ELF@41s4 (@@1r8 5P xHP rHP nHP jHeHHP ^HP RHP XHP RHP NHP JHP FHP BHP >HP :H  H H H  H H  H  H H H H H H H HP EHP HP !HP "HP #HP $HP %HP &HP 'ޡHP (ڡHP )֡HP *ҡHP +ΡHP ,ʡHP -ơHP .¡HP /HP 0HP 1HP 2HP 3HP 4HP 5HP 6HP 7HP 8HP 9HP :HP ;HP <HP =HP >HP ?~HP @zHP AvHP BrHP CnHP DjHP EfHP FbHP G^HP HZHP IVHP JRHP KNHP LJHP MFHP NBHP O>HP P:HP Q6HP R2HP S.HP T*HP U&HP V"HP WHP XHP YHP ZHP [HP \ HP ]HP ^HP _HP `HP aHP bHP cHP dHP eHP fHP gޡHP hڡHP i֡HP jҡHP kΡHP lʡHP mơHP n¡HP oHP pHP qHP rHP sHP tHP uHP vHP wHP xHP yHP zHP {HP |HP }HP ~HP ~HġHP vHP rHP nHP jHP fHP bHP ^HHHP RHP NHP JHP FHP BHP >HP :HP 6HP 2HP .HP *HP &HP "HP HP HP HP HP HP  HP HP HP HP HP HP HP HP HP HP HP ޡHP ڡHP ֡HP ҡHP ΡHP ʡHP ơHP ¡HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP ~HP zHP vHP rHP nHP jHP fHP bHP ^HP ZHP VHP RHP NHP JHP FHP BHP >HP :HP 6HP 2HP .HP *HP &HP "HP HP HP HP HP HP  HP HP HP  HP  HP  HP  HP  HP  HP  HP  HP  ޡHP  ڡHP  ֡HP  ҡHP  ΡHP  ʡHP  ơHP  ¡HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  ~H 5P HP  rHP  nHP  jH eH HP  ^HP  RHP HP  RHP  NHP  JHP  FHP  BHP  >HP  :H   H  H  H   H  H   H  H  H  H  H  H  H  H  HP  vHP HP !HP "HP #HP $HP %HP &HP 'ޡHP (ڡHP )֡HP *ҡHP +ΡHP ,ʡHP -ơHP .¡HP /HP 0HP 1HP 2HP 3HP 4HP 5HP 6HP 7HP 8HP 9HP :HP ;HP <HP =HP >HP ?~HP @zHP AvHP BrHP CnHP DjHP EfHP FbHP G^HP HZHP IVHP JRHP KNHP LJHP MFHP NBHP O>HP P:HP Q6HP R2HP S.HP T*HP U&HP V"HP WHP XHP YHP ZHP [HP \ HP ]HP ^HP _HP `HP aHP bHP cHP dHP eHP fHP gޡHP hڡHP i֡HP jҡHP kΡHP lʡHP mơHP n¡HP oHP pHP qHP rHP sHP tHP uHP vHP wHP xHP yHP zHP {HP |HP }HP ~HP ~HġHP vHP rHP nHP jHP fHP bHP ^HHHP RHP NHP JHP FHP BHP >HP :HP 6HP 2HP .HP *HP &HP "HP HP HP HP HP HP  HP HP HP HP HP HP HP HP HP HP HP ޡHP ڡHP ֡HP ҡHP ΡHP ʡHP ơHP ¡HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP ~HP zHP vHP rHP nHP jHP fHP bHP ^HP ZHP VHP RHP NHP JHP FHP BHP >HP :HP 6HP 2HP .HP *HP &HP "HP HP HP HP HP HP  HP HP HP HP HP HP HP HP HP HP HP ޡHP ڡHP ֡HP ҡHP ΡHP ʡHP ơHP ¡HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP ~H 5P  HP rHP nHP jHeHHP ^HP RHP HP RHP NHP JHP FHP BHP >HP :H H H  H  H H H H H H H H H H HP HP HP HP "HP #HP $HP %HP &HP 'ޡHP (ڡHP mHP ҡHP +eHP ,ʡHP -ơHP .¡HP /HP 0HP 1HP 2HP 3HP 4HP 5HP 6HP 7HP 8HP 9HP :HP ;HP <HP =HP >HP ?~HP @zHP AvHP BrHP CnHP DjHP EfHP FbHP G^HP HZHP IVHP JRHP KNHP LJHP MFHP NBHP O>HP P:HP Q6HP R2HP S.HP T*HP U&HP V"HP WHP XHP YHP ZHP [HP \ HP ]HP ^HP _HP `HP aHP bHP cHP dHP eHP fHP gޡHP hڡHP i֡HP jҡHP kΡHP lʡHP mơHP n¡HP oHP pHP qHP rHP sHP tHP uHP vHP wHP xHP yHP zHP {HP |HP }HP ~HP ~HġHP vHP rHP nHP jHP fHP bHP ^HHHP RHP NHP JHP FHP BHP >HP :HP 6HP 2HP .HP *HP &HP "HP HP HP HP HP HP  HP HP HP HP HP HP HP HP HP HP HP ޡHP ڡHP ֡HP ҡHP ΡHP ʡHP ơHP ¡HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP ~HP zHP vHP rHP nHP jHP fHP bHP ^HP ZHP VHP RHP NHP JHP FHP BHP >HP :HP 6HP 2HP .HP *HP &HP "HP HP HP HP HP HP  HP HP HP HP HP HP HP HP HP HP HP ޡHP ڡHP ֡HP ҡHP ΡHP ʡHP ơHP ¡HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP ~H > ';8;;;;; ;(;0H )@`  > '!  > ';8!5 > '0+0;"+*+0΁`#@ 0΁1 !>&;8>0)@09`")@)@0΁`# 0΁1"; > ' 9`9`9`9`9` 9`(9`09`86`@!`xH )@` !!! P -@ @ @"P/> P-> ' %)> '" %"+/> -> '+cP> "`""#t@>= ;x ;"`;" @/@ LҊ@@2 @ 0P -@ @ @"P/> P-> ' %)> '" %"+/> -> '+cP> "`""#t@;x҂@ ;Ԃ@`;"k  ւ@ ؂@ " +?P `* -` @t x ``-`܁ @ؐ tx Ӂ )>"@"P -@ @ @"P/> P-> ' %)> '" %"+/> -> '+cP> "`""#t@;x;;>"" ;`#h#l;;;;@ 4E``htx ;`#h#l;;;;@ 4``htxr )>(#@)>) P -@ @ @"P/> P-> ' %)> '" %"+/> -> '+cP ;`@;h#t;x;;;;;`@ 1#;`htx, /> -> '+cPۜP -@ @ @"P/> P-> ' %)> '" %"+/> -> '+cP ;`@;h#t;x;;;`;;@ 2;`htx偌 -?P @c-@-P -@ @ @"/> /> /> 6PP-> ' %)> '" %"/> /> /> P;x> "`""@;,/,;@ ;`,;h)>>!#p 8% 8H  p@ @ `E < 0x  +?P`-- -?P%-?P0P -@ @ @"/> /> /> 6PP-> ' %)> '" %"/> /> /> P;x> "`""@;,/,;@ ;`,;h)> c##pH  p@  "`@  0@@ `x) `E <P -@ @ @"/> /> /> 6PP-> ' %)> '" %"/> /> /> P> "`""?P * * ;`@;h09P -@ @ @"/> /> /> 6PP-> ' %)> '" %"/> /> /> P> "`""?P * * ;`@҂@ Ԃ@;h ւ@ ؂@@¶`h ?P `*  P -@ @ @"/> /> /> 6PP-> ' %)> '" %"/> /> /> P> "`""?p " ?P "  ;`@;h@ `h ?p " m @/>  @̀-> ' $)> '" %-> '+cP-> ' VP @ H ,@`#> 'a$` (08 @̀;)> '"0+0;"+0+0 `# @ 05-! % >&t 8 >0-@0=`"-@-@0 `# @ 05-"Y  -> '%- +cP ;`@;h #t;x;`;;;;@ .;`htx -> '& 0Ʀ! H,@` !`hpxX (08@HP @̀H,@`%> ' $!> '!`8 (0 @̀@ @̀  H ,@`#> 'a$` (08@̀㬀29?@ @̀;'> '0/0?"/0/0 `# @ 05-!$>& 8>0-@0=`"-@-@0 `# @ 05-" ?  H,@`#> 'a $`!> '!`8 (0@̀ -> '  @wP-> '"/> d4ɐ  ! H,@` !X (08@HP @̀> 'ℒ `?* `"" * `@"> '⣒  * `@&* *  ֊@* "``@!>% Ԯ$'1@'0@ )>+>%@#'> 'Ħ$$3  > 'b "@%> '$   c d  mt@ >  > '"$"|@t@ >  @@   >  @@ K#>%>C  'bĀ@%  '`@`@ 06  '`@`@ 0, *H Ѐ(H+ `!Ђ* ր  Ԡ҂2`*`D4`@ D֠ 0 !Ђ* ҂2`*`D4`@ D>%c`@> '"! *> '""!`> '""H(  /  >  ==> '@H > '"" > l">Ca @ l]"@!> n$#H``> n"c !>& @!>' D$ $ >& \ *> " > " > "!> "!<>#"">#"#>#"#X>#"#>$""4>$""\>$"">$""0>*"!@ @d#@+`;h;p;x;;;;;;;;;;;;;@L@P@ `hpx gP    "%> '> > '"  "> '>@ > ' !>&b# !>&b# J@*@ ` `*@ ?"@ 2"# @ `*@ @ `*@  "  ?J*@`8  ?"@ 2"> * > ' >@ *> ' >&#@" > '" > '"   > '4``6 > '>:H"(o  (1L`!4"j j ` *@  ( !> n!` (08 2㿠@ '> 'a` Ъ@@>€"Т@: H" H*/  dh> '>'b " `2 `2`2" " ?" ?@>'b" Њ@" "@ 6 :@ 6 `6:   6  J?*@``";" " J `*"J*@ `"" "R2@ `4"R2@ `"" ""@ `""@ `":@ `""@ `R2@J *`2J*@   6 " J"`*@`"(" " " J"`*@"" J"`*@"" "" R"`2@"" R"`2@"" "`"@"" R"`2@2J?*> 'a>(\` #` 6 J *@`#`  `"<" " J *@`#`  "J *@"`" "R 2@`8"R 2@"`" " "@`" "@"`  :@ ` " "@` R 2@J *`#`  2J#`  *@#`  #`  H@ `*  @ : " : : : : : (: 0: 8: @: H: P: X: `: h: p: x 2@ *  @ 2* H@ `      ( 0 8 @ H P X ` h p x H ?P *H ?P +*?p` "@?p`"@@* ?P` <@ "@$@% #@%"$@% #@%&؃%"@ւ"%ւ"&؃"@  >) "2 J "2 J   "2 J  J  @ @: `  : `z Z@  r R@  /*# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@#  # # # # # # # # # # # # #@+ 3`@;  /)# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@&@# # # # # # # # # # # # #@+ 3`@> ? @ 3 > '" c@  Њb@&""""  > F`t@ @> nc ``44: " longjmp botch `&"`㿠>*@>"6 0㿘``@ǐ  (@0`@ ``@  `@ >`,㿘```@  ``@  `@ `` 2`㿘         ``@ [㿘    z  u``@< ```@ 4 ``@. @@` ``` @ ! ``@   ```@  ``@  "` .@` 2``@ @?ݐݬtި0߸0l<ltH,!"!)),((h(''''L'&&&|&H&%%%x$ p p$$$`$D$## "+ p p p p p p+++"`//D/4/4/D/D/D/4/4/4/4/4//D/4/D/D/D/4/4/D/D/D/D/D/D/D/4/D/D/D/D/D/D/D/D/D/D/D/D/D/D/D/D/D/D/D/D/D/D/D/D/D/D/D/D/D/D/D/D/D/D/D/D/D/D/D/D/D/D/D/D/D/D/D/D/D/D/D/D/4/428::d:H::6D59P9098800888x8X7076544$37700000000330000000000000023222210000000005000000005utwdwHw,vvutvvutvutututututututututututututv`v@vuuututuLd,(D`|T >  b(>+\> c> b> b> b> b> b> c> _`0㿘?.`c0@(`0``)` !@.((2 h" `2 @  ", ) @ `0 0@ "Ґ* 2 x(`0``!@׆'(2 `2`Ր !@`` @͐ 2 !` " `(`( $   @  3 "#`(   2  8`  8`( ۖ @ 8`(<?? @ 8` 0`  /`!'`"'``#/`'`+ '`'```` ```````` '('D(`  ?ȅ(`*(`Ą(`#\` 0,`  (@-``0)   (@#` 2* /`. ,  `0 (@ĉ4``0+` @(@#d ! > , @=G`6`5`0`4`.`/`1`2`3`7* ```,```-(D() +**`(`@ @@ #`#\ *+ +`> @P@@=@``````0 ((@*,`,    ` ` ``''Є``''؄``3`2`+`*`  + *  @''`,`0   ````` `!`"`#``'`-`1''`4`5' ' 2  > ( @ @ @0*,`,3`        ((@2`+ +`   * *`@  " >  K2  > D@(`@D@6 DaȀ (`@6 DaȀ (`@6 Da(`@6 (`@6 @(6 (`@6 ">   x"w> ( s 㿈````````0*,`,3`        ((@2`+ +`   * *`@ !? (!` {Ђ``/(x`"<??? ` ` ` (`@7 !Ȉ` ` ` ` ` (`@7 ``/ `/ !Ȁ```(`@7 !````(`@7 ``  ((`@7  @  ) (` @ #`#d #\> @;` ` ` *#\+ +`@ > @;`&`'5> (`@7 `*`+@(7 `*`'`&`+./ @; `"``` `!`#`$`%0*,`,3`        ((@2`+ +`   * *`@ "b?  > @;M6 2V?  P > @;<6 27? ( 1㿀!.`.` @(`@ 8)0( @# !Ȩ h ` `p`@ ?(# `2- - - `%(0``(`% 0``(`(% @@0``(`(% @0`(`(``%(`@5   !@0(`@5 #\ 0 #` !> #d `#h` #l"> @:P3``#\3`0#`  #d 3`#h ` > "@:` `p?ú`(?c  ( t ,,$  0``(` )( + `(` *4`,` `"`!4``@4` `4` `` 4` ` " 4` `@" 4` 0``"4`?4`4`$ (0#\ 0``#` `#d > > @:< @0``(` $ ``,`4`` ``" + ,,$  0``(` ( `(` 4`,`(`@5 * - - - `%(0``(`%㿀!.`.` @(`@ 8)0( @# !Ȩ h ` `p`@ ?(# `2- - - `%(0``(`% 0``(`(% @@0``(`(% @0`(`(``%(`@5   !@0(`@5 #\ 0 #` !> #d `#h` #l"> @9{P3``#\3`0#`  #d 3`#h ` > "@9e` `p?ú`(?c  ( t ,,$  0``(` )( + `(` *4`,` `"`!4``@4` `4` `` 4` ` " 4` `@" 4` 0``"4`?4`4`$ (0#\ 0``#` `#d > > @8 @0``(` $ ``,`4`` ``" + ,,$  0``(` ( `(` 4`,`(`@5 * - - - `%(0``(`%㿀!`` `08(( @$!Ȁh2```$`, `, `, ` $!``  0``(`($ 0``(`($ @0``(`($ (0`(`$` ,` ` !> (`@4``(4` `(`@$3``#\ "#`  #d 3` #h ``> #l@88P"3``#\3`0#` #d3`#h ` > @8!> ?b?èc 5;9a7?8  ,` 0`` $4`l! 4```"`!4``4``,4`` 4`` @@4``@04``0`"4`4`4`$ (0#\ 0``#` `#d @7Ř  @0``(` $ ``,`4``'` `,,$  0``(`! `) ` `(`! `,`!` 0``$4`h! ` ` $` $㿘!`@   c!?@7Z !` ` @!` ?2 * c?  (`2 @@@&&㿘!!`0@?a` I4   S  > ?@7-h`P! ?@  ?`b2@@0 ((` @0@@  E   > ?@6㿘! ` @6ِ !`  @6ѐ !`~@`f (`0`<  `   !@@6 ! `!` @6 ! `!` @6 !` <҃<6  (`6!  @@6 ! ``  `6@6x! ` @6p !` `2! ` @6` !` ?c(86``8`?` f a!2y`xf㾐> !c<' `_D`4!   G `aS1! ?(``  ` > @6"? F``87 ! ˤ  > @6 0`P2!Ā     @ !!``4` ,`  ``<   @ > @5ٔ?> @!  > @5Д?  ېג  Ғ   !`    㿘!Dp($$4 ! 4 4   , ,  k4 !! < !4 < (!Ȁ`" !4  ?(4 !Ȁ@#&!Ȁ22!! 8`   $E!Ȁa25!! (8`( , (@  > @5h@!!8`(  ` 1`@$!Ȅ@&!! > @5I!!8` !Ȁa"!! > @5: !!8`( > @51!!8` !ȝ㿘! V> > c@(`@3 @Io`?D ?``?@c  @  '2!4@, @0b<! ` @?`  (@@"쀦!@`, @〦 _6"T&"8" &"_!` Ho/a``@@4#p"T(`0`8`  ((`0"<(`@|!`_3!``@!`  "T'''''''''(`0``,"``1` `O"V6"V"T&"`7'Ԕ Q ` H("T'''''''''(`0``"`"@3@"X`6"X7`"X"\"@(3@0(6"X 0`"X"\@((06"X7؃0`6"\7֚`07"X7ւ`6"X@`76"V?h`) 2`0(`> 2p@4# ,` &,>+|`(`0`0`@ `` $ 8 &( ` `$` ` #\2 > #`  @3,`&, `$` ` 2 > X@3 , ` &(`$` ` 2   > @3֔,` &, `  > @3Ȕ8,`2$ &,$& `$` ` 2 > @3 , `$` ` 2   > @3 "`$"0 @@`(`)&",`v &, ` `$` 2   > @3 "$"d0 C@`(`)&",`d&, `$` ` 2   > @3b,`B &, > `(> b `  > @3M!`"'Ԁ`2%,'Ԃ b'7'''''''"$7`'  , > `  @3#,` &, `  > @3,`  .F&, `  > @38,` 0 `  > @2`,`% 0$ ` >  bx> b#`#\*+ 23  > @2ߔ,`  0! 0      0 0*` `0  (@`2 ?`@"0*0      `#`0p> !c<' +@>  c+-`@`1 .o/``?  (`> 6@@2v  > >  ^aٮ`6@>  @2_0連``?Ӛ ?Єo@1 5> 6@" (@&"``Հ`!`> > b@`@(`2"` "``> `(0 c ;4`0b<!@?` @ (@@,` @2!`46"T&"8" @&"_;!` H@2@`> !cؠ @?` @ (@@,  @?` @ @10yb<0+  3 @1! `{@``@ǐ"D`> `>  `*З2 > @.>  @10(`> `P0> `0  > @.=@> `ޘ80`> `ؘ0> ` Ә0`> `͘h0@M!0X!.`.` (@ ¤@ (@(@ 8(#@ ! ?`(`#@ !``#@  4!`2$``!4  , , ,,  ) )   @@(` `    ` !Ȁ`@3``#\ !> #` ##d #h ` #l3` > `@1P#3``#\3`0#` #d3`#h ` > @0> ??b?èc / ,`,`!  =@ 4 , 4 4 ! `` ``  !Ā@=  !Ă``:7  h1 !   ( (p@@@  , , #\ 0``#` #d @0`` ` #@  4!`"UW$8!Ě Є ( @$!Ȁ`@a3` %'7''''''''ǒ@@G$`(0``(`+@$0`+@`(`1$`""!0 (()(@&"`u.`?!.` @?(`@@> .` .`9'̂@  @0  D` , , $@ 0`''''''''' 0`?0 ( 7', @'7ҐPЀ@2נ `g""0`@`(`$ ?#&" @@   `  ((  0`0``:7(`"  87` a}4`@7Ԃ@7 @" ` `0`o@7``h4`ԃ(`0`0``#\#` > @/'""0`@(`(`&"$ ! ,`4` 0`??`(`! ' @0T 㿘"0`` (@`<`  (@`p!`2'ԁ i '''''''!7'`(`&p!'Ԃ j'7'''''''!`_W.`$7ր7 7` h'?A? !`_Sڃ(`0`0`()  1 *, *`  4 @ `1 +@  @  3 3 ` 3`2@ 4   + +`@ *0 * @  @  ((@@7ւ`7` '?? !(`ڇ0`* (2 0` ) *  1  1 (    *`  2`2`3`0(( +`  2 + @  0 ((@p!'Ԃ q'7'''''''$77a'' .`7֝p!'Ԃ o'7'''''''&$776'a 7'7ؐ?(`0`` (`, 3` *> 2@. ԁ.`7>+@ > @.`  ֐ > @-`֐ > @-H(`א,  2> @-ݔ`h!'ԇ.` 0''''''''7ԃ.` @(`@.`0@ 7'Ԑ2  > @-X?a .`''؂ 8 77''''''77'Ԁ@@f` ,,'@@` 0"`!Ă@`'7؄ ؅(00'#\#`, 8@7Ԑ 7֨7'''''''> @-\'Ԁ@5`!`'@ @!@$'Ԃ''''''''7ք 977 `  7'Ԁ@ `  ((  0``  ((  0``""0 (()@&"""0)(@&"h!`0!` -` +! 5a2$!'Ԃ 2''''''''7 7  7 7 70'@"'ԁפ ``.''''''''' 677`' 7Ԁ݄ 5'''''''''70`0` ` @700 ` 7Ԁ@> 3``23`2 #\  `@,w 'Ԃ 3''''''''7 7 '7Ԁ@   >  @,Z'Ԃ 1''''''''7 77'Ԁ@zi !`Ѐ` ΀` ͐``'Ԃ S''''''''p7Ԃ``k @"t77ڂ`1   '7777qC'!&"('؂ R'''''''H7Ԃ``C!"p77ڂ`1   '7777G'&" " !&"$'؄ J'''''''7ւ``7Ԃ 7ւ``ւ`7փ(`0` Y" (@&"!$ ''''''''77Ԃ``2 @"t77ڂ`0'77ܐ'!&"('؂ '''''''7Ԃ``!"p77ڂ`0'77Ђ!$ 3!`'>  @+Y 0`"!(&"@"!!`_p!`  !`_qP6!! @ z! _|?Ђ  &!&!Ђ $ (&!&!؂ < @&!&! `_(|!!` H!` H(!` H !q01> 瀠P6`.@䀠_> > .cp 4!`  !` !!`  !` (!`  u!`  !`_PЂ``/$ "!6! @ "!>  @*@``/  &!&!Ђ  &!Ԃ `_&!!``@!0*``)``q d.!Ā +! p> > .c 4!``va )"UD$5>  @*r !`Z` X` "W!!&!&!&!&!`"!@!!``_y @@0 a0#"!@*/ !`  !` @1@* d  c@* !`  a Ҁ !`  2  c` "!@) d??"!!` `_!`  !`M`_L!` H!` H!` H!`_P``!( @,  4 @ 2!!@@ h!!``.!``0 !``@ !!` !!` !!` !!` !``"!@! `@ 0@)q d??"!!` ''''''''7ԸԠ 'ђ@"h!!``@`! aS"!!`_*!``@  '7''''''''!@@&!Ė$6!` `&!&!&!&!̐` Hڂ (6!C <_8!!!` .!` @!` .!I _8'!`$` !ȃ0```_ 5?Ђ``0@ &_?`> ? Hc+ /?  @(ٔ   !`_ ``Z  ("h,@   *"@ ` !Ā@@ 0((`@0@@*"@` $ "p''7ڂ 0'''77Ԅ 4`4   7''''77777@> @( !`@  d.!Ā ! > > .c 4b!!`` ` 2! ̂b! !'Ԃ ?'ؖ7Ԅ??b''77?a7'''''7777ސԀ@2!7b!``"ܟ@#\#`*2>  @(!`ava )H$ >  @(!!`  "!@'ڐ d??2!!` > `!``  @@' d!`!   ! @` !` `   @ @' d!`!   "! B`  !`  !`_!``@@' d!`  ! c@@'w !` "! !``@>  @'y؁@'[ d'!> .> c 4 <.! h! !!6!6!%6!!`! 0!` "!Ђ``/! @`!!``.!! ``   @! @`` @ @X!G !!`  Q*> @' > > .` 4  (.!.!!``v!{$!`` !  `w$!*"&!!Ā*.!~&!> > .c` 4> > .cX 4> .ch 4> .> c 4i!> > .cx 4>+h> > .c^ 4 ̐b $ >  > @&#M!> > .`8 4  <.!.!> > .`0 4  <.!.!> > .`( 4  (.!.!> > .`H 4  <.!.!> > .`@ 4  <.!|.!Đ` ` 2)!!`  2 !;!``@>  @&h> > .c 4``@>  @&V9 !``@>  @&F> h$> #ؒ @&9 !> b$> # @&, !> d$> #Ȓ @&  !> > .c 4 ̂h $ >  > @&#! > @& h <h$.!Ē > @%Pd$ ̐d $ >  > @%#!>  x@%!``0  `( ``/>  H ) 3 @%ʘ-` !`2``Z0@8@ '"h`   (0`+`3 `!Ā@(0`?c(+`83 `%@"p''7ڂ 0'''77Ԅ 4  7''''7777В@~,`0`@"-`!(@&!Ē @> @%W!'Є b@'''''''' `_7!ą67@77`'!`P耠`_@% !` !Ā`2'Ԃ  '7''''''''x2!!`_( !7bw> ! S؀K> . 6!6! %> .6!!`4> b!!!#\#`#d > @$!`";!!!!((`@D@@@!0`!( !(!!( !_!@ !@!!@ !"!> `@$ !2!!`" !!!> x@$ !`_8!  '7''''''''2 !!؀ 6! *> 2@$z,"!(@&" "! ?``  &!  !`` ` w > > .c 42!! P(0``N(0` ?(e`P"H!7ւ 7/c2!Dia2!! `&"``'Ԃ6"V''''''''76"X 7@7e@"X* 2> "@#!``0!@&!776|&!` a@ !a`@ !@ !`" > 0`@@# !!`4> a6!6!6!> .> `4!> `7ւ 4''''''''7Ԑp  'Ԃ '7''''''7'"!>  'Ԃ '''''''7'7ԐȒԀ2> !!@ &!@ &!&!!!@&!Ă 7؝㾸> ` c<@' `+` > p@#: ,` &,@ > (`>+ `$` ` 3`   `> @#!`"/, ! $+`d+` @? ?4 ̈ (0  (`(`  @  " $"3`(@ @@ `(`&",`"&,0 `$` ` 2   > @"ܔX$&` b `$` ` 2  > @"˔,` $&,& `  > @"`,` &, `$` ` 3`   `> @"!`"p, ! $+`d+` @? ?4 ̈ (0  (`(`  @  " $"3`(@ @@ `(`&"B, `$` ` 2   > @"n,`7 5&, `$` ` 2 > @"] $, F`$` ` 2 #\  > @"N (&,.F>  @"E` , `$` ` 2 > @"8 , `$` ` 3` > `@"+ , `$` ` 2 > 8@" ,!`"``h"G `$@ † >   bx#`#\ > @",`̂ &, `$` ` 2 > 8@! , `$` ` 2 > @! , `$` ` 2 > @!ؒ , `$` ` 2 > @!˒ , `$` ` 2 > @! , `$` ` 2 > x@! x, `$` ` 2 > P@! k, `$` ` 2 >  @! ^, `$` ` 2 > @! Q, `$` ` 2 > @!} D, `$` ` 2 > @!p 7, `$` ` 2 > h@!c *, `$` ` 2 > @@!V , `&(`$` ` 2   > @!G,` &, `$` ` 2   > @!6,` &, ` `$` 2   > @!% "$"d0 C@`(`)&",`"&,0 `$` ` 2   > @! "`$"0 @@`(`)&",`2$ &,$&H > @` ڐ2>  > @ޔ``````` `@`2x>  > @ ( `$` ` 2 #\  > @ $a& > `(> b `  > @ !`?`'$ b'(7$','0'4'8'<'@'D@$7<@`$'@D ,`6 4&, `  > @ `, `$` ` 3` > `0@ S ,@=!@,`&(&,2,'$`$` ` 2 #\ >  @ :, @J > @C{` > @<q` > @5g` > @.]` > @'S` > @ I` > @?`x @/ > @ h#`  > @X`  > @H `  > @8`  > @(`  > @` `` ` $> b㿘.`6`@& @&`$&`(` .`F!``@(``"6@>@")5>  @x㿘`Q (`>,4"@>"@n d@'/"@'* > @z@  @  >  @l >  @dȁ > ?@\؁p!`` ` "! '!`` '.`0` @> @@c@(`0``HM(` > @2 !"G"!  @?'` @8@`2%! @?` @`>  cԃ.`@B @`@.`"@&6", `@!,` @`0>,@>"!``!> @Ֆp , 0``*> 2@ƒ  @` "!(@&" !!pa !Ψ '!N }'! y'! u'!> @a뾒 "!(@&" !! pa@!  > @~(M  > @v" @A>"! @'!`b !> @\\끒  @ $ "!(@&"!!> @@Re  @ה  !"(@&"!!!> p @!FF  @  !"(@&"!!!> p @9'  @ ʨ !`_E` "> @  "!(@&"  !p ! " *  @k ?""0 ()(@&" @W !"(@&"!!!> pa @,Œ  @7 h !! !> pa!"(@&"@ꥒ  @ !`"w!`"t!@ !``* 2  "tЀ> @W ""0 (@@`((`&"! _" > @@  > @8  > @0  > @(  > @0 > @h0!!`  > @ H٨  > @(Ѩ `  "d(  ,!) 0`@4"d"{ > @ (`>,|> @֒  > @ϔh  @h?0> @@Ē >  @ > @ dP "> @{ &"8`6"<@|Ґ > @h!{ !h !}:  > @0!{ !w !b(  > @yH!d !ނw㾰> c!!"86"< @?` @<`2 !`@?` @<"V(``s l> @ !4@: ,``!`4"<ۄ"@@2* "@@8!/8Q!"('`b `02!!`[ !!`&",t&","0` ! _8c!!``@!`   &"(&"0>  (, @ " "@@X>" , > < :> !`"('"( > @x!&"(``0 !!`!!` #2! > @!_ !` H(!`_ Ђ``/8!@\ d!!`!` s!`/ !`!` * `!#\@>! > @BЦ&","0`2O!  &"0 @h"l!,` u?``p ?`'  " _'@"!@`_ 쀤 "@)!Ā`  > ``` ``  '``" ```` `2``!@`  > @ܔ @[֔ @!!`@2"l2!!` [h 6!> !  ", @[ @zA,`#\3  > @8>  @`@ '   @*w!Ā` > "" , @`` @, "*6"``` ``  o'  > @_ 1!@!!  `@!G``  &, $""0 @)@`(`&"`"! &,!`_!`#``$#` `c  2.F  >  @a@;Ė,`$ &,  !"``"߀``_ A``$۪@ > @()!c @@;fc @@;` > @@```>  @`X@;````>  @`h@;{`c @@;tK" `!`!!`"&" !6"> `@  @Z @! (@"@2r``}(!"! `$` ` 2 #\  > @ &,!`_8,`2!F` !``%&( !$ d) ) @? 4 ̄ @  "$"d??c1  @@`(`&"``"$,` &,`4 $( @> @4 $`"~, (&,.F$&(" !!```@!Ăo`2 `),`F`!"wF6`` `0`W(`8` $`$` ` #\(2 #`F#h#d,> #l @"(``/ "6"/  ( @Yߔ @  26 > @ՔH!!``!؟@!`_ݸ !`  ! ` > `@ `2$ &, > @H!Ā` 2|$>  @ap@:Dt$k,`` ?@2C&(,"@&(=&(@t!X&,8>   c<' & ,(&  4aă0` `   e& , b@@  > @]  e& ,> @D!h a @?``@   @ > @E  e& ,"     e& , , aoh0! h - `0 > @ -@ 0瀠   @ 08` H 8`b?蛐?c9@ 2)b@b a_C  `?`?   2 6Lb0``8@`  @@Xː  , ,, , 4 @ aa`$b$bb 0(@((`$bЂ   @@X  , , , @ <aa`$b$b@$b @X @ / a`_`  / a`_` `  , a`6$d@?,  4 , #@ ?5@*  2 a " a 5@ a`_ @a85@@۔ 0 > @B  f& ,`_a-4 4?40 4@8`,2 (0a( 0`@, , @/4 4 $a@ g%  & , $H` `$` #\#` 2 > @0aa`$b$b`4b0 ,  4 @ؐ0v },J`f`?"'  `"  4  a]    L/ > @Ȕ  fV& , $A/ >/J` 4  B aa$- d- @? @4@ހ"3  `"/  4  * a 4  % a0> !!xc<@' `0&!x  @@W  )/?  4''/ '777Ȅ'!7 4o@'' @@'`' @'@/v'?''' '/'/''''''''/" 77?8/@8`/!'/ǒ@7X@  @W* @'''''''''7 T7o0`7/7` @07' 蚃oa  C '7c9@,!Ā` +> :@5!x(@&!x :$!>  @ݔ@ *> > ` @ϖ/^Gb @@7m!x(&!x? > ?@0!x(@&!x > ?@0@曐!x!> ?@0ʝ0> !c<'  @V < 74@ a7@  !1 7@  @7@ " a77Ș C 3 7`?7`!x@!0`777&!x! 0@@0'''''''''  47 n7@ 7@ 7&%b77''⫒!x(&!x`   > > ` @3/:!@!0> !c<' #`0 > @!`_   > @! @V  @  )/?/`4' '77'Ԉ ''7 7!Ăo@'' @@'`'' @ g'@-?' ''//!q!/77'@@5Ԕ $P!Ā S  @@U @'''''7'''' T7o0`7/7` @07' 蚃oa  C '7z?@+!Ā` )"!Ā > ?@~0d> c( @@6> c0@6  !Ā` R > '@6 cP0J> b@6 @P> !c<'  > @P`''''''' # 47 07`0`7  @77 !`!q77  'C 3 7@/؂ n'''''''''7 7 7  &%b7'77'h    > `` @!> 'x'|<!@' ''''''' d7x`_W!#7z74 7|` 7~' 7`7'!x@f@&!xxxe!`_8`0@'.(`(? 6S&O  !x(&!x @ >%.`$7z7`0@(.(`(?6&  ˀ7z> ` @W)kƂ?!x(&!x?> @8!'!> c<@' @0`` 0? > #< J> ``` 0```c&@!>  }@ ~`~''X0```X`'(`0`(@`(0`  !U S'  @0``` `7'T''l't ?T' ?P' ? ?t'd ?pl ?h??c 0 1 '\ ?# @+ 3`+`  ' 0((@  ?`  T2`7*`  -/` * @ 2.*4`,`  *, @ 'x '|x4,t ,@l-`d(`\)   -   +? ???І ?' < 9   "[ )  0@@@@ 2 D@ 2 H@ 2 L@ 2 `0  > @@3Z!+> @; ٰ?      ?# `? #\> @@39܃, 0` 7  > @!Ӗ+@֐!`0` ((@`02(`0@%@%`%`%`%`%` %`%`08@8H` 0\800?*)?+??#c  8+`!3 > @, 0` 'z@0```d `0`#`0`?-``03 H 4 03 !> @~h 0 8$ 0\??@ +`@)??#@@Z$ 8 > @d@pd'&@ pd"&@c&@!>  @Q6  > @J9!.+!++ \`8 + #`0)???@@@@#`8 !> @'@O @> c<@' !!> @Ȑ!)> @6 `{B;> p a `Į̴-;`'Ԑ' `3`` `}z!> @3`` ``0ă3```4S'''А@p̅(( @) (`#)  @ (`+ #@+ + ؚ@+ +`@+`@+`@Р #`#\+`  @> @ E ;ʒ@d ;ʚ@b@C50 @ 9b#@```0''`'Ă '7''''''ȴܒH?> < > (Ӑ  Ò  І?@Ѐ@ 0ņ@ ` 8 ;ʀ #耤@( ;ʢ@du ;ʚ@d@C8 " #@ 9c@#  !@]7 !`"] `(`  '?(`@?(@ ' ! "V! ````?'`? _U/'/??c@ @'!`/8' +` > `@!?> ( @8!!` `(#\> @֔x!> @є[ 7 !`  '?(`@?(@ ' !  `!!!(`( ~C`%   2!`"?c"/;`'/3`0( ,`,-`        + +`@ @2@*(@ @ @@*@@  ?0 (@2/3` +`,`,-`  ` (+     **@       ???`0(` '/?@ '/ܘ/ 7/ @ @@ @' !_J~ U ~'` ]' qb7'''''''7Z"(`0`$0`2 > @ @' '!> @ה a?@!`1')  > @ǔx @'ԅ(`!> @HE? > !c<' _`e` ''''' '!Ą R/?67`''''''''''77/'7€ C "4!x!! 0@$!''''''''' 4 T @77@ 7@ 7a ''77۹@% !x(&!x@@&!x.`2`Ԕ0> a @@/ߖ > ` @2(!`@@#ɔ!Ā` > `(`3`ѐ 1 > @Ȑ?> @"aД @@/`.`2`Ŕ0a````(`(@` (`3` > @ @?>, > @  ? > @ ? , 2> @ ڔ`  > @ Д,`z  > @ Ŕ`r?  > @  j? > @ @c?  > @ Z`  > @ S? > @ L?2` #\ > @ h?? > @ @8? > @  1? > @ }*?㿐!@@?x??c !oe.;@+/6$,`0` W 2 !@@  !o  e̐?0,` > @ "X?6,`0`& !oe? 2(`0?*@ 0#\? * > @ Ղ? > @ p͂?㾐> !c<@' !> @ `0 ? > #< > 0``` `` f&!> @  > @ݦ"ax@> @&axpe&a_{  pf&ax (&ax> ` @ -oe`0!@-5 `"   `> @ qax(&ax &?`&7'̖ H`6'4!> @ Px4X   > a 4  @ `   ((`@ @( ` (` )  `  (`(@@@   ` 4  ֈ+`@!(`(`(`@    ax?(-&axpcb`0''(`0'$   (`(@@'+?c@@Ԓ!>  @ / "/ 0``2 `4?@@2 `0ٖ oeF ''''''''' `0? ? ? ? ? ?܉)  ?(` ',+ 3`+` 0  ?(@(    ?2  -  ?*@   -  - *  4`   ,  2` * @+ 4 ,@+`*`,`,@- @ @@@@@?@@"`H,3 `@`H#lԖ3#p!#`#h#x##\#d#t#|> @ Ԑڀ `0`8`?'`0# ?'`8oe2ax4`'Ѐ@'ax(@&ax!eg.̂f&!>  @  > `i!i`> @ ֒!Ж> @ ϒ!(0'0@p '0( @%"*$(`"?c@ @(#\> @  Ђ ڹ8`BԐڀ yoeax!(@.}&ax> @ ר ?`H3`0 ,`,-`  (   + +`@ (2@@ **@ @  @  @@ @0 > @ AX 8 0+?c` ?! 0 5! 8?@`0`8Ԃ`'`0? > '`80@ !'d'|'t'D|''L ?x'\'Tܨ ?t'<7 ?pd ?`\ ?XT ?PL `0?HD 8`+ 3`+`@ 0  ?@(<(  x  ?8t2  -  ?h*@   hd- *-   4`  2`   , LXT D* @4 ,@+ <,+`*`,`(`@@  @@@@@!?`( ) @0" @@2 D@2 H@2 L@2 / "`0) @ 00Ԃ#@8`#`#h#l#d#\ > @ [X]Ԑ > @ SUЀ@!,`L@2`@@2`D@ 08 8?c ?)??@#@) @@ 4$ 8 @ @ 4`@ Ԑ!> @ x0` 0`L@ 2ѐ 20(   **@ ( 0(   ( @ `@  (    +` (   @ `D@ ܘ 7`0 84 0? 4@)?+??#c @+@@@  $ 81 `@"4> Ԑ!> @ 0`$ 0#@#`#`#`#`#` #`#`ʆ@0008@88HԄ 0ԛ+?)?@#+?? c@@@ > 88@!А!@ 0`$ 0c> !ax!-(@&axLЀ` > @p8!> !x@i!'4!.㿘! hS bfd22 ``Հ`2`` `?`>2!> @@> pg>,c8??cc?> $`  -?4`* 0`0&*4` @@)U - 4`a4` ph$2``Ð  > @X? 8 4@@@@! 4?c   00`.o(`@0@ 0`$ 0@t 4``~ 8$ 8 4@$ 8$ 4 0 8 4`$ 0 $ 4@S  4$ 8@$ 4`0 $`0@F`"!`4`0$`08 @@ 8 0`$ 0ݒ ~ @ v-  (`Z`0  Ș ߄3 2``. -  &  > @i]? > @c0W?p'''''''''`   > @O?.`>,TC?c * 22` 0!_$ !` ;7ր* '  $(@""0 `7'()@&"p2i? > @  !`_`?c8.`.@7 `7Ԅ '7ؐK2D? > @ޔh""0  (@@`((`&"0 ` @  "!`_`.`0`!@" ƃ.`7 ` 77؂ ` '7 X ?9Q !`?``q0D!`"?0=!`"?=06!`"ސ?0/!`א?`_Ԃ b!7$7`': ?+> Ӽ  !`?_ 0!@N.`$77P  7  > @9? 0?c* ؓ2`* 62`2j @1@"0 ) $ 0` `(`^7֐ > @ ? > @H? 7܃(@ 7օ) ` B7=7ւ 7փ:  6 > @?'ll'P`'l> c<'  8 7P7R'h'T'X'\'`'d'p!P*P" ! > 0` ``7`!ă0` ` ߴt7` @F  7t`7x(`0`g@8``7z(``"`!ă0` `2'l`!'`7~(`0``}87~"` '`  'Ԁ ` 'Ԗ`"` `n7` ?Є('؀ s'؀2!؂`'! 7(   "``HЉ- 5`- /5`@/@5 'П-- /5`5@ //5 -5//-55 //55//#\//> /X5 //@ `!`7$7`!ă0` `_߂ t7` @F  7t`7x(`0`g@(_`` > $@؂$7x`7z(``2V!` > @ 7z!ă0` `"N`'ll$ς`'h'P'l B7j7P'T'X'\'`'d'p-PV37|`  B'Ԃ`E'Ԁ`Љ-5-/5(@'/-55@ //55///> /@ `!`7``|!7`!"p"t؅1 770 777 7 777> @s"p"t0)  0`1 (0#l(#\2#h #`#d > @]!Ā` " !x> c@ @%!x@j@&!x! 0@@'P'T'\'l'p'X'h'`'d 4 `7P@l7T@`7V'l  7\7^rpc'p@(1 ) 1 2#\  > @ X~!xP(S&!x&"$&" &"(" (@&"0H>  @0B > @0!Ȃ'Ԃ`0'Ԃ'Ԁ '؂``c @a!'> ` @(!@ʐ"(> !c<'  @D͔ ` /`!`7!!!((`@D@@@7!Ć1 `771 `\7`7(`0`g@8]``7(``"f``7(``"n``!/`/`7(`0``}Ҁ(7!!!(`(!!`!!` Ђ``/*(*0`4'!  /7`(`   "?``j- 5`- /5`@/@5 7-- /5`5@ //5 -5//-55 //55/#\//> /X5 ///@% ! ``*$7 ``M!"p"t؅1  770 7777777Ȑ > @!x@@@&!x! 0@@!'p't'|'''x''' 4 `7p@7t@` 7v' 7~7|rpc'@@  > @Ԕؐ2p!xp(&!x> c@$h ` > "2!!!!!`` :7?7 ń  Ԃ` 7Ԃ `` ‚7` ``Ԁ 2 ` @7` @"*؇(@*7؆*0`$!''p`'t ' 87r7p''x'|'''7t7vǒpp ! /7`(`  7 `` 7`7(`0`g@(`` > $@B؂$7`7(``2`` > @4x 7`7(``2`` > @& 7q7``,-5-/5(@7/-55@ //55//> //@ ! ``2܂$``ׂ!Ղ$>  @0*!`8#!7Ԃ`7Ԃ `` 2Dj7`097Ԅ `/?7?@D7؂`` @!&"$&" &"(" (@&"0> ` @'!@ң"@㿘!`!$ϐ> @ϒ ! !p !  !`_ԙ㿘!`z1"!@@<> @| !6"`1 (0`@)"d, @9 "!@S $" $ (!``@ $$ ( @$ ,!(0`@8"d! C!`_8!`  !`"!`_8!!`  !` !!`  !` (!`  !!> @ 0 0`  !L" @@"@@x > @(!`_ !`  j!`  c!"(@&"0P@!`""!! @"!"@"!"@ 4 ` ? !xa } a xHo4!p(@e!p`` "!pHp@"!h!p "!p"!p!hHp@㿘א!`_ !`  `  ށ `@ !) )  @(`"* * * * `?: @B 沈?b!x~"!x㿐#@ (a#'@ *C(( @@(`@eu' " c㿘!xhb@"`!xb&!x㿘E > p `. .  @@(`@沂a #` 1M`! Ą#`㿐'P'T`'X!Ăo@  > @? P@"'> @8 Ё㿐` ab"V!x(`0`3``P !^ !Y!@ d  M!xF d!x>`@ۀ%> `&!x@ (n#> a "`V @ݐ!x &!x> a> a "T+ 3  > z(`6@!x&!x >  >kadX >  >kadp㿀`g.`>j!`a!Āo]!8?c, ., . @$@(`@`   `" b` ` 4*``  P` * *``   (`   !`  *`@ '?#  >  > a> a > a$@@` #`#\ >     >  0!x` > &!xP 0!x!߀`N&!x@ >  ֔`0> b> c> c Ȓ 0?*&!ă0` `"2`"!`0`0& 2`((@  2:`1 ?`( @&??c 1  *) @?c&!0`0&(8`.02> a@2> #h#p #`@b?c2> a@2o?#`#h> #p* &b?c"?G &)#h#p2> &a 2#` ?@> * b#\#d#l >  !``!`z` w` u , 3 >  80 ?c> a2? #d@#l> * b#\#`#h >  2> a@> b#h#p#\#d#l ?4* > #`d0) > a@#d> #l ͂b2> a@?> #d#l* b?2> a@?> #d#l* b!`` * 2 >nb@Ӕ!x`&!xm >  0 > {h@r㿘 @&  $42 (@& !x``@! `4> Up (@& !x``@@8 X (&   > $!x6@g㿘 `4䪐 f"E e g h ` `  > >  X>n@Y`@˔  @& "1 ,{ ` `  >  ` X>n@;c @ %#> 'b @ @&  > ax`@$axN` & ,^E㿘!x``! &! !f 5>  㿘!x!`&!x&! q&!f 5>   @ > c<' 4@Z "Ga `S@@H@& a@  `'@F  $` a``@ > U@D  (& ,&  p> o> 9 0 > 3P0 > *(0 > #  @(#@ $>& > 'b  X@! @& @    @&  @@<    /7/ $d@?/@aa`$b$0 > x @(g& 0gd @!㿐L f, h* e*` *  !@?  A``"#耔2!`` &`,@ڤ 5  `,` &`,`,㿐"!>q>jc&!T&!X(!P@&!&"&!& d& ` `I!``D!(0`4>q6 >b W&!P!"6 P6 R > H (> @/' !`g` e` dBj! 0'!> # @"!`$`  "'@ $P ~&%@?b 0'!> # @"!`` ހ` ݂ ! 6 R0``6 P 0(@6!   >& 6 &  6 $0`6 `6  ̂ 0(@6!`'| 0㿐 `4>nXc@*"0```48!x!`_Z!`   " @@!`j`_]!`   @&,"!(@&"  _{!`  !x``P@ Ő5>  !x``0 f"!x; g er`  0`/!x&!x!x`(`&!xʁ`   @&,!`   @&, @&,! hȒ  ` ` > -H>n@n`@ȩ @& ` !x /"!d(`0`""(`*0`2>   &!ds@Eo!`  b!x`@ &!x> 8%[@ "#> 'b @@&㿘  4!`> 'bȀ>p!x'!x'!P !`  $0` `.@a(08> 'bȀ2 &!x'!x  &?a=)2 7..`. (.` @@` 0` ` ""0 (@`(`@)'"a(7a <?c@" <@M@㿘!"4 "d(1 ` &`"&`(0`` ((0`1 @?1 `#!`(`0`@ &"4 `2! @*`"d@` !"d@   @   (0`2  ?` !@*`"d@ 㿐!!`&" " "h'"$'(`&!`2#``  '  `&` &@#㿘!`=`_!`  !` H `  !``@!`  !` !!`  !` (!`  !`  !``@! " ` @ `** ` `** @ ` `****! " ` @ `** ` `** @ ` `****! " @ `  㿘ǔ! "~``&! s`. ` .! c` 6 ! U` 6 ! G`6! 9`6 @`  (?c  ?!Ā@ "` ` " !Ā@ " `$`$"$```0((` @0@@0((` @0@@?`(@8`Â@?`(@8`@?`(@8`@?`(@8`@` .. ?0(c ?(`0@@z@ 㿘4! "D``&! 9`. ` .! )` 6 ! ` 6 !  `6 @`  0(?`(@8`@?`(@8`@?`(@8`ӂ@` .. ?0(c ?(`0@@@ 㿘۔! "/``&! " ``` ` ` ` `. 6. . . 6 @`  ( @`  ((?`(@8`ݘ@?0(c ?(`0@@ɂ@ 㿘! ``` .&. ! x` 6 ! j` 6 ! \`6! N`6! @`6 @`  (! "g`$`$&$?c  ?!Ā@ "`(`("(!Ā@ " `,`,",```0((` @0@@0((` @0@@?`(@8`@?`(@8`@?`(@8`@?`(@8`@?`(@8`@?0(c ?0(`@@m@ ?0(c ?(`0@@@ 㿘! "``&! `6! x` 6 ! j` 6 ! \`6! N`6! @`6 @`  (! "o`$`$&$?c  ?!Ā@ "`(`("(!Ā@ " `,`,",```0((` @0@@0((` @0@@?`(@8`@?`(@8`@?`(@8`@?`(@8`@?`(@8`@?`(@8`v@?0(c ?(`0@@c@ ?0(c ?(`0@@@ 㿘4! ``` .&. ! ` 6 ! ` 6 ! v`6! h`6! Z`6 @`  (! "`$`$&$?c  ?!Ā@ "`(`("(!Ā@ " `,`,",!Ā@ ")`0`0"0  ` 0((` @0@@"(!Ā@ 2`,`,0((` @0@@",!Ā@ 2`0`00((` @0@҂@?`(@8`@?`(@8`@?`(@8`@?`(@8`x@?`(@8`j@?0(c ?0(`@@S@ ?0(c ?(`0@@w@ 㿘n! "``&! `6! ` 6 ! ` 6 ! v`6! h`6! Z`6 @`  (! "`$`$&$?c  ?!Ā@ "`(`("(!Ā@ " `,`,",!Ā@ ")`0`0"0  ` 0((` @0@@"(!Ā@ 2`,`,0((` @0@@",!Ā@ 2`0`00((` @0@҂@?`(@8`@?`(@8`@?`(@8`@?`(@8`x@?`(@8`j@?`(@8`\@?0(c ?(`0@@I@ ?0(c ?(`0@@o@ 㿘! "R``&! G`. ` .! 7` 6 ! )` 6 ! `6!  `6 @`  ,(?`(@8`@?`(@8`@?`(@8`ӂ@?`(@8`ł@` .. ?0(c ?(`0@@@ 㿘6! "``&! `6! ` 6 ! ` 6 ! ``6`?c ?@ 0 ((` @0@@#@ ``2@ ````..?..c` ??@  (1 (` @0@@#@ ``2@ ! "_`,`,&,! "P`0`0`2`3.260.3! "8`4`4&4! "$`8`8&8! "`<`<&<?`(@8`@?0(c ?(`0@@@ &<?0(c ?(`0@@Ԃ@ ?0(c ?(`0@@@ ?`@(8`@ 0(`0(@@@?`(@8`S@?`(@8`E@?`(@8`7@?0(c ?(`0@@$@ 㿘M! "Q``&! B`6! 4` 6 ! "!` ` &  @`  (! "<`0`0`2`360.2.3 @`4  (4?0(c ?(`0@@ׂ@ ?`(@8`Ȃ@?`(@8`@?0(c ?(`0@@@ ?`(@8`@㿘ߐ? c ?&!Ā@ "` ` `& ``%!Ā@ 2``0 ((` @0@@&!Ā@ 2` ` `0 ((` @0@@& ``ߴ㿘? c ?!Ā@ "+``&!Ā@ "``&!Ā@ " ` ` &   ` 0 ((` @0@@0 ((` @0@@0 ((` @0@Ђ@㿘x! "~``&! o`6! a` 6 ! S` 6 ! E`6! 7`6! )`6! "``& `  ( `   ( ?0(c ?(`0@@@ ?`(@8`ӂ@?`(@8`ł@?`(@8`@?`(@8`@?`(@8`@?`(@8`@?0(c ?(`0@@z@ 㿘! "``&! `6! ` 6 ! "` ` & ! `6! r`6! d`6! V`6! "C``&! "/``&! "` ` & `$?$c ?@ 0 ((` @0@@#@ ``2@ ?0(c ?(`0@@݂@ ?0(c ?(`0@@ɂ@ ?0(c ?(`0@@@ ?`(@8`@?`(@8`@?`(@8`@?`(@8`|@?0(c ?(`0@@i@ ?`(@8`Z@?`(@8`L@?0(c ?(`0@@9@ 㿘! "Q``&! B`6! 4` 6 ! "!` ` &  `  (! "<`0`0`2`360.2.3 `4  (4?0(c ?(`0@@ׂ@ ?`(@8`Ȃ@?`(@8`@?0(c ?(`0@@@ ?`(@8`@㿘`/ .` ? c  0``  !Ā@ @``@ 8`(@0`  `+``0@```4֘` ! 7 @* `*! '`2! `2!  `2! `2!  ` * ` *  @`    ( ! `2!  `* `* @`   (! ` 2 ! `"2"! `$2$! `&2& ? c  !Ā@ "M((0`(  ? c !Ā@"8`0`00`0`! a`828! W `:*; `;*:! G`<2<! 9`>2>! +`@2@! ! `B*C `C*B! `D2D`@ (8`DŽ@`@ (8`@?`(@8`@2D `C*B*C?`(@8`т@?`(@8`Â@?`(@8`@ `;*:*;?`(@8`@?`(@8`m@?`(@8`_@?`(@8`Q@?`(@8`C@ `*2*?`(@8`!@ ` * * ?`(@8`@?`(@8`@?`(@8`@?`(@8`Ղ@ `**! @2! `2! `2! `2! `2! ` 2  @`    (  @`   (! {`2! m`2! ` 2 !  `"2"! `$2$! `&2&! `(2(! `*2* ? c  !Ā@ ",,0`,  ? c  !Ā@ "440`4  ? c  !Ā@ "<<0`<  ? c  !Ā@ "iDD0`D  ! `L2L! `N2N ? c !Ā@ "GPP0`P  ! `X2X! `Z2Z! "`\`\"\! "````"`! "?`d`d"d ? c0`h !Ā@2 h h `@ 8`(@0`h`@ (8`@`@ (8`@`@ (8`@`@ (8`j@`@ (8`T@?0(c ?(`0@@@ ?`@(8`@2&! (`(?`@(8`@2(! !`*?`(@8`@?`(@8`@?`(@8`@?`(@8`@?`@(8`@2Z! 2d`\`\?0(c ?0(`@@@ "\! 2X````?0(c ?(`0@@J@ ?`(@8`.@?`(@8`@?`(@8`@?`(@8`@?`(@8`@?`(@8`c@?`(@8`U@?`(@8`G@?`(@8`9@?`(@8`+@?`(@8`@! "@@ ` `** ` ` ** ` ` ** ` ` ` `* 2***  `   (   `  (! `2! "u`` ` `!* 2*!! b`"2"! T`$2$! F`&2&! 8`(2(! *`*2*! `,2,! `.2.! `020! "`2`2 `4 `5*422*5! `626! `828! `:2:! `<2<! `>2>! `@2@! `B2B! }`D2D! o`F2F! a`H2H! S`J2J! E`L2L! 7`N2N! )`P2P! `R2R!  `T2T?`(@8`(@?`(@8`@2T?`(@8`@?`(@8`ӂ@?`(@8`ł@?`(@8`@?`(@8`@?`(@8`@?`(@8`@?`(@8`@?`(@8`q@?`(@8`c@?`(@8`U@?`(@8`G@?`(@8`9@?`(@8`+@?`(@8`@?`@(8` @?`(@8`@?`(@8`@?`(@8`@?`(@8`҂@?`(@8`Ă@?`(@8`@?`(@8`@?`(@8`@?`@(8`@?`(@8`y@! "@@ ` `** ` ` ** ` ` ** ` ` ` ` *2*** ! c` 2 ! U`2! G`2! 9`2! +`2! `2  `   (   `  (  `(  ((?`(@8`߂@?`(@8`т@?`(@8`Â@?`(@8`@?`(@8`@?`(@8`@?`(@8`w@㿘! "``&! V`6! ]` 6 ! d` 6 ! k`6! r`6! 0`6?c  2!Ā@`2` !Ā@``@ (8`@2!Ā@``@ (8`@2` ?`(@8`̂@?`@(8`@6! ` ?`@(8`@6 ! ` ?`@(8`@6 ! `?`@(8`@6! `?`(@8`@?0(c ?(`0@@_@ 㿘0! "``&! V`6! ]` 6 ! d` 6 ! k`6! r`6! 0`6?c  2!Ā@`2` !Ā@``@ (8`@2!Ā@``@ (8`@2` ?`(@8`̂@?`@(8`@6! ` ?`@(8`@6 ! ` ?`@(8`@6 ! `?`@(8`@6! `?`(@8`@?0(c ?(`0@@_@ 㿘! "``&! `6! ` 6 ! ` 6 ! `6! `6! `6! `6?c  !Ā@ "60`  ! "[` ` & ! "G`$`$&$? c ?!Ā@ "1 ( ("(!Ā@ "! , ,",!Ā@ " 0 0"0  `@ (8`Ʉ@0((` @0@@0((` @0@ڂ@0((` @0@ʂ@?0(c ?(`0@@@ ?0(c ?(`0@@@ ?`(@8`}@?`(@8`o@?`(@8`a@?`(@8`S@?`(@8`E@?`(@8`7@?`(@8`)@?0(c ?(`0@@@ 㿘! "``&! `6! ` 6 ! ` 6 ! `6! `6! `6! "````.6.! `6! Y`6! "a` ` & ! "m`$`$&$?c  ?!Ā@ "`(`("(!Ā@ " `,`,",!Ā@ ")`0`0"0  ` 0((` @0@@"(!Ā@ 2`,`,0((` @0@@",!Ā@ 2`0`00((` @0@҂@?`@(8`@6! 2` ` ?0(c ?0(`@@@ & ! 2`$`$?0(c ?(`0@@@ ?`(@8`o@?`@(8`]@?`(@8`N@?`@(8`@6! )` ?`@(8`@6 ! "` ?`@(8`@6 ! `?`@(8`@6! `?`(@8` @?0(c ?(`0@@@ 㿘_! "``&! `6! ` 6 ! ` 6 ! `6! `6! `6! `6?c  !Ā@ "60`  ! "[` ` & ! "G`$`$&$? c ?!Ā@ "1 ( ("(!Ā@ "! , ,",!Ā@ " 0 0"0  `@ (8`Ʉ@0((` @0@@0((` @0@ڂ@0((` @0@ʂ@?0(c ?(`0@@@ ?0(c ?(`0@@@ ?`(@8`}@?`(@8`o@?`(@8`a@?`(@8`S@?`(@8`E@?`(@8`7@?`(@8`)@?0(c ?(`0@@@ 㿘h! "``&! `6! ` 6 ! ` 6 ! `6! `6! `6! "````.6.! `6! Y`6! "a` ` & ! "m`$`$&$?c  ?!Ā@ "`(`("(!Ā@ " `,`,",!Ā@ ")`0`0"0  ` 0((` @0@@"(!Ā@ 2`,`,0((` @0@@",!Ā@ 2`0`00((` @0@҂@?`@(8`@6! 2` ` ?0(c ?0(`@@@ & ! 2`$`$?0(c ?(`0@@@ ?`(@8`o@?`@(8`]@?`(@8`N@?`@(8`@6! )` ?`@(8`@6 ! "` ?`@(8`@6 ! `?`@(8`@6! `?`(@8` @?0(c ?(`0@@@ 㿘!`  F@6 ?9 c!Ā@5@  0`!  +?0``@(8`@`6 ? c 6`@!Ā@``@(8`@6`@`@(8`Ʉ@@?`(@8`@! H@2! O`2! V`2! ]`2! d`2! k` 2 ! r` 2 ! y`2! `2! `2! "``"! "``"?`@(8`@2! `?`@(8`@2! `?`@(8`@2! `?`@(8`@2! `?`@(8`@2! ` ?`@(8`@2 ! ` ?`@(8`@2 ! `?`@(8`@2! `?`@(8`@2! }`?`@(8`@2! 2w``?0(c ?0(`@@@ "! 2k``?0(c ?(`0@@@ "! H@2! O`2! V`2! ]`2! d`2! k` 2 ! r` 2 ! y`2! `2! `2! "``"! "``"?`@(8`@2! `?`@(8`@2! `?`@(8`@2! `?`@(8`@2! `?`@(8`@2! ` ?`@(8`@2 ! ` ?`@(8`@2 ! `?`@(8`@2! `?`@(8`@2! }`?`@(8`@2! 2w``?0(c ?0(`@@@ "! 2k``?0(c ?(`0@@@ "㿘 ! "``&! `6! ` 6 ! "` ` ``.6 .! "``&! "q```````.6.....! W`6! I`6! "6` ` & ! ""`$`$&$! "`(`(&( `,  (,?0(c ?(`0@@@ ?0(c ?(`0@@ւ@ ?0(c ?(`0@@‚@ ?`(@8`@?`(@8`@?`(@8`@?0(c ?(`0@@x@ ?`@(8`e@?`(@8`V@?`(@8`H@?0(c ?(`0@@5@ 㿘2! "``&! `6! ` 6 ! "` ` ``.6 .! "``&! "```````.6.....! /`6! !`6! "` ` & ! "`$`$&$! "`(`(&(! `,6,! `.6.! `060! `262! "`4`4&4! `868! }`:6:! o`<6<! _`>6>?0(c ?0(`@@@ &! k`?`@(8`@6! d` ?`@(8`@6 ! 2^` ` ?`(@8`@``.6 .! 2W``?0(c ?0(`@@@ &! 2K``?`(@8`B@?`(@8`@6>?`(@8`@?`(@8`@?`(@8`q@?0(c ?(`0@@^@ ?`(@8`O@?`(@8`A@?`(@8`3@?`(@8`%@?0(c ?(`0@@@ ?0(c ?(`0@@@ ?0(c ?(`0@@@ ?`(@8`ۂ@?`(@8`͂@㿘``..``..@````` ` ` ` ...... . . 6 `&`0`&66 @( 2 @ ` ` ` ` * ** *   `   ( `"㿘``.`@.``````` ` ` `.......66 . . .㿘ޔ``.`..` .`  (` .`  ( a  (a$ .$a%  (% b$  ($ b,  (,b< .<b=.=b>.>b?.?b@  (@ b`  (`bibh.ibj.h.jbk.k㿘{? c ? ````!