec_create: out of memory perrorlibcUnknown error: Unknown signal: _catopen/usr/share/nls/%L/%N.cat:/usr/share/nls/%N/%LLANGNLSPATHО,@Xp$ȟܟ ,P`pؠ 8iHl 4Tlآ @Pḥ@dxĤԤ 4Lpĥ4L`|̦  Undefined error: 0Operation not permittedNo such file or directoryNo such processInterrupted system callInput/output errorDevice not configuredArgument list too longExec format errorBad file descriptorNo child processesResource deadlock avoidedPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkOperation not supported by deviceNot a directoryIs a directoryInvalid argumentToo many open files in systemToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksNumerical argument out of domainResult too largeResource temporarily unavailableOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not availableProtocol not supportedSocket type not supportedOperation not supportedProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceOperation timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downNo route to hostDirectory not emptyToo many processesToo many usersDisk quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticatorIPsec processing failureAttribute not foundIllegal byte sequenceNo medium foundWrong medium typeValue too large to be stored in data typeOperation canceledIdentifier removedNo message of desired typeY\hdhphxhhhhhhhhhii i,iDiXidipiiiiiiijj0jDj\jxdr_bytes: out of memory xdr_string: out of memory %$sniglet^&snprintf0123456789abcdef0123456789ABCDEF__sbprintfbug in vfprintf: bad baseINFinfNANnan__find_argumentsInfinityNaNisatty !#&(*-/14mABCDEF7yACnF?O8M20HwZ~???>ccpp `8 ǃx8 089 pp<cc8` a`p ǃ0 009 0`<cg8` q`` FLJ0 009 8|cf0`8  p089 `f?0?  ?8 `f0   8 `f 1   8 `f 1`İ   08 8 `8 q`8  088 0` `qxp ap8p  008 pp ~??>?~?> 0 4f xǎv|w0xxD\1``bˌ  .&Ș|`` 00( r @ t `"b`11F0 ~sLJ;??~~c   @@? `mF8|x`a1C  mv<88J|LJϜm~|8Z cc `Ș F@F R#cHX $|B b#c0`Ș ,FF gό9>|a`G8p 9>Xa@@@x@gg"" e j    ky ( JKYdu f    bv z!w" (F2R r u'g <<p%[)]*())* * ){{}}{}(())()[[]][]#$G>> P30123456789=:f/?/*?*n+n,N-N.m'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !+ Hh VqQ:q:QZZ    l h b  w  i x X      0  $  k  j  is a directory is not a regular file (use -f to see it)SS-aTg-,-bT@dgL-l-BTtg--cTlg- .,.dTAgT.p.eTLg...fTg..FTTg /8/gTg\/|//hTPg//HA|g000iTHgL0l00jT@g00JT!\g01lHLTxg181mTgP1`1p1nT"hg|111pTHxPT1qTDg11(2rT"g<2`22sT!Xg22ST!g2 3uT"g3H3d3VTwT"g|333xT(p 44XTAg$4L4yTpgl44zTg44"T 4~T!`g45?Tp #Tg05D5.TAgd5t5a (press RETURN)... (interrupt to abort)##,$382@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. $NetBSD: mount_nfs.c,v 1.12.4.1 1996/05/25 22:48:05 fvdl Exp $ $OpenBSD: getmntopts.c,v 1.10 2006/09/30 17:48:22 ray Exp $Ȏмظ11"t €u6Uu|agPtPS[X!Using drive X, partition YMBR on floppy or old BIOS Read error No O/S No active partition OxU+xULUU܁UUDU$WV`Ԅ4VLV TVЋxV8VXV<VWW,Wx4W05\hWWdWplXXCXX@Xa0a+!@aPaA`aBCDDpaEaFaGaUXVaaabx caefahaiaLalbnbqbq br,bs8bvHbwTbx`bu@(#) Copyright (c) 1980, 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: umount.c,v 1.20 2008/03/26 06:55:06 otto Exp $$OpenBSD: mount_msdos.c,v 1.22 2007/03/20 03:45:54 tedu Exp $$OpenBSD: getmntopts.c,v 1.10 2006/09/30 17:48:22 ray Exp $!!@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mknod.c,v 1.16 2007/12/30 13:52:40 sobrado Exp $Pklllll`5 $l ,l  4  4l(r$@lDlAHl8HPl(Xldlkll, xl!"|l#l$t%l&'(l)l*l+l,l-l.l/l0l1l2l3l4X5l6`ptppppp$qLqlqqqqr0rPr priorityrttvarrttssthreshsendpiperecvpipeexpirehopcountmtuUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CLONING XRESOLVE LLINFO STATIC BLACKHOLEPROTO3PROTO2PROTO1CLONEDSOURCEMPATHJUMBOUPBROADCASTDEBUGLOOPBACKPTPNOTRAILERSRUNNINGNOARP PPROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD LABELȻyaXyXyy<'<+fYx:fx<ftef7yf6DfLaf6LfdPf\h$fPXf,qLfc`fd8fhfHS4f$Vhfdtf8L,Wfd|f 7Јf f,@fNfPfL+ffdyf6Xf Rf w<f<^L_f$Vf`rfSfW{fDf^fW~f6fuf wzf9ȇf9Їfvf$V؇fLjfhff wfpfPfxNfNfDf$Af7f]05fdf`f,@fLU$f|,fq4f\d<f_DfvLfpf7TfHN`f,a nfuH5fFhf`7pfpfTryf6xfxL'f4fcUf[fNWfQ<NOOP @(#) Copyright (c) 1980, 1986, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: reboot.c,v 1.29 2007/05/11 01:53:07 tedu Exp $@(#) Copyright (c) 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount_ffs.c,v 1.19 2006/08/11 11:47:39 pedro Exp $$OpenBSD: getmntopts.c,v 1.10 2006/09/30 17:48:22 ray Exp $d( 0(EHC P E(  0(EHDHC ;Zx0N$OpenBSD: buf.c,v 1.18 2008/02/12 07:57:29 otto Exp $$OpenBSD: cbc.c,v 1.15 2008/06/08 13:58:10 tobias Exp $@ $OpenBSD: glbl.c,v 1.11 2007/09/03 14:26:54 deraadt Exp $$OpenBSD: io.c,v 1.12 2007/11/06 10:22:29 chl Exp $l$OpenBSD: main.c,v 1.32 2009/01/28 22:17:30 sobrado Exp $\H$OpenBSD: re.c,v 1.10 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: sub.c,v 1.10 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: undo.c,v 1.9 2007/09/02 15:19:07 deraadt Exp $t$OpenBSD: utils.c,v 1.29 2007/09/22 21:10:49 sobrado Exp $, 4 ... ...LXTXXX`XhXpXxXXXXXXXXXXXXXXXXYYYLXY Y(Y0Y4YDXX@f?Pf@`f[tf\f\f]f^f^f_f_f`f{f{g| g},g}@g~Hg?LXTXXX`XhXpXxXXXXXXXXXXXXXXXXYYYLXY Y(Y0Y4YDXX$C@@ JLLQTZ_fq44~mm#!/bin/sh - PATH=/sbin:/usr/sbin:/bin:/usr/bin T=$0 [ "$eo" ] || eo= hex() { case $1 in [0-9]) echo -n $1;; 10) echo -n a;; 11) echo -n b;; 12) echo -n c;; 13) echo -n d;; 14) echo -n e;; 15) echo -n f;; esac } alph2d() { local t="$1" local p="0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ" local sub=${p%${t}*} echo ${#sub} } h2d() { local s="$1" local f=${s%*[0-9a-f]} n=${s#[0-9a-f]*} echo $(($(_h2d $f)*16+ $(_h2d $n) )) } _h2d() { case $1 in [0-9]) echo -n $1;; a) echo -n 10;; b) echo -n 11;; c) echo -n 12;; d) echo -n 13;; e) echo -n 14;; f) echo -n 15;; esac } unt() { arg="$1" tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" while [ "$tmp" != "$arg" ] do arg=$tmp tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" done echo $arg } dodisk() { [ "$DEBUG" ] && set -x n=$(($((${5}*${7:-16}))+${6})) count=0 [ 0$7 -ne 8 ] && l="i j k l m n o p" for d in a b c d e f g h $l do M $1$2$d b $3 $(($n+$count)) 640 operator M r$1$2$d c $4 $(($n+$count)) 640 operator let count=count+1 done } dodisk2() { n=$(($(($5*${7:-16}))+$6)) M $1$2a b $3 $n 640 operator M r$1$2a c $4 $n 640 operator n=$(($n+2)) M $1$2c b $3 $n 640 operator M r$1$2c c $4 $n 640 operator } RMlist[0]="rm -f" mkl() { mklist[${#mklist[*]}]=";mknod -m $1 $2 $3 $4 $5" } M() { RMlist[${#RMlist[*]}]=$1 mkl ${5-666} $1 $2 $3 $4 G=${6:-wheel} [ "$7" ] && { MKlist[${#MKlist[*]}]=";chown $7:$G $1" } || { case $G in wheel) [ ${#whlist[*]} = 0 ] && whlist[0]=";chgrp wheel" whlist[${#whlist[*]}]="$1" ;; operator) [ ${#oplist[*]} = 0 ] && oplist[0]=";chgrp operator" oplist[${#oplist[*]}]="$1" ;; *) MKlist[${#MKlist[*]}]=";chgrp $G $1"; esac } return 0 } R() { [ "$DEBUG" ] && set -x for i in "$@" do U=`unt $i` [ "$U" ] || U=0 case $i in ramdisk) R std bpf0 wd0 wd1 sd0 tty00 rd0 wsmouse R st0 ttyC0 wskbd0 apm bio ;; std) M console c 0 0 600 M tty c 1 0 M mem c 2 0 640 kmem M kmem c 2 1 640 kmem M null c 2 2 M zero c 2 12 M stdin c 7 0 M stdout c 7 1 M stderr c 7 2 M ksyms c 8 0 640 kmem M klog c 6 0 600 ;; xfs*) M xfs$U c 51 $U 600 ;; video*) M video$U c 38 $U MKlist[${#MKlist[*]}]=";[ -e video ] || ln -s video$U video" ;; tuner*) M tuner$U c 75 $(($(($U*2))+16)) 644 ;; systrace) M systrace c 50 0 644 ;; ss*) M ss$U c 29 $(($U*16)) 640 operator M nss$U c 29 $(($(($U*16))+1)) 640 operator M enss$U c 29 $(($(($U*16))+3)) 640 operator RMlist[${#RMlist[*]}]="scan$U" MKlist[${#MKlist[*]}]=";umask 77;ln -s ss$U scan$U" ;; uk*) M uk$U c 28 $U 640 operator ;; tun*) M tun$U c 33 $U 600 ;; *random) n=0 for pre in " " s u a do M ${pre}random c 40 $n 644 n=$(($n+1)) done ;; radio*) M radio$U c 97 $U MKlist[${#MKlist[*]}]=";[ -e radio ] || ln -s radio$U radio" ;; pf*) M pf c 46 0 600 ;; lkm) M lkm c 35 0 640 _lkm ;; fd) RMlist[${#RMlist[*]}]=";mkdir -p fd;rm -f" n=0 while [ $n -lt 64 ];do M fd/$n c 7 $n;n=$(($n+1));done MKlist[${#MKlist[*]}]=";chmod 555 fd" ;; crypto) M crypto c 47 0 ;; bpf*) M bpf$U c 22 $U 600 ;; bktr*) M bktr$U c 75 $U 644 ;; bio) M bio c 52 0 600 ;; hotplug) M hotplug c 37 $U 400 ;; audio*) M sound$U c 36 $U M mixer$U c 36 $(($U+16)) M audio$U c 36 $(($U+128)) M audioctl$U c 36 $(($U+192)) MKlist[${#MKlist[*]}]=";[ -e audio ] || ln -s audio$U audio" MKlist[${#MKlist[*]}]=";[ -e mixer ] || ln -s mixer$U mixer" MKlist[${#MKlist[*]}]=";[ -e sound ] || ln -s sound$U sound" MKlist[${#MKlist[*]}]=";[ -e audioctl ] || ln -s audioctl$U audioctl" ;; apm*) M apm c 34 0 644 M apmctl c 34 8 644 ;; uscanner*) M uscanner$U c 69 $U 660 ;; usb*) [ "$i" = "usb" ] && u= || u=$U M usb$u c 64 $U 660 ;; urio*) M urio$U c 67 $U 660 ;; ulpt*) M ulpt$U c 66 $U 660 ;; uhid*) M uhid$U c 65 $U 660 ;; ugen*) n=$(($U*16)) for j in 0{0,1,2,3,4,5,6,7,8,9} 1{0,1,2,3,4,5} do M ugen$U.