Ā@ ``0 ((` @0@@ `` `㿘U `  (㿘F  `+ @` `*`**`(*㿘'``.`..` .`  (?c  2`!Ā@``@ (8`@2`㿘``.`@.``````` ` ` `.......66 . . .㿘ޔ``.`..` .@`   8> 'D`d!> > bh> `bx> ?pc 90> 2  @ۼ0@0`H0#\#` 4`(`@(#d4#h 8Ȃ`(`@#l8#|D@#x##t#p>  |  ,?? 0`"?@ > @x> c<' `> P +> -> b/p  p   @T`@  2  0@ /p$  > @ @> c<'  >  > > /(c (/( Ŕ@  Ŕ@2 @2/( > @А P㿘! 'H!@0``0``0 ` j %!>  h  ZH 2"@`00``!Đ!> ?ݥH A !>  ݘ!> ?ݑ  -  !>  ݄@oh0!> ?y؁<|=d=@=@=@===@=@=qq\ppphnPnPoonPnPnPnPnPnPnPnPnPnPnPnPnPnPnPnPnPnPnPnPnPnPnPopopop0h4T||H|T|~|||8   @ "   @2  @2 @ 2 㿘!> . L`0> ` >  ` @S 2 > @L   ؀ ` %D`   ؐ`  2 ؁@,  L㿘 ؒ @ . @ %D ` #.  ؐ@  . `$`" @ 쀎` ! `&%> .`L2   `1> @  ؐ@ . 㿘 @ > @ > .`L" >   @ޔ!q ؄ .%`  㿘!> . L`> a>  ؄ .%`  %    $@ٵ  @ٱ  L㿘 ؐ` !> . Laq>  ؂ .%   La2_>  .%`  p!%D` $(`>  @و!  `   `  ؐ`    ` %D`"+ ؁>  `    ` %H ؂` &%H %H ؂` &%H   `  !*@8  ؒ !)@2  %H ؂` ?&%H.  .    . `   ؝㿘`C` &%0@%( %D` H `   ؐ@ , 2 ؄%0!> . &%0 L`> 3`Vb0> @!` L`"Y%0%0` >  `%(@@ߠ %0@8%(> @ؐ %0 > @ٗ!8%(%0 @ %D`  ,``   ؐ@ , 2 ؠ `  ؔ `  ؒ @, ؒ @͐ > > aX@ؘ!` L`2%0%0 㿘` ` ` `((@(`@a " (@" > @:!x! "> @2>  @2>  @"$* `M`"` `N*`@ @ 2>  * ` ` @ &` ` `? @&@&`" `& @@!㿘>`0`(`& Hod4> l(@e> l@f"Hp@   @ P >@b8 `& ܒ 㿘Ho$(@e"` > l@G"Hp@㿘> a4Ho4 ܂(@e ܀` !"`,`@$`"2 ܢ`@ @Hp@ <@ 0`2  " ! ?   @l !` (`@ a 8 (`@ a 㿘%D`  %@%(@(?`?`~`, @(`@a w  ` `,,  #  .% > @f!!> . L`2> a>  ؂ .%  %%`@.%6% .@``N,  & @.% ! !@c%H   ؔ`  ؔ` ` `s`@!> . L`> a>  ؂ .%  %%`@.%6%`@ &%`H&%%``` , ! 2 >  @"0!> . L`2> a>  ؂ .%  %%`@ .%6%q  !%< !W@  * * "@ * 4%H 2(9%D%D  ` ?`"`@!> . L`@> a7>  ؂ .%  %%`@ .%6% %@֙ < ؒ %@֓"2 L`` V ؄` `Ų %@ a ؒ %@y"W L %@s  ؒ %@m" L %@g } ؒ %@a"s L㿐`;> .` `L ,  ka .%``2%D`Ђb@> 'b@ #@`%D` >  `  ! !Z%H  J ؔ`  ؔ` ` `"g`M%H`"`D`D ؂`/&%8&%4' %4%8 `  `  倈`@2G %D` "C `La~>  ؄?.%`  `La2l>  ؂?.%   @ !%< !R@  * * "@ * 4`%H n%D `  ?`  a|``/   ` `D*%H`y v  &%8&%4'`%4%8 `  `  倈`@2 %D` " `La!> . ؄?.%`  ` L%!`@6%.% L2>  ؄?.%`   @2%D` ``/`La>  ؄ A.%`  A@ #> 'b`/ .`,`D`,*``N*`%H` G``L`2> > .`L>  ؄ C.%`  C%H`Y a X Ѐ``Lae>  ؂ .%   ؔ `  `/`M`N> @"  `  k`L%!`@6%.%`Lu>  ؄ F.%`  F` %D` 2E`L ؐ`  =`L` %D` `L ؐ`  %D` `La A"@Ԛ Y ؒ "t@Ԕ  ؀a2<>  ؄?.%`   @>  "@|  ؒ "@v  ؒ "@p  ؀a >  ؄ B.%`  B B"@]  ؒ F"@W  ؒ ”"@Q  ؒ Ɣ"@K  ؒ C"@E 1 @A"(> .㿘9> . L`> %`>  `S> ;> cH``  -`a` J `@ ` `C Ho(@en-`@(`@a h a45"  ""  `% `!`  (MHp@ `t `  L`2e @`2` Hp@@ 2 .`M   ) @`  (```  `!M * * ) @ `.`N !" $  @fi :`"   a~" -`@(`@x a  @~@y L@6` `? @` &@&`&` &  @f".% ! `2 !2> @# * @` ` @` ?&`&` ?&@& & @& @@"㿘` 'Ђ`@&`&`  @ %`%` 1> .> 'b'@ #`@ܓ L`> a2>  ؂ ,%   %%`@ ,%4% *@  ؒ *@" L㿘`> . `L` `/P` , , , , ,  .`/ `  (, , ` 4`&`@ &` &`D #&`H&`- `* - @(`@a # `2, 3 $ ,  % `&@ `& `  `&`&` % !&ڠ> @Ҟ#X, ]& 9㿘` ` S` - @(`@a K+> .`L`2T ,@&``L`("X  ,` `L`L, F` `@)` $ ,`L`" (`2}>  ,`" 4> @a#ϒ @"f% ,`"< Q- ` @HN `L`>`e`H$ (`L`" ( - !+> .`L` ,> @-#p@ѐ``L`(2 , >  4`#*@2 ,`2  `2 4- @(`@ a "   ? $$ @fv  $ ,`L`" (`&  .% ,@# ,`2> 4> @#$ (㿐+> .`L`%> @Ґ#!> . `2 e#\> l P"   > @` $ e` `4e`,e`  ,`܀`+ "" ` $,` ,  ` & `  ,! ,2`ܨ @ۦ@א`܂!$e$e  ``8@ 8@`*(eL`& )!eL)!)!)!`ܚ`@  @`:  ,e`L7> `؄ ,e`  eD`4`/1a )!eL)!)!)!`ܚ`@ ƈ @܀``$`$`$`a @$`܀` `܆@@0,e !@# `ذ"1I#h '`  4@~7 ؒ @  H L %  غ` %% %%%> `> c`#x#`-`- 0`0#\#d#h#l#p#t > @ (Hod4 (@e `@"> > @А  Hp@@Ð   , @(0` @a%`@~V> @Щ    (@$ 㿐> 0b@%`"d %(`"e %`"S> %(`"O> %D F *> .%<`d@> @~!%< @ P`. A  ,`,` @ (`*` "@ @* %D . 뀠` -.  &  ` & .%%@ 6 h6 j  H6 V& x& |' > #@> 'bА*`*`@ @ > @? @; Ё & .  @c &% @b &%(㿐%> .L`2%%`@Y% `]La >  ؄ .%`  6%&%$%%  @&%$@(6%6%(`0``L6%```@"+ ` `Ya2%%`>  !@'R % M( N% (`&%$%&% %D` 2&%$ % %$vLa>  ؄ .%`  `]>  !P@”'$%$`"%%D` %$%P8 '` % %$ `  `  倈`@2O %D` "K La^? .%  > .`Le  ؂?.%   @Հ`u```2h%% (%&% L`2}%a>  ؂ .%  %%%`@.%6%La": >> ` %D` 2L ؐ`  L% > @:! % '> @3  ؂?.%  > .`L" ؒ '> @!  ؂?.%   @ '@  3%%.% (%$&% %%`.% ( `  (`@`(`(% &% > ' @"L ' @  ؒ '@ܐ   %`.% (%&% %`   )%((% +`% (`%&%$&% % (%&% %`>  !@ί'I %`  )%&% % (%&%  %`   +@%() %( !%(` !%(`% &%$ ! !`)! 怈`%H  < ؔ`  ؔ` %&% !%< !@ 8 * * "@ 0* 4`%H 2%D` `@ ͢ ˀ ?Ȣ`%D `  ؝㿘3> .`L`2X%0%0`"Q % `L%  > @"!%&%0.%`L`3!> .%`"%0 Laa  ؂ .% %0%(1> @@"@`8. L% `e%(o"6`L`2`L`-`Llb%(> @@"(%`"%0 L1> @ۑ!> @ؐ!%0`D>  La:>  ؂ .%  %%`A.%6%`La>  ؄ .%`   %> @ͮ  ؂ .%  %0%(1> @@͠"@ %@͜  ؄  %@͓  ؒ %@͍" L`(`L(```Lb2S ``&%0`]`O>  @q `L`2> > .`L>  ؂ .%  %%`@6%.%(``La}>  ؄ .%`  `La>  ؂ .%  %&%0.%`` v`Lb &@.  > @)"X%%(H`` `>  @ `L %(` @ `"D` `Lb2L> @z > @  H`L`2> > .`L>  ؂ .%  %%`@6%.%%(@ > %`2` @ pu`L &@ߐ"s> . &@ِ r ؒ &@Ӑ  ؃*`>`Lb2 `n%`Lb"j%> @̾#@e%`Lb%> .%`@"```2X%L` a>  "@̦&La" >   @̝& ؂ .%  %% `@6%.%6`Lb> , ` % .%` a$` #%`Lb> `@%&%`H&%`Lb> %$`@%$`H%`Lb> %`&`` a %`$`H` `(% .%`LbC-> . ```" ``@y` > @@ 7`L> @;#H% `6% ` % % &@' ' ؒ &@!"> .a2%`> ` " @ Lba> @ "La" >   @&  ؂ .%  ڐ , @(` ` ; , @(`@a "4a `M`",`N `N(`@",`N  * ,`N,`M"  * z%@ϐ"pn%@ː#XC, @ǐ#R`@@Ð @`@˿#hT%%> @˹"%>  @˳#%(`ݫ, @(a@`(O%Lb2q ` ```L `, @,%( `,,%L`"` |8`%<@ Z * * "@ R* $ , (`(`"@ G* ,`@y`  @ ?@ :!, , @(`@"> @Z#%`24 %L @&, `(  , ,LL>  "@?&La" >   @6& ؂ .%  %%@`.%6%@.% ! !@è%H   ؔ`  ؔ` % `> @#%(`> ` " @ %, .%( %H` ؔ`  ؔ `  Ҕ > ` # @ے , (`(|%@ ! !`@)! 怈@%%H   ؔ`  ؔ`  @a4 `M@xW` %> @ʨ"J&% !%< !"@ t * * "@ l* 4`%H i2%D` `   ?``@x#` > @v#%`G@@a(a(a`L2Y> > .`L"1 >  &@_ * !%< !ِ@ + * * "@ #* 4`%H "2%D` `@   ?` `> @/#%((%%D%D`,% ` X ؔ `  ؒ &@"> .x'> .L`ؐ@ > > `> 0a> > `> >`X> >`xؒ @,@ D ` ,ؐ@ ,`$`" @ 쀊` ! `$L`!> .*``` ``U 퀈`@2} ؂`,  2z 퀊 А 쀊` "l 4L`2 ؐ@  L> .`Lj؄ ,`  La؄ D,` D  u* o*> @v" %> @m!0h 퀈`@)`@" L`B   > @Z!ؐ@  " La2"> ؄ ,`  $  e  Ò-*@? @  퀊{ `w  `"`o ` ?`H#\ @` @ D@(w{ @] `@  ,ْ 0> (,`L0(L@@` `  $`H` `( ,$0La2Ԑ؄ ,`  0<`> @Ƚ#p > @}"(`2L`@J> 쀊󀊠D` "L> .`L؄ ,`   ` ,L2؄ ,`   $ @>ϐ<@ Z 2Ђb@' '`'@ 2@>쀠" 2؁  쀋`444`~, `,7  $(D`2 (@,L`| ` {> . ,Laΐ؄ ,`   `` > @ 8 @ >  @#  ```"> `@u` > @"`   ,(( ` ` ,] $ ,  `@ @ܒ `L`> .`L؂ ,   `@,4ؐ@ ,"  "  ߂@,`?t  ``e`{> ` ` S (>D`  ,` ` (`(``"2`2 t " ! ?   @[ !@e"X 쀠` $#\@Z   H`!8 2 !$ `@ $`H,$ L  "D`@`@2 `/ؐ@  "H> .`L>> ؄ ,`  H`"{`D`D$8'`/$4 48` `  倈`@2D` "La> ؂?,  > .`L2> ؂?,  @ $  H`"8`!ء*@   4 #\ #`> @ƾ La!> .؂ ,   L`> a> ؂ ,   `@ ,4 Laʐ؄ ,`  F!La؄ ,`  8!*0` 2 `M`q> ``(`LOLL (( `, `ML`F> .`L<؂ ,   `@,4 $ `;> .`L1؂ ,   `@,4 @+(pv!À L> @#@ܐ @(hF> . @(hF؀`2W>  @ (fؒ @(f> .> @"` `"Q> > @"> D`2> .`L> ,`  P8'`  $ ` ~$` @   倈`@22D` ".La> ؂?,  > .`L >  ` *u @ť`؀` , ؐ@ ` D` 2Lؐ`  L`@$> > .`,La2؄ ,`  $ `@(> > $ ؐ@  "  La2s> ؄ ,`  -  ` > @F!P g ؐ@  " La2V> ؄ ,`     ```  ,  > @"  @*؀`6h> .s  @*f `8 (`@ a  @),> @!!$0 `> @! > @! *k@ݐ $L`> @{`C`$@ `$` $`$` o$> @ (0H`" D`2  , > @į"p @ī#@O` ?`/La2> ؄ ,`   ` > @P!h g> L`@2-> .`L7> ؄ ,`  P8'` $  @c):2ؒ @^*{@Z#0 > @U#> .`D> @O"@K# WD *U@E @A"@ِ> @<!` D` 29Lؐ`  1L@&!90@"#0K, `ѐ> .`Lǐ؂ ,   `@,4 $  *O@ eؒ *^@ ؒ *K@  ؒ *H@ ؒ *:@ ؒ '@ ؒ '@ܐ $@  !  @̔)d6ؒ @ǔ)?؀`> .`L؂ ,   `@,4 d$ > @é#Pf @ > @Ý#`X>  cؒ @ @Ð 2I`> . @@Ã)s> .`L"ؐ @z)s؂ ,   `@@,4a  #\> @^# #\ *#`2> @R  ! @M)9ؒ!@H)/> .> @B#P  > @9!@La">  )@0 ؒ (@* @ h @#)}gؒ @)}]> . @){ؒ!@){> .> @ ː>  )@ Nؒ@  )@ Rؒ )@"H L㿘#> .`L`I> B>  cHp@#贆5 @ "`Ho$(@eHp@``Ho$4%(@e%``L`r0@¬0  @¥#h㿘#> . `L 4` `L`2` 4-   M0`- @(`@a I- P b& &  & D`& H& . LHo$4&(@e&&  $ `& Hp@`2 \ 2 S )`- - !纐 $  @U S> a4:" Ho$(@e`"   a <" Hp@> @#`L`"p@ > @#` i- 4 @ ? ,4,6  ,@$,@nR /& D & @$m& H0 $,@nՑ- `@(`@ a 8ttt#X88`fa0#X`? (` ?`2 `@0 (` ?`2 `@(`0``0`(@0#X`& #\#\``@0@? (`0``@(8`@@(`0`@`(`8 0@#X`& #\#\``( 0@? (`0``@(8`@(@ @`(`8 0@#X`#\`@ * 2 `?(c08`(@@ * 2 㿘 Š      㿘  (@20!  ƒ >    s >㿘#X88`cd0#\0 Ĕ     l i D c   (`8   4`2 M  .` g*   `:  #X@?8@8`fa0㿘#X88`cd0X e  a ] Y  U  Q  #X88`fa0#X#\88`dc1 `  (`0`#H ߀`1#X#\@880 ?(c0 8`(@(`?0``@8`(@1#X#\@880㿘Ho(@g #d `@$#d` &#@ 4Hp@㿘Ho(@g #d` `` Hp@  (@J $#d 4@ 0㿘#.@? c  @`(0`@ @(`0`@ 8``(0`@(`6 㿘#\#X? c c ) (`0` d"#`(`0``@(8`@ d` #``  >  @ h>  @} @㿘#` ~b #X#\@1   #X@&#\#\ (`0` (`?0``@(8`@` ?(c08`(@㿘##Xb#\# `&`# &`#X#\@880(#X 0> @  #X#\@880#88`dc0`:`(`0`#X#\@p> 0b@883`&`#X 88`cd0&``'` (`0`h"#X &`#X#\@880@^&##H&`#D&``?(c08`(†@` ?(c08`(Ղ@㿘#X#\`88`cd4`` ` (`0`74?8H8`@`#5z#"+#X#X88`dc0#`@`4@(`0`````2#X#\@#88 0@]#\@`880.`#`"#X`#X88`g`0`.`?(@`0@(# #X>d88`dc0c@`.`(``0`@4@`2#X#\@ 880` ?(`0``@(8`@` 7  8(`h``?(`0`@`0`y@ ?(`#0``@+`8`@ @`(``84@(`0`+ 8 `f?`@(8`]@@`(` ?0`#`@+`8`@ @8(.`0`(`+ `8  `.`(?0?) 8(@ (`0`@`(`8Z`(?0``@(8`q@`M# ``4#`1`K#X` 4c##`$`>#X#88`o`5T#``/#X` ?(@8`݄@` ?(`0``(#?@8`@`@(`0`@`9 (`0K?`?4## ` @㿘#X#\@#883`@V`(`0`#X ` p88`g`0> 0bH> > !(`Ȳ  @`` `@ `@ @@"` "`@`&#`> ,`Ѐ`> `> @!> b@@,,@``> `> > c@ސ!> b@@`?(c08`(@㿘#X#88`g`4Q(`> .0`> > c(Ƞ `<@@21` `@2@&#` %88`@ @4  `2 (`> 4 bH, , > @!> b@@9`@ `@y`Ơ@t`?(c08`(@ ?(c08`(Ȃ@㿘# P#?@[۔??@@֐@Z 㿘> 7cP#X#\ P>  @ ~’c(@cd  cd8`0@` @$ & & & & H```?`@(@ @k8 "}>        @`@?  (@ "ܢ@ B  ? <  ?3`   @ 2Ƣ@ 88`@`@4@ (`0````"1 `0````"Hp@? ?3`  0@ ?  (@ @X!  (`0````}e `@ `0```   @Ԗ(H` 84@'  㿘##X#\#`"#X@88`@`4 @8c8@4 @ @ (`0````" `0````c88P4@?8H8`@`4#X#\ 88`آ@ `(0@(`0```` | "#X`@`0```` #X#\88`@`X0  c@(`0```` | "@`@`0```` @`!h`4@88`@`x4@8c8p4@8c84@Z ##`2P@#X#\@8804 4 D@ (`0````e |m `@ `0```㿘#X#\88`dc0`?`@5@|M#`?`@5@#X#\88`@`X0  c@(`0```` |, "#X`@`0```` #X#\@ 88`ذ@ `(0@(`0```` | @``0```` {#`?`@5@㿘#X6##\88`g`4`H# yd@)> @!H#"/> > @ ``??c4#X88`be0`#X#\(88`fa1 0c܀ '1> @!`@!X.# 4>@bx`&##&@?8  4y "D>`&"D>b&!>a&!&!? @" P6 &"4@& P@ǐ#X#88`g` 0>>@0#>b>&#L>`&#P&#T(`h0`#`_> #X  88`fa0#X #\&#@8؃8`@`(0@(`0```` {+ "#X@``0```` #X#\@88`@`X0  c(`0```` {@``0```` @!#(0``"#D```#}#X#\@880#2.#X  4.#>@ޒbx`61##?&@8?(c0(8&`?(c08`(@W0Ւ???@X #<`@k K#X 8, @(c2   (c# " @A @T "4#X㿘#\#X ` (`0```` zk @``0````  `"XX88`g`04`@88`a4` "@X\@ 880c,@   ``(ׂ`X\ 88`ؠ@ `(0(`0```` z "X``0```` X\88`@`X0  c(`0```` y "X``0```` X 88`fa0` `  @`a? &@85`8@`x`5@`p`5@`?h`5 `  P@88`@` 5@8c8H5`@{4@`88`g`4`@7@4@4`1"@X\@880@ ?&@8?(c0(8` (@`@&X` ?c4`X@?(`0``@(8``ς@@`8(`㿘Ho&(@gHp@㿘 >  @Sa 膀@< 㿘#X#\c#`` `@#`(@ 0 #@`c> #`e8%&#&##`` `@"# @> @88`@`H4  6  @> #``&#㿘#X#\@881 @  #X#\(88`fa1 0   g  ?(c08`(چ@X㿘#X#\`w P#`` (`0`) ?c+0>`` (`0`22? ".   @ > В@ڔ  @ƈ `#`` (`0``@(8`@Ӓ ؠ`@> 88`@`@4`  @(`0````" `0```#`` ?(c08`(@ (`0```` w`@ `0```㿘 \#Xd@`@S#\??c!`5?"`"<!@yȒ   `"}>   `$9 "@`> @y @  #`` 8(`0`` ``R"`ʐ!` (@a ń( ` (`0`@* ?7"`Ȑ@yo `%`&##<0`@8`@@7 D @ H`#``?(Ҡ4?4 #` o  m0 $   @,@ / 2  ,`@Hp@ @>  b#`` (`0``@(8`@8(`0``[ 7 "&""",@  ǀ    0 4 ,@  2  ؄,0!` (@ W(0!` (@`@("@ 0"@ %"@ ƀ `(`0``@(8`@` (`0``@(8`@,0``@(8`*@<08(0(`8`` $`!&! ` " !&!? #8@5` \d6 \@1!  #?8?c(0(8㿘#\#X`? Pc +`!h4@0@(0` $7@4@      % {4  Ű mဌ @(`0``@8`(@(0` ̀(`0``@(8`ł@㿘Hof4 (@g a"3 \80a "9 \@Ȓ P 4" \Hp@a50 a6 @# 4 \`@$ Hp@A`@#`"  `6 \`  P@ I Hp@2 \ 6 \lި \4p(Dl0x88888@,Lhpx      4 , $    lXPH@ll80llllll(`` `@?΂` d 1*`?0``@(8`@10`` `@?̂` h 1*`?0``@(8`@10` `ഀ*` (`0``ഀ*` ?(c08`(@ 2 {`2  Ȇ@:  @: 㿐 ` @* 2  @ av`N?`(@8`@E  ` `?dശ`  Юิ+<d25@&@@?Ȃ`p@7(`0`@87(0`$@ߠ  ```  > Ё` ` `@(8`@7͆@?Ȅp(`0``@(8`@ ?(c ; c̘. +  t 㻐 ` &`&`3&` &``(0`8=C"77 `@ ?`(@8`@ ``&`(`X=C &` =D&`7" 7`@ ņ ?`(@8`@`"` `` ``&` `  ``&``&```&`㿘`6` 6` `@ "` "`㿘!  - ` 0 > @  )  `@?`@(0`` (?8 @6``  &`6``2&` &` `@?`@?(c08`(ф@` 2@ (>`  2@##`(?@8`@2` 8(2`  2@c?c( 82`  2@c?c( 82`  2@c?c( 82`  2@c?c( 82`  2@c?`) @8`@c2`c`(@8`@2`  8(2`  2@##`(?@8`@2` 8(2`  2@c?c( 82`  2@#ۈ#㿘`` (`>   ` *`2``8*`@2`  c6`   c6`  `?`(@8`@ۆ   c6` ӆ   c6` ˆ   c6` Æ ``?) c c8 c6 6+ 8c 6 `` #(?#c86  2`  66666666666` }   c6` u ` #(?#c86 `` ) c?c86 c+ 8 6 `R㿘  * n 㿘`@`8  `a8 @ *`( cT   ? @(`8`0` ` 1 >@   `  cT>  @v!H`` @&`  c6o` (&㿘` !  0 <&`>`0&`@K  @?c  D`,``  ``@(8`@@ mb&` ```  㿘 b   `"4 4 ?c"q  FD J 4 ``8 (`>ق 4 ``(` `  + 0   *08  `@`@r> x  4 `4 `4 `4 `4 `4 `44 *02 㿘` ( `. @`5`` `  `% < @@]   @44 .>4 `׈ @ۈ!Θ ̘ ʘ Ș `2Ϙ ͈"`"Lj$ň(H `'=  '7'7@> cL ?c (8cL @ @  2m   `& `'=  '7'7@`?(c@ 8`@ (` *79  ) )  @ @(` @( (*; (` @@ 77 V&  > > c!  --00`#`#\#@ ؊##d@ l@ ؄ d d#h@ f,#l-`44 > @! > `& `'= '7'7@ `+ *(?c 89  @;` s@ vb> ƒ  &@=$ 77@ 2Oʀ`@$Ò`.2Oπ`-2OҀ`2OOÖ́ ?`OOІ+ &+  (** @ @ (`) *()  *)  &> fa`&   > @!x㿘@Q!   @}Ւ  ` ` *` 2`  6 {6 㿘 `@ ``&ϐ㿘`?` "``"&`9`-`+ z``8`〠dc``@(8`@29 `8& "`5`` "`F`` `Ec`(`1>#ʹ`֑@"`U`%`Cn`. `  `c(@  8`@6""H `ۂ`c`(8`6 Y`"K` ``8.`ʁu`c`(8`6 `*܂c`(8`6 `c(8`6 `c(8 `4& c(8`6 `c(8`6 c(8`6 ` ` `kY@#8 kT `c(8`6 ``c8.Hc(8`6 `c(8 `0& c(`1 > `@c(8`6  D`@ k `c(`1>#`͑@`c(8 `<&  >  @|! `8& 㻐` ``  `@ Dja ?c `,@` i i, 0``@(8`@4`  #<5@` 5` `@ MP G ` 7(<0?c) 78` 7 `@ +. %< ` (07  7 `@    ` `@p> c<' 4 `? W> @``'///'''2  * @@`? c( <  j ` ޔ @`@@ 8@@ @@4  4 4 2  `"? #\> ?@"0@~#x> ! #c<' e#`& cb(  >??cZ <'0@//'* ''0/@`? c( <  i ޔ`  @.`.`.@`(`.`@8@"4`,, 4`, 4`, @  > @#Ԃ`&&&@}#(P( \dB a"> ޲`!Ⱥ`(@m  @퍔 D(7<@I 26  \a1`@"`2ݐ!` ؀2؁@@0"@ Ĥ(`@ a$!&! =; `57!b݀3?c(87`2  `02>  #c8@!  `  D`  .o Dh” ```   0̂8’̐ h  hh ?77#7`7 n7#`@7’c< h cB h  c8@<` ?c(08`(@! 7 `  D`  < D @K @ \ 6 Z6 \ `!  @ #> @ѐ"8`7‚(7h2  Ґh-  `0@  #c8@ݖ?c! ( 87`  D`? D D a@" D`7‚( 7g8Ҕ g C 㻐!#c & ``  `!#@p &c > @["!#@o&`"=77 2 `2 > 'b@  #* @x0  d@ < 17cF7"耢 K  ,, @ ` @뻐  g `  @먐   bc6 "耠` ` @릔 d,@` `7@ `@ 㿘6 8k >  @ѐ"   `(```U1  `,```La1 b ?ഢc50``?  io ``(`0``@(8`@@`?   <  .`?0``@(8`@.?0``@(8`@㿘 `   @   >  @A#ab ?തc@?Ђ``@0` i??^@`@?Є`(`0`@0` ` J`:@?ނ`D@(0& `88@?̄`h0@   6  6`@8`$    @?ʄl0  2  @?ނ`D@?(c08`(‚@ d`?`(@8`;@?7 <(`"`  !7 <77</"('#$㿐 `` `*2 ! @ +`  8 $  `@?Ȃ`p@ (0@D  @?Ȃ`p@ (0`"6`  6@ `) @?ȅ0`p `0`?t `?`"`  ీD"` j*2 ` 4`4@ ?`(@8`@`h@.`@?0`@`8(`4` `? Lీf``ΰ <# 77Z<# `@?Ȃ`p@ ?(c08`(m@@?Ȃ`p@ ?(c08`(l@` ` @ $6` ` 4@!4` <( 77<((`>4` #+'%&"!㿘 `#``##?(f\ (@fW㿘>  @o! `@ @> 㿐 `6  #` @     cf*??2 > @C#@  `&?%c <77(7`ߠ  P! ?   D@Ð ̐cw !  ((0(7?c877   D`` <@!    > @ܐ#Xz 㿘??ദcฐ#8(`0`` e??" @#(`0``@(8`@8(`0``逤  `@?`3@ `@@?ഀ  1  `@@?ഀ t 1 ```1ab ?തc @?Ђ``@   e;??"0 @  @?Є` (`0`@8`` 逡 W@?`@ (08@?8`̂ph p0     `J > @"# < `> > @#x <.`?0``@(8`@/ ?0``@(8`@.?0``@(8`k@.?0``@(8`P@@?`@ ?(c08`(@Ȃ ``  D `?c(0(8 8```, D(`0 D Fh `  @ $`$`  t @ڔ ` c@/`  D  @> c`2  @w    @(``-``$`$` 0?c8 ?c(88 fc`(`0@ $`$`  `@ . M  `0@  > €`@`8"``2t t@ "m t > @ 0%0`` ``C`  , <(`0 <@ >> @ɐ#0  <; <@֒ ?`@(8`@' $`$` a a  a  ```  @ D "  @@U> > @ 0Є`0`(@> `0`* @ > @x @0` D``< <  <@+ `" > @_  $`$` @ '@y` h   `>  @? @   @ @??㿘 `ച   @?΂`d0@ ?@?̂`h0@  ` ฀@?΂`d0@x  @?Ђ``@ @?h`?cp0 *0`   $   `@?ނ`D@(08 8@?`Ȇ̆h0@ t E  `88@?̂ch 0  `@@?ഄ΀ ?dc  0"`  0 @?Ђ``@ ?(c08`(@ `88@?̄`h0@  `88@?̄`h0@ g 헐 ` ?88@? ̆h0 y o `88@?̄`h0@ <  `@?ނ`D@?(c08`(=@FI p> c<@'  #``؂!&&< 77@֨   > @! @ P#8_L@> @ؐ!H  `_@ ?& 0`6 `$"$&!` `&!`(&%&!Ȇ  &"$> ! #> aX# > c!   > ap`6` `6)+6`6)`6` 86`` d&6 `6`6`66`<67 7 @ W` 6``^`|`o `=O 77 2`,䀠``,!  @nX  @  T `=Ƃ 77 ` ?`(@8`@```T6 ` `  6 H#?c ``(8`6 ``@c2&# & ` ` `d2a& `Є& aj h& cx&`6#` > >@ԍD  @x ! @s ``ΐ`Őa`` ` `l `M @n 0@ "." ( ( ( ( @(> @ `> &@ax ` .!@0 `T6`&&` ` @& :_e `& ec `& !&   @ ! @ ```a  @    @! @ %`z`am  @א! @Җ %``aNe  @Կ! @Ժ `p`ga2M" @Ԫ C`( @Ԥ 9$ @Ԟ 0` ` b&  & ac `& $r& ؂'&" @| " @v " @o $ @h " @b i( @\ {( @V Z$ @P Q( @J $ @D ( @> u$ @8 l> @q7#@h>`0`Ho4(@g``K @> a!@fp @J J%!Ђ@%0a뀦@F 0؀@"8cኀ@ 8҂a@p5@5 0@*   4"\@1 `@1 (@d%Hp@ Hp@@>T @P>0Ҁ@ـ@>`0`@9w V "YŰ  @ 0怦@瀦@\` # `2@/$=A"2 2 `@  ?`(@8`@` (H   @H>|  a@tꀦ@m>`0`@9$ " i   chm( @ 4@?% 7҆`0`@8  Ґ @ւ@\`߆a@a@`@  `@\(8`԰ %a逦@0aր@0 a6@є  @' Ͱ>`0`@8} \ $ @.Δ "=22  ` `@ 2' `   >&(` @@ `{?'̸c  |'Ȁ` |@  |@{  ,``-``-` -``-`-` ,`,,,,,@ `4`@(@8`@4`> ,`S8,`R  (` :,`[  (`84`\ `(@8`@4`^ <     7 n` `,`t,`B 2`  @`(C,`B`2`@,`x@  2 ,`x̐ Y | +@&(` @@"|@ 'Ȃr'̒    @.$=B"2 2 `@ 2f  . (  ( ( ( (  @-$="2 2 `@ 2C ?`(@ 8`@6>`0`@7j I   @- ! !Y  4@ (# X  + 6h   @-$"`0`@6  `   @-$<2 ?c(82 I  \` ဤ`@ ـ>`0`@6 d \`Ұ 2 `C  @,̐$ <22  c2 2  `@  cc%>@hג`#> 'b@ į `* * @jb*#* @ !>  @bÔ`0`@63    @,$W$ o (`3`8l ?(`-1 ; a7"8 X  `@ 2H 쨒 B \`A`<`0`@5 Ȧ 麐 +\`5\` `@ )`@0(D+\`@ @w0 0 !W}    <!777 `@\`~ @- 〦 4 @+ P    <777Ԡ# *!tXr  4  2 #Ӣ`7 Ғ  &@ܤ< 7Ԡ ?4  7 (`7 XP `\`"`@`〠3ሀఀ~ @5;   @q D0 ` <  @  `^ # *atW 4 `8`(`8 44% 1 ?-1 ?`%q1 ?`C1 ?` `"۠` ) ܀*Cւ ҅1 4?c(84 4`@ (`4   TW +4〠  `  @۴ 퀧`) `K `@ Ӱ܄`(@ 8`@5` u  ĺ `1   `@~1   `o1   Ⱥ  @ DWIN`G   ` <  @ 㿘 8   `7 @?p` 6 㿘 ` '`7 ?x`Vതฮ4﷖ 6 @?  `l@1@@?ʀl0@@?`l0@ 6 R@4@?ʄl (02@?ʂ`l@ (bx0 4@?ʄl ?(`#0``@ (8`@(`8`@@?ʂ`l@ ?(0"x(`8(8 Ւ5 6 " 㿘  < @h< dHo&(@ `   <@Hp@   g 1> @ۑ!`#``'Ho(@ `@i` < 7ą(7!?#87 Đ@``@(8`@7Ą<77@``@(8`@7Ą<77@``@(8`@7Ą<77@``@(8`@7Ą<77@``@(8`@7Ą<77@``@(8`@7Ą< 77@`@`(`7ġ< < 77h!`@2 ``3`'ȃ('Ć7Ȅ<07Đ7'''''''7U`  (`x  'ȃ('7Ȅ<077Ɛ '̐''''''U\7 `@# ``?c<7Ɖ)  87Ą7`@#'ȃ('7Ȅ<077Ɛ#'̐''''''U$7`"H <77 #8  UU ```  a2! ` 77Ą<7@`< K `#`   `*`2`` &: |> `& &: 2k> ``̀_&!`@ Hp@  `@{ 6 @fx <g `@n"0j0(`7Ă<-77`"` @#  !#8@ז?4`SJ 8`  SE`SA .?0c(84`ﬕ 㿘` !e "   `2  `@ߐ1> @ H> 'c<'P' 1`'P<#@@/'P v ! /ؐ k  `/c1c `2c ^>   ''PP C ! 6/0 > @K X0@{`> @D 0΂c@˔ 2 ` !ܐ "= `8, :, < 7   2 , :"- <``" <`` `2  , :, <@f!h , : , < < , :܈ , < 0 <`, ; , :`- ?0c(8m `Tb   !#8@ֆ`6'`R8 #8` R3 `R/  (?c 8`@0 '0'0`'? /耈? (? (? ( k o &0> @     `,,`(`0?c8`(@` 4 6 > ` * `0  `*>  @Z  Ԓ *`> @R!ԅ,`2 `   4 `" > @A!X   4 c@cq    > `א! U*㿘 `@[> @$!  !#8@ϐ 4`Q 8`  Q~`Qz .?0c(84` 㿘 D```  @$Ȣ T  q@ % * Ѓ9 (`@@  0 '"  9 (`@@  0  (@ @0%?`5 4@* % @ @$@`%   & @& @  $@ Q  >ېcd@`@@bِ'L'P `'P'L 'P'L+` ?(c` 9 8 zLPx ݖZ P`   P ؒ ! ! " c@b.0``"i` `̴-  !#8@?6P #8  P P'L ?( 8`@6L 'L(`0`@`8(`1 L`'L0L $`'L  ``&@7`> @!ȁ@/> @!LPx ݖژ P` ! `\- - `" > @ِ"  ," `T> Ho&(@gHp@ ]  дa`ʒ -0``2`` . @"/``@"/ "@ /8``2  ` 6 > @y"h @u"(0@  @=$$  2@  ` x|> @]"H}  @#) &@  `@$6 &@ j 㿘 `1 !$@ @"`@ !"&@6@&@ !@ @# x#@&@3>@_`> @"ڐ㿘 4 ?ςc @`<  ("Є  (@(0"!    ? @ & &  @ @&  & @$a @$^  @$@!$@㿘` !z " `@1> @Ñ"㿘 `_ ! "`96Ho5(@#@`T! >  c( @$ @$ `@`@  `" @@ @` & &Hp@gʐ#> : a Dy QK 2   Hp@0>  @Z#! 㿘`?`(@8`@!@2 ` `@  #<` `"@l > @5#x@@b`> @*#H@ `#:2 `#82 Ho' (@a' ` "  ` `UΔ Hp@@`( `?c(84 8Hp@``;` G""6<" 8`@C> b"< @> <&(`@aԀ"2 a (`@ a" d"&"`?@ݐ> @# 沖 @:  b6`@Y&"倠 !@ 0ހ<>  c<' >`0@` ' 0aՀ@@@8aׄaӀ@FaҀ@">  @d# k@ 0aր@2> &HofS(@@ e `{a ` |xc8`& T`|@ O @ߔ | c8' @77777 7 47 8/˃0`/ 6/7 :``  // :` ```/ ( :` ```/ ( :`" ``/ ( L  | "Hp@0{h L  t@'hHo4@(@g@ 'p`$   H p`@  M  4l7N  7P 67T 8 7R :K/V "Hp@ 6K̔ 0@* +tK  %t@@4@@) X K Ho&(@g }ЃHp@ @t'tK X K Hof(@g    7` 47^ 67d 87b :Kg/fHp@0@) X KP Ho(@g "  ``2Hp@0g@> @`!x 0 @ Hp@{ ݐ`2 @@^  Hp@0k㿘 Hof4(@g"3     @ ??& &6  `& `! !!#& ` > 'bВ #@ q@]YHp@! a!㿘@`. Ho (@  ``2"Hp@ a  2`0@]``;> a@.Hp@ 㿘 `;` `! Ho (@?c(<08`WĀ`M``a` Hp@@a`?c(<08`5`,? `c( @> :` @@` l`(*`> @ `0```P"d> 0`` ";> B`0`"Q> `2/> > @ 8``002` `(`2`> @  @Ғ ` `0-0```5`"/> > @ s`@ Ho`> @ j`(`@2> > @ ha` `2> > @ X`@ (T`> @ O`@ xK`@ G`> @ B`> @ X=`㿘Ho (@g ! 2 .> ?c> a 0#8 !`3j $  @ ?$$  @4 $  &? a  @e Hp@  0`ф$ `8   =4      @ $? @$ 4 $  @@\F&?"? `7   `*4   &@%@  4  & #@[Hp@?@@̐ǒ㿘# @ #D#dd# >a\ #D#dd# >(`D #D #dd#@ >(`D 㿘 \a86`6`6`6@"` `:`   @-  @2 (2   (@@`"0` @    \?6 \4456@6 \?`4`4`56@ \}6 \㿐 @{  < `$`` 0$`$`2' ` @   * 쀦` $` #@$&@  @⃖(```` (@ '`$`㿘e @>  "   t@ > @{S  0@ 㿐#X> > a> a #l", @ O`0`@"/````?`- @> "?:/77 #P #l" , @ O`&#X` @ @ #t, , "@@"@㿘 < @g `;  #@@@X@ 2 `; < @#@ <㿐 \d@`@Oc`> a!cpb,@ O`&a \"`;@M   "3$c` D "cx@z cx, , "@@? /6 Z7 07b c @ HcTcd$cd`   \d6 \$c`!` ؀  "$c`؀  (`@ a$ !&!"@ d6 \cd@c`" ah a"7?7""""""(`(@ ( 777* 0#l#H#P@�`7&#d&#`I&#\#p?#T(` 0@7I7#h"?* Ƞ 7ޟ#P`$#T  #H#t#l@"07/:?, /77 #P @f#T`  #H#x#p@"0/0, 7/77 #T @f㿘# @ JD d#`"#@@#@# @u##H#h , 2#4  @J' d#  ab" # # @ !"?# @ !> # !B 6 `@{ 06 #`@ @"#㿘Ho&(@gHp@㿘Hof4 (@g a"* \80a "3 \@˒ 0 4"A \Hp@a50 a6# `  @#$倢 4`A`@)W Hp@`6 \`E 0@e Hp@`@  Ґ \ 6 \㿘 >  @a @< s㿐#d`g#\> > bhX> b8'0) 3+) `y0`@j@nh @#@@ d Ѓ) 0`@> ЀdIc #d@> #T &#d` `* #p",  O` {@6  І@>  #d@> #T &#d` `ڠ &#\ 0#d`"6 "  І@> А@  І@> @@h@㿘# @ * 4  c ?@ c  @!  6$ " J"`> @Đ"`@ <``Ȇ@<`Ȁ(`@<`(Ӏ `> @" `> @"`Ȑ@ <`ȁ㿘ɐ `  E"$>`&"$>߂a &!&!>?`H"&%b6  0&!> & 0 @&!@#L@$ &#L  &#P&#T@"> @a##P> @\##P#T) ) (`  @) &#t#@&#h &#l&#p&#x@ @@@@2>   &#P&#T@@  > @"&#P&#T @&#T&#P &#P&#T  &#P&#T \ "*@*` 0*` *`; *` ` *@ 0  +@` 3@ `3@`㿐$ #@$#` #\Κ?c(86㿐#.0`@#@#D$$$ $@ ,`#`4 #\#&,`0`@ (`0`#`#\@@㿘 "\.@ @.`.` 0.` .`?`.`  .@`` . @`@  c0Gi @`@0 6  6 0h> $#ȸc<' &# #D#@$ GD#!,G@# !#,G; `'`!  &#Ȱ c>  (`` " ,0G  d  d  @(``?,@ ,  H,, @, 7> .X#`z#\А#\#`X@ȵ  ?,@&#Ȃ I,,?, X#\V#`#\#`X@Ȓ ? ,@&#@X#Hx> $c<@' #@#D$]$ "L$ >  @Ӑ#h@ >   $ &$ ?<.#.# I`? @.#>c(>&#$>b&#&#> &# cP`&#`)&#"D  ?,#B>@ >  @#0  &$ .#?  4 @` .#& 4 &$?`$#`#\ W `? @E@ ?``(b?,#Đ>`&# ",  ,#`#\$/"?@W#X㿐#D$ "`( @(( > ( (>(  (n /`L/ ` ">@`  `  /2 `  > @̐# "  / `3` `2`  / @> @`2` `"4/24` @`@ c0   E  @`@" > @ܒc@/`"4` `" @ `*@`2` 4@o##D` #D `@($`"#0#D0``($ ` >  ` > `>+` $ ` > ` > `>+`> ` #㿘#@" 㿘@"##,&`#0&`#?> `?㿘$` #D  (E0#D  (E*  2#D#D(`㿘#@"c㿘> 8`&#>>\`, &#<#>>@֖,͐???@" #$`@͓  " @ @Ɠ "$`$(`   > >+` `<  > >+``<> ` #> c,#㿘#@" 㿘@"6##,&`#0&`#?> `?㿘> 8b&#>>xb#&#< >>@t,???@" #$`@m  " @R @f "ttttttttttt#P#\ c"  @#@>`88 D#@?`88 H#@0`@ P88#@<@` a  T#@>@`88 X#@?`88 \#@<` `88#@`"  ``d#@ " "(`@c !0#@ #@ #@ #@?`@ 88#@`00b  #@ဂ88`@ @#@ #@ #@ #@ #@ #@  c"!#@!#@!#@! #@!#@!#@!#@!#@! #@!$#@!(#@ #@#l#p'@`O+ #``&@ " " "(`@`#@&+ " " "(`@`#@ " "(`@`#@ "(`@(`c(`~@ "(`@?(`@(`@`#@ "(?(c(ӄ "(?(c(3 ??c  0(`@@@#\$` #P`#\b"#h` #b ?0(c ?(`0@@@  "#h` ? @03`(?c @(`@@@#`#\#P* >0$` `  $`$`$ ?0(c ?(`0@@@ 㿀'D \d@`@: #(`@c1D!'`OD@D  #T#  /`@c @ `"%`, `D"`u!@DÒ @حD @9 @  #T @  D`,c @cpD`@D 'DD @r #T ``( @ `,`Ɔ ' 0?? @   @ ?? @  `(*`  ?+  @ 3` 2*@   ? `,- 54   *@+`@ 4@ @4@5`5 @  @@/`8`4  c     `,@g #l `B??    ??   ?3`? *)  + @ ? 0 * 45  +`   ((@, 2`2    4`4 @ >#T `# @ `,`d ` @'#l `#K 0 # c'  ((`@ c #P#\@D! c'D c0Z(`D`D`9 Da؀ D!` ,"D؄ ' D(`@ H a `D ??@@ /`0`(7`@ x@ 'D! ` #"؀  D(`@  a" Dt #T D\d0\ a!@ 0c a㿘6`@), @c #T `c @`(#Tc@@c$c @> $` @&cc& {6 "6  0 㿘% c` #T  ` @`(#T @@ִ$ 2&&&X#P@`)#\`4 DŽ}6 "`, 6 a@` +`3`??c @ @0(`@@@%@`4 ?0(c ?0(` @@΄@  @``@2 @"耢   @ 2 (2  8 (@@ ?` ?#@  @`@`60 ((` @0@@ 㿘@"#(&`#$&`㿘# ` # @ s 0 @q"㿘#\#P`0 $@!##(@@ @?&`?$#(@ `@?` a`@`+`3`??c @ @0(`@@@`<$+`3`??c @ @0(`@@њ@㿘 ?c!?@ d@@?Բ#P@0((`@0@@  㿘`#P8#\ I$K - `   $`&@$ ` `(#$`@8?@` $88 T&@ 8?8`@&@$  6?.?(0`τ `ǘ  $ #P`#\`0@@ @0 >b  0@ ?0(?0(`@ @@ `(@@0`(1 @  @0 >b #P`#\`4@@ @4 >b  4@ ?0(?0(`@ @@ `(@@0`(1 @  @4 >b 㿘#P#\.`.`?@c@b @$ # c #? 3@@d"# >Ր `0((`@0@@@.`6`c?@@(0`Բ1> @|ӑ X㿘#P#\@.``.@@b ( ? c%? 3@d  > @`0((`@0@@?c6`?@0`ֲ@>  @| p㿘@> >   @| 㿘" b`@h h d@  @>  >  @|g  `@ ` ` a>  >   㿘#\#P#` $ ? > >#@8?8`&    ) `>  @|&!@`@|!! 㿘#\#P#`$    > =#8?8`&     `>  @{!`@{!`㿘#P#`Ho&(@g@8?@8`@@$  ʘ  > @{Ȑ!Hp@㿘 0  (@ 7 (" ".`@$T `@! 2ؖT ` ``(@ l cq` `0.`@8@l"LL *     ? c +`  ?( 0@ *`  @ ?,  3` ( 4` + ?@  (0@+` 4   ?? 0 @@ 23 @ @ @  @  @ 8@T `@㠖 @  㰆`$ $`?`0? ` @ (3`  @  *   +  @ * ?( @0 ` (2`?@  (0+`2   ? @?0 @ 3 4      .`@8@l2WLL (       > @zʐ!> @{!㿘 cc`{ "㿘  c ) @    $ #T ` #@  c  ) @    @  `İ 㿐 㸀`#P'#\ 0'3# ?@?  @   @??  @ `(2*`  ?+  @ 3` -  ` *4@ , @ 4? 54  *@+`@ 5`@ @5 @  @@   Z! #T ` ``(@ #T @`@'@ S&   `$  (`C ? $ 0@$ $  D @kb @ `!#T. 㰡.@#  #l`2o  c  @  "#T! #&@`# a  @@ф?  ?0(?c0(`@@@  a 㿘@JK#8 \6 Z{`&6 \#c` #T  `c@`(#Tc@@Mc&c`@2ccc$c$$s@ܐ"Z%#㿘#P#\Ho (@g uא `@p` ` $@#`0`$@  $@#`0`$@#7`?7c$`@>`88`$$@ ??c` `($@$@$#p`` $@$@| `$@ c9 ) 0880`( @8`` $@`a"$@@`4@@# ``"@`c ca#8$@@I  \`@{6 \Hp@  (0?c?(` @1 @@ ` $@Q# ?`0?0(c0(`@@@ `$@F  (0?c?(` @1 @@ $@8# ?`0?c0(0(`@@+@ c ?0(?c0(`@@@ +`3`??c @ @0(`@@x@`4@ ?0(c ?0(`@@@ d@ c) 80`@8`9 ?08( ?0(0`(3 ?0(?c0(`@@@ 0?c((` ?@0@@ 㿘 > @y a @> |㿘 #P`@#\``` @@a4@@@ ; ccT 0`` @@a45?@) 1 ?  (`1 @@@/ 7 66`/`(7 .@@ǂ@ 㿘#P`[#\` ?E O`@F ? 08  `a`@`I %`E`@` @> `V` @ c&\`@ ccܐ&@He!ʐȦ` ?0(c ?(`0@@@  0 `@ ?0(?c(`0@@@ `@ ?0(?c(`0@@@ ` @ ?0(?c0(`@@@ `@ ?0(?c0(`@@@ 㿘  0 D#c` #T @ c@` #T @$#T# @"#T @##T  0c#T# (@#??@A@?@;@㿐&`0#T>  $a##`##\   "#T 1> @v"# , c  "#T > @v"8cTc (@# #\    U#T # @  c `> @v^"cT @ccT  0c@cTc (@3 @cT. @`(#\ (  @> `@v2" c@@` cT @$@cT @ccT > @v"hcT ' cT. @c(#\ (   "$#`>  #@u5@c` cT @2@@b> @u#HcP@c\ @( cԒ`&@ @``b$>`&b$?`"6`>c&a&a>#`0(  |&a&b@&`0 >cT&a&c,>>Dat&c&c4&c0b >>(@Wcp`$c\`P chb"ccP`&chc\`„ b#cp` ??@N c`">ch@4 c20` `" ct ``` ct`&ct@{@c8>c@DX1 #@3>@DSbc\a  ?(0?c(`0@@@ m(`".cpcP&chc\` ? @03`(?c @(`@@@b#cp` `Q`O???@ c`cp`7 $cPc\@?` P88# cPc\@?@` T88#@ cPc\@@8?8` >#@aX>(&c,&c0???@ c`` ! @y @ !Yc 3`?+`? @ @(0`5㿘#P 0@_#\aka  waa@@C @;B ;@aa a$a(@ @D ;%%@'@%%$" @Hof(@g@"Hp@ @E#8a ?0(c ? (`@0@@ a  ?0(c ?0(` @@@ a ?0(c ? (`@0@@ a ?0(c ? (`@0@@ @@C @;B ;@ua ?0(c ? (`@0@i@ a  ?0(c ? (`@0@]@ a$ ?0(c ? (`@0@Q@ a( ?(0c ?(`0@@@ D 㿘Hof4 (@g a"3 \80a "= \@ 0 4" \Hp@a50 a6 @" 4 \`@ Hp@``@& Hp@``@6 \`2  0@QMܐ "ڐ  Ր ͐ TXTTHT``㿘L?c??> 0g ""@-8! h>"0`@8` "' @' ` @`@0 ((` @0@@'` Ț@@ @ @ 0`0(΂㿘L?c??> 0g ""@-8! h>"0`@8` "'`'`  @`60 ((` @0@@'`  Ț@@ @ @ 0`0(΂㿘1?7?c?>`0@g ""@x'`h9 0`@8` "g  @@@@0`0(""@cD@+  " `?"( cD2@?0(c ?(`0@@@ 㿘"@"cD>@/  @ )?? c 7?/`' @``@?"`"`(0 (`0@@/`@' @`@?""@/` cD6@?0(c ?(`0@@@P` `T##`#@ (#(   @(`@ @`"@4" \0````") !&" f"*aU"Ujb "@B"&Uj@`?" # `   \ \ "? \(`@(`@0``ɂ` \ ?#(`?0(  0  0() 3   "?&c0((` ?@0@@ ""88`@`v \ # F""@P\\""@f"` `0```` "   """@s`\`\"""@S\\?c""@"@b"&"@s\\"""@\\ ?0(?0(`@ @@ `(@@(1 0`""@"?` `c00(`?`(0@@@0``\?0`@ (`?@(`1   0((3` `\ ?0(?0(`@ @@ @@0`(1 (`{u @s i0p\ ?#(`?0(  0  0() 3  "{" ?0(?0(`@ @@ `(@@(1 0`8"$@v"` \"@"@cL"&㿘#$#( `` c8$ #$      >  c8$ 㿘1#X$ @  #t`,! @ $ @ 7 7c, @c,^(z `c,``(`0, @@ `4@ 0@ 1 1 `` "`,"1 `&1 `,  @ , @ +c>ũ. (-z`0$ ``( @ $ c8  X .  , t$  c( `,@$& ˰㿐#` : `S (`Ȁ2B" fH" `@" L#``l""@pLL@"#@@ E""@yLL@ "' 2" #"@`"# fH"@`" fL'  !@@"! fH" fL#'˰ "@NLL"""@]HH""@mLLL ?(#?0(`@  0  0() 3  ~L?0`@ (`?@(`1    0(3`( uL ?#(`?0(  0  0() 3  "\H ?#(`?0(  0  0() 3  "uL ?(#?0(`  "`"` ##`0 "` ##`.`""@N"fl #"`5@``"`@``"``"``@"` ""`"@3"fh #"``"`"`@``"`@`` "`"` "` ?fl?(0c(`0@@@ ?fh?(0c(`0@@Ć@ 㿘" .##`" @" "@@0``` >  @n#`"@@0`` k@""`\<"@R > @m Д >  @m# ,# a@@@"""@DDb"""@gPP" #!` V""@  ""@  ۰  >  @m#<" ,# "<@(`@ ?#(`?0(@  0  0() 3  @ ?#(`?0(@  0  0() 3  P ?#(`?0(  0  0() 3  D?0`@ (`?@(`1   0(3`( e㿈# ''` ` > @m3#"`#"@!&"`$"``(`@#&@'``@(`@''' @?(`@(`ڂ@`` ?(?0(c(`0@@ӂ@ 㿈# ''` ` > @l#"`#"@!&"`$"``(`@#&X'``@(`@'''q @?(`@(`ڂ@`` ?(?0(c(`0@@ӂ@ 㿘$!#0&@ c@!c(*  `` #T `#P#@ `& #`&> @mA > @m> (> @m; `> @m8 㿈%X $ @  t`,! @ $ @ 7 7\, @c,W -c,`"''''0`'4777, @  `&"77+ `, @, ނ@)#>`7, @$ ``( @ #X, ,#t$ c(  `,@$ & դ㿐c< '!(`@c,)"`6@/  ! # `U 2m \"`1 @/ D @]Z (`@c,ۤ"c<4@""% 6 Z!`+ a؀ ʄ䀤!`  "" D؀``(`@( a"`!&! "@   @?0(c ?(`0@@@ d6 \ a㿘#(`@>  G/z t  c(X((@@` @> #,`"@#$$#,` ` `( #$`$ #(&$`&6 6˦` {6 㿈#( @@#>D#t c(+#X,  @, @ @> #,`"@ª#$$#,` ` `( #$`$ &$`#(&6 6ʠ {6 㿘c, '`" #(@u#$$ @$#(,`@@      `d 㿘 c,% "#(@Q$#(,`@@      `a 㿘 +,% `" #(@4#$$ @$#(,`@      `b 㿘#(z@`6 c,X #,`" #(@ @$#, `@$@&#(,@@    `cX  #$& @@  2 㿐 ""{6 ?`@88@!%'ؐVҐe=#( @#( #(@!?c>6㿐k''f }6 "`$"a 6 T'M'@&?"" ee @cL ""p` @& "耢  cL`  @h  3( $ &`"`""%?ec0((` ?@0@@@ e- 5 ??c  0(`@@@> @j& 㿈"ctc>&6c<6!%cX&:  @ """ &#$  #\( @       7#$ @ 7 p)> !#$' 8@ > #\#``$ܠ $@   >  7@i  !#$@ ! ,@$@@  !@  $> @h #$ (@ 7#$@  c,#\` $ @  "!>  @hː ! 8#$@ `0$@#$#$@ ֐` $ @  8TP0&&c0&@  `" &a' $$    @] 2"c0 &> @h!(#$  c,#$  c,!>  @hp!#$ 㿘  @ 7 4e 21 @@c:&&L@  c,.`@c(c(  c0@0#@ .` @ 1  1   0 1 `:4 $ >$ @` $ H$ P$ `$ \$ L$ $ $ D㿐 " #    7! 7`@""88`@ @!%$ cJ6 `'~ 㿐*'P:.` c(  @& &&c( P#(`0 .` 1 `1  P`40 1  #$P#\       ' >  @g!P#$ @P c(  @Β    & @h&#$P @   7P.` (@ ` 㿘 " "    7! 7"@88`@ @!%, cH6 㿐'P.>.` c( @(&& &@ P k,c(0.` @ `0`0` P40`0` P04xB #$P#\ ( (   7 >  @g'!P#$ @P c(  @@    @t(`(& &@Ғ c$P @  P 7@ 7> `@g!pP.` (@ `Ӑ 㿐8`  0c@cFcHcJ#("-# 8`0@g @(6 `A(``c(6  dS @K> #(ق# `"`"cF!%"`"cH!%,# `"`"cJ!%$@"N( (@@(6@`  ` W @> |#( 7"Z `>  $`$`  @> $` b`` 4`&4` t @W ?@""`$@vS `#((`a c(6, ,  d @> F#(`4`$ , 7`   7` ` @5   @> `D"!&# `2I"F'sG"cH?c((!%,# `2F"cJ'ZcF?(c("cJ?(c(!%$ @f{!(?c(`@㿐 " #   ;  7! 7`@""88`@ @!% cF6 `' 㿐"`x" #&\""@c> `'""@Y""#f"`A"  (`@#&'n# `+א 7P> -# `" c@6@'" 0  # #`@{6 x&#&#'"   ?(?0(c(`0@@@ "?(`@(`@ ?0(c ?(`0@@@ @e!h> #(c<@' x `` 0cB X>> a@> > a> >   a( ;@dϒ"``6"`( (#(1(@@0 *0 o`J`M`2@d0 `4.##@d3 @ /> ''''''''''͒耈@"  . @g@%> . @g& & . @da@d\@7 㿘"@9" @``` ?`8 @8#% `@G" e @  "`2 0 ? A # `ǐ-" e @2" "? @c0((` ?@0@@ ``0ɝ㿈# ` '`i > @c"H> b@@r 0` ?c ?`0 ((` @0@@$@  @` 2B``` `#\#`   > @cǐ"@; ` 2/#\`8```D ``<` ` `@`$ `0`4`(`,"`"` "!D@ > bx` #\#`   > @c"@ ` ?0(c ?(`0@@܂@ 㿘""@?`8@8!%" f"`2"c80``#& V8 #(`0 x d j#@3@ #(0 Ԃ@ ##(B " x f(#(6  t0 ! z 0 "g @2"" ,"c8  #(cD60 ``#@ #( 0 #@%  3@ 3@!` "  3@ #(0@  !c:1 1!` "  1 #(0@  #@ 3@#  3@! @ 3@! " 3@c8 #(08 Ă@ !1 Ȃ(1 #(0 ܂` #""?88`@@#`h#(z @n# `#(  @3@  @ 3@!   3@ "3@# jc8 0z@#@!#8 #(`0@`!#$ `` $@ "`"#`@  $f0"`y"cd#&4"`"c\#&8"`"ch#&@"`"cl#&<"`"cp#&$" fd" ""@)!@!@? c" "P3@ #@ 3@c80`` ??0(c(`0@@ł@ !@?0`(`?@@ 0`( ? c)  (3`0 "cd ?0(?c0(`@@@ #&4"`"c\ ?0(?c0(`@@@ #&8"`s"ch ?0(?c0(`@@@ #&@"`g"cl ?0(?c0(`@@@ #&<"`["cp ?0(?c(`0@@N@ #`@  ?2 * c?  2 (`@@@㿘Ho&(@gh    Hp@> @aq"Hp@㿘>  @ac"HԐ @> 㿘Hof4 (@g a"3 \80a "= \@o# 0 4" \Hp@a50 a6 @=# 4 \`@ Hp@  @%) Hp@``@6 \`2  0@>ߒܐ "ڐ ې֐ eaΐ 㿘""@ДDD?"c??c  %?;?-%)"@DD@#" ""@)DD @#"""@;DD @# N<`@""@~DD @#"""@ۘDD 0((0@@@@ (`0`@@0`(#"c""@ɘDD (00(`@@@ (`@@@@0`0(# <`""@DD("""@{DD""@P "DD D+@ D0((0@@@@ 0`@(`@0`(bD(00(`@@@ (`@@@@0`0(LD ?#(`?0(  0  0() 3  " DD?0 ?# @+` @( 0(`@@@ (`(@ ) 3 0 D D ?#(`?0(  0  0() 3  sD ?(0?0(`@ @@ (@(`(1  0P㿘""@DD"""@DD"""@rDD"""@ODD("""@,DD(" >`"@ "`D>  @_d#w ` `"@*"`D >  @_Q#8D ?(0?0(`@ @@ (@(`(1  0†D ?(0?0(`@ @@ (@(`(1  0D ?#(`?0(  0  0() 3  |D ?#(`?0(  0  0() 3  YD ?#(`?0(  0  0() 3  6" ?`D?0(c(`0@@ @ >  @^#Ӑ _""@WDD("""@4DD("""@DD"""@DD"""@˔DD"""@DD("""@DD("""@bDD"""@?DD"""@DD"""@DD("""@֖DD("V "@"`D >  @^1#` ?`D?0(c(`0@@͔@ "@DD(??"c   '%?-?D@# "@F"DD0```2&@#Ԑ ``8< ""@ߘDD0((0@@@@ 0`@(`@0`(̂(00(`@@@ (`@@@@0`0(ʂDD@0`""@.DD("""@ DD("""@DD"""@ŔDD"""@DD"""@DD("""@\ D D(". D ?(0?0(`@ @@ (@(`(1  0D ?(0?0(`@ @@ (@(`(1  0D ?#(`?0(  0  0() 3  ҄D ?#(`?0(  0  0() 3  D ?#(`?0(  0  0() 3  D ?(0?0(`@ @@ (@(`(1  0iD ?(0?0(`@ @@ (@(`(1  0FD ?#(`?0(  0  0() 3  #D ?#(`?0(  0  0() 3  D ?#(`?0(  0  0() 3  ݄D ?(0?0(`@ @@ (@(`(1  0D ?(0?0(`@ @@ (@(`(1  0 ?`D?0(c(`0@@@ D ?(0?0(`@ @@ (@(`(1  0 D ?(0?0(`@ @@ (@(`(1  0D ?(0?0(`@ @@ (@(`(1  0oD ?#(`?0(  0  0() 3  LD ?#(`?0(  0  0() 3  )D ?#(`?0(  0  0() 3  D ?(0?0(`@ @@ (@(`(1  0D ?(0?0(`@ @@ (@(`(1  0㿐 / ,     p&   衐  " >  @[B# Ζ  ! @gi> @[2#H#$> a#\ #` $!    "#$ >  @[ >  @[# , @  # #$'8#\       "#$>  @Z #$ 0@#$ (@ >  @Z #$   @  2#$  @&#( ""$>  @Zʐ##$ c8#$\`&"$`& Ȅ`&'Іdh& @&  pl&&>?8`&!6 >>b&!&!!c,  `&!h&"& 0  0#&!<>>@;#"`0 0 # @" !  #@  & @  & @  0 @   0 @    @ @@`@h  + @  `+@  Bp@B`BPBB@BBAܝ㿘` > ?4 : @ *  2 @8`$?6 . , +`@ 3`+ @` @0(@ ; (8 0 @ (0@4`8, @,` @ +:`B : 3  @ C+ 3`@8` @`?  `* (㿘> .a . `8> 8 l`ȅ(㿘> .a . `8> 8 l`ȅ( > .a * `8 2  ` 㿘 8G t` C `JB``O?` aĀ 5 : -,@,` - ` `2  `=`` d,g @ d,b ` d `"-0 @ ` ,` ,`- 2Ĩ` @,``,``%b͆ Gˆ?,` ,`,`,`,``  -¦㿘   8. , ,    `" . ,  d `2  d ,   8 ?,@ , ,,@ ,, 0㿘 `O ,?, ,,, ,  ` `',, @` '0ڐ  @` "? ͐ d @ 'Ѐ`  "   @` "  @'Ѐ` >   @Xʔ& 㿘 . , ? , ,  , ,  d  `  0``o``2m.  .  `k( `"?`(`> @Ya!H`( c ?( 2O  . >d ,  Z ,  , 2 `Z"  . > @Xs XX `   & .  , 2 ,.  T, >@'TaĐ <>@'Ob̐ >@ ˒c a& l ം & .  `( !, 0``"F.  ,0. > !@X,  @`& . > !( `>  & @X  `. > @X 0> @X 0> @X  p0> @X H0 `>  & @W  `.  . ( 2c?  ,0I>  @X!h㿘 8` `> 8`9@ T3`H  `@ @ ` ```@~ \. ` `@2i `l `t`%`t |$ `l@V `l(`@` `: ` l@  0 t x`& t%& x `"&   @?,,  " ` ` & @ . ,0ސ@( <0ځ  `  `l(`@` 2   (. , (`@`  > . sa> c<('  Hoe4 t(@f t` a" | `, ,Hp@ ,> `4  @ `" @X H`"  t`& t `2 `, , `2   H`@ H,0@*!Ѐ H p@  , 2@ 0㿘> . sa(`(   `$`@"   ``@"``A2`, , -` ` `$0, -` `"+` `z`$d ?-``>  Ha t!`W  |`@$ | | $ |*-``@4  `5F` , `$``(% %  % L ` ` @> 8 l(`Ȃ@`  (, -` , |`z`"Ђ , -`˂ -`-@<-`-` `, -` , -` -``$` !?-`(`㿘> .a . > 8 8` l ( &@ `]@"i  y@"9 Czx@"9  k@"&8Cl`j@`\@ؐ @E 2Ґ   0``2`2`2`2`.  ,. ,`   @. ,`0  (. ,`0@G{@2   `@. ,`0@Am@2  ?. . ,` `2`2`2`&}  ``(`N ` `2 ` 2`D2 ``2&b   . ,`0[ @㿘 > c` . `.> ]`L>`LȈ`0   @ 0`@ 2 @   @ 8 @k@%ː <@%ɐ T l@   㿘Ho%`(@f`" ` Hp@`@  @@` $@Hp@H``` @ `Hp@ 㿘Ho(@f``  `'  @` "?.@ @`  '  @` "Hp@㿘 b  ] 8H%$Y(@ ` & & & & t` 2 ःHp@@  `` . (Hp@> > 8aܪȮ T  `   p x`& p& x @ l(`@`  8 f  @%p < @㿐Ho4 p(@f p t& x& p& tHp@> c> c> `c> c#\ >  @U%aHo4 t(@f t`a`" tHp@ 㿘> .a .  `   8 l> 8(`Ȃ@`Ho4 t(@f tb < . .`@%  t$ t. Hp@ @Zl t㿘 > .!`?0` @ @D!(`@ " Hoe;(@ 8`/ЃHp@ t>>a\$ p$ Ѐ $ Ԁ @  uHo (@f 9` t`  Hp@  f 8 @` -  -  ,- ,  - `ӈ 2 t(`  t$ t`2 > 8' `  !`  @t tp@~$ t "  t$ t ` Hp@@$ t c $ $ c> .$ a$ $ `` $ `` @@$ `% @$ %$ Ho9(@  - @}_   % % % % + V  *' ?, ,,,, `KHp@ l> 8(`@fƂ , @  %b- G `. d,g  d,b @` d `  t$ tO t2  @, @}ѐ"@% 8РՆ?,  ?,Ѫ-  0E㿘H/` /?.`.@: .` .`.`.` .``Hp@\h\p]\h\h\h\\\\\\`4`4_`$`_____aa````````abb8bpba@ccHccax㿘 @?. :. 9. 8. ;. < D  @` ! ` @` A  @` B  @` C C @` D  @`   @` A 6 @` B  @` C 㿘 0`   @" 4 " 0` 㿘 @@& 0㿘>a@>>aؐ>>b>>bL, @$`` ` ` (` !  !! ! !  ! @`` `!  @&H! `ۺ  `"! ! `"! ! `"! ! @ &D !   㿘 8 9 :(> (b) ) @@(`@0``Z(`> ` Ho,4 @(@m @@ j ;`   @ ` j @@ l <`   @`  l @` i N @` ,` c2 @` , f2 @`  d @`  eHp@ (`㿘 @` ! & 4 㿘 @` ! & 4  @  ``2 ``  ``2  8 (>`` 0` * < `  * 8``8 * ;߄ `  * : `  * 9@ ````  (>``    "` < "` 8 *` ; "` : *` 9 *` 㿘@`  (`><? &``&`$&` &`>  `H@s ? &``&`$&` &`>  a@e ? &`$&` >   &`&```8@V  `(&`<>  @OaX? &`$&` >   &`&```@? &``&`$&` &`>  `h@5 ? &`$&` >   &`&``ђ`H?&`$&`    &`&``> @a  &`(`,> @`8`D&`@>  `@@  &`X  &`&`? >  &`$&` ``0  &`?&`$  &` &``> @`X  &`(`,> @`8`D&`@> ^ `@ &`X? &``&`$&` &`>  ``@Ӱ ?&`$&`   &` &``> @Œ`P`,&`(>  @`0 &`@ 㿘@ %`0    >  @`  &`$&`&` &` &` > @`  &`$&`&` &` &` >  @`x &`$&`&`  &`&` Ր`>  @`p  &`$&` &`&`&`  >^c 㿘 @F ؀ !" &!" 㿘 < @ !@ m@ 㿘 <!@ !쀠2  @2  ?& @ V$!@ S㿘 4  @ i Ѐ` ԰ `$ @ B㿘? > .!̱6 @%s V`@% > .a&`<!&`8@ E!&`@ #&!@%r 㿘? > .!̱6 @%Q `A@%b @ (!`@ @%U@ !@\( 0㿘 @ !`@  #@2` `? ?$`@ $@` ` &@ ` &` &`   &` $&`  x  &`$$@$` @$́ &`$ &`$&!@㿘!Ȁ  @ @2  @"   2  ` $ @  "  x     @` w ` @$ ` r 㿐? 6 > . !@$    @  Ѐ`  @ `@$ @ X$ Ф ؔ    #\> @G2`@G+  @F  2 @ _@ ?$ @$@E  0㿘 4 @ P  Ђ$ Ԁ`@ (@ @ $㿘` ` !@ 8@&` @ @ԑ㿘? > .!̱6 @$F  @ # Ѐ`` @ &  ??@ Ζ !Ȁ`2@$! `? @` "@"`  ,!Ȁ`"!@`&!@ `? @` "@"`  ,!`"  @`&!@??@ @ ߐ Ԁ`>  Ԥ` @b  Ԁ`@ @D @ ɐ@ & А@# > > >  `@Nm"(㿘!Ȁ @ @2 @" 2  7   ? @ $$  `$*`F @"`(````" "`, "`, HB  "`, :"`,``4  / &!㿘? > .!̱6 @#~ !@r @G@  @4 a@@$ @: @#wa@$@@N @'@#ev@@#\R@@#S @ @#H @ @@#<㿘   4` x$ `@ `Ѐ`"$@ Ր & ,@ `@> @L  & ,@aĐ$a @@ $a@]a耍 aԁ@ Ԑ ` > a @X  `@ @c㿐> @La В @ `Ăaa&a&a̐aԒ &`&a@ &aȐa@  a> @Œa(a>>|@Jl!> .a6`R6`P&`` `0&`&`d6`>'> # @&Д&`㿘> p`Ԁ 2 0  * `" @  2  Ho$4(@e  Ȁ  ̄? @" Ȃ " " Hp@   Ho$(@e" " " " Ȃ?" i " i @#iHp@8  c " )\`#` `!`") ((@") \@  @ \@  (2݂ 耢 2 \ "   \@ 2  X  耠``   p(((Ꝃ ((꜁   p(((ꐄ  ((ꝁ ``?!?  2  2 `?  `'`   !)!)!)Ԛ`d c "`)耠`   9)Ț`d!)ԁ`    9)!)Ԅ  !)9))`i>a("㿘b? "4"c @ @ `9i\b ! " #((`(@*i`Xb&b`,`(0(` @&b`, ( 6b6b&b̒`@ "* 7"耢``@ 2` b@ "b``` `b`X&b`,`(0(` @&b`, ( 6b&b6b`@  4 5 6((`(@ C2"`0`2`X"㿘b? ""c@`i&bi\`<`=`>`?`;`8`9`:*) +` @ ( 0&bē*`+ *   ( &bi\`7`4`5`6) ((@&bi\`#` `!`") ((@&bi\ 4 5 6 7((`(@ C"`0b`" 8 p @|bi\b`@ @v ``&bb`i\ 8 9 < = > ? : ; **((  +`(`, @ +*`* @) + @ O 0b((@ 3`+`+ @@3`C+`+ @ @@ q+C c @ 6bi\  p@'bi\b`@ @!  @2  &b@"&b `  , (0(` @&b ,?( &bĄ   &b&b@bАb @ 26b6boi\㿘    c` i\ `#` `!`") ((@@ $ b@ϔ &b@&bā 㿘)\  &)&)Ԓ`p @))@" &)#`   >@na$#``?㿘> Y cX @Iz  2 㿘 \ ((`(@耠` `$`"`` "```Rp`>  @IM!F? ++ꒂ ! +++ꗁ p`> @I9!X` (`() @@ @>@? `$@9 9 @ @ ? \`;`<`=`>`?`8`9`:+ (( *) +` @@  ` (`(@@>@` ```````` 0+`*`,2     @ @ @ @((@@4`** @  , ,`@@>@> @I!@x)\) ! " #((`(@  @``2 @ ) @X #(@ X4( ` ܂@@ 2 ( &)p> `@II!> p`@IA!㿘`@``((`(@ > @I.!㿘`>:*#@ϫ 1> @HW"㿘> 7cP >  @ Ԓc@*`:  @ 4/t@ "(  @4't@",$8  & 8`"8`2 8& p*$ p& t*$ !*`$*$@<*`@ ( t`2  @(8t`2 㿘 $@c` i\)\` @  $  2 *0:! tt? @ p t*"*p t"*p! tt? @ p t*"* p t"*p! tt? @ p t* " )p t"*$p >`p  2 )0! ̄? @ )" )Ȁ ")Ȁ >`p 㿘!> p Ԁ$@"@  22@2  ?" @ߒ  Ԁ`> p `ԁ$ ԝ㿘 )쀠`") **   * "@* *&)))&)&)   ), ,  @@(`@F `)*` 㿘!> p Ԁ @20@2  @ ""  " $ ԁ`  @א %               #l#p#\#`#d#h#t#x#|#### %> @FH㿘Ր> ``> @FՐ"@J > > c"@F͒@B 㿘)\  @> @b H  > @F    ((`@.5>  X@Fx 㿘 @uf  `?`@. . 8!> #<' @@:@k > @&!㿘> 7cP >  @ cX```p&`p*&`t* '*)X7>9`D@- 㿘 `4* ʐ  @   $`  >(`DX> c<' ` ` ```  - (>   :@ݐ `//// //\ `@@D\ `H@?\ `X@:ڐ : 0@!㿈> p`> <' `;''!> "@  2 "@c`"3 il2- "*  @ ` ` `((`(@ 2 ", `( @k@ 2 ` 1  > $ʂ@0@Y"㿀> ` `!`"`#`(`)`*`+c<' + (( *) +` @@ `** @ @ (`  @_ " &    (((`@" )ݐ)@  2>   ((`(@```V > @F$"@- $@    ((`@* @  @  @   @  ((`@`* @`@Д  v>    ((`(@`(`)`*`+((`(@  Z> ?, , , ,     ((`@  * @̐$@    ((`(@  X   @) (`(@00+`+@+`0+`    @) (`(@)00+ + 0+ +  8, , , , ?, , , ,  @E}"@W")\`)h> .(`H(`@ @ @u 6`6```'|`6```'x ` ` `((`@ ` `,`,`+ | ` ` `) ,`0(,`00,`,`+`@ @00,`0,`,`,`,`,`֔ ` `! `" `#-  ((`@ `  ))  \ ` `! `" `#-   ((\ `@@)l 6-   @  ` ` ` `((`@`*     ((`@*  ````) (( @Ӥ ` `! `" `#-  ((` `@0  )) @1  X1 1 ` `-`'-`$-`%-`&O \`@ 'x ` `! `" `#-  (( `@@դ*`  @{ x* '' @6 >  h@C#X !$ X>  @C#>  @C#(㿘)\  c r+ +  a m+ +  M A++  R C+ + + + +  + )d6+ )e6+ )f6+ )g6`+ 6`+ 46`+ + "+ #+ 5+ 6 + !+ 7+ 0+ 1+ 2+ 3+  +  + + + + + + + + + + )   A      F"()&>(h &X&@o 8H )`(8#@2)` 8`0``28`0>)>)怠(؆(ަ㿘>">:ax0&*&*>>"`H&*&*>>9`H&*&*>8>c&*p&*l&*h&*t&*x&*&*&*&*|&*&*`-` ``C`c` ` `@ @3ɰ  @Q @"n @, @  @@ 㿘  4 `(@c   *4$ *`"*@ 4  4 > > >  c@C(㿘 :*t`@) ")\@ )\ ")`@ )` ")l@ )l`" @ `@ @ݒ  2@ `(`@c > c*@V @ʁ> >  c@CX.)㿘`@ >'`0 ``  @4 ` @?@ `@֥ `2 `&@㿘 K*` > &* @  *``?Ho4(@&* @ > )p`!> ')p`)t` "В **@ @ #2)p `2))X @#THp@e&*  0 @+ 㿘 c   $@㿘 bd c `)\ p@ d*x`@ 㿘)`%> `` ```h @ΐ "`@A@ `` > b 㿘*(@ *  p t t t? @& p& t*X`$*X@ $* p㿘Ho$4`l(@e`l`2 `<2! ̂?  H `< Ȁ &`@ȃHp@  x@Ґ`<&`<&`@&`*(@ s&`p*`p&`t* *X$*$*X@ J> `@Aϐ (㿘 )`"*  ,&*X, @Ȑ"**&*&)* &*&*&* &* &*$  ) "`` x  <@@4" <@f@㿐 4'L'P'T@d'XL <'  @㿘 bdc `)\p@ d $)x , , ,,  >  ˒`H> c<@' >```0``\e``e @*?  ?@ 1> ` `h> ?``0 (``?@@`  }  C?@C  >`Ӱ?`>`Ͱ @"0㿘  @ &)\)h> .qH.` @ ) &) ) @)h(`(`@@` T )  "` @2 ? )?  `&)쀠 `*`) * `@ # @2"# #  ))*`# &))`   ) @`` (( @қ &)`> ` > ` 㿐 4'L'P'T@J'XL <'  @㿐 4'L'P'T@9'XL <'  @㿘 0`> 7@c"X>  bx#` @I@赐"#  @ђ "$#'D!@\ @:(@ ^E>0@++  @ 'p p'l'''t?''|'x''p` p'@ @pd+"" !0` @G 2Ґ̐!  "@@9DtȒ`>  @?!D> ` @? 㿀>  c<b'  $Sc\ p @4  > b'耤 '  @"  2 " (` @>  a8 $@]  # \````) ((@b)@bȀ(bڠ > @B"HӠ  ~ @gbȮb¤  @ @ 0>  a`0b̒ a ~@Fb̤b 〥l`2@ ` @   ((`(@ 2`. @"   @)$@** *  * @?((((l$`\$l ( ) * ++`(( @`) +0`0`) () )0`) *@   ( @Ӕ 55, , 55`, , , , 5`5`, , \ ` `! `" `#((`(@6 ( `*``\#\ ! N`\#\ x P >\ ` `! `" `#`((`(@  鄃*``X`Հ``2 ` Ѐ` ` ` ` `) ((@`0`0`+`0`+` +` +`   "/`h>  a'>  ڒa!>  aӠ ``(   `\㿘"> `!@= 㿐 #\  㿘)h`>  b  @F ) &)\ @  @ $ $ $ $ $ $ $ $ $ $$ ($ ,$ 0$ 4$ 8$ <$ @$ D$ H$ L$ P$ T$ X ")\ \ 2 $㿐 #\  㿀> c<@'   @ ")'''쀤`'PTܘbCm       `\ϖ ϐ       ) (`+ @+`((   ``2`\`c ` >  b@2  $ % & '((`(@$`` < ) (`+ @+`((   Ƥ@U   ) (`+ @+`(( Z   2`@(` "< )`"8 `\]`>  #bX ) (`+ @+`(( 3 ) @ X` `\9` "   @ƒ > c<@ #> @M`>  ibX@2)р`>  ^b0> >  Xbxڐ> @<"@Ɛ"`㿘7 @9   ;?5> 7`@7``@;כ`a>  c<@' 9)耠`^`>  #c8@  u> )\`#` `!`") ((@> )X   , @ `X`  >  cP0Ԑ>  b0Φ `    0@ X"0  )  @:8 >>  @;#x0>  Ȓc08`0  @ؔ? 8 e<`e @)? >8`0` @Ҕ?8@[ 0@"xd> ``>`(`܀> c>@@`  }  C?@C *?00$ 0q0> @c0( ( @`o   > _`8>05- - @> cP>2)\|(`(`(`(`(`(`(`(``~ $`\8$``)\ 3012) (`(@@$`$@@&`0<`0<`()\  b`8 HU`H* @7  ")\> aZ>4@0> p> `P&*>  @!0՝㿘)\ !"#(((`@) `X`  ``X` (1> `p@: p`b@b耦m`@ d@&@"_)\`p>  @:h>  `+> 'Hod4*(@ e* <2 p" p@Ȁ p2<* <2 p" p@Ȁ p2 `h@:1 @~@:)\Ho$,(@`4@ѓ@/`<\  bb&b@2 ?&@| @RHp@@JeӢ`4&b(@> c<@'  ”   >  `8@  > >  a@0@ f"@R( >>  a`0(`0  @? (@ފ( `װ (>`0` @?@}(0 e,`e @7? T> `` `(`̀"> cԂ  ( @ʔ?@T(˂ @@` }  D?@D  @4 " \(" ` @} h?==(=0% %@}y 8 HH   %X@  c r.` a.`.` m M.`.@ A R.`.` C ` .`.` .`.` .` .`.`.`.`.`.`.`.`.` .` .`.` 4`.`#.`<4`4`.`=.`>4 4 .`8.`9.`7.`;.`0.`1.`2.`3.`4.`5.`6 4 .` .`:.`!.`".`?`@> @}$b !> `H!> @8  `X> @8  @˼*Ȓ!"")\")h") @}    $l@ˮ $"%$$  +"@A"耠`2`.%`2% `"`&"@   ` "@, @) `" (@# (> Ӓa @ 〤&"㿘b`9b;?b 0 c@ %&!> a )"> b\@ *\@"*`> a؂ bR bj @   )\p> ua `> c<'  )h') (`@+ +`(( PTbC" >  Eb w> (> .(bH  ">  +a0ܘam@ސ `V`@{  2   ((`(@1 >  bP 0>  b00((`(@    .... .. . X.  >  @7{ 0((`(@  P....@ ="> c<' @Dq?@0`2 `? )  8 * @  >> b  8`0  @? 8@A8  e<`e @? h 8 @? @,8db֦   @ *Ȓ @ 6`'@`'ih(`ܦ ܀p `2 ? (`@ߵ [8 @a? PՖ Z ` ` ` ` @ ` ` `) (`@+`+ @(( PTbC 8 @G?@88 @??@8u > @ "ܘm@8 А 28 ``* 8 @?@ۧ8> b@8 `I@3 0E> c08> ߒb0; >  ؒb뀤` @w (  @r  $$  $ $&㿘  @a )h> .(``H(` Y) ! PTܘbCm` )l\  X`  \@ " ` $ X \@֒ @ђ  ` ` ` @ ` ` `) (`+ @+`(( ͒ @2  \ \ \   @ q)\  Ĭ?h> c<' XU>> .`0H  ?к̸4  @Ԕ G " $ ,@?$`\ $`X A Ē@s * @? )`h@y $`` `"ߪ?` (@?"˪"ʦ˪?)" &)> ?ߒc`0@ڋ?0> @ L"p> bc<@' $H  @m :bb  @b*Ȓ "")l > @# $Xbz tb0`0$造 * 飐 "` АH>  c bb Ȓ   / @ W/?G$hb   b` 5 2$\ ? ".b\b`7`4`5`6) ((@@ Ð>  =`>  7c>  0c>  )c> @"N$bh`  $d鈔 `2p鐀  > b`p@ 2u2\b  ((`@( @ + 00+ + 0+ \b  +`(`(@  ) 00) ) 0) "\ꄟ耠`1(@Œ 4>'>'@苖` !`2 !$$0` ` ` 4#, @ @$c "#> a$c4  \> pap1 `#" 0S kd` > \pa0\ `2gpl "lꌀ`@ " 볐  2l`S@ ƐLp>  D`@>  =``  > `2@y 途 `h@x# p|@ A 耠` $ > @! $ \ ؐ > a@O > aPlp@쟔  , ?@\L p`,`44, 0, 14, 3, 2\ @wԐ p\p> Hb  "> b0\p>  a9 p@wД  у4> ǒa\㿘 4@ <@손0b @"e00b&@"P100b"@D0b!@< & L"Ő@ʥ b%@@($Qb'@    & L"@ʊ b(@ 0b)@Ղ ,耢 a݂@`8˂  ݀ o؀ r Ӏ ]΀ vʀ Iƀ 2```B`u@ `v@  ->5` 4㼈)> "> 'c<@' > > bPX   $@&@"#2~  @ş  "  $$`$@ @w   "R $@w  "K $ Ӏ   $ '$2 $?$$ $ % & '((`(@$ 4 5 6 7((`(@?5  1 X@v  2 T P`"p$$` i$$ $2"^$$$$ $ @`]$ @$' X @   `7`4`5`6) ((@$` `3`0`1`2) ((@$``#` `!`") ((@$` $`P`$`T T2"$`T$`T P` T$$$ P$$ @ϔ  ƒ @ɔ   ς"'쀥> 2T`2T  @İ   P'`\ @u`h`;`?`<`=`>`8`9`:*'@'`* (( ) * ?` `;`?`<`=`>`8`9`:+ *(( )  +`@ ?`(``;`<`=`>`?`8`9`:+((, ) @* @u?`0  `8`H H @'`X"耠2G'``2'` "`@ȹ&"T2~>  <b''Ь  4'" ?'C퀦` ? ( @ `P`29`[@$@` `@14`(@(@@(````````@+`+ (* ( ) @@  @ @`$`"'`(`@Ȑ@`"@`````````* *(( *`)  * =@`$`2`@> @0#87 ('7@H'@ )@'T2nP T  $@3 @0 `2@* 2P`  $@ @ `2    $@ @  `2 2   @   @ `@ > c<@ F> Ք"$`T @s  2 $ ' $ 2 ` :B`$J``?T>  b`q '{' > @09" >  @02"&"@ΐ"  (  % u' > @0"X'㿐> pЀ`" А`4> @Ƌcb> @Ƈc> p `&b>5`@递` > @0# @t%c@b> @/ Ђ!6c6c> .b0 &cch.cq'&c > #@ > &c>aܒ x> 7>&"X@͔&`0㿘Ho$(@e  "&)t> `@/#&)tHp@㿘Ho$4)(@e).`@`X" " `XHp@)@)\> `p@0V#*@>8&)tD  @ Hp@㿘Ho$4`l(@e`l` `< &`l@/ Ȁ &`lHp@> `@0 㿘  `?Hod4 (@e > $)p0%> '*XВ (`@6" #2*X $)pHp@@ΐ)p 㿘  4(`@ c "`)x`2R)\`xHodF(@ l`2  <! ̂?    < Ȁ $ @ȃHp@ @r x <$ <$ $$ @ $ `@`%"L*'`5`".*a``"Q*`2**@ 2*_e l> `p@. `*` &`,M*`5``(`*2**@ 2* *`4&`,   @rQ/뀠`7`*@ 2*#*@ 2*@ 2*> @. 8 &`,`` 2***@ 2**@ 2*2**> `@/" h > c<' \`<`=`>`?`;`8`9`:( (*@ + ) +` @ @`%3`   G> 'ԇ4 /ԇ4 '؃, 4 /և4`@'܉, , //؂ 4`4` /'''''///ߐ////ޒԔ 粰 0'̀ 'Ђ?////΂ ///Ӑ/Ғ̔ 瞰 04`4`4`////@#(')\> c<' 89?<=>:;ࣕ**`(+ +`@*(`, @ () < +  8 3`@@   C  `  ৃ+  ` ?3`@; ?<`* :2'Ė 2B:*   > ` @-   @ @(; Ȁ'؀7`̀@ 81`Ȁ ̀ 0e((@ 3`+ +`@@C3`+ +`@@ @ TzC c @ Ĕp> @-N  @ @( 'ؚ`5`E ?-  '??-` j4`'''''Ȁ@v@ߌ ' } @߅ ''ܒ  |@p̐x('؂ '?'/3`'/ʅ3`'/Ʉ(0/'/ę3`,` 0`0`0`0(`0@-/'/''////Ƈ(@'// x` j ? [  |?@p/M/P ?'/N/C/O/E'' /F/G/H/I/J/K/L'(C''`  @ ` *@ 2 `8  Ho$(@e p*$`p#`t*$ 9#*$ Hp@ ` >  @x `@ݽ@ݺ)\3`) ) ) 3 ) 3`) 0) 0) 3 ) i\``<`=`>`?`8`9`:`;```````* ((+) +`, @+ *,` **`@  @  @0g((@ 3`+ +`@@C3`+ +`@@ @ S9C c @ Ԁ ȀV  b'`<`C ?膀@`C ??ȄC? Ri\(`(`(`(`(`(`(`(`i\# !") ((`@@i`Xg `@Xa`@ *`  b@&5@ @#j̀ `@ '> `@,k!i\> p@+!'m̀ j0  8f@{̀ 2 >  @ > @+y!P> `@+r!p؀@  @汒  "\ p> @+X!> @,!0` ㆥ   " >=bt"*"*p>=>=̂b"*l"*h>=>>H` * "*t"*㿘)\@` `!`"`\`]`_`#`^+`+ (( )  *`@@ V ,  욐&) 㿘  *g 㿘    㢐  )\ `\`]`_`^((* }?$ 㿘  >   ch > @oc)\ (`_(`](`\(`^)\ \ ] ^((`* @2 >  @ R2`, <2`2`, >2 , ;, =, ?, 92 2 , 8, :)\@`\`]`_`^((*`@@ V&  $* &) h'D 'Ԑ> # )\  \ ] ! ^ " # _+`(`+ @ ( ()   ? '̅2`(` *` à<< @ Q֒`$ '  'D*` 4)+`@(X `)  (`  F?ؠ@@ Qg̱*@ 2`8*0@*@@خ@ЬD<f4@ಀ@ "j)\" <" 8" @>?@`" 0" 5 " H-@" 4" = >" 0" p" ,D 0" `" @ (`@" 0) 0@  \" D)@``" p` p" " D@ " Dd`@ O `@`E 4:D4@D4`9-`D` 4)`X@'쀤ݬ )\p`>  @)# , 84@(@<<@DD4E  ˺ خǬeqmHo$(@;D Hp@ e*D D0㿘  @Ho(@e 0dN &  0`$ 0 ( 4`@ <$ ( ,`] % ,% (j`O``K2`p pX t t t? @ 8$ p $ t p M!  t t p t? @ 8" p" t羐ip`jX`@ƐHp@   4`> @)# ,`$ ,  "& j@  (`> @( ђ% ,Hp@$j p t$j$ 8> @) d<P8DD  * >@c$" "*p>?>@cl"*l"*h>@>B` "*t"*>@>@`"*"*"*)\`#` `!`")  ((@#)㿘  l`2  <%@! ̂?  ܮ  <  <Ȁ $ @$ <$ @ $ j@ 2 >  8 2 l> `@)B H@)@ hx)\) ! " #((`(@  @``2 @ ) @X a(@ X4[( ` ܀@,` `  耠` `N   * p> `@(!>?  8 (@ `'" -&)  *  8 (@ `  8 (@ ` 瀣  8 (@ `&݀ > p`@(!5>. в @ > @( 㿘  ; 㿘  Ґ  v 2 㿘  >  ` > @k`)\7 (<7 7 (=6(>(8(;(?66(9(:&) 㿘Ho$4)(@e).``X % ++ Hp@)@)\> `p@(L#`@ X*@ >8&)tD  @ Hp@>?$`䀣`@`"@`&*`@`π`@㿘  @Ho(@e 0da  ,`$ ,  & j@  ( 4` G$ ( ,"Z$,$(j`s `o2`p p t t t? @ 8$ p $ t ,`} p "  t t p t? @ 8" pv" t R`P ip`jX`@Hp@&  0 4`$ 0 (` $ ( ,2$,h1  > @&Ő ֐ l`A <$ <$ @ $ j@ Ԃ $, ``@Q$ 0ʒ > @&  2@Ӟip@@$ ip > @&! $,@ӎ0>  @'Q  8$jt p t$j$ 8@> `@'A 㿐>  8 m)\````(()  @?h\ )\`#` `!`") ((@ |& 4> 0 73 3 ")\`>A$ 0$  0@$ 0< $$ <$$ 8$$ @ $ 4$ H$ p$ ,$ h"*))\ ) ` `! `# `"((`@*`@@ R5 * % `Xd > `@& !H   & 4`X (@`If` 0$ 0$ ) 0@\$ D)``$ p` p$  l`` $  @$  @ & @`Ho$4 (@e ` ` ` j 8Hp@ al$  @$ 00p(@`2 ` `A" 0@$ 0$ `! `" `#((`(@(p` 4ٞ& 4p`>  @%#> `@&A!h  " ")>D>Cb4"*p"*l>D>DcH"*h"*t>C>Fa< "*"*>E>D`Hp* "*"*"* *2 :     @   >c`x  >cax 㿘`*> > ax> > aТ  @%,  2 @%% `Z@ .@%  2 @%`@ 㿘 \` P`Id>$  @>E$ 0a;$  0 @$ 0 0< $ 0$ @$ H$ <$ 8$ 4>`0`.`$ , 0  `\@$ D`$ p$  p`" p$ h$ $ $ $  @ $  @  4& @`& 4$ 0$  0$ 00{ d?㿘   ! ̂?  ع  <2Ȃ <& <& @ & *@ 2 >  8 2 <& @@%R hx)\) ! " #((`(@  @``2 @ ) @X d(@ X4^( ` ܀2?!  0   < "1 p> `@% !2 8 (@ `%"&)`ߘ 耠`ۘ ؘ > @$ ֘ 8 (@ `&2&)8 (@ `'2&) 8 (@ `2&)> p`@$ɐ!㿘  T 㿘    ܏  )\ `\`]`_`^((* j?$ 㿘2  `0>  a@g )\ (`_(`](`\(`^)\ \ ] ^((`*@2  :  @ Kt 2`2`, <2`, ;, =, >2 2 , ?2 , 8, 9, : >  a@g )\㿘Ho$4)(@e).`@`X * "9`.  `Hp@)@)\> `p@$0!Ѐ` `X*@ >8&)tD  @ Hp@ ׀`耣` `X `X㿘  @Ho(@e 0df &  0`$ 0 Ā "  H < `2l H ( 4` I$ ( ,w"j$,$(j`^ `Z2`p p t t t? @ 8$ p $ t ,` p "  t t p t? @ 8" pj" t >`f ip`jX`@{Hp@ > @"ː" ,`$ ,  \& j@  `" ( H <s& H > @"  27@Ϥiph  > @" ֮ <$ <$ @ $ j@  $, ` `@,$ 0 > @"! $,@{0@$ ip| 8@Ӿj4ip$ji p t$j$x 8>  @#* 'D ''>  ''' z'\ `\`]` `!`"+ `#( *) +` @ @ `^`_'` '`$'(HD ! !  ?` '  .ȃ, C??F< ?'4` @'C??48 ', = `, ? ?''@ I\@ ````) ((@' `  @@ IB?Ѐ` @ I7 f?ЀHԮE( @D J , 'D'   @ 0 (@N8 @ Ij膂@ DB ;` i-P`X > !H@!`*4@а 0`.8c0@(( @D 40@, @ D,''   @ 0 (@8 @ ID;`膂@ DB ;` i-`X` = #\#d#h(#`# Ԃ #`#\#d#h #\D#`#d#h #\  #`#d#hD u@fi@@G`'/ (@7@ @ '?' @F4 '> "0@ ڒ` (@` `A=#`#d#\#h> @ "Hܒ @do   !D( #\#h#`#d <耥8@܀Ho$4(@e`D  8`8` `8! p !  p*$! t*$ @#*$'DD `` `  DHp@   * "   "*?? !8hX>Mb>K"*pd>Ob"*l"*h>I>O`"*t"*x>H>QȂ`"*"* @ ` ` `((`@(   `, 㿐> ֧p  ` `0  ,i\````(()   @?& 4 \>Q`@" 0" :  $" < $" 8 $" @ A`0 0`4" 0@" " H" 4>`0`" " ," i 0 `\" Di@`" p` p"  l`1 "  @"  @ & @Hod(@e` Hp@  0 @" 0 " H0i\@p`> @#`@> `@ W"㿘 8 0` <`@$`($ `( @$`(@缁㿘> 7cP >  @`$`( l`" < "  Ā "  Ȁ 2 Ē)p`*X`@> `@ "㿘 , 8``8  ,Ho$ (@Hp@eHp@0㿘 O  0 "@b  0@ >H׍b(X?@(X@ ??<?  @] $ 20"  ? @ <$ $ @l@ 0 4 <@d 0@_  $   & (@1 à(X͢ 㿘"Ȁ` "Ѐ`"Ā`   @ "Ġ" " "İ @a@& "Ā@ 2  ` ` (8 `, ( hh `2h4"Ă &"   "ĝ> c<'  '4_'8Ү / ->  `8ݟ  8`@ `@ޒ @ے  2@`@Ғ 4 `@> @ے4 >4`0  @څ? 4 e<`e @֘? d`(`܀d  @   >  c0F 8`0` @c?@40 Ƭ   `4 `5 `6 `7((`(@?c  @Ȑ " \4" `" "  \`Y588  (4"#"@  n    ((`(@   7  >  b Q )  >  b C @  > >  ``Ӭ 5  4 @?4@y  * > b$8> @1 㿘 , "& 0b"!b & 0)\ `#` `!`") ((@&) ")\ ")\  ``bЀ` bĀۑ(h   #&b̝> c<@'  %s  > f`8 @ A> @ž8 >8`0  @g? 8@  8>`0` @e?@80ڔ> :bհ  e<`e @٣?  d>  &``ܰ  8 @C?8@̠ Ұ `(`܀  > bİ   @ " \8" ` @` h& & \`7`4`5`6) ((@ && & (& ,& 0& 4@` \  # 8 H H  & X@~  c r*  a* *  m M* * A R* *  C * * * * * * * * * * * * * * * * * \`  ??,`6,`0,`1,`2,`4,`5 ,`7,`3,`# ,` ,`!,`",`<,`=,`>,`?,`8,`9,`:,`;`@> @`b!>  #`H> @.  `X> @(  @**"#")\")h") @`w   &il@ &i"& 4 @K&i  @   @  8$** *  *  8((((`۔ il$i\&il ( ) * ++`(( @`0`0`) +0`) () )) *]  @~ `  i "@u  @q `ܐ@l ـ @ 8> a  @^ ܀x'> <' ؒ  '''''@_'''''''''''''''''''''''@'ܔ@?@o@֔ @Β@@^ @^ @^ ` > @6 X㽰 ?@^!!@  "   @@@ @ @^r!㿀 ,> c<' )h )i )j )k((`(@ (4 @^W @^T  ,>  ! " #((`@+  h 4 (?ߤ (O ,)p @^ "Ӑ(@^& ͐@Ð p> c<@'  ?? !8hX >  4c@ (X Ӟ  >  c00> @   >  cH0ݒ @* $& $'& (  @ @ "͠ @*$ ($  ( @& ( ( $ @|@$ <@ Z$ 0 <$ 4" <*@ߐ @ , '''''''''    ((`(@@`N` "')\`;`<`=`>`?`8`9`:*) +` *`@+   *0  (@y  Ѓ, `4, 'ܐ(X@3   , >H >b0_^ (X?b(X@ ??>?  0K!'ԝ㽰 ?@]E!!@-  "   @@@ @ @]-!㿀 ,> c<' )h )i )j )k((`(@`(` @] @]  @]   a>  @ϔ  h ,`` `!`#`"((+  Z(?; ( ,)p@]j  21 ! " #((`@+  h ~(? 4 ,(ik(ih(ii(ij (ژ ,ip # @\(@(  > cHӰ @D > bc<' ")bȲ|@ @\ @\ @\  K> bȀ`"|bĀ| ,׭(h ߰ |@ߤ "ٲ|bĀ`ղ| ז '| $@`ʤ ׉  ` } 2  2 Ԍ @@ِ 㿘 ,  4((((@G( , (` (`#(`!(`" ,(4 ` `! `# `"((`@`h(+ ǘ  ,(ik(ih(ii(ij ,)p($ @\( , (`(`(`(` 㿘 >  ch  @   @)$* ** *  (((?()l$ &)l)\& , ( ) * ++`(( @`) +0`0`) () )0`) *& 0b7 0be *& 0 `& b` b > @\̒c)\4(<44(=4(>(844(;(?(9`(:&)  "b bȀ`&b́ #㿐 '' @Ӑ $    ? && @ঐ  & `$ `2u `   `` "z```"``$ 8`  44 > > `@24 0 `< @+`0`2( 0@hX9  0"Y`$   0  ( 0 4 0<   4, $ $ $ "$ $  ,````) ((@``"$  0 < $  e @? 4 l؃, !$  < @ ` Q`$`` ``````() +`   ?2`$ <` ```````` 3`(*`,2        + +`@  4` **   , ,`@K?```()   @?' ( > >  c@!" 0& 8 8@߽> @C#㿘`'   >I 0al @Hof4 0(@g 0@K   0`,Hp@0 㿘 , 8`8  ,Ho$(@eHp@ 㿘  @Ho(@e 0dB &  0`$ 0 ( 4` $ (Hp@ ,W % ,j`:> `62`p pe t t t? @ 8$ p ,$ t p Z!  t t p t? @ 8" p`" t  `> @ِ# ,`$ ,  D& j@  (> ` @Ɣ h ,`@Hp@% ,0 %>Q 0ah @& ăHo& (@@ 0Hp@0g0$j p t$j$ 8> @P > @M O NOOO`O *2 :     @  㿘> q.>cؚ@   1 1 `1 @  ((`/`&`@> q `(`> p+`؂ #    (`) (#(` 8`(8!8``""؝㿘  . & >U>U`p&*p&*l>U>UaH&*h&*t>R>U` &*&*>U>Sb0&*&*&* > p* `@> q؄  `* *`> p > q`؆㿘> q cء. @ ! @ $@ ?> q> p`ؘؚ +` @@ @( `a+` 㿘 \`hlɯ ^`^d L$  @>T$ 0`P(I$  0 @$ 0 0< $ 0$ @$ H$ <$ 8$ 4>`0`.`$ , 0  `\@$ D`$ p$  p`" p$ @$ "p  @U "(" " p"$ $ $ @ $ @ 4$@`$4 $ 0($  0$ 00x` ސ ?  d0l?㿘   ! ̂?  \  <2Ȃ <& <& @ & *@ 2 >  8 2 <& @@ hx)\) ! " #((`(@  @``2 @ ) X _(@X4Y( ` ܀*?  `  耠` E   * p> `@!>R 8 (@ `'"&)  *  8 (@ `2&) 8 (@ ` 2&) 8 (@ `&2&)> p`@q!> @! >  a),`@X@`2)> @Z!(㿘   Ho$(@e 0dw &  0``$ 0` "` H <` " H <@@ߒ &  `2o H ( 4` L$ ( ,z"$,$(`a``]2`p p t t t? @ 8$ p $ t ,` p "  t t p t? @ 8" p@" t y >`f p`X`@۷Hp@ > @" ,`$ ,  `& @  `" ( H <& H`> @  2;@ph `> @ِ  <$ <$ @ $ @  $, ` `@h$ 0`> @! $,@0@Z$ p]y 8- 8 @4p$b p t$$q 8> `@b 㿘  ` & p* p& t* !* <   Ȁ  㿘  ˗Ԑ 㿘  k    )\ `\`]`_`^((* ?$ 㿘  `> @Wqa@i\ (`_(`](`\(`^i\ \ ] ^((`*@2  :   @ : 2`2`, <2`, ;, =, >2 2 , ?2 , 8, :. , 9 $i 㿘Ho$4)(@e).`@`X * "9`.  `Hp@)@)\> `p@!Ѐ` `X*@ >8&)tD  @  Hp@ ׀`耣` `X `X)\`#` `!`") ((@+``* ") 'D ''> <H'''p 9't\ `\`]` `!`"+ `#( *) +` @ @ `^`_'|` '`$'(D! ?!  ?|  ?'l| ) C??@, `?C 4` < @''ȅ5`C??-  |l'ĩ-` =8''''h|9 ;`''@ 9e\`  @```) ((@'@c Ԣ @ 9 @ 9讣@  c E@`E 4`E +` @lG `h| D't,@'pp`` @ 0 (@8 Ȑ@ 9@ DB ;` ??鄖 ?   (@X8 (@`" ^ _@ g@ ?8  J`h ahɀ> > Ḓ> @!Ԓ @UOM   48D( #\#h#l#p#`#d  < &`3?l@C?Ԁ@'h|((@1 @8 ''2(U`+` @lG `W|h4`|0@ |,,@ @D'p'tp`` @ 0 (@Q8 Ȑ@ 8D;`@ DB O;` J???`hm ْ Ԓ  > q   yԐ> q > q` @#p (#\#`#h#l#d% Z( #\#`#d#h#l#p I( #`#d#\#h#l#p 8#\D#`#d#h#l#p &#\D #`#d#h#l#pߚ #\  #`#d#h#l#pD͚  *4@װ 8|`|3`8+@0 @ݐ4 '> "0@q` (  @‥2Ԁܠ (41#`#d#\#h#l#p> @B!X> q9 Ԓ @SD( #\#h#l#p#`#d` ޠ   .1@3@ > q ( #`#d#l#\#h #pD; q < ܆2(֒Հ@쀥Ԁ@ > @ݐ! > q  А ֒/Ԓ @S~D(#l#`#\#h#p #d (D(#d#`'#\#h#l#p P   68@:@<> q`  #l(#`#d#\#h #pD  < Ն2(Ѐ΀@쀥@ߠ ݆ ֆ φ Ho$1(@`D  8`8` `8! p !  p*$! t*$ @#*$'DD `` ` Ɛ ȔDHp@ e  * >Yc" "*p>Y>Y؂c\ "*l"*h>Y>Z`"*"*t"**") 㿘  ? 㿘  ֐  z 2 㿘  >  a>  @Rb)\(`;(`<(`=(`>(`?(`8(`9/(`: ))\,  `< `= `> `? `8 `9 `:((`@ `;(*)  0+ +`<00 +`=@+`>00+`;+`?0+`8+`9 +`:.&) 㿀'DDD@ '>  2)\` `!`") ((`#$3 8`@(` ` D'  4  + )``1 (  )     ))\-`X) (`(@`' d @@d4i@" <" 0" 8" @>[a<" " 4" H(` @E 8 (" 0 @" >`0`" p" ,D 0" `" @ (`@" 0) 0@  \" D)@``" p` p" " D @ " Df `@ l `@D 4D ` 4쀧 @ y'쀧 P`   @@8 @d1@    @ e E-@ ``) @ 1 (  D W2@ @Q@ e E-@2@ E(J) Ҩ8 (fb8'))\p`>  @ s#Ho$(@eD  Hp@ D0㿘  @Ho(@e 0dN &  0`$ 0 ( 4`@ <$ ( ,`] % ,% (j`O``K2`p pX t t t? @ 8$ p $ t p M!  t t p t? @ 8" pƎ" t˞ip`jX`@ԦHp@   4`> @ # ,`$ ,  "& j@  (`> @ ߐ ђk% ,Hp@$j p t$j$ 8> @   ? 2  ` > lcp   㿘!> l1> l%> l#> l`  #t`#x   @  (  4l  cp#@"@@8@ "`cpl" @ 㿘#> 'b>Ca 1> @ t"(>  @ObP > l `" > l1  ct@3 > l 2 cl"  >C"!$a "?> l" b cp > l cx`> l 0(`3`  ` > l,`(> l$ ct> l> l p cx1> @ +"X`> l1T000L00ltddT@(ldddddlllllllpllL ,8  ddddddddddddddddddddddddddddddddddddd ddddddddddddddddlհհ@lհl`"1 `2--" `"" "D`   ! !  `K  @"J !  `2  ` ! ɒ `"` "7 `  ";@#  !!  `*#` @"? ! #`` ``1"`@@"#@#`   "!  !  ! "! #``  ``"`@"#@#`   "! k#`"" `2`  "` `w`  " `2R" @ L@  `2 "` "@ ``R `@ " @"` ` `.  `y"` `"`` "` `"` ``` `@ " "` 2"  "` "` ``F `@ " `"` "" `2` !    `K! @" ! @` "` `"@ ``` `@ " "` 2" 0"""  `2`  !    `#`@" #` `s"""㿘@M` 2V``2   "`""@@") "` @"(@@9`9 `""@" @` ` ` ``2`@"@@9`9 `ݒ"``` "`""@@""@"``   2`2 @2 0  @ `  2  `2  @20 @ `   `" `6 `2`0"14`2-0 (-"(4`"" 4( "D`, , 4( ! ,! 4 0 0`K 0 0(@"J ( ,! 0 (`024 `4 4! 4ɒ ,`",`4"7 `4, ";`(,# 4 ! (! 4 0 0`*#`0 0(@"? ( ,! 0#`,` ( `00`1"`00`(@"#`(#`, 0 , "! 0 (! 0 ( 4! 4"! 0#`,` , `00`"`00`("#`(#`, 0 (  ("! 0k#`,"(",4`2`4, "`0 4`w`0  4"4`2R"4@ L`( 4`2( 4,"`4"`( 0`0`R 0`0(@ " ( ,`("`0 ,`,4`.( , 4`y"`04`"`0`4 4"`4 4(`"`, `0`0` 0`0(@ " ( ,"`0 (2"4 4("`4"`, 0`0`F 0`0(@ " ( ,`,"`0 ("" (4`2`4 (! 4  , 4 00`K! 00(@" ( ,! ( 0`((`4 4"`4 4,`"`( `0`0` 0`0(@ " ( ,"`0 ,2"40""" ,4`2`4 ,! 4  ( 4 00`#`00(@" ( ,#`, 0`,s,"""㿘`(U`,2(^`0(`2,04"0`""`(@"-0"`,0@",`(`( (`, ,`0 0`4 4`0""(@" ( ,`(`, `0 0`  `0`2`0 @"`(`( (`, ,`0 0`4 4`0ْ"`,`0`4"0`""`(@""`("`,`4 , 2 (0 (`2  (@2 ,0  ,@ 0`  ( 2 ,0 ,`2  ,@2 (0  (@ 0`   `" `6 , (`2`("1,`2-( -" ,`"" , "D`$ $ ,  ! $! , ( (`K ( ( @"J $! ( `(2, `, ,! ,ɒ $`"$`,"7 `,$ ";` $# , ! ! , ( (`*#`( ( @"? $! (#`$` `((`1"`((` @"#` #`$ ( $ "! ( ! ( ,! ,"! (#`$` $ `((`"`((` "#` #`$ (   "! (k#`$" "$,`2`,$ "`( ,`w`(  ,",`2R",@ L` ,`2 ,$"`,"` (`(`R (`( @ " $` "`( $`$,`. $ ,`y"`(,`"`(`, ,"`, , `"`$ `(`(` (`( @ " $"`( 2", , "`,"`$ (`(`F (`( @ " $`$"`( "" ,`2`, ! ,  $ , ((`K! (( @" $! (` `, ,"`, ,$`"` `(`(` (`( @ " $"`( $2",0""" $,`2`, $! ,  , ((`#`(( @" $#`$ (`$s$"""㿘` M`$ 2 V`( `2 $ ( ,"(`""` @") ("`$ (@"(` ` 9 `(9 (`("" @" $` `$ `( (` `(`2`(@"` ` 9 `(9 (`(ݒ"`$`(`,"(`""` @""` "`$`,㿘 <@  $` 8 $& 8  ` 8 $* (` `? "`("`$"` "`,&& & $ @8 $ـ  &`(&`$&` &`,"ذ ԰  @ $ 2 8  ` 8 $* (` 20@8 $瀠  $ 2 ( `2  @2 $0  $@ (`  2 $( $`2  $@2 0  @ (`   `" `6 $ `2 "   @    `    `  `:? "@"`" `" ` " @"*`*` @@ (`" " "> 4" 㿘>  a4 $*  &  & #& J@ /F$& #& &  @    z@ 20 z@ 2   @ $ 2 8  ` 8 $ (` 20怣@8 $怠 > rc`@> u8`>d`" $`  `2" Ȁ`2" `?" @ * ` *0`*`(00 ?0c `20㿀_c> c<' @,@` 6@`=  >   `* 2  * 2  * 2  * 2   * 2   * 2 *  32 B `* 2 * z2 * t2 * n2  * h2  * b2 * 2 \* ,/ 2 2`T26``G* A2  * ;2  * 52  * /2  * )2  * #2 *  ‘2 `* 2 @"㿀> c<@'  _[ `2@* 2 * 2 * 2 * 2  * ܑ2  * ֑2 * Б2 6@@ > @շ"㿘 & & ``` ``$(` &`7@4`"$ ``" &O````  7@4>\`(B``ڂ &  7@```` ` ```` ` ` `````*`.  .`+`*() /`@ / . . + 0@4 R`2  ʄ `  &`7@4  & 7@ 4 & !7@4 & 7@ x4 & #7@r4 & 7@ j4 & 7@ b4 & 7@\4& 7@W4& 7@ (`M4& { pk\> c<' `gIԒC``@@6@@*` 4 / ە27@@Ֆ 5@* ,`2 4`͖ 5!F4  * 2  * 2  * 2  * 2  * 2  * 2  * 2 5"- b> @ z  * s2 5@m   * g2 5@* 2 ` 5 Y֖* S2 ؖ* M2 ږ* G2 ܖ* A2  ޖ* ;2  * 52 * /2 56@*`/ 2`2% Y5@"㿘  ""` `````@, ((``@ `2```(`"`؂ ?@`` *`>\`??   ``*  ߐ@.@* 2 2 .`.`    ``* ϐ@.`* 2 2 .`.`, (`(@ `(``* 2`@,  2* 2 .`4 2 .`4 4 .`.`.`.`````((`(@) ``* 2`@- 2* .`2 .`2 .`.`.`.` Y`` ?`  ?`Ġ     ?  " `c .@6`  ,`Y .`6`,,`@0`0`N 6`6` 1`@-- `` 2? &`6`??Ҕ `9(`>\??Ŕ .`S`  < 9`e_c`l- ?  ?   ?      ?    `(`>\   ` ??   ?   ?  ?    ְ  `  e    `    [    V   Ӕ Ѯ   ͔ ?`   D `    " @ @@@ `?@@@ `@@ `@@݂  `  @@Ղ ߀ "  :+@       8       ن݀2  @ `? ` (` >\  `? `?@ @ @  `? @ @ @ `?@ @ `? @ @ *`** 2`2>j`2 @    @   " 8 dz`dT@`?@@ "`42 86" ( " "@(@@"`(@@" `(@@"   ` (@@" @(@" `` `" `" `" " `"  " `" " `"$0`22`$4`22`#`6"@ $v ` @*` $V@" $ $*` $`2*`$P`22`$V` a@2` $`2*` $ 2*` L@ " 0㿘 $`$@` *`>  @͐#>\H@@@  ` @@  ` H H@@   `  ` `@ ` ` ` `@@ p  @``$2 @  ##"$yԀ@" $u ``b@2 ``'$u $u ؀@" # `db@2 `d'##"$y܀@" $| `hb@2 `h'$| $| @" $} `lb@2 `l'$} $} 䀠@"  , `pb@2 `p' , ,v耠@"  \ `tb@2 `t' \ \`쀠@"  ( `xb@2 `x' ( ("F -@"  X `|b@2 `|' X X" ]@" " `b@2 `'"`##|$y $yw$u ]@"`   `b ܆ ܀``` +` - X $ynv$| 0 0 " (ْ " \㿘 > . `,1> @! 28> 9 @> @ @    ``> @ 耤`2> 2> ܃. > @}"0. `1> @w > @t#0 > @n#؀ "뀤> @h 怤@d ɀ    Π 㿘_???    (@< ` "7(" ` @@4P > > bXp  @1@``- `.`  񀦠#2`@```- 0``1> @ 8ˈ @"$ ? ??  ? @ހ   `> 2`@ .`0``1> @ 0 㿘`  `z`'   :H, > @Ԑ#p ``"F> ``> @ʐ Ѐ``$> @Ð x` `&d> @! `"`&]` $> @ @"z>  &O> @! &"H  "H 4 D \> @  d $<1> @ >\h@ p`> @ h `> @~ ` `> @y @ `> @t P `> @o X `> @j H `  ' { | 2y x` 8 @ <#> @R` E`!>  ]` `@H  L P X T@B` E` ]`2 `@8  D@4  > @/ 0> @+ !>  >m` 㿘 $`$?c &"  > saP@?`> s `> s `> s`2> s> s ` > s `> s `> s @> s `"> s "` > s $`$ 00> `> ` & > @` &f#> @a@ & "_  '!> @!H`&> @!X` `&S@a@`&`"M``'@!H> ?@ Ё㿘" @W 2 㿐```<``?`@ (``(`@ (`@`` @ 8`````< `?(``(`@ (`@ ` @  8` " `t`"````?(@cc@8c` B  8c@cc@8c` B 8c"<$"`@`H@8`H`@ 8 @ 9 82` `@@ (``@8`` B `8``c@8c``# @ 9#@`2`$`$T`=P ` ``?(`t``\``?`#\#`@f9`?!  ` ``?(`t``,``?`#\#`@f`?T`L`H㿐'L   LMNO/. ///.. `. @4 6 * , .2 4 66@㿐  `@  2   L  "E .  `"X ``*`: `  q ``  H    "    `߀`+ 0߀ 8"N H P.@3 "  H  `#\ #`™3    0"r L T/ @3  L "< H P.@3 "  H  `#\ #`3    "` L T/ @3  L` 23  H 4  `` /`0``v\`2 .`0` l`B 7`  d0` L2N N 2  H  "k  `  ``I m LD  H  L8  2  H P  `#\#`.3     L T/    #`#\3     H P  `#\#`.3    L T/    #`#\3      Ly/`  r  2  2   L  " ` К     @2   L2   L  " y   H P. H PΙ. L T/  L Tl/   2 P 2 P 2 P. P  2 P 2 P 2 P. P  Z  X.   R : .   2 T 2 T 2 T~/  T  2 T 2 T 2 T/ ! TՖ  `b`  L  2 2 220 LQ  L  2  2 22o/`   ' L 2  2 2 0   0 㿘"@Tw  "  @T°   ``& & & @T\& 㿘6 ::" $  $  a@``@  ' "2 * `7R4 $D> Ą`   $ " @``հ  $ !"  ` @ $`' @ $4 $   @$ $ @ݐ   $@ $ $ :>,ah(@8h( > `  >t`  㿈 d'& $`  `&``## #\#`  p @#X& l&  #\#`  p @ޚ#X& l& p> ''жc<'''''''' ``'`    '/ق '''/@Ѐ    t 8@`?" 8  >  /'/@ 0@o"X> c<' `#> =`cz`"8, .0`08 @* @ @> '' /''''@/܆  ,  <`cx`l @(`0`@* 8" 8   ''Ȃ 'А''/''''@/؆ (@, @"p> 'Рc<''''''''' ``Y`"8 `h" @YЀ !    <h`"T @Ű`? ) Ѐ  8`F" 8 B> `3`"'    > D`?  ''/ـ / 2 <h`T> =a /'܀/ ``` 2  ``2 @"0@Ȅ"㿘_ " @K (`0``"& @,  7@  ``(`(  7` 7@> rc`@8` @ ˀ 0 7`27@> rc`@8` 㿈0?c t( @ #\   <`" @#\   A`G`" t4 @ `K> r``(`V @#\  m ^6 t4 tb`ߴ> saP  > @Kap> !x@y > @v Ё> saP > @:ap> !> rc!xL   7 @@< @ c!x(  > @ap> @M!> @J 耧 > rc!x(‧  > @ ap> @;!> @8 ր > saP > @ap> !> rc!x(ŀ  > @ap> @!> @  > @ap> @!> @  㿀 ` (& ```& t& l& p`(`. >]?`T <)  `> r p `*& ` @  #\   `  p `*& ` @  #\   > s p ` ``3E`(`& `.  `& l`3(`& `.  p`r> r t`  @ `#\  h  `@& p. & ` p`  `` `@ ,& `.  *  (``(`2 ` t`2> r ` c!x  > @ ap> @O"> @L Ѐ 6 @@< @   ,.  aP > @ap> "@1 > @. Ёc!xW  6 @<  c!x(π > @ap> @"X> @ À> rc!x(… > @Вap> @"(> @ ր> saP > @ap> "p> saP > @ap> "@> rc!x( > @ap> @א"> @Ԑ > @ap> @̐"> @ɐ 㿐 \@6* . @ & . `?& <. . & @`. `> @)"``45`  4> rc` @8```' `& ``  (@`( 瀤 |   t`"]  4> rc`  @8` `(``& ` @ƀ `@€   & H& L . 6 ~ &  >  . @`(6 | . ``$  x`& x ?7! H   L  , ~`"u +``"\ @ P`" T@6 \ T` @6 ^  6 ~& L & H  (`(.  >   p. 6 |!6 ~i`:2 P @ `   #\ ښ d   `~8  (@`c   @ `  #\ Ú †  ` & d @: P6  `   #\     `& d`  @ ` #\     `& d`  0`(`  +  #@ ` @& T& hs& P  @ ` #\  t s & d` ` `  値 `& PS& T 8ހ Ԁ  @*؀  P > c<@' 0`(` 8   @ 0>  @ `#\ 5 ?쀠` ̀`  ("     @ `Ӱ 8 @Đ"㿘 ̀`1`3`9(` dc`#> wcc 2$> wcd> sc`D( : @> F$@@ B$@ `$  @> a4> > >  b@$> > >  b0@$X > c<@'  0`(`쀧   > c<@ i>  ` @ `#\Ȗ    ?  @`` ``%@ 4 @ "> ```@`@K >   %@) 値  Ĭ@ D` "Ɩ ` Ė "2 @$ ۰ @Ɛ#㿘 h`" TP` > s#@w`"P`P`2#> saP  > @ap$< > @F#P>  @B Ё㿘> s"`@;  8" 8" <㿘 &> s> wa#>  F& `\ \X` X da4d`"@ t@ 2㿘.`@``$`82 > s@@2 +! ?  > u@!@``8"> s `"\@`@`"`D `@`D`> s `@Ԑ"`@ `"`<㿘  @ `` & 㿘 > s a` @" @ @埐`X`&`X@& H> = cx> 7c<' 0`(` 8    1>  @ `#\ A  ?쀤 $  `(?`2  t    $ @›#(> %> t(c<' ;#> u`Д X @  `@  ``  H @~ L@z @> s$> b< $  H@c  L@_  !> s@n"H@+`В"H`@S  $(> @F#(㿐 2 ??$ c$ $  ``@> b ``@>bX `J L H  `#` ( @$  @$  @$  *0`2@ 2 @ @\ 2 @0@ |'('0`*2@ 2 @ |' @H 2 @0 H L㿘> s c(((@ ' $`$`2    `  c ' @>  $ $h&@$x`&`&2&&@ d2 x "`"x`&㿘 c '?2 "&&&@(> sc( ' `2 ' ' ch&@@&? $@>'  ' $h&@@& > @cxb&&㿘 沖 @H0  :" (`* :$`2* <$0 2   " 4" ,` @ `@S l`(> c<7\@' @?s'Xz``gj`"`( @Ew  ;t2B :4 8|  $ ($`2, <$0 28  > c $ $ $ $ @0`": `"@  66 ,`@@& \& `. & 6 \` `R`:> <@ > `, :$ 4$ ,> c $ $ $ $ @0`̀`  4, $ $,`0`0`, , , ް(  @( (6   @``,,#\    @b > u`@@6 /@(@$4> = ,a@ (``,4, /4 X'X '`/'ܐ/    7ܒ  @  |>  . . \  n`> =a@DCl>     @  c> @#8㿘_c@?``  @ER   `` @@B @F   "6 `$@8@C&`>@D0 `@$`  @$ $$ $ $ ` @@4 4 4 , `:"2 ,  $ @ `$ *`@4  @/ ( `, (00, , `" :, ``?(,  @,     , , 㿐  @ ``` @A @` @Fy& @ ? `&`2?  @/z `, `  @(`0`0`,, , ``?8Q @,   , #   @/X<(,`(@$ `  @@@U444 , ,  $  ,$ ``:  @ @I ! @. .  `   @*@ @ :* 0`0`. .  , @"@ * $ @?㿘 $`"  @]& 㿘`$` @_Ĕ &` `?㿘 X`(>  ta4# 0  0d `2d`> uN!(> rc`ap?@8`1> u ap@f"ā@D 㿘> u?!(ڤ > .'> bᏐ X` 4 t@8`` 1> .@7"؁@Up 㿘> 7cP>  @^c@W X ̀`2y>  d `P  h" ` `a  ` !> u c@ ` & `  `  d`2@DC @ ` 2@/ @t0  ":    ? @ &  & > t@א#4> rc`al?@ al8` dd`2 h@D h@?> t@ཐ#4> rc`al?@ al8` h@C  `> u a > >  b@]%h> 7cP>  @̒c@y} D` " 4> u" ʀ`@@Ð G,   8 Ȃ` &" #` #\#x#h#l#p  d#d#t$ #|##> u㿘 )'> .> . bآ -> u +> a4(`@$Ԁ` ̀`   `@$Ԁ 1> .@S Ԁ`$Ԁ 1> .0急 @""㿘>~> cT> r> wcؤ '> 'Hp@А @Ho 4(@a!l@ -` @ @/  0ݝ㿘 !@-O`  ` ` (`   @. 8!. 9`"0`. :#. ;`$. <%. =``&. >~`` `y P`   . `!. a`"0`. b#. c`$. d%. e``&. f`. `. `. `. `. `. `. `. ``'. ``&. @-s``p  `> 0 @0`0`. ǃ0`. . O. Ń2 2 . ȃ2 . . . > 4. . . . ` . `. `. `. `ʃ0`.!`.!``"`!`.!`. `. `. `. @.`. `. `. `. ` . ` . ` . `4. p`5. q`6. r`7. s`8. t`9. u`:. v`;. w`<. x`=. y`>. z`?. {`@. |`A. }`B0`. ~`C. `D. `E. `0`"`L`. h`. i`0. j`0. l. m. n . o. k`L. `M. `N. `O. `P. `Q. `R. `S. `T. `U. `V. `W. `X. `Y. `Z0`. `[. `\. `]. `H`"`d`. `. `H. `H. . .  . . `do?<. =. >. ?. `hl?<. =. >. ?. ?. . . . `0. . ̉00. . `. `. `. `. `0. . ԉ00. . `. `. `. `. `00. . ݃0. . `. `. `. `. `0. . 00. . `. `. `. `. `. `. `.!`.!4"0`0`. . ȃ0`. . . . . . `h2<?. . . . `> c<' H "[  \ ``$ \ (F`d$2T \(`_ `"E dc9> rc`ax@`<`''''''''''''' `&/ `&`L`2  d?/ ? ? d> c4@a`d2J`ax`0>  ( (D(\ > :(> rc`@8` d(` ΐ `> rc``@`8`۰ @Đ  / ' d> c4@aD`d"ax`> u@"<`?* 2 ;ax "6ax ` && ` `3`       @1`d > @@c ` &K`(v> @c#lax        @`d`  d * \* D* @#H㿘  ``` ``J `F`"` `O`"w>  ..