$j c 70 $(($n+10#$j)) 660 done ;; ttyU[0-9a-zA-Z]) U=${i#ttyU*} o=$(alph2d $U) M ttyU$U c 68 $o 660 dialer uucp M cuaU$U c 68 $(($o+128)) 660 dialer uucp ;; uall) R ttyU0 ttyU1 ttyU2 ttyU3 ugen0 ugen1 ulpt0 ulpt1 uhid0 uhid1 R uhid2 uhid3 uscanner0 urio0 usb0 usb1 usb2 usb3 usb4 usb5 ;; wsmux|wsmouse|wskbd) M wsmouse c 63 0 600 M wskbd c 63 1 600 ;; wsmouse*) M wsmouse$U c 62 $U 600 ;; wskbd*) M wskbd$U c 61 $U 600 ;; tty[C-J]*) U=${i##tty[C-J]} case $i in ttyC*) n=C m=0;; ttyD*) n=D m=256;; ttyE*) n=E m=512;; ttyF*) n=F m=768;; ttyG*) n=G m=1024;; ttyH*) n=H m=1280;; ttyI*) n=I m=1536;; ttyJ*) n=J m=1792;; esac case $U in [0-9a-f]) M tty$n$U c 60 $((16#$U+$m)) 600;; cfg) M tty${n}cfg c 60 $((255+$m)) 600;; *) echo bad unit $U for $i; exit 1;; esac ;; wscons) R wsmouse0 wsmouse1 wsmouse2 wsmouse3 wskbd0 wskbd1 wskbd2 R wskbd3 wsmux ttyCcfg ttyC0 ttyC1 ttyC2 ttyC3 ttyC4 ttyC5 R ttyC6 ttyC7 ttyC8 ttyC9 ttyCa ttyCb ;; pty*) if [ $U -gt 15 ]; then echo bad unit for pty in: $i continue fi set -A letters p q r s t u v w x y z P Q R S T set -A suffixes 0 1 2 3 4 5 6 7 8 9 a b c d e f g h i j k l m n o p q \ r s t u v w x y z A B C D E F G H I J K L M N O P Q R S T U V W X \ Y Z name=${letters[$U]} n=0 while [ $n -lt 62 ] do nam=$name${suffixes[$n]} off=$(($U*62)) M tty$nam c 4 $(($off+$n)) M pty$nam c 5 $(($off+$n)) n=$(($n+1)) done ;; ptm) M ptm c 98 0 666 ;; tty[0-7][0-9a-f]) U=${i#tty*} o=$(h2d $U) M tty$U c 12 $o 660 dialer uucp M cua$U c 12 $(($o+128)) 660 dialer uucp ;; st*) n=$(($U*16)) for pre in " " n e en do M ${pre}st$U b 25 $n 660 operator M ${pre}rst$U c 25 $n 660 operator n=$(($n+1)) done ;; vnd*) dodisk vnd $U 19 19 $U 0 dodisk svnd $U 19 19 $U 2048 ;; rd*) dodisk2 rd $U 18 18 $U 0 ;; ch*) M ch$U c 27 $U 660 operator ;; cd*) dodisk2 cd $U 26 26 $U 0 ;; local) test -s $T.local && sh $T.local ;; all) R ccd0 ccd1 ccd2 ccd3 vnd0 vnd1 vnd2 vnd3 sd0 sd1 sd2 sd3 sd4 R sd5 sd6 sd7 sd8 sd9 cd0 cd1 rd0 tun0 tun1 tun2 tun3 bpf0 R bpf1 bpf2 bpf3 bpf4 bpf5 bpf6 bpf7 bpf8 bpf9 pty0 bio xfs0 R ss0 ss1 ch0 hotplug ptm local wscons uall tuner0 radio0 R video0 audio0 audio1 audio2 uk0 random lkm tty00 tty01 tty02 R tty03 apm crypto pf systrace wd0 wd1 wd2 wd3 raid0 raid1 R raid2 raid3 std st0 st1 fd ;; wd*|sd*|raid*|ccd*) case $i in wd*) dodisk wd $U 16 16 $U 0;; sd*) dodisk sd $U 24 24 $U 0;; raid*) dodisk raid $U 71 71 $U 0;; ccd*) dodisk ccd $U 21 21 $U 0;; esac ;; *) echo $i: unknown device ;; esac done } R "$@" { echo -n ${RMlist[*]} echo -n ${mklist[*]} echo -n ${MKlist[*]} echo -n ${whlist[*]} echo ${oplist[*]} } | if [ "$eo" = "echo" ]; then cat else sh fi @ . ..FMAKEDEVGconsoleH ttyI memJkmem}yKnull}yLzero}yMstdinyNstdoutOstderrPksymsyQklog}yRbpf0}ySwd0a}yTrwd0ayUwd0b}yVrwd0byWwd0c}yXrwd0cyYwd0d}yZrwd0dy[wd0e}y\rwd0ey]wd0f}y^rwd0fy_wd0g}y`rwd0gyawd0h}ybrwd0hycwd0i}ydrwd0iyewd0j}yfrwd0jygwd0k}yhrwd0kyiwd0l}yjrwd0lykwd0m}ylrwd0mymwd0n}ynrwd0nyowd0o}yprwd0oyqwd0p}yrrwd0pyswd1a}ytrwd1ayuwd1b}yvrwd1bywwd1c}yxrwd1cyywd1d}yzrwd1dy{wd1e}y|rwd1ey}wd1f}y~rwd1fywd1g}yƀrwd1gyƁwd1h}yƂrwd1hyƃwd1i}yƄrwd1iyƅwd1j}yƆrwd1jyƇwd1k}yƈrwd1kyƉwd1l}yƊrwd1lyƋwd1m}yƌrwd1myƍwd1n}yƎrwd1nyƏwd1o}yƐrwd1oyƑwd1p}yƒrwd1pyƓsd0a}yƔrsd0ayƕsd0b}yƖrsd0byƗsd0c}yƘrsd0cyƙsd0d}yƚrsd0dyƛsd0e}yƜrsd0eyƝsd0f}yƞrsd0fyƟsd0g}yƠrsd0gyơsd0h}yƢrsd0hyƣsd0i}yƤrsd0iyƥsd0j}yƦrsd0jyƧsd0k}yƨrsd0kyƩsd0l}yƪrsd0lyƫsd0m}yƬrsd0myƭsd0n}yƮrsd0nyƯsd0o}yưrsd0oyƱsd0p}yƲrsd0pyƳtty00yƴcua00yƵrd0a}yƶrrd0ayƷrd0c}yƸrrd0cyƹwsmousewskbdyƻ st0rst0}yƽnst0}yƾnrst0yƿest0}yerst0yenst0yenrst0ttyC0ywskbd0 apmapmctlbio . .. pppfirmwareygroup9spwd.db protocols+services+ fstabE resolv.conf\ hostsE ... . ..chownydhclient9 disklabel9dmesgyfdiskyfsck]y fsck_ext2fsfsck_ffs9ifconfig9init]ymknodymounty mount_cd9660+ mount_ext2fs+ mount_ffs9 mount_msdos mount_nfs9newfsy newfs_msdosping]yping6yreboothalt]yrouteyrtsolyumountbioctl .B ..ztsscale9 .B ..miscJkeymaps . ..termcapwheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root bin:*:7: news:*:8: wsrc:*:9: users:*:10: auth:*:11: games:*:13: staff:*:20:root smmsp:*:25: popa3d:*:26: sshd:*:27: _portmap:*:28: _identd:*:29: _rstatd:*:30: guest:*:31:root _rusersd:*:32: _fingerd:*:33: _sshagnt:*:34: _x11:*:35: utmp:*:45: _kdc:*:59: _kadmin:*:60: _lkm:*:61: _spamd:*:62: _radius:*:63: _token:*:64: _shadow:*:65: crontab:*:66: www:*:67: _isakmpd:*:68: network:*:69: named:*:70: proxy:*:71: authpf:*:72: _syslogd:*:73: _pflogd:*:74: _bgpd:*:75: _tcpdump:*:76: _dhcp:*:77: _mopd:*:78: _tftpd:*:79: _rbootd:*:80: _afs:*:81: _ppp:*:82: _ntp:*:83: _ftp:*:84: _ospfd:*:85: _hostapd:*:86: _dvmrpd:*:87: _ripd:*:88: _relayd:*:89: _ospf6d:*:90: _snmpd:*:91: _rtadvd:*:92: _ypldap:*:93: _btd:*:94: dialer:*:117: nogroup:*:32766: nobody:*:32767: a  n}of!NI n i & ! K F   _relayd*YYRelay Daemon/var/empty/sbin/nologin2&_afs*QQafs Daemon/var/empty/sbin/nologin2_syslogd*IISyslog Daemon/var/empty/sbin/nologin2_kdc*;;Kerberos Server/var/empty/sbin/nologin2popa3d*POP3 Server/var/empty/sbin/nologin2_ypldap*]]YP to LDAP Daemon/var/empty/sbin/nologin3]_ospfd*UUOSPF Daemon/var/empty/sbin/nologin3U_dhcp*MMDHCP programs/var/empty/sbin/nologin3M_identd*identd/var/empty/sbin/nologin3_ppp*RRPPP utilities/var/empty/sbin/nologin1_ppp_mopd*NNMOP Daemon/var/empty/sbin/nologin1_mopd_rusersd* rpc.rusersd/var/empty/sbin/nologin1_rusersd_identd*identd/var/empty/sbin/nologin1_identdpopa3d*POP3 Server/var/empty/sbin/nologin1popa3d 08`YI<  YI:`[~ [~YI`@@<@TU 0YIb0YIAYI=$YI R $YI R fAYIAuYIAuYIAu VAYIN7 /YI#(/YI#( ]AYI-"YI& "YI& ϔTAYI.YI04YI04 b>AYI?t$YIk$YIk i>M#YIG.#YII/#YII/eH~#YI1$YInr$YInr`hpxPT)$YIb$YI**$YI**d$YI$YIj$YIjTz$YIl(W $YIl(W $YIl(W /tmp/fstab.shadow|4 $YI $YI $YI /tmp/resolv.conf.shadow(: $YI R $YI R $YI R /tmp/hosts- $ $YIk/YI _#/YI _#ŐM /YI>CZ&/YI+0YI5z| Kx1+w3%ߵR<V#B}C EW#v DYZAiT <`ep @zC<=7;ܱ,&vZ.N,p,%~/<deM){$N4tly躱yÕϻke_"!=\lD[\{fhF@ҮՔiDNF-xU{K4ZAOmBe|B *=<,M%8zO6ORBޭvFNIMMsUb]3aAoi[aX}s;N^fI] L`Wk $WK,p/.qOgHJ Q9;K?GT)1qbIeZlgT(n}і(\7S#+L>\ͣ<q5y0mi~_f?v?Al@U Wqi uO֚|gv8Kpc cE -2+zGj;<]LDoj > 9 L G n , n _ospf6d*ZZOSPF6 Daemon/var/empty/sbin/nologin2'_ppp*RRPPP utilities/var/empty/sbin/nologin2_pflogd*JJpflogd privsep/var/empty/sbin/nologin2_kadmin*<<Kerberos Admin Server/var/empty/sbin/nologin2sshd*sshd privsep/var/empty/sbin/nologin2nobody*Unprivileged user for NFS/nonexistent/sbin/nologin3_btd*^^Bluetooth Daemon/var/empty/sbin/nologin3^_hostapd*VVHostAP Daemon/var/empty/sbin/nologin3V_mopd*NNMOP Daemon/var/empty/sbin/nologin3Nnamed*FFBIND Name Service Daemon/var/named/sbin/nologin3F_spamd*>>Spam Daemon/var/empty/sbin/nologin3>_rstatd*rpc.rstatd/var/empty/sbin/nologin3_relayd*YYRelay Daemon/var/empty/sbin/nologin1_relayd_isakmpd*DDisakmpd privsep/var/empty/sbin/nologin1_isakmpdsmmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin1smmsp*fa#A< r j %  > 9 ` [   G B _snmpd*[[SNMP Daemon/var/empty/sbin/nologin2(_ntp*SSNTP Daemon/var/empty/sbin/nologin2 _bgpd*KKBGP Daemon/var/empty/sbin/nologin2_spamd*>>Spam Daemon/var/empty/sbin/nologin2_portmap*portmap/var/empty/sbin/nologin2_dvmrpd*WWDVMRP Daemon/var/empty/sbin/nologin3W_tftpd*OOTFTP Daemon/var/empty/sbin/nologin3Oproxy*GGProxy Services/nonexistent/sbin/nologin3G_btd*^^Bluetooth Daemon/var/empty/sbin/nologin1_btd_ypldap*]]YP to LDAP Daemon/var/empty/sbin/nologin1_ypldap_snmpd*[[SNMP Daemon/var/empty/sbin/nologin1_snmpd_ospf6d*ZZOSPF6 Daemon/var/empty/sbin/nologin1_ospf6d_ftp*TTFTP Daemon/var/empty/sbin/nologin1_ftp_ntp*SSNTP Daemon/var/empty/sbin/nologin1_ntp_afs*QQafs Daemon/var/empty/sbin/nologin1_afs_rbootd*PPrbootd Daemon/var/empty/sbin/nologin1_rbootd_tftpd*OOTFTP Daemon/var/empty/sbin/nologin1_tftpd_kdc*;;Kerberos Server/var/empty/sbin/nologin1_kdc_x11*##X Server/var/empty/sbin/nologin1_x11_rstatd*rpc.rstatd/var/empty/sbin/nologin1_rstatdbin*Binaries Commands and Source,,,//sbin/nologin1binoi"ID y t 5 0 @ ; _rtadvd*\\IPv6 Router Advertisement Daemon/var/empty/sbin/nologin2)_ftp*TTFTP Daemon/var/empty/sbin/nologin2!_tcpdump*LLtcpdump privsep/var/empty/sbin/nologin2uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2_identd*identd/var/empty/sbin/nologin2 rootdaemonCharlie &/root/bin/ksh2_ripd*XXRIP Daemon/var/empty/sbin/nologin3X_rbootd*PPrbootd Daemon/var/empty/sbin/nologin3P_rusersd* rpc.rusersd/var/empty/sbin/nologin3 rootdaemonCharlie &/root/bin/ksh3_hostapd*VVHostAP Daemon/var/empty/sbin/nologin1_hostapdproxy*GGProxy Services/nonexistent/sbin/nologin1proxy_portmap*portmap/var/empty/sbin/nologin1_portmapsshd*sshd privsep/var/empty/sbin/nologin1sshd [T ni  { v 6 1 [ V   8 8 _ypldap*]]YP to LDAP Daemon/var/empty/sbin/nologin2*_ospfd*UUOSPF Daemon/var/empty/sbin/nologin2"_dhcp*MMDHCP programs/var/empty/sbin/nologin2www*CCHTTP Server/var/www/sbin/nologin2_rstatd*rpc.rstatd/var/empty/sbin/nologin2 daemon*The devil himself/root/sbin/nologin2_relayd*YYRelay Daemon/var/empty/sbin/nologin3Y_afs*QQafs Daemon/var/empty/sbin/nologin3Q_syslogd*IISyslog Daemon/var/empty/sbin/nologin3I_fingerd*!!fingerd/var/empty/sbin/nologin3!smmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin3daemon*The devil himself/root/sbin/nologin3nobody*Unprivileged user for NFS/nonexistent/sbin/nologin1nobody_ospfd*UUOSPF Daemon/var/empty/sbin/nologin1_ospfd_pflogd*JJpflogd privsep/var/empty/sbin/nologin1_pflogd_kadmin*<<Kerberos Admin Server/var/empty/sbin/nologin1_kadmin*vm,%KB K F  [ V  } x 7 2 Y T  h _btd*^^Bluetooth Daemon/var/empty/sbin/nologin2+_hostapd*VVHostAP Daemon/var/empty/sbin/nologin2#_mopd*NNMOP Daemon/var/empty/sbin/nologin2_isakmpd*DDisakmpd