`> a4 `` ``(` (́ 8 `8 (́ `(` (́ (`A (́ .`  .`" ">  .` ` .`.` . ">  `" b "  7> rc`h@8`h  (́ `. h `'T'X`2 `   `|``ʀ"z`p `"` `P` h ` N`.` $ @ `+`0`(@`$  @@, +`0`(@`$ @$-`0`@8H4 ` K  U 2W` @,(@  ?b% ``PA `LA\`"6D> rcax`> T`T 0`P@=`P  `  @ `  h@@" 2`"` @ ` 0``( "X  aۀ, @ > saPD `"TX@'՘ ( -`0`84&@`4$( @ $ & `   ` , `   .,Aaۃ(@@&f ` `" 2Y`"2XT@' ߰ -`0`84&@`4$) @ $ & `  `H  `   `` . ` >  .,> a4 ```8`Ѐ``(̀` (́ @" $ `  ``Y `T X  ` `2   ` ``: `5 X   `2'/`> r ` `" < $4$> rƪc> @姒`p, `  > a h> a( >  > `(#\#`#d#h#p#l> @嵐 0(@ $ 8`8  `? b%`   3Aaۃ(@  4Aaۂ#@@8``` #\;`> ` @匚` uT> @U`^ `  > a h> a( >  > `(#\#`#d#h#l#p> @d 0(`(```] (́  ,`2 (́ , `  (́ Đ* `_,.`(6 ` Ț . 2 ` `" ` Ӑ " ` T`T 0> rc`h@8`h , ` @( " T`T 0> rc`(@8`(  (́ d` D |``@ $  L H#|#  #\#p##`#h#l#x#d+#t  ` -` 0 ` (@f0㿘 `' ' `& &d!h"Q``  `" "" `$1i ,`"0 ۰ $􀠠`  8  ?` 8  ?` 8  ?@8ل :`? (`2 "`0"`,"`( ."`4&& (& ,  8  ?`  0@8  ڄ?` 8 :` Є? &`0&`,&`(&`4"ް  Ą?`   ,㿘. `> s^"\ "c$ `8 2 ` -  2 &`& "H `&@2 ` " '`L> sD`H> s\`D> s(D(\  2 > s@"` `> u @! l> .`b" ``8#"`8 ` 8`8"  9` 2 '٦  "<" <   `< `<aP > > `@z > @㥐   > @㝐 В> s?@آ"`> > `@_  棐> @㈐    > > >  b@A"s?拐> @p  ̒ 㿘> 7cP>  @c؀@]&) J#  K> r `2 > u`>|@>`&> u" > u&a` &`!l@`>&l@k#`@] x`8[? > @a> @ > s?@"` ? Ͱ? &㿘 P`0 0@ " @%? `z z3 `x x.1"` 8   ?` 9  `"  ذ`2԰ "`"`"@ "` &!&&  퀠4 ` 8ބ  ? &`&`&@&` "   τ?` 8Ą  DŽ?` 8  ?  `0 0@* @8 `z z `x x 4"` 4  2 0  8 *` 8 *` 8 *` 8  ` 8  ך P`0 0@* @8 `z z `x x 3"` 3  2 0 8 *` 8 *` 8 *` 8 *` 8 *> c<'  d `  X@f> r g> //x\2''> rc)> u@!(>}p $dJ> ud8G @> Ѱ?d(d,e `\`(z8(`x `0 D` =!( '> a0 p`0"` p`@&p> c`?@8`@#` @X"$ `0x`8 > u?@S"0> @aH  > @=  y `' ' `& &@D"M``  `" ""X`$*W , 2 ' `  8 ,*` 8 ,*` 8 ,* @8 ,:` (@8 ,*` 8 ,:`  ( 8 ,*` 8 ,*ޚ` 8 ,0 $ w `' ' `& &?C"K``  `" ""V`$*U , 2 '`  8 ,* (` 8 ,* (` 8 ,* (@8 ,:` (@8 ,* (` 8 ,:`  ( 8 ,* (` 8 ,* (` 8 ,0 $㿘> rc`@> s8`|"\ , 8 (  ` `@  ``"`& ` `  㿘> rc`ax@8` O50 "2> s @ .> s&0 8&> .b"   @ @  `& & 2 22@2 > s "\ 2 80 ˔㗖  2&00 `@0$ @ > @zah  > @ߥ p   |  H/7/Б* U L * O <  @77 w&@ ̀`t  "r d  0 H H `I  ``K > @a4 `"M `@ (@2 &`&E "B  (`@```& >  H ">  L`Ԅ `@ gH  |`$ . v  @`$ ()  ``>  +`> @a4 `2@ ``@ ( (`@` ``2 u`2  "  <Ј  u`2{  2 |  (` "R @٦  L ` (` 5  ٙ@ . 2 | (`@     L @(`@     .  `& *`v@  `& ,*`p@  . `& |. `2 `@2 @@2 c |@ @@ > > > Z b@E> >  b@=> >  b@5> > >  b@,h |   H7 / * / L *  @(`@0 ` <  @(:0 &@ ̀`"  " d  0 H H `[  ``] > @a4 `"_ `@ (@D &`&   `(`@``&@ G ` H,@` `#\#``,@ z   L ,. ,`&` @ #`#\`h  @`$ (  ` @ @7 )  ``>  +`> @a4 `2@ ``@ (̀  "U H,@@ , H@` `#\#`@-  n " L |`$   . W q,` , L`  (`@`z  ``2D u`2@  "<  < 6 u`22  ,  ,  @  @@@2@@`& ,@ `& ,`& f.  L,@ `L,` L,@   | H,@x,p@ L, @ 0` 2,`& @2'`&@ 2"`&{`, @ l  g  @b @ ] V |`$ @  `(8 |   H7 /'*  ל/ L * ז @(`@0 ` <  @(0&@  ̀`"  " d  0  H 0 D(` @`` " ` ``"  ʀ`b  `&&  "X @@ "`& `&   `(`@``&@  ` H,@` `#\#``,@    L ,. , ` #\`&@ #``ؚ  @`$ (  ' ` @  @6W 2@ ``2w u`2s  "o  <"k   6> rc`p @8`p  ` ``" P 6> rc`p @8`p^ 2i@  (`@``&@ t `  "K H,@@ , H@` #\#``@S   " L |`$   . r ,` 8, LT`u`2  `& ,c@ `&_ ,`& S. `( `( > saP ) D) \@ T&@`Q > ```y 8``s 4``m``" 1 @@ PC  **@`   d #\#`#h#d B#p#l#t  #x$*#|## *옖 . L,@ `,` L,@ | u | H,@],U@``"``" 1 X`@  `L@`d`@#\`#d`#`@#l#h#p#t  L H |#x#|#S#@  8 *@ d` * #\ 4#d`#` X #l#h#p#x #t$*#|## *1 @ P4 @ <@8L @ T@4X@ 8@L@@ P@(E(]@(`D(`\ 6 L, @ b` ^ @Y@ 2T`, @     @ނ @ ق  |,  , @ @@@2@@`$ @ . `(> @AaJ@ ` > @l @ ` `#`` 4Z 8@ | d`#`#\#h   L H#d B #|#l#p#x###t/ -6= 8``7 4``1 `   @ ) D@~ D@$ P@ P 6> rc`h @8`h㿘  |  K   ` H  L `:" ` * Լ ,Ե  X(`@0`   Z(0  - ,' 0,& |4$@y2 @`@ " H \ X" |菐  > s@А"`  H @ L ,@" \w  2      , `:" `* ^`-`W "o   \(`@0`   ^(0  ``: , ' 4 $, & `"h&@&&@> saP  > @>a@܄ > @i Ђ `Q``` `[,$ @ ` `S ` (  $} x @s L 8 m 4h 0c ,@^X \|  \(`@0`   ^(0  , '@K 0G&``j` L`d-`$ @ ` `\ `Z :y, 'w, ' |''''' ''?'/'/'''''''''''>4` > Ő` ` ~``:    \ ^6 X6 Z> wc$  '''+> rȬ ,   ?@"# d'쀤 +#x@<#x <@^_c $y" ` $u2 #& $| |`?"  h $|" $} " $} l 'Ā 쀤 2#x@''d'$p $. @l耢?c솀@=c $v``"  ~@m  ~a" $t $t ";$p @  @w | .  $t`2  ~ x`" ~ $`2 ~c @@9 @ `. !x(eܐ > @ap> @!> @ Y @` ԭ`6 ^76 \P'쀠" $ " $ pF'쀠`"" $``" $`" $`" $`" $`'   "   ו  , " T t'쀠`  ` `  ` ,2 t T`" T`"  T`" P T``"n T`2 \ y " @  0 @V  \ " ~ x'' P @` G \ 2 x ~`" -`:`Ҁ`" $$p`"! $ ~a" $"' <~ ৐  $`n`   $`f`  @C3 w $`_`  @`? l $`X` )  `M $a"6 ${> u` #@@$'܀`2@Ѐ`"  d" @ ` @1 ``ʀ`" dpqЀ``&&Ѱ `$p` 2 $䀠 $ )> tc x `` C 79 x@9 `   $ `2  c`(@8`(> u` #@@˽'܀`2@  + T``  0F  T`` P @B  T` " `2  `  @ "   hl  " <c`H@8`H $t`2- @πa2$p -`2" ]`2" `" $$|?@2" $l`2" $``"$p"'6 ^6 \`G@os B @@r< ;0 T``  @ 0+  T)> t @'#4 $`h$`l$`d``@ `d ` `d` `h" `` ` `h` ``" $ ` 2 $``ʂ`4`ʚ$p`4`$p" `4`ʚ (`@ ` 4`@4`) ,`,`4`4`,`,``,`̂?! ,`΂ `"쀠``   ,`\,`D,`> > a04$` `$``ʀa`0 ,` Ԁ c$p@> . <. > s&a ` @ˌ c`$`"" `X `X2 H$ ,@(2 4` `". ؀V `2  "   (`(` (@` (#\ڵЂ@7'Ѐ"$@ 2"$@!$T`2% @#`" $R @ʒ $R`2'#`?u  @`  \9 "F ~> rc`8@8`8 ` Q {" "$L:",A$N*`"< @ |2`   z $2"#`" -@X*@U$c  - 2 ( ] 2 X $``" $l` $`$X$\5  "`" $l`"T$p` $l$d$h2  2H$p"'쀠`  D` 0 H` @ L`" \0 $~`" $@25" $`")$p@"%$p"'@9Ђc`( 7@8`(    2` @?@`h"`d  `d  ``" #4  2#4@_ `܂ `R> u^}&"' *ԥ \ 2i ] |' ZԜ ^ 2d $` ' H#\ Q @c`h@f8`h@? $Tԟ̀ #*`: @ |2` " " `` ` ` ````` 򀠠 $t` &@&' n'@ $x`e"*'`:  ,`͂  ,`\,`D,`ސ &)b`"e$|"' h$`4$`8 ``"- ${$`< `" `8`0$`8,`E`"  `E` 4`@( 0`(@8@4`@ `" `8`$`8   ,`\,`4`X$`P,`D`2$`<D`4" $`< $`<`<ط  'cؔ@=c@h2 @> u @f# ' P$p@ $. @g耢? v``"j@c`` ${` |(`0` @,`D$`8⦐ *  H2 *  L24`B`8 |  L H`#\#`  * 2 #|#l#d#t#h#p#x##Tc p 7@9 p   c`X'؆'Ԅ@8`X o7`H@Ɣ ac`ʀa"9 `0`4@Ѐ ", cax(R  > @Қap> @ɐ!> @Ɛ F f  `  $  L H | D@ #\#p#t#|###`#h#l#x#d/`( @78`(i`h"`d  `d  ``"4#4  2*#4㿘 .`& `.`' |\6`$p  (0  (`@0`  H  L `:"f `* @ . @ <  @F =& ̀`9 `2   d`W`"cu  `&&" @ d` @   @?> saP ,`> 2@b( > @ Ё`"A  @?  (0  (`@0` `$`"```?* &@`@ ` ` `u`2  "  < `2  ``t0€`p. &@ @ ` `h `8 > c<@'  H/ L:, `0(64Q 18640#`#d,#\ ƀ " > <@ >  0@` `(64# 68 @ߔ    < @ | 't7`?//@ //'x` `" ` )[  `/7/ڠ*  ڑ* tx775 &@ ̀``" d  . (`@` $ .  $ @(0` (†2w   ` @ @+ x (@+ i  :` x 6> rc`  @U8` `S> 0`2P(64#\#`#d[  A> @> a4 ! @(@"3 &`& `  ) @``&@@ ,`?',`$ | . `$ @(0` ( `Ҁ`,`& X@ `& ,,`S@ `& . > saP(  > @Tap> "@Ђ> @  #\` ( L 'a ЂԄ(' '?H' ` #\`  / ?  26> rc` @8``(`@'L/' '?H''x#\   7//ۑ* ݐڑ* אtx(0(0܀ &@ ̀`" d   `&& 0  H 0 ` `Ԧ`  @  ʀ` > s @ > r (@  > saP89   @Ā``&& `"  (`@` &?``f+  + ` #h#\ #`#d``4 $ .  $ @(0` (  T+ @ + @` #h#\#`#dܚ  Z 2x  ` @ @)| x (@)v xx#\ - 47//ۑ* ڑ* tx(0(*0܀ &@ ̀``" d  @" `&& `"  (`@` `&``R+  + ` #h#\ #`@#da`倣``$ . `$ @(0` (`ɀ`?+  + `  #h@#\#`#d4``"[ x @(Ԙ & ƀx#\ܖ ؉ >ܔ'PL640,#d#`#\ > @@" `&& `"  (`@``&@,`?',`&` ̿  ݐ  `  @ @( `& @ `#`#\ + +`@ @ ৔ Ő  :. `&̟ 4`,x @(` `$ @  `(. `& *`@ `& ,*`@ `& .   ,`@`r `> saP(  > @ap> "> saP(  > @ap> #(.  , H @ 2  "} `@ W  L,``  @2  `"  `@C  .  , (` @` () 0`0`**  @ ` @' 4҅, H@@    L,`@@    .  , (`@` " @  4 , ( 0`  @ ` @' > saP(  > @aap> "X@#x``2Y u`2U  Pt"N    ` @ @' x  @' א  `(`@T`(` B #\#h#`#d  ʾ `3`+(` @ )  $  @  2  $(`" #h#\#`#d  ʋ (`2  $  ` @ @'& x  @'  Gx 0 H K   .  C  z :?.  `(`@6`#\  ֿ h 'Pɂ640 #`,#d#\R  6> `230`2/(64#d#\#`:   > @@" `&&& `"$  (`@``&@,`?',`&` ې    `  @ @& `& @ `#`#\ + +`@ @ Ô   . `&ʻ 4`2,$( 27$ў @| `=`20 u`2,  't"%  `0`2G u`2C  >t"<   `&& H  0= H H: 0(` `  `` @ (` @     @ 2 9 W  `  @ @%  `& @ #`#\ ,,@ @ ! ?  `&` :. ,@ `&`  #`#\ *H@ ,@ `&`   #`#\*9@ x @% `$ @  `(.  `& *``@  `& ,*`Z@ `& . ` > @^c  H1 > @ˉ"  L* > @˂"Y@> @|#@ ɿ ݐ  `  @ @%  & @ #`#\ `,,`  ݧ Ő  &` :. ,@` 7,`x  7@%^  $ @  `(.  & *`  & ,*` & . > rc!x8   6 P @< P+ @+ + @=+ 5(`@2 `$ (`2j c $+ I+ A+ k+ c`@2 @@2  u`2 S (` @   ނ  @ق @ 2Ԃ `$+      @@ 2+   ʼn+   @@2 @2 @ 2  L> saP(  > @Cap> #x> saP(א  > @7ap> #P(` @ ΂  ɂ  @Ă  2  $+      @ 2+   +  @ @@2@u`2  u`2  ` > @גb  H̪ > @"  Ḷ > @"@> @#ɀ ". , 4`+` { `$ . `$ @(0` (`S`  ` @ @#ߘ x  @#٘ x @#Ә %  `(`@1` ^. ,  4` 耡 `$ . `$ @(0` (``"  ` @ @# x (Ö `(`@`(`@" #`#\ @#d#h  ֚  (`@2 `$*@ q4`+`@    #\#`#d#hƳ c(`    @@b @` (`3 @B*@ 3 В * 4 4 @4@ 4!`(` @ &  !  @ @ 2 `$(`@ =4`R+`@    #\#`#d#hA /(`@"?  #\#`@#d#h  + 1 (`@2 `$(` @      @ @ 2 `$$* *+`@` @ $(`  4 4 @4@ 4̀`@` O(`(`  2 2 @@  ( 27> c<@' > w7Fc'@'8'4'<`.> rcah"  h`"&TP "*ax a2 `` > `:` @' +`: @ o> Ԥ  "P P 2 ax`  > @Вap0> @#> @ 0 HبF#\** `Ȁ``@`&,"OaѬ `/у6`9 8` `" `ʀ`2 `@цax@`<`@/ф 7F L ` `@G `8ȃ(`@D`Ѐ8ˀ`2 `8 `ڀ`(`<̀`"8  Ѐ ` `4 ,Ѐ` Ȁ`\`=̀`4 <``"4< `Vр`"m8`Gv` 8G@4@\$8`\<`` 2 W@ 8  v`"G@4@\ `π  :`(:<2 2 <"" " " <@`:(`:Ѐ  < d2 <#\D* `Ѭ `,/@ ,6e "E&P < d` Ȁ`p`!`?` ,a` , 0``"(0`@# , 0`@  * 2 `8@݀`]<`2 & <8@u& ΂  `ۀ`@#<G <o `~ |&`" `` `0`ƀaw(0``'`K`:`〠``8Ӓ* 0`t8@e48 `d'<`h'@ `̂@/@&Ȁ`@`2&@rx&@n:` (:``` `2Pa28<8@54 *  U` 7F@J<`@Ř#@:g&<ddV@d"<ˀ`2<0(`<`?e88 `",<@4* 4`?LȀ`` ax @7F <`  <  > @Şap> @͐ >   @Ȩ /`  `?@* 2  8ʒ* 0``^@du88`d'<`h'@ `̂@/р`_<`܀`ʵ,@ǃ6Ȁ`>` ax @7F <`  > @Vap> @Ņ#>   @ŀ ͨ8* `8@K`?<  > @6ap> @e P> @b 8 8@4ɐ8* `8`2`ܔ<@R48P`m,0P> 'c<' #> ``;(;&'@ d`2& > @ď d``du@ `?' `'8> saPِ > @Ēap>  @> @  'Ȅ /''''''''/ȢВ d`n c p` t`  p x` |`"  p  " N[  e "d `'> sЀ`R`r lE"|@ @9 d`( l @, pd 沖 @q '0h` 耠` 쀠``"cX1 cX 2 K : `(:#\  @ 0C@#@Ë 7dт``2 X7҄ #\#`  @R > saP( > @ap> @ ؂``ဠ`2 X7ҝX> 'Ġc<' (> $`"`;(; &'Ȣ@ d`2&@"2 > @t!d`{`du@ `?'` `> saP ֢̐ > @èap> @א! > @Ԑ ɢ̀  8`q" 8` ''''''/Մ /d'`('ТFԀ jc p`2' / *M  Q !Ȁ`` `8?`> saP > @Zap> @É! > @Æ |Ȁ`2'cX 2 r 沖 @^ '0p@m̀`B> `P`<@8`P4`20:`(:@eM0XȐ  @  "/@$ C@# #\#`   @QĀ > saP(Ȑ > @ap> @0!H> @- "ȄhT` T@} l@ 8!6  ؀`8>  $h1 $x` x`$`#`> ,` ,! @d!> ł`h`L `Ldv l   @Md"!>t0` 0Ȓ `@*`6 Ȓ@N 'Ȓ Ƕ'> !Ȑ@  'ȶ&@6> ńhD` D`0"14`2-0 (-"(4`"" 4( "D`, , 4( ! ,! 4 0 0`K 0 0(@"J ( ,! 0 (`024 `4 4! 4ɒ ,`",`4"7 `4, ";`(,# 4 ! (! 4 0 0`*#`0 0(@"? ( ,! 0#`,` ( `00`1"`00`(@"#`(#`, 0 , "! 0 (! 0 ( 4! 4"! 0#`,` , `00`"`00`("#`(#`, 0 (  ("! 0k#`,"(",4`2`4, "`0 4`w`0  4"4`2R"4@ L`( 4`2( 4,"`4"`( 0`0`R 0`0(@ " ( ,`("`0 ,`,4`.( , 4`y"`04`"`0`4 4"`4 4(`"`, `0`0` 0`0(@ " ( ,"`0 (2"4 4("`4"`, 0`0`F 0`0(@ " ( ,`,"`0 ("" (4`2`4 (! 4  , 4 00`K! 00(@" ( ,! ( 0`((`4 4"`4 4,`"`( `0`0` 0`0(@ " ( ,"`0 ,2"40""" ,4`2`4 ,! 4  ( 4 00`#`00(@" ( ,#`, 0`,s,"""㿘`(U`,2(^`0(`2,04"0`""`(@"-0"`,0@",`(`( (`, ,`0 0`4 4`0""(@" ( ,`(`, `0 0`  `0`2`0 @"`(`( (`, ,`0 0`4 4`0ْ"`,`0`4"0`""`(@""`("`,`4 , 2 (0 (`2  (@2 ,0  ,@ 0`  ( 2 ,0 ,`2  ,@2 (0  (@ 0`   `" `6 , (`2㿘.``?6` ` ``2/ @ ```2- `? `@2 `@ ` `@. 2#``? 8. 耎`@҆(6 8. ӂ@6    ((`@() (00. .0. . X > c<@'  0`(`쀤 ! ` @ `#\Ȗ Ț .`0` ` ` 3   ` @@ , ` } ƀ@+ 4 ` @   7ƒ`@ϒ"@ @ ` @ɘ $ Ĥ> @!h㿘  ` ;> rc` @8`  "> r` ` 2> r 2> r@"(  ,   ($  *` ߓ2` 4  ` ``  ```@  @| "ӈ` І     4 4 㿘 @P>  D` `G   @(`6 (0`! > s @> saP. > @ap ? 6 ,> 2`@"8>  @ Ё 2> saP > @ےap> @"h> @ Ѐ   > >  a@!> > >  ax@!@> c<'   `0`  0`L `"@``"< @ ` *#\ Ƞ 8  0`(`쀤 1̈    ` @`(?` ``( $@ 4 @  '@ `  @2`*@ 0 ` ``2 @ @%ڐ " `2~  `  > saP8  ς` 1 "0 `"  h" h``2 h  `N     `!`  > 2 h`"  h Ӏ `π ʈ``ǀ "ݰ @˂> rc!x(7` > @ce > @  *` c> > saP8Ґ  ς` v1 > r `` G` ``/ / / /" `" ``2 ``/ / / /" " `2 `  ?@"  @ ` `@( )  +` "  @ ` `@( )  +`a0 b(> s`": hdd> x@` ٬ @`(* h `(& h (`(`$$, @#,  `  @`*> rcax8 ` 6@`0 @<`0@$ ,   , ` `   `  0" > @b> @& (` h  ['  j  S 4 `2+ > > >  a@ɔ#6 @ 0> sP` ```>  @cǐ B > @ 0c!x ` 6@ 0 @< 0> @b> @А _0<c`2xu > > b@> @ ڀ`@!`r l Ьb@&@'> @xp ` ``"@ "" ""@8 8 ; :` ?  3`0:: 12> @#%> @ax`` @Lp#@> @s# @qax` ` @8p> `` @d#X@bax`` @)p> `` `@T#x@Rax`(쀦`p@ " @Eဦ`" h `> r< h> r㿘 0`" H> v@7!$ H`1> v@1!$H> @c<'  > v @!$&@ D  "" " " " "  `q" `"g @ ` `"2 ` 0`(- @`(  ` @*#\ ǚ  ` 0`(`쀦 $ ̀ ` @`(?` ``(= &@ 4 @  9> ` `@`0@F@$  ``/`/@// `/ `/ `/ `/# @ @ @"@ ``* ?Ƣ@ @`* @!> > >  a @N#㿘> vX! 8"- < < < <? @ @& 8 & <> v3> v`L  ? @ $@$ @pa&a @ "  & D1> v@^!> v a  8㿘%> v (`@֐> saP> va`@ 0` &` > @ap> "@@" 8> @ 㿘!> v @ L > v`  L@   > v  6> rc`( @8`(㿘> va> a4> x /c| H!@ *> r> cجp> > `XY`  H@ x`@  @ː@ɐA` 2 H㿐````@7, 4 `> ,`(.`,2`2 @ @,` 8 `> saP   : `@$ ` , : @ 2 :@  > @Lap> @z > @w ހ @H    ,(@ &> @ސ h㿘 @>   ? @ $$ @&!> v@T L%> v$@`" L@ `? @`` $@$`@@=@$@` @`$D@ & D㿐#> v `L   #\> @`!> v P!   #\> @ݚ`    #\> v> !$@Ӛ`!@|#`L c@ > v aa `㿘  ` ` * , &`   `% % `$ $"  ꀢ  ( 2` \ `$U  㿘˒ > a4 8" H < > v < <? @" <?" 8!!`" 8> va 8 v!#` 8 <? @" <?" 8!`" 8 8#`㿘 @` ` F ,`" `   `% % `$ $" 逢  (`2 &`0&`,&`( &`4 && (& ,  `$ݒ   &`0&`,&`(&`4$ 㿘`W``"`"`> rcx;> v`9> v > @ap`> @ > @ ?c> rcx;> v` 9> v 6@=`L@!'! cx` #> v9a 7%> v @ > ` L+`2@( D6 L`+` D``*2`  2@(`0`6 `;> v`9> v `="`   2`    2 ? @8  $`ۂ @ ,` 0x;> v`9> v > @aap> @!p> @ `L;> v9> vĀ ``2{ x`  `@ ``@ #@6`6` e* +`00`] $`   (0`͢> ;> vap> > `9> v)`L`"6  ?$`  @ $@$ @K!'!````- $`m`@ (0`@ x`(@ @ @`2  ?& D   $@$ `L@!'!" @`&@ `&`$ > @Ȓap``> @ @ > @ 逦> @ap $> `> a0`` @ > @ݐ > rcx;> v`9> v > @ap> @͐ > @ʐ €;> v9> vx`N :;> v`9> v  @谒 c (ug> & @ @& Da4a& H`!6 L> v`b& 8 8 <  @& <`\&@ @ `& @&`x,``"0 @    @4 x4 `M&@ @ `& @ @&`> @Aap> @p!> @m 0j& D > @4ap> @b!> @_  > @(ap> @V!> @S `@M   6(;> v9> v@?=( 8! & D> >  a@!I& D> > >  aP@!ih> c<@'   $`4`4`  (@`( @4```(@4``̄4` t t````((`@( /'// "u & "p  @` L D `?`x`, &0`Ȓ@   @n X``"(  $( @R  A 2 0`0`@؃(`0`0`,`,`.`0`W,`/ , 00`?@؀@> s> rcx89 ,``,` 7@ @<aP  @ 8> ` 7@> rc`( @8`( > @+ap ` `*> @ @U"@>  @Q 0> @ap> @I"(> @F ,`@   (@!> @"> > >  a@"s㿈 p`  @ #\    > saX"  p  n*2 @@ h> c<' ` w"  2 `(`2  ( @2  ?((`2  2  '  '/ / /'젒 "I & "D  @e D `d@& `    $  @`?4`@4`.`,00?@c> s> rc!x) 4` 6  @< aP    >  > @Map`> @z"@>  @v 0> @@ap> @n"(> @k Ѐ@!> > >  a@$"#㿘 @` ?((`@(``0> rca @(2 @ax`) ` 6@`@<`   @'   @    (?Ѓ0`@2   > @ap> @"X> @  р`㿘 / `+ , "'`   `% % `$ $"  ꀢ  ( 2` y `$r  `"0 `2,-" `"" "D`   ! !  `K  @"J !  `2  ` ! ʒ `"` "7 `  ; ` ! !  `*#` @"@ ! #`` ``2"`@@"#@#`  "!  !  ! "! #`@`  ``"`@"#@#`   "! k#`"" `2`  "` `w`  " `2R" @ L@  `2 "` "@ ``R `@ " @"` ` `.  `y"` `"`` "` `"` ``` `@ " "` 2"  "` "` ``F `@ " `"` "" `2` !    `K! @" ! @` "` `"@ ``` `@ " "` 2" 0"""  `2`  !    `#`@" #` `s"""㿘@U`2^``2 "`""@@"-"`@",@@ ` ` ` `""@" @` ` `  ``2` @"@@ ` ` ` `ْ"``` "`""@@""@"``   2`2 @2 0  @ `  2  `2  @20 @ `   `" `6 `2`"1`2- -"`""  "D`   ! !   `K  @"J  !  `2 ` ! ɒ `"`"7 ` ";`#  ! !   `*#` @"?  ! #``  ``1"``@"#`#`   "!  !   ! "! #``  ``"``"#`#`    "! k#`""`2` "` `w`  "`2R"@ L` `2 "`"` ``R `@ "  `"` ``.  `y"``"`` "` `"` ``` `@ "  "` 2" "`"` ``F `@ "  `"` "" `2` !     `K! @"  !  `` "` `"` ``` `@ "  "` 2"0""" `2` !     `#`@"  #` `s"""㿘`U`2^``2"`""`@"-"`@",`` ` ` ` `""@"  `` ` `  ``2` @"`` ` ` ` `ْ"```"`""`@""`"``  2  `2  @2 0  @ `   2  `2  @2 0  @ `   `" `6  `2㿘. c`dd`"F $  @Aɰ  Y 8`e`h@$d`>  bp  @(@d @$c /@$`@(@d @ /c@ع`h@  9> saP%  @C2 $> @ܒ`c`h@$d`> N `> ےb $@  > @apch> @ܐ"x> @ِ Ґ,@@x L@`  @ @w$@B d 㿘 _> wc[ 8`W`$`Sd`O @`K D`G @B $@=> w 4`/d07`$ 8@B dh0.d`*`$`&d`"d`d`dx@d@d`  8` ` @B 㿘#`` &##$h&#> saP &#> @ ap> @;"> @8 &#㿘 `h h@ɐ &   h㿘 $@@    $@ h> wސ#d @B;㿘 (`8`/" > wc۰ $h㿘 @Z H && & & & $& 㿘 #`h h@{ &%  `" &`&`&@ &` &&&   &`&`&@&` $@ ߄?㿘 `h  h@F  &    h 㿘 `h h@0 &    h㿘 #`h h@ &%   `" &`&`&` &`&& & Ӱ  &`&`&`&`$@ǰ ߄?㿘N> wc/ N`/" ; $ @?Ĕ @$ /@`t%,@  / 8`@$L`a> 7> w`ȴd@ / "DL-@L`T@ֶ ?N$@֯h#G$ @? A$`$`(@۔ @ `h$h@Ӑ@$$@ -$$` Z > sdh` $d``h@@ 0,aP rd@@ @@ 0~ > saP @@ @@ޒ 0o> @zap(h> @#> @ ے> @kap ( h> @"> @ ސ㿘&#.$.$N`i $ @?  uN`/ ,d`8`",J`h`2Z`h, N`.,(N`.2' N`/"(`2d> s d`,dN.2 N`.2 N`/2 L`O@- / 2*, (`2+> @$@ / > @ђb  ސ @@Z> s8  $c$`"$,d.@$ `@Ô$ԒaP  > @גap> @#x>  @ Ё> saP   @@% @є$> @ap> @#X> @ 㿘 `h  h@x  &    h ? 2 @? ?  ? 2 @? ? > .b* H0` L@"L2H` L㿘> wch > s > s aP > s aT> s  aX!\@d   H*`0` @ "2H>c4 @ * > .2`>a" * > .2`>a"㿘 xjx&`X㿘` %  " @ߐ 2 L H`$ L  H,1  (1 0cP P @=  @ @ L6 H`  & L &&   @$  H &&  $㿘> ."* 2 㿘> ."* 2 *`2``($H@  LH@ L` L ! ?  >`p " * > .2`>c"* > .2`>c"㿘N` @2M  &@ @4^ &@ 㿘 0>@>`0  8>`>`8  @>`>`@  H>`>`H  P>` >`P ( X>`(>`X  @@e``Ē Ĕ @` Ԕ `@[  @`@V!$ @a$@Q!d @ad@L! @a@G !a@B"b"bc#c ݐc Na䀠` bА@ &c$ `"$ bb ĐbXbh cHcX ##&c &c@J # &c@J c  @Jj&c c@  P $$$$ $$$($,N`&d&d&d&d &d$&d(&d, &d0Na$`"&d4 z&d4$8$@$L$N$PNad&d8&d@6dL6dN  6dP6dR*  fNa`" $dڐ6dT*  [$d$X&dd$h>dX&dh$v$V$`$l$p$t$u$w6dV&d`&dl&dp.dt.du.dw.dv.dw$x$y$z${$|$$}$~$$$$$$$$$.dx.dy.dz.d{.d|.d.d}.d~.d.d.d.d.d.d.d.d.d$$&d$$&d$>d&d.d$$$$$$$$.d.d.d.d>d6d&d6d   㿘 `$@OА`$`)`` ``( @O`*@O `, @O`-@O 2`(@O `@O `(@O `(@O `%@O ے`(㿐Œ`0`@א@O`@А@O`@ɐ@Oa@@OydT7@Os c'@Ol d@'@Of dX'@O` d\'@OZ d`@OV dd'@OP dh'@OJ dl@OF dp'@O@ dt@O< du@O8 d|@O4 dx@O0 dy@O, dz@O( d{@O$ d}@O  d~@O d@O d@O d@O d@O  d@O d@O (> c<' @K͐ ( " ,@<  , & (*  @; & (    $@ E$< ((` " @O> s ll     > @{#㿐@   ! !@m 'Ho&(@@mzHp@g㿐@b  !` !`  ''Hof(@!@mQHp@@m! "!g!㿘-> t0`> s Ho(@a%> t> u, $,> s bX   #> l ,L $`2 @l  c|`"  " Hp@, <> u+> l"a,c|`>@m`? ` @lm `2@,  "   ? @L $$ $  ܒ@, 2 Hp@%0°  㿘'> t0`> sa%> t , ' > u a,@l"@d, "$0    ? @L $$ $  ܒ@M, 2 $0  㿘%> t, +> u  a,@k@1,   #   ? @L $$ $ Q ܒ@, 2   > s ` $ > t c0  㿘 $`" * @G2  "3> X@Ǖ  @ē`㿘@-- $`> ` 㿘 $` @Ht* 2 & ? 㿘@3  !  ް 2 0㿘 d `"dbbb b? @&d<&b&bd ` d`b``2b`0ߐbݐbېcc "b@qbdRdTd4d0@d0`0@2@2b@2b@2c@2ސ c@/ c@/ b@/ bh@/ cX@/ 1> u@I & bc "c@&c㿘 "  `4`" `0@> w c@9Ho 4`(@a``$```(`,`0&`&`&`(&`,&`&`{&`$`" `(N``( "&`(@: &`(&`,&`4(Hp@ < 0㿘̐  `4``0@"`$ `" &`4`,`$&`,`&`4 㿘a   $`" `0`,`$&`,``0 `&`0$&`4 @> `$0"`P@"}01>@˂<I@؂JG@ E1;@O:1E@|AI@ -> .32G@X-> .@<؃Ho04(@a04@"> up01A@",HH0j`@^=0;/@"&8-0B)@-@> s Hp@ @ .0 `W@0;0'@T@@ T@"8i0 0`@"(.@'@@V0|@: D<@ >@-> .D`ڨ -> .@<0(@"p0 U@> u؂&@k> wĂ+@,@ > rc!h+ > a4!x!!tN!!h" @:D0B`@":0jcт@` 00@ D`* W@"$Y@ Z@0`@0@&@VJ@vD0@0B/@-> .0`@0"`P@c0 @"NR0 0 R@"z0T@ Q@) d%  @6ߐ$  @6ڐ$(> wc> y$c @> w chch ` ` ` ` ` ` `ް   $ $(  @ $b Тd@$Ɛ@b$ N`ဠ`L `2  "@89 @86 0k@",e32D@",AFB@C@ ,`4D(08@ @ Mc@`@0f@c@`0`2@50[&@WU@-0S@)0O`@a0j`@-> .0\?A"  > u > u?<!(     t   Q 0`_!> r @/ Hp@ h@:؁!> rb#ؒ@. 0뀠`42O D(08@.@ ߰a%> uذ  > @=ap> @l#Ȱ > @h 0˒ @e, l b L`$`$`S`$  C$`> tc, 0 @E  2 L $`2  $`@h F > t,@@0`-> .0`@" cƂ@`0@0`2@ -> .0`@"M80"Y@ЂZ@ȂW@װ `Ӑ@."h@"0V@y\@m@2 > wh ` O @" ,Z?1;@<@:@ .ΐ 9 & 8 "> w $i? . `& 2% `2`2 `2 ` `|`x`t`p @"H. 7J@"2,*#,M@Z ,`4VD(0H#\8@ 4`42G D(0<@@ װ`42: D(08@@ ʰd(2- D(048<#\@@J  \0``(`0 %> u @C J 2-  $|$$D4 $$H @( `2`$@. /0 (> .( @`|`L@8w  ` (( @@`l&,`2ΰ D<@y@ `,`2° D<@Ȕ@ T. N . 8 "> w $~? "N` Ӓ (@В ( + 2N`20 . d(2 D(08@Y@ "> u`> saT&    &> ub `&`> sbX &d(2_ D(08@@ > wh `  `> wh  ` `s > saD((&?" xNx`@ 2 ` ʐ`4 ʠ`&> saT@@* 0 @, @,7'􆈠NL `%`"v݀"F@` `? @ 7/ޢ/ߒ-`ܐ@LD-`0,Ґ@F,4?ɔ`k  1-`@` &` 6H &0`  6J $T6Bd   @3p$  @3k$(   /> t;> s ̐ " 4`" 0$d@^$ 2V`ဠ`L `0`a$"@4ؒ  @4԰ 0 > rcah > !4a`ad #at#ah!48;a`#a`#adax`(  > @Vap> @# > @ 0` > u?!(     , &Ѱ c$̰ x | 2 x O@@P@90`[@ > u?!(Ѱ *> ub4D  0 x  ` x  X`  $ t"&dȐ &d~ @!ːz@!v@.N@(*@Ӱ > ub Q  I L $`2 Ɛ " > saPT > @ap> @#> @ 0I@" 0F> ub %> l  L $`2 v " > saP. > @ap> @Ð#> @ 0#`2@Q@B S@ d|  @26$  @21$(`ɰ    Δ$($ q@]x$ `ꀠ`L `l$ "@3 @3 0N`(!> w> s a\a\ ` ` `> sbX˰  > u' >  @":  ` @ '@)@  9(> y`@ > w(c &`8 (`> w@c &8 ((> . b y&@#%@I0@հ > sbXi > ub c  @   `T + *((  +`(`* @ *)  @''? ް 0*`8' @B "@,`2 D(0@ o@ `42t D(0@ @ `42h D(0@#d#\#`48@b<@,d2P D(0@@ d(2D D(0@f@ հd(28 D(0<@@ ɰ@@X@& . O   `"&<`&  &. ;  ` `@   $<@2"$]Lה  ><@:8 6p $```2d<? `h  c  `[\0``(V '> u @ E  |` $D @4)$H@߰ /087  @8$@᪐$ @ "-@1 @1 0 > s> l  c|> s > l  c| @$@ᇐ @  "r@1˒ @1Ȓ 0 @0 ?> u!( /> 4` !+>  $`t l d$ )$`h[g * .`4`(  \  0`"`pd<$`0`pa0 @$`p$`t^ h@ȉ`h @$`h#h@) #h  `$  #ؔ x@ਐ> a4$  $ $!t$ $ ` ` ` ` $ $ $ $  ! "  D`" <$@"X@1I  @1E 0z?  bJ   @@6N! @/ > ua` !  `͒` , , ) Zє! ``2 `ͅ) ) @&@1 06@W> whS .`& @0 0)?"C gx'(HX'" "Z& ` `N`  2 &" '2ꢗ  $2増 D &V "ݢ &tM "Ԣ E 2@u 2pN`"Nx`dJ``"â @ ` 2 Nx` `@ 2 ˪` `  & F` D`2"@0@0y 0?ꡐ#d 2   V   ``&?ꌐ#d "cN A "\N ` ( @` | .x& `t `ڀ0n  [) 0i2ʇ( &@0+ 0` `$`\&Z #,$`$`` #, [  0K@0  @0 0C @0 @0 0:@0  @/ 03@/  @/ 0+> .b `<@``L` @  W    $$($ @Gd@Y$ 7`ꀠ`$ "@/ @/ 0 @$@g$  @ "@/ @/ 0`ٰ $$$#x$#|$#$#$#$#$#$#$#$#@/  @/ 0Ő@/ @/ 0@/  @/ 0`"$$<<`$$< $`"  T`"   2  $|x 0 2  $|q" 2  $|j" 2  $|c# 2   2  $`" $ $u`"  $``(  $``(  $"`$"$"`$ @`$ `,`W$`,@/  @/ 0N `` ` d<@2b ` 䀡 "bb$"" b"b$"``$``` d<b``` `4$`0 @(`Ր ` u`   2  |ڒ0 2  |Ӓ 2  |̒ 2  |Œ 2  € "̐ 0B,՗2 " u@.  @. 0> .`Db@  @ Y@$` @2@> x> ycD>~`PcT`@@`$@(`@a`@$@.\ @.Y 0@.V @.S 0@.P @.M 0s 0~@.F  @.B 0w,@ 0r@0o@.7  @.3 0h@./  @.+ 0`@.(  @.$ 0Y`"( b$"$"b" #"b$"`"$"` @` 4`$`7 + 06r,42 " PN@- @- 0'  2```B `@㿘   & ` d<b`  `& ݁㿘>~ #T > @  > @  㿐$   !> 7> u#( #\> @V`    #\> u> "@L`     #\> s> !@B`0    #\> t> #4@8`@ H   #\> s> "`@.`P    #\> u> !@$``    #\> u> #@`p    > u> !,`@#\@'@#@)> .bb  @ > >>b8@@ab$ 4> u> w a( d> w%#> t    > u aa `> u> w b㈂ x Ta Ą# - > t Zcp  r#@=  $!x@V$!1>$!|!T@ DXHd"1`2-$-"䴀`"" "Dd$ 䨂 !$!$ $`K $@"J !$ d2 d !$ɒ$`"d"7 d䬀 ";d#$ !$!$ $`*#d$@"? !$#d` d`1"dd@"#d#d 䬄 "!$ !$ !$"!$#d` d䰀`"dd"#d#d  $"!$k#d""䴀`2d "d$`wd  "`2R"@ Ld `2 "d"d d`R d@ " d"d d`. $`y"d䴀`"dd "d `"d dd` d䨀@ " "d 2" "d"d d`F d@ " d"d ""$䴀`2d$!$   `K!$䨀@" !$ dd "d `"d dd` d䨀@ " "d 2"0"""$䴀`2d$!$   `#d䨀@" #d ds"""㿘dMd 2$Vd$`2$$$"`""d@")$"d$@"(dd9$d9$d""@" dd d ` d`2d@"dd9$d9$dݒ"ddd"`""d@""d"dd$ 2$$`2 $@2$0 $@$` $ 2$$`2 $@2$0 $@$`   `" `6$$`2㿘 @ 4 &`+`" '?` 8!?(``&1  8`8 (J`?(``( (`8? )`ݐ  '` (݃(`?H@  8@؂ ?㿘$$܀ `[` !@$`2*`6$*`2`$4 @6$6$``$,``4 6$"" " " " " `" ` *  *? $"  ""   " "  * * "  ?(@"   ?(@(@ `   㿈 '''' 耦 d>@-jbx$>@-cbx㿈$''''!>@-U"x "$> saP $"x@-I > saP  > @iap> @ > @ Ё> @^ap> @ > @ $㿈&@$'`?'`'  '>@-bx "> s$ >@-bx > s&aP( > @+ap> @Z!> @W 퀦aP($ > @ap> @J > @G $`k> c<@' \`d'''''l > {$ ` $Ȁ M?$ `IԀ`  @`&  $@6 @    8 `?` `Y> {  `8> {&$y'  "e   @ `դ@Ӑ$ @>$> <@ >  `X `Y`` ` -  Ӧv r `Y  ܔ> {I8r b   "9$@2 `Y؀`2`2`2 `2= `X$> z@* `4> {&w "k `Y$$܀"f `Y$ @`] $Z > {@*ݐ! ƪ`e `Xn u h `=  $@>$ @ ``P`" `[`@8@ `[``" ``Ȃ  K0> z`a0`\Ј ? Ք @$@>$ `P`" `[`@8@ `[````0`\Ј  @gO#"" " " " " " " " " $" (" ,`" 0 `X* & `Y* ' `[* * `Z  &`"!`4`" `8`P`" `[`D" `[``"``2 $`\` >c4 * ( &`倠``4""`<" `@" `D" 㿘$ ` \$Ȁ g$ `ca ` 3/` > saP8^ /`/` @@d8dh`C @8d8D8dh > {Ra$> {@)! ` `״ `Z`ф `Ӏ /`@(`@d(dX`C 8d(@8dX $ `@P "2> {(`@:P@` @8` > z " @)$ 2 `> @ap> @+!H> @( Ѕ/`/` @@d8dh`C @8d8D8dh @ H &P0֝㿘$ ` $Ȁ / $ `+ )  $ @>$> {Ra$> {@)t! "$ `2$ "$ Z`2$$ @>$> z " @)W$ 2 $㿘 $@ɒd @`㿘   $ " $ 㿘  Ӑ &$$ > |>ցa !P㿘  $ +$`"  $`2 &d&d&d &d &&$&$ &d&d&d&d$ 㿘@ @@ 㿘 %> {`HHo (@a" P Z. Z P`@=& PHp@& T L 㿐2Ho(@a&$(&$,$( `( `, ` ` ` ` ` ` ` `$&$X&$\$X `( `, ` ` ` ` ` ` ` `$&$&$&$&$Hp@&$ f  0ǝ㿘  $ 㿘 P`> {@ܐ H [(`(` ( 1> z! @ё㿘`@> zaN`> wcT㬰? 2 @㿘N`/"N N#`?@H#N`0(`` (   `/ J`/  $ @ P$"@ N# # 㿘N$`&N$`?@ $ Hd$0(``  $ $ @ > @ap N$`0؝㿀> a4  ð  R 'd `#d &''' 'd''d!>@("x "xd@(  쀠`> saP۰  > @ɒap> @!x> @ Ё g  d&㿈F g A C  $ ` $ &''' '$''$7>@(\x x$@(V `> saP  > @rap> @!> @ Ӑ  $&㿘   L  > 0c @c  L  @f㺠> c<@' > a4m:`'M > |P NH$( 2+   2$  "$' ,$(< 0c @cސO^$( ”  @ > @eN $( ǐ  &.@ch#㿘?Z >  E> |&  ?!PX # 4$(MԲd( * ` ` `> saP   > @ap> @!> @ Ё Nה$(d(Ѳ`> c<' `+  M 4    4< 0c @cMu 4  /N 4  4 > N 4耦@eސ@b#x> `Xc<' `6`"$Ho`4 `Y(@a`X`Y`` ``` @ `01`0@( Hp@    >  @( 0$@b#> saP? > @ap> @"> @ 0㿘@``L`㿐`#$ "$@#- $ "$@#' $Ā "$$̀@ @+$̒> z@#X  YȒG$㿘 $ɒ 2$㿘1> z @Đ#X  Mt$( $e "&$ @`" @$@& $@& @    &$&$&$6$6$> z @#XҰ㿐@  $ "$`<`0@c @c [`2 L$؆@>$ L $ @&$$$܀ @d [6$6$ Ӗ ``L`㿐`"`"`<``$`$`2 &$ $Ā "&$ . &$&$ > |!P$Ȁ "$`"$ > z   `2&$ $$  㿘$` `&$$ > saP > @ap$> @"(1> @ 㿘  $Ԑ$ 2$ԁ㿐} ʐ  `D``<@"' > |?!P' 2 d ܐ d  W  ?&d &d'& $`D㿐}4 > .> |'?!P 2 $  $ `   $$$$' 2$  ަ &u` <`$<&@ $D㺐\> 'c<@' }geca`''D > |'P 8<0c @c@ @K$( 2E   2> u "d "@$d@ "<$d5 2$ɰ$(I 2'  L $( q Ȑ > <@ .> @bzJ$(  $d'd "􀠠 `$(À`'$(Ȑ @`#㺠> c<@' }R`'; > |P <0c @c5 5Ju$( 2:   23 ْ "d " 7 3 2$ϰ$(3 &K|$(  Ӑ @ > @aJ,$(   $d$d'$(πH΀@_#㿐=?w :[  2> |'?!P} #> ap2  @Ϡ $ `$$$$'  ` &@ `㿘> |P!P> z` $Ȁ $``&$$ ` h> c<'  $( 8@'@ϙ  h@ϓ$ > $`` &$  > $ S`0@^#a4 ͖ 뀤   $@ &dȰ$   "&do 0̝㿘 $ 㺠> c<@' > a4}O ''`A  > |`?aP= 0c @cC`CI*$( 2H  CŔ 2A (`'( "Vd 2  ?( ;Q 2$ ̰$(l=  &> c<@ > J#$( C "(  > @`H֔$(  ( @$d $d'$(ŀ   "ݰ  " $d 2$ $dO'`$ @! $dȨ a$(6  '(  ͒ 2$|$d'(  Ȗ " "$'$d@] 㿐}/   ( $ ``    А$`> saP8 $$  > @ap$> @L"P> @I $$x> `Xc<' &@&`&`&` &`&`&`&`&` &`$&`(`8&`,`"$Ho`4 `Y(@a`X`Y`` ``` @ $`0@$ʘ Hp@@?  > `0 @$ 0$@]Q 㿘@` 1$<`0@c @c `L`"#$ `[&`T``$؆@>$؅<`0@c @c2`L@_j`L`$@&$> saP($ > @ap> @"> @ $@&$㿘 *(`(` ( @ > z ! @@ / `*`$,, [ [`" L`* `&`> @"`$4 `L``/ \ " `&@0  `& ``"@ `' `(, X, Y Z`, Z 4`$@ , 1$ 4, 0``` $ 8, 1 $ <$ @$ D, 0@`$ \X> `&c<'''''''' ``I`"U@`' $$ Ho4(@@%MذHp@  `2  <> @  ` X Y`` `  a˔@$ /'/`' ``` ` $``` '/ق '''/@\4 0`> '/c<'''''''''''''  @` ``''Ă?''/d  @ '/> @[ @㿘 Ò ,P ""> { @2 > saP8  P`D@: @P`D> @Lap> @{"> @x P`D @r H &P?㿘  P " > { @@: @P`D @U H &P?H$> c<' ?"v$ $ `"O  ~'''' (  Z`" L' Z* Z$ L'` # LĔ  2 Z$ T$ L'`2  | k b$ $$$&$&$&$$$$” $  `C 0֠ &$  >  2 @[" X㿘> a4 }E ٶ @ `D`<`<@8> |?!P 7   ː  d  F   &d    $> 2$$`DƐ2& &`а  p> \c<@' m    C  T    D` <@" $ 0 @ 'Ԃ`;> |&$ aP `?  n Ԯ $N\'Ԗ ` 2'АԒ L 0 `l `?m  D 4   {  " `@U`4?`0@c @cF 40"@\ِC "Y  2$ L' [`"VجԺ`ؒ $@8$ @ʪؐaP" "$Ȓ   "Ԯ "$'$> @Z  p `?א` )Ā "   Ԃ`+$ ?$$d2& D B'   07@<ؐku  㿘 ! $ à    `[` &`T$`&$$؆@>$؝X> c<' y ϔ 2g  "b $ `]'c   ,D 4 9 ﱐ 4 є `@?`4/D 4 2"  & L'`@2 4<`0@c @cΐE 4 Ґ `;0"@[E 4Ҁ   >   & |  @Y `> c<@' _b A 2]  "X  `xq   9C 4 F % A `` ` 6< ? C  Z`@?/ Z``? 7Ca 4  `@4`4<`0@c @c D 4  @ "> "@ZT 2 Z /D` 4`@в`4 &ܰ @X @> c<@' > a4`'\'y'd'  2u  "p d `ހ`j > {`?!(  : `> D'''  ' * Z`@`" L' /逥 "  TB͔ 4 2  Q 4> 0c @c<6B 4 2 P /p  "j Z`ǂ` /   > <@ > C 40"@Z5ĐC 4  4  UR&{& G.. @@(` @BV 4 2j  L 5 4j /Cx 4 L   d  "  O'%`L' / `[`"JdؒM   '.ϔ  ' `2 @ &  a> l䀧  cM/@WG @ c<' yR c 2K ? "F d `P`@ d  8```@LB A 4 2' : 2" Z    Z* Z 4< 0c @c B 4   > "@Y$ɐ 'p     ` Z@U / Z@6"   CAH 4 2\  L 4> 0c @c+ %A. 4 2E ː ? ɀ  Z@Ѐ̀* Z`" L'BE 40"@XՐB; 4ð   ///'' x v& rI0le@VJ P> c<@' > a4 y' j 2q F "l  ``f > {`?!(   ['m   0@ 4 2= A 28  a \ r /途"_ " `=@ 4 z:`4<0c @c%`ʐA 4  Δ  ef @ U> "ߐ@XA 4ʢ`4@ 3Y2& @ 0ڂ /  "ð  $ L'  Z`@  /Q/  /р @Uk 㿐$   #\> z> #X@zޚc \   #\> z> ! @zԚc `   #\> z> !@zʚc  d   #\> z> "@zc0> {#\ H H   > @zc@?> { `8`8 > z ` ` `  > { ) (a   +a ) 㿐> a4?   T$'&  > |?!P .I !`Ho` (@a .?|$ 2dHp@$$'ꠐ ؐ`> saP   > @;ap> @i#P> @f Ёd@$0֔w値`Hp@ > @c<'  `    (>Є Z`2 ` & L` ``&` Z` `&`&`ږ  Z . Z`&``> 4 2Ŗ ` `4&` X`[` ``\ `\ Y> {   8`> {! ( < $! , @ ! 0 D! 4 $` 8` <` @`  D`&`@Ho $(@ P Jx?  P ? Hp@ T@K'`> 2n ` `i&`a P``X\ `X Y> { ꉐ  4`> {!  8 !  < !  @!  ` ` ` ` B $> @Sݐ Ђ 'x'|''''''''''''''/i`? `㿈 ''''Ho 4``(@a``&`X`?`&`\$>@bx```?"$`2$Hp@造`$>@גbxHp@㿘 l`)  @2  @2  `2  `*  @4  ` @2  N 2  `2 "v  `" @` 2 )2C`v``" ``(@  @ @%ܑ*  2 @% * 2 @2 `2 2   `2 `" @{`*  2 "| `@n*   @ɐ * 2 @Ґ@_%*  2e @% * 2 @2\ `2V `"Q @E`*  2K x"  `"C @7`*  2=   `  @ 2  @ 2  `2  `2  `2  `2""`"` "`"p> |!T 9!T@V7 &  V? ? ? 쀠`? 7 `2耈``@2 (7 ːޠ "> saP  ͐(`7> @ap LL , #\, > @Ӑ > @А ЁaP > @ap> L !@,> @ Ё㿘`) B6`  c+c6`c `?c@   > s 0c@ "`0  > saP'  @ > s 2 > saP   > @Lap> @z!h> @w Ё> saP 8`?> @6ap   , L> @`!H>  @\ Ё> @%ap> @S!(> @P 8㿘  @ > |aT  ` 2@ @"  @``  2 6 |  l6 x 6 ~ 6 z . & . <ְ @ p x z | ~   > s'''aP'?7777///'؀ .'%> |T 2@!> | @t" Ȣ p:  x 2  z> |4` |!X4` ~4` ,` ,` $@@t,` 2"@s  > @~ap> a> 《 `> a> ۀb> c> a> ۀ b> c> > c>  a> ۀb> c> a> ۀb> c ## 2 `#\#`,,`00`#d##h#t# L#l#p#|  ,#x+`> 3`@~t!> @~q %> |T s!> |@ $   , L > | 2 @ 2 ,@  L@ 2 > | @tA!X ; l, +, K, k@$$@ T 㿘%> |T > |> |bX $T`" @@s"$`2@@sT 2 㿐 l   !> 7> |#(!X#\> @u֚a> |#\"    > @u̚a> | aT㾸>  c<'    $?   'X'`7Z'\'d/b'H'L'P@'T^@7^ D@'Dp @ 0`(`쀢Y7X`U`TP((`0@'T'P  "C @> s`/`$  4 $ "G2 4 TP1 (`) @?P҄#2  TP1 (`) @?P > saPA> |H!T) ( mk TP1 (`) @?P4n TP1 (`) @?P'H'L'P'T'X'\'``D'd``(`^`(7Z@/b`@{7^[ > @|ap^> @XbZP`> c> d a> ۀhb> c> `a\> ۀab> ca#l#|`. #h0+0`;`#p#x#\#t **223` > `@|א!> @|Ԑ ~> |/a ```/l/m/n/ol`^T^Y7^ /\A/]> @O"@P>  c<'       @  `  `2#\* k 0> @N"X   @  `"1`2- -"`""  "D`   ! !   `K  @"J  !  `2 ` ! ɒ `"`"7 ` ";`#  ! !   `*#` @"?  ! #``  ``1"``@"#`#`   "!  !   ! "! #``  ``"``"#`#`    "! k#`""`2` "` `w`  "`2R"@ L` `2 "`"` ``R `@ "  `"` ``.  `y"``"`` "` `"` ``` `@ "  "` 2" "`"` ``F `@ "  `"` "" `2` !     `K! @"  !  `` "` `"` ``` `@ "  "` 2"0""" `2` !     `#`@"  #` `s"""㿘`M` 2 V` `2   "`""`@") "` @"(``9 `9 `""@"  `` ` ` ``2`@"``9 `9 `ݒ"```"`""`@""`"``  2  `2  @2 0  @ `   2  `2  @2 0  @ `   `" `6  `2   " ```2@ `" @2`  $`" L`X\@"  `  ` @`    `  (@@ 㿘 N` @ @?`Ђ`` ( ` "  `2@ `"  @@ϔ  2`0ٰ >c 㿘     "   㿘  ܐ &   㿘  $ + `"   `2 &`&`&` &` && &  &`&`&`&`$ 㿀> c<'  '''@4'!> |#    > @K"p @ Ȕ @ > a4 Đ#& & & 0㿘#> |%> |c@%'> |('@> saPw (( " @ *  uc'> |(`(`"6•*@ 5 $c$``? 8 ($( @@(` #`$+`'#`#`#` #`#`#`#`#` #`(#`,#`0 !+`&  4 `' `' 0 8@)( `'`8``@(``$˖ Ȗ?`〦   #` #` #` `(`Հ ````΀3`> @xuap> @x"1> @x > saP} > @xeap> @x"1> @x ```"3`㿘 U  Q6`  `  D" ````?8 " \`"  ``"H /``?`F`" `E`` 2 `2  "(   22 Ȁ  \`" € `?2 ̀`2 Ȁ`Ђ  `` ` ` ``"        㿀!> |$#` ''_> |#b #\#`#d  > saP > @wap> |c$> @wȐ#> @wŐ Ё``> |``#`1@`2`> |㿘 `"  * `3`&> @w#`7&  `" `> .b ` ` `> |#@  `&  `  `&  ` > saP͐ > @w0ap> @w_#1> @w\ > saP > @w"ap> @wQ#X1> @wN 㿘`` `> @v# `&  `&  `& 㿘 > `L``H !> .$"􀠀`T`a2"&$@v#㿘 Ā "  ߐ  ` `  `  2  " \  X  H>Ձct 󀠠" 8 H>Ձct `( >ibИ ` >ibИ 㿘 P Ho`(@> .`  @+L $$ & P  Hp@a> .㿐!> ."`> 7c(   d #\> |> "@ns` @> | c @-> | b> - $"> @v 㿘Ho`> .(@a> . 0`  $  $& P>@+x $ OHp@> @uא 0> @uӐ H㿘Ho 4> |(@a> |?#   2Hp@㿘Ho`4> |(@a> |?ː# 8$  @$ y Hp@ 㿘Ho`4> |(@a> |?#   @$ R Hp@ 㿘Ho> |(@a> |?#{ 0)> `*,ː 2` @ `!4$ j2 в`Ѐ   `Hp@&  Hp@ p> c<' Ho`4J@(@aJ@`?6`4> |?# !> $ `8 `< ` ` ` ` ` ` ` `$ `( `, `0 `4 ` d` `8 `< ` ` ` ` ` ` ` `$ `( `, `0 `4!4 ࠆ 2 0 @!> |#  `ܐ`3W `#`&`&` ` ` ` ` ` ` `X `\ ` `$ `( `, `0 `4 `8 `< `@ `D `H `L `P `T&a@&aDa@ ` ` ` ` ` `܀_ -)> (`@`@(`.  @` @@@ @ 8@ @`@ C :@   @ 8` H`@ C :@  ` ۂ1``PЂ $ $ $ `8 `< ` ` ` ` ` ` ` `$ `( `, `0 `4$ `$ d ` `8 `< ` ` ` ` ` ` ` `$ `( `, `0 `4!4$ 2Hp@ > ''' ''Ђ''c'@F"㿘Ho (@a> .`l Hp@㿘 $`" 4L`0H`,Ho )(@"+  ?@`   `  `L `L EH > | `H @iO"& Hp@a L `ȝp>  $c<'    > +> | b@j  Ho_(@> @` T> $ L L "]  ```$ TВ@ה `%`h`w`n`e>  T " > @ > "@@r`> ʼn!p 0  4$ H$ `"$ `% L, `, a$$   L ` L$` Hp@ V $ La> @J` > 0 H   " L L "b b@hHp@h >  @9` `%`@3  T>  @-` `%>  @'` `% yЂ v$ T@Eǐ"㿘Ho > .(@a> .` " > AHp@@rʐ 0㿘 Ho (@> .` &  Hp@a> .㿘|Ho > .(@a> .` " > " & Hp@@r 0|\@Ж " 'ނa1   #@!(@ ! 0`   @0  @ ) @ ! 3`@!#@0`#@ @(  @0"@  1   #@!(@ ! 0`   @0  @ ) @ ! 3`@!#@0`#@ @(  @0"`  1   #@!(@ ! 0`   @0  @ ) @ ! 3`@!#@0`#@ @(  @0"`   1   #@!(@ ! 0`   @0  @ ) @ ! 3`!#@0@ #@(` @ 0`@"` 'ނa1   #@!(@ ! 0`   @0  @ ) @ ! 3`!#@0@ #@(` @ 0`@@ "@ " @ ` ````?>  lc<@' `!   d`= R> s ' ' ' ' b`"< b4bh/ xۂ``  @ ]> `;`S?> saP(  > @q` & to>  @qŐ!80 p | t x'''' b`2ʒb b4`" c$Ēb`ƒchaP ð >  @qq`0 &?ð> saP(  > @q_` & t2>  @q!0 &`H@Cܐ#(㾨`\(` > '4<'L' 'H y $ ```y s'H'L`8L (`> U ` ~ Q 8`N `J `F `BH  @H% D@H% @L@H% <L@H% 8L 8qkה s > s 4&4`#\ `, > saP( s`  > #<@  m> `  `  ". ~ s> @pa `s} s``"98 $`ـ`" >  @pɐ >  X`I s`'H['L `e`LH 8 ` pu 2  ` $?8 l`17F`"E 8k]kY  + "U \ X ` l h'0','('$' 7FkB   "?8H Жp8 W8"U $q9 $`B`!LH p$ 2e  $``"*  `8 lHՐ  l `䀠`uLH 8 ` p 2A  $ ``" j   "p s ` (LHp sLj͔ ` sLHp ` s 8pϐLHp s s` " $`" $`//ʒ `j> rc4@'<ȒP> u!( l$ À "  jx`(հ ` > @oaX rg> @o!r` >  @o > \`0 s8`'H(J'L d؀y \H X ` l h  `H>#\cD#`#d#h#lLK 2  l hX7FpS $ `ဠ` #\#`#d#h#l d؀"88<8(@ F0) @+`0`b  @ `H؀@"88 d؀" ` ` l4 ,,@@@b  ($ 0`H>#\cD#`#d#h#l,LH " $7 `H؀@" ` ` ($ 0#\#`#d#h#l $``"  s`H夔?2 s> saP(  > @nВaq >  @n!>  d؀")> F> ) "@n2`!> `H؀@"> F`g?8ibH`2Ӡ 8@X H% 8 ``H ` l#\ h> 8cD#h#`#d#l \LHw X " $  ``H ` l#\ h> 8cD#h#`#d#l \LH^ X " ` <> @n" $`2?8 `2?8 `2?8 `?8@@ܐ#@`Ѐϔ8 `} `H؀@@Ȯ \`2؂ \i#҂ \  ` `#\ l h#l 8#h#`#d  ` `#\ l h#l 8#h#`#d`2#i` \ ` \ ` \ `2 \ʐ`  ` ` `ې 䯔?> s s `@ Bx>  @mؒa> `5  $`2 (`. ,`"-x0'H>  \c<@'  ''''' b#`#\` ]  `c`:a  , |/7/hh ^ Z7܀WV@ \7ޒ w " \b``0  (`4",>  #`#\"   ``"  @2 쀠@2 耠@2 䀠@2  > <@ t>  ^``   ? ,@(``/ /`42 "N74/`/ 42 `@"(0`@ (0`@ 7ސ    , @XБ2    0?(@ {4(0`@t7ސ  ? , @X2  ? 0@ ϔ  X 0@?^#P 0@X> rc> xc<7' "`> `(> b0 b> `8> b@ > @lbH`\`o`> @lܐ"`^`o}`,> @lՐ b4`b~b#\Ӗ€ `?@U6`\a"o` b`2```Ub @  `A``,@a# ``g^`gZx`$ `> `(> b0 b> `8> b@ > @lQb`\`o$> @l|"``^o>  @lt  >  ```*) 0``16`\`"6`\ b`@@ -    ` ```,@`͖``) 0``%6`\`2 b 6`\`^6`^(`0``Q`"6`^~ b z6`\`^6`^(`0```2r b n6`^ k6`^ h6`\b #\#` ?b`26`^``*b@ ؒ ``,@`| Z`x`(? > @kapbb~> @k"> ?@k 0u /6`^@><#`> @k]"`@Q7b``,@`~ 3`x> ``c<7@'  Ĕ@ b"4`"~"#\• >&`fi`6`\"`2`ߐ " #\#`` 2ѐ?"``:`,"`"1"`^" X` @@"@?c8"7&`f7ℐ` 6`^> saP(? > @k6ap""~> @kc"> @k` ?> @=#x`27&`"k" a@ \`"`@ 0\ 0\0> c<'  "? < 2  @? |> `> .wc@t> .c+``" `D`jt''/'/'''''''''''''''''''''' d/' ' ' L'<<'  ' 8``(@ v`4 =?  ''  HD''/̒ e  ,e   \ ^//77``@<` @`D`@9 C<` @@Z 0@=#~ z&<?'''c'㿘 @㿘c-   1> .> .,   @    1> .> .@!  #@4c! c > .@ > .&# c 㿘1> .#> | c1> .#` 1> .@d"@ϒ  &#> @i# @ƒ  &#> 㾸> c<' > .> . c   2 >(J$ `@4@ #$ ``"% `= @@ @@@@k  > Ц``ဠ` (@  @˖ `(``  `@  @  ` '(Ų@  (@  `; ( 0@ @t2@ @$$ @ 'ؔ!   @  %    ?% $$5 ``<&(#\u՘ 2 `>p/dPtdKx` @|` @a```b`<`@#\`Pnښ 8.`=<@h ?8  @# ;  ` ?8`=` G $=`"  @,  |h 3> @h#@;#> @h#h  @ 8@@E  cc6``6`bDcޒTcڒ㿘Hof4"(@g"> .c(` "" "? @$"$"> .c c)  ?`?2ZHp@@r @  0㿘"  @X E $" 0> @gI a>$ l>ah$!$!>?$$!, h> :` d$!, j@m@lƐ D u@Vޖ dHo&(@> |㴈㴀`$"㴂" $"> .c`> .c.` Hp@ g> | > .Hp@ 㿘Ho4!(@g!`&! ؀ 2؃Hp@ @0 (`@ a" !&!Hp@  a ؀ 2؁ (`@ a"   a㿘 D`@`    \ C`` ` ` . `((@& 4` ` ``((`@(& 8````((`@(& <``(`6 @``(`6 B`. D`. E``"i 0  \ 8ô   L. `((`@! 4. `((`@& L  ((`@(& P    ((`@(& T  (`6 X  (`6 Z . \ . ] `} Hy `0 H (     H((`(@f'`(h`\  ``0 0`(```` 0((`(@'`` ` `  4. `((@! C.3   ` > |c`0@8`0 > |0> |c`0?@8`0 *` *` *` *` *@ *` *` *` *` *` *` *` *` *` *` *` *@ *` *` *` *` *` *` *`  ʂ`2 > .c܀  $#̂!#"$"( ("(? @ $""$""((" $$<"#́!#!$@"$> .c܀ \0``> .c܆ ΀`" @"  @`?`   @` *   > | #>)c 㿘 @ T .` .` .` .`.@ .` .` .` 4.` 5.` 6.` 7.` 8.` 9.` :.` ;.` <.` =.` >.` ?.` @.` A.` B0`.` C.` D.`  E.`! 0`" L`.``.`  0.`  0.` .` .` .`.`  L.`0 M.`1 N.`2 O.`3 P.`4 Q.`5 R.`6 S.`7 T.`8 U.`9 V.`: W.`; X.`< Y.`= Z0`.`> [.`? \.`@ ].`A H`" `.`(`.`) H.`* H.`,.`-.`. .`/.`+ .`H .`I .`J .`K .`P㿘  4@i !.@ `.`  .` $.`!h $.` 0( 0.`!.`$.`".`#.`'00.`&.`% .`, .`- .`. .`/ .`( .`) .`* .`+!.`0!(`0`0`.`2.`3㿘 > .`)c܇+`#̅+`> . c!##  "  !  +` @ ?. & & 㤀"#́##́+`@ c > > >  ` @eY(D㿘 `@`> v  @[!$&@  㿘$`> s$8`> saP  @4͐$@4ː$$&#&$&$ &#> @e3`@> @eb P> @e_ @4$@4$$&#&$&$ &#㿘> .c#  ``%>   l!@y?> .b@t`> 'І$(`@4> saP > @d`@> @e+ h>  @e' Ё a0   ((`(@@! > saP̐ > @dݒ`@> @e  > @e  0$#$#@4a$1> } 8`2 ##> `> `@?#؀` & 8$#> saP > @d`@> @d > @d 0?> @ڔ$#؝㿘 @Q㿐> 7cP> .c>  @&`A   ? @$$ #쀦`&# ʂ&0  d d` `& + 2 "  #\   @W "@Y`&``2" `U " @ "@Y `_ "&#     @ "@Y㿘> 7cP> .c>  @%`#䀦 2 > >  @2@3  @cϐ!㿘 㤀" ?(2(΃)  㤂c 㨈  #Ѐ"$$<"! ? @Y6#Ѐ"$< &#? @Y$#Ѐ2$<&#?c$@ $$2$$<&$<&$@ (&#́㿘> 7cP> .c>  @%6`c`B ʀ`>`c:c쀠`88cb@Y  0`: `.`: 6 c`$c c c $c>@1|c@3 > pH`` > `l@#  @3   "Ȑbؒ Ðb㿘> .c܀̀`( \`@D`"Ⱀ @q  !> #@ # @  `#  @& ̒& & !  (@_4`4`    @֐ , ̒ (`0`0`,`,`> s !!lЀ *   ,`(  ? @$$   @ !n @XRЪ`  ` %,`0 ,0 ,,, " < !N@ %@<  ? @c`  @ $`4@$ $"$ <%<%@,0 ,0 ,,,> .c  &  @` @@?,  @  %/`c%,,,, - ,00`0,,,``դ D` `& ̔ & & @RD & & & Ⰰ`:ఆ@= @8`C =ఔ  x@~К > |c`x@8`x (%́`  Mc``@8`` (%́@-> |@c=`p@8`p6 (%@؞@㿘> .c# l@@(<##̂@<#$#Ɓ㿈> .> scT''  / ''/7> $0/ @'ؒ 㿘> saP> .c> u`!> a0$`&$ &$ Ӳ @1$$ > @b`@> @b2!H> @b/ > u &$&$  @1$$ x> 7cP> <@' > .c>  @#Q`@  \`@2 '@ >   '''''//7ސ@Ԕ 'w 0@4G 㿘 > .c܇.`.`> . c.`@#" c`l@-c̈`$c& # & # @$#. ΁> > >  `h@a(*㿘> 7cP> .c>  @"`X`#`\`@ ʀ``2 c̀`((dH ΀````>  `Á  ʀ`"c > @`!@1d  Ν㿘> .c܀1 ʀ`"  ΀` ``` "> @`Ӑ!f > pH`` > `l@!J> @`!㿘> 7cP> .c>  @"m`p``\`@ ʀ``" c ΀`T`(JdH ΀```"> @`"   ʀ`"c :' `!`5 ,  > 0 @`> pH`` > `l@ >  `'2 ς`, c`@>  @0  Ν㿘> 7cP> .c>  @!` ddp2  `'  \`@ ʀ`#̀`( $H . ρ ʂ`6 ʁ@0 㿘> .cܒ @Vb 0$ " $ cc`l` `@$c> $ cԆp c$cԂ@ $c̅H`` > `l@ q 㿘"`) \`@%> a0#&#5> }8`)> > saP&8 l!@z?> .b`@t > 'І$(`@/   > @_`@> @`*"h> @`'  lP@  > s㿘"#k`"  \#܀`2 \`@4 \#܂4 \@/b$H > @ $# \`2k㿘   +` `(( @`> s `` > saP> |c`X@8`XHo(@ 3 2+` 0* @ (`@ ` *`@@i f $ , - % & ' . ( ) / *+`*( (`* @ , *`)   ++3`3`3`. ,3`. -. .3 3 0 . $. &. (. 3 . !. *. ". #. '0. /. +. %. )ah*( ) ` G`"Aal`@ @"F`=ah , ( + - . / ) *(((`+ @) +` @ =`Hp@ > @_`@> @_F"> @_C > |c`X@8`Xa  h @(`Hp@M> s@ (=ah0㿘 ,  㿈?> | cZO "<X`ʀ`4 .       ) +`(`(@ (* @ ?    ((`(@' ѐ  ְ a ΀@ | c  `r0ʀ/       (((`+ @) +` @ ?    ) (`(@Y' 2X @ | c  `r0ʀ/       (((`+ @) +` @ ?    ) (`(@Ye' 2X @ s@\> u b    N((`(@ !@X}? `"X/ @ ʐ`rS4 ʠ`ذ { U? `"UW 8  @"  "` @2ʂ`0r" 㿐> |c > .#܆ @8c c \`@"> rc!h  "  `@<`@ @9  @8`C9 `" `@<``(` @d  @@`(@<`(   (`@ !`8@<`8` @<`  @ > .`? (`$`0~ @ ((@` 値`0@<`0^@   (` Β0{`8@<`8㿘    ((`(@%> saP > @\’`@    ((`@*`> @"@\  > @\ ЁaP `"   s > s `"     ((`(@> w    ((`(@?U`> wc"` @I ``?> t` #4@R "' k_ ""  >"E  f"A kR   h0 o @` @!> s@Q"``"`@Q $H`"0> v@Qz!$0`"> v@Qs!$> t@Qo#4 > w> vbd@:> wd|+`@```` ( 8 9 ` a(`( : ; b c(`( < = d e(`( h> @[`@> @\ #> @\ A`H @  ʐ  (Ɣ  8 9(`5  : ;(`5 " < =(`5 $ - ' >- & - &@+ @ ` P  ` a(`4`  b c(`4`" d e(`4`$ f`,`& ,`& `& &"  `Ȁ`: ,`'    ((`(@$    ((`(@ $ԒpԔ     > 0((`@(> @! $a4$    ˇ(((`@ `(`` @> wcc @#$ ,  ,,! !(`4  (`4!,!,       ((`@(+ ) @ +`@ <    ((`@($ p q r s((`@($4 t u v w((`@($8 x y z {((`@($< | }(`4@ ~ (`4B ,D ,E k`"0    ((`@($L    ((`@($P    ((`@($T  (`4X  (`4Z ,\ ,] `"H$d$h$0?$, `$ `$ʂ`4ʐwj `  T$      @ A B C((`(@+ )  +`@ %`0g $ % & ' L M N O((`(@+ )  +`@    ! " # H I J K((`(@+ )  +`@      D E F G((`(@+ )  +`@      @ A B C((`(@+ )  +`@ Ȁ`0  P     ( P 8ʂ`94ʂ4ʁ k,`'"I$d `0H (    H((`(@5#`"  i`00 j( l m n o0((`(@#` :<,`':,`' > pH`` > @`lʝ㿘3> r> |c> `@> > 0`Р   >` f ` 8x ` 8x `8 x`"% ``x` `P@<`P ۰ @Y @Y@Y`P``2x ``2x 2 0n@ @㿐`  > }$` `8 @   ( @c   b#\ ( > @QE`ȂcЄc&cԂd<&c&d@ (?&c.c&c&c&c&d< 5 @ <  &c6c `0> @WԔ`>>`\&a&a>?`&@&a.`h> :a` &a%.`j&`ldH>@&`d$>@&bd>@&`@^@]C> @Xa0`D @GW > . c܁ > .>da #㿘Ho(@a@(jd@(hd$@(fdH> }`81> c܀`7dD`b@ `(@bc쀠` c@(K  c쀠`2c@Nbc@ 5@  > . c܃Hp@ p@В?c܀`"dD> p@ǒ?dD㿘Ho (@aHp@㿘Ho 4#(@a# G&#&#&##> }`8`2 ##> `> c@ꐒ?#؀`" $`8&#> saP  Hp@> @XI`@> @Xx#> @Xu ЃHp@?> @g&#؂ $`8&#> saPې > $@(I    Hp@㿘Ho4$(@a$ '> u ΀`"   "*$ @"+&$ `$  l#̂ @a8 &$$$@' Hp@`8  $8   ۢ`$ @ۀ`&$ &$ Hp@㿘Ho (@a" Hp@㿘Ho& (@g0`@Y&! 2!Hp@p> c<' >`0` a@H@(aa@e0a@"#'ذ  > @2 Ho&r(@ \`A@uHp@ ''''''b`ؒ`0@g c' c'c m'Ȱb`"İ (( `l8 Ho&4  l(@g l@D& lHp@ @  8 Ho2(@耠`"+8$c쀠`$E,cHp@ g \`A`@6 \c؀2%@&dHӐ0x& l`$cg`@6 \$cؒ > @ \d`A?> @$c@)T 0$cO؀dD`"c~b@ w`(c~`O$bHp@0.@T  l`l b``l 8c~(c~`7$bc8`">T \$c$cc ` ` ` ccb<)@(@$c 4c,c$c$c??,c,c ( > @ JD$dDA0c4c~(`0`@< $cxc4c~(`0`@<b $cx$c`&'dD`"$b@  ($bHp@ 1cb@<1Ԁ $dD`"$bb@ `($bHp@ 7c~b`$cx4c~,c}?,c|㿈1> r> |cؤ> > `@> > `жp  9> @ @`lY` 1 2 3((`@($ L 4 5 6 7((`@($ P 8 9 : ;((`@($ T < =(`4 X > ?(`4 Z @, \ A, ] +` H )`0 H *( , - . / H((`(@#`֒ S   `0 0 (     0((`(@z#`  ({ H 0 1 2 3((`@($ L 4 5 6 7((`@($ P 8 9 : ;((`@($ T < =(`4 X > ?(`4 Z @, \ A, ] +`"  H> 4$  PC, Y`">  )`0 H *( , - . / H((`(@#`㿈1> r> |cؤ> > `@> > `жp  9> @ @%`lY`   ((`@($ L    ((`@($ P    ((`@($ T  (`4 X  (`4 Z , \ , ] ` H `0 H (     H((`(@#`X S   i`0 0 j( l m n o 0((`(@z#` h듔 { H    ((`@($ L    ((`@($ P    ((`@($ T  (`4 X  (`4 Z , \ , ] `" H> 4$  C, l "`X@  `0 H (     H((`(@#`㿘> .c܀ # $"$<!`.! #`@%> `& $(& $# l` 8@#$#&"$$@"$&"($@ @$$@ $.!& $pH`` > @`l $e#܄ 8㿘 &&@@}8 &"Ă &"Đ@}0 > &"Ȃ &"""ȃ() () @#@ @(`@ 8 `㿘"`#`l@    ́ Ŕ & l@| 0 &" &""(`(` 4& l & l*@*0*`*`00`*`*`** * *   (`0`0`*`"`*`#* * !+ @+ `0`*`*@0`0``*`*`* * * *   (`0`0`*` `*`!* "* #*`**`+* (* )*`(*`)* ** +*`*`* * *` *` * * *`-* ,*`,* - *  *  *  *  *` *` *` *` *  *  *  *  *` *` *` *`(( @@(``0`*`*`0`0``*`*`* * * *  d> (a0`!> wcc!(( @@(``0`*`*`0`0``*`*`* * * * *`%* % `'*`&* &dd*`'* '*@*0*`*`00`*`*`** * *   (`0`0`*`"`*`#* * !+ @+ `0`*`*@0`0``*`*`* * * *   (`0`0`*` `*`!* "* # * * *  *  *  * * * *` *` *` *` *` *` *` *` *  *  *  *  *  *  *  *  *` *` *` *` *` *` *` *`(( @@(``0`*`*`0`0``*`*`* * * *  d> (a0`!> wcc!(( @@(``0`*`*`0`0``*`*`* * * *  `'*`%* %dd*`$* $`   @` -   > }  H>)c 㿘)> < > <``, 2 @~ː @(0`@ (0`@ ,  0`@<  ,(` 0(0`@ ,  0`@< ?0 㿘 `@N   > }`H` 7@8`` , #0$ #4`4 #8<$ #<+@4 @(@4 @MK$ 4 ,  @`, 4 4 > >`P2.`$4  D`  `@*`4  D@@Ӕ   @> `@8`C >   "@l˚ > }`H`@8` `C > `6`$    (0@@?@@ (`0`0@@8 @4 㿘``R`"B# \`@H> }`H@<```.`"(`(` .`0`0`) ) #  7]"(`(` (.`0`0`) ) #   @  2F`@< 7@#`9 \`@&#@ #@"耤`*&# @y  "``(00(`(`(@(`> 40(`(`00(`(`"(`"(` "ք *(` "(`(` (` (` (`  ((((> a0(( @@(`(0`0`0`(((> 40`( (0`0`( ( "( "( "ւ *("(((({(㿘#@-"耦` \`@&#@C > }`H`@8`"`) 1 1 +`+`> a0 > (( @@(`0`0`+`+`+`0`> +`40+` +` 00+`+` !+` !+` !+` !+`㿘#` `  㿘 @㿘 .@   `.  (`0`0`.`:`.`;. 8. 9/  @  ~ /  (`0`0`.`8`.`9. :. ;. $. %. &. '. . !. ". #.`$.`%.`&.`'.` .`!.`".`#. ,. -. .. /. (. ). *. +.`,.`-.`..`/.`(.`).`*.`+(( @@(``0`.`3.`00`0``.`1.`2. 2. 0. 1. 3d> (a0`!> wcc!(( @@(``0`.`7.`40`0``.`5.`6. 4. 5. 6. 7 `'.`=. =dd.`<. <x @  /  @( `/ $ $  $ # 77  @ʘ "Ԕ ' *7//ܘ //7@ "&" @> }`H`@8`@0> }`H` @8`㿘#@ \`@     \#?@  > }`H`@<`#  @W j @  20``@<` 7@Ұ  @  "`` l(`(`(@(`> 40(`(`00(`(`"(`"(` "(` "ׄ *(` (`(` (` (` ((((> a0(( @@(`(0`0`0`(((> 40`( (0`0`( ( "( "( "ւ *("(((((㿘Ho&4c(@gc "/b(`(` >"@ @` > }b H@"bbbbȆ`@&b>bЀ@  Hp@R 0@2bІ@9 H!  &cHp@ 7c&b@ c㿘Ho&4c(@gc "1b(( &@ "@*`@` > }b H@"bbbbĆ`@&b>bЀ@  Hp@ 0@2bІ@9 H!  &cHp@ 7b&b@V c > c<' &`A`   r @ > 'x'|'''''''''''''7`x    :   @0̐   R @ & ','0'4'8'<'@'D'H'L7P` ,       @@0 7    > @8 㿘Ho&4c(@gc ".b(`(` 0"@ @ܒ` > }b H@"bbbb`@&b>bЀ@  Hp@ِ0@2bІ@9 HҒ &cHp@ 78 ''''''''''''''''''''''''Ā` ˜       @    㾰> `\c<' @A c``z `?  `C $`G?` G?? ?''?  ?@t|@rd E ???y >"2  ``  0?D? D? ?''?U ۔ ?@t?@r\d @ E @?  h0> @  㿘> }`@   *#`8 # `&``# " #` `&`2#O# 2 # F#㿘#`"#`#,`1#"`'>!#`@k `#,` "`3>!"@`@Ȑ#"@Đ##,#>!`l@@M "`@ #>!a@"㿐# @Ԕ 'H   5 '@ʐ < #"3"##83#<##0' 3#4+#  \#?@'?#< ##@` #d@ ##<(`#l0`(`c#h @ @  @7 @ ?@ a`##l#P#L @ @*#H#X#\#`#p#t#x##D#|9   /@1##P53@;  @  @   @ @ @ @  $##T ?d##X ##\ "##` ?##d *##h ? ##p`##@ $##H ?##L @##t ##x   ##|#######@ @@ hH ##  ## @ @ @ @ @@ ! ##" ?####ba ####  0> '@H>>c#!#!> ?c##!+ h> :a` #!+ j 3 \%ܐ t'  @O< @Nc   D @8z > }@## @> }> . `@>da #㿘Hof(@g@S> }@2#@2# ?$#"@E 5@B Hp@  @㿈>`0 `@X@ a@0a@:@m @@ @`\`Z#8`W#<`S@> }4`\H #<"Ђ`` Hof(@g:Hp@ ''''#0'#8'#< 7 #/`G3h(&Hof4`l(@g`l@ mHp@ 4`\ @䰒 Xg  R` 􀠠   (@f "F Ho(@gѐ``$#8``4#<``$#0`%,#h #?``(## }4`\ H<"Ё4`\#@ ` $#<?@ ((`0`(`$#@0ϝ㿘Ho4!(@g!`&! ؀ 2؃Hp@ @i0 (`@ a" !&!Hp@  a㿘Ho&(@gG Hp@㿘Ho&4 #(@g #` Hp@`  Hp@Hp@㿘Ho&(@gHp@  > /`` @2@ " @` 㿘  @㿘 1> @G!& ((@@  @F`1> @F!(㿘 @"`& @ 㿐P'P'T'X' Θ㿐P'P'T'X' 㿐P'P'T'X' 㿘> /` 2  "  @` 2㿘> /`20 @ "$ ?  @  2㿘  @U   > /" " `" ` "  㿀> c<' 0'@@00b&@9/00b"@20b!@. 0$@4%#@%0b@     &  > b @0b(@  "  @ 0@!0> l> n c > n> n a > n`* Ho$'(@ > na> l+`+` @@"``?"` "` " `"`"`"a"Hp@  e> n ? 2   `  > l`   x> ܠc<'  > l c  > @M!@a@`` ? > n" 8`"2 㿘`A > na> n @Rax> `c<'     > l> ´c !@m ^ 􀦠@ݒ 0ސ #> @!P㿘> na @'> l> n+`> l+`# @  @ ` `? `  `   `  `` @" #@ "a> n @U̐!c> n> ° @E(!> nሀ`? ` @ #> n @U!x!> #<'  'ܔ '@2 > @!`x!> #<'  'ܔ '@ > @!xR` > /`"`8Ho(@> na`"` `Hp@ e> nHo4> n(@e> na 2 @2  ?" Hp@! Hp@㿘$` > '&$@oa 2$@I㿘 @    `8   $ `$ $ $  @Ԗ( `2 @P 0x> $c<@' 2 \@# @  `A`A" '@ 2> @#($'''/?․`d`c$$      \*`*@*`*`*`*`2` `|6`$< &`($ !@@> 0@PN$`,#\2> ’ 0@D!`㿘$` $  @m $`"$`$`" l` le8 i  m 7`  (( (((((4 ($14`( ($ Ԑ$`,$`=  **  **$$* ( ( ( le  ** *  *  n*  l* C(( $`ؔ   **$0`*$*$$$$`ɂ   **$0`*$*$$$㿘Hof4$(@g$$ $? @$$$$@ $Hp@@b]@Nm$ "$@͒ $ "$@ǒ $ "$@ $ "@׻  @׷ 㿘$`| $  @m! $  @m  le8\   \`  (( ((< 0`@ (((8($`I<`0`@ 8( ($ $`  ** <0`@ 8* * $  * *   * *$$*   ( ( ( le  * * *  *  n*  l* bC  2` 7(( Ð > @C!㿘$`Ho&(@ &$&$p > ' \`> 'bА$(@`@Hp@g &$&$R "> ' \ 0> @B"> '㿘@q /$`2@qI  $ @`4`    (($0`($((( D  @3@q'    @< @[㿘>!`0n@H`@(  0 ap@z1ao@"$@p0@(@$(lh8(@  0ꀢ`p`0@< $`g @6"$`^ "@/ ` 3 $``V3 a@o@j N``$ "&$@_ &$ @kҐ?a   @ԭ  I@&$$ "&$@G &$ @k?aâ  @ԕ  1@&$$ &$&$&$&$$&$& .  . .@K$> :&$&$&$aa.$`$) `) `) `) `)  @@  2 h&$ ``2&$ l l8& l&$㿘> }> / `h@= $!> }> } a 㿘$ @:  l   0> @A*@!#`!$!%$#$ l? `, h4 \  $#, j>&>&a$!$!>$>%@c$$$x$$| > :!$! !!,$ $( ( $( >'( b@%(@G_@F@l D 3@0 Ho&%3> }@o`h" $$2$$`h> }$$``hh$ h$$Hp@ (@g3> }㿀>  \c<' ;> $`>`t`" $ 0> Á > '"ЅH&$(``&$ \"Ѕ(`(`  " $$ \&$Ԑ$@vHp@0В 0@@"H$`ƀ`Hofv(@$ؒ``&$> :.$$) ) ) )  ) &$M&$؀ "$ \`Ӕ$> 'bВ`($@7Hp@0Ho4I \(@g$`?$&$> :ᘆ.$$,  , , , , @Ē &$$ &$@Խ &$$t&$6$@Hp@0[g$Ԃ``g&$<(g$ؒ``&$06 \`e> $$ $ ,``00(( ?((((  $'''777'/?`c7`2`ᄔ@ &$(`s. ($ \`#&$ؔ 0> @?"$ؒ 0> @?ڐ"X$t &$> :aa.$`$) `) `) `) `&$) > 'bР$(`D 0@?"$ 0> @?"$ 0> @?",$@K#8㿀> 7cP> }`> Ð @%cHHo&4 (@g (``82(`Hp@`>> })> } h```> ` ` p```> @?l# @/0ͪ  @ 3 `]> @?X#h0``$$`@$@Hp@`)> }> }> ä`l> > ìbP'> }Ho&4 (@g (` 2(`Hp@ h` ` @ ` `(ؐ `"@? @̐0@  2`0     `/(`(@ > @>#0"@ @`7>  `  '' ' % @  `@@```((@ "2ܤ〢K ef D> a` 0.> ×2@>" 08w ހ2> Ö > @?c-`2> @?Ր 0 7 ` `T$$ @$@Hp@ Xh`k(`e h`2d0_`]d`2dd2dd2d`D(` @/ @  - 0`>$ `@@o<`0@>;02@’  2( @>30 `> ¢ @>+#@02K耠2G@V  "B > Ö > â @?)c> 20@? D `" 2 @/ 1 h `` "/  `> Ô > @>c-`T> @ K (`?0􀠀B > @?! (0`@4> > '0`2ݤ@  `''H> ;@I$ \`" '$.> Õ2!@= 0'$> :ᘆ/$$) $)  ) ) ) @ '$$ "$t@ '$$t'$'$7$'$'$@0> >  b@>z#> > >  b@>r# 7$@$ \`  .> Õ2!@=T 0 $@'$$p@0ဧ v h$` 0> @=B!x0֒> ¢ @=<#0В> @=6 0ʀ $ "@ѣ  @  '$'$"䀠`" l$ "@ю  @  '$'$  l(`耠`> @"` 0@<!%' l``7$ $3`  '$3`'$ > ' \`> '$bВ`(a$@ 0o`'耠`h> @<А!@0d 0> @<ː"> '> > c> `І////d@2dd@" dd`2d> @< (``> Ò`0@< X`d"``0> @< ` `0 T` " P" X" `" d" h\`" l`" T" p  T` `  X`  " T" P" X" `" d" h" l" p㿘 t > / `D0 ( @@d (&@ &` &`&@ 㿐@8`0`*8*@0((@ @3`c+`+  @` 0@ ((@ @6`F.`. @㿘`2 t`7 T``  (` Q2(`$( (@ ($( d@ 퀦`2$(  `<(`" T`4 T`".  @e@'@c@B.<)@`< ` `8 T0 `&"  @& @`8 T0"<@ 8< `(<㿈> /`@h!> / D` #> ' D@gb> / `H@ݐEbШ > n! !> @X@А8"  88`@2*:*@ 3`b+`+  @(` 0@(@ c@ C 3`+ +`@@B " D2`*`d* @0((@ @3`c+`+  @` 0@((@d@$ Db@f D> / `H> 'bА> /@f `D> / `H ``  ` @#@@@@Ȟ@ ``  ` @`@@w@@@ ``  ` @@@@@֞@J $`  ` ` `  ɞ@@@@@@(@㿘N $`1> / D`  `` `  D`2 > @;#h@!@3@㿘@9, ` !@! `  ` `  @@@@@'@㿘> Ò@:#> @;H#㿘!> / D`"@`) `t  $`t @ #> /`L` > /`P B>/ @  $`L D`> ð @:R# @ 0 D@ 2  @ai  >` > @a^>   > & (> `t $`t @Σ ??> a4@  㿘 T`Ho&(@ h @  T& THp@ g T` (  `&"  @& @@ ( 2 <( T `"  @& @㿘 T`: `7 Ho&4  (@g T`2 (`  `"&"  @& @@y (` 2 (` T l& T& THp@  `"  @& @ h @  T㿘@8     "  Ho&(@` Hp@M 0g`0㿘Ho&4> :(@g> :a` b`" `a` a`@>*``2bHp@ > /`P >/@ a4 @ @ > / `L  (8@"@ H:` P:` X:` `:`  h"`( l"`, p"`0  ,  8 @ 8@ 2  0``"` @ ` ` `((`@(1 ` 瀠' 0`0`+`+@0`+`+` ` Ԁ`` ?+`(( @@@8` 8@83`  㿘 @ ` , @` '.@: ` 㿘 `&  > /h2`2  @  h㿘 8߲ @㿘#> /`h 2      @2 `$  @3  " " `h"$`h? * @c+$  Ӓ:  &  `2` (@$ ``  㿘@"&@  ` &`&  00`  <@l 0㿘&@  @f@ 㿐 0`H (` ,  (` < @& ,& (``$& 4 &S 4 h`& h X `@> X@8`C& ,@> `?& 4``6 h@"& `&@`&` H P@> H @8`C> P& 0@  < @ <4  @ ) )  @(`"* @b?`$` 8,< ` & 4& , $ ~: "`  l`& l " l p& ,`& p㿘 x @U  " (" 0 X"" `2$  $ 2$  $ 2$  $ `B$ # $ 26 @b7"@ 1,!+ @$   8 (@@ $ > â @7K#$     @ (@($ $ * * $ $Ð$ 8@~ <   `Ք ڀ@ $" $  ʄ` `(`@`    @ 0 `  @  㾐 L C  ܀ > a< ' ? ? ? ? ' ' '  '$ ' '( (', ,'0 0'4'8 '< '@'D $'H` 'L` " \! !&P㿘      @`$ @ ( $Ȁ ! $Ā"$$ā  $$ȝ㿘$@t " $Ȇ@ $Ȁ@"&$$Ā@"&$ā  㿀 ` ܀``(` (# (@`2  `( $Ԛ` `A   > İ @64 @ < @<4 ܀`, #\#p>4#`#d#h#ld@耢 ۰  " "  `<ΰ $dā@ > @5 dĀ`Ұ 0` dȀ`>2d#h#\#`#dd8@ d T` X \!` `@:@㿘 )  `  ,   , @` "  @` Ā`"Ȁ` @  Ȁ@$`Ā@Ҡ $$ȝ㿘@3  !`   @F%"%% ` ` ` ` `"!"$$` 㿐@3 "$  "  Ho&(@#\#` !>3>3d">3aHp@g 㿘` X  ` `@d$T` @ 㿘 X$@ `"$@@'$@㿘``  X \> Ē`0@5 h@ǐ 7`4ܐ "$Ē@` >```@<`B  7<``2$``@ 7 $ @`& @㿘 `\ $``"```$  H 2``@2`\@`9 $ 7 @_`|$`` *`@`㿘 " @ l& ` p `2 @ 4`2   8`  4   " ْ  D  @` `㿘  p  l |`& Ђ#`D`F` 4`;`" 0`0 h&@`@ Ђb? & l?/a & l& p@ Ԅ `& 4& > 'ԃ(`@  ` @>9a@$@@j l  ` Ђb@@Ђb@@㿘 `20!  $  @" 2 $$   (< <㿐 (`@`Ԁ : ` @`К@< =C<   (@`؅(R' @`܅: : : @!@` " ``` @ ׄ  Ђb?!& ?/a & `  ނ Ђb? & ?/a& ?/a& ?@@"  ̂`$   P$ t $ hN$ x  x  t !@@> @$  ($ $ ݐ $: : 8: @@ $ $ (4 4$ $`$ l@ $ 4 ,6$ $( 8`$ l`$ l $ p`$   @@< C<  `(@-``  耠@&) ``l`܀@ 6:` `܂`8`"W "C  H  &  (@ `@_ `& &~@Ђb?M& ?/aD& `p6 @  (@& ` `@_~& &Ђb@  & (@ `@_k `& &Ђb@㿘  *@ ` P2 4` l -@ 4 Lp`@# "L$`  耠 @ l` p@ & l& 4  *@ `Ё " @`,`$@` @@ T& |`&  㿘> @3 ` `@  ""@  `"`" >0a \㿐 x  `v@m`"  & (`@ `Т `# ,`<`"`" H l`ǐd €" L H@2`,`    & 耤 =  &  "> `2 ,< < $  `$ @ (`@ ` (`  ` ؃(`@ ` `@^u& `&@`"  & (`@ `Ц > ,@`<"5` `(< `" $  l`2 `6``& ݒ 2 `2$  L`2$  H؀`ӂ ǃ,`Z   S & 耠4 $ ̀` (`@ `$  H ۀ``2FE H` ː&  "  &  '> `,`< < H  `(  ؅( \   H(`@H `  X& @1ϐ @1͐ 㿐  `@G 耣   l ' 4$ ` `"` \@" " `"@`"`` , +<` < p@   L2 @4$ p$L@6$ L" 4l4 L   "  !   " @b`" ??(< <| ` `?㿘 p   @O ؂ "  ` ` ` ` ` @C \& L&& @& P& &  & <@["& & & 8& $ d `  & d: 0`@8``& ,& ,`Β2  & (& (h (& $2  & 0& 0"& TXl#@[  d`, , @[@ d, @Z$  & \  Ho&,(@g,`"C `& H`H@2 H P` `@'`<& D'`@ `P "``  @```2Hp@! a#@[\ \|` \  |Hp@& H㿀 h \`d@sp \4 `l &`&`&`&`&` &`3#@[.* &`&%b: &`  &` `| ` `\ `< ``#`#d#h&`&`&`&`&`#\#l#p >6 ` &`" 1> @/} 㿘  Ho&4(@g@Z"& & 8&  `2  & ,& ,ݒ2  & ( & ( (& $Ғ2  & 0 & 0``   (`@`| f `|Hp@ 㿘 Ho&4 4(@g 4`& l& 4 ̀`@༃Hp@㿘`4`rHo&(@g`P`"``@ D`{ ` @2`D@j`D D&`D`(@` "  H@a `H@2`H(! H@"W`H `23``P  @`& ` &`D`2`  @!  P 2 @Hp@`\1@ ` @@ ! @?`0`(| @ |`(\ \`P@ @@ #`@ #`@#`<   @@   "` `  !?@` ?" h@a``Pa`2`P: h(a" h" l ` !  ! !Ą? @"!"!āa ! !   @@  "& D " 8 88" <!  @@   <(!怠 D@ †@ ܆ 0㿘> /`D2  *`@U@* 2`@  㿘> /`D6`.`. @ 3`+ +`@ ` @0 ( @@Wn( :: @: `: `: `: (` : 0`(: 8㿘 4/@`( B . `8`@ ` `   ?U @UZ ,, 2` @4 4 4 @UN @ D@F @ (`(@+ "$@ ``@  ?# @U- ,, 2` @4 4 4 @U! @ D@` @  8 Ԁ ?ކ???@㿘  5`>``?3> / ( @`$> (!`"! $`!&! H@*!@"!"!"! @ ??&!&!  2 (M!(  xp@B@bf> Ha !")  HH@ 8$ @ "L`H@ n ! "  H@ {!!"!? &!!&!&!! @ !! `" X (!h  `@ B  > X`Hf8/ X)  h8 P @ P@" TJ> P   P @  T@ (!p> HB `> x( h X f@C> XB> `@c!c<! `!""L!!"!?  &!!&!&!  a  2! L@ (|!!@ 8 m@ q !㿘@  @   (  @ B $  (@  0c D@ d, 4`4 @S@ D ? c@S @ * 2`2 @ D@ @ c , 4`4 @SҒ@  @B? c @Sǒ @ * 2`2 @ @ E8  㿘@`  P? ``@ G F>2`d*`* e@Uj@ @C= 8>> >  ? c@St ,, 2`@4 44@Sh @ D> (@`@ > >@ >> `> `> ((> ˔`ŤD8>` `?(`@`    @ 0 `  @      ܰ "~ a(z '` 'd "v'hR'h ^`'l J` 'p "n'tC't O`'x ;` '| "f'4' @`' ,` ' (? 0? 8? @? H? P? ?!'<!'@!'D ? ? X? h? p? `? x?> /`D?' `'  `'!?!? !?(!?0!'8  'H  `" ` ! !&'l'p 't'x'| '''P>`p 㿘 `2!05   '! !!@>! 8`@C@]>!   @ @ 2   !  ݐ  ; A㿘 f  `b Ho&_(@ `` " 2_ @V`2  @" !@(@ ` !!!Hp@! "  ` 7 @".  @"  " @  " @  " @  @  @ g S     z 㿘   z ܀ w 㿘  #  `   2 0h " `Z  2 T ! @; @8 㿘` X  `2 ` C " ``7 2` T` @ 㿘@(  a`   @Z!$  @U "" $! a$ $ 㿐@' "$  "  Ho&(@#\#` !>@>?Ę!T>>՚cHp@g 㿘 X` ` " $`  @@8@"D ` `@> ""@  `"`&     @: ?% @І@@C<Ȣ<ɐ`"0@<0`k`` ``T06@>`@<@.<8,@@@ * ! @ D@ ! `@@ i !  @@ yĆ"Ă? $!$$! @!!ā   "`2v$@` `0>`@ @ <8Z` @԰ P@8@"TH p@*9 p@2 t@:9 p@(2P & D"#DĆ"Ă? $$! `$! ` ! `@ ( 2! D@ (~!ā@ 8v > @(!㿘``  X \> Ē`0@(, h@ 7`4 " `"  2$$@ܐ 7` ```` @"&` `"@`"` @`& @` `͈ `D`렰0  @@` 8 0"S`$$$ $$0@>`@<@<8! `" $@@@ 8@ "D$! $!  @! `"* "&     a``&a `X`h8 @`P@"`T/>`P`  値  `W$!``"  p`H @ 0(0@ !a"Q`H>`H`H``(` >`@ a(ja(@a``&a!!&`x&`|`&a&a!&`P&`T`" !`HH@ 8V@ "OL!&aa&a @` ```h`(ah2`(k`>`X&``&`d @ *>`H@ 2`H`L@ :`H>`H(~`P z @|~@~Ɛ< @ 7<ؔB < $ 2 @@ (!"`H@  &a&aἂa  "LḀ2H`@ (2va`&`@&`cn>a(t `@ ($" @@  $$Ă  "D2@@ (Ā`  ` @ 8```2`! p! t&`H&`L! '! ` `@80$㿘> /`D2  @*  *`2 2`@P@ >@? ?5   @@P - >` @N$  @P#@ >` ? c@N ,, 2`4@4@N  4 @ D>` 2  @* *`2 2`@Oْ@ >`  ? ?5 -  @@O̓- >`(p 1  `"/ (  ܀`$            '''''''''  `?  ؂ `Ҩ  ܒ  @!  @  % @ "" %, 0`` 2  `   ]% 耢*܀* 沄@?b4` `\2l 2`*`@ 3`+ +`@ 0` ((@@ c@ 3` +`C@+ @3`C+`+ @@3`C+`+ @@3`C + +` @L@  d`, , @PQ@ d, @PL$  %   쀠``  @1 0%ې        `耠`Ԕ  @ 0%(   u Ԁ`܀`"  @ 0%h   _ %`$%%%Ho&4(@g=`0@`? @(`@`$ ^ `@(`(@@ `2$ " $ 2% `2 Hp@ς  Hp@ "  "` ! "@2  "@,  "@&  "@  @  "`2  (` @ < 㾸 Ϡ -  ܀ ( `&' ' '  '$ ?( (?0 0?8 8?@ ` 'H ` " ⏔ ఒ  &2P㿘 `-20'   !  0 8@> 0 @8`C@{> 8 2   !  㿘Ho&4 (@g `"  ` (`@ ` $ Hp@ 9  `(@e  @a   ` (`@ `  ) @ #` `?<?#` J @<  @8 #` @2  @. 㿘 `  `` `    ` @  @ 㿘    ܀ v 㿘` X   ``   `'` 6` T` @ 㿘   ` ܀`(`@` "   ܩ,`  Hof4(@g`Hp@`  `$ -`0`` 2 `   $$  4$ $ U$  沄@?b4`  `\2l 2`*`@ 3`+ +`@ 0` ((@@ c@ 3` +`C@+ @3`C+`+ @@3`C+`+ @@3`C + +` @I@  d`, , @M@ d, @M$ 6 $  `   g0|  @| @  @w }$$z㿘@!  !`   @` T` !" " ?" $` 㿐@  "$  "  Ho&(@#\#` !>F>Ft!,>Eߚ`tHp@g 㿘 @` X  (`@  ``<@ "-@` `.@ ""@  `"`"   @& @ `2  `$   (@<  @8`C< (` ` ဢ 㿘``  X \> Ē`0@" h@yÐ 7`4\ ") `` `+```@"&` `"@`"` @ `& @@y`0`8@< <`0B  7<`8`2$`@ȳ 7``鲔 2`0 @㿐`  (@>@㿐` @j`   . @` .`?(2> /p"  p> /`t2"@2> /`t`t> " > @2 >G`t>hcL! @㿘> /p > /  pl> bl l> @!p!0㿘 1> @!e!H  > /"" " " t"  t1> @!T!X @>Ga 㿘!> / t`> @!A! t > >haL> ` @!5 @)@!/  2 1> @!&!p۞@㿘 2 d㿘#> /`x`> /`t " $`x !   2$`x㿘}  $ $    $$ $ $t > @ !X0㿘%> /x`> /`t $t`  $    2 $x@`$  K@(9  ""`K@(9  2`   "`@`2 " `@`֐ > / b>h> Yc̘#L> bL`"> > >hcL `>hcL!㿘#> cl`a" @   @cl  @@8N  @ cl  @ 㿘@滐 㿘@涐 㿘@汐 㿘@欐!㿘@槐!㿘@㿘@  8> c<' @dԀ > @ !@  Y> ā@ Ԁ %ܠ , "   #\#`#d#h  ؘ @  > @ `0Ѡ @*  @#` $ @   2> @א!@ |0@ v@  > @ː!@ p0 4, @3#> @!@ a0㿘 > @#(@ X> b z>h>c#L>h>`#L` >`0`>h>atL>h >[`xL@@J>h`fL>X``?J>h`fL>X`8`?J>h`fL>bp`?J>h`fL>b̒`?J>h`fL>a`?J> `f>h>!@`?L>[`J> `f>h>!4`?L>[`pJ>h`fL>a`?㿘N> $`f$`? >hcL@J>h`fL>c`?>h>`PcL>h>cP#LJ>h`fL>a`?㿘` > Ġb@@   `> />Ic<"> c<' @  . [ > @ߐ!@  > Ł`T> tbH ; 3t `"G@ z @ a0> bt'l?p/x &pl@xta > > /`|> > bp>  xbx>  t> @"0@ 80> @"@ 20   Z 0bt>  xt`ˠ @ 2 (@ /x@p > p> >  x l @   @ ?'lt`%t@Ȑ bx 'p@  > > @H"@@ 0i@l t> @="P@ 0^xbH@ x0Ý㿀> bx>  bp> >  b|b>  t'#b> b|*> > Ī`Ш`> 0> /`#> 0 !> @@ !"|`@  "$at@@$at@ "|`>  b  @B `"@ 8"@@`2 # 0`` 8 "!""2 " 0``2 0``" ``3``"• "   㿘  2 (`(` 0@@```> Ť`(`  ` ( @a;` 2   (`(`@@`㿘  ʐ !%> n`" -  ``"" *`` +,  @ @8,`2, /, &,,㿘  "&@&`&㿘    `" @@ _ " 㿘`" > Ű @ >  @`[bP > `` > Ŕ`> Ű @ ؁`> ŀ`P`2` (`@(``0@@`j@> Ű`       "`  (`(`@@`@!`  ( `@`o 2  @> @`d ` 2`  @`@ -+ *> ŀ`@> ł@ > ń8@  ?}&`> Œ  h@v > `}` 6X 5 5 6p 5 5 5 5 5 5 5 5 5 5 6 5 5 6 5 5 6 5 5 6 5 6 :T 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 :8 :, 9 9 7 7 7 9 :T 7 7 9 7 7 9 7 7 9l 8 7 8 7 7 8 7 8T    ((``2 ( (`` " ?2" (㿘!>   ?? >  $"p 2>  bt㿈@ /@ @# 2 > @ސ!@@ &> @ ?'@ <@l?'@s > @"@@Z@! @T!> > "H`H@_\  ""H>  @_TaЀ ""H>  @_La > @͐쀢 > @"P@.㿘 >h@ wL> @|!0@ 6 x> Nc<' > 0(aPaP``8> (`>L `^8G> > @X!> @U  ?> Ł ؖ   @6> @A#(> >h @ 3L>  > @4!@>  > @-!P>  ؖ  ߚ  > @!H>  > @!8> @!X> @!p> c<@' >h> ŶcL>L'Ԯb0> > ŸaX .> Ԩ    , `@  ?``1% , `Ii@ "۴> @Ӑ д<>  bt> c<@ > Ł(`  ؘ  @> Œ@!p Ҕ > @!x ǔ > @!     ?`^@   ?`^@|   > @j!u  q  n  > @Y!d  | ?`^$ @LW  S > Œ!`@B ] J<`@ 3@9> L bp@  Y@  T @*5 @횐!㿘N`3> 0"  `ؔ x`㿘@ $   % (  = ,@ > c@"@ > bx"@ > bl"@ > @ "H > Ł > bp"@ > bt"@  !!@ > @ > Ű !Ё@ r@ !0㿘@t  @X  >   Ѱ $! >  $ ސ!㿐Ұ @@> > ŠaШ)`2 6`$@F'@( ?`?` $M ߀  ک'@C?ڠ' Ѐ`@C'@%@ 㿐 @?`"> Ţ a @@'?`  ^ @@'?`@$ 㿐ǰ @?`-> > Ťaа 0@@'?` #퀤  (@@'?`@k$ @@#@#`㿘> 'bȀ@Gd@[Z@D㿘> > Šb0h : Р `Ѐ` :  L@@%v (` : @(`"> ł` (`8`@`$`H`  -@%^@(`2` > Ų a@r"`{1> łH_2`@%I``{21> @_"@%@8@pN`s"N 3> 0>P `X a/> Ԩ1> `Ka@% ?  H܀L@` @ H (`8`@c`  +$ (܀ Ӏ`!> "`$"k> "b> @ "4_L@] "> @"a''''''耠`'  , @2  4* '@̐''@@o L@ @`  `` H``Ω`t% @(`8``:` @(`8``:`L@` @ (8` +)?{H`  _s(ܶЀ :3> 08  H IP I H I I J< H Jx H J K< H J L H L H Kl H K L( H L8 H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H Jx㿘 @#㿘`#%> 4#> b8 @: @`,* @#Б: b8  @@8@ ܒ4b8 ג"@b8 @$b84  @$44㿘!> %> "48 ͐""4#> b< ǐ @b<$8$"4㿘 N@#  > "8b0k?`^5!> "4( (("4 ("8`$"4@#v&"8"4"8Ғ"@"8"4  @  . >Q,!> %> "4< @#[ "4< $"4 !> > "4b<@#J "4$"4 > > b48  [ !> 1> "4"8@#0H"4"8`$"40> !> b8"4@H@@# "4`$"4> > b4<  0 #> 0> 0a\d%> @1> <"8@ %> 0 > )> 0"%> 0`"d"8`@ !`` @(!X@$`#!`> > b48@"   > 9"x!> > "8b<@0"@"8> b4 "@ް > !> <"4`@l ("4@"(@" "4 @"H"4@"H !> %> "4<8 H0N "4<HH`  0B%> 0)> 0`!X > #> 0"a\ 5H`i@!!\!!\a\ 0'#> 0a\ > $a\")> 0@ K%> 0!X`@> 0a\@ @ \ \\H@a\a\`Y> 0!X/ \%> \<1> &"8H`"8(@!X`&"8(@`#!``"8$a\(@`&"8 "8> b4"8< "@!X@$a\ \ @" !!\!!\d!\`1> %> <&"8H`"8(@!X`&"8!X \ \%> <> 1> b4&"8<"8 ,K@H* > )> 0!X"@  "K@K@ I2ך`@ " <> 0a` $a\)&"8 K@`<)> 0"㿘@!> > > b0$"<3> 4&b8@! @ b8(@b8"<  U Ul Ul Ul Ul Ul Ul Ul Ul Ul Ul Ul Ul Ul Ul Ul Ul Ul Ul Ul Ul Ul Ul Ul Ul Ul Ul Ul Ul Ul Ul Ul Ul Ul U U U U V( Ul Ul V V V V V U U U Ul Ul Ul Ul Ul Ul Ul Ul Ul Ul Ul Ul U U UP> > b> @ > 0ah  >  ah> "@b?H!"@> 0 ah> 0 al㿘> 0> 0 ah l㿘?߀`]  ? ?Ѐ` ^ 0E> 0a%>  $@ ` ` `7 ?@Ղ@$@ /  ? `?` `?Ѐ` > ŀ ?> \" `> ŀ _  @Т?4΢?@ O o T& t$ X$ x"> 0a0 u%> ?` \?` \ _ \K `?8]> Ń(`>Tl   \;> > (bH> łbH`xⰢ`L?`?` \?Ѐ`  \ _ \ : \,@H  \ ,@`@0' ?2,@ِ,@ ?2> > ̐">   >%> @w"?   <       .        > 0al  al@㿘1>  xe"Ȁ "> > b@ > 0ap㿘1> n!` 1> @"> &!@# !> >h@7"> @# &!㿘> 0a`` > ŀ cX> Ŕc` @" @> ŀ c8> ŀ c@> ŀ cH> cP> 0> 0ap > >hcL 㿘-> 0x)> 0+> 0!p6%xa|@=l@  !p&a|%x@ !p㿘> 0a`$ ?#> 0at@> ł?߀`]3 Z C P cch @@o8`  (``@[ c: q8 Kat $at> Šcx@X8`  (``"҂? ΂?!> 0@H!p> 0a$!p`> 0,!p x> 0#> 0a|ap@<Ӡ$ap$atΤ > 0p` p@! > 0t> 0` p t> 0 x$at @@ > 0t> 0`$!p t xh> 9> e!t<' > d@=> > c> > ŢcԤبЦ;> 0@@    @Ԕ@' @T ̀`b쀠 Ԁ@Ѐ @!t` @Ր>CW`t@  > Ł   @ʐ0@;#> P`  P" J `p> > cP> `? H cT> >  L b|J> `p>   cP> `? cL T>   b|J> `p>   cP>  `? D cT> >  L b|J`c >   cP>   cL>  b|  cP>   cL>  b|㿘!> #P`  ````  > L` L#P`` > cP  h@ 㿘1@&  " @ `"   " &@ `"&@ & & &@> P` `!`` `  P   P   = > H` H> cT> Ł @#~>  @ Ё㿘> c\` `@㿘> c\` `@㿘> c\` ` @㿐?+> '%cX> 0 a?!P` @( %cX 2&㿘> c\``@㿐 !> #X@  #X&&@@%@&@㿐> 0b䀠 ۔ > 0 a!P ` `  㿐 > na@`((`` :(('(``㿘> c\` `@> cX   >Xb,㿘> c\` `@> cX  >Xb㿘> c\``@8> 0b> <'  @*V` > 0b쀠: @`2>  @  Ԛ > ƀ#( $> Ɓƀ#( @` > şƀ#0   > şƀ#逦`@) 㿘@Se   L@  @S[`?㿘(`O> 0> Ťa   (` `8`:2 @, , @`@S9 * :  ,  :, @(``,> 0a`w >  ` , ݦ ٨  cX ަ 㿘'D D 㿐(`Q> 0> Ťa   (` `8`:2 @, , @`@R / :  ,  :,] @(``?> 0a.`> Ƣ>Z`@``@`@ , ئ Ԩ ? ݲ 㿘> 0 a,` `@R  `2,`1> @ϑ $ ` ` `㿘> 0a > ƅ. `2   ` ` `?@ H㿘@J` ``F"1> 1> @ x @8[N` @2N@R "`N` @ p㿘> '>C b1> 3> ư @I``@> 0b܀bܰ&@> %> `"1> $\e  2%> 1> $\@& 㿐  `?`?@' #> !>C$bH p )> cL`B`2(> > @6  p`1> &"x> 'bȀ("x> bL  20> > @ > @!H p $bH@ ؂ p`1> &"x> 'bȀ"> "x> >h#L @ > > @  `"> > @  > Ɲ㿘 `@  @&@㿘   @ "   @"@@  㿘{ > 0> ư !c8> 0@> "H > e@Qa 2 & > eat> d@> "H> @QK 2 & 㿐D > ϐ! > 8  > + > !!0!0㿐'D Dy 㿐 ] > 0D"  D㿘)> 0#<`> 0cH > >Ba#>B cl@ 8 @    2 %#<> 0 c<㿘!> 0#H`> @ "#H  > Ơb  @ "   21> @ !@> 0cHcH@8 `> >hcL! >[b4@㿘> 0D > 0  D@> ` @> @ ɐ"0㿘!> 0#H@ @2@21> @ !H  @"" #H" $#H> 0 c<1> @ "H㿐 ڐ 2cΒp> Nc<' h  hNl" > ƶ?Ɛ"`>h> ƪcLp> Ơ bx$ؒꙔ  c    U@ aԖ    K@ WԐh  2ې &> 쏐"&> >  t p  > Ɓ b>  @ߣ" r t| t\ t< t s s s s㿐 ``((` ->\ !> 7cL>`0> `$`,` -> Ha`` ` p@ @Ľ 0Ґ> 0@͝#L> `$D> 7@#L0> `$(> 7@#H0> 0@!|> 0@w!> 0@o!> 0@g!;> 7cH'@^  `('cH ;> 7cL'@M z x`8u s'cL  @*@`  `*``  @*@`  @ `*`*@`  ` @*@*``  @ `*`*@`@@ *@@  @(( *@@  @((  `(`  @(` *@@  @(( *@@  @((  `(`  @(` *@@ (( @(( *@@ (( @(( *@@  @(((( *@@  @(((( *@@  @(((( *@@  @(((( *@@ (( @(( *@@ (( @(( *@@ (( @(( *@@ (( @((ɞ@@  @( ``(  `(`  @(`  `(`  @(`  @( ``(  @( ``(  `( @`(  `( @`(@`?㿘  $ @4F 4` @8`& & &  . 9@& & & & (& ,& 0& 4㿘 4ܐ h  =`2 tҐ &    =`2   0"  x 0" 0㿘   @3 @* @8`4 < ʠD?& ʜ x t& Ă @& & 㿘Ho,4 4(@m 4`4 !8`" 0 =` 0 Hp@㿘Ho,4 ̂(@m  4&!04` 0@ Hp@㿘` 4  !  h`I` E0@8`$`@39`` ?@ 0$ 㿘`"  ` ! > 0@#cP@4#͕` 㿐 &////@4 `9```2 /@3$@ ? `  `#  (@/.  `   ``(( U/?(?/㿐 4`d>r 0 t x l! #\ T  . `( 0 t l>r@T 㿐N ݀`2 4  @   4``"`$ 0   >t#\!   . `` `$ 0  >t@  㿘> 0c .  4 0 \@ ? X N ݀`"    0  . > Ho4 (@m 造`N ܀` Hp@ X0 `  `  ``)   "  ` ` (c& "   "  "   "   ` `  㿘 .` .` &` &` 4 0`@   &`0@8`.`  4 0@@P> c<' .`  4'`H 0 Ԁ 4'  0'`D . > @Ґ"㿘 &` 4 0D@  ` &` &&` 4 0D@ ` &&p> @ c<''' "t`` `"' 4  0'`D "~`Ѐ@"p&@p(`*`&@1. > Ɓ 4  0'`D 2` ''Ԁ m'  ܦ $耈@"` 4/' 'І`?Т` @1|'@1x'Ѓ(@`4 'hЀ ` ''ZЀ@& .@1R& @ @. `'`$@ц @̄ 2(s@" 㿀> @c<' ""  4` ' 0`?`'D 2 ` `` %  `$`` > Ɓ   ``$"` @ټ"㿀>  4c<'   !<&@! &`@!&`! !&`D &`!&`H &` !&`L &`!&`P &`!&`T&`\&`!L&`d!`X&`$`{֐`і`;!Ā  4' ''D 0@ 2&`&`&``k!@0 &` !(@0 &``  ̂ @&`0  &`p!,&`t&`4 .`8 .`x Ԁ@ .`9 .`z.`:@ .`y <0``.`> <.`~ .`? .`!@0n &`(!(@0j h&`h!(@0f l&`l @0b! &`,&`&``, &` =&`   @0M &` @0I &`> @"㿘"!!( h @0:&`  @06&@ `" &`@0/ $&`  @0* &`&`   > 0cR` * ! > 0Pc"`8"` 0Dc"`8 <8`2=`2 0@  ̀@  <8`=`"4Ą@ `` `"  㿘" 0 4"  T`@&@ L`  @ &` ` ` ?   @ &` ` ` ?  \  @ \ @ "  2  >`p 㿘> 0c . ߰ 㿘 4`P`"`  0` @ @ 㿘 \   @y  2 㿘> 0c . aЀ``4> ưaРcx @i aЀ`0a@"ID(  a@(0a@"&@ a@3 b}@`  H`0@  @  `\" "$`\ @`0@ `@`0 8`0@`0@㿀> c<@'   @" ` ` '@ ` '`@5 @02 @ 0> Ɓ` ''䀡   ``$'耡`  4 0`@ 90؃( 4@`$'@@ 0@U"㿀> c<@' 88` 4  g @: 0`@8`@"g`` `<' 4 '`D 0 )`S  $"4' `"4`ؐ @ G 4 '`D 0 ```$@# @ 2(0ĺ"@@: 0`@8``А ' 0Ń(@`4' 2`0> @ֳ"P> c<' ` `4'`H`0 Ԁ`4' '`D`0 " `4 > Ɓ@ '@`0@ P0@w#` > 0#`> <@' %#@ !`!`  ' 4 0`HȀ "@ +!<`ꀦ  Dƀ Ɛ`?/0ǀ  'ǐؒ0"'> @"#㿐"!. . j  耠@ `2``2( 4"  4``)>t 0    #\!  耠`"&! 4`d!>r 0 t x l! #\ T&!@! =` 0  !  `$ 0  >t@   0 | l`(>r@T&!@Α!㿘> 0c`?0` @ @c(` !̀` !Ȃ` $!Ȁ ?` $!ȁ?  !@ɜ!ȁ㿘> 0c . Hol`A(@m`A!8`"5 =  M  ` !8`1 =`":!4   @&  '` Hp@@ @Hp@`"  !0@ ΰ ̰`р`ذ@ L`ِ0߀`" ̰  㿘> 0c`?0` @ @c(` !̀` !Ȃ` $!Ȁ  `$!ȁ k!Ȱ`$!@!ȁ> c<@' !  p` ``  8@&@`` @ `0> @Đ#0>f ࠒa >;a !>9b%㿘```> ƀ`c> @ǐ#> Ƃc> ƒ@# > c㿈  >g'''X@ۇ > @# 㿘@, @ @,`@  `@D 2@`@D 2@''@h> 'Ȥc<'  @D Ȃ`' 4 0`H ? > Ɓ@7#H㿘@Du B\@Do w`;`q&@1(  &#/`/` @``,@DN `,`$ @$ $`$ 4`&`@&`(`Ԧ&@3 (  &#/`/` @``,@D `,`$ @k$ $`$ 4`&`@&`(`Ԧ .` (> c<' > @ Ѐ`"> @`"> ``"> ` `"> ``"> `$`"```(`"`d`,`"> `0`"> `8`"> `@`"> `D`"> `H`"> `\` &`8&`4&`0&`\`@ 2&`4`h @ 2`h`" `@ `h @a  .`.` +)p?> 0&a'''&a<&a@&a&a> 0> 1c> > 1`PL> > &aD.aH&aL&a.a&a'Ȭ`hPȰa@`'`H@ P`'`H 2Șaxaq> 1,a<#\> !#\aȀ`2O`(> @7#&`4@ > Ɓ`2D`,> > @&#0>ga@b0@ҿ#X> &`4@ 0`!> 0#Ta  b 㿘 !@Ϭ&!@ƨ!@Ʀ d@Ƥ `Ho,4!Ȃ(@m!Ȃ`&!> 'bА!ȃ* *> ǖ @ @X => ǃHp@ DA h> ca `0> ]`L>q`L@`0   @ 0`@ 2 @z   @u   @p   @i  @ `0  ǰ `'> '`d=Hp@  @*ݐ$a`G$a@(`~`0a@`:`Ho,)(@`$`@$`Hp@ "`ԁ! ÔЂ *$`d*@ a$`d` `ԁ m``=`㿘> 0c .  4Ho,`(@m`"  耠`28!8 `&  造`2'N @ 02 <`" <`2 <`2 &!8 < =. <. =&!8& XHp@  =. <. =` 4,@ 0. 造` 40,". 0@ 0. ' 2 4`" 4@ 0 4  `  ` ```    >jcX@㿘> 0c . L ݀`u !Ѐ` > ǰ!Т` @4 !Ѐ```2!8!,`$!, `( =`/> !4 ",!@'`:  @>`!@'$@&`!4 @$!4`> ǁ `ڀ``&`@>` ` dHo4 (@m  Ȑ! @ T @$ d!$ d`U " Hp@!`I @  4@ $  $ @$ 䀠` $ L ܀` *Hp@!@'v@ 2Ͱ !` 0@``Hp@ # W 0㿘> 0c`?0` @ @/c(` )!̀` !Ȃ `$!Ȁ```  !Ȱ` $!ȁ`  `$!@!ȁ 㿘> 0c . L `L !Ѐ` > ǰ!Т` @' !Ѐ`!8`"; => Ǵ` ```1 Hol4 (@m Ð T!   @$ `!̀`F$ ` D 4H 耠`L `! 0ߐ `> ``> Ǵ` `Ho,4 ̂(@m !0 ! `V u @$ `!̀`w$ ` " ̃Hp@ Hp@!(`+& x 4*@&$  $  t$ Hp@!$` 0@!(@&^@ "h`0Hp@ #ئHp@!(`@&A@ @&8 !0@$!0`p n0xHp@e # 㿘> 0c`?0` @ @/c(` )!̀` !Ȃ `$!Ȁ``` !Ȱ` $!ȁ`  `$!@´!ȁ 㿘  &! 뀠`> Ǡ d` 뀠`2  & d! @  造`& d 耠`  ꀠ`> Ǡ `` ꀠ`  & `! @ٖ  耠`& ` !&!Д"s  造`2  4 耠` 40@ 0 ,@ 0 㿘```"&!́    㿘` @ d L `@` @ 0 X  @ @2@ %&@ X 㿘Ho,4 (@m 耠`"   ``  40@ 0.  造`  d` 4,@ 0. Hp@@ d& d@ `& `(>  4c<' `C  ` / `/`<a 6 @ ' `@ ' `"`T'`T"`' `"`H'`H"` ' ` "`L'Ĥ`L"`' `"`P'Ȥ`P"`' `"`D'̤`D '      " ``= 'Ц'Ԫ  ```,`=`,`= `=2a8 `\@`0 2 `=%???? `=``0 @    ```l`l"`,"&`,`,`  `,`,`ޤ  `l?@$ `` "`l`,?̠Ē@$ؐ `ހ`2`l `l8`, ,``,8` ,`` `*a 4 `\ `za< ' `ؠaߐ`ߐj `X"`;`\`"`;a<ؖߐ`XߐT `;`"`{aؖߐ`;B `{`"``\`2ga<`" `Ғa `"`aĀ"``4' /' '@`0@ఒ `" ` `=`M`N```@`0 `"B`Ho,'(@U .`@`l@" `=o `=`  `造`L`܀`*  `耠` L``5Hp@ p`" ``8 ( `$``" ``8`$``"````Ă @4$``8`"%`x,``8`2 `x `造`2`x `=`"`xHo,(@m Hp@ %`x`"! ,``x` `耠` `=`Ho,(@mĐHp@@ > Ɓ`3 0,`=?  8 耤 " c ''   2`\``@`lF`lP``,`=`> 0LcP@#H#q `> 0EcP@#A#Q `::6. 2`\''''''!h`Ă  &`l????''''''m0הؖߐo`{Ȓ "`0q `=^`2``8@#h; 2 `= 0 `<`, `4`0@ $&`X&``&`d&`.`.`&a,&a4 &a82`< "M`4a`> ``` @2 `4@`0&a8.`<.`= `.`<`< `.`<`<  @:ːa`a aa aaa````'d'h''''''''`'t'l'p//.`.`&`l&` 2`4`h`" `0`@ `4`0`h a aa !> 0#Tޒ`ڔ a㿘> 0c`?0` @ @5c(` /!̀`  4`' !Ȣ``$!Ȁ` `` `  `$!ȁ F!Ȱ`$!@>!ȁL 㿘 <`> 4 ꀠ`: @% h | l x@ @ & | t& | N @ +&  N `1&   @ & :& &  d`"7 ( !Ѐ | t ``. @ `& ` d` ( 0 |>r@T & d  @ &  &  t& &  t&  0 |>r@T "Ő> 0c . aЀ``4> Ǡaа` @ aЀ`!@ }@"*0a@"v\!~0 a@F0&a@2 @"a #@@@H a$@a# a@&a@2 ﭒ@"\a"@ @ Ho,4a((@ma(@!)`&``l`@!#"&``|a(`t$`@ q &Hp@ C `@`0`0@ €<``0@ $a8`  @9  `=``'` a@ `&a`@ , & ` `̐Ho,(@   `=,`,` `造`   2 `=  `耠` Hp@`"x$`X`X`B $`X 倫 a a(@ `&Ho8(@````a`̠` $@ t &```@ n"&`a@$`&Hp@ @2 a8& @2  @2 a m`m0v 8`0@\`0@ & `<&$ `0 㿘> 0c`?0` @ @4c(` .!̀` !Ȃ `$!Ȁ``` [!Ȱ` $!ȁ!Ȱ`$!@ !ȁꀠ`  㿘 <` 4 뀠`"  @#   @@ &  &  N ݂@&  $&   @ $N ܀`$ !4@& &!4 䀡  $@ @@  @@ (@*! @*& !`"!@n  0!@  :  Ȃ& & @@64`` 䀡   $@ @@  @@ (``@*! @*& !`"u !@  / 0!@```"O`$ =`"!8N ܀`") !8`2! ``.!Ѐ   d`K. @A d& d```B`$ 0 >t@  Ā4!8 !8 ؂@S& ݒ !!& `l&  ܖ t  0 >t@ " = =!& `&   ``㿘> 1`l > Ha`  ``((> ] `L㿘> 1`l> Ha 2 ((> ] `L p 㿘> 1`l``p2 `(`(`> ] L,`" @> Ha`" `㿘> Ha` ``@㿘!> H!` 2`` @ ! @㿘> Ha  > 1p`!> 1  p`$ pp pp`!> 1@ 㿘> Ha```> 1`l  > Ha >`0 >`0 p 㿘 `b@> 1`l> Hp2 ((> ] `L3> 1`l` @  &`l> Ha 㿐> Ha$!>   @$  @є 6 ((> ] `L@d 6  㿘> Ha ? > ``4 ((> ] `L@@4 > @ܐ!    H'0`w@   @Ґ$$ږ " @k @9$ 2  $ϖ 2   ,@P@ 􀠠 ` @ؐ@]0''܂? ''P@ `3`( @$ @`3> 90 bl  `( ` `$ `0 `4 8 < `@ `D H L `P@ `T ` @ؐ@  @@]:0@v` `P@Ð@M> c\> `0`@ $  @-  $> ǰ ?@(#  @Œ   '?'''''@ ` @ @ 4`"@       @ @  D '''''''''Ԃ'@@  D&@&Ȱ @l  $  0 \ h h L D p p 8 \ 㿘 Ă?!( (@ Ȃ ( 1a( ܰ"㿘 Ĥ``([ '> 1`@U)> 1` x9$,7$n  ` "?0``@)8 (@ Ą`(@ Т`  | , L  @ 2? Ą (@ `@$ Ă ( ( Ĵ$ ((@  㿘!j! i>  `   `2b> ! `,` $`,!Q> &!   (`@(`@@ d$!(&!(@ &!`逈 %2  `݀ $`,! ``$ &!&!  (`@(`@ d> ǒ @! $`,! $`,!> @ڐ!$`,!> @!@@!`@!@!x㿘> ah, , "!("  @ $  ,   ) (`@ d    &!  &%6 >( (@ ( (@  Ђ?(!`@㿘 ! ( ``(%m%&%  % @(@&%&%` Y&%> ǒ @q"` .%% &% -> 1`@]/> 1` xU ,S 9  ` "?0```2F Ģ2%%`"| % &%+@ Ĥ(@ |` " Ġ ,   @ 2? Ą (@`4J `(`>w%Ȃ%C  `P %2% Ă (`" <>  !  8?@?`@ @.% .% {.%> ǒ @"0t  q.% n.% k.%`@p %%@M&%  (%Ȓ @Ð!S  T 㿘 Ģ@T `@O'> 1)> 1` x$@,7$@  ` "?0``@)/ @. Ą(@ Ф`  | , `  @ 2? Ą (@ `@$@ $@(@ ā 㿐!`>  @`%> 1|`@? %-  @``@$  `@ w` (@@  ``2   > @." > @("h Ą (@ |" Ġ > W T>   @2? (@ (  @ > 1 `x> B  ?> א  ` "? 0``7> ǒ @#@! Ă` &!(     &%H&% (@ (  @?(!&! > @Ő" @# Ē @#! (@ (` /> ǒ @#X!@l",`@ (`@d *!&!`&! !&!   &%&!$&%&%&% (@ `  ` @   Ȃ $( > ǒ @q#!㿐!`E> !>`g > >wa|> )> 1``  `@> `  t !"!( d ` "?0``,@:!%`&!&%`> Ȑ@+!%`&! Đ ``(%&% ̂ !(  T >  $  &%`"  `b  @`" !`&! @ !`"  %"P Ć&% @ 2> Ȁ`> Ȁ`2L!` `!$&' (``0> 1 @@x  "  @@2? Ā`(@ Ȃ ( ( Ђ?(  (  &%&!&!&! &!$&%&%&% ``(u% `&!> @싐!`ʐ`! ̂ ( %`!%̂ &!&%Ԣ 7> 15> 1 `@"`` x `^&% [ `@  ` "?0```N ` @ " !%"P !`&%&!`2 Ā`$ %  Đ ``(!%`&%&! Ą (@ Ш` | `, `  @ 2? Ą ?(@` ` `!`Z> Ȓ @ !%`&! &% `!  ( ":  /   (`/////  3 @   $ ,!%H&! &%‚  @Ɛ!%&&%   > @븐"    !`,0` ``8> Ȓ @렐 ! Đ ``(v%&%> Ʉ> Ȓ @닐   ` Đ ``(`%@|! r %Ԯ%̪  @@r  `' ,g `!${ `" !6n  ̀(@2Y  !$! @ ! !$@ &!  &!$F ` Đ ``(%K% ̖4(@   2 ` @6 8`- ` > Ȓ @-! V&!$> @#@#%@(``C&%Ԁ`"O%$ %̀2 %͂`@2 Ă` > ȃ(`>wT!$! @!  ``(%@  `)A  Ъ 0``2ۂ `> Ȓ @ސ !%̂``ʀ` (`6 ÂƂ `` 2    % % Đ ``(% Ć&% @` +@ > 1@ a|\`,Z`}  @ 2?R  %`2 !%` &! Đ ``(b% Ć&%` &``! %!$%  &! &!$%΀`` > @c!%2   Đ ``(7% Ć&% @` `> Ȓ @I!P% Ą (@`1&%̢ 㿘!`"!@!> Ȯa> > ȴbp;9> '  2> !`2> $ (( ,`" 04(`@(`` @(!`@a,&$ &!!`> `"&! ` ! "!@!%`&!&%@(`@ d &!   &!$&% &%&%H&%2$ ,@Ɛ$ ,!&%&! &!$&%&%&% (@ ( (@Hof$(@ ?( Ȧ ( @@)  `@"( (@Hp@1! g  `T`! $&%&!Z  ` ݐ  (Q `  (@ (Hp@   (@) Ă  (6 Ă  (0 `@  "T %  @@"? Ą (@!A Ȃ (!A @"8@"PB b@ !;&%2 ! @ &! ! `"  耠"  !$!&  `"   `" @ `" @Ԓ#@ 0  $(!   ( @@2  ̂ ( Ħ ( ( (@  Ђ?(!㿘!`"!@!``&!%`" Ă`&%Y!`@ ``(%㿘 4!` Hod(@e!`  ``> @藐"!`B ,`+```8 @& ,Hp@+`  , ` @ 0 ` 8 4 < $? @ H D!(`$!(2$$!` !`> @#H> @#㿘Hod4(@e`".> `  `4 > Ȓ @6# `& !)  (`@(`@ d!` Hp@ސHp@@#pHp@.!㿘!` `!`@!`  `}! 㿘#` @㿘#Ȁ` "&`&`#`@㿘#Ȁ` #쀠`@&#ȁ㿘#` 8@?@#@7@ 㿘#Ȁ` #耠`" @  > ɰ @疐 ( &#ȁ 㿘##L? #(@`# #` ` > ɰ @i H㿘 @?  & 8.$0`` $,`0`Y "b(0`8$ #` @$@(`5# @#L (`0 ?@ ( #3`& (`3` @(3`$@@(`Ϣ @?Ғ  ,`$0`   @?Y( ` ($ @ @> 㿘 \a  b6 \?(2((2(" .   @*f  @D2 2   (@@`(` @*P    \ b6 \?(2( \}6 \㿘.20 "   |@ > @  8@ @> 㿘 \d@`@##!((@" \"`hE `>  D @ ###(` (` (j@>#(``<@# <#`04#(`0`@l#(0``4###@o#D ##P,@c+# ##`(( @@+#d+`+#h0`+ ##P+##`4#(`0`@C# 4 !`4 ؀2 6؀"(`@. a$!&!#L  ?,   (  @ 2 04#"@ b4#d6 \ a@懐 > ɒ @怔 㿈> ##D#P<' 6 6#6#6#`,@#"n##,@#x,@#|,@##` ,@# ,@#"#\#t,@#\# ,@#T#š,@#X#Ę ,@# ,@#l?,@##P`A,@ cT `,@   8 #p ,@2#p##l`6#,@##P,@ #` `#,@#,@#Ѐ`"#@##P`,@ @6 @ > Ɂ H,@#x@֐!㿘#D##P`,@#l @(``c" # #l @(``6?#Ԁ`@㿘Hof4 (@g a";`\80a %@ݒ 8 4`\`@8 Hp@a50 a6 @#/ ߀ 4`\`4`\` 0ڂA`@&`"Ӱ Ͱ  Hp@ 8@Œ   40l`\4`\ 㿘Ho&(@gYѐHp@㿀#D> > ɸ` ##P`B-#l# @ ##P`-#Ʈ  U) @#) 0` ## @ @+`0` `a `(`@@?####`#d#\@3(7#€ 4,#Ā0*2#ˆ@6##ń#\-#ƅ) 0@"####؅0` (#L //(`@7, 2 > @ ah @Z> 㿘 >  @a І@< K㿘#̀X>#c  4`" 6### (&#( (@ ;`&#; 6#6#6#ğ   c4.  6#{  h !>>P& 8&!Ā` &!",?`"&", 6 &!@ǐ"> @㐐#H#@ 8@@ 6#`\&#>b&!Н㿘 #>>@!, !  @  !@㿘##D` 8##P`,#l , 4` 2}#l` Q`#`M`#d` `#`   І@>   @ {6#> 6 ) 1 /6 ###@r#D##P,@c+###`(( @@+#d+`+#h0`+##P+##`6#(`0`@"6# 6 ``0`"# @> #܀`<@t##P`,` "#l##   #l  (#l,#l ``   @8> 0#`  @ > Ȃ} z <0> ɒ@x  ##D`@#P @+@#\#D   $"`#D#P(@ #"`#h#D`@`#"`#D#P(@ ##P#D`@ A??+@#T#D?(##d#D `?`+ #h#D# @@ @ +@#D#T(#D#P(@㿘#D?(@#D``@"%```" $(# >>@,> ɠ a @Ֆ   2@" 0 $@`# #㿘  > Ɇc @(`*@` > Ɇc @(*@` *> Ɇ@@  @(` @?( @(`@ `( *> Ɇ@@  @(` @?( @(`@ `( *> Ɇ@@  @(` @?( @(`@ `( *> Ɇ@@  @(` @?(( @(`@ `(( *> Ɇ@@  @(` @?( @(`@ `( *> Ɇ@@  @(` @?(( @(`@ `(( `> Ɇa ` @ *@ > Ɇa @*@` > Ɇa @`*@` > ʆa @(`*@` > ʆa @(*@` *> ʆ@@  @(` @?( @(`@ `( *> ʆ@@  @(` @?( @(`@ `( *> ʆ@@  @(` @?( @(`@ `( *> ʆ@@  @(` @?( @(`@ `( > Ɇb @*@` > Ɇb @`*@` > Ɇ b` *@` > Ɇ b` *@` *> Ɇ@@  @(` @?(( @(`@ `(( *> Ɇ@@  @(` @?(( @(`@ `(( *> ʆ@@  @(` @?(( @(`@ `(( *> ʆ@@  @(` @?(( @(`@ `(( > > ʚa @(`  @*@` > > ɚb @(`  @*@` > Ɇ b` *@` > Ɇ b` *@` > Ɇ a` *@` > Ɇ a` *@`   -   L` `"  H1`   H`  (`@ `( ( H `" H`4"""" `,"   " `" "aH`@!㿘!>  @ߐ   @ڰ$`㿘 $ " H@s L& $ H (& H@ `(㿘``(&` 4& 4`2` 1>  ? $$ @կ @sђ L & $ ? 1> $$ @՞ 㿘 `1> @Ք @Ւ 㿘> 1`2 @`  ` T  `> > ː#@'a`J 6 P`6 R(``2` 6 R`` L& L``` & L`& X``@& L` & `& L@㿘$ l`@# 㿘 $(x`@G &6``A` ``=``@  "2!!,`@&`@% ` @&" #`   ,`@& "! 㿘(܀`  @ (|`2 @" @``@ 2 @@s L(ܠ @` &(܁㿘 N $ "`@r L$ $``@`# ``?  `h81  ( %   " ``? ` 쀦(8  L @q$$B$ $ $` nd 2 $ $ @r L$ $㿘(ܤ`  7`x@  L`@p `@L ܆$܃(( @@ h|&@ h` h@r~ L㿘@v  2 " ,  㿘  2 0   @2ߐ` 㿘>`0`@vr < ,@7 ," #  b!@  @z) `4` > `$ a@  p> 1` >`0,````# ' `` ` '?؂ ''''''@* ` @&` '@``> > ː#@Za`㿘> 1`7w 0>`0`` `@H " R `2  ( 4`"` `` $D $H $L$ @}` $ @}`> > ː @a0ŝ㿘 ` @za$" `,H`a 㿘 ` @zC$" `,H`a 㿘@z @n㿘>  @ > 1``> > ː#@Òah ,`$ 4$v$  $$l  & ,ް 㿘 4`@ 8`"7 >  @  .> 1`"> ː L@om $ $ `   (@2 `4`0`$`4`$$ $`0$$  $  $`$> ˔a.`@z ې 2 0  `2> 㿘@`8``"> 1 `2W``c 7  &` > 1`2;`` `` q ` @2lV`@"iV` 2  > 1`2`` X ` @2#`@" ` 2  `> > ː 8@ a` V`V` > > ː P@a` > > ː @a` +  "` `a0.` `"&` m&` %    @?$$ `$$ `$ @$`$  `$ `0$ `  @  (@$`$㿘` ;> &`> 1` `` $$p` $$l`$$x4$v$  , $  , & ,° `> > ː pa@ې``  $$p`$$l?$$x4$v$  , $  , & ,  @ Š㿘 T  `&$l6$t`6 T&$p`  a0` 6$v L`` & L&  , &  , @$ , L`& Ly@r> >`0@E   a L` ??6$v` `  `!$x`` >`!$|` a0   x >` |㿘&d|&dx&e7   \ ) @  䀀 ##  ?) ## "d|"dx2    ) @   䀀 >`Ȓ  ?) >`Ȓ 㿘> 1`2L Ϣ   ,H`(! "! L`-  L`"  .  ? @& & '   ? @&&  $  `! K@1& L > > ː @چa$ , $ 㿐cd@I   L@mE P> @pa``(&`` &`&`(&` &`,&`$@vْ 4  `&`< ` &`@ @qǐ ,@Lِ @q ,   0` 0 > 1`  (& ,! , ` @E&`8@n L㿐(   #\> > ː @>` >     > ˚`#\1> @23>  @pa㿘 (d # > > ˤ`ب @qp@qn@qJ (` `0`, #@q<! @ dl@Z$ `` ` ? @`Ldl$`$`L`$` `> @ @q$ ,`㿘1> @q* `0a ' @q"@p  H`8 @" h (@`  @p`, %`$%`, h`2`8@pޑ@pܑ @p l@pא "`,㿘!> @p !`@p@pȐ 8``  ,a2   < "  ,`l@p@@ ` L`l` `l@{$  $`h,`l@p㿘)>  ئ@pa % @p@p 8$`$x` <```  @@ @O  @pl@pj 㿘!> @p ! `h@pa 㿈#> @p~`a `@pU  `a0` V>   @pe@pA` 8`26 ,a20 <"#   a0,, @@@ `` E@p"`   @@ޤ   "a0 ՚ a0@,, @#@ @a0$(xU` @p`a )>  @p@oݐ T P`"T R L`  $ Lݒ   $`U` v``a0''  L` 2 X`@2 `@o`@@oʐ`a ˀ L  @ X`") \ ?% L @  ``"" d ?$ L``,D   8`2> L@oy`؁@* L L. .   @ B@> 1`2`4 @ ,, @[@t@oL> @!@oB ؁ L`$ L'@oZ@o6`a0@->  `"f$ @oGa`@ `@o@@o```` @`@o/`a`,!> ` @o'@o ؀`U`#\ LC$ L> > ː `@ث"8$ d L0$ \@n؁@nݐ ؁> @nؐ ؁  @ @ 㿘#> @n`! "` @n@n`ؐ`4z ">  " ` `4@n@n@!@㿘%> @n!`!`@n@nؒ?f@n&! ,H`(!@nx ,㿘 (!> @n @n@nm ` " `(? @  ` `(> `! ?   @U`(" `   $`,` ``H "`L@}~`L @}x@n2 (@kW L& ( 㿘 (`A!> @nG @nE@n! `(`@n`@1 0㿘 cj@ (@* !cm@">3 0o@<0ch@2i@d!> @n @n@m آ `9?  3 @m~@C} f@l@e@@!> 0܂cg@!cn@7`? `?!> @m @mߐ@m ؀`̒ cg@" 0ci@Kco!cn@W!cm@w @ ck@!>  f@o#lck@Fe@ i > 1`> > ˖b@)!P0` 갆 @" cj@2 {@ 0ch@2t uo֒je L ``$ LD`\  " @| "H@|yH &L& $D$LF$HYBv>:6?? 㿘!0> `0*`!!4`@? `@1`@r!4& & &!&!0&!4&!  0`X ` ` ` ` ` ` ` `$ `( `, `0 `4 `8 `< `@ `D `H `L `P `T> @W"㿀@rא &!4 @hY"! !$>`0`"!0"!4#d #l#`#h  #\@  @i㿐 |` @ ` `h@  @  >> >`  >> >` 㿘> 1` ?6 4` > a, ,  0@Y `@@N 㿘! @ΐa$&(a( &,a,&0$ 8@a ` X&t]bi&@! ]ao! &4! \#` #` #`6a  &<  aW&X&&6p6r@@6 ?(0`1?@#`3> @6.  `@@@J`㾘> c<' @qC +?> 1  04`, > a, @ @@@e0b@"f&0c@`8 `   `e@"(%`r@ `h@"7 b@2 \?"&\  ) a) @@!2 &d&``s@2ͤ `"ɤ   @g6! @ฒ\!@hϒ 0`ʄ `&ฅ(&` 0@y  Z  `$$ $,?$( @'d''`''h' @$$ ät 4` `@ t$ @ $ t @t$0 u@ 2t ӀH( H&&  t`@? `@c`@0A`">  07`KӔ!00`20+ @ & `ਂ (@"Dࠐ@ 00@ ฒ@  e`g@"T@Ԑ0&!0`@   @” Z &d&`> @4"@  t`@? `@`@0ޤ ऀ8 @o`H8@g @@0V$ ` $@Y 8, 6   (?c> `* @  @f H$8@Ӓ@= $ >`$@$L@W0$8㿘> 1` ?0`@4# > a) ) @@ 0@F `"!!` !`" ! 2 @@&`2! $!Ж !㿘 !. .  @@e )> > %!bP  ! $ @ҟ @l 0@E`@@> 1 `1> @ő"(㿀> 'c<'@' 6 ' @ؖ"b@? ''!8@^ `!8@"@ > ˁ@+"` `<`H>c㿀> 1 D`?@0`@0`@  > a+`+`@@a2a8  <& 4 0& @d& 0Ho$(@e@THp@`T <`@?"L& @ <&& <` Ga8(`(  0 "Y,`>0`0`   @@B  a0 #\#`a4 0 H <#d5 @- - @4 B #l #h@G & 4 0d& 0a8`v 0& <``( & < 0>`0 `> cP> (b 4 #`#\!> ˒`@ې"X`P ,`㿘`C%> #>  ``> > ˘`d gffg(`c3dτg((`+`ag`(`( 0((` 0#@?``@`@ ͂`$,``  R`  > 1 `"`8> 1 `ȁ"`8("  "  a@`` ?  > #   > > 1! ! b  >Fb㿘  > $@s 1> "X@}!㿘%> 1@ܒ> 1@[ > a`@8`@p㿐!> 1@!ܒ > 1@I > a`!܆@@^8`㿘   @5@-㿐9> 1@c > a 6'> `h%> 1/> 1ఆ@@&8`h>  c|``'` '@%` @=ఢ@@ <`@:$$`@ @s'> ̂㿐 > a > . c  (8`    $@ @8` 8!@$;` @48? ?c8 8 882V+> 1@֐` > 1`> 1 ` @8`8` @`0v $$ $  > ` %> 1`pn$ . (`@ > !. @  `@,ဘC `> 1B `;B9 ``8D 88@ ; ``I@h`  @8> . c  (8` _ 8?c{ x 8?l8;` @]88$> a`x@8`x> a`p`@@%8`p@ 0(> c<'  `-> n%> `d` 5@sD@vl@v(&@  `@@ X@  > ˁ@A"@> c<@'  @> a؀A @(2'> 1@ݐ> a `3)> 1 ؔ@y @@ܠ @@Q$@@Ɛܔ! Ԑ bC @<< @ܐ@\ @@Y!@ > ˁ@8+ $`ʒ@"㿘``8  @b  ` `$'@ @  " 8`@*@```8`2`@F:``` `ဢ@  @ @c} @ `b 㿘> cl `a"   P  > >!@aX 1> 3> !@ؓbh  2`0H> `c<@'   @ X> ˁ @a (< `'`*@ `@Д@' "``@@c 0[@ ``` ` @!@u` @@ @@]@& @@w `@"㿘 `  ` !x`B /@& &` ` "tp0@& $&@8@&&& 7`& 8/0@&p0(8(@@& @&  㿐  >@ >`.`86(@>@@   @T  H@&'@OY''@   @'(% ''' @' @G''Ѐ '  'P`$` @\ &'Ёd'`'H`=I ` '0 "$8p@ H$8$<  ̂`?p8''@ 8' ??@''    p@ 280$8$<    @    @N8   E    `H 8  @8`C<8'Ѐ Ā  ` 7`!d`%`0``"8Ԁ``3N`!@h`8 @C<8@  ``Ɛ`(` @  $@@_ @-ؐ @ay 8"88$@ȥ8` ` 8 2  ''ȃ8 8`@  @N2Ȓ   ̆@`H<8> @ ```8<0@@ Ă P@ @”@N  @ @% "@\Ё "@MC`` 'І?'І'' *2 (@2 @''"t<8̠ y > `h`8 @8`8H`.$%@ɒ=@ J@`’ |@ 2Rv@\D@M@ @%@P @ @: I쀤`@  Q(y%`h`0@F8`0 2)6@MZ@li p@"`!  ``&<'ȃ(` ɰ@#'Д   > 'Ѐ@ :z<80$8@֒`  '(%@D<'@p'Ё@8$@  `" `  " "㿘 gl     &`&@ ` @u` ?Aa9, , @ @(` @,`,`""*  @a, 80`@8` d$@V0 * 80`@8` $d, ,  (( ` @ @ (`(`  -8`(`(` ( !&@&`   (Ѕ( @㿐 ? /  /  /  /ߐ  /ې  //|㿘> 9aX  <`> ^@Y " @q$  @_ :&  @n̐#0㿘> 9aX   <`> &  @p `@qC @n# & 㿘> > `  3 @ @(`@@@ 2@ 2`2 `&&   D  @W!  㿘>`0`)> 6` %> @ ̂ @(` 2    @2 @2  @qr  ȁ㿘> 'b 9 > @> `́  ` ```((*  * 㿐'H`*` `>`>` @K```  ( 8 *􀦠2Hڠ``= ` `>`` `>`2 㿐 `' 6`6`H`" `&`am&`6` @Kc? 6`6```  2;```@`a6` `@2``@6````` 6`````6```@``6``@2``6`(`@&`(&``. 8  ` | 0  8 8 8 8 8 8 8 8 8 8 8 8 h 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 P`( x0@"`㿐 `'p !`?@@f``!h @? c) @&`C`2@ `< @*9` ` L "`H@ 2HL @``ـ "@Jm  2 ``` 倢 `` 8`4 `2@(`  9 @ : 4     ,@4`8,0@,@@@Nؘ `H`@@8 `    !\(`((@@@@ 2d!h!lb`$ 7 ''6'''Ē> 1<( ` ''ܐ'Ē> 1/㿐`(`,@`$ > @ c@N !`2``( 0 !` ap `$`(#\ `@$ `( 0@>` 㿘N  `7 ``2 `2@@ ` ` `2@@`8` `2@@`8``&` ` ` @` ` @``&` ``2 `2@@ ` ` `2@@`8` `"@@Ғ```̠  `Ơ  㿘> @ #H@ܕ `!> ˢ&al "#`@    " #`&al`1 @  "'ܐ'Ē> 1|耊" ?X6 !p  x7 !''''' @ז` > 1bx[*> 1'M㿘 `"  ` ` > ˰ cx@ E " `> ˔ @ =c `}&`" > ˔ @ 0ch "`0 `@"`!@㿘 ` !(`> @x#`,> ˠ`@ `(@0@`,(0 ``(`$&` @ &`$0>`$`$`@&`$ ` &`> ` > 8Ѣ    ˆ > ˠ c@ Æ > ˠ c@  㿘 `(@ `$k`0> > ˴c@>> `D89> @`, `@@4&`(w @L`2 `,@$  /`-  ` ߃(`@`,`  @ߠ`(`$&` &`0 &`$1   `,@ˠ `,`  à `,@ `%` @`,`,%   `(&`$0&`0 ` ` &`  ) ((`@@ @"` 8` "` () (`@@ @"`8`"`     (((`$@@@"`㿘    (`) / @(@/`.@@0?0`@?`@@(`@'``&` @`??0`@@(`('``&` ` ``` ` () ( ( #`"`JC`    @(`@ 3` @() (`@@ @   @() (`@@ @# @  (`@0`"`㿘.  `"  ?.> 1ch * ..㿐+  `2 @ *"Ė ;``;  ?P`.;`;E `` #@@  Ђ``  ,`? Ђ`` ,,` ,`Ѐ }. . Є@$@?i`;2? ?㿐`\  = ."6  `;@.`B `.@6 `.F6  -   2@ "`|"`㿘"` @bѰ  4 0&& 㿐 `` &`2&@iҐ F&㿈> 1> ˬclئ&&`% @l :  @W   @R D `$ $ $   @kR " &"'$  @e3$ " 6@ < x "@E   r `H    (((`@@@$ l8`$ h    (`()   h < p  @ @ < x `4db`2> '<쀢 "@E " @E > 90` (` `4:N2\ p@Y\ h8` &2\> 2` 0`"'(@ 8  l@ 8` 8&@hi6@@#@h F> @#> 1c 0 @k3 `> 9$`b  0@j|@j'$ @! $  @h F> @א ,@8@I͘ H @@h " @E   > ̒  P@ó F@h@D> @è 8 >bؘ 㿘" 0 &`&` &`8&`&`&`&` &`$&`(&`,&`0&`4 ` Z!` Z!taD t&`t 㿘"!8!d``?㿘 6`@`Ӕ  "b `|` @W  ?@ @h0 @Wǒ 9`$$b($`$㿈 |`$'`  @`Ր @iZ > c\@ @)` `  @cؐ @ y ?@\ l`"'p` '> ̮ `  '  (8(@H H @  , ```"@D4'd `@D)'` ` `(`@?b $ 9   @D"@D `@ ?@@" @W 9&b @Uq!t @N!t`P$ `P) ((`@@ @` "$8 ` ` ` `(((`@@@$\ ` ` ` ` (`(($`$p@$t$?$0`%0@C` &b&``$&`(&`&`$$$$ l" `$V` $d"`|@C`| `\'[Sl'` X> ̐`@˔   '> ̔ @’`  '> ̔ @` 2  ' `20'0c ?@~ > '`@K 8 > $dd`쀣`" V "    (((`@@@$\ (`$p(($`0`%0\(8@G $d`H $hl&l0` 0@BlV'l`&l  tΒ ! $ @`"&? @&(&&0&,&@Z9  4`@h    @d|> ]`H&@g 0@]ْ  $@ @D @g0ې@L` `!@} -@f!0ʒ 2  Y Z  @$ ! Y $@֐!t t} 00 @~ $@g٠ > ca>0> @i`  > > lb!> @i#\ > @ > > ̐ ؒ`@jj #\' > a$ @  `a$  ! 9 0@ik@3 `  @ia@U@ #a$㿘@E(?0b > ̦ " D` 0@@$ 0 0D($ 0$ << 8 @̔ @$ @@@s  H @;  ` `DڀP 0 h$ 0@A  (`@?b@ ( @Ԑ 8@Д  0` `0` ``p<) 1     @  6@ .. @ &6&@  aW6&&&6&&6&6r@6 0 h$ 0@A  ,   h @ , T H  ,4  "$ 4    (@` `"` "  4 8       E   `(` >     "      `d`  %    $      `>c4 D㿘> ̰ @!  `` D>`  ` >` D㿘 @|ޠ@do 㿘 @|Ԡ@de 㿐 ` ad` ` ` 0`( @Ep @@   H``@@ @@ `>  c(>  ``8> @# @#@@`c @u> @t# @$@  @ 㿘``@(`6`#0(0@ #D #H` #H#0&#D&#H@uk  ">#8&#@?` `$ `$ `o$ T`$ `$ `$ `$ ,`$ 0`$ 4`$ 8`$ <`$ @`$ L`p< `p`t2$ H4` $ H $ D`$ (`p< P4$  @Q$  ' '''Ă'$''''''''䀢 Є& < @S  $ H$ D`$ (`p< P4$ 㿘" `"N"`="2    !! C!`# 2-#" ``` 6"#((`">#}2 #((`># !"}2 "Ф # 2!   .!#' ဤ".  ```6"#(@ "Ă `! `4``> c ox'D'` #P' @Pٔ *!* *"*!* "#0D`  0`'@Pő(`'$H$D $@<(䦌 `<8p8  ' 8, @ &@ d` D H  D`  "8@?88`D@  @R+!(d @  "(@>( u ^  `H   ( @ 8`@C<( j 4 ` ,`!& ``P`(` $( @ <(d`2> ˔!@c@ `2 dL`!`";,`] d p`#\`?`! `,d2(ǐ  h(, l jV`,(怢 $(ۀ M"#D'' $@<(䦌 `-<8    "(@Qy ?(, @Qn x '``o `` p` %` `` Z' #@'>4O: :*82(@:@పDL@@B=ర p @   H@s @)`p" ` @= V``RP`p ` '䀠S :t0` 00! @O< D 0(  (8(3@@p@*@"t#\#`@B$ @P=  @@=@(#\9#!@ ͘ #\V 㿘  4`W   @" ,`  | $ D0@@  @y ")  0$ 4d$ 0Hod*(@@>^Hp@Ho$ (@@>OHp@ e02`  H <@  $ @e0> @!@?2J@?``0`   HH(`0`@1`@  + 8`` @ H0 * 8` 㿈@ 4 * ' @ `   "@<` @0(? ?c(`0@@@ @ @<&@  @<`"   4@`<  @@ @"@㿐  &@@ i#?`c@ `8`9`:`;`?`<`=`>*) +` @+  ((  ` @+`  ?( @0@,`  @  ? @ + 3`?  (0 (,+` 4? ?  `@4@ 3 @   @5 0 @@@ @ܠD?,   D4`@@M%<& 4y D`@_&P> c<' @@( 0?ߨ@" 0 0 $(: " <0" D" 08   @$@$ @@:    H@  " H  0h$ 0@; > ́z  1 3`?)  @ ?3 c @ ((` @1 +`@ @   0 @) (` @g !@`@Ű  0 @$ 0 0($ <$ 0< 8 @ᇔ @$ @@:. " H @Д @ n 1 0` `0` ``p<) 1     @  6@ ..  @ &66r@ aW&6&&&&@u r6@C ς@!X (`*`2`?(c8@    @`   -"  "` "` $"`0"`4 "`:`"`"` "`$"`("`, 㿐 `` &&  2@8 "`  `  `" `+ `( `) `*((`(@" , 㿐`,`-`.`/) (`(@%??0(c0*   @Lc& d a `,`-`.`/) ((@0`(`@@0` *@+`(`) (`0* @E& \`0`1`2`3`,`-`.`/ *(`@  * (( + 1 ) @ 3`  (1 +` @( @3`8*  *@?;   " d@: d@M `,`H`-`/`. d) (`@(0(0*x@:g d '   d@M  d 0 1(`0(ђ  0 1(`0( & `*@ `8`9`;`:+`( (1  ) (` @1 @@ ޖ0x> a a aac<@' * ((`@ `?0(c? (`0@@@" a?`a> ̆ap> > ̦ aa ؀ @  @ Q 2   * ((`@` `0((`@0@@@ ?` ӆ w/@    a a aaΠ @@   @  逢 倢 > @#H㿈>`0`&"' @ / `' -> @xВ'`ǐ``(8@> > @!@e @9^! `H ? י+ *(`(@ ( +`@ 21 ?)  ?3`c  ((` @1 *@ @   @ؒ @J %`@@! @9 ! i> @!А! `@`Hw@9'@ 0 `@@L @`@`Hw 0%`8%``%` ` %`%`4 @X`   `> @EV@ \`@``"rW` `"ja``V  `4`4@^` > @m"`> 9$ b  0@]@]z'$`& (*(`(@+`@ +   21 ?)  ?3`c  ((` @1 *@ @   X@ %` ` ` > `4@"!  `4`  `4  `4  `4  `4 `   `4  `4㿘"?<c0`(`@ ?@0`*`@@@ @8` 8㿘"6`  @TG 5@tђ`   ?@W ?@s @t; `|@]Q ``2 4 d " H@K+  H "@K% @K" `$$b($`$@K  d㿐!   !> 7> #(!#\> @b( D#\   > > ̐ @b0 0#\   > > ̐"Xb8@ X@T' @\ > c\ @t`` `  @W @s͐  ?@r ڒ  @I h&b|` ` `$&` &`&`$" |` " " !' $(@<0 ( H  @J  @J `$&b(&`$ @7i@t` ?@r^@s  `H 2 H`Huh @7L?(0?c'  (`0@@@ 0 ((` @0@@0` @ @'  '77κ  +` (@;̘  `H B ׉) (`(@0((`0@@@% v% ?%  ! ! (`+ )  *8 +`7Κ@ 0((`0@@@' J   `Hj 8 É) (`(@ 0((`0@@@ % $% ( + ) @ (` `@+ ( @;`@ 7Ɔ 0((`@0 @@% % @6􀌠'`"  `"  `ƅ(`(@f> ̰ @(" H` N'瀥 > @"@ H! `H  Ӈ((`(@1 ) ??c  (`1 @@@ @    ) (`(@??0(c  (`0@@@% ,   ) (`@(  0+`3 (@@ @% 0 " P@6' P@|  d  @jՖ L`% H` ,'Q  ( @: !> @"s H  ,'  ( @: v> ̰ @"`Z H!`Hn P! 8s `  < ,5 @@% <@5%?' @;! H' 2 Hv@5 > '@)# H! `H   ! > @5i |' `!  ((`(@@#( H (`> ̔"@  H㿈 $& $ -r  쀠` &? @&(&&0&,&@L R4`@Z\ |> ]`H& @ZQ ``@q` !`@p @q "$ qt Y Z  @A$ qh Y $@6@Z @?`,`-`#`.`/`"+ ( #*+` @ ) (1  8* ? 1  2 a @ +`2 (`( 㿘  d`?@@  @!`?㿘&`  (`?c(84 &@&@ (`(` &@ (( ( @&@ (` (` ( ( @&@ `* *   @> ͂`Ԑ@ (` (` ( ( @&@ @ @b&@@c&@46@$@' !m* *  ( ( @@&@ ((?c8`@oh(8`(@(  @&@pb&@    -㿘 `4`@% `8% %  0 1( ?@#`@(8`@%  $ % & '+`(`(@ ?0( 0(`@@@ 8` @%  ( ) * ++`( (@0`@@ (`) 3  8% L` % 4`" 8% `8% $% 7!  H P  , \ 44`" 4 L M N O H I J K) (`+ @+`((    4 8% <% @% H % D`% ( 8 9 ? < = > :+ (  ;+`(`(@ )  `?( @  3`? @  *+ @  *  ?  @(0 ` 2`@ ? (0+`2 (? ?  3     @4 0 @ = P4% X% \%  , T 44`" 4 D E F G @ A B C) (`+ @+`((   `+`#? c ,`  @  ? + 3` `+` ?  (0(@ ? @*@ 23   2?@   (00@?  @ @ @ 2 ; @ @(<=  ? < = > 9 : ;+`) (`+ @(  ( `+` ?   @ ?( @0@ *   ?,  @ 3` ` 4` + ?@  (0(+` 4 ? ?   @3 2  0 @   = 㿘 @! 'P'T  B ח**(`(@ ( ?1 ) + ?c@ @  (`1 @@ @ 3`@ 3 (+`    (`? ` @(8`@"> > ̰ @Ð#  " #(`0ր̒ ش    /?@. @! `  @ ` ` `) (`(@0(0d(`@@ @ ` ` ` ``((`(@< <` T3 +  @??  0`(@G `P@C 8@`d`` ͒ 8 9 :`\ ;((`(@?) 1 ?c  0)  "@ ? c!?`+`@ ;89:) (`(@0((`@0@@"@ `&+` `?`<`=`>) ((@+`? @(P3` ? @3`   8@  @#T @ 8`P 8@?E@B@d `> Ͱ @ݐ ( ش    9?@e @! ` @ @ ` ` `) (`(@0(0d(`@@ "@ ` ` ` ``((`(@< <` 'T3 +  @??  0`(1E@@ ` q M?,8 4 (@<  @,8 4 (@< ֮@> ̰ @p#؁> Ͱ @i 㿈 `  `!   `@8 B     ! (@! `2 @ 0`80@(!(@! 㿈 '?7 2@&&@@8&@```(8*@5 > `8`@f H@ '@ݖ&@@ P @ג! 1 @? Ӊ) (`(@ ؄?(0c  (`0@@@ '@ ։) (`@(  0+`2(@@ @&@ ? ) (`(@ ?(0c  (`0@@@ '@  㿘  @l  㿘 > @֐"X"" " " 㿘  " ,@/&  ,`   "1> @B 1> @Ñ"X㿘   @ "} ,`"    " & ,@Bђ    $`& M@ "@ `@ @A m&    @/&   $@& $& 8` $  R`%$Y   $  %(` &?(c8 L>   @ m$  & , ,` &  @&  $ % (`?c(8@&  &@ ,& `   @& & $8 $  "~ , & (`Ӥ @/+&  @  &m>" @ΐ   & (& ( > @Ð   & (㿘> `  8@ @9 > @ Ё`>c4  `` >`  ` >`  "   `@ " " @ *" >`" ?㿈  `^ `@`8`9`:`;`?`<`=`>*) +` @+ @ ((  `?+` @  ?  @(0@ *   ?*  @ 3` ` 2`  + ?@  (0(+` 2 ? ?   3  @ 4  0 @  4  @   `D4$@'ۚ   @.P'  ('$@' @ca㿘 > @ݐ А #> @!a ?? c  a( a(@ ?((a@ .@> @ a@А 㿘`    4   (@`&  4 @ $ % ( ) + & ' *`((`) @(..@@NÓ㿐 > 2@T &@> @n! 㿘  P@t H 8 L @(`@`> "    ? && @t @!P㿘 ِ " @@R$  @ @@ > @ &  㿘> `0` @j"` P@t} H 8 L @(`> `& ` & @tM @Ґ!P㿘> P`0`&@t] L H@(`@!@ 2 80  8@2@t* @R 〢  &@t @t p> c<@'   '  4  @>, ''''`" @,@"0 $@ `8`9`:`;`<`=`?`>+ (+` @)  ( * @  ??  (+`?  (- @?@  ?  03 @  45`@@@ @?c 9? "` V! 2 ` `2c8 $ %(` &p/    ) (`(@0(0(`@@@'  '؀`@ (``/7*`2` > ͒@$!`   8% %`"` ( $` 2_ ` > c<@ V> ́ ' /'آ  .///7 S  ł    +`( ) (07(`0@ @@////''/ / 耦  8% %( (`> ͒@!x@ ` ''@?! > @~H!x'  @'`;'`?`<`=`>`8`9`:'*'('؆  ` *`+ )  +`@  @fԒ @ "@97 &`" ` ?*  @( ` ?  ? @ @+`2`0@ (@ ? 3 ? 0'<`   `" ,@ 0 $> a ,  ! [> ```& `+ `") `$` ` ` ` `) (`(@?(0(`@?0@@ ( 5`U`f  `$ `%(`@+ " @&d   (@h@  ` @!7` ( $H@.I@J. &k > c `8 @d8`8U $  ```  @%<,>  ` ` `@f  @9q0  ``"  c `0@8`0㿐   7``@8 5 2 H | ` $ D` `0 <@ݒ ??$ @< Ho$0(@@+Hp@ 2`  @f "  0$ 4d$ 0Hod(@e@+bHp@e0΀2| H <@욒 $ @㿘 !mg' @ !m d@Ր!n 2 !@Չ!m  !n@`2 @| d 2& @v!     > ̈́ b8    (( @@(`(` ((& 8 h 0> ͐gb8!T@`!!@B '@=`.` !m@6 d !n@0! !n!m@ D!m@$ d  !n@! 8!m!n ݢ$@@퀦 6@@ d , @ ! & Ȁ@  ̆ $@@`.`.`.@ ..`@ <@ <.`@.` $@'> 2b`> #> 2 a`@8  ##S`F@ a2   `2  `" , `    `  ` 㿘  (`  2  > F!> #@ ` ` ` ` ` ` `   @` & 㿘 @Ut   @Uh  @Ub>  4c<'  @> > ͔hp@b@у 80`@  @=$@`2aT@_   P * ''' L@( ! ''' لa`\ &> @z# > c<'  |'`  @ h!` $!d!!' h'''' 'a'a'`4' @4' `' ` `"'@`4'  `' p@'> ' '  ' `' `@''Ђ  h'p 't'x6p " 0 > ́   (``'P'''T'D`| ='X'\'|'@?H@@͔ h`۰ 0 'p  ('x't @Tw ːp  @Tnp lht* @Tc   'p'  'x't@!'p֪@  0!0 ` '(ߔ   @@ є  @  }&{@z #8H> c<' ' >@5   V> ́`'  ''' 47 7//'S `F''/ł  ''77҂  '//'''777'7 @S֖ 4 ( 4@@ E @8ޔ '?>@4Ȕ  @:s 0@y#P  @ `  ` `  `  ` @S* ဦ(4 @ @> ͒@"x> ͐| Ȁ@G  > ͒@"> ?`  "    > ͒ @f"Ȁ@  @SS @D  ?@ޤ x  #`#\#d#l #h@d `2 㿘, ,  @8;aٖ 20,(`@@. * `2  $8 *  @8 a   " @9 @9  @9 @2 @ 2 耦㿘'T\`> @ & 8 @  @@ @0``'@'@`(`@'@ k@  + +  &  >ɠ`$  $ `$ @EV$ @$ $ @"    + + $ &  @$ $ >$ c܀` @E7@$ @$ $  @8@@T G  & >Ȃcp&+ +      @  T@  / + +  @&  $ $ >$ `耦` @D$ @$ $ & @&>   8 @T @p @l @hg   C8@_{ x` '/`3`*   `(`0``(a @`" `,8` > @" ,  @6a`  ?@8 @ϐ`ߐ &a&a `,5> c    !(0`@) ``2 cܒ @0a  V  `,"ǒ> @##Ð  ``  @P> 2b&a4 . 0`?'> ͘ pB  "`,> 2bb`   !`,`o  `''``6```,@[ '耢 ؐ. 06?9   'a#\M'䀈``a"a(e&a @&a "`,a ""a(&a @&a  '&a&aa '#\̈́ @&a &a&a  a "&a a2 &a@> a a&a@@(@&a&a@`@&a$  @5ݔ " `*" `," `@"" &a8&aD@7r @`a@A0̂ @n&a> c<'  D '?'l'''t'p@;l   4`"` @G'@ > ́`@_/ 2 P`$"`@vX#``!@_  ``@^ @7   4    Ѐ` ,  @5Xܦ 2`쀢`  > '`8    ` @`2 `-  t`@@ @@ x`"` @@&D'dK'>  a '`` ` ,`t8  'x t@@@@ @ @ @@'@  `@Ϛ   ^ &D' Т  `d/@ @@@ '&D¢ ``섐`?   (0`@2 ''`2 `"% `  '#\Ř @  @   @ @&$& '' @_` @u ePaDa@'` a8 @  @6 > @#@6 > @#@X`'  ''  ''>  'Ђ ''̄ '  '؂ '''a<'''_ @̰㿘@  !@`&!< @㿐`a(`8`!a` `> ͔ @咒cp ` @ L ` ` " (*H  ( @(`8 р ππ    al` @_`!`@]l @^a(`9 @8t ,a0@@8J , za(`&a( 0 > 9bl  (0`, , ` `? ` ? `  a( ` @3&a(` ? @3@$`  ? @3$@ ?$@3 $a(`,"@)  2$@&` @Ò 2`a(``&a(> @#a(a&a, &a(@ a ` ,a ` `8a(``l&a(`@_ `> `8@Ð# " @4ݒ ?  @4Ւ ?@"`+`>(`  ` @(`8`8@ 2 2`((`8` <` 9(  H`( @^(`!`@\ @] ?=?a( `2  &a(@7~ ,a0@@7V ,`` @(`8` €` ` @(`8` ` `a0 > ͒$@I$@ $]Ȗ "B$@> @#@ ``@_T >@$] 逢 > @#x㿐`  `> b`8 &`  Ac#\`#` ?@?㿀`  `> `(&` c#\*#`` ?@̚?   #\#``` `` #d#h#l@^ ``   @8@@ 㿐` $ > `b%`! ` @0d A`` ``c #\` #`@ 2@ 㿘     (( @`  @E    & @3 ? & & 㿘``"    `(( @@ `>  `@$ @ ``@` "``@#㿘 @  , ,  ? &, @1" , , ^9 @   "& @3= ?& > @ > > > ΐ `(H@Ɣ Y㿘<>&a&a > ` 4``(@5&a `+ + >Ș &` cp a aa @ @ a    ``*```` &`+ +   a  a a @       ``@۞@>`0`@%ў@>`0`@I@P @ '܆?> ΂`X'''''@7  > @G > @B h@Dā`!> !<`'> ΢!<` @g- !<`͐ $5> a  > @#\'#` ?@P? d > 2 xW> Ψ`7> ̬0 @ $'\1 ?''\) 21? \!'''Ԑ@Ȕ ' @ِ " > 4 -/ ˦  s$/'/[ '[ Π?> @!> @w!> @t `>)> `0"$@l `@s-> @> > ΐ `@b(8@]@y@@@c@@@9 @3@ {@@> $ a@$a@$ $$$$ $d܂ > $ %> $$`$88 <> @a0$<`"$ `a0  @a0$> !  c`! c`$! `,H`b we41   ,1,> 2bdp1 1 $0\>0@la4>3@lb`> c @:Y$` @Q0 > c@G$$@ ɐ > `@$$``?8@8`@28@> 'b  @<`? $$ @& @9 !> !  <`* P <`p   <`X@<`h  8 $`  <``!>   >>B @漒c> 'b̒ $L  @8I$ @@@c>@C, 0@p@;@/@Q@@^@/O@l@f@6@> -b b   2 @g@oHo&(@g@@@vHp@ 8>  c<) @ ؈? @ L+> @qc8#\#`"#d    >@ Ga > @#Q!> "X` > ΢"Xa0 @eO "X`2 > 7@Q"P > @w,!8 > @w(!@P2> lb`> Ο@ > @!8 > !$$!> @ $!$  @ \  \#> `@< \ @Y ` c8 \ `c8@<`c8>  > aa!!`! !$` $ `   @ $ $   2 @% >ٔ  > @#2h T >ʐ > > Δ@#(ሀ G >ʐ  > @#᠀ ; >ʐ!  > @#` / >Ր!( > @# Ȁ 2$> @ ʆ@ވ>   `T> 7@QT"`> "!<@cN!<> Π"a @d > @c!P@a! @_!> @\!> @Y!> @V!> @S!x㿘. @a c  2 `(`  `2 (` . 6 㿘#> `> `0!>  ` @Zܔ?$ $`܁ ؀  㽨> <' >`0`> !> 5> c> > κc#> 9> 6/> 6)> '%> 6 $ $`@NP\"В (@d. ؀ " ` 4`> P ` L@8` @ d(@8 ؀@2P,@ P ؀ "'& 4`+ P ` "H@Ñ8` @Ġ d(@8P@`ܐ $`&`@P @Zd?&`&@" ,@ 8P`ܖ @ZV? $`@"&> `` >> ΐ!H>cȒ 8> `> <'  o ! Z  `X@;"77a@'aa!"@'``' 7ڒ'Ђb?@' ?/'a@'> '@Vb> '[bВ26 7   @ 7`'` '`,`+?`` `"%?`p'a /#\ ##`#l#d#h  ( @Y    @7'?'b@@'> @mӐ#0P @6 O@` '?'''''@Z "ā @W 4`2. #> `ܦ`%> ؀`"@> @a ܀ "  `@Ys$$@`$`ܰ  > ` @@Y` ` @YX  X  X X` XX \ X"`X" X`X``X" \ X@ "`X `X @"   X`  `"`X"`X"" @ >`p >`p 㿘   @,^ ""   >aؔ @tw@㿘1> 6@aѐ"X> 6bT`> `@aɐ`@a$`@a@`2`> ` `@a"X@a㿘 @a  & `@a&`p@` @a&`p㿘 @a @ @aw㿘 @a  `@ai㿘 @a @ @a]㿘 @at @aT0 > έ.`c.`% %@a` @"!(`(` &@` @@ 2%% @% % @a(&@` 㿘!> 6@a6"X>  "X@a `> 6bT > Φc@ @a(   $   @b  `@`  㿘 @a  `> Π cH @b  `&`p  ` & @@`Ӂ㿘00 d 4 0Ho$(@e@Hp@R 㿘  `)> 6"X@`& !>  䀠`> Τ cP"X @bF  䀠`> 6T2 @2 ?&@`"X T@`"X㿘`0> ΐ @`u .`& .`> Ά c&  "& '> 6@`X3> `䀠`> ΢`cX @b `䀠`> 6TX&@`Q T @Ր#X> @Ґ#x㿘` `hc > 'bԇ,` ,` @(`"* @s  c > '> 'b!#@¶#@> 'bԒY[ @T?@H`> aa"`" Hp@㿐  7 ` hc> 'bԇ,`,` @(`"* @  c> '> 'b!#@c#@> 'bԒY ?@@Тb@Ȥ㿐(&( @@(`& H`> aa"`" Hp@㿐(&( @@(`& 㿐@ > ```  @&& &b@& 㿐(&( @@(`& 㿐@ j(&( @@(`& 㿀> `> '> 'b> > 'b '''''@OU '''''@OJ 㿘 ,` , ,H` > $` $> 쀠`Ho-(@ > v> v b@ Hp@n㿘>#> v`0bT@  P1 T> @``@  ,` M>0 P`%! P> ,` 2K!P0`P`#`P > aO "`8!`&!`8@;`8> @`  `& H$4  (@9 (b>`0  `P P> `& P,`>0`` @k @Ɛ>0 P`! P @`>0`P`#`P @9 >`X@ > `& `0b#`P@;`0`0`@@8`@㿘>`0`  ,b"q> `쀠>0 L`& La_> a8> ' b> v"> `@ #" @  #"> aT> > aP #aT> a` "> > aX@C 8aX@ ` C< 8aXaXc> ! Жb?  > ?/a !#!> a  ?/a a#a!> a4a> a0@e *> `@  ؀`> ' ܀`"  > 'b@` Ѐ J!4 耠`> ' 쀠`z> > 'b@_ 2s> !L@fG n> a@VցƐ>0 L`l& L@ki@  `C#膃`C<?2 ( 8aX> ! Жb? > ?/> @f  >bp >bp 㿘 >8 @V`> % a> v> v  b@ > `쀢`> '> 耠`" @> '>  a( ؁> b耠` > @ؐ#㿘 ,` . ,H`` > $`` $> `쀠Ho-(@> > a(> v> v b@: Hp@n> c d d, dd d d e0 e e f$ c 9 (@` `< (`@4 ) ``??2? @* *`  ,`2  *`0*  ? 2 "@   "㿘@+ ,.` @ $@>`& $ +  " @ (@ (#@ @4>  & 3 ( (@ (   & & @#㿘 `">  ` `@   ? @ &@1a& > Ē> Đ"@w@ 㿀@ z` , V` ( -` `(`&` 7'''而 -'쀌    7`@ 6` @Q ` `&` 7`@ 6` @Q 0 7`(6` @Q~ ݰ㿀   `+` & ``" `D`2 V   `& `2  ( 7''''7 @QR @ [> @a 0㿘 `*6`*(``N` `@&  ` $< & ``)`8``8``$ ``@' '`@' '` "` @9` "`8@9`8 "`@@'Ғ `@ "1> @'̒ 1> @!<@@'ƒ '``8``8``4``㿘>  @!<    @3$` $` @3`,> @)`H> 2bX 4`(4`*`H`$@$` `$`$``?$`$$` $`$`4㿘  ,@* > @Y!< HRv  " @3  @3  ,6 *> ϐ@)o`H `4k  H &&     P  (`*  & & RL&   RH  RD  R@@*!@*A 4n  `&` P` `2`< `6?& 8& @& <& 4  c  ` "` @` `6 @)ې c (`@8` c, 4 ,  '@%I &&  8``<`  ' * @%; & (`  '@%4~& s㿘 @( , `11(` 2 2  Ȣ Ȫ !  '@%  , Q$@ @  Q%@  `4U`8``8`@&,& && (`8``Х=` ' @$ ,` ' @$   <  < , Qq$ @ճ   <   ?, Qc$@@@ե  `8``8``$ &  @&_ ' @&\ '& & & && @&S ' 㿘 @6  ` T` `$` `` -`` `$` w -`(@O``@ON @O ` "&`  ( @ .   `$  `!$ @- 2'`O p ``8 `,`> ϖ p@e`P$߀ 㿘 @' ,` &`  .@"  `$   @(@` *`"'2' >+` +@  "  4$  `$ '   4 S ג׀`@Đ3`(+ @ 㿐 X   !> 7> #("#\> @#`X> #\!<!0   > @``> bȁ㿘@' ,>`0``,a7D 8R @3  c- .`  >``( +``"   +@  "  @4$  `$  3 @Ɛ3`(+ @ 㿘 > '`'L ``$@<8`-``0`` +< .  ?0@@"" Q}8. ?,``@;  )`(`@<(܄ m .  (@@ӂ`    8 ?0@@  ΂`.  ( `Q%8. ??`,`: +` +@%`2 ` `3`(+ @ ` 4%` ``$`%`%`$L @`(@  x @>Ӱ c<9> '`,> V $ ``  (` `$ ` `" @') < "$ EL@&Ő``& `,@' ``` ,@&ߐ  T (`8`&  34 `̂@4 `' # b~@ "d  T `Y ``w & T `"`` b @(  "  `&` `` `v pT `"M`j  @T `e ` (ؔ Ma 2\ W`W쀠`ŀ`_`"W M  PJ @(HZ" `, (`<&< `@' b}@ "0  b~4 ' `# &` (ؔ M 2 W`W쀠````2   @L @ 2 `M  `2 `D   `" `DH``  @LZ :7'''' @LI @ 7  (! <`! @`! D Cހ    2  &1  @ P?ؐ   `` ``(@% @L @  2  &  @ i?ؘ` ? ` ?ؘ` ? ` [?؝㿐 @,  $ؐ@%  `@%$    `$ В @%_  @%R㿐` @-> ',V   ``8 `" @@@Q `@%L$ @=4  ` $ l@%͐z @% @7> $@<`$$+  "@ (@(#@ @%> "$0 @$& 3 ( (@ ( $ @D h@B#㿐  ,@$ _ ̔  > '> bĀ@!  $@L:` +  "N @ (@ (#@ @[> L > & & @ `> Đ"@   " ,"9> `" `"   (`   " `" ` &@& `"  & $+  2@ 3 ( (@ (  4& ȆȀ`" ` " @#㿘 @# ,.` > `&  $@>` +  " @ (@(#@ @4)> !  4@$  $ $+  2@ 3 ( (@ (  @\$  @l#㿘 @ ,@$ @@#  `@@#۰ 㿘 `,@#`  `@" `  6`@#㿘 @Ű   ,@#Аm@# `" 㿘 4 @`4R``( > 6b"`8 "`  4`(2  @2  ?"   4(" 8`"2  (` 4(2  @2  ?"  ( @ "  R``` > ϐ a"`8     ?` ( `" (2   2 (㿘 Hoo (`>    ? @ (& & & ( ! Hp@ !  > > ϐ `x@$3㿘 8@"& 8 (`@2(@2  (?`"& 8@"  4 ` 1> @ّ#<@0@@(`@2& (`" 8 8 4)1> @#㿘@  8@ @ 2 8 *``8>݁`  `" > >^c" ("`8"`<"`"`H"` "`L"@"`"`"`"`"`"` "`$"`("`,"`0"`4"`@"`D"`P"`T"`X"`\"``"`d"`h"`l 8"`H:`8o "`㿘 8`2`4`< : @ `@0@ (`@&"& ( 8!`8!@:!  @ʑ, `4`8*J_`4 *$ @Ξ*`8 "&`4@] &`4&`8 `8(`@&"& (  @@`<`<&`@㿘 ` `2 @9 @Rg&  `" & @U 㿘 Hoo (` &  &   @!  (`& ( ! Hp@ ȑ> > > ϐ `x@$$㿘 2 80   8`  "  (``& (  2 8㿘 ( 㿘``4 (>  c`8- @  @ @3`2 `4 4`8`<>  c`@,@  @ @&`2 `<@8`@& ( `V$ װ  8@ 4 ` @h$ 8@@_$@ 4’㿘 (H``A ` Hp@@U   `$ Hp@@`l "Q''@#耤 Y'`V?   $ `2Ȩ Hoo `2T   # `!& > ϖ@RHp@ 2?``" 0*, ?  '`'Ta> 'Ї(` (` ( ( @ @S  '@􀠀؆ ֆ '' @`U&  $ ( & `M e@  @?$ f$  ( `"i 8 & & & &  $& `p` "f$  ($ $ $ ( & ͶHp@ GRH` `   @?''Hp@&@, $,G,&@'@ &   @?$ $ Hp@@=ဤ`  2  ($ ( u&   $   &  ($ ( & Hp@ 8@ H`Ta.> 'Ї(` (` ( ( @1Ђb???/'a'' {'@@'t& nڮh  #"t sp 㿘V`  8> 6(b@ `@ 5` `$` @4/ 8( 2 (` "%` @2T V`@2` 6  8`y`` `X$` ``   `$ ,` $ 0`$ $H` 8`  2D (Hp@` (`H` (`$ (Hp@`` (``H` (``d$ (Hp@` ``$ (0< ` @@1 @@ (`     2 @2T 2c >  #@~ܨ j `4 ` `8`$ ,`  $ 0@&`&` $ `$ `$ ` $ `_$ $@ e”0Q0㿀 ,<@   @&  %` @ "      $7'?.@'''7ؔ  `&  (  4?`& (6  (2  @2  ?&  ! ( 㿈 @{  U `" `% ` ! E: " ` `% `8" &``,`2 &`> ϐ`@ &```O(` $/`4 (`('E  􀠠$)` `*,o,4`* $] ``" $`04`*D` ` ``&` &`ޢ```( @(&`&`` &D `% ``` =&>`㿐 `,@@Ð ) 0` 0` > 6bd > @}""$  `(&`4&$`4$ , , ` 㿘 <@V@ > 6 㿐> 6> 6b@' ` 0#@#'@(( @@(`'`  4 @ >@U bp@Vϰ $<㿐  (`& & ( `" 0#@ϐ#'@(( @@(`'@V <. 㿘 @ ",  ,`'>`0` "`` @ @"> `$`4`  4``0 $` $`(4` ($`$ (  a"` 㿐 Ĕ   !> 7> #("#\> @~`> #\#> ϒ @a  @~ 㿈`8`4`@ @> a&!@@m`@  `@@*a!@#\#`  @ز  `@@Ӱ  @@R&`@ %> B`@c@#\*#` @ؗ "`4`@@ DS ؂@ (@ @ &!@㿈`''` Cx  ,!4 &@(@'(`@`@'C ''耠  CN  CD  ( &` B @ ' C(    C  2 x`(D$($,@ &a4`|`"   8> @{#@)a`@A+ 28P`$` `" as  ` @@A 28a`I֠  ` @@ߖ 28 @B  #\#``@`#d#l#h  @Cš M`+> 2 @&` bC > 2 a @`@  a4<`F   @@ a(` b"   @ b @%` >a$8 a 8   ` `a r` `@C 8> @z~#0c2@۠ @ è $@値  p , '@ @0M''L °,H`@&`, @''''?'''!> # ?@ # '''' > 2bd'' ''''''ܐذ n> cc@l `# @H` ,H `,@@( ?`@ `@ ?'`Ȁ`2 Ar ~`$'A  H`2_``!> @yː# "@ ؒ @B@y#> c@@ْ ?H`(&@.ǐ> @y#W@7aP a `,@ Ȁ8 'B5a @)@#'a H`@&,``` "H`@!$lH`~&`` `` , > cHo)(@j@Sy%%%%%%%%%%%%Hp@> c@!> @y #Ԓ @B0(   `,؀ 7 `(L؟@   *,h@5 @ ?a0`  `L@ " ?/`3`$/`3`D`"`؟@ `'a08``,`@ H`(&@-Ȑ`,aЀ@ ,@ ! !> @y#@$@찒 ̀5 ?''''''5' ,@'+`@f , ?" 0``  ? `$'@*  "q#> 6b䀠`(   `@@`(`@@ @`'X V '  @.@>` > $`p(@0$``$`t$`h(@0$`d(@0$`l$`x$`|`?> ϐ⒒؀  ''`$>Ц ؒ  = ?Ȓc F@=`!> @w֐# "@ @w͐#ؒ @@> cc@@ ? @ H`(&#@w!b*  @@^h> @ ! @͐ JH`a&<`" `8`&`@ `@{`$$h d``, $d"```0 `  ,@~`h'耢  '`@M ,`2  H`(` ``e @@J> @ 9bl  `(, , ` b`'Ғ@'0`@ ,`Œ`@T!PH`&,H/`@( @H[`@1!8 @ > c8 "   @`$?" "   `$" "`$"   (㿘 ,#@Q    ? @ ,& &    ? @$ $  `@! "!d@&!d`!$!d L " P@ * P> @vf l `2!> @!  @>@ > @vY#> @vU > 6 > @vM"> 6 @y > > ϐ ap@"~㿘`,` D  L`L@`$  & L6al P x@!A $6al& L P x@!8@~  ,H`w $ DI`(`2@@GO@0 0㿘#> 6@Gb> 6`& 8 8 < b& <@GӰ@G8㿘> 6%> 6b> +a@G 2  8 @Ih   8 < < <? @$ 8$ <@G@  ,@  , 1,2 (`@@0h  @F0͒ @ 0ǝ㿘 4`6`> ϒ` @ ! ,H`@!  @" *.    ? @ ,& &  `> ϴ aА 2@H  ` ,  P` %> &!n ,zr!0`L`" 8@ 8 . 1 < < <? @ & <& 8  > @& ?& `&    ,*&  $'%> 8@Fm`8`\,h"`,H`w 0 g @/ `8@   ,9& T@3> a`@mf `> @[! ` @F3  ,;!0@O-!@O+!4@O)!L@J ` @" @㳐 <`"s ,@^o ,|` P` @; X@ђ x , `$ > c8$`@E0@/S `$  ` ,H`@ @#@0al ," H`@#@ ,H/`@( @E   @*A ǚ ,@)   @uEl P`@tGl P "& @" | "&@$x&&h $ P  @1.  @~ "&@: 㿘@*` y 㿐> 7bl @`';     a @0   X 0㿐@`2` ` &@`b > %a') +-  $  "` `"`   `,2 @2`4``"<``(``?2  `1(8`  ,@h"3 08`"X ,`" " `,H` (!`4&`` ?c';p ,hɆ `(`@ Æσ8H1`˃8,@ǃ8 ,H`@!`4&``֐  0l (``;<'0̀@``h`` ,H`@!`4&`` al(`` ;'0" ``'! @Eі "A `4&`` al':  ` `  P: H ͒ &w u 㿘@F  @v > b4@``"`@24 㿘 > @s̐ " "& " " $  &  " "!d  @$ ( t`;ڒ  > @s#`$ ;Д `!@>3`  b``@KP !4>@KKa!L>Ӕ@KFal``,a $ , `  ,H`` & >`0`P ,> Rb(㿘 `,@/ @fp  > 7blB [@b@ b> '`+> 6b@ @ > v .%b> '#> 6 b"bP> v> 6"@Fc D> b%b #`〣@> v> 6"Ēc@F # > @}#ȁ@> v݀> a> Bc܂c'`> B> c@#h#\#`#d @  1> @0?> 6bb%b b @|"b$b@  > : `p8 > a@ ?bb$b%b # @rŐ" " (" ,2!l* 1  ,H`@!" "   "   d% `%d  @`@a: 4`\>0@JEa4,` 6' ,,H`@! $a @晐$` @ ,H`` ,H`@@!@ `,H`@! 2L8@2h<LM$`L@$$`$ "a0@$a4a0`H`@$aL`> Rb(\"'\\@ #\@q '` > \\` \ `l`d@@!  ,h 䀠`! , 7> %> ) T@X $X T`#g@# ) *@ ] ޺> > b`X$`$`4b܂` `4> > "#b$` (`@$`8@`8 <"Ԃ(` @"`4 @(`@4$`<`$   $%$ $    ,$%$$  `4 $ Dڐ䀠`$ LL  @ L L4  L4 ``4b@'8V   @- C! 4!Ho-4 (@n ,`1@~$`@ 6Hp@`@k *  > (a`4\@ > a ` ` `"d` d2 ,@@ > Ϥb @BƖ ,@쀠``,h3 Ѐ `4b@ `@   > \` `l`d@@ @.$`$恐q$`;`> \` @, `@@@L\ ` `l`d@@ 㿈 #`#\#d   R 㿈 H `#`@?#\#d  >>bx@7 ` >#`#\#d +Ж %ax``  @'''7_  `8 ,`#`#\#d +>a> ϐb@ 㿘#> 6c >  `|c  @ @ r  `$c$ @ @ c  2㿘> `|  @   > 6" " "c` `> @y"㿘 >`0`. q 0`0`> `4a@x"8>㿀"'T'X#\#`#d>  "   ,H`b T!'@xB & ``@`"`?` `8``,a `?㿘&& & & & & & & & & $& (2 `@4a$ `4Ђb@ $ 7 㿘%>  8 <@& 8@`& <& < @  & @@@^ @@> > > ϐ bh@y* b> > ϐ bh@y# c㿘 <   @ `8 `@@ `<@<h ( ,''''Ђ''''''Ȁ,''' '̐@`Ȕ @4w  @> ϔ@xb> b܀ 2 @@2     <@2  @㿘 `<`@`  `$@h>  ,c<' H`@`$@ 4@'ϐH`@$@> c< > ρ@K"h> <' b'''''''''''>Ԃ? ,''̅H``$ FȅH`$> c< > ρ@JԐ"㿘 ##?`8(@@%&`8``2` ` ``8"``,`2`a0b``2` ``㿘š $ ` $`2 0 @ `" P``  ,H``%`+ `!? `$@ @'''''@6' =Ā @ՐH`%    `,` < @< X- ͐ @5Ȁ  @3ޔ4`=`  @Ғ  ` ֦@  ԰  ` A``  > b܀`<2  h'>  ,<' H``$ ` @۶   @@ @ϐ@5H`'@ K H`$ > ρ@I_"`>  ,c<' H`@`$@ ȒC ''Đ'ݔH`@$@> c< > ρ@I&#>  ,c<' H``$ Ȓ '<'@'DH .`>`4b'8 '8H`$> c< > ρ@H#h>  ,c<' H`@`$@ ɐ@'dH`@$@> c< > ρ@H#X%>  ,<' H`@`$@ Ȓ@? 7''Đ'&H`@$@ > ρ@Hp# h> c<' `M  ,H``$ O @} " "6    .@`"/!0'Ґ@  H`$ )> ρ!0`< ` `  - `<Ғ Д- 2 "ǒ@ @G#0h> c<' `  , g> ρH``$> a @8 ǐ @ ""  1 >&`0@2@ `'G 2 @&&'  ``"@I @b H`$0@G}#@ ` @ 㿘 `! > &@sÐ! ` 1> @s#  > @s#x > @s# `  > @s#P0㿘>`0``>> `4@9``>  @@tQ (@&@&@@@@`p`5`,``->  @ɲ #   `  `  ( &@:K`d> @t !X @ـ  ֲ  ` %  `&    @<( &  @ @& ` `&    @<  &  (&0 `Q @ &  (@&?&  `o   @ v  `r `n '%  @&   @; ]@ ` `@&&  & 0H `q>  & 0#  `&    @; &  .@ `& 0%  @& & (&?&  `"  @: 0 `&  >  `@s0 `@" > @s( @s&#> @s# @> @s #(&`@&&  ` > @s    `& 0> @s!0 > В@s @r!`p"  " ?" " " " ""   X | ۼ> 6` > v> 6 b b́ `> Bc> v > 6 b̄b  ` > vb́ 㿘> vb̀  ,` ,@` 2 ` 2 ,  㿘 ,@`? (`> ְ  `` `> ]`H@> \aT,` ,`$ 1)1% $  `< ,` ` `(` (`> 2 a1 ɂ`K ,` ` `(`(` > 2 b0 0ڀ`W ,`  @ˁ` ,` `O `X( v  w` `> 2b@6Ȱ > 2a.`` .`$0̐` 0ǰ 7$` S  T` RaJ .`> 2bĒ` .`$0` 0 $` 6  7 @(> \(aT"@@ 0 > ](`L"@@ 00  Y`)> ca @%> ]`L,` 0,`$ 0q 00l $ > 2>b̄P aK @2`aK.`  > 2b@> 2a  ` 8`s `@20> ]`H0> \aT>aT`@ `&@`@20> ca > ]`L>`L`@ `0@0`@20> 2 ;a> \ ٚaT> ] `L@}4@@#Q@㿘#> 6c`"!> v"ԀD" 0,a`"Ԁ"$c0` "> 64@Oc"Ԁ` `0``2` $c> 6@Ac `$c㿘   ? && @Ȓ > v bԁ > v b ? && @ > v bԁp!> v"`> <@' @``$@&  "̀    $@  2 $ &  &@ > Ё@C!Д - &  "̀ / ,@`  2 , &㿐> `$'0c @ 0c @   @,!> 6 0c @"8=0 0c @"( 'c@˂@c@ .> vbԀ "W#`( 'g!> v $"  (@   '@@Ƃ  H @] ?" " D" > vb̀($"  $2$ $$b`$ ` `7> v &0 c@Ƃ  $$ &> 6$ c @0 $ ` `& `8 `4 `0 > 6 c!> v ~$"  (@  w'" $& , & ,&  > &a@ & ,& ,  & ,-`!> 6#`8s nm 7> v @e -< >'  @  $#2! 3> 6c`. `01> v`8"԰ @? 7> v84 @7 0- ' 8 4@{  $#! 8$ $$ $ Z "` `"`@m "` `( ' *7> v 0 " 8 4:1 ,"` &c $ $ &$ 3> 6c @k $  $ `%& $ 8$ 4$ 08&  &c& > 6 c" <` _ٖ$ D> `<@nl!"$ 4 $ <c@9 $ 0`0 `8 &  $#! $#! 8㿘? 6  !> 6#` 1> v"Ԁ`"#`` ## @5$#"ְ ##@5$#0㿘? 6  1> 6#`#> в`a%> 6#`! ``2 @7  #> Ђ` $> 6# `> 6c$`"#c$ > 6#(`2#(> b8!#(#(>>aą808 c$*## ## :## 㿈> Ђb> #\> Ђb(#`#d> > А!a> > Д> > И!b> > 6a > Ц0b8 `"`@`     #\89 23 ;#`3`#d@: ; ;` `bH 㿈!> B##>  a'> 6` > vbؗ( '  @V#\> 6 c#> a> *` cH @E a> > ax  <`0((@ @C< ` 8 (@@ @)$ : $`0((@ @C< ` 8 * * . @@ > > a\ @` @2 @㿀`%> ( @@ ŀ    (@8%8 (@@@Ho4> (@g> a.` > 6?.`c0 @`4 @ @5 6  (@$'- - > @X @@` @>  cX%@ (`0`(8`?`!> 6#%> Д!E@ے#` @ #@!H`"#`?7ob6 & @f#`@2c#` 8> &> a > ! &8@(`P@@`0`@=`$`@=`` $ $$Hp@  @ > 7> #L@7%a  @yY%> +Hp@  k'> 6c0@w`7ob"#\:#d> > > Вcc@l,#> #\> > А#`c > @lcm%@(`'> > a`8> > Bc> 6c`@ @ #\8@ #`, #d#h  @@  > > @l#0a`8ܠ@ `` > > !a > a @ =`$@8@ (`0@(@0W$> @k͐"y `$0``  @ -C=`7o@b"%@  @`8 @2  `" Ѷ %`> > > А b@l > @l]"h> В@lX"> @lU > @lR 㿘> al> cHi.`> > aa &8@(` (@(Ho4a(@ga $P    (@@8 9  (@@ > ҄@`܅(@ƒ+`.`> a:(> (cX!n7ob" \  7ob 8 6  `4 (`%0`  > @k .`> 60> ђ@kِ 0}   (8  02    ,(  0@< 0 ``@<  @ @$`@T$@  `& $ Hp@> ҅(`@ 6@@2{@> 6 c( @ `( @$`44``&@-@ $@@< Hp@`2q `m2`> @j > @kc $@8 x ( w> @24@.`> 60> ђ@kL X> (`@(@    (@@8 9  (@(``2 "9  `  (`>  @"@ > 6 -    /> 7x`Yx@#I> 6,`.+> @#<`    (@8 9  (@@@((  8> #X)v''@"X 8  ,` @> Ѥ `آ @  "@*@i@ِ@`@(> 7 @a| > 6 c0   @"H  > > %x`   )> 7@i!x@bH @$`x`@(x> 7  xN` 2  _.> 7@a|^x@    " "㿘`2 > @jB! 㿘" ` > @j4!0㿘`"  >0@2 > @j!H> @j!`㿘`   ` ?   ?@0ҁ㿈> Ҥ`$,!>, 0@ @` @ ?*`@`` `@}  `$#` "E `@` @1&]@1_`?`Ґ #0@0ܐ > Ғ@i"`"$  ؀` > @i!`@0Ԓa4@16`?@0 Հ`0 > @i}!> @iz!㿘E`W 㿘%`F 㿘>`0`   V 㿘`N `  <@@4" <㿐 'D'P>`0 ` HodĂ(@>  @_a@ " D" 4" ," !P" 0c!" Hp@ ` @?`> Ҷ b+@.@`"  0 z$ 0 0 @@9 '0 $ 0$ ) $ @($ <$ <P@ <`@@ K`"{$ HD@Hod (@e0 @0  0a 0`$ 0Hp@T@ 0d" < 4 "  < @ R@Y>  @$$  @9  @C'  ? Hod(@ `@Hp@> @]a@6vHod4 (@e `0えe;> @Vɒ$ H@VD@4P0> @hD"> @hA"> @h>"`@h<" 2 @"  `48  > > bԄ (@  4@2 80 @ 8 2 4> > bԄ (@24 "  4@28, > > `|0 (@  @20 @ 2 㿐N` n.(8``m"> ҆> b耠@(`L@` @(8`m> @g "> @g#> @g#@1> @g#p> n{b܀w> Ӏa> > > > > Ґ#cؔ@g#؀5>> Ө`0> > `> > Ӯ` '> N1`  4@` @f`*L@`n&`w`a2 L @fՔ2ܤ X)0t`"@f ?`4 `?` X`1,t`"#\+ #`; @f݂> Ȃc> #\> > Ӓ` > > Ӗ( 0> Ӑ#@f`8> > Ӓcؔ`> > Ӗh x@f} @}bRb㿐 1``9> ԅ(8`0 , 4!> > Ӑ ƀa  !H`!> ӟƀ" > ӟƀ"0!L  > ӟƀ"P T d@ d@: L P x> ӟƀ"x!  > ӟƀ"(: > @eϔƖ㿘  J 1`  H`1  2 @  @   2㿘 `@` ` @, $ 2 0   "  @2 1``  `"   2 `"  ``&``&` $㿘 ` "|@" |   ? @ && `  > @[Ӑ!H1> @[ϑ"㿘    ? @ & &  `& & 㿘5@ `>  @ 4] +> @[" f b      @ ??& &  `H&  `&    $  &  > @[r!H> `4b 23&& ` && > >  |a0@(`@& |a0@(`@  |a0@(  |a0@&(`@&2>  @[>"K& &&  &   $G  ,H` >& `0`"&> @e#X@e"> @[!HΒ> @e~#> @e{#0㿘> > b (  @20&@$ 2   )i @ 2 " @`"@ `$@"  ""  @2 )㿘ǐ @ " > @e5#㿐> 'b> 82 >  )   bܑ: > @t!> '"#>  )$bԔ 8`> 2 |@g: " )!>  $!0> 8` 2 @[: b> Q `!0`M K!p   !> 7> #("#\> @]Pc!h#\   > > Ӑ @]Fc H#\   > > Ӑ l@]<cȒ P#\   > > Ӑ#@]2cؒ #\   > > Ӑ"@](c 0#\   > > Ӑ!H@]c> #\#> Ӓ c  @] > @d#  @4"> 7bl [`4 Ђb@"  @4"  `"  `"  @" `,""  "   ` "  @"R` `(``@`@2 @8    @ ` !`1! @  ,h  *` ` `!P@  ,!P ,"㿘 `  "@  !, ?  ``􀢠   "`@>&ct 㿘@ ````  !f `  !]   !U ` 㿘@ ````  !> `  !5   !- ` 㿘 @`P  `!,  & P &`"> >^c#㿘 > @Z# "㿘! P $㿘` ! PӐ $㿘 @` @%  @  @  $" `,H`a  㿘@ ``]` @Z`  @Ȓ H @`  @ 3 @`  @ 2$ u$" 2$  ,H`a  `  @  @0㿈` @`'' @'u 2'?j'`㿘@ ``p` @m`  @+ [ @`  @ F @`  @ 1   ? $   @$" "  @2$  ,H`a  `  @  @0㿈` @`''@'b 2'?W'`㿘@  ` `@4&  `4"   `  㿘@  `4"   ``   & 㿘` `@1 %>  @X䀦` `  @`#`4\ `4" o  >    ` ", @V`4߰p    ` Ұ  㿘  )> `4@W̐!H%>  @Wǐ @K  @VÒ!H@V  &㿘 @`@< " @ @ ’ +@   "$ ? $ $ $"  ,H`a  @ƀ @ 0㿘 ` @  \@$@``2,  @0`  ,H`a 㿘 @` @%  @  @ J %$" `,H`a  㿘 @` @5 "  @  @"$  , @" $  $ $ $" `,H`a   @̀ @Ȱ 㿘`` >Оb??/&a& `@G ;`@F ;aF;㿘 Xْ`֒&a&`&`&`&`㿘Ho-(@nHp@㿘   @ E@ > &@&`&&&&`쀠2`> 'bЃ2`*`8* @0((@ @3`c+`+  @` @0((@@  @@& @@5`-`- @0((@ @3`c+`+  @` @0(&@(@u  @n@&@ @k@&`5--@0((@ @3`c+`+  @` @0((@@K  @D@& @A@&`@ "Кb? " ?/"a"  ` ` "  " ?/" a" ` @&"  ` @@!`  `" > >^c!4㿐#> vc(`!> > 7c( #\!4   > @Wa`P $c(!4@U   $ P@`#  P`0 H'    X ܐ    X `F H`     ВՖ ` x''''''''''''''''''â㿘@  ``(   `8  ,`> Ԗ 習``㿘`?  .```8, 1 ` ` ]$` $  `i> 7*``b> 7?# 8- f @8,>@"Z`) <<"J@Ɛ@4 6`> 'b8 > @چ >` <@ 85#@ /@ " > @  >  b  8  @  @8> 'b8aa@@`>>(Ԕ" #@ > ҄ @ ǀ 㿈` L   `82 ,@J`2@> Ԑ`` @㿘 ``  `@ &'?쀦4 N` S .`Ho(@``@0``Hp@ $N`۴ n`㿘@`4`` ` I  "$ ```"9 > b܀  #,@2 ``@"/`2,  ` "& P "   `q   `&`  \`㿘@`;`` ` O DJ (@ )>?& ``"9 > b܀`2 )`` )`,@ 2``` @2`K 4`` "!      )J 4  2J Ā ) `&` `@ ` ` (0`(`H`@ 㿘> v#0` `(> a @@ `?` (@08(H`@ @ ` ` (@0(`㿘> ! 2 > a> 7 Ha > 7a> ߐ" > 7> 7 \a> 7 `a`2 @`|`` @40 0 > 7a&> 2b\80`@8```    @  > 2b\80`@8```    @  > 2b\80`@8```    (  㿘> 2b\80`@8```    2  ( > a?* @@"> v> bc0㿐 ,">  b@8b> > b!> " - 9>  >`0* B"c  !'4&  > b8@8b8 `\@> b @8b  ̐0> b0@8b0㿐> b> H!> -"W %" c?N   \  `@&@8 U"㿘> 7!cP0> Ԑ @Ȓap  \! \"  .`   @?&& d` T (@( TT 1> V".` `h㿐 `@> b c '@!d *  \ 2 ,ې    > & b@8b@   ,@2> $> > > Ԑ `h@Zڔ!㿘> 7!cP0> Ԑ @Ha , \` \&h& h> @ hT (@@ T " 㿘!> v#,> X > Ȁ #,`$#,> @ZY 㿘 ( d`d h & X> &!h1> "㿘> 7cP > @aX>`@*T`> , @`T " g&    , >`@`H "Y>  X`F . 1!T` &`0 2. X H / Ho@  Hm(n!T`!T%?*  T͐ > "(@9"(N 1`2%>  X`> . 1 X`>  > > > > Ԑ `h@Z!> > Ԑ `h@Y!7> > * `h8@Y!> > Ԑ `h@Y!!㿐> @@`! '/'  @& Ђb?&  ?/& a& aX`& 8aX 8 <#aX!& @Yl!?'b@'㿘>`0`Hom(@n ! $ ,!, 1 ,H`@! Ă`@,$ ăHp@㿘> `0`Hom(@n> m! % - 1 ,H`@!@,P%> Hp@>`02>   H> Ԥa-> 7 ad`RP` @5!T` 09!T`4 ` `HHo-(@n!T`?(H`$Hp@@!T`ad`PHom4 (@n @+- 1Hp@!X8 "< > > Ԑ `h8@X > > Ԑ `h(@X > 7a@6  @" "@4  2 "@ 㿐 `d28 "  8@2@@2&㿘 $`  & $@ $  & $@( ͓ & $@㿘  >@*t   @(W! & $㿘@'  $`` `  $> @W!& $ $ > ԰a @ $ `$`땓  & $㿘 (     "" " > @&aTHoo> b@`> 7" > 7" b@`#b@Hp@ > Ԑ >#baa   @`$"!" "!" H`> @ > 7! @@2? "Hp@ > Ԑ >#b@a!!Hoo ``2! d H `"`@ d"@" d`8+ `@@@2 ``  ``" `Hp@ `8 8"88"@"@"`@ @   @@ @ `$`"`@"@ @`"`@Hoo ` d " `@@ 2@ ?"@`8`@(@" Hp@" d S Uh Uh S UT S S Ux@`` " ,a"  0( b2 `@@  @ ` 2,0@ `?``@`? $$` $ $ "" " 㿘 (@ $H`.`!`n?&b`l `]!8!!`@S!!!`J! !! `!!!" > 7a@x!@!!'!!!Hp@@!!> 7H`@ `"!!!!!@!!Hp@@!! @!!8@!!?b` `1! H`@ > c8$ ` #`H`@ j2!H`@҂`H`@` $> 7 a) @ "   ?a (@#a  !)  #a !"`H`@`*``  Hp@ !? b!!Hp@ ?b"! Hp@ ! (@!!Hp@ ! ">`0` ` " 42  (  ! ( 4(2  @2  ?"  (@*@ "  @ `" @ 㿘  0@T ," 0H`(!  <?% cHp@  /"  ,@"  ,H`@ Ho-4N 1(@nN 1` ,@ X` . 1@)0> > > Ԑ a@U:'$㿘! $&!X ,H`` @?b> &!b !(@   㿘 `0`42)%@`4`,@'Ho-4 (@n @'. 1Hp@`0``2`,`4`$`4@|`,@ݐ Ԃ 0؁ @@"`4 ?㿘  -`- ,*: `u> Ԓ@Ty"(,`"e 4`_ .1Hp@, 4` > Դ 4b@ 2@  4`H`@! $ 0$ 4>%a)-> d",@2Hom,(@n,H`@ 1`(`@`@(Đ 4`$ 4 4 `$ 4%H`@@! ,H`(㿘 @֔ && & `  (@m& & 㿈``@!4B ` 2 !<`􀈿c&!<&!4&!8   &!<㿀@`? $ m`` h g `>, @'`'' +@2' 2`'"`'2K "M B+'ݔ 7 `8 ` ,` `'''耦`   `8 ,`"4> Ԕ`"   `8"  ,`  `' `@' ```' ` ` '> ԔbHG  bH@ ɒ㿀   #d #l#\#h#` @v " > Ԁ`bX4 #d#\#`> ԰@R$"h@> > b`@> @`c<`' !  '@3!`!h''''>  `a``( ' d( ' l(@ @(@'@@f "  @   #d#l#h#\#`  @ 0> @%o#X㾨 > c<' ,@ > c> `d`l @@(@`@В "> Ԙ!@Qs !  7 0 `p#$` !`  $`?'x't'p''@' @   4`  @ @0 D@8 `  `6 `@2@A'(@ ', `0!0'''''0@ @ @d "0힒  > 7 ,ae> "L> `a"L`u  > Yb> @$#h㿘 ,H`@! .``0> 7a@ &!`@"   (  "`ѕ `0>`0`  $? !(@H`8 @ !`. @@  q  `8 2R ,~e> !aHoo ,`"]! ,H` !X!`$!a a @ $a> 7a@"$@a$a$@Hp@ !``-$ !0` 'tt`'tx7t ,`"!!XӘ@Q"!h!d!\ !0$!`$!h$!d$!\` 'tt*> @P"㿘   ,. 1H`(! ,H` @&> c  `@$ @ ’ > @Sa`㿘  ,!0``,`??`> 7a> > Ժخb!!(@    ?(@H`(@$ $A`,"!h>*p 4`  `,2!``` 2!`6!lHo-4(@nm Hp@!`,2X!`,Q!hƚ6!l  `UHo-H(@H Hp@ `,!!l~ (@@2y!H`(@ $ $ H`@$ @O=!Q`,!L`,n  @O'!;`, !5`,㿘!2   ,7!" , ,h!" ,   ,"! ! .!(H㿘 ,` (@ ,@"(,@2@"(@@ !.`@> 7a@,h" $!H`@   !H` (! ! $!H`(! ,H` (! $   ~  ,Ho-4N 1(@nN 1``z`"a , Hp@@"}!("z!ô@ u!N 1`@!@ @   L`  , `!H`@ [ & H!H`  @!H ` ,`?"w``U! !`2 2.!@#Z0 > d  c,h ` N,` ,H` @! ,H`(! d ɴ  X`ʴ  U. 1"L X!H`(@ C H`(@ 04 ,H`(! `` !H`(@  6!l/ 0`  ,`@P0> @N#!H`(@  X㿘  H N㿘> b܀ (7#c@   ,@ ,H`@  @ $ `   >bȔ   ,h  $a (@2 !&!h&!d&!\&!`  2&!h 8t` .` ,`'x !0't`& @!@&!a߀`a(@ $a> 7a@"$@a@$a$@'t@!/!㿘   " ,`"    􀦠㿘 c ݕ 㿘 & > b܀S b4`$,@ C "`? 24 6 " -   ' bꀦ 4`$,@2 "` 1``% 㿘  " " `"`"@`@ " Ґ    0`"`"@`@  "   ܀2   㿘 `` @  -Ђb@c"   @  V ,      ?         $a$`"a$" $> >^c"D㿘 > @Bǐ"D $ y!( $!$㿘 $a$ې& $㿐 > >#@Ya> 7c(!(#\> > Ԑ"Dc   @Dt 㿘ܐ $a (> 7!a N?*  (8$a ` a$aH`!a $@ 7!4a `P$a $`P> 7bli [@!?@c! @a]a` +   . P `8> ' ,`"> 'b(("@@@u*`: 8`> 'bЖ@r8@ D_c!& HH`@$!(> @”(!`"2 H "S> Ho$` ; <" # "` H`? (@)$& `*> &``ސ p  @4 H`'p 0!ɐ?> ϐ`d ~> '> > Ԑ a0@Kr&?> > Ԑ a@@Kk&H㿘``   @  2      ? @  $@$ `"& ` @ 2@ @"@@`@ ` `?  "@"`>`p " @㿘  ܔ   " ` " `" ` " ""    " 㿘     , *, , ܬ   ? ( @?&> @J#x㿐``:> ``4> @ 2 ` &``(&@ ``"/`(@ `$ $``?@&`>`  ʰ   > @JP#@JN#㿘`k`]>`b> `0  07 &`2& / "@`$``6`2(   @$ $!@&>&@`Ұ2`2 ဢ `܀ ׀ @ `0``> @I#ܐ > @Iܐ# D p x H l \  ( H t D P p  8 t  < ` | $ X p l (   ( L  (  H d  0 T x p D ` h  d D (  x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x 8  0 @ 8 P ` 8 p t >PbD 㿘` ``` > 'c <   $@@f;> 'c  D $$@ 8  `W`> 'c c "`" `" ` " `" 6 3@Y &  />  ;> b0 $@I ``X@ -, , @ Q`$ @ *, , "@ E`ݠ  @"$@ C > 'c Ô $,  @k $ ,  "@b  ؠ    @@   "@  >&ct`  >`0??"  ``2?   `  > c (㿐``2 `1@`` (  7 @ b`$$ ($ $`0 @< (`8$ 0`<$ 4`@$ 8`D$ < ۺ     `` $ @X` `, H``$ \x ` ە㿐' '@`   &@` > 㿘 'P@`   &@` P' 㿘@pؐ  @  &@  `> > 7c<@' ''ܒ ݝx > |` #> b      "@p   )> 7" ;> 7 ;> 7b >  > b (( "'b"%"d*  'b _%"*b d> դ ` 1 R"%@@FC• @pb b @@Ő ,$  0X<  8<  @< ( H< 0 P< 8 X< @ `< H h@< P * ''''쀤 / @@  "  C @ A B#\ D#` E #d F> #h G@E#l ">  (> b|> 7px@@ 2> 7> b  ;> 7 b @3 @b ,$  0X<  8<  @< ( H< 0 P< 8 X< @ `< H h@0< P 2 > 7;x0> @ @@ `@E` &@!> "   "Ȣ ? `W =$ 7X`W7$ X+ 1  X  `??'?''''''''' "ê> bĪ (( @ @(`ct&@$&@ &@㿈`E `F ?V`1``9`,b5 `` ` 6 ,`$5  "2   (&?',?``#\ @   ٺ   $q& ٬ᦒ `(ϐ& P`Ű `  -?`ݳ ـ  1`` ,b `,  /> P `$PƔ   ''''؄ ='''?'@xݔ | t  '-'(&q> a  ^' ''  '''''?@x I"v`!  ?''''''''@x /  L@`2` `"`@2N@`@% @&@''ܐa @Ԓ    ',@  `&'`x' & (ϰ 'b Ȱ & 㿈   "`` @ΐ >` &`(&`, >`  `  >`0  @ >`8 $  >`@ `  >`H P  >`X (&`d , ,@`&`h &`x @&` `&` `&` ` &` `&b0 `&b4 `Ԓ` @ 6` `6` L#&` &` &` 4b@&bX >` >a >a P&` T&` < >a 8&a!&a !&a$ $` a&a( $` a&a, 1 .a0 b8.a3!l6a4!6a6@!0! @a8a``@ ``"````&```@"``N 1` 1``8  `" 1`P>b@ 1``M  >a!&a!&a &a8`&a &a8&a &aă8`&a &a̅8&a &aԃ8`&a &a܅8&a &a8`&a &a8&a &a8`&a &a8&a &b8`&b &b 8&b &b8`&b &b8&b x   |Ђb??/&b &b$??>bH &b\4&`l `"`@`4&`p``" ,@`4&`t ,`C?` `"@&`|`p&``|`?`&`|` >`P 1``5(`"!L`X&a `&a h&a l&a!L >` 1.a0 x &` |&a&`!.a1!.a2 t`aP@  X P>aX&`|&` 1``σ(8``  @4&a㆖ &a&a&a&a X&` \?&`&bX `>` h>a p>a av`&``㿘'P `    `"` @(@ "` E > bܤ   ,`W N`1`"O``IQ > ϒ ,`"<` ` `"7``p@23``,@@&` o ڀ%@"`@&` X À%@``2N`1 8 > " "H@`"`,`@"`,` ``"`@`4"`,`@"`,``4@"`,``,b`$P@z x P, @r!0 \@y!`l&!| >V`& `, & V` & ` & `& ` > ``& (``& ,` > 0`(&   > @ 2 ` > 8`0> H`8> P`@> X`H> ``P> h ``(`>h```? ?`> 8`a`!`4 &!x```&!``&!`4Ђb@@&!H@&! ǂ & &  & `(`4&!t`(`&!l` &!p`(`< >!``@&!h`(V@&!V`&!` >!` P`&! ` `&!$`Lz >!`X>!```!$`_`B```  >!X`2`( | > p 4& x & | 8&   >  P  >  P`` @! ` `@] w`& 8`(& > 9a0@> & & d& `D >!(`>&!0`,&!4`0&!8`4&!<`8&!@`<&!D`&!H` &!L`$&!P`(&!T`H&!`D >!(`>&!0`8&!4`<&!D`(&!H`9&!`P`??>!㿐'P` `(  a  P@ `  a!! Z `k`B`   P@P@? @  > bȀ` ` `"@*    #\ 2@%@`2` Ɛ> b܀`m  `,@2``,`&`N`1` ` &4`@".```2`,?k> b܀`E  `,@2```,&`N`1` ` $Wa `4@"Sa ``2`,z   񀥠``< Հ , `" `,`2 *  #\  4`% ظ`%   `*"?  #\Д 2% *"?  #\ 2 % *"?  #\ 2`%``< *"?  #\~ 2%@ , `" `,`2 *  Z#\Y  4`% ظ`".?  ;#\: 2!%"?  '#\& 2`%"?  #\ 2 %G V ,`,`@P X @㿘`@@  @ ``  &@`?``ؓ 㿘@h * @ @`  \`@$`?&@ `/@\`Ҁ ? @&@> # Ղ`?㿐 #\㿐#\㿘`@` @  &@`  b `? `S  㿘`@` @  &@`  > `? `/  㿐`$> 2 `> 2b(> 2( @@`"     " `< b`'`&`<  \ @` (`  >*b( -㿐' * '㿐` ` `(` ->> `$> 7bp> F>=w0> 2b\U>>> a( J>>> Ăa`` "*<> a\d N> 7bA\U  ?> 7> b(`(`##n+ > b > aH`@ 3> `,`y ;> 7٘bh  bh`dE` d'bh `,@bh> aL0]> a80W>> > a"(  >>> !Ăa``  ( > 2Ib`> a<05> `00/> `(0)&'bh  > 7"> x> c<@' `\?`> (` @ > Ձ>  N)  ->i b ܰ հ> >9"̰> >0"ð> 7'#P  @$> 9  > 6b > 7"l> '" }@0y> 7ޘ"Lq> c> Ha`"-?`'= _ VW!> 7#$#$ L#$@I@50E>  => !e# 2 /> - a@> '"$> "> '"> 'v" 3> `$'d찒  `$`쀠@$&`$ 4`"&`$ > ! 8 ݰ >  ` !> !D':$!D8Ű@U\7a> F> 8 #> 8#> 9"h> "c }> b> c> b> "IHk> >Ϙ"b @[Y @aP }I @ @ Ț7 (0> b̐ @e$> 7b> 'c> 6b> cl`a"   @-!> 6"'j䰒 䀠2 @c4 $" #\1> > & # # # # `0     $@  ``2 3> 2@e!b\$ 2  a!& hf> cl`a2  !> '## #`UQ> c$#  _> x>  ph>  `>  `5 W>  ,\N% GE @ k PR@>&`$'@##6 ; @a  @c\ d@ > 'c> ( X`'```  @*ђİ Ā` (` ->  "`>  ``   l`: !> 7 K"p 逥 "0> a` ``H2 K"pг Ȁ` @>, ֢`@> Ңa0> ΢c>+ ʢ``> . Ƣat>\ ¢b> b````#\ȟ@`` 2> 7~"p ` `^ @k> 7 `@`@l  "c"p> aPd @ ``@2 @ X"     ? @"" X" 0> aP 㿘@װ 㿘Ho6 (@n6 > aP)> n+> d `2 Hp@ 1``1 X@"$ X`$ $` ? @L 1$$  |` @  $ |, 1ݲ$ ؐ !HȠ %c%# $*`> Փ:`@9T `㿘> 7bl`@ [& `!  `   D    D@2  D  & D  &  &&>/b?㿘Ho-4 X(@n X`N 1`@ ,H`d Hp@@  ,㿘 >`0 `  $` 2 $!" $`  `, !$`   $`  $?  (@@@?㿘>a`0``&  ,H``  0`"! X` Ґ , 1&  &  X`& &  ,h!"퀢 逢 㿘>`0`,"p,H`{  #` @A\`>`0`>9a \㿘 >`0,``>N 1`>>  !(HHp@ ,H`  `8@ ,` `  Ă`. 1& > 7P`> Ր @Ւ`@ RN 1 @N 1@8 x㿘>``03`L 1`2>  `8@2! , & & & Ho(@n&$ t,!$ X$ |$6`> aP$  @ `2  Q ۂ > @7̐ @7ʐ 㿈> 'bȒ> bLH`> ccԃHp@Hp@ C H 쀦20㿀> 7bl@`  [&  ` X   "`& &@2쀢 2& `8 ,`"w쀡eg `耤` > 7 Đ" 2& #&!%@'䀥`a'> 'b(($> 'bВ8@^88`, B @a@ : D6'` & D> 7 "  ?`   ?& D &`  D` & D& D!2> 6뀢?  π`̀`'ɦ> Ր` 'b@'㿈Ԑx`- `Ho(@&`@= qEϐHp@  2n&`@:&`P$}xa(  沂a  }xa Ђb?  > 'bԀ"    `  > 'bԀ&"  6   "@" b@"   `"   "  @"  Ђb@" "  `2 "   㿐   @0` @ @4&@ && &@ &@ 󀠠@   㿐ǐ   @ @@" ` `& & @`  Іb@㿈  `  Ā 2J & & ́ Ȥ?/b?  @& & Ȁ@@& &    $  `2   􀠀` `"  ? @' '?`$  ,`@!?'b@'㿀@ Ho)(@ (@`?`?Hp@`Δ j (@`?`?耠 `''耠`􀠀    '耠'?'b@'㿐@ `@   `8` ,` ` > '"t > Ֆ ,``㿐@``" > 'b'@^"`'`  T  `8  ,`> ϖ `p@` 4 O `82L ,'@^˒#'0 2V `ސ  ِ! > v> Ր#4ڔ?P #2`#{܈ @ 'J' @ '耠;'耠`&5'  " ` > `'@^x#'ݐ ` `8 ,`> ϖ `0 ''b'?'b'㿐`` ` J 7 >`@`@!#@' '  @ 'Ђb?'`?/'a') ) & @@(`& 'b@'㿐@ "`a   `8  ,`> Ֆ `㿐`W @]#> `$W> << => Ho(@ j` @$>   > a"`@''# Ђb?"?/# a"> > aP THp@ @ `Ȅ  > a4> Ւ"@!@@2 > հ @2!Кb@㿀 `@ +`Д  % ǔ  `(( @@(`''q   > ' bb `㿐  "`  @` L㿐` @> > 'a`В@Z8` ? )`& θ  o  Ho)4> '(@j> 'bЖ@YN8> 8a`Hp@㿐@ D`΍ "B  (cY7c> 7b4k> ' @g> 'bؐ@^  @\˒u & Ho> (@j> > T aP THp@`Ho(@> aTHp@` !А@\"@"@'@^|' j> > 7) ) ` ( @@(`@ @6`6> 7@> 7b1 b؇((x@ `H```ؐﺔ  <  ''̒ 1`.  *  $`"%ÐHo)؂(@j؃,`@8``98`Ȁ`9Hp@  @ؐ`䀠`0@Ђb???/'a'ؐ <<ȁ@40@L0> > hh> h `h!!  2! " " " 㿐2> h&880`@> ե8`p> X` '> '  @1"@  ?   l`'  @1"@2 㿘> a> @0!> @0!> !h> > ahh 㿘 /!> 7@"> a> h> > ahh " a @#``@ ! ?`#` #`#@ @"2"a@"㿘1> 7@א"9> > > ah!hh%> '@)@xp"!h@D@`?! `#` #@` `r@C@aZ0(`@`#` @C@aZ0(`@#@ @$@aG0(`@` @` @@a,0(`@ `!h@2@@f"000 g@ `4#00 g@*00 g@`#` @Àa@4 00 g@g@ `(`@g@(`@g@(`@ `g@(`@`` ``@$#`@@=s!h㿘1> 7@7"> !> h(`@#!@> @h` !(`  !(`@` !(`@ @#` !`W(0`g@@@ !` !(`  !(`@` !(`@ @#`  !`:!(0 g@@@ !` !(`  !(`@` !(`@ @#`  !`!(0(`@@@h` !(`  !(`@` !(`@ @#` h"@ @@ 㿘#> 7@b `  ?     & && b& @㿘 `2`3!> 7@"  > ! @& & ! "@@>  #`h ?& !& &  @@U"`> & ah`&& ` ` @I"> @/ϐ!> Ւ@/ː!㿘> 'bԐ(("@@@YГ*`㿘> 'b@YȐ㿘> 'bԃ6`.`>`* @ 3`8+`+  @` @0((@U@ c `㿘> 'bВ>`@V8 c| `㿘`> 'bԃ0( @ 3`+ +`@ 0` ( @(@ c@ C 3`+ @@Ym@: 8`> 'bЖ@VT8@ DE㿘> 'b`(("@@@YI*`@: 8`> 'bЖ@V08@ D!㿘> '`@Y*b@: 8`> 'bЖ@V8@ D㿘!> 7"`> ؐ!p> 7"b > 7  b$"> 7 b㿐#> 7b` - !  9> 7" "`>;> a`G> 77> Ր"X'a"`;> 7p;> 7b'ؘ ܀ 7> 9> 7p> 7bb"`'b;> 7b`b> 7bb> 'WbГ2 @p:`a`7> > 7 "X>: 㵔'a7> 㿘> 7b> 7!> 7b"1> > '"b1!p2 @>`k㿘> 7`> 7 b > >:!pc > 7>:"Xㅖ > a㿘 @  > ` `2  a   " `& @`&  ~ @ & @㿘> % aŐ ``` @@  @# 2`v㿘&@&`&` &`  @&` ` & @g B> 7b @}&` ` & @X 3㿘 @n   &>;> <c(@B&``  L@V 2` ``@/" > @-"@& ^> @,"(`@&`` 0㿘`> `?!@$``   @ 㿘 @@ &@@> ` @-v"` &@> ՠ`bPJ  ``@ְ 㿘  $b   " " "" @  >;& & "<㿐   !>  !#\> @%b`!@%  > 7@"> 7b`1>; ` ` }"<㿘> Ւ@-!"p㿘 ː @@㿘> 7cP > @͒c   LH (`8  .!>`0 `H@ > n> d 㬁㿘>*> 7b0P L`,> Ր @cP |,@& Lȁ & |`& |h` & |톒@W 2 |& L㿐#>`0`@8 L 1`'> 7P`> Ր @rc@`@@@"h`j 2>`@`@!#@' }' Ђb?< ?/$ a$ rX@8`1>HH` 15> ` P> n c> Ր @c@ >`02I>  D /@`@u >@  2 , 1b @`@<@2>@(>8>`'b@'> > > Ր b@,V!e> > Ր b@,O!㿘>*> b0쀤(> `耤q> > b܀`V'> 7(`T`|2 &`T``G`x`1`&`x`|`T &`|ԑ2 &`THo-d(@nd/`T`P* * * @Vx`L&`P&`Tt@Vp&`La1N`1`a.aHp@``2`x@+ > y"P `P00`".aЀa.a0> > Ր b@+˔ 㿘1> v>=#8a> 'b@U > bTo#8㿘Ho-4 L(@n L``$8 $& LM!`1!.!Hp@㿘> 7cP > @ c0N 1`!`> @+@" `,!l`!H`@( 0(@@#@X g. 1& Ѝ |`( & |>`0! `H@ > n> d 㬁㿘> `0 `Ho-(@n! .!. 16& \ Ȃ`(& ȃHp@> @*ܐ"㿘>`0`Hom(@n ! ,!9, 1 Ă`$ ăHp@> bT ! < `" L ` H``  L` > n> d 㬁H``> > bp hbph> `` > 7b` `!  ` `㿘  (@` -   ?& (  & (> X` X㿘 @` @ ,`" ,㿘`6  @.`  (` ,`" ,>`p 㿘    "4 $@2 `/```" > Ւ #`@)G`'`2 ` > ղc $@  ` 2 $r٢@)$  > @)#㿘> X` XX XX> @)̐#㿘> bp !bp ` `$` $` ? @  $$ \ `2 $㿘 $`!!> "p  @> 2    "p" " "`" ` `@)} 0> @)z#> @)w P㿀> c<' +> 7@b'> \`> ֢\`bܐ  \`b@$\ @l   (`0``>  `Ő " `> @͐b\\``$\@bܰ > ց `;@ ‎`  > ք ` $@d  2 $q> > (b`!@  " @2  (`8"LT 8`2 T  ` 4  - "D    ? @& &  @(``0 ` 6@` / @ > '(n $@$`4 > 'bȀ|`ג0w @'  84 > @'ܐ!H0> bl @(!> '@p#@( @( 㿘> bh @` "  $@2    ` 2 $ 㿘@@ /m` q l `$ $$ (V` `"1V`V`$ `   > @'V 8U> $ $ `&@` .`6* $` * G I`22@$@ @(@; $ ,$ V`6```̀ʅ) @@ ) ``@$`@@ $ V`@4``.`檒@ $@ > @'!X@'!> @'!p> ֒@'"> a> ֒a> @'!㿘` ` ` @ > b`2``"*T` ` ` (`0``(` `(&` ` 8  (6` ``2T` 29㿘 `@%> 7؀`2-``" @  @؀`4  `" &   "& 2 & & `(``2 `> `@'o"P> `@&"0V` `"> V`> @&" `> `@&"  @&"H㿀''''䀦` ` ` @ > b`' (' `" V ` (`0``(  ` 8 #(6  `2V   2> 7b؀ 耠`> `@&?"] > @&2"㿘+> 7@b'> \`> ֢\`bܐ  \``b@P$\   ` 2 _`@  (`> V` `i 6` & > bh` & ` [ ` b > ƒ#@%ޔ  > b` &`   `" 2 P P `+` 0 `  2@֔@> 'bȀ" @b\\`$\<> 7@Ґ"܁2dž `00V` @`6`> ֒@%#X> > > > ֐ bЖ@&!q> > ֐ bЖ0@&|!s> > > ֐ bЖ@&t!r㿘ض , ƀ > 7* b@%M@0㿀> -a|'()a|'''> (''b(&8 @  (`0``@i ` 2F(8 㿘 ʴ   > ְ @% #h X "V"`X`@ @  X""`X@ @ * "`X"/ X2@"`X! X X @@:`4+ X"#``X`  `@ "``X`  "`X! X`4"`X2ψ`8"`XȈ`(`X X"`X! X" X (``   (`0` (a8 p"" ( p < @2 8?c" <2 p 8`) "   2 " 2 " 2 " 2 "  @ 2  p <(`0` @ 2 N@2 r" 2 " 2 L" P" T"   p < @`" 2 㿘`8`U D  < `(4  @K   0 d& 4& 0& @?@PO  (```  @B @K(@ "& @@<b'< "@ `` 4   @@KΐB @`8B儐 @M& @  <@ ـ& @*` & <`(> bb> ` |>  b> \aa"@㿘F > b2 0  2I 㿈> c<' @fǒ /  ? a> ׁ@M U 2?N `.2? c ``8?''  І`` B1 @8`@(  (> b ɤ  (`"   @@g  ( 2 ("? > c> *a,;`> ְ @#0 c'#X``1 㿐@0?2   (2 ?c(`@ˮ  >> ֐@"Ё`0 @S? e `e@ߣ? &> @"Ŕ >`0` @D?@> @">`0` @2?@Ǽ @)?@Dz 㿀> c<@'   @f  O?@ '> ׁ` Ђ`` ((H`> \a`a . @`"?@f 2 . @`9#h㽘> lb> <' R d , (@ @ `  @  ~>` bT>t` a>`c> @"j p>c@ > א P@# > #x㿘`DH`B> bh 2 08(   3`` @f H``2 ^   ((@?c(&@fb ւH``2 ?& `4㿘 (> @! > bh > > `   > `` @!`2  @!  2> @!ِ Ё>cА >`X  >a 㿘 @  ,``& ,@ `t@㿐 @ ,Q& ,f ` d C @ h l@& hЂb?& l ?/& ha& l`$> `2 H P 8>`B`C > 8@> PP  0>`B`C > 0@> HP  @@@> @P Ј?b@ > @!] 0㿘%> ]H`.`> \ aT`@@`H @4@%> c `> ] `L`@@`0  @4@@ H@  㿘` p& x (@(& p& x p (@(& t& x> > > א `@"#㿘`.`  @.`@`  p& x  p (@& t& x   (@& p& x > > > א `@!֔#㿘> bx`@? 3 "    ? @&& > b  b>  b|> b> @!e!0㽘> b> <@' 2 $0  $@2  (` `$ (#@ > ׁ< d  ( `$ ( #㿘> א ےaP @蘒  (`$ ( 㿘`(`B! " ?&``X> &@ > &` " ` !"> b|&` ?&`$e   ((?c(&`$`$>H $ H > bx`@ !> @ Ԑ!X㿐 D?`@0`>h@`0`> @!c>ic 0 > @P> ךa a> ח*!:ŀ < d  > ׅ? F!ŀ  <80`@8` 8` @  > ה !ŀ`> &> <, @```8 @@ D @Fג #\> ןŀ!`8 @G  `,  @F @F > גŀ!`(Ã, > ŀ#`x?? aW@ ?+`c @ (? @0`3` aWn .`@ @(`0@6`@@@a 7ނ0(``X(``  (``H ,  (3  0 4 8 < H X '*` ?aW8 ?3`&6  @+`(` @@3`@ @& (+   (,` 9 6  3  2 & ,(`* @2@ @ 2& 0(* 2  3& 4(`+ @3@@ 4 & 8(,  4  4& <(`, @4@@4 & H(, 4 & X`\?(0(`@?0@@#`\  ` p r`0`(@6 p) 0?c6 r '?`t 0((`@0@@#`t `  (`6`@.`(@0`3 1   *22` *& (`+  @3 @ @+`1 @  @ & @?6 & c ?`0 ((` @0@@#```@ (8`@4`+```0(  (`0@@@ 1 $` ) ( 1  $` r*К````() 0`0@4`4`6 |6 `p`< @@!`r`"?`%`<%`P%`5`%`5`p5`5`L-0` @ 8  2%`T@ (%`T  %`T5`5`NJ 5`  @  `  8`  (` 4 "`pk  5`p5`r`  ,` 4`4` `@`  E  ?á, 㿐`8`3`(`/a-@ aW%`@! "B'ޡ`?,`@@@   C` @B@      @ @C , ࠀ`    (@ 3++ࡂ (@''`@@`  %> 6`6`!I > b| ( ࠁ K  2  6` "6`  @@`ʔ  2@`Ô  "6`! 88'H'P'T`TN (  (`0`?c  '@'??    ')?' KF4  @D@D 0> ?(" & 0 00`@ & <& 0& 4H@@ 4  @D/  H ( ᾔ @(`?  ``  HaHa(᪀ˀh   `^ <p*  )  2   0` @   +  (0` 3 ;` ``  ``%`P P '`$.` + 3 +( 0`2 D# 3 2  * )  0``  3 \  ` 0((`@0@@8 ``" 8 `? 4=```- 0(01 (`@@@ D) ?  (1  @C ?P`220`2, `&0,`28 `?&,8`O ,o0I&8`G ƃ-`D` `?`P "˂  \`PP T(`4 C  @Eh@C 0> ?(b& 0 0& <0`& 0H@@| 4  4(4 `( Y  +  (0` 3 8I 5`5`7` PP H``2PH2P H ((08P2PP`"&Q |  `2  `8  `'     P1?/  .    6@&&6'T<p &P6L@@ @2 &T@(&T&TB6N76 @D  H ( > c<@' ?> 'L'`b )> %> '" ` $" (` 2 $`> ''!> "@^u  ""2g "5>  6> l‐> 4`>b@'> l Ӑ ;> lb?  4 Ƞ4 h  a> @j@D dD g `? ` ` "``:`1> l> @x"> c<@ 1> ׁ" @2(`""" @ʔ " W v``d"`2t'> @L"" > c >  $" (`2 @8 2 $> @1 T'℀2w `"' R Ĉ  (@) ?($ (``@`('``> l#> l b$bs`?> h`> `a> ׬ '\P0d  2S@@  > @" `\> .@ݐ"0@ېH/` /&  @\N& Hp@@] g`   @]@C`Hp`*(p ` @`=> > bP0> > ׺b8H> > `H`@@`@@H/` /&  @[& Hp@@]M  @`ǀ`dd`> l? '> l#> l$$b⌄  `? >@ >  > l`>FD`a > ג "@9> l @݂""?,#> l ↆ`?@0`@0`@?"S"1 `2` 0`@0`2` """#@ #> l#> lb2"> lb$b"?"b2  > lb?  > ח2#82 @ab?"> 2  > lb?  > ח2#H2 @ٖa> @֐ _> > @ϐ!> .?#> lb?l'`4` 4> c?#> l a'> l$b$℠ & @.  1> @Òb. ` `J?`dC> ld? 0` ?c(1 `(`'`,@ Ѐ '"@\  T"7(2(`"  @@\  2; ?R'`@L'````````> #\#`#d#h@H#> ld'`#```````> #\#`#d@"X> ג@"  ?    @" "  > 7 c  ? @" " 㿘  @ ?` ` > 7c      2 "& - +H`Hp@  и 怣     ѕ  " " " " " " "" > 7 ` " " " > 7"  @ 㿘 >    > א#@c   > ؠ`  @ 2 > > ؐ#@Hc>h>Q`b㿘> vcX  >hcLҒ  㿘 ` ```@?> ؄`(    `$ M " `> `?"@`  &    ? @&& 㿘 )``&` `&@ `$  "` `$ ޹ >  &` &@ `$  "` $ ާ1> @ S"@ O" 㿘  @ U @P@ ` { C  2 0S`2@I@("$ *SB @8 :@2 2  "! ? ?  | ` F&  !> ؖ#ؘ> @ 0> ؒ#@V `@   !> > ؒ#@ > ؒ#@D &   && `& > > ؐ#@3c!> ؖ#ؘ> @c 0> ؒ#@% 㿘# `2 @H @-``;?&`@&@&`  `&`& `2 &` @"( &`?@&`  &@  `'  &`"  & ! ?  ݐۑ & Ձ㿘 }p@@|ࠀ`>  @  @ (!> > ؒ @!H > @ > ؒ @!pr  > > ِ!@Ւ`   @?> ؄`(` `@ `  @  @  @ 2N֐  `& ޜ  F@ (@ @>$@Ȳ!> > ؒ  @ > ؒ @I > > ِ#@D`!> ٖ > @v 0> ؒ @8 > ِ!@4`@ "! ?  0   @!? !{ #㿘 0>  2 &`?  `2?      ? @ & &  > ِ#@ݒ`㿐 \ @  `+> > ٔ"@Ȓ`(P`%> vP`u` ` @X& $' (Ѐ`' ' 0 0 H    耠` `'   '' ' ' ' ' `2( a*> vT`:> vXb> `> ``2@& X   XX& M > > ِ"8@q`(a`& : Y" "  `"  `&  > v" T`> v  X T&  XX& !>  "   #\> @ b`"@   `$P ` `?A "" " " " " > d%> v> ِ"p@#`8 !> ٔ (> @S!> ؒ (@"> > ِ!@`( & p Ed`G>   @ 8*8&@ !> ؖ#> @ > ؒ#@ !> > ؒ#@"#> @"> ؒ#@ѐ"D\@ ` !> #> @#(> ؒ#@#X  '> > ؐ!@c `\@?a'؄   `@  ''' ' @  و @  @2  @ @@@  ̞ '''*C *@ ,! `?\@ @ @ @ > @  @! A􀢠=Ԑd %  @`"􀠠"'쀠@: ''' @@@ـ `%` #@ ł@`8 * \@`e>  `& ؖ 2( "c 0E   " ? \ @ @ @@,  @ 耢  @`"'쀠@'''> > ؐ#@c> ؐ"@c '''؀`f  c \̂@''' # !> ؚ#> @ː#p> ؒ#@#> > ؐ#@c'''> cl`a" ` (`` @6 @    > d`   d> > cd p  < @" @@ 㿘> cd> @##t!> #p` #p`> cl#p$#p= #p㿘` > cl`a@V  & `a&H`    > > ` h @ `〤 ݀〠0R` > 7c > "`8l"` cp`"` `Hp@ 㿘H``A> cl@ > Hp@ @XctHp@㿘> clH`> ٴ`H #>   ! @cp`$cp " Hp@Hp@> p  p`  @ @@    `$  @&`$   @Hp@ # b}@"A( b~@  `v@" b@`w@> c " > #p!   `!  `! H`> cl @Hp@ cl" `> p ` pp  p` Hoo> cp2 @2  ?" Hp@ Hp@`"1`2- -"`""  "D`   ! !   `K  @"J  !  `2 ` ! ɒ `"`"7 ` ";`#  ! !   `*#` @"?  ! #``  ``1"``@"#`#`   "!  !   ! "! #``  ``"``"#`#`    "! k#`""`2` "` `w`  "`2R"@ L` `2 "`"` ``R `@ "  `"` ``.  `y"``"`` "` `"` ``` `@ "  "` 2" "`"` ``F `@ "  `"` "" `2` !     `K! @"  !  `` "` `"` ``` `@ "  "` 2"0""" `2` !     `#`@"  #` `s"""㿘`U`2^``2"`""`@"-"`@",`` ` ` ` `""@"  `` ` `  ``2` @"`` ` ` ` `ْ"```"`""`@""`"``㿘 3`$ $ 4 ,@ `, @   # `"   `2 "`"`"` "`&& &   &`&`&`&`"ٰ  `$ $  ,@$ `, @   `  2 $    `$ $  ,@$ `, @   `  2 $    2  `2  @2 0  @ `   2  `2  @2 0  @ `   `" `6  `2 `"  " 㿘`   @?@9Ϭ@9& 8 L@  " P" " " "  " " " " 㿘 > 7`P> ٤`h $ @  " @  2 2 $㿘@(`` `(`` `8``p` (``` l $ ( , d> ٟƀ  X> ٟƀ  0 4 8 <> ٟƀ  P @ H L> ٟƀ!   > ٟƀ!8    > ٟƀ!` ) `> ٟƀ!  `> ٟƀ!  `> ٟƀ!Ȑ  ">  $> ٟƀ!ƀ!@㿘 "   (  $`@2  `$``(`` ` 2` $`` $@`2`㿘 X` X `> .>`D >  a> .>`D㿈 X?'/?`/ ?`> .@Bc㿈?'/?> ?`a/ > .@Ac㿘`@@ X@@T X@㿐 `Q'` ``   0`  Hof4> 7(@ g> 7c'T@ 0 'T@(   Hp@   Đ     ѐ0`   Ò0@6v`d  &`dʷ0㿐 X`$ @ d lbH` 5 7> b> bP  * @@ \`$#\ d#`@ R`$ X  > @ G  d`$#\> ٰ @ ="`  @ @ d#\> ٰ @ .#> @ )  d`$> ٰ @ "   d#\> ٰ @ #X 㿘     @ @  "  }  @   q? @`> c<@' (< ``a> ڂ`> #\ > ڂ`(#`#d> > ڄ0`8#h#l> > ڄ@`H> > > > > > #p#t#Ȓc @ `> 7c> > ڲp`> > ڪ`> > گ< ``" 8>  @ epd @ Đ$? 88` @ 8:`@  ठ?88`  $8:`@ @ ਢ?@88`  @$8:`@ @ ଠ?88` $8:`@ ఢ?@88`  @$8:`@ @ ഠ?88` $8:`@ y <?@88` @$8:`@ m ภ?88` $8:`@ a 4?@88` @$8:`@ U ?88` $8:`@ I ༐?88` $8:`@ =  > a2bdX> @ . x a> c<@ > ہ > @ Td> @ #>  > > > bc> ڐ P@ h"> 7x 㿘  ( ,`&  `&  &&$&&  X`& &, lbA t |  x`& |& @& | "&($@@&( @ H@& H7@  b%> @@ !   !   & ! $ `"&  < `@& <& \ |> > > ڐ `@ #``>  p? > 7cP$ L> @` L`" d lb"N' X ` @y7b&@ v&` ` $  &` $  H L & Hu& L haB~ 2  @  8`@i&     @??$$  $  `&  $ "!' t+Ġ ". d $@ N>  ,@*7> > > ڐ `x@  Ðї& h     @?$$  `$  `&  $ &  d> @ !$ `$  &` $  H L & H& L& @' @ !> @ !(> @ }!H> > ڐ `X@  㿘 ` @@3 `$ @ځ㿘` `2  H `=>  H @ :&  @ & H@` ` @?&`&@ lb t < & <& 7"`$`&@ `&&`ے < lb1> #@ !> @ !㿐'@Ѩ `) < 4$@` `G>  H @ 0 @@0 4 `7>  H @ 0 @@  2 <@^ ! > c     ? @ $$$ Ɛ lb2V 2 > > ڐ `@ $/㿘 L`" '> Q  ` `%>  `2>   ?    @& &  > 7 c   ? @& & @ "(> ڐ `p@ Δ!> > ڐ `P@ ǔ!㿘`A`@ @   `@&  `(`4 @ @@@ǒ 2 @ǰ@ & @к  $@L( 0> > > ڐ `@ {!> @ 0"㿘 lb @> 7c$ 7b" 0> `#> 7㿐 H 0! `l  H 0`&  -     㿘& 0`   @?@3ɜ@3& 4@o H 0 @K@G㿐@` @?@3Ɂ@3} $# 4?`"  4`& `& 4 ِ   4 8 & 8@  4㿐'`#`2U H  N *l`"   h da& h э  L P8/ d2 " h ` a 2   `&  `& `" L@Ϲg@Ґ L P d> @5"Ѐ "t d H`s7b@2v d [   ? @$ $  L H& L& H 2 `P&   @?      `&    `  H 0۰ d> @$"> @#( @26 d  @?  `   `&    H  >  @``p > @#> @#P d> ڔ @#p> @#($> ږ#@ > @ > 0ct" p㿐\`> ` > ` `   ` ( @@2IIۂ & l& $& d& & & & & <& 0& 4& h& (& X& H& L& & & & & > & 8?& P㌂` & T㌀"> & & &  $`80`@8` <> & `& t@2& ,@2& $@2 $ & @ $@2$?& x& p& |& & & & & & & @Ϋ > c $(> 7> .c& 5&   & a:&  lb& l`& a` `|$` S$` ?u$` 4   #\> _`X > 7> .c& &  ! & > 7c(L@(@,@2;#@1 | 4 * * > a` 24` lj$`>[>[a$@#$`* > c@1t܀ >b>bc$@$`> @ 8@ h> > > ې `@!x㿘Hoo> 7c ~ Hp@㿘Ho&(@g X `> .@:Hp@㿈?`?'//?Ho(@g X `> .@:xcHp@  (@@ (( @(` >  T>^c㿐> v> c\T> > .`ب   ,@)   w#\<m  `ā  (@  (( @(` >  T>_c , , d L \ x 0 | x | 4 (  ,`2 `  `! `"> >^c!H㿘> bL> bH> 1 `l`.@ ``0@ ``  `> 1`l/`9> 7`. > ch"뀤 . : 怤 > 1`l@ ``΂ @8 Ѐ ̀> 1l" lƀԀ`߁2 ``cTǀ`> c<@' @ 6`'x`'|@'tК'`   '` M %# 2 t 2&> c<@  > ہ `". `.M % ?   (`''/:  `Z((`Ѭ /ؤآ /' 2 '"@   `  `?. /B ^ ` a`. "@" $ ` 0 `?.   `".䀧`.2    $c? ` 逧`?. Q?3 >`2LMU>  >'lƔBl>c!2'   2t@"2q@ @"n@` `/0   g 2h@"2e@ @"b@` `/    2\@"Y@ @V`(`8` 8` 'l4 lȚ`  ?/ `` `%> '( @  ``0,, 4`4  %`0 0%,' 'l l`/  'l l`/ @` H' '  ̑(` (`8` *4 '?Ѐ î M(`(`@@Ѐ  `'?'  (`Ђ M(`(`@Ѐ  '  (`/  (`@``'?' (`  +(`/  @(`@> ۢ  ` x/ N'  q(`@`'l @E ll"@Y`e> ۂ`' , 2@"E @@ ` "/2 /  (`: `l"T 9   @> `  ",(`> ےa' 4 "@ `?M`` `'> ے @'llL #   `". `. @ؚ`/آ   `/Ă  `/ `8`? 'l +l?'l 0#l?   ` 0 `?."> ? 'l 0l?'l* : l ?ր {? 'l l? ` 0^`. `.'l 0̔l 'lŔl2.`G>   ` , `@ ,, 4`4 @`%'l @* `0 , @*l  ` `0%A,8'l> b  'l) lؚ`@ @`0@ -`/ @@ `?"@` `  ` @ؠ L'lIl  'l l?̈́`  (` "M ( : ``M` N   (@'|'xx @ "&  @?`` ,`". #`. (: ` 2 `". `.  (: ` 4 À`v  2 q> 'l: lנ ` $  'x (@'| 'l@*nl  %> "Q@``'  N?!> ے U'll>  I؀ "%Mڰ `2 >.;㿐'`' ( ((@㿐'P'T'X'` 'P ('ڔP ('Ӕ(@㿘!> 7@q#<  Ŗ > bL@G#<@A#<㿐'X'H'L'P'T;> 7@Sc<H '  > bL@(c<m@"c<㿘> ސ!㿘>  `ְ 㿐> 0cLH'H@?'L'P'T'X'  v`㿐 L'L'P'T'X'h 㿐>'H'L'P'T'X`0` ,` `  H'  `  K x> c<'  < ڔ  > Oؑ*  "  >:  ʔ  *  :  >   > ہ !㿐 'L'P'T'X L `L @+F  L  '   ' 㿐#> bL'X'HH'L'P'T'`!> ,!H'> % > 7cH@@ŷ0!> v##"ǖ$bL!㿘> ۔!P> 7cP` `` > ے!p@ˁ㿘> ے!㿐'L'P'T'XH/` /JL'   Hp@> cd'  x H> ې >iba㿐'H'L'P'T'XH/` / H'  YHp@> cd'  H  㿘 a`%&@` `  @&I * 2`@ @ ,!H&!D`&!HH` @! > d c㿐 ,` 2 !&@!   @& !* 2`@ !u   7r  gE㿘` @#  Ho-4`(@n` ` @ `i Hp@ g  t h \ P D д ѐ Д  \ T X ϔ  0 ĝ㿘> (bb $1> 7> (` 3> 77> 7@&c\((`8&#`d(`@8&(`8&d` ``  (@` ?&#`> 7cp> 7x > 7!#t> !#tb(@> 7> 7tcx@ `> tb > 7(@ p㿘(8`-M 8`0Q ``8( ) 8`` ` а `  ```$ɀ@'(``8  `2 &@ 󀠠2؂```ۀ@?  (8`0  N`x`X    ``    `` (8``*".` @ ?Ђ``   ) ` @(8(8(Є?Ђ``  ) 8`` `` ` ` @?"@22  @  㿘> (. b>  > #( `(`1> !>jx1> "1> !V 1> }# ` > 7cX` ` > >hb"> >hb#Ȓ> >hb"㿘> 7c\. 8`@#> 7c`@$v1> > -@S@ . 1> ۲K"hc`@> -. > (8 b> >"> 9" Ta>  a `|/T T |V `L`C` > () ` @(`8  (`> '@ > ۢb8 @`(`8  1> "&@!> -"((> -a@:> ۖ@ "0"c`&@(`@> 1> "P"4> > ܐ"@ > א" > Ґ"T"V > ʐ"@1> ۝㿐> > ۤb> > ۠bТ>@@>1 (J` ` ` ` ] &@ޒ㿘> "> 7|J`5|> > ܤa p>j> ܨb@> > ܮa> > ܸ`> > ܴ``8'> v@%b@ o  ```2 (`b``J``T0Q0N0K0H0E0B0> > 0> :#0> 6#0> 2#p0> .#H0> *#0> &#0ĝ㿘N` E` C` A`  `  `  `> 7H` > 7cd*(> '8`̪?  (8`@(`@$`@? `(8`@-`8`&@ ?ц 㿘#> 7ch? > 7cl $ch> ʐ!$ch> Ð!ch, <  q`? Q$ch`?㿘'> 7d)> 7`%#h> '> c̢`  @ d@ ?,  ?%#h㿘%> -#> 7c`'> 7 $h  ) c`@@ ?,  8`?$h㿘 (> M1> h="x@$^"x!> 7> 7#tcx > "xbϒ @$O"x#t@$#t㿘> 7c\$!> 7> (b. P `C>``Q`M > D!> @". : א e1> !4#`3> -b4+1> ۄ&> -(a> ܒ "#`> -&(`@`> !1> !2> ܒ>  ". k: > !1> !"h1> !0 0  㿘> 7c\ !> 7> (b. P `"E 7``27> ܂ 0 > ܐ". =: s d]~1> ё #`(> -b4 1> ۄ&> -(a> ܒ"#`> -&(`@`  $> !̒"h1> "0 > ". : > !1>  > "01> 㿘/> 7\;> 7`='ch. .8`> (8b(> (> ܬ b@  ((`8.- (`8@(`8# `8@2`"@@2e'sdR"?'ch\ @ɤ ?iސڐꀤD怤ِ․㿐  ` `8  (`8` ` 8` ` " 8` `> "Xɒ > ۑ.`.: v:  (`"Ё㿐(`<` o` m` h`g  `  ` `<` @(`<` <` E` "D`<` ?> 7cd`C(?8`> '  (8`@(`@"@=s (8`@-8`?  s[  > ې  s` @(`"Ё> "x  㿘> 7c\S'> 7`K> -b@4m1> ۃ. 8`> ܤ">  knf, 8``y`Y`n`N, 8``y`YJ cؐ`!> -& "*`> %@!`&(`@`> -&(`@> 5"Ґ܁1> -"ȃ. 8`Ȑ> ܲ">  #&, 8``y`Y`n`N, 8``y`Y"h c> (b. @ l$  `` @"耠@ `` J> (- ` U    (`@`(`8`.`   B  3(`8 > '(`̠@8@>`(`8 > "22 > "> ";- Ԯ` .`@;5 " $ > ( `  ƥ- 1> " 㿘/ ?  c> 7 ch> (bbB..8`> ܵ8b@ ``4 `@!R2 @< 2 t2 T @2 T ``2 n dvfceif2c,`ב:  %> -`8-`8``> ܀> -`?a < 5> 72`  @#<, @@;Д  " `d"'`耤`c`e`f2` * :  @, <`c?> 7 ch n`  T ``2s 0 ؒl zh Nd ِ` 㿐?> '> > ۢb.`> (> ܳ>`b -> 7 (@9/L` ` ` ` &^ 2 L\ , > "h ? q Q֒@`@;? `a'2'{Ē   fp)> 7> 7#\c`''''''''.8``+> (b$  > ܀   @ <2@;    `> ܒ a#n? , Ԓ@.77> ܒ i#Д\ a.: ,: #\􀦀 .@  ?,` > (a,`> ( a0P  `0 > -a`> - a|P  `0 b5%#\?`1 `@@2@:w 2V`"V`2V&> #> #8> #X,`:: ?` `@}@2@:B 2V`"V`2V&  `Ԡ `@Z@2 @: 2 T ``2 T 4 4 㿈(`= ` a` _= ` "g @` c` a`"` @  `  `  ` -> 7`L@`  @-> 7|N` ? ?|,@N, @2@9Ӕ 2,@N, ;`` ` ` ` @&|(``2(`>  '` @, = ` ` `  @ >jX= ` '> Ր '`> ݠ  e'쀣`> ݠv UW''쀣`2u> 'C qP?'쀣`w'%> '` >  '쀣`]> ݠD Ԓ'쀣`2d> | 8'@K'> 7؀`? > c> ݒ`> h u'쀣`7> ݐ $ 2*> > 7'a cX`> ݠ( u dR'쀣`2> = J'> 8"E'4 xA'0 `=', H9'/5'ߒ > 7', cl: 2> WW'ƒ 2> L@`"p$ @``(8` !` " `> 'mb tvt T܃8` 뀠`> '` @``(8` @ۇ( <' $k' 2> WW4 f'і 2u> WW% c'– 2f> WW e' 2W> WW d'? $ 㿘> x > > aPq@5 (  1> c!    N - 2  * *  @> \!T@2  * *  @> ] L@> ca 2 `> c?c(> ca@ `?( 0`@?`@(`@@> ]`H2 `> c?c > c@  (@ @2(` ? 0`@?`@(`@@ 㿘> 7cP> ݐ @xa>`0at`> ݁! `E 㿘 ` `    "  㿘 '  ^& "  `" V`6` `$ V`@`@" &`@``@6`& 6`^UV`㿘 4@ &@) >  XbȀ2&@``6`㿘>  a'L'X'T  L@:@ 5 (` (@,o`(#] .  `$ 4` (`@ `(@%@ `$ ]Ԃ  ̃5 T> ݂a䀥LX @   @] " ``c7`a`>  ,b @`(W a,0 ` `$` p < : @5 |";Q}b{"T` `` 2` "T` "Q` `` `L$` `5   ` %|'T` `x t ^  "`  `'`` `v3~2``L'`4``` b~ `$` ]1` A v "`` 2` x `"'``@4``` b}{````w l%``4``4``(`<c%'`(! <`! @`U! D@(8 `/   $x  `W&   7 Q` '''''耧 '`'``@ = `@'``43 ``821, `\؀ 9 8P$ @?`>8B >P ;4 ` @\r `&  `2Ѹ  w ؔ  m  ?  #ð    |2  㿐@ [ْ  `2 ` `` #`#\C 㿈@ [  `2``'' ` #`#\ # 8 `/   $w  `V&   V P`''''' '`'``@ = `@'``43 ``821, @\؀ 9 0H$ @?`>0B >H 4T ` @[ `F  `2Ѹ   ؔ-   ?  #"ð  {Y ɐ 㿐@ [  `2 ` `` #`#\K 㿈@ Z  `2``'' ` #`#\ + 㿘 "dԒ  . `8> & $Ho-!(@X> bȀ"2H1,`@,H` Hp@nX> bȀ2, H1> `  "Ȅ6 `0Ĉ0ٝX @`@`0`,`ȡ,`,` "͔ ,`@Ȅ'Ģ'` i , "d`H`$?ɀ # H`` 2` ``" `  2` `  2' `8" ,```> ݔax``> ݔax` `> ݐxa `  , `  , "'` `8""` ,`2```> ݐaxS``> ݔaxJ` `> ݔaxA` ; t , [ `8 ,`> s  M ,VŐЂb???/'a'''''''ܢ'ЮԶ!' '' 9>  ,"̅H``@$w  ```%V|35 ?  '`.'Ta%> 'Ї(` (` ( ( @Hoo ,`@"̀@Hp@"􀠀φ ͆ U'@@'H`$!> > ǐ"PHp@ "|"0awr EX > '``@`@ ,` P'@  `@В    (`@0`D#@* *  (%@(( @@(`''x  , H`$#" @4@;  @'? `''T a;>  ,b̅H``@$!`#U{13 ?  '`,'䀠%> 'Ї(` (` ( ( @Hoo ,`@b̀@Hp@b􀠀ц φ T'@@'H`$!> > ݐ"ЬHp@ b0M@ " U Ђb?g??/'a`' b}@# (@( b~@  c@" b@ c @8 " 8 "`@ ` @  @`4R``(< > 8`"`8 "`   > 8`"`8  "`!  4R `(<"2 @2  ?"   2  @2  ?"  !  4`(<" @`2   "  @`8 ?@2   @0` 4`(<" @`"  ?" @ 2    @a"  㿐> 7c(> #\"> ݒ Ha  Ř  @" @" @:@㿘> ݠa @b!a  & @ " @a & @㿘 ` > w> Ђ > B؂ @ @ H & 㿘 (&`8&`<&`H&`&` &`L&@&`&`&`&`&`&` &`$&`(&`,&`0&`4&`@&`D&`P&`T&`X&`\&``&`d&`h&`l &`H   >`8@ @_B?>`@ &`  $&`$ (&`( ,&`, 0&`0 4&`4``&```&` 㿘 (`A < @ ``2  `" `@``  $` ` @`k``@`@$`@ꀦ ` @ @a8… `ְ `аS  @``@$ @㿘 @`@ ``K  @`  8c:  b& @ @㿘 , @ D`& @> ݲaZ @`  & @  D` <` Đ`@`C&`@&`<1> "ԁ㿘 (& & (̰ 㿘 ( L> `D`$`D *@"A`@`` @*` s`` @ $`$`@ @`$@$`$`ڤ N`D`7$`D@aT8` `@`H` @a6`䀈``<!`@`$`@$ 2`D "`D$`@䀤`@` "@ϐ$`@@` @a&R` `D`$`D`@$`@@T`D #㿘> Bc@!  j> w& && & &  @ 㿘 (`<``@``D`$`Dq!> > ݦbh "S`D`@ @`   `" ` 2:`D` @"@(`@ 2~`D` @ @@:`"`  ? ` #`@`!$`@ 2`D`@`2\`D瀉  "` `D`4$`D@"=`@`2 Q`(@8"Ѐ`> ` @> @`>  "`D`$`D`@` א$`@`@` "@א$`@@̀ `ɀ ƀ ư D`D `$`D`@ 8*`"@*`@ (``  $`$@@> $`@7$@T/$`@` `"@`@_  ?n`D~$`@@`` @$`Iİ@ "Ђ`$"#> 鄐"P邐"8> "㿘& &   ` `& @& <& D  Q/ 0 0 4& (& & ,& $c& 8㿈  !> "Ԧܤ   א"դ  ,[ B 0`> 80 `$ ( `Z찒 *0`0  `( $`<$<, , `, , , ` @~  STk 0[D[A0S@S|8 p  X  X x  <x H ,XXXXXXXXXXXXXXXXX T    L|||||||||||||||||00000000000000000000000000000`  ''''''؂'' =?` @ 耡  (``@ > 2=c@8 @C =c @ &c=c㿘 ``@ے @`4> `,@@?ݐ #`,a@`42`,> `$ 㿘` ` ``,` `P`?&`P@%@9[ P@ #` #,`,@ # $",  , >H`Ђb@." 2  &>b@h`L1`o@ $ &> 甐"j 2,0>b @hy`@g` ` p``"?`4Ђb@'` ,bWhH`@C @`4@>  &`,H`h ``4$`D "`Lf`L`"  &` `L ` @ `L1"` ` ` O a@"@`$$& ` u ?/!~ڐ@ F ,B @+} @ϳ`' `  `'Ȇ  ? '''''' #'̖ `,H`h ``L@ 4Y$`D" ""  ,b|   x!`! <zQ `Ђb?4` `0`2` ` ``D@4" $`D~z "C> eS$`D`,H`(!F`L`Ђb? `0`2 8&` ` ` `0``4`L@@ `L`Ô `Ђb?4` `0`2` ` u``"`L@ "`L`  'I ,b    x0 P` P }@w,bݒ   x P@ e`t P_` `0`e  $`H,b Δ  w!@ݒ @`O!:` ` '``H'C `Д 6 ؆Є '? '''''`'+`> *w $`L'0 (`'8`D   'Ȣ` @'ܐ   ''Ȗ 'Ȗ 4lHo-(@n$Hp@ '@*İ  *wl $`L `    ''ؔ . ('܈ @ 'c8䚠 0> > > ݐ bp}"f> > > ݐ bpu"?> > > ݐ bpm"X> > > ݐ bpe"K㿘 (  @P$ (㿘 ( 0&` &@&`&`&`&`&`&` &`$&`(&`,&`0&`4&`8&`<&`@&`D&`H&`L&`P&`T&`X&`\&``&`d&`h&`l&` `!$2``&`&`&`  `   !$&`㿘 (Ho``A(@a`A` L`"^  ``    ! < ؀/ "F 8`  H`"  `. Hp@4  `4 Hp@`@2… 2ְ ` ΀ϰ ƀ  `4 ֐`2` ` ` `T 2`` 8`" `㿘 @Q (@ ~@0 c@}@"12``iS`rM  ` b@-@2 0``& " <`" @`" D ` a2  `   b2 2 2   &  <& ~2    }2 2 2    @   @  (   >ҁc4 㿐 (#\   @IϚ 㿘 ``` @;  ``@ @1   `  `@@@@ > c?`c 2l d@"dl2``@? > c 2 0  @2 l d`  t `@  0 @  `6 4 ` $ (@" $" (` @4> " 04" 8"`  x"` x " x` $ ( @" $" (@> 4" 4a4" @`  ?` ` @"` "``" x` ` @"` "`㿘  u | ?> 㜀   ``$  l & ` `@4& ` l `& `& ` > &`& ` & `& & #?!#(> 6 p> & ,4 t& t& H& x p& l& p p l # p> `  v| & l l& p @ > ` 㿘`  ` > `h (( @`` t  ((   vI  & 2 > c"`(`(` `"@`$@ l2` v#㿘 !ؔ  @&  `   @  Ē " > H"㿘@9C > ͐#>  㿘 I  @` ``@  " А$`` $ `@$`$`@ڤ @:   @9((> "㿘 h`$  t> ! ?    t  & x u >  ǐ"㿘!>  E# d`> ` B# 㿘> c 2 d0  d`" l}$ d l 2 d㿘 ``@> "`h%> !`l `  ` ?(c&  `2  &f  ! " `0㿐 ``@'``   0! *>  h`($ hא!  `h3 d`k$ d 2 h d` Y h`$ h d` hs  2 hېː d`> `&۰ ZR &$ d> 㿘 @``S F  ,@B'> h@> 8>  h`h$ h(%> ->  , $ @!@  '` h! 4 d % d`$ d 2 h d`" , Y h`$ h d` h  # `f 2 hJ d`2 `" hk Y hf$ d d8 `  /`hC&`h*0  2)`h`l "m`p`p! p`p? `d`h`&`l&`d&`p &`h5> ݐ`h0  f! +`h`&`h`d``h  m 2`h ` 2`h`,>  ` > `hڰ @ ``h԰`p'Ć"`h`&`&` a> >@&`,&`4`h&`H> c`l ``@>&>&#\>cct㿐 ( > ( h   ! h > 7 c(> #\#    > 0c8> cc> `> ` > > c '(((H)l'''''t'`00@0//h/..P.-L㿐`?`  .  ->  -. > 'c@> 'c<> 'c8> 'c4> 'c  '  @Ԁ$Ҳ $ > 'c  '  @b?c4 $ > 'c  t'  @M?c4 $ ;> 'c `' c @9?c4   q;* #> c aX*ϒ  q/* !> c  *ÒaXr˒  rȒ $aX$ r'c > 'c  +' i e4c a$ _ 㿘> ` ` @2@"T  2 $> p > 8` `T `%>  X( 7  (`8`4+`8` (( @0X`T @!X (`    (`8` +`8`` ((  60> ޙ#H> ޖ#h㿘%>  M>  `'> 8 +`1  +`8@(@2  (`P@2+`4 (8(``?# `# 2!   +`8@܆2@"@@$@`$` 2 (`%`P '> '` ?c `+> aX,  9  @ . >P &  * p  `    4 " `@`\@@@  "@q # &   `$  "! 倦&  . . @ '@!  `̢  `@ƺ`  @,` ŀ@ " ݔ! &  {. . @'@ɔ! &  g. . @'@! &  R. . @'@! uŀ D i\@ D b $ a@$ $ > 4$ ,w M> 8` $`$ \  @ \p > Ҹ!\aX%?aX.. @0aX`   )  @ 3@ @` r?aX㿈` 8` (@cF2` `@>&>&c\t#\#`P  "`㿘 @``?`!> '# > 8\ @.  > G!\, , nǐ"&% #  X` 5`"7%  ,   ' pP > (!\ !> '# /> X  ``@; 2ǰ "ְ  />  % ` %`, % `> % `% % `? (15 5 % $> a4% ,X> 8#\@ \X@?c( @&    `   f  "X o > ѽ!\X 㿘> '#> 8c(`` `%> $`` ҡ  > & 6 &  Ҕ>  "  @2э``$``㿘@ Z  (; `;  @5@2`P@2` " 00(``L 2 (`8``F@ > 2L@2 ?"> J > 8` ` (; `  2 `(`0`0` ` y  2&@> ` 2    @2&@ `(`(` ` `  X > '' `@?c @ ` ;> aX- @`;``@   "&  ,,Ġ @` Ă''7` (`1 Ġ  `= ` (`1 @`T 1 (` (`  " `2  @ 0  " '  0 (``2  `2  @"̖ '   ` (`(   @0   h) #T `2 `4 aX!$@> ݖ aX'@`{`V@?@2  YT `2l 4 "} Ā@ng ,  @ l``3   3+  @"S  "  " 8 ` (`(   @0     @` 4(( @  > a4 $`$&aX<@&`44 Y,,# @@"?T? "??H ?> ;#㿐 D   !> 7> #(!\#\> ҈c  #\ d > > ݐ ~c!> '#   l(* # >   aX l!(> > ` ?@@P@@??x> 'c> b0 * @`" `@ * ?> 'c?c  > b0)  ;  @ 2 0㿘 T`) @ ,  kڐ&`T Tp@`?`c >     (`0@@ (`0(@@  &`T㿐`?`  .  ->t  -. > 'c  '  4 $ > 'c  '  @Հ$Ӵ $ > 'c  '  @À$ $ !> 't#  > a# ``#  (84# 0> 'c `'[ `@?c   k5* !> `"0*ɒ"0lђ $"0  k%* !> `",*",l $",r'`㿐> 7c(  #\ @ > > ݐ"4Zc!> '# `  k* `>   b0 j(> > b,# > > b$$# > ( b 㿘 ``> '  i e-> (@ ^ > +> ab `` (@5 P %b %(@'> 4@ :` "^  > "$`C`!"$> b0(@,`?,`!"$b0 @@  $ <`$$ `> $ $ $ b,,`?`(@04 $ ` <$  ( `44 ($ $$ $ 0$ ,> a4$ 8$ 4?c @@& )> b0`# ``b0`@,`> W#ِ4J?4ڒ(b `5%( %b  # >  > ݝ㿘 > `0.k `"` 8 `ff ? (c@' 㿘`@  a `b    #"@㿈  `Tg@ \`@@?  T@$J ``  ` "`  `> ) a8``OMa@('8@ ,`@@#\*#` @* $@$ (@4> $ 44($,& @&!> '#   *  i  ` "  ? @   `T' @'㿘 8 !> ! @@(@> "4> > "( 4@ !"( @ X `Z ##x ? T (b$ -$ h! @ < Z  <  $ Ȃa@$ $ > 4$ 4> 0?> c@ $(`  ``@>&>&#\>`tct㿘> '`c?c@(1> "0,` !>  b@ @f*?> &`4 ($ 04 ((``$  b_"0> b$$  㿘 T  `  TjV & T  T  `"@@ `  @NOOOOXO\l[[[[[[[[[[[[[[[[[[[[[[[[[[\$\|\\t[Y[[[Y[̝㿘 Ѐ`@ @ `@@?`㿘 @K !"! ? 6 @h  ( `h* h`3@ 4* *  @@(`6 2 @8`> > c c  `   x    x@ >ށc!㿘> c *  * g> &c 2 p0%" l* $ (p"" (" H" 2 2 2 t" " |`2`" l* $ (㿐`" ` (`@e >> c+ + -iJ > c> b> c> c㿘> ` "    ? @&& @%[ @%Y ( H@%V >i> c$> b!㿘!  >gg pb$$" h h @%[  h (@%W  h H@%S > $  > $  # `!#>kc" h㿘d ꀢ / V 8`2?㿘Hoe4> 8(@f> 8 `' ( H`2  @( Ѐ`$@ H`& t2  @ Ѐ`& t!   H` t`ր`Hp@܀0㿘V Hoe`(@f` >`0` H Ȁ)'h`>> ި`0( H %> ' t`& t HT  a@Hp@ Hp@ p  >*b0 d, , , $4 @ d@p> ސa8 `">  |`"> `"> "IL`1`@ `1 1``+`@ 8``?`?``+ @ 8```?(!``?@ (@ |"|`|8*  `,`,`2l4 `L`1`T` `1``8c`  ` Xt cЄb?V'`?/'a'P'?/a''L`1> ހa `4> ހa`t O> ! @###\#`@-#d-"*  d* $@ޑ2 > #h#laa@6 L`L8 *U4`4$P @4' aH6 ah6 a6 a`2,4㿘_  t`  | ` 㿘V  H@ t`I  H& tO C>0a$ 㿘> 7cP > @"` t`@% d"  "  @# H 2  t& t @ ؀` @  t& t㿘` "4 >  Q 瀦     @?`8`? @2 > #@9#`d`` &`d@#=`H a> ݂c@?`!V`6`?#@9#`d`` &`d`H@#!   > V``#?(`>D  `h ` ` @k`Hoe(@f`H> z@$/#8> $ 9 @ :`d@&`dHp@` 6`  > #@9#`d`` &`d @"ǒ`H `l6`2j i @m @?`(` \?`c @``y 6`? r om?k >6` (> c \@8c`d`H @"&`d `4 ' ^ ! )+ )>  0]㿘`t` (&`  @  ^     ^  ? @ߑ ?㿐 ˒Ԑ Ho ((@f (@!ɒ "  @!  @! "  t@!  t(& tHp@ 6 6 㿘`     㿐`` (&`V`‣`$`>`@ > ݂c@ ?% > ؐ"`?6` `t@2@N`?6`w`B`?6`(@ `n@`2``> ސ `?6`Ђ? `?6`&`t) \͐@Ho4`t(@f`t`` `&`t6`&``@! " `@ ؔ ``t (&`(&`tHp@`V`,8` @@6`` , ` ߒ? `?6`  > 8>(`D h㿘Ho%`(@f`` (`< `4 t>(6 6 & tY`2  tHp@ r~((& t > ]`L H` H Hp@@"  t@" ( `" t0@"~0㿘` t`&`t  t & t   "    ؔ    㿘 t` `0 +& t  & "      c  r((& t > ]`L   & t & t 㿘 5 㿘` ,  㿘> 1l@" l   `& |6 ` & t&   > ř!H& t&  㿘`p *`s `hV`Ho%(@Hp@E> > b@8b`$>  &`$c ?@8cD`0`%. #(˒  5!`!@ !`!@@`t!((&`t > ]`L  c@8c`D>  &`Dc ?@8c` X (2``@2``t  2?2+`)!&`t2``@ `@T `@|  `@c `@~  <@`h`"`(@("``t( \ 7 (G&`t (' ) !? '" ``@ ` `@ `@ `2T Q"P`(2)`|2X`tT`tf@Hp@"> ]> `h`(@0@8`6]`t`(`$j`t`d" `` "`@`H "`t`@"X`t`؀`S@  O`t @L&`t`(``h@@NV``H@ `t!" `2```` > &`t(&`` 2`t"  !@ ע @2`(`a"``(@ `@ ! ^`(&``@ ` "ɐ`@À `@ `@``6`(`8``"5``t(``@2`t`"`tV`,`8` `8 `$`t ?  {`t `!t`3 `t`h ?4&`t, i`te`t"`?`( `2ư `"`& В`@0`|  D`t`@&`t`"``t!"H`r`P06i,`t& `|ْ  &`t Ғ В 2`t2| {`A" `t ^ `t&`tM``| F `t"K`․ G`(@C6` I`t"s```"`t@Ґ``tj`V`† R| ``6``t>)&`t@R`6`R `N`@  "?"`t@?  > ݄ c `@@?   ` `@@@u`t&`t  /`"`'r`t?(m&`t6`i`t& `(`@`%`@i&` ^"ް ~`Ӓ`}"`t`@;Q``{`tǰ }Ű |ð {`  x> 7cP> ސ @a   t      '' *@'''''& & & & & tȒ@   t(& t㿘> 7cP> ސ @|a   (   `  㿘Ho%4`t(@f`t` `"` W7Hp@   Hp@?? 㿘 > ރHo%(@f t & tHp@V"(㿘 >((> ] `L ((> ] `L ((> ] `L <Ho%(@f"& Hp@` 2  `t`2  ?@6  8 @0`㿘 >((> ] `L ] `LV`! > 8 `&`8&` 8 `&`8㿘6 ((> ] `LHo%`A(@f`A#` T``H@$ "`2 Hp@Ғ`Hp@b ` " `tհ ׻```"ʰȰ 㽈`>  ݂     )  H-> 'Ho%4 t(@f t   > 8! Hp@ ܐ`&`Hp@>0   @",`2 `$ @2&` HC`X`+ ` @i ?@"#6 6 @ $6 9  @ = d @& dB$@ @ H׀`+` D 61 H @ HĀ`Ho%4 H(@f HHp@0`" U@ HڦQ> 8 t`& t!`ࠀ"~` |"z` @"u`2r` $a2l`!@2g` `X | > !bP> 8  @`> @  > c<@ 7> ݁&`` &`Hp@`&`@ ђ `` غ`#Hp@ɺ Hp@` #&`#` &`㿐>`0`` ' '  ( Ho%4(@fHp@   @" ,Hoe(@f2W (> ' D  @   `G􀠀'`= t   @݀  > 8`> 8!( Hp@ #`2 # #`? ` 2Y " #T `ǪHp@  @ . F   !~ ``      ֢Ӏ Ѣ Ho%/(@ h@  @3Hp@Đ\ 2  | {e `ې> !bP> 8  " 0ρf h@Ғ  @U0̀4K t0Ð0 |`$a;a@7  ` {) > !bP> 8 c " G ( %`R2'  Z >`r '0>k  Hp@} #Hp@u Ho4`t(@f`t` "`p` "`"`t"`2`"`x}"`tHp@ P @ }@  ]> > 8bP#   @2  ,"/|*2) $a2$!@2 `z!ט " @> @Ȃe@> h@"Q b@"  }@y `@5 ]`r@O ` " ld " l `  ,` l(`> 8Ȃ@`  u@> n  `g@z> c@`8hp> n@ @T^@Ga@ ` @`" `` > !H``, ` ` $`$|`` H``! `r@$> R`^@> X7c@`8Sh> @ M @ > @2Fh> Z@eg@ c@`Ho%4(@fc@` & $`6(Hp@  @"V l wo@5b@mHo%(@f)R&`(> 1!> 1 l` " @`t`(`(ذ  @ '܆?> ΂`X'''''@^ Ĕ@` `@W!Ĕ@k @lĀ K$ lHo%4t(@ft ਀ $t -F$ਃHp@ @= @%@@Pv@^ ` [ ,`W n  @"$| @@b~@ؐ @F[@- s@͐H& @\>  *@    |44 4 x4΁ Ho4(@f&&Hp@  ` a | c & > 8bp  l@Ho%4 (@f l> 8(`Ȃ@`.@ 2/ l,lHp@` `ư Ho%4t(@fta"a r(($t > ]`L 0&  ,J Ho%4x(@fx@((@(($x`@` @$x` "x@$x`@` x@$x` x@$xHp@ Ho4t(@ftd$tHp@ Ho4ं(@f@&$ःHo4t(@ft݂{Ho4(@f`rt`$t6666  `Ԁ`@ t2 ( @"(($$($ऀ $     u6  `@D ਄ ! >O$ $(#$ࠆ& $n Hp@ l] l ]$t ਆ&  (`@0@7((0  ,48<@$$ $$$$$ $@$<$8$4$0$,$(-$ _   `@2fq aHp@瀠` ,`2W|Ob$tY?㿘> 8b4? 6 . @ Ѐ`   l> 8(`Ȃ@` 㿘> 8b4? 6 .  @> 8 l`ȅ( t$ Ђ$ t  8b4? 2 * @> 8b4* ` @``Ѐ`?   㿈> bXbX`` > c<@' ?7/@3 >  > .`-.`"@ #> ށbh@ p//@ >> ނb@/6`"`"0`(` 0`0`0` t`-/ 0'"0*  >aؔ 㿘!> 8Y" %> 88##> 8> 8b<& * Y" > f ë#6* ܐ#> 88b4Y*b4V̒ $8$b4b4. @` " Y  U 8 $|> 8b4$@㿘? 6  > 8b4.   Ѐ`" l >(a> 8$ ЄȆ  w$ . !& . s&㿘'> 8Y > 8b8   ?! " ? c(`YN > wa. 0 0@Z    4` @f_ @~ @^*P''Ȃ`'@@~2^ @`& @^0ם㾐'''L  `@ ,Y4'찒 4!谒 > 8--ĒXސ 0`> 90 bl  `(@~X'\'`''`-''X@Z( l P`$  `@^S!''^'l@}і^ l @~Ɣl <`( 8@~  l@gؠ  '?''X''\V'` h 0` 0`  `l `(@~lL " L` , , `Y , , ` ,XR7?b 5> 8  2 y,  ? 4@'''''Ю`"' U  X]X6 ,U-,O,Xh{0v@el,s㿘> ca `> ]`L>`L$`0  `@  0 2> b" > > w a㿘   > 8> 8 b4 8ԑ 㿘`    -> 8b8yr7> 8W !> 8"<L"< 2 "<4$"<> 8b8 $"< " W> 8b<yN0> 8b4> c< @' ?6 . > 8     ```t 2"!& "`t`@&` > @̒ > #<@ ~> ށ` 2?`(``ꀤ &`d  `(``he`aa `l> 8 @(`@```ؠ  d&vT `t` " ˪``(`";`(`(`h65`( d d @@8   v) `t`  @Ք֠ ~ ``@y&`w #6"@6`t` @Ð+g0> 8b4> c<'  ?6 . > 8@`  P t ` ` &" H `! 6 H`5!N " t .> ށ  #uy  ` `@2`,` `,  ,u ",` uc ",`!0ـ/ ` b0"Pd  H8 d@&  u` F@ 0 䀢d0u-Ѱ㿘> 8 p4`?`@0`@(` ` v ~r z P`㿘> 8b4 ?0`@(` ``@e6 > ]`L(( @><`i `l> 8(`Ȃ@` w `h"`"`  @u @: c@`( `b2 ` @:`2L `2 ```?@"Z `@"`H`_@`f@2 `l` `Æ`$  `2 ` `2 $` ʄ@ ߂`$ , Z `2z `h$` ` $ , H    aP`|` @0 @:2`H`p@2` `l` `l`$  @" f@2s` `@ , j `e ` $   c@`85 `l`H@{`H0 `lb@`w@2( `l`|   & 2, !  ߰ `@ , ``H& ```&`| w`|q ``אް  c@`8` `@ , @`$ $  $  㿘 p> 84`?@`0`@(`  ` (    @ ( ``(``u  p> 8 t4`?!@0`@(` @`  ( >bܒ 㿘> 8b4 ?>`06 `. `> > 8bP> 8 `' ( ` "@   @( , "% ( |"! (`$aa@` p^!蚘 "  ( `6!舘 " ` > 8 l(`Ȃ@`  (`` @ ls   (   #@ Z ( (㿘> 8b4? 6 . @> 8 l`ȅ(D 㿘? 0`@ /> 8b4, @ O t &  X  A t Ѐ`> 8$ t`` ! "`$ t " t$ t  c$ $ % c$ $ $ $  t l> 8(` R$@㿘> 8b4 ?6 . t`R ` `I `A"#`Ho4H(@fH`" ta   A `= Hp@`"` ` "4h(`?`2`   `2  !`  `` ? `: 2 !ð (͂  ʂ ਃ0`Ƃ`` > 8R`b4 ?? 2 * !? > 8 b"`8"` 8b$"`8 `>  @ 2`*`* @ :3`Ѕ+  @:+`@C  B ) `2``   {    Ԃ 㿘#`>(`(<`   2`% `/" ?@{ߐ @ @@- ,<``1 3 9  (`<``ߤ? 5  (`8`.R    K@/퀠9, , Ђ@*``*`@  (`@"< @ۑ: 5`-`=`*@ 3`+ +`@ ` 0((@ @c@C 3`+ +`@@C3`+ +`@@C3`+ +`@@C3`+ +` @@B>@ Ǡ 㿘  & & Ԁ`& ܂ & &!l&!$ !&!l& &!$"X &!l&!$㿐 H/9   (``" N? (`?N N N   +`(`(??(`(@ +`@  7/////2`*`: * @ 3`+ +`@ ` 0((@ @c@ C3`+ +`@@C3`+ +`@@C3`+ +`@@C3`+ +` @>@ 㿈`(耢 $ !8`& |0`@*C*@ 3`+ +`@ ` 0((@ @c@ C 3`+ +`@!䚃@C3`+ +`@@C3`+ +`@@9 C3`+ +` @`@&"&" "#>"@> =& > ސ \b@6 H@`AQ`V2   & & &!l&!$&  H!`S`? " &!$H!``W`?  &!l4$  & " `} & 0N"$H@@."$``(&(`> ސ \cX@   `2" !"X"  !,!t& &!, &!t  &!l& & &!$> ><> ސ \c@Ɣ > ސ \cH@ > ސ \c@ > ސ \c0@ |> ސ \c @ u" v'x H    `*K`,K@= x> @Kch 4 "V ( N Ђ`` @ @ ``G`2+`-`9 К@  Є(` .` @ @ `怣`xH`*`,(@,(@@ `, ٠  9 Ʉ@(Є ւ`@ސx   㿐 `܀ $& b` > 8bP/@'b> 8`ܐb`> 8b/@c 'b> 8`ܐ a'b'ba,`84`8`'a3`80'a+`<  , ( + @0` @(@b@,B*@ 2`*`, 2* c @3`* + @ B+` b 2`B*`@2* *@B 2`**` B @2* *@ B* 2`B *` * @@ c@2C*b** B@2* @c "'a?b'a`x"u> 8a!` 'aa'b (`(` (]'a\> 8b @ :X> 8'b > 8`ܐ㿘 . lݐ!`e!x K> & , ,`> c(> 8`̟㿘`l`Y S S  I"(> (`  (!> Ҕp> , ` ,  xX$$`N$  $$$$Ԑ> [@c`Aࠔ  $$$,$$$ > @ cx`3 @c`'0$&`> 8`Ȑ K< &`܁_>c ɸɸ㿘N`U"N ?`:N `.N `.       .. #>. . . . . `  2 (`= `ۀ`/ق `?@֒x  @@O  , = `1 3 9 ޠ N`4,<*@ 3`+ +`@ ` 0((@ @c@C 3`+ +`@@C3`+ +`@@C3`+ +`@@C3`+ +` @>@ ̢ 5 \` " \ !( \>9ct"X㿐N`D"N ?`: N `. N `.      . . . . . ..     H` `/ `9 HH`JIKN @) (`(?(`(@ @)  7///// 2`*`: * @ 3`+ +`@ ` 0((@ @c@ C3`+ +`@@C3`+ +`@@C3`+ +`@@C3`+ +` @>@ 㿈"耢 dq  H`@C` m `S`&!!8`& D0`**@ 3`8+`+  @0` ((@@ c@ C 3`+ +`@@C3`+ +`@@C3`+ +`@@C3`+ +` @@`&!@&!D!H#>!H@&> P \`1& HJ` "J  &   \`"/!(!X` & \ & \`   & & \\Pd8 \ & \#F .(d d & \& d> ސ $c@; G"X!X㿈!T'   H  ``; QH``;(@*(@@  㿐 &`܀ aP` > 8aT/@'aT> 8`ܐ`> 8aT/@ 'aP> 8`ܐa$'aP'aTa ,`84`8`'a$3`80'a +`<  , ( + @0` @(@b@,B*@ 2`*`, 2* c @3`* + @ B+` b 2`B*`@2* *@B 2`**` B @2* *@ B* 2`B *` * @@ c@2C*a@** B@2* @c "'a?a@'a`x"v> 8a!` 'aa'aX(`(` (^'a]> 8aD@ :Y> 8'aX> 8`ܐ㿘 . l!(]G  H> & 0 0`> c4> 8`̟㿘`l`A Po ;  FŐ!`> 4`  4 > > 0 ` 0   $X$\]0$d  a⠔ <$$l> [@c]!h$P&`> 8`Ȑ H6 &`܁\>(a`2J`*`/(`9&  H` `/`94? H@`2? ) `   (;`() `Ё?2?㿘N `:"N ?`:. .  ?   ? ;  ?怢 < (`(` `"(( ( @  2*:*@ 3`+ +`@ ` 0((@ @c@ C 3`+ +`@@C3`+ +`@@C3`+ +`@@C3`+ +` @>@ 㿘N`+`- ? c ?* *  @(`" 2*:*@ 3`+ +`@ 0` ((@@ c@ 3`C +`+ @@3`C+`+ @@3`C+`+ @@3`C+` + @>@N`+ `>@ \` " \ !( \>9ct"XX 4> ޠcqÐ ?? T!@o!m S7 ? 퀤@   "(@&"///// 2`*`: * @ 3`+ +`@ ` 0((@ @c@ C3`+ +`@@C3`+ +`@@C3`+ +`@@C3`+ +` @> @ d Ģ!n`'ĝ㿀" ے耢??''H`L"s!& D @ @ 8`0`**@ 3`+ +`@ ` 0((@ @c@ C 3`+ +`@!@C3`+ +`@@C3`+ +`@@9 C3`+ +` @@`&!@&!D!H#>!H@> P \`5& HH@`6`8 & 4 \ & \!X` & \$ `9  & & & \  \`2!X!( "X!X?2! d & \& d> ސ $c@ 㿀!T'   H  ` `  MH` ` (@*(@@  㿐`aP` "aTaT/@'aT> 8`ܐ` 'aP> 8`ܐN a$/@'aT'aPa ,`84`8`'a$3`80'a +`<  , ( + @0` @(@b@,B*@ 2`*`, 2* c @3`* + @ B+` b 2`B*`@2* *@B 2`**` B @2* *@ B* 2`B *` * @@ c@2C*a@** B@2* @c   > 8aD@ |> 8'a?a@'a`x"r> 8a!`$'a c'aX/`& g'aPa'aX(`(` (O'a㿘 . ls!(Y  E?> & 8 8`> c<> 8`̟㿘`l` A M# ;  Cy!`> <`  < > h> 8 ` 8   $X$\Y$d  a⠔ <$$l> [@cYՒh$P&`> 8`Ȑ D &`܁Yl>(cc@Hoe4(@ f`$? @(@    @8` ` 82 (@+(   `@" `"" " Hp@   " Ho4(@ f   `2 @ $:Hp@ a @  @ #`9  @@ ` @8@ 0݂#`ڈ @ք@ Hp@  @Hp@ * :`9 00` @ 9   ` @;`" (@ @((`` (@  (@*:` `*(( " (@(@ (* @ &> w耠"  `> w a`" ""8``8!"  > w a  "@ "   8``8" a"@ 㿘  "   @  C >  "&   8`2:@ C >& & 㿘 >A  &  & @& && & &  >8` 2 : A  & @& && & & 㿘Ho%4@(@f@`P"$`` (@`` ` `! 8 @ (@@+@` @``&`  &@Hp@ `> &`&` 8 @ (@)+@` @``&` &@`&` Hp@ #$ `&`&` Hp@?㿘Ho4(@ f`3@`" Hp@ 0$?`&` & ` & `  & ` & ` & `& &@&`&`&`&` &`&`Hp@ 㿘Ho(@fE6 0$@.$@  @ @  @ m  @  &  Y @    & &@֢@ & $@& & Hp@  Ho%4(@ f&?  )"  "( "  @8` ` 82a (@*( ` " " Hp@  " 㿘`$R HoeG(@`C> && & Hp@& ` @ @  m   @  & &@ڲ&@fv $B Ho%4(@ f@ 1`"`!   `$` !#@ 4  @" " "@ `" `" " Hp@ " "" Hp@ >`0`,` `  @iϞ@ ,` ` `@i@@ ,`$`   a@q@  @,H`    >%a?㿘``,``  @j`@iO? @j/ 㿘``,``  @j`@i#? @j 㿘,``  @j`?@hĖ @i > c@2"@2㿘 2   : V`" 4@ 4*V 㿘        V "V 4V V@怦2 4V`2 42 4 " 4㿘> c@```:`  4  `@8 ``2`㿘> c@   @:  `$``4@ 8`$  2 | 㿘> c@   @:  `(``4@ 8`(  2 |ٓ!㿘`7 + 3 "+ #"2 < ! !-`($     *( *R @2 4 0` 4 @ * [  @@0 `0 0㿘!> #@> 8> =0 > D`h  `@~$#@#@> ?> ;c|  `$#@``"`@``: ` ` 4@`8 ``2`> `  > cD> > b, @!> w (">z+b1> w>!cz%" {!{ 㿘Ho4> (@g> c@`> ``: ` ,` 4@`8 ,``2`> H` Hp@> 8 b@* @  * ? ? ` 2  ꀠ`"2 (0``* 2 쀠 㿘א?* *  @@0`0`> > a㰂#@`1 > #> :a !# > > w c    `(`0`0`  @@*0쀣`    *`*` @@``) (``?> 㔀`> w \`@*`*` @@`(`2 ```) 0@耢`䀠@ :䀢 "`2` #@`҃*` 㔇) `?*`*` `0 ` ` "  T` 2 ` X(`(` 0" T % `*" `$   8 "@ `!   @" `5 ` @`2 `  @ ڒ   @   @    @ " ! 8 8` @ @ :"  "@" `  "@`   @`" " ` `` \@"  @   @     @ `"  ` \@"    !  @ L @ 㿘> ߒ@ (V  > > ߐ 8@X > ߟ@   > ߟ@  > ߔ @@! `2  (`2 @ L> ߟ@" X P> ߟ@# T> ߟ@#H D H> ߟ@#` ` \> ߟ@#  > ߟ@!(  > ߟ@!h $ &> ߟ@! :> > ߐ!П@ , 0> ߟ@"@ 4 8> ߟ@"p < 8> ߟ@" ;> ߟ@" 㿘``?  6 `c` ,6 h & @   ` @& > > > ߐ c%#㿘 2 0$>  \@  @ L@즒   ```   @ @엔  2  @쎔 #㿘'H`.&(> H  H0 H @ h$'H&> s `> n @k (> h "" "  @ " 2   `( ` ` ` ` ` ` ` ` `$ * <㿘 \"   ` ` ` \ & L6 ` D`>  @ L@ H & L6   X @(`(` ( > "0 ! x㿘V > (`H@`0` ``"> !d@ 㿘 Ho&(@ Hp@g 0㿘Ho&(@gHp@㿘`2`$ ` `"& \@2&G` `  gU@ `  @& `2 &㿘Ho&4 (@g > @ !d` .`> H@`0`Hp@  @2 "" "  " 2   `( ` ` ` ` ` ` ` ` `$ * <㿘?[Ho$;(@Ӓ > C `, , > &@@ b0(`"ǐ && @Hp@  @ &@& 6 ( @@`$& X& L& T& D& H& `& \gĀHp@  n  >  Hp@㿘Ho&4 (@g > @ !dm` .`> H@`0`Hp@  2 "" 2 " 㿘   @    :   $@  ` "2LT $V   2]  @$  & C  @@$"6 @ @eɔ $Ho&4 \(@g \ $\$ \\$` `` @4Hp@ @$$ $$ $o    @@$f@`$ $k & G 0㿐`'H` H '􀦠bH H  `b&` KH `@@ @&`eV $Ho&4 \(@g \ &`\`$ \`\&`` `` @6`Hp@B` H@ 'H @B& @B$D LT $@ @"  7 &` (pa&` &`  H 8&`  H`d@ †` H@ 'H @> !0'H 0`l` > !>  >  >` 㿘` "L  @ @ ` @ @ @`"@ <@`" 4 `  @$`  @$ ` @$`b  '` `&  @$ ` ` @&` `2 `2@ &@ ڐ .>` 㿘`@> @4V   @& &  `5 @&  ) `"? 6 c6 d6 , & 6 2@&& & @&!H 㿘   @Ô > a> > #>9a 㿘> 1> 'b0#> 8e\"b\֖ <"Ð`Ā@"1> !d㿐> 8b@@@!>    !d!#\> a!d#> .c> 'b!d> wc> b 0> '> 'a2     #\ `   > >Ð#sb`> j!h㿘 e  @  *` $@&@T`X h @ ``  @*$@$ ` 4@* $8`@ cϔ@@ "#T` @`` $($&8$`   ` 4%   $@$ ֐$`  `2$@ 7 ܰ 7 7 㿘;`=>  0>  @: &@ '>  @&@` 2  >    @8 @  &!> !> !!㿐('    `$ H$  '> `   ? (` @@$@$  @$  &@`$ؤ@ @$ $@  ( ` բ(b&@? 㿘 `1`E! @@A` @G&@ @``  @ bŔ` &@$`  @`h&  @& >` @0``S $@%  @ @  @ L@@@ @&@ʰ`  @@$ V   @   .  `$` `? 4` c`4` b , & 6 `2 `@$`2 `"$@Ԑ ͐ E``2 0㿘`G ``^> T`? [`(   '  `M`  `@$ |$ ``$@Hof*(@"Hp@ ` @`@ $`b    $`$`,4 $` x `@a $``@` $`4`$``$`\gHp@ <"Y "@"  `@2  @ "  @ 20 @  2 "  @㿘  " 6  o6&   26 㿘 @@2 ?"6 o    6 & 㿘` `4ޒ o " 2 2 㿘     af 㿘``!   "$ @6 @`ޒ  2 "&   @6 @`  㿘 'HH      \@ H@ `?@< @8C@`2|V V j  @   `ss& `2H & &'H ``H& @8  @ C F&@>T  7 `  ``]`+ &` `H`@  @`& `  ^` @&`  `&@&'HL      ܰ i` ") `H`@C@  @*@@"@  H`\@ @& s'H͐ϐ @    @&  `a`> "x㿘Ho 4 (@a ` 9`  % >`0    Hp@ `""  ` " " $`" $"  4`(" L` ` 2 8`  ,`" 0 ?@2 8 "    4`(P2" P2@ 㿘 < @ T= 㿘> 7cP>  @bܒc >`0    㿘> 7cP>  @bƒcp p` ~&`P6`6 & L    ` V 2`" 8@`㿐> 7cP' L>  @bc8`   0 " Ȑ +@`6 48` 2h`hl` hpq `   8``<  `"* X@  > > >  b˔$倈   (> @ B   2 (      ! 4H`  $@* ր @6 '  M G  @$@  @   @$$` @-%  ߀$`  $P``"  @$$`"L $$%$    `    H 4 $$H/(  ^5`@ `2(2%`" "  (6  `    ' e ` `@4Ӧ a܀2D̀ Ҕ B `    ' KX%@ > >  b$㿘 a PP @`㿘 aF @  ` @ 㿐 ` @V + `R - N 9`|Q  >`L  `H>`0`@B 7 `5(`6 ``>`6`Ho`4 L(@a L`";`P Hp@``)6` `6  ` >`0 ` a% #  e6 @E` 2 0`e6` `2Ǡ `  ";` +@- "`Ǡ `"+`ʠ #@ Ho 4 L(@a L`j Hp@  `6  eC6 06 `"` -`" 9> `& L&`P& X & \& h & l p>l~a`e  i `a6 b6`& l& h㿘'P?c@ ` `` @P"#1"h@ *Q*>`0`9 "  `( @ '4  1!"@ |#4Ӱ *հ  ` !?cÂ"4  ` `` @P#2 *@` 2 *`" *`" *" *``oP  `@` "k U2  `2r  @   j 7@ p 2e 7$ ̂(@4 2Z * ? `(U `8'@  ;  E 2> *N">  `28 `Pc4/ >6   ߰ 2d  \$  ȀU$ ؀` 2  @ ` 2  7 @  2 7D$ B4 `  @6 `L A6 Ho(@g@  `=6        ???????%4%%%% %%%%% %$%(%,`%0 & 6 Hp@` ` ```@@ ΐ@ M0 c6  㿘` `` `  >`0`    㿘> 7cP > @^Mc `" ` `@ S  P f@  L`` @ | ]1> #㿐> #\#> !c   `4R``( `#> 8> 8cd"`8> 8c"`8Ho4 ,(@g ,"` 4! ,`1 4Hp@ ct"`8㿘 L` - P`Ho )(@ >`0     `"- `(> 8@4> 8c@&6 4Hp@a >`0     `6  4`(````! 4" `" `8 ?@2 `8 " ` 2 ,`  `  ,`" ` 0    㿘Ho (@a  `  Hp@㿘>`0`ic`_T@ )?Ho (@a > ݐ#  2" " " " $ 6 2` 4 ``$!`  @$!`` $! ``$!`4$ $!@ 2  Hp@&@`4 Hp@ +㿘?c@ `  *`` @    " p4 "kV >"fV _"aV  *!&?"   #> '&` b`@ܐ$b@ƾ> '`[b$ &Ð Yk"L V @&*@%ń "   `  V  `&"' &     @&V ` &   ؐ @z& Ȑ @u&  @p&  8 6 8i& `e *`a]``YPP#lHo 4 (@a &` ` X8@Hp@ 7& P`"  L. -GV  `2 >  9  &` X  &㿘Ho (@a L <6 8 Hp@㿀'H'X` 'H 2'X  a2d& d2 '' ' `"` # 6 Ho`4 L(@a L `ע  " 8`>  8`"m `@`  @> ` ``T``"R H`  g H @'` `(8`ր8 "`a2b2`" ``` `O 2`` `" ` >`0  @ @C2X`X@@  `2  `6  `6 Hp@0``"``2{@`2T` 2 ` 2ߪ 9`! ؀!hԪ # `;6 @ Hp@ ", 00`"# >``0`     2~` ''(8``I 䀠q(`0``>   H6 D ?` @耠`=$&` "Y`} H`  @`& H5`` `"5` `(8``2䀠2+`   H6 à23`!ł$Hp@`N2'Ho`(@a$` ``2"O @ `π` ` ʀ`ǀ` 8`À` ` `@ 2'  ` `    ` ` $` $`  @ & r& @y'쀤`2` ` 6 Hp@ ` @& T```"  ` @&  & ```L & 耠`" @@& $@ 2L> ' " 1/& *26 :1 * @"* 8&`"` `" 8 ͐ `>`0`   " # `  } '@`"  ` `'.`(8`8`  ` @& T```"  ` @&  & ``"@`L & @& $`$@ `` "' `\'`2  '` `Tk`` @& T```"  ` @&  & ``2`LH`p @@& $@ '@ Y0S2@q` &  ]6 0 `  `6 Hp@( 0>& & ;& 6 ]08  @ L`&퀥`& Ӑ# 6 ]0#& `"a& `` Đ#X&  `@6 > >  b0"us6 8> #Hn #& A& > >  bh#q㿀 'P` 'H@    U``` P   {` `.  `   ` ``'耠`@?`''''P'` ``b #PԲ 55Ho 4(@az8 ~2) ` " H2!Ԁ`2ԃHp@ 9(@5`5\5P`F @#@4쀠2$"  Hp@հ (%  `@ @<`9 @ ̀ ǀHp@!P`|  ͒  쀤~g  V( `xP`Ӏ ($@K\$ %@P @ `C 耠`P`0``5Ho (@ag P`H>`0`Hp@` 5 'P  `8 ` C `ƀŀ`P` 쯒 " "  g4$@P`  @$  `ɀX ` Pq -?5; ؀@2d`Z5@?5Hp@ "iP8o @} "^PO8`> b,( @ )$ `q` `l`g` Hp@ 'Hp@ 58Hp@5[0Hp@ #㿘Ho (@a >`0`   Hp@㿘 ` -Ho (@ ` `  8Hp@a `  >Ő 2 8 >`0   0ޝ㿘Ho 4 (@a `h2   `   5>`0`   Hp@ > #㿘Ho`4 (@a `2O  `7  `"Y `b `"  a(>  6c'> '(0` TV !\ "  `> `0    " `7`86 Hp@@    "  @   >`0    Р  2  > # 4`(Ho4 (@g 쀠2  @2  ?"  쀠`"  Hp@1 Hp@!  4`(Ho4 (@g 2  @2  ?"  `"  Hp@1 Hp@!  `2 `   "0   202 ( , , ,? @" (" " ,"  00!  (`> 8c@0 (`@*`"  @    㿘> b0`P`L. .  d@$@ %'> w!> !d P d* * @ @ L@ '> w.  d@ !> !d P d* * @~ L@ $XX$X㿘 Ȱ 7 㿘 "(& $&   @&P` `"    @&  & `L &  2  `"& $& 㿘``h >  # u  `(    ( `  Q& `$ $ $r 㿘    `$ L  8V  @&R ``"   @&  &  ` L & H&@` " &  `2+& R ``"   @&  &  ` L & ) 2 &  "& $`"& $">  "  2& $&  @" "  &R ``"   @& ې 㿘 k> ` @`    ! 4D ? #@`I  @&P``"!  @& !& `"L& `2 @&P``"!  @& !& `2L $`"&  `& & $   #@&  $`2 `& Նh 㿘``$&` 2 &``&`(`6 2`(&`, @`  0 &``&`(`6 0`(&`, @` > = 㿘 4`" >  `2`26>  `2+>  ` >  ` $` > > >  `0PZ#:>  `0T#C> >  `0M#B> >  `0F#A> >  `0?#@> >  `0p8#?㿘& & 㿘 ް 7  `ْ  7`$`̀`$` $``؀`2`Ȃ($``Ȁ@ $`؁㿘`J `` ` @`"f $@`mP`V`"] $" & `2&"0&& ` @&V```"  ` @&  a& ```L& `@&@6``2``"91> @68&VV`2& `` O @ `  @& ` &V`` `  ` @& @"@j˲& & $P`y `N   P`5`"- @"R``"   @"  a" `2$L""" $!` "`2``2`F@̈́2P" "2!" $`4 @"R``"   @"  a" `2L $`""  `" $` "`2``2`@"  $`2 `" 㿘  $   & $> > >  `0"2` $20` `2Ξ@@>؁b" $㿘V`(`4` 6`4b2D<@B VL6`4㿘>  4a  4` `@6 4@? aW` " 4` 6 4 4 6``@> @?2 4 a(>1b` ` 2 @ `2 @㿘  6h0V 6 㿘  6`8U6 㿘> 7cP>  @PԒa@!> "0 P d(`(`"@Ð" L@(U4 U0U2) @S />  {㴰 "L @ 6< 66 & 6 6& <&!&!&!&! &!> @6 6  /& ̠@ & 6 & & 6 \ >`0`     `U6 @6 |. 㿘  {``6 k Um 6`S# X`6Tד 㿘@ `v>    @   ! 4X@   a  @`$` @L "$C$@  @&P``"!  @& !& `"L& `2 @&P``"!  @& !& `" $L&  $`"&  `& & $ @ 0 ۆ!0  "㿐` '`Kd   `82 ,KX `2`>  aP㿘 @`@ ``  @-    ` )m `0㿘P R ` && `"  㿘` g`@   堒  .( `䫰 7 $ J $@ (@䙐㿐 @ ( d  9 ` W` JǤ    ` Om  `    ``>)0㿐 @u "` J  `" ` `(1  `    ``ܰހ`㿈 @'7 7` `5`JQ  "``(`̖ ` `쀢" `" ` 'J8` "` `  'J 㿐 @ -`h  ` `  䜒 ``   7`  I`  `$ ``(`G ` j   ( `݀  7f ` 㿐 @ ``( ` >` ''  ''''''''؀```  '؂@`'؈   `82 , 􀠠`(#\ `؀@ #` `ؐ c؂$'`% "' '耢 IP O `8 ,`耦 &I<  ; `' `"!쀦`n ` @` &`I @`$@I$&`0@8`0 H8`@C9 H  `  "쀢 |m`2^ ̒ ,  xȔJR$  J j}`"`2` $ B  `> waPup` H  ```` `@'? ''''ԁ'؝8`ܔ H 耢 (1`'@'Ö "` *Hf @' ꀤ`'HY *  `'̦h ' O  '''''''؀`'`2  ',؂`('؈ @`  ``8"`,`2 `> ǒaP`"'  `  qԖ  ``8 `,`$`(ؔȖ Ś $؀@?  # 0ƀ "#  ,  PȔH$' 8 @9 8P8`@C:P  ڐ2Ӏ :g ̀8`ܔ G 耢 (`@''- *Gd `*  p````` @''؂ ''''''ԁ㿈 `, v M ! 0` 0 > 8`@ `@`2  `(, , ` && BS x@`` 찒 "@``谒  쀢 b]`, +  耢 J ' 0`> 80` @ ` `(  C0`0  ` `('ఒ +``!` F   , , `( , , ` y谒 "` ːv'Đo'0㿐 @9 ``( ` ֒㿐 @! "``,   `82 ,`('߿ ` `2``> ܒaP㿈`` `F   C`@ ;Ho4  ((@a ( `  2(T 2>  6a`T 2`0 8(`2*4 8 ` "!P "T 2Hp@ `$ Q`2 8 @? 5 5 @4 84 80(`24 8   a`` ,` , J ْ  0  `0> 8@ `  `($ Ғ 2``` ` ,`o` ,0, , ` &&  6N6 0x> ސ!h㿐 @' ( aa* % `  8(4 80`Hp@ 4  `3  ?ީ?" ``  2 ``8`,` 2  a( ` ހ $q``> aPdHo`4 > (@a (>  6ap(0!`  8`(O " 0t,h@l,@㿘 /?c"& P`2 ` (@2`20`$  `$@2   ۄ > >`ؒb   , R `" ,> ` `" ,  ` >  >ԁc` 㿘+> `x`'> Ȃ #> %`x H$` ,$ , 2 ,Ȁ => 8>c0$ ,`$` ,T $ , ",` ,2 "2 "T $ , (" @2 `"P  2 ,``2> bĒ &*  Ȁ? ? 2 ,`2 #@ ``  ? R `  ( ";<    &%`x㿐 ````?c"@  @2 +> `> 'b0`@   ,  `    D: (ݖ  `e  D-  |$  ߔ  $@V& @`   @"G@"CP `"CDo ` ` `1%` D]O' נ? `DH  `  `%`0q @ 70l i  㿐 >@`0``0 0`8E`-  } `` `B w "9`@ 'R `` ( 4` ``@Bu` 뀥`  , `'$]4`Đ , `ܐ ,  ( `Ԑ , 7  `@(` 2`C     ,`ò?<`/ (` ,` , "Ҳ  ,C( '@&   >  '` ``#`C '@&   `P@``"  `@ x@㿘 -& R```r$ n @`"> `"> @2  &  2  $  ~!x㿘4 8 ` $  n 㿘VV@ @ )` R```> V!    P` `# /` `iu`j  @ h  D '܂?'''''@ `4` &@(7 ` @? `|` =TT@ ) ` 8``ް = ٰ =`   沖 Ô&  ` & @& $@4& ` & (  % $`% $(% % (c* 㿘 `" `|@) &  `"   9 6  | `ک > ` Q ́M  `@` ``h8  `4 / ` @< h/ ݢ   j`A$  `(@ ?''''''@[ Ā @?Ȁ@'u@))X 0 R@)0H@t 'H(Ȃ8a'L@>ذ $" |$` ` $ @$$@4$@?$(㿘 Ȁ` ` !> 8> 8c#  <    7 "$  껐 4> 8> 8c 㿘` ( @ ` `2 &``.`> ڐ!>`  - ːƐ - `"  ݀`  倧 x ހ V```> !  (`8```> ! 5   &HV`j`"i ?& 2 4> |$ ` | 4 &0 8&40> >( & `"L& ` &   A `  `"?& ``";& ` &   `@  `"``2`  > 8& c @{ p l 8ho d ƒ^XRP  ?@&H C  0  @ $ 0 , @  $ ,1 > !˒ *X `"7   ` `"  "L   8`     > 8c`I D 7) @ Ϣ@ &`'8`,`  0`! &   , 0` Ȃ  &  o `,@ @ 2  9 `ﵔ 2ܸ  ` U  㿐> !%> `H#\> !hp> " > "H (> "h㿘> 7cP > @C ` `9  0` 8 > >  b ` 8 C?89 `b9   $? $ $ @& & $> b> 88@c:  $?"   $ @& & $> `    @" > "> `> 㿘 0`3> Hod (@ 0a > b I  0aHp@ 0b  0 }& 0e0 0d  4" 0> >  b$Ho4?Ȃ(@e?Ȑ d@<H  0h@? Hp@㿘> 7cP>  @BQ` 0` >  0` 0$ 0@X~"㿘> 7cP>  @B5` 0` >  0` 0`$ 0@<b# 0`" 0@=h@㿐> c@#> ' ` '> '` 8`@D @! d$> ,`4` b  0(( @ @@ d> a4*`*` d@8> d  d #> ``> &fa$`> a@Ґ`*$``?#\   !> $`!@ > x_c@!@xX `> ``` ` ` @ `> < 0`@8`(`4  @> 8`  @> $ a@> $> b 㿘> 7cP > @A` t` 8`M>  0`D!P c!> # !Pc!> # `0>     ? @& & > `> a8@  8`@ 9  8> 8@!`#a8#a8@ ) 1> u!@> #`~#> >  bH 㿘Ho$4 H(@e H` 8`>  0 0h& 0 0hY `> a(`@ 0`"  0& 0 @ d@Ɛ H`&  8> b> ``8 > "8 @ 8` ;` > `&  $ & $ 0?c& 0@ &> `C 0@FHp@ 0`H >  8> b> ``8 > "8 @ 8` ^;`!"> ` 0`2F@& `> & $` 0#` 0a,& (?c& 0@> `E  0@ 0(& 0EHp@  ` 8 > b`> 8 C 9 ` 8`@9  0`"& @`&& @ $#@& $> 0`{& (n> k!"2> 8!">  t`2M 8 0@0u ^  #`> >  bH~" 0(& 0EG @  d0㿘> 7cP>  @@` 0aZ>  0 pa$ 0 " ) `> a$`@ 01 @5> ``  0 0  0@2) ( @9  0`@ 0` 0@($ 0D 0 $ 0 0 ($ 0@> @9 (}#㿘 0` 0`& 0Ho$((@@Hp@>`0`ഄ F> ]`H ((> \ aT 0$ 0 0a$ 0Re0`㿘 L``8@$`<`0d"0l 0C M `0`"`0@($`0Dm㿘Hod> (@e> > 6 5 89 ) @  %> '/> $%@> & a@{> `&> -> b%> ``@7  @ d@ِw  `8`""` `8`$"S`> D"`8`)"#` Hp@` @`8``8`> `@0Հ@1> > ""` &"E7 `8`` @"Hp@@> 㿘/> 8 `` 'D-> '> b #> 8Hod (@e O> `> ``8 &` "`> C"`> a8 > > a```-> '(@> 0`88`B4  @8``  t < @+ d@   ````%> r@ f!P> c!$ 0$ a,$ (?$ <@$ DD` 2@< < D@D@`d  > 8##$   > `!#@8` $ Hp@@