privsep/var/empty/sbin/nologin2_rusersd* rpc.rusersd/var/empty/sbin/nologin2 operator*System &/operator/sbin/nologin2_ospf6d*ZZOSPF6 Daemon/var/empty/sbin/nologin3Z_ppp*RRPPP utilities/var/empty/sbin/nologin3R_pflogd*JJpflogd privsep/var/empty/sbin/nologin3Juucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Bpopa3d*POP3 Server/var/empty/sbin/nologin3operator*System &/operator/sbin/nologin3_rtadvd*\\IPv6 Router Advertisement Daemon/var/empty/sbin/nologin1_rtadvd_dvmrpd*WWDVMRP Daemon/var/empty/sbin/nologin1_dvmrpd_tcpdump*LLtcpdump privsep/var/empty/sbin/nologin1_tcpdump_bgpd*KKBGP Daemon/var/empty/sbin/nologin1_bgpd_syslogd*IISyslog Daemon/var/empty/sbin/nologin1_syslogd_spamd*>>Spam Daemon/var/empty/sbin/nologin1_spamdoperator*System &/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonrootdaemonCharlie &/root/bin/ksh1root"\Vpk-( Z U   } x 7 2 Q L nobody*Unprivileged user for NFS/nonexistent/sbin/nologin2,_dvmrpd*WWDVMRP Daemon/var/empty/sbin/nologin2$_tftpd*OOTFTP Daemon/var/empty/sbin/nologin2named*FFBIND Name Service Daemon/var/named/sbin/nologin2_fingerd*!!fingerd/var/empty/sbin/nologin2 bin*Binaries Commands and Source,,,//sbin/nologin2_snmpd*[[SNMP Daemon/var/empty/sbin/nologin3[_ntp*SSNTP Daemon/var/empty/sbin/nologin3S_bgpd*KKBGP Daemon/var/empty/sbin/nologin3Kwww*CCHTTP Server/var/www/sbin/nologin3C_kdc*;;Kerberos Server/var/empty/sbin/nologin3;_x11*##X Server/var/empty/sbin/nologin3#sshd*sshd privsep/var/empty/sbin/nologin3bin*Binaries Commands and Source,,,//sbin/nologin3named*FFBIND Name Service Daemon/var/named/sbin/nologin1namedwww*CCHTTP Server/var/www/sbin/nologin1wwwuucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucplf% >9 M H ] X  _ripd*XXRIP Daemon/var/empty/sbin/nologin2%_rbootd*PPrbootd Daemon/var/empty/sbin/nologin2proxy*GGProxy Services/nonexistent/sbin/nologin2_x11*##X Server/var/empty/sbin/nologin2 smmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin2_rtadvd*\\IPv6 Router Advertisement Daemon/var/empty/sbin/nologin3\_ftp*TTFTP Daemon/var/empty/sbin/nologin3T_tcpdump*LLtcpdump privsep/var/empty/sbin/nologin3L_isakmpd*DDisakmpd privsep/var/empty/sbin/nologin3D_kadmin*<<Kerberos Admin Server/var/empty/sbin/nologin3<_portmap*portmap/var/empty/sbin/nologin3_ripd*XXRIP Daemon/var/empty/sbin/nologin1_ripd_dhcp*MMDHCP programs/var/empty/sbin/nologin1_dhcp_fingerd*!!fingerd/var/empty/sbin/nologin1_fingerdip 0 IP icmp 1 ICMP tcp 6 TCP udp 17 UDP ftp-data 20/tcp ftp 21/tcp domain 53/tcp nameserver domain 53/udp nameserver www 80/tcp http shell 514/tcp cmd nfsd 2049/udp nfs nfsd 2049/tcp nfs dumb|80-column dumb tty:\ :am:\ :co#80:\ :bl=^G:cr=^M:do=^J:sf=^J: vt100|vt100-am|dec vt100 (w/advanced video):\ :am:bs:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :@8=\EOM:DO=\E[%dB:K1=\EOq:K2=\EOr:K3=\EOs:K4=\EOp:K5=\EOn:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=^O:as=^N:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:do=^J:\ :eA=\E(B\E)0:ho=\E[H:k0=\EOy:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k5=\EOt:k6=\EOu:k7=\EOv:k8=\EOl:k9=\EOw:k;=\EOx:\ :kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:\ :ku=\EOA:le=^H:mb=\E[5m:md=\E[1m:me=\E[m\017:mr=\E[7m:\ :nd=\E[C:rc=\E8:rs=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :..sa=\E[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t\016%e\017%;:\ :sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: vt220|vt200|DEC VT220 in vt100 emulation mode:\ :am:bs:mi:pt:xn:xo:\ :co#80:li#24:vt#3:\ :@7=\E[4~:RA=\E[?7l:SA=\E[?7h:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:ho=\E[H:\ :if=/usr/share/tabset/vt100:im=\E[4h:\ :is=\E[1;24r\E[24;1H:k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:\ :k5=\E[17~:k6=\E[18~:k7=\E[19~:k8=\E[20~:k9=\E[21~:\ :k;=\E[29~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=\177:\ :kd=\E[B:kh=\E[1~:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:nl=^J:rc=\E8:\ :rf=/usr/share/tabset/vt100:\ :rs=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :..sa=\E[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t\E(0%e\E(B%;:\ :sc=\E7:se=\E[27m:sf=20\ED:so=\E[7m:sr=14\EM:ta=^I:\ :ue=\E[24m:up=\E[A:us=\E[4m:ve=\E[?25h:vi=\E[?25l:  . ..chownydhclient9 disklabel9dmesgyfdiskyfsck]y fsck_ext2fsfsck_ffs9ifconfig9init]ymknodymounty mount_cd9660+ mount_ext2fs+ mount_ffs9 mount_msdos mount_nfs9newfsy newfs_msdosping]yping6yreboothalt]yrouteyrtsolyumountbioctldhclient-script#!/bin/sh delete_old_address() { if [ -n "$old_ip_address" ]; then ifconfig $interface inet $old_ip_address delete $medium route delete "$old_ip_address" 127.0.0.1 >/dev/null 2>&1 fi } add_new_address() { ifconfig $interface \ inet $new_ip_address \ netmask $new_subnet_mask \ broadcast $new_broadcast_address \ $medium route add $new_ip_address 127.0.0.1 >/dev/null 2>&1 } delete_old_alias() { if [ -n "$alias_ip_address" ]; then ifconfig $interface \ inet $alias_ip_address delete > /dev/null 2>&1 route delete $alias_ip_address 127.0.0.1 > /dev/null 2>&1 fi } add_new_alias() { if [ -n "$alias_ip_address" ]; then ifconfig $interface inet $alias_ip_address alias netmask \ $alias_subnet_mask route add $alias_ip_address 127.0.0.1 fi } delete_old_routes() { route delete default >/dev/null 2>&1 if [ -n "$old_static_routes" ]; then set $old_static_routes while [ $# -gt 1 ]; do route delete "$1" "$2" shift; shift done fi arp -dan } add_new_routes() { route delete default >/dev/null 2>&1 for router in $new_routers; do if [ "$new_ip_address" = "$router" ]; then route add default -iface $router >/dev/null 2>&1 else route add default $router >/dev/null 2>&1 fi break done if [ -n "$new_static_routes" ]; then set $new_static_routes while [ $# -gt 1 ]; do route add $1 $2 shift; shift done fi } add_new_resolv_conf() { rm -f /etc/resolv.conf.std if [ -n "$new_domain_name" ]; then echo "search $new_domain_name" >>/etc/resolv.conf.std fi if [ -n "$new_domain_name_servers" ]; then for nameserver in $new_domain_name_servers; do echo "nameserver $nameserver" >>/etc/resolv.conf.std done fi if [ -f /etc/resolv.conf.std ]; then if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >>/etc/resolv.conf.std fi if [ -f /etc/resolv.conf ]; then cat /etc/resolv.conf > /etc/resolv.conf.save fi cat /etc/resolv.conf.std > /etc/resolv.conf rm -f /etc/resolv.conf.std chown -RL root:wheel /etc/resolv.conf chmod -RL 644 /etc/resolv.conf return 0 fi return 1 } case $reason in MEDIUM) ifconfig $interface $medium sleep 1 ;; PREINIT) delete_old_alias ifconfig $interface up ;; ARPCHECK|ARPSEND) ;; BOUND|RENEW|REBIND|REBOOT) if [ -n "$old_ip_address" ]; then if [ "$old_ip_address" != "$alias_ip_address" ]; then delete_old_alias fi if [ "$old_ip_address" != "$new_ip_address" ]; then delete_old_address delete_old_routes fi fi if [ "$reason" = BOUND ] || [ "$reason" = REBOOT ] || [ -z "$old_ip_address" ] || [ "$old_ip_address" != "$new_ip_address" ]; then add_new_address add_new_routes fi if [ "$new_ip_address" != "$alias_ip_address" ]; then add_new_alias fi add_new_resolv_conf ;; EXPIRE|FAIL) delete_old_alias if [ -n "$old_ip_address" ]; then delete_old_address delete_old_routes fi add_new_alias if [ -f /etc/resolv.conf.save ]; then cat /etc/resolv.conf.save > /etc/resolv.conf fi ;; TIMEOUT) delete_old_alias add_new_address sleep 1 if [ -n "$new_routers" ]; then set "$new_routers" if ping -q -c 1 -w 1 "$1"; then if [ "$new_ip_address" != "$alias_ip_address" ]; then add_new_alias fi add_new_routes if add_new_resolv_conf; then exit 0 fi fi fi ifconfig $interface inet $new_ip_address delete $medium delete_old_routes exit 1 ;; esac exit 0 #!/bin/ksh FILESYSTEMS=/tmp/filesystems SWAPLIST=/tmp/swaplist MODE=install . install.sub if [ ! -f /etc/fstab ]; then DISK= _DKDEVS=$DKDEVS while :; do _DKDEVS=`rmel "$DISK" $_DKDEVS` if isin $ROOTDISK $_DKDEVS; then resp=$ROOTDISK rm -f /tmp/fstab cat /dev/null >$FILESYSTEMS cat /dev/null >$SWAPLIST else ask_which "disk" "do you wish to initialize" "$_DKDEVS" done "No more disks to initialize" [[ $resp == done ]] && break fi DISK=$resp makedev $DISK || continue rm -f /tmp/*.$DISK md_prep_disklabel $DISK unset _partitions _psizes _mount_points _i=0 disklabel $DISK 2>&1 | sed -ne '/^ *[a-p]: /p' >/tmp/disklabel.$DISK while read _dev _size _offset _type _rest; do _pp=${DISK}${_dev%:} if [[ $_pp == $ROOTDEV ]]; then echo "$ROOTDEV /" >$FILESYSTEMS continue elif [[ $_pp == $SWAPDEV || $_type == swap ]]; then echo "$_pp" >>$SWAPLIST continue elif [[ $_type != *BSD ]]; then continue fi _partitions[$_i]=$_pp _psizes[$_i]=$_size if [[ -f /tmp/fstab.$DISK ]]; then while read _pp _mp _rest; do [[ $_pp == "/dev/${_partitions[$_i]}" ]] || continue [[ -n $(grep " $_mp\$" $FILESYSTEMS) ]] && break isin $_mp ${_mount_points[*]} && break [[ $_mp == '/' ]] && break _mount_points[$_i]=$_mp done >$FILESYSTEMS : $(( _i += 1 )) done done cat <<__EOT OpenBSD filesystems: $(<$FILESYSTEMS) The next step *DESTROYS* all existing data on these partitions! __EOT ask_yn "Are you really sure that you're ready to proceed?" [[ $resp == n ]] && { echo "Ok, try again later." ; exit ; } _i=0 unset _partitions _mount_points while read _pp _mp; do _OPT= [[ $_mp == / ]] && _OPT=$MDROOTFSOPT newfs -q $_OPT /dev/r$_pp _partitions[$_i]=$_pp _mount_points[$_i]=$_mp : $(( _i += 1 )) done <$FILESYSTEMS for _mp in `bsort ${_mount_points[*]}`; do _i=0 for _pp in ${_partitions[*]}; do if [ "$_mp" = "${_mount_points[$_i]}" ]; then echo -n "/dev/$_pp $_mp ffs rw" if [[ $_mp == / ]]; then echo " 1 1" else echo -n ",nodev" case $_mp in /sbin|/usr) ;; /usr/bin|/usr/sbin) ;; /usr/libexec|/usr/libexec/*) ;; /usr/local|/usr/local/*) ;; /usr/X11R6|/usr/X11R6/bin) ;; *) echo -n ",nosuid" ;; esac echo " 1 2" fi fi : $(( _i += 1 )) done done >>/tmp/fstab while read _dev; do [[ $_dev == $SWAPDEV ]] || \ echo "/dev/$_dev none swap sw 0 0" >>/tmp/fstab done <$SWAPLIST munge_fstab fi mount_fs "-o async" ask_until "\nSystem hostname? (short form, e.g. 'foo')" "$(hostname -s)" [[ ${resp%%.*} != $(hostname -s) ]] && hostname $resp THESETS="$THESETS site$VERSION-$(hostname -s).tgz" ( cd /tmp; rm -f host* my* resolv.conf resolv.conf.tail dhclient.* ) cat >/tmp/hosts <<__EOT ::1 localhost 127.0.0.1 localhost ::1 $(hostname -s) 127.0.0.1 $(hostname -s) __EOT ask_yn "Configure the network?" yes [[ $resp == y ]] && donetconfig _oifs=$IFS IFS= while :; do askpass "Password for root account? (will not echo)" _password=$resp askpass "Password for root account? (again)" [[ "$resp" == "$_password" ]] && break echo "Passwords do not match, try again." done IFS=$_oifs install_sets while read _dev _mp _fstype _opt _rest; do mount -u -o $_opt $_dev $_mp || exit done /tmp/ttys mv /tmp/ttys /mnt/etc/ttys questions echo -n "Saving configuration files..." ( cd /var/db [ -f dhclient.leases ] && mv dhclient.leases /mnt/var/db/. ) ( cd /tmp hostname >myname _dn=$(get_fqdn) while read _addr _hn _aliases; do if [[ -n $_aliases || $_hn != ${_hn%%.*} || -z $_dn ]]; then echo "$_addr\t$_hn $_aliases" else echo "$_addr\t$_hn.$_dn $_hn" fi done hosts.new mv hosts.new hosts save_comments hosts save_comments dhclient.conf for _f in fstab host* kbdtype my* ttys *.conf *.tail; do [[ -f $_f && -s $_f ]] && mv $_f /mnt/etc/. done ) _encr=`/mnt/usr/bin/encrypt -b 8 -- "$_password"` echo "1,s@^root::@root:${_encr}:@ w q" | /mnt/bin/ed /mnt/etc/master.passwd 2>/dev/null /mnt/usr/sbin/pwd_mkdb -p -d /mnt/etc /etc/master.passwd echo -n "done.\nGenerating initial host.random file..." ( cd /mnt/var/db /mnt/bin/dd if=/mnt/dev/urandom of=host.random bs=1024 count=64 >/dev/null 2>&1 chmod 600 host.random >/dev/null 2>&1 ) echo "done." set_timezone finish_up .tgz" done SANESETS="bsd base${VERSION}.tgz etc${VERSION}.tgz" : ${EDITOR:=ed} [[ -x /usr/bin/vi ]] && EDITOR=vi export EDITOR [[ -f /etc/fstab ]] && umount -av 1>/dev/null 2>&1 umount -v /mnt 1>/dev/null 2>&1 welcome if [[ $MODE == install && ! -f /etc/fstab ]]; then cat <<__EOT You will now initialize the disk(s) that OpenBSD will use. To enable all available security features you should configure the disk(s) to allow the creation of separate filesystems for /, /tmp, /var, /usr, and /home. __EOT fi set -- $DKDEVS [[ $# -gt 1 ]] && _defdsk=done ask_which "disk" "is the root disk" "$DKDEVS" "$_defdsk" [[ $resp == done ]] && exit makedev $resp || exit ROOTDISK=$resp ROOTDEV=${ROOTDISK}a SWAPDEV=${ROOTDISK}b . install.md set_term() { local _tables TERM=${TERM:-${MDTERM:-vt220}} ask "Terminal type?" $TERM export TERM=$resp [[ -x /sbin/kbd ]] || return _tables=$(bsort $(kbd -l | egrep -v "^(user|tables|encoding)")) while :; do ask "kbd(8) mapping? ('L' for list)" "none" case $resp in [Ll?]) echo "Major tables: $_tables" ;; none) return ;; *) kbd $resp && { echo $resp >/tmp/kbdtype ; return ; } ;; esac done } welcome() { local _q cat <<__EOT Welcome to the $OBSD $MODE program. This program will help you $MODE OpenBSD. At any prompt except password prompts you can escape to a shell by typing '!'. Default answers are shown in []'s and are selected by pressing RETURN. At any time you can exit this program by pressing Control-C, but exiting during an $MODE can leave your system in an inconsistent state. __EOT set_term cat <<__EOT IS YOUR DATA BACKED UP? As with anything that modifies disk contents, this program can cause SIGNIFICANT data loss. __EOT case $MODE in upgrade) cat <<__EOT NOTE: once your system has been upgraded, you must manually merge any changes to files in the 'etc' set into the files already on your system. __EOT _q="Proceed with upgrade?" ;; install) cat <<__EOT It is often helpful to have the installation notes handy. For complex disk configurations, relevant disk hardware manuals and a calculator are useful. __EOT if [ -f /etc/fstab ]; then cat <<__EOT You seem to be trying to restart an interrupted installation! You can skip the disk preparation steps and continue, or you can reboot and start over. __EOT _q="Skip disk initialization?" else _q="Proceed with install?" fi ;; esac ask_yn "$_q" if [[ $resp == n ]]; then cat <<__EOT Enter 'halt' at the prompt to gracefully exit OpenBSD. You can then power cycle the machine and boot your original OS. __EOT exit fi echo "Cool! Let's get to it." } stripcom () { local _l [[ -f $1 ]] || return while read _l; do [[ -n ${_l%%#*} ]] && echo $_l done <$1 } scan_dmesg() { bsort $(sed -ne "$1" /var/run/dmesg.boot) } scan_disknames() { local _n _oifs=$IFS IFS="," bsort $(for _n in $(disknames); do echo "$_n "; done | sed -ne "$1") IFS=$_oifs } get_ifdevs() { ifconfig \ | egrep -v '^[[:space:]]|(bridge|enc|gif|gre|lo|pflog|pfsync|ppp|sl|tun|vlan)[[:digit:]]+:' \ | sed -ne 's/^\(.*\):.*/\1/p' } get_drive() { ask_which "$1" "contains the $MODE media" "$2" [[ $resp == done ]] && return 1 makedev $resp || return 1 return 0 } mount_mnt2() { local _dev=$1 _opts _file=/tmp/parts.$1 _parts disklabel $_dev 2>/dev/null | grep '^ [a-p]: ' \ | egrep -v "swap|unused" >$_file _parts=$(sed -e 's/^ \(.\): .*/\1/' $_file) set -- $_parts [[ $# == 0 ]] && { echo "No filesystems found on $_dev" ; return 1 ; } if isin "c" $_parts; then resp=c elif [[ $# == 1 ]]; then resp=$1 else cat /tmp/parts.$_dev ask_which "$_dev partition" "has the $MODE sets" "$_parts" [[ $resp == done ]] && return 1 fi grep -q "^ $resp: .*MSDOS" $_file && _opts="-s" mount -o ro,$_opts /dev/$_dev$resp /mnt2 } stdsize () { local _p= _s= _sz=$1 set -- " " K M G T P E Z Y while (( ${#_sz} > 3 )); do shift _p=${_sz%[0-9][0-9][0-9]} _s=${_sz#$_p} _s=${_s##+(0)} _sz=$_p done (( _s > 500 )) && : $(( _sz = _sz + 1 )) echo "$(( _sz * 512 )) ${1}Bytes" } askpass() { set -o noglob stty -echo read -r resp?"$1 " stty echo set +o noglob echo } ask() { local _question=$1 _default=$2 set -o noglob while :; do echo -n "$_question " [[ -z $_default ]] || echo -n "[$_default] " read resp case $resp in !) echo "Type 'exit' to return to install." sh ;; !*) eval ${resp#?} ;; *) : ${resp:=$_default} break ;; esac done set +o noglob } ask_until() { resp= while [[ -z $resp ]] ; do ask "$1" "$2" done } ask_yn() { local _q=$1 _a=${2:-no} _resp typeset -l _resp while :; do ask "$_q" "$_a" _resp=$resp case $_resp in y|yes) resp=y ; return ;; n|no) resp=n ; return ;; esac done } ask_which() { local _name=$1 _query=$2 _list=$3 _def=$4 _err=$5 set -- $_list if (( $# < 1 )); then echo "${_err:=No ${_name}s found}." resp=done return fi : ${_def:=$1} _list="$*" while :; do ask "Available ${_name}s are: $_list.\nWhich one $_query? (or 'done')" "$_def" isin "$resp" $_list done && break echo "'$resp' is not a valid choice." done } isin() { local _a=$1 _b shift for _b; do [[ $_a == $_b ]] && return 0 done return 1 } addel() { local _a=$1 shift echo -n "$*" isin "$_a" $* || echo -n " $_a" } rmel() { local _a=$1 _b shift for _b; do [[ $_a != $_b ]] && echo -n "$_b " done } bsort() { local _l _a=$1 _b [[ $# -gt 0 ]] || return shift for _b; do if [[ $_a != $_b ]] ; then if [[ $_a > $_b ]] ; then _l="$_a $_l"; _a=$_b else _l="$_b $_l" fi fi done echo -n "$_a " bsort $_l } save_comments() { local _file=$1 if [[ -f /mnt/etc/$_file ]]; then grep "^#" /mnt/etc/$_file >/tmp/$_file.new [[ -f /tmp/$_file ]] && cat /tmp/$_file >>/tmp/$_file.new mv /tmp/$_file.new /tmp/$_file fi } edit_tmp_file() { local _file=$1 ask_yn "Edit $_file with $EDITOR?" [[ $resp == y ]] && $EDITOR /tmp/$_file } manual_net_cfg() { ask_yn "Do you want to do any manual network configuration?" [[ $resp == y ]] && { echo "Type 'exit' to return to $MODE." ; sh ; } } ftp_list_files() { ftp $FTPOPTS -n "$1" <<__EOT user "$2" "$3" cd "$4" ls quit __EOT } makedev() { local _dev=$1 if [[ ! -r /dev/MAKEDEV ]] ; then echo "MAKEDEV not found. Can't create device nodes." return 1 fi cd /dev ; sh MAKEDEV $_dev || return 1 ; cd - >/dev/null } addhostent() { local _addr=$1 _name=$2 _delim="." [[ $_addr == *:* ]] && _delim=":" sed "/^[0-9a-fA-F]*[$_delim].* $_name\$/d" /tmp/hosts >/tmp/hosts.new mv /tmp/hosts.new /tmp/hosts echo "$_addr $_name" >>/tmp/hosts } select_sets() { local _avail=$1 _selected=$2 _next _f _action cat <<__EOT Select sets by entering a set name, a file name pattern or 'all'. De-select sets by prepending a '-' to the set name, file name pattern or 'all'. Selected sets are labelled '[X]'. __EOT while :; do _action= _next= echo for _f in $_avail; do if isin $_f $_selected; then echo " [X] $_f" else echo " [ ] $_f" : ${_next:=$_f} fi done : ${_next:=done} ask "Set name? (or 'done')" "$_next" case $resp in done) break ;; -*) _action=rmel ;; esac : ${_action:=addel} resp=${resp#+|-} case $resp in "") continue ;; all) resp=* ;; esac for _f in $_avail; do eval "case $_f in @($resp)) _selected=\`$_action $_f \$_selected\` ;; esac" done done resp=$_selected } configure_ifs() { local _IFDEVS=$IFDEVS _ifs _name _media _hn while :; do ask_which "interface" "do you wish to initialize" "$_IFDEVS" \ "" "No more interfaces to initialize" [[ $resp == done ]] && break _ifs=$resp _hn=/tmp/hostname.$_ifs ask "Symbolic (host) name for $_ifs?" "$(hostname -s)" _name=$resp _media=$(ifconfig $_ifs media | grep "media ") if [[ -n $_media ]]; then cat <<__EOT The media options for $_ifs are currently $(ifconfig $_ifs media | sed -n '/supported/D;/media:/p') __EOT ask_yn "Do you want to change the media options?" case $resp in y) cat <<__EOT Supported media options for $_ifs are: $_media __EOT ask "Media options for $_ifs?" _media=$resp ifconfig $_ifs $_media || return 1 ;; n) _media= ;; esac fi rm -f $_hn v4_config "$_ifs" "$_media" "$_name" "$_hn" v6_config "$_ifs" "$_media" "$_name" "$_hn" [[ -f $_hn ]] && chmod 640 $_hn && _IFDEVS=$(rmel "$_ifs" $_IFDEVS) done } v4_info() { ifconfig $1 inet | sed -n ' 1s/.*/etc/resolv.conf.tail if [[ -n $_hn ]]; then _hn="send host-name \"$_hn\";" echo "Issuing hostname-associated DHCP request for $_ifs." else echo "Issuing free-roaming DHCP request for $_ifs." fi cat >/etc/dhclient.conf <<__EOT initial-interval 1; $_hn request subnet-mask, broadcast-address, routers, domain-name, domain-name-servers, host-name; __EOT ifconfig $_ifs group dhcp >/dev/null 2>&1 dhclient $_ifs set -- $(v4_info $_ifs) if [[ $1 == UP && -n $2 ]]; then mv /etc/dhclient.conf /tmp/dhclient.conf mv /etc/resolv.conf.tail /tmp/resolv.conf.tail return 0 fi ifconfig $_ifs delete down rm /etc/dhclient.conf /etc/resolv.conf.tail return 1 } v4_config() { local _ifs=$1 _media=$2 _name=$3 _hn=$4 _prompt _addr _mask if ifconfig $_ifs | grep 'groups:.* dhcp' >/dev/null 2>&1; then _addr=dhcp else set -- $(v4_info $_ifs) if [[ -n $2 ]]; then _addr=$2; _mask=$3 ifconfig $_ifs inet $_addr delete fi fi [[ -x /sbin/dhclient ]] && { _prompt=" or 'dhcp'" ; : ${_addr:=dhcp} ; } _prompt="IPv4 address for $_ifs? (or 'none'$_prompt)" ask_until "$_prompt" "$_addr" case $resp in none) ;; dhcp) if [[ ! -x /sbin/dhclient ]]; then echo "DHCP not possible - no /sbin/dhclient." elif dhcp_request $_ifs "$_name" || dhcp_request $_ifs ; then addhostent "127.0.0.1" "$_name" echo "dhcp NONE NONE NONE $_media" >>$_hn makedev bpf$(ls /dev | grep -c "^bpf[0-9]") fi ;; *) _addr=$resp ask_until "Netmask?" "${_mask:=255.255.255.0}" ifconfig $_ifs -group dhcp >/dev/null 2>&1 if ifconfig $_ifs inet $_addr netmask $resp up ; then addhostent "$_addr" "$_name" echo "inet $_addr $resp NONE $_media" >$_hn fi ;; esac } v6_config() { local _ifs=$1 _media=$2 _name=$3 _hn=$4 _addr _prefixlen _prompt ifconfig lo0 inet6 >/dev/null 2>&1 || return set -- $(v6_info $_ifs) [[ -n $2 ]] && { _addr=$2; _prefixlen=$3; } [[ -x /sbin/rtsol ]] && _prompt="or 'rtsol' " _prompt="IPv6 address for $_ifs? (${_prompt}or 'none')" ask_until "$_prompt" "${_addr:-none}" case $resp in none) return ;; rtsol) [[ ! -x /sbin/rtsol ]] && { echo "No /sbin/rtsol." ; return ; } ifconfig $_ifs up rtsol -F $_ifs addhostent "::1" "$_name" echo "up\nrtsol $media" >>$_hn return ;; esac _addr=$resp ask_until "IPv6 prefix length for $_ifs?" "${_prefixlen:=64}" ifconfig $_ifs inet6 $_addr prefixlen $resp up || return echo "inet6 $_addr $resp $media" >>$_hn addhostent "$_addr" "$_name" v6_defroute $_ifs [[ $resp == none ]] && return route -n add -inet6 -host default "$resp" || return echo "$resp" >>/tmp/mygate } v4_defroute() { local _dr _prompt=" or 'none'" [[ -x /sbin/dhclient ]] && _prompt=", 'dhcp'$_prompt" _prompt="Default IPv4 route? (IPv4 address$_prompt)" _dr=$(route -n show -inet | sed -ne '/^default */{s///; s/ .*//; p;}') [[ -f /tmp/dhclient.conf ]] && _dr=dhcp while :; do ask_until "$_prompt" "$_dr" [[ $resp == @(none|dhcp) ]] && break route delete -inet default >/dev/null 2>&1 route -n add -inet -host default "$resp" && { echo "$resp" >/tmp/mygate ; break ; } route -n add -inet -host default $_dr >/dev/null 2>&1 done } v6_defroute() { local _if=$1 _routers _oifs if [[ -z $(route -n show -inet6 | sed -ne '/^default */{s///; s/ .*//; p;}') ]]; then resp=none return fi if [[ -x /sbin/ping6 ]]; then _routers=$(ping6 -n -c 2 ff02::2%$_if 2>&1 | sed -n \ -e '/bytes from/{s/^.*from //;s/,.*$//;p;}') fi _oifs=$IFS IFS= PS3="IPv6 default router? (list #, IPv6 address or 'none'): " select i in $_routers; do case $i in "") resp=$REPLY [[ -n $resp ]] && break ;; *) resp=$i break ;; esac done IFS=$_oifs } enable_network() { local _f _gw for _f in dhclient.conf resolv.conf resolv.conf.tail; do if [ -f /mnt/etc/$_f ]; then cp /mnt/etc/$_f /etc/$_f fi done ifconfig lo0 inet 127.0.0.1 for hn in /mnt/etc/hostname.*; do if=${hn#/mnt/etc/hostname.} ifconfig $if >/dev/null 2>&1 || continue while :; do if [ "$cmd2" ]; then set -- $cmd2 af=$1 name=$2 mask=$3 bcaddr=$4 ext1=$5 cmd2= i=1; while [ i -lt 6 -a -n "$1" ]; do shift; let i=i+1; done ext2="$@" else read af name mask bcaddr ext1 ext2 || break fi case $af in "#"*|"!"*|"bridge"|"") continue ;; "dhcp") [ "$name" = "NONE" ] && name= [ "$mask" = "NONE" ] && mask= [ "$bcaddr" = "NONE" ] && bcaddr= dhcpif="$dhcpif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 down" cmd="$cmd; dhclient $if" makedev bpf$(ls /dev | grep -c "^bpf[0-9]") ;; "rtsol") rtsolif="$rtsolif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 up" ;; "up") cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 up" ;; *) read dt dtaddr if [ "$name" = "alias" ]; then alias=$name name=$mask mask=$bcaddr bcaddr=$ext1 ext1=$ext2 ext2= else alias= fi cmd="ifconfig $if $af $alias $name " case $dt in dest) cmd="$cmd $dtaddr" ;; [a-z!]*) cmd2="$dt $dtaddr" ;; esac if [ ! -n "$name" ]; then echo "/mnt/etc/hostname.$if: invalid network configuration file" return fi case $af in inet) [ "$mask" ] && cmd="$cmd netmask $mask" if [ "$bcaddr" -a "$bcaddr" != "NONE" ]; then cmd="$cmd broadcast $bcaddr" fi [ "$alias" ] && rtcmd="; route -qn add -host $name 127.0.0.1" ;; inet6) [ "$mask" ] && cmd="$cmd prefixlen $mask" cmd="$cmd $bcaddr" ;; *) cmd="$cmd $mask $bcaddr" esac cmd="$cmd $ext1 $ext2$rtcmd" rtcmd= ;; esac eval "$cmd" done /dev/null 2>&1 route -qn add -host default $_gw && break done [[ -z $rtsolif ]] && stripcom /mnt/etc/mygate | while read _gw; do [[ $_gw == !(*:*) ]] && continue route -qn delete -inet6 default >/dev/null 2>&1 route -qn add -host -inet6 default $_gw && break done route -qn add -host `hostname` 127.0.0.1 >/dev/null route -qn add -net 127 127.0.0.1 -reject >/dev/null echo "Network interface configuration:" ifconfig -a media route -n show if [ -f /etc/resolv.conf ]; then echo "\nResolver enabled." else echo "\nResolver not enabled." fi } install_files() { local _src=$1 _files=$2 _f _sets _get_sets for _f in $THESETS; do isin $_f $_files || continue; _sets=$(addel $_f $_sets) isin $_f $DEFAULTSETS "site$VERSION-$(hostname -s).tgz" && \ _get_sets=$(addel $_f $_get_sets) done if [[ -z $_sets ]]; then cat <<__EOT No $OBSD sets were found at $(echo $_src | sed -e 's/\(^ftp:\/\/[^/]*\)\(:[^/]*\)\(@.*\)/\1\3/') Set names are: $THESETS __EOT return fi resp=y isin INSTALL.$ARCH $_files || ask_yn "INSTALL.$ARCH not found. Use sets found here anyway?" [[ $resp = n ]] && return select_sets "$_sets" "$_get_sets" [[ -n $resp ]] || return _get_sets=$resp ask_yn "Ready to $MODE sets?" yes [[ $resp = n ]] && return for _f in $THESETS ; do isin $_f $_get_sets || continue echo "Getting $_f ..." case $_f in *.tgz) ftp $FTPOPTS -o - -m "$_src/$_f" | tar zxphf - -C /mnt ;; *) ftp $FTPOPTS -o "/mnt/$_f" -m "$_src/$_f" ;; esac if [ $? -ne 0 ]; then echo "'$_f' did not install correctly." else DEFAULTSETS=$(rmel $_f $DEFAULTSETS) fi done } encode_for_url() { echo "$1" | sed -e " s/%/%25/g s/ /%20/g s/!/%21/g s/\"/%22/g s/#/%23/g s/\\\$/%24/g s/&/%26/g s/'/%27/g s/(/%28/g s/)/%29/g s/\*/%2a/g s/+/%2b/g s/,/%2c/g s/-/%2d/g s/\./%2e/g s/\//%2f/g s/:/%3a/g s/;/%3b/g s//%3e/g s/?/%3f/g s/@/%40/g s/\[/%5b/g s/\\\\/%5c/g s/]/%5d/g s/\^/%5e/g s/_/%5f/g s/\`/%60/g s/{/%7b/g s/|/%7c/g s/}/%7d/g s/~/%7e/g " } ftp_error() { if [[ -n $(echo "$2" | grep "$1") ]]; then echo $1 return 0 fi return 1 } set_ftp_opt() { local _q=$1 _opt=$2 ask_yn "Use $_q?" $(isin $_opt $FTPOPTS && echo "yes") case $resp in y) FTPOPTS=$(addel $_opt $FTPOPTS) ;; n) FTPOPTS=$(rmel $_opt $FTPOPTS) ;; esac } install_url() { local _url_type=$1 _file_list _url_base _oifs _prompt _passwd ask "HTTP/FTP proxy URL? (e.g. 'http://proxy:8080', or 'none')" \ "${ftp_proxy:-none}" unset ftp_proxy http_proxy [[ $resp == none ]] || export ftp_proxy=$resp http_proxy=$resp rm -f $SERVERLIST ask_yn "Display the list of known $_url_type servers?" if [[ $resp == y ]]; then echo -n "Getting the list from 129.128.5.191 (ftp.openbsd.org)..." ftp $FTPOPTS -a -o - \ ftp://129.128.5.191/$FTPDIR/ftplist 2>/tmp/ftplisterr \ | sed -ne "/^${_url_type}:\/\//s///p" >$SERVERLIST if [[ -s $SERVERLIST ]]; then echo "done." _prompt="Server? (IP address, hostname, list#, 'done' or '?')" cat -n $SERVERLIST | less -XE else echo "FAILED." cat /tmp/ftplisterr fi fi : ${_prompt:="Server? (IP address, hostname or 'done')"} while :; do eval resp=\$_${_url_type}_server_ip ask_until "$_prompt" "$resp" case $resp in done) return ;; "?") [[ -s $SERVERLIST ]] || continue cat -n $SERVERLIST | less -XE ;; +([0-9])) [[ -s $SERVERLIST ]] || continue set -- $(sed -ne "${resp}p" $SERVERLIST) [[ $# -lt 1 ]] && { echo "There is no line $resp." ; continue ; } echo "Using $*" eval _${_url_type}_server_ip=${1%%/*} eval _${_url_type}_server_dir=${1#*/}/$SETDIR ;; *) eval _${_url_type}_server_ip=$resp break ;; esac done if [[ $_url_type == ftp && -z $ftp_proxy ]]; then set_ftp_opt "active mode ftp" "-A" fi eval resp=\$_${_url_type}_server_dir ask_until "Server directory?" "${resp:-pub/OpenBSD/$SETDIR}" eval _${_url_type}_server_dir=$resp if [[ $_url_type == ftp ]]; then _oifs=$IFS IFS= ask_until "Login?" "${_ftp_server_login:=anonymous}" _ftp_server_login=$resp if [[ $_ftp_server_login == @(anonymous|ftp) ]]; then _passwd=root@`hostname` else resp= while [[ -z $resp ]] ; do askpass "Password? (will not echo)" done _passwd=$resp fi IFS=$_oifs fi _url_base=$_url_type:// if [[ $_url_type == ftp && $_ftp_server_login != anonymous ]]; then _url_base=$_url_base$(encode_for_url "$_ftp_server_login"):$(encode_for_url "$_passwd")@ fi eval _url_base=$_url_base\$_${_url_type}_server_ip/\$_${_url_type}_server_dir ifconfig lo0 127.0.0.1 if [[ $_url_type == ftp && -z $ftp_proxy ]] ; then _file_list=$(ftp_list_files "$_ftp_server_ip" "$_ftp_server_login" "$_passwd" "$_ftp_server_dir") ftp_error "Login failed." "$_file_list" && return ftp_error "No such file or directory." "$_file_list" && return else _file_list=$(ftp $FTPOPTS -o - "$_url_base/index.txt" | sed 's/ //') fi install_files "$_url_base" "$_file_list" } install_mounted_fs() { local _dir while :; do ask_until "Pathname to the sets? (or 'done')" "$SETDIR" [[ $resp == done ]] && return [[ -d /mnt2/$resp ]] && { _dir=/mnt2/$resp ; break ; } [[ -d /mnt/$resp ]] && { _dir=/mnt/$resp ; break ; } [[ -d /$resp ]] && { _dir=/$resp ; break ; } echo "The directory '$resp' does not exist." done install_files "file://$_dir" "$(ls -l $_dir)" } install_cdrom() { get_drive "CD-ROM" "$CDDEVS" || return mount_mnt2 $resp || return install_mounted_fs } install_disk() { ask_yn "Is the disk partition already mounted?" if [[ $resp == n ]]; then get_drive "disk" "$DKDEVS" || return mount_mnt2 $resp || return fi install_mounted_fs } install_nfs() { local _tcp ask_until "Server IP address or hostname?" "$NFS_ADDR" NFS_ADDR=$resp ask_until "Filesystem on server to mount?" "$NFS_PATH" NFS_PATH=$resp ask_yn "Use TCP transport? (requires TCP-capable NFS server)" [[ $resp == y ]] && _tcp=-T mount_nfs $_tcp -o ro -R 5 $NFS_ADDR:$NFS_PATH /mnt2 || return install_mounted_fs } install_tape() { local _z _bs get_drive "tape drive" "$MTDEVS" || return export TAPE=/dev/nr$resp if [[ ! -c $TAPE ]]; then echo "$TAPE is not a character special file." return fi echo -n "Rewinding $TAPE (mt rewind)..." mt rewind || return echo "done." while :; do ask_until "Skip how many files? (or 'done')" 0 [[ $resp == done ]] && return [[ $resp == +([0-9]) ]] || continue (($resp < 0)) && continue if (($resp > 0)); then echo -n "Skipping $resp file(s)..." mt fsf $resp || return echo "done." elif [[ -n $_bs ]]; then mt bsf ; mt fsf fi unset _z ask_yn "Is the file gzipped?" yes [[ $resp == y ]] && _z=z [[ $_z == z ]] || _bs=10240 ask_until "Blocksize for this file?" "${_bs:-8k}" [[ $resp == done ]] && return _bs=$resp dd if=$TAPE bs=$_bs | tar ${_z}xvphf - -C /mnt || return done } set_timezone() { local _zoneroot=/mnt/usr/share/zoneinfo/ _zonepath [[ ! -d $_zoneroot ]] && return if [[ -L /mnt/etc/localtime ]]; then TZ=$(ls -l /mnt/etc/localtime 2>/dev/null) TZ=${TZ#*${_zoneroot#/mnt}} fi : ${TZ:=GMT} while :; do _zonepath=$_zoneroot ask "What timezone are you in? ('?' for list)" "$TZ" if [[ $resp == ? ]]; then ls -F ${_zonepath} continue; fi _zonepath=${_zonepath}${resp} while [[ -d $_zonepath ]]; do ask "What sub-timezone of '${_zonepath#$_zoneroot}' are you in? ('?' for list)" case $resp in "") ;; ?) ls -F $_zonepath ;; *) _zonepath=$_zonepath/$resp ;; esac done if [[ -f $_zonepath ]]; then TZ=${_zonepath#$_zoneroot} echo -n "Setting local timezone to '$TZ'..." ln -sf /usr/share/zoneinfo/$TZ /mnt/etc/localtime echo "done." return fi echo -n "'${_zonepath#$_zoneroot}'" echo " is not a valid timezone on this system." done } sane_install() { local _s _m for _s in $SANESETS; do isin $_s $DEFAULTSETS || continue ask_yn "'$_s' was not installed.\nAre you *SURE* your $MODE is complete without '$_s'?" [[ $resp == n ]] && _m="$_m $_s" done [[ -n $_m ]] && return 1 return 0 } install_sets() { local _d=disk _locs="disk ftp http" [[ -n $CDDEVS ]] && { _locs="cd $_locs" ; _d=cd ; } [[ -x /sbin/mount_nfs ]] && _locs="$_locs nfs" [[ -n $MTDEVS && -x /bin/mt ]] && _locs="$_locs tape" echo "\nLet's $MODE the sets!" while :; do umount -f /mnt2 >/dev/null 2>&1 [[ -z $DEFAULTSETS ]] && _d=done ask "Location of sets? ($_locs or 'done')" "$_d" case $resp in done) sane_install && return ;; c*|C*) isin "cd" $_locs && install_cdrom ;; d*|D*) install_disk ;; f*|F*) isin "ftp" $_locs && install_url ftp ;; h*|H*) isin "http" $_locs && install_url http ;; n*|N*) isin "nfs" $_locs && install_nfs ;; t*|T*) isin "tape" $_locs && install_tape ;; esac done } munge_fstab() { local _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do [[ $_dev == @(/dev/svnd*|\#*) || \ $_fstype == nfs || \ ! -f /sbin/mount_$_fstype || \ $_opt == *noauto* || \ $_opt == *xx* ]] && continue _opt=$(echo $_opt | sed -e 's/softdep//') [[ $_fstype == ffs ]] || _opt=$(echo $_opt | sed -e 's/rw/ro/') echo $_dev /mnt${_mp%/} $_fstype $_opt done /etc/fstab if [ ! -s /etc/fstab ]; then echo "Unable to create valid /etc/fstab." exit fi } mount_fs() { local _async=$1 _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do [ "$_mp" = "/mnt" ] || mkdir -p $_mp if ! mount -v -t $_fstype $_async -o $_opt $_dev $_mp ; then cat <<__EOT FATAL ERROR: Cannot mount filesystems. Double-check your configuration and restart the $MODE. __EOT exit fi done /dev/null 2>&1; then echo "FAILED. You must fsck $_dev manually." _fail=y else echo "OK." fi done /tmp/resolv.conf for _ns in $resp; do echo "nameserver $_ns" >>/tmp/resolv.conf done ask_yn "Use the nameserver now?" yes [[ $resp == y ]] && cp /tmp/resolv.conf /tmp/resolv.conf.shadow fi [[ -n $(ifconfig -a | sed -ne '/[ ]inet .* broadcast /p') ]] && v4_defroute edit_tmp_file hosts manual_net_cfg } populateusrlocal() { if [ -f /mnt/etc/mtree/BSD.local.dist ]; then /mnt/usr/sbin/chroot /mnt /usr/sbin/mtree -Uedqn -p /usr/local -f /etc/mtree/BSD.local.dist >/dev/null fi } questions() { local _d ask_yn "Start sshd(8) by default?" yes if [[ $resp == n ]]; then echo "sshd_flags=NO # disabled during install" \ >>/mnt/etc/rc.conf.local fi ask_yn "Start ntpd(8) by default?" no if [[ $resp == y ]]; then echo "ntpd_flags= # enabled during install" \ >>/mnt/etc/rc.conf.local ask "NTP server? (hostname or 'default')" default if [[ $resp != default ]]; then set -- $resp sed -e "s/^servers /#&/;/#server /a\\ server $1 " /mnt/etc/ntpd.conf >/tmp/ntpd.conf fi fi if [[ -n $MDXAPERTURE ]]; then ask_yn "Do you expect to run the X Window System?" if [[ $resp == y ]]; then sed -e "/^#\(machdep\.allowaperture=${MDXAPERTURE}\)/s//\1 /" \ /mnt/etc/sysctl.conf >/tmp/sysctl.conf cp /tmp/sysctl.conf /mnt/etc/sysctl.conf fi fi [[ -n $CDEV ]] || return _d=${CPROM:-$CDEV} ask_yn "Change the default console to $_d?" [[ $resp == n ]] && return ask_which "speed" "should $_d use" "9600 19200 38400 57600 115200" \ $CSPEED [[ $resp == done ]] && return sed -e "/^$CTTY/s/std.9600/std.${resp}/" \ -e "/^$CTTY/s/unknown/vt220 /" \ -e "/$CTTY/s/off.*/on secure/" /mnt/etc/ttys >/tmp/ttys [[ -n $CPROM ]] && \ echo "stty $CPROM $resp\nset tty $CPROM" >>/mnt/etc/boot.conf } finish_up() { local _dev _mp _fstype _rest if [[ -x /mnt/sbin/swapctl ]]; then /mnt/sbin/swapctl -a /dev/$SWAPDEV >/dev/null 2>&1 while read _dev _mp _fstype _rest; do [[ $_fstype == swap ]] && \ /mnt/sbin/swapctl -a $_dev >/dev/null 2>&1 done /tmp/sysctl.conf cp /tmp/sysctl.conf /mnt/etc/sysctl.conf fi echo -n "Making all device nodes..." cd /mnt/dev sh MAKEDEV all for _dev in $DKDEVS $CDDEVS $MTDEVS; do sh MAKEDEV $_dev done echo "done." cd / md_installboot $ROOTDISK populateusrlocal [ -x /mnt/$MODE.site ] && /mnt/usr/sbin/chroot /mnt /$MODE.site cat <<__EOT CONGRATULATIONS! Your OpenBSD $MODE has been successfully completed! To boot the new system, enter halt at the command prompt. Once the system has halted, reset the machine and boot from the disk. __EOT md_congrats } ROOTDISK= ROOTDEV= VERSION=45 VNAME="$(( $VERSION / 10 )).$(( $VERSION % 10 ))" SETDIR="$VNAME/$ARCH" FTPDIR="pub/OpenBSD/$VNAME" FTPOPTS="-V" OBSD="OpenBSD/$ARCH $VNAME" SERVERLIST=/tmp/serverlist for _opt in d f l m n p s; do ulimit -$_opt unlimited done dmesg | sed -ne '/^OpenBSD /h;/^OpenBSD /!H;${g;p;}' >/var/run/dmesg.boot DKDEVS=$(scan_disknames "${MDDKDEVS:-/^[sw]d[0-9][0-9]* /s/ .*//p}") CDDEVS=$(scan_disknames "${MDCDDEVS:-/^cd[0-9][0-9]* /s/ .*//p}") MTDEVS=$(scan_dmesg "${MDMTDEVS:-/^[cms]t[0-9][0-9]* /s/ .*//p}") IFDEVS=$(get_ifdevs) CONSOLE=$(scan_dmesg '/^\([^ ]*\).*: console$/s//\1/p') CONSOLE=${CONSOLE% } [[ -n $CONSOLE ]] && CSPEED=$(stty speed) md_consoleinfo THESETS="bsd bsd.rd bsd.mp $MDSETS" DEFAULTSETS="bsd bsd.rd" for _set in base etc misc comp man game xbase xetc xshare xfont xserv site ; do [[ $MODE == upgrade && ( $_set == etc || $_set == xetc ) ]] && continue THESETS="$THESETS ${_set}${VERSION}.tgz" isin $_set xbase xetc xshare xfont xserv site && continue DEFAULTSETS="$DEFAULTSETS ${_set}${VERSION}0123456789abcdefK`)-- -x.K`)*43.x* *K`,s))4)))K`....4..K`:-...4.-T-p-K`<X-K`+8W.K`, -K`)t *..4.*K`t *..4.K`...4..6TI`K`D9'@{-|-@ X Xd$`,L`0L`N`N`N`N` N`@L`22$2$22$2$\22$22$"3x#3%3&3)32$ *32$<+32$2$2$2$2$2$E$2$2$2$2$2$2$2$2$2$2$2$2$2$2$2$2$x$2$ty$2$2$2$2$2$2$2$2$2$2$2$2$2$2$2$2$2$2$2$2$2$2$2$2$E$2$2$2$2$2$2$2$E$2$2$2$2$2$2$2$E$2$2$2$2$2$2$2$E$2$2$2$2$2$2$2$E$2$2$2$2$2$2$2$E$2$2$2$2$2$2$2$E$2$2$2$2$2$2$2$E$2$2$2$2$2$2$2$E$2$2$2$2$2$2$2$E$2$2$2$2$2$2$2$E$2$2$2$2$2$2$2$E$2$2$2$2$2$2$2$E$2$2$2$2$2$2$2$E$2$2$2$2$2$2$2$E$2$2$2$2$2$2$2$E$2$2$2$2$2$2$2$E$2$2$2$2$2$2$2$E$2$2$2$2$2$2$2$E$2$2$2$2$2$2$2$E$2$2$2$2$2$2$2$E$2$2$2$2$2$2$2$E$2$2$2$2$2$2$2$E$2$2$2$2$2$2$2$E$2$2$2$2$2$2$2$E$2$2$2$2$2$2$2$E$2$2$2$2$2$2$2$2$2$2$2$2$2$2$2$2$2$2$2$2$2$2$2$E$2$adGH@%K@p0A @ 0,@P6`6t666666666666 606D6<//t/p/A70000C7T0@00X0A0@A0C0C0|D7H0PX0I0hO0@e0e0E7l0m0m0m0m0m0:5m0757575:57585(85L;5858595;5757575;5P85x8585;5@95h9595 <5<5,<5<<5L<59595|<5<5<5$:5<5<5G/|H/H/DI/@J/`K/xK/K/M/>?? ' ` ~ ^ "' ,AAA AA'CEEEEIIIINOOOOOUUUUYaaaa aa'ceeeeiiiinooooouuuuyy"A"E"I"O"U"a"e"i"o"u"yA^A`A*A~ACE^E`EI^I`I~NO^O`O~OU^U`UYa^a`a*a~ace^e`ei^i`i~no^o`o~ou^u`uyg7\+2d+2+2+2727252d92 :2;2A2B2X5K2V2P2P2Q2R2S2R2R2R2S2S2pi7xi7i7i7i7i7i7i7i7i7i7i7i7i7i7i7i7i7j7j7j7j7j7j7 j7$j7(j7,j70j74j78j7????????????????????????? @`px|~ 08<>????????????????? @`px|~ 08<>????????? @`px|~ 08<>? Boldface.iso1 \`wfllllllll||| 0 `F8ll8vv0 000000 0 0f<0p000x6 0>p00p>p|`08l 8llF`0| 0|``f`?8`DDE9  2 2 a>wc`aaa?`  0  0f`vvf`    ` 00`000000006??a@ 0  @````@``@? !? ?1```@```0 00`gop``````p@??`@@000  000 ``````p?```<     `xx``88`9  ?0```g ollg`0? ? @@`@`````a``````````` `````` 0 @a``````````````````@a0@0@000?00000 0 0@0@000?000000x` ````a`` `0````````````````````````80acflxx|ngca`px00000000000 0 p`pppY`Y`Y`M`N`N`D`D`p` p x X L F G C A@@@`0 ````````````` @0@00`0`0`07000000x `````````````0@8@#a````|ngca`p0`` ` p<@`@``F p` ` ` ` ` ` ` ` ` ` p@?`@000 f f f v w@3@7@;;p` 0@8   @`p` 0@ ?   ?``00 || ||1`0009 ```gop````````p`xO1 ````p@0`````1 ````````p9`p0``````0`   1```1?`? `@ @ ?0p00790000000y 08````acf|x|ngcnf`f`f`f`f`f`f`p'y0000000y ````````p@8q``````````@p````  ````````p`8````s48000000x00@8 0?  @y00000009`p` 0@0@ pf f f 7@;@;@p@8  ` 0@0@  xp`A8 p`8    8 >`6gC0000~|V`s@ o`?0000?o`@ ``00`0?a00`0`00/@)@(@(@)@/@0``0`0`?` 6ll6 `??0/@)@/@*@*@+@0 33 ???<f0`~<ff< y00000009>`0000x?```?````````` 8<0`0`0`?l6 `` 6l08@@@@08 8D8D8@@@@ 000@9  ? @@` ? @@` ? @@`  ? @@` ? @@` ? @@`   # ##CCC` `````` 0 @  0@0@00?000 0 0@0@00?000 0 0@0@00?000 0 0@0@00?000 0  100`0`0``0`0`0`0`0@1 p` p X L F C A@@`0  ``````` @0@ ``````` @0@ ``````` @0@  ``````` @0@ ``````` @0@ 0`  0` `!!c`c`f`f`l`l`8@8@8o p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` 0@ ``````````8```acc````````ac 000900090009 0009000900096@&``?fff v@;1 ````p@0  0``````0`0``````0`0``````0`0``````0` Dl88lF ````p@8 'y0000000y  ````````p@8 ````````p@8 ````````p@8  ````````p@8 ````````p@8``#c`f`f`l`|@8?`` y00000009`y00000009`y00000009`y00000009`` 0@0@  xp````aaaaa`` 0@0@  xp `\`  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ͳɿپ̴ްX`X`2Y`)`a``'```````(`  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~`o````(`8`&8`!`,6k7k7k7k7k722p7<3$3 3 3  % 3u Du u <u 8u 2u 0&'u 1&u 0&u     )%uu 0 1 8%u   3 D D%uu < 8 2u 0&'u 1&u 0&u  s7`t7*3+3*3Dv" 6t7u7*y7|7# # `~7~7$70w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-܁7{{707< 4!4$4@(4h)4(4/4545464P64547 7THo4Po4744h7L444447`44447x4444X7`4444t74444̌74ؼ44474444h78444474@444\744447444474D4447(4T44407<4D444L7d444474444t7d444474444(74 444x7L4x4@4[7P5PQ54R54#$NetBSD: blockio.S,v 1.4 2001/06/02 11:15:56 bjh21 Exp $.symtab.strtab.shstrtab.text.start.data.sbss.bss.arm.atpcs.ident % ! @(8( .`@4`@9@D@9ݍ@K@`  @B)a  8``   98d H$T$/pP#T:4\1ELafRP!]3$f, ,4E828,/ؼ%T#0(8!$2"o` .\,|;@(`S $,[d4Lo #TP>/ *D`' j,L}`XA8*8G5X3(1"<F8 R'peT:$r(554dR`'D}$D%8 '\X .l>8#\,!7/4$F-8R3L]x-)fU'pt5$&D2.d}#d8x0T`af`4TU(4{0\6hA8D #/Q!_Lp1 q^"\{X2LPJ'<Dk-*`L"I(, 2f п/<&48 -h'%8q.E:8\2XjFfuP(~p/( Xq3F+PJ"(TN h5e <|-D @Y(38<# 2<2!<Bl"$Nt'x^x85t&1t0 /0!H4dX-#<$`>8 @4`@ d6(pA884&B0%4R#e[đ1ee r\3e~ܦ%2x3e3e(#h8$$72`/LDv" p#"2.f,<C<%O(ZI5k!T} 88z*/75=8!"dH(l`5 %| X/0 75- (|C G!V .`d dr Lv! e*X '< di/ -( u,   ` l $ X1| $6 ( `H8(6 .8F h}2T ddfa Zfn |) ,H5 Pf (H D20 \4  h@1( L0x a1 ) 5e, 29 E%0C [$0M f X 'm `$ht ?4 E8x ,e p# ,R`  <6e@ x# l+! Ќ!@ tI4 , x35 8d) "P2 +2pA /8R 6^ Ĕ.Tl &xx Pnd $ tB! m&X t3 6e !-` r" 0 F+ Xs"X /t# _#t5 D4@  Q w0Pa 88`j p#Ht tE!t ) @#p 4  C0 1T |1t l(D "P `@B)3%&$4|/H2pbN!u@C!d\#Є"Txj1h/=84(4 83x- &D d#L$! 0txe:b#K0[H0Hf#m, ~dp4hx&(#H8PO5!x'Xf>O#H "Tm0d2@n@,#et3 ^4/40~1`Q(')5P3 Q`)!8`C(L#V`_"Tk8w"v"#<"8Ѓ2E#`H## N`(4,/\<;5#L$`3@d;p]"D0T e,e(4s#/D\e( (D3^!@,!5'x3 0 2,daf?",E8(%N0)HY`#(a1o]!|x2p2\f;5Ff`,]5xod ]f #2 )) X%2 S2,O 3[ D% e )8v )(8 q"( 8 / :5 ) ,+l 0 0/!W5 !@8!<0x'!58 8!2LL!E2(`!<{#t!pR!!`;4!F)H !P&!#L!*8!3!#,!$-!DP1d!0"Ȱ&` "0"<#\&",$ /"0X%?"X/#M"!^"pl/Xi"w34y".#|"X"-"4"<3e"*8"!"8":5" Z+ "2P#/d#&)#D/t?#'Q#2Lh#82ew#`#%x#c%#Q`#!`#8#`# #+#x'#|B3#d#4 $`$K`)$0`1$3`;$5eI$5W$DI/m$ |$ 5@$P64d$:8$@"$`6'$p2($h-l$(%1%t,$%)2%#E%4,!4_%1Ts%T.e%H%%`%8%Po4%<.<%!%x"%%%L %ܘ3%Ȏ$&*8&4#&`f7&3B&Y'X&q%L`&64`m&Y/x&0af&5'0&0r`&x &Ԧ4`&t`&m4&y18&$G0d&n%('D1'$''d#3'\">'!I'odU'5\'>"0m',x'8'h"'X3'Z/t'0*'X4x''2'J5'$0(4!( "8"(,l0(43$A(( 'TO(<&^("ef(/s(PL`(p"\(d^)(8/ (df(Xy0X(&\(p/ (&\)!)q3$!)1p5)A,D)28T)X0<d)f p)f)d/H)H8) W. ),0)|)8) 75)x3"L) )8f*  *,n"*̤"@!*q/2*p`=*<,pL*ԆfxU*f`*(4&`k*e0w*;0*ph(|*D! *8*5e*`*,2e*%+< +(,)+hf;+G+F+2V+f^+4u+ 4e}+h+!+(8+`+%+.++ħ3p+N`+%+78+!X ,,*,54@ ,lr1@2,\*&C,8n%V,Q#T_,hw+Dm,68,`,$" ,(w`, j"<,%-,@'L,#e,0,d=',0 -A8$-"d9-L`N-,eU- f->/$|->3-" -$%-50-u&t-| -q--<1-Խ%-|0t."@.!$.+$3.O4$?.0dL.L`Z.|+g.v1$r. 2.d/|.O`.< .=%x.g"\.>1d...0$L.(l/V/`"/0:/_1<J/L`[/C8i/]1L}/`]*/3e/P%/D3x/0e0/l<5/"/ "/S2/`-X0Dq`0` ! +0Ѕf\30d890HfD0+S04O!e0P x040f!`0<+30 &80Tv"04;(00$,02H0r-1P8% 1'\1`!(10061|;5I1H&\138i1l94`z13(18+(1D?'1o`1l;5131/L1`$ 1|#2X5  2,R%L2@o4#2F!x52444B2H8I2+Z23d2V3s2`~2PF82Hp+82 j+ 2&2,2`2 42,m4 2,)2/$2u'34$ 34&T35)P%3&|-33;3m#J3.DX36`3v*Xk3p^2 3I3l3%3ďf3b103|e323@ve38(3\!p3083" 4@ 4 W/\94x'B4@"0Q4-8b4H-hr4-%x4,$4/,4_14|!4$ 40@4#44844t4p5 5( 5t3\/5e(I5+!0^5*j5.v5q`5$50d5+2(505'05 '5`#&X5 r"P5p!$6X3@672$#6LA836,e=6А#|J6M/(\6<$ g62$t626|(p6& 6R16$6,%6|<56+643. 6&6"6 6$67 7K/!7X.e,7Lq"t87'8Q73b7x1pm7'H7,@7,H-h7D(t7 7;57L1e7e(7 p7 838H&<8h#h.8c*:8$B8A8`8Q%h8T4\}8|+8 188T$6B8|!8`8l1x8-88/(8},X80 8959$d 9f"9!|96 *9i,?9\XfP9(3Y9h/8`91o9,W. 9:89#9$L`9(H9p#,,9(92$9 &:`:8:d1\0:-4> 0@,>L"3>H(K>xj#U>f8b>D)4n>%<{>3`>[3X>*d>t(h>x"\>7%8>xG(>&P>t%T?"e?\` ?2-?(8?!6 D?0`Q?/V?X,Dc?Dn1q?@,#}?@4$?:"?p3p?\0L?<@(T?88?!?Я$\?#e?3 @$@q!0 @4X.@x/84@4od@A@!U@/`@P2xs@R!@#@0d@Ąf@&@y1\@:8@$@$@0L@hzdA0c4AL1`"A4df /Ai/=Ah eKAl,%ZA%xeA%oA&~A#lA$hA0/A 3A,<At4 A'8A\!+pAd92AH2xBX` Bp@84(BL24BW5;B $KBP"\XB 3eB3pB /XwB#<B8%B10BCH"XDCt4TC<]3^C3mCT. {C+Cܕ(TC8!C4HCDdCl0+ C4$+lCD8Cs`C3D-$$D\48:Dx$ADx9&GD#lOD"^D/PfD4dxDS!xD` pDD# D'0D95DT0PDp>/DDP!<D43 Eu+\E!*ET37EȏfHE%YEX#(qET&H{EdE+PE$PEdE)8EW%EH&PE(># E#5xE /8F/<F,0p!Fye*Fk04=F/KF|V%[F4 hF@#zF5%DF3FH. FF $F5F3tFH8F~+lF(Fq`G%G8G@!#G24.Gx1,@G@4XG`dGV2|Gdt-GL-@ G*5GT0pGtg5GK#G"`GL"GQ2tH0#H0-H $/>H48FH4/[H0'hH!x{HL1H@fHp"\Hp#H@"H;%HDs H)H,4hH0(IXX'I N`%ID'9I $$>I43xOI|f8XIf0cIEflI!<sIq`yI4I,%I8L5I4IfIv#Ik1dII5I3J0!J@(%J5e,J! 8JTndFJ43RJp1/cJ$lJ؁"txJ&0J,dJ40TJ#HJ%3lJJ-hJdH+\Jd.J\"JTf.Jp&5| KfK}& K#"4K2'PBKLfUK!tiKP$tK !,K&K:5K3Kx /DK4"Kt}1K\(KY$ L"TL\b!L4+L17LT'18LLE$`VLt``L*lmLD @uLz3LL+dLh)L$u`L(+dL].L)8LX4Lt/L\+2L  M$4M,0+M%e2M" GM),XM(4,cMB8qMA'|M0dM&M& \Mh0M$bfM0~`M. MtN$Ml%N.( N|0hNd%#N&3Nx3tENw*QN<,\NH5lNԶ"sN ,N$)N+5N"`N< 4N|S5NB8 NL"LN 3NP!<N!8 O4xOC!h%OP50OT%;O4dxIOX3/xQO%]OW$gOH*vO&O4 O&@Oy`dO)O `O%O I8OH8O^(` PTn-$PdPtd'.P-8:P0KP"VP1gP2lvPlfP 38P|"(PT}0P *8P,L`PG8P?&Q X!LQ>5Q"L$Q80QW)h=Q3UQ2lbQ(@mQH!<QX<+XQx"Qh%Q1dQ!hQe5Q@A0DQPQ`Q PR)<R24RC25R)DȐfORDO! aR\"HoR$"R/R5 RȄfRg'L R(HR,58 Rt"RP0< S>8S80S2 BS4u1DMS`aS@8nS )XS&8SdSK`S8,S 5S0`St$ S#\TH1T\1$$T(.T,d?THJ"TTQ&_T/uT'TT2tTl1TԿ,T$TX $DTP$T",TH!\ U(8UZ22U1GUd)tTU3e_UfkU ~UP4(ŪfU<3xU.Up$DU4U,eU4#lUc,U0O!V#dV"*V|!X?V8,$PVO`[V* qV"VxI"V5 VT"VW0Vp&Vp3V82V$1LV.\V:8W$ WdW,H81W*%=W,LW&P^W ejWI5WH0XWL\5Wo3W8O00W%We!WPfW\'PWI&xW`W4PX\& X$ X!XG/'Xh&D3Xģ(FXl]5RX4afdX huX(tX(4\X""hXzdX`X0`X<53XD$`Xg4X&(Y4'Y0/+Y@B82Y .,NY@I`aY,pY(yY*YHdY~`Y\0\YY,Y0Y$Y0(Y@#YP4dZ$tZ $ZEf.Z4eAZTfRZ!h`Z`iZG'tZġ,DZ !<ZL`Zb0Z(ZN`Z z!Z8$Z dZx`[y08[`6[\d&[,%0[`e<[ 3J[xH#0[[0d5s[-[L&<[@"[~&[#|[Xf[@$ [830[f\HL`\Q,$ \#)\l3' 9\$I\*8S\od^\/s\E5z\`q'\"\!\48\O3\F8\48\p*\hX$\&@]/44]0/]`25@2]4@] +Q]8-a]-# p]*]0#]4]&],*8]Џf ]Y']Z1] 8]r`], ^L)^>8#^'8=^X_"G^P1PW^$g^+ t^d}^A3^*p^\.e^75^,5^ "L^4B#D^T,^4x^^(`_3_%)_`0_00l<_O`K_8X_p-dk_ %4r_\$ly_ؼ4_4_1h_od_!_,d!_t/_h&X_Ԉ4H_T-_\+ `x0`|&%`# 0`Е4<`$n0K`5eP`(& Y`ej`0,z`#e`4f`+X`/`-3p` 8 `95`,F/`d`!Ha4") apd3pa&'aT5Aa(Ya*8haD4ta 58 a30al_!Da 0a3/a)|a,a4a?2a0a,b/bn.PbI2@8b,eCbLdLb($\b81Lob 3zb+`b\_fTb"8bD+\b|C&4b\"TbK#bX4 b(48b#hb4#cT 4c*8&ctA87c/(Oc18^c'<sc3$ cxecG2c4\c` cX+XcD8c`%<c:8cX$@dX&D d`fdp0'db.4df?d=8KdP0<_dLdgd+wd.0 d/pd@J"dK`dpP!8d dc/dV,e@0Pe/e$\%e`"3edb10Je>2@Te8>8_e8xe$lede!e/de$d4he$8e@e4e28e0,eH/ee9-@e4 f e $f`44fB2Ff](X]f mf@>8wf2 fP?! f\ffD&f!f4f2f 1f33\f&efX2X g7&Hgh,!p/g58 @gI Sg@+`gy%|mg0zgh95g@8g04gD<)g)3xgK`gx(gpfg"hw`h@2@+h4\:h2(Fhp%XPh eh0%shx$`{hd0h4hT1h)h8he!,h8$/h,N`hs)$h$|i) itd%i3 'i&d1i Eiw`d[i8gi0Pi" i`iO`i|%<iܝ3$iP&0i0C+iؑ%Xi<$ti#eid/i+Lj*jxR"jp8 4jm00BjD%Lj.0[j+djć3\nj(dwj,eXj,/(j`fjK`j 4j(,jH2j!4jD)Dkn2k Q1k(`3k18Dkh/Xk V- gk' rkw*k3tkLv0k58 ks'k"kpW08k 8k} ko`k+l!lL-el 0ld75@lo/Tl((blH8mlTj xl`l424lp"lp5@l8l̘%dlq"8lPo#<lx{  m&3mef'ml/3m)8Am\-!Xm,d `m)lmHzevmP`}m8fmc.m5&m&em8+mh$mT0dm48 m(1m* n 4nZ(40n0>nԾdInH2p\n#lnf1\xnx)n$@nZ$`nH" nB5n25n xn4I5nI+nh"oL4, oX8Po44o$0?o/Ook-\o 'Lgo48 xodG!$oXb0do@8o1o / o-0oH5poL?1xo0(p2px'-p25p@3e?p$PIptf[pܬ5dpx&qp2ph%p,px$pHfXp2p p`p5p(@ q,,q&@ q<8*)q205qd=q3DGq"\qN!nq6 vqx"}q%dq8!@qa5qx(q22q(7&0qT&qPX.pq\75qЫ#0r91rb*($r!6r8Gr.|VrLg5\ri3erP20ur2\r.<r(+rI3r0+0r(DrdK1r2 sL.&sL \4sn%JsV$Ts`]s4js#xs3@s L`s)hs5$s ,sl}#sv0$s`e/sY,Ps\ #ls( DtftDg5t*3h(t`-,8t|(Vt8%]t4,@tt@u0t(tl!ht#Tt6!tpE5t34<t|&tr%tM5t4duT6 Pu!/uĴ&()u.6ue,Gu 3XWu`>8cug10{u,u0u8u&e@u܃1Hu(<u/u%u u15Tu'v8"@v <5(v',@vh/8Ov;5bvA8{v,tvdfv0"pvu`Pv78(v`20vh61v$W&v%w7#w"6 wr4T3wc1$Aw$NwTE,xZwС!xbw%kwS1Huwl e~w8#8w5wP.8wI5w'w4ewv'wg#,wPzew*&xq`x$ 4x2'x /4>x"(Ext!\Lx&3|Zxxfjx .lvxd5x6!xp`x)Lx8#Dx!4xDJ2xX10 yQ#TypO$ y-+y+9y4XFy\""@Uy@8MD&b2To.l{P+T38L%x*4%$2Ȉi,؈&߈u`,|2$dJ!t) 4*M1;P/L1b$5wx2p+u`() $Dm34̉*݉9%p&&@& u#txF!,'4> 3IO((c#ws"3$4d*H!Ldu3Њ0X' 0T.8'#4#,BD5<M&X%L_'Hs0|J'$K8TI%[,1g42ev T1K5 *801ÏL`ҏ`$܏h4H238$/``/L':T/<DȔ!W2Lc0)mB8|&X20,28@ 13$J5ΐ='ؐ!X3#pn#lb.428-F55W$0@!PPp*^&lW,{d&Hl8 /H84,2\E+XʑH4֑/,.4V!p<$4$l0p"@!+%t0|fGL/[B8g-8$s "t2P2(F+l)8ɒ@2ْhI5 J5U3 p1# b(:LT%hFP-eM5pY&d# p}&Te([$L3'Xp202e0HГf-+(p @ 4,`4, t`2 p!>1Rp 'Ta'z`3d.8ԑdD&LidϔXeؔ13S3\/+!&X*028:Pd0C\0LJ\52d[PdbDS5l<5s |@l4x3<H!h/!0C'L<5ҕ]f-+ؼ Td< Ll1(#*d350$9X 6 E,q4`XtO1bm$ jD>8s#l{dd,8~$38348$ 5H˖0*|Ֆ :2$G8xp08Np&*^`Xfl68 P58 X0@`F8p/8#\ȕf$ʞH ٞ,2_1hU,Ef!p*+C59Pi3GH5\lzdd 6 p 6 |d35\A8`4@dK`ǟ$@3+%2d`5/'##,38%T=l,TJ2axo-o,{,T6$*\<5&.(pՠ"D6 P8#P3h3dXf<\1<) &x;7/H`$RZf`%jh!x^1x(!4H!@̡'hd"D4$x/hM`"*8,69$R`@q&N#6 Z@*kH!wK,S5+( *< ,,$ɢ\;5ܢ5 2`4 `.80I!.2@*8Ot58 ^d5 m91x~$28(3\h0 Ȇf)8O#ɣdң/h|$8+2$TY,h B8 8.xU(@@(R1lS%7Y &,g/,n;-T}l!h4D4fH#tϤ`ؤm0(/(p`O$p4j2&Q3t7@H1LJdTd3]t75m)$x 8$cfD!xc4L5`ǥ85ݥ28 2 -0@ .PHf*,1A!H\#<YZfb(H~ T"h8dp!T() P,1,æ`1Ѧ>%ߦ%Ș+HH5 /D:5) !P3I5J,1`YL/hK`{~% F'D&<n#D8H1J5ЧB8ާJ5X 3d+ T)p(&*x :30tCH4QR3`(^1|u0@|L2&$x!`0;2%dʨ@8ب38D"H3 -|$84#d074>d[1`I@- Xhe`!l1s0)\@<"4D1/$od2ة,,0*8/T3e0/80U%0,!4=(N`JL`Qk,d* s{e~&$75X5%L4T )ƪH`ͪp1Pݪ$]5/X/82!48 1J!=F+I /W\C'He00LnD!0z0TXf48e'x#Df10|n4ȫ0X Ы'83'l!6  2,! #$) Q(P@<%G|)8Q 0apXfjk(T/$ -Hi&`(l'!Ь2\M.8"8(%$ !4 D58 ( 2442\F3eR &L_fgfvG+D@4\)&D$2ԋ/ 8"@ĭ 5٭8l2f2"Lw''|n%8(odC\+,T8\`}`j,(~]4C1d48ܹ+ /0Įh&Ѯ8>3tݮ|A8%HX.P`3\'/6HdA^3\K\2]p/$pĽ$y8"P+1I5,eR2,ѯ1$xk04L!T$$ E5(0,H8+@V(Cؑ#RH"cش2s ,hĨ(,h#+h`3˳P`x۳,&(Q10\/$T(('FtM5PL3dM(z4&#< \`4 0"``Ǵ,2LԴQ#lܴl2D5@M $l8/HB'Lf(ze6 *4Fd0Y0gt *tr 80{/$`4,PB8T F8#pµ4ٵH22$44`d("؄#L*,8/=:)`L-a"XjHX3Hw/4@/tT.h*5$ȶ̬5x4,(/d/H !032LK@+PZ$"h&0x/8-@ P/D/e0%p %LƷY(X۷<5(31Dl1 86e)-H&<<0xP4N`<[$,j`I,@q#yhB!(184D8`b,lθ/xܸ Yf,``dFf/ h0*Hd9̇fD!'O2Z:8fxD$xnr0X]$\4e*8(-!4`ùH` ҹf۹ 2`5`/84p@A8%LJ#1(O/pA$Lx8S0~4eJ5{ 2X&TP5#Lk32 ƺ15غ{'L{2H %d:8 d( $%  /f@)lNd"0cpS!$v2lw+5< .,8 ,ڻ} d(d,}1H {%|ȼ2%B81d-e='^$(m$~ 22418ü/L˼6e޼D/(P0@4L`$L$ I&3p1'L%T20h3< +K # U%He8uXe2\&|*8 8ɽ(00ӽ0eݽp 2,((PM5)d35/ O,@02TNL-[)i,&v"h=&D|1t_*ԓd /(`-ʾHfԾhfd,LX$"l.8 PB4*1d9|40Fx#`Q&<Zx#h x35Hhr` (ÿl4 ѿ#hݿx0#$t`H8h2`&4*5&@B$P3xS4#`E4,I3$S$&`E$ hf&(@x*.(/e-%,,'D O#(+#8530"pN{0d1@kD3es "~8`)L050\fpe`!>8XA2 <#83t`F4TX7&P_&k65w(+ fH3e%t#|%xС3818(D0S#<L;5` v2t*/.hA3I6!PY,c3d 0rHy3)$8(T&DN! 8  X42TB(02532p-84-438\2A|W/\R"l`0 .po)zx%4+D]'l=8 $ P2p`85,y3@S1D.<& -L5\2PF/XR4 a`j3y*`A8 31 /8&2ff'&D"8 Z1+ 4Y!? 8L0y!4X 8`|#@wIfh($`?/@̛%0@#'(D"HLd(D4` 1|f@$d%/4@DA4PV /Hjd-#,x|#0C1l/Th-e `,e$ PQ/ /l/N \*f:(tG#eO81TVE,@ai$k6rD`z!`h4(`008t0f04e468 &D4p-`.Z+8*EH3eO#W"0bp1xuPI"`2\F+%,l *0~`0.e%8 4 ,h.)H=0-Nԫ4H\,i3$e0Hy / m#t8184a!(/f/L\(x "L| +4`1l6*`'D `0X`9C8Gx) Z@]5e0/v̰)h.8X"($&-(5@B+y#xy0`N($&H%R$X058 A$8L )`\$@i$t~`~-@8*X!X828܇#  04f0HHq`'B8.d`;3E8m4U08]~!n@d}!\| '$2Hx" |4@3"dD4 <*892X*`!H5Ԕ0@F/&(Q(&H^ `hv1z D8$=83$5p{*\<-2t 8m%H,N#Pĉ1d 8!4!6 " 7L&)l>,R#dLL)5^3l*8t@42D75+J!x1p .d1$`4p@) g! -t398pFR5V9/$j`#)rm&<y|!tK4!LG+Ph+#t@0D(LZ4z0<(.e p&4&D!`#/4<@.Z|dj&y"4!&<1%,!&\T00d@`fT,x8(8"$7M5FL @O1d|.erH&T}(0,$%l,5h/('d8814(3ed|`4X4$ z$4#5K6eU&3l_|H/$s&{TI`<=84(98@O`dO! `0 (,, 0$d>(82d"L3e.xe;42<I\ XK4$i3s5P2\D80t`4,D`1@=10hXf<3|"&`[1G+<& 48P;"lI8]5TT/`gF,@p3e}#+D5hj%H040C/H,4p^3Ж'dL<$<4H,+:T&dGtzdNx4[X1(oh&D`lj0h-P02 0/;5{$p# 3H0 +D(L:#Ld Y`&dR2<$6$efd,8O5D& h ze$-!8@~4T` 91&4)29! 9*M\.YI'e`q34{2 &<"6 ,, 58  2$#0r`0|*#'d+26#hF25MW$x\w0xh)+t|^(<4(|!X"4w`\-4h3(1d!|4 22t0AX)T01^|$k8H6eU0xaL,qD%&| "s`%x(B-MX3eT|`[#0mx!6 y&X*$/lTr` 3^f/c#1pm0Np}$8X!k 4u` p`Hk"h58  |I3T*D&|R#d4D s`@@0d-K`;,Qn%en1<t0"o1d0#0L0L831$$30 [1l/"̦.T/52X>|+IHX4W,P1d" q !@0&|Td"z-8(3b388 D# B  8J PdR \`Y I5m  X{ T,X 4L \`<  2h , d l0$ Ȋ0 / P/$ #( %H /e t00/ Z'> Գ%L @#4c z#q `y <4 0 ,0 d,T `/! (6 <- (D p20 P1\ 14 m0H 0!_ ?(x |2t 31 /| / R` *8 :8 (L4 2*%9e3<Cu*O*]|i#0itB/{dv#tD/P\2Xf/,*/!4`44/3J'X3l 04!(9( @ȾdJ' Xx- bY%qM#H`24T85=8<%X(4'H1l ;8pD.8#4d2p$T;p5C!3QpF8b8k1wH8|B,@L$F8 @e#3" *h1< L.pP"6 ('>(!(Q83<\1\t81$24/<'(85 %l1@n%< 0/t30` $$d't="6q!LCV1M80l[4q%ch6j!r(dhO00B8A8( |43eXdd#@(4<2<,<$b'8B8)+(7`8?A8K@$V'j5r|m1|(D[f9(C'P,k5~`638\1)8pI"+U"5%\G"\U"d'v8,@8z#L`$h1P8y10|4@L`28Ll#P`., $P!./e7ģ0 H\4Yh0h3q 24|84D49'E% <+ ̾dO0884Ls3@1P/8#`*m,4 /=\dFt}`T@+4a40u0оdx`.@f,0@C8@%H.8@'3d$t,A/Hm0`08 8<0Ix/Y,iu/Pw0E(HX$\R!42- cftJ5l(4 0,od ,75A/0|N#d %DO%P,/@<8'5`(D1C14(dث'h, !4(M`*8W.7;5I /\48 j(4HuHfzL/<%p!hDL`%x-d2P@fB8 XX!X`%tf6Ԑ$,A"MP(g!PtL.8X3x)84,84,5ef2 f $4j.$b!01lXf>& L|$R4J!ci 8s/@}ȑ0(3h(46:5r%<L%($8!8 &|' .=8<#PDv Mq`S1m1t0pO!&"lO&-[&Ч0(i&@1tw&4.e~&Hi0$&,;5&2&)&-8 &/&x1&?.0&p|#L&T2-'$?2'\&$'&%*'5!(A'C8V'%a'd j'@`v'Xff'L`'4\'P4<'8'4' J5'$/'P,+L',e'U, ';/$ (Df(p%@ (8>.#E.fM.F8[.w1 j."$s.5y.L2.Г( .$. w`.3.s3. .8u`.ħ0/8/ /$f +/L.03/D*C/@`#T/4h/|3@s/)/#6 /Py*/|$/D8//e/N`/p!/4/0$00N` 0<750L`+0u,X70I!0Q0\d^0H5i0H!4z04T0D*@08084h0|l1X0O`0'0D$60*581x&< 101U%*1B28B1H*P1\S5Y1Wfd1dj1"/Dx141 @1$`1X2\101p%018.81q`1 $01 z+` 2)82D14#2L-p,2@%`52 &(8L2<&]2\r'le2t#r280$2'<2:)T24p%282"/82D9'h2"`2`b#|2PA8 3% T3T'l13L%83p4 F32X3)0b3@.8p3$"~3%3D53.&3H0p34e3T` 3`N,30+x3.4$5P4,% )4(68 ;4|,L448 ^4'r43{454ȁ`4|"$4%4n004 4/(4e425|15%5?$|%5b1d:5tB5I5n%\5Tde5/u5|~`$555d#d52'5H&\5{#5X(P5XXf5f 63e6Tf#*6!563@6pN`J6G2]6T\fm6 %|6446o26\F$6t*$6,!6H!l6N36``6/$7O!,7$!%%7.x27!F78^70%k7\!x{7+27/7L*74.7 57Q`707!7l478184% 8\$8:8(8u+58,2G8@ +TS8 a8%l8dw8g1,8Г 88Ț,P8\(8T4@800d8#x8$,8l?38p@!X91@98A8!9@,39'K9D0dR9n)H\9ԡ4j9tc)y9!L959/9e98 909/L9&93X9$!:$:' L :d4,,:-@B:5eK:`T:l&[:4Th:x)du:|k5:`:/0:j/:L):*:@%:&"8:L%`:91 ;h'd;8,;!`6;0PB;H)`R;&0[;<28f;$"\t;0;u2 ;(#/;\3D;N`;8;@$;*;3H;p4;`;$0<h#d<d X-<TK-;<0!>4<*>\2`8>/A>08 I><8d>5n>4{>A8>o%x>(! >5>`>4`>0>@:%>`D5>1p ?f ?5)?\.88? d??a'K?PS1H]?L0n?o&z?|zd?0f?`+?d38$?I!$?11?%|?Xd?d?XK5@8 @t/+@L!7@h 0Q@W3d@53p@<+@ 4H@2L@#$@"6 @@95@@J/ @,/$@|/<@"|A؟2pAX[1"A2d.A'IA3VA1 eA#tA1Ad-2|AG5A lA:8A-8A%AN4A2`A|;1Ad`5BxfB($B̚'6B`d@B/VB@+PjBd3"|BE B)Bm(T B`O5B0B%Bd!DBd.DBd54 Cp- C`.C'&0:C$IC"@RC858 bC\s`mC@2dzCfC0C F,4C'C"$C8u0CF+C(Cԁ1Cܪ%xC&D(1DXfDDd)DR d3D =Dw+GDK&PD@ `D{*pD42T~D%Dt(dD\(D/8 Ds`Dd&0D% Dp-D@$D#|D`E2(+E^"5E!DCEG,WE]4pfE4yE8" E4eEl2/E'E !E#8E&E0E!DE10Ft-Fb1H*F|y`\OF0. [F'iFdrF8 FH F 8F,dF`s-HFfF`K/F*F8F0PG|,G8$,"GJ#/G{e3G| FG0P]G&PnGo#\zGA4HG]2G'dG`&HG$&hG ,@G2G GL+H^$ H2\H83"H#.Hd:H/(AH 30QH /[HTr40kH$/~He!H4/$H /4H$38@HP*#hH C84HeHL75H%I( HI(3I0L`FI$UIL!dI1tI\58 I4H8(IX2hI<5I5-I],I75I9* IZ.J95J3e!J)H3J\)t>JI&(GJ8TJ81(fJ|'J$u"J,'J|6J&-Jg,LJ3Jd4,J\ffJ!  Ks1K75,KT.EK2hRKcf`Kd( rK $}KT;"K )0K0`K@&K&@Kf,@K)K|((Kl8 L;-|L:8-L ;L1RLG,bL`kL4@L (L\(L&@Lx&TLddL91L "L0L p M#,xMQ` MB 0*M&D4Mh,<@M(|QM܁1bM%-tM44DM 5<M "MxfMlA8MD-%TM,M,)Mk#DMx3\M%'$NC08 N (tN`X!+N?47N1lDN(/TON43X\N48cN>0uNf ~N#N8h0HN\.N"hN_$@NHC8N\,|Nl3`N>8OfOB8)Ol.H4O0>8IO 4 WO5jO<1tO$"O4pOl&TO#eOy*`O4O#|O$U/O45O#$Pw!p P0P(l6P<.eAP1ET'[T'qT"0T2T)TwelTC8T $T68 TR2,T"T4 U)U#%U(d1U `;U<`BUK+MU-p\U,&(jUeqU2&L|UI#Ud 5U2hUH% U|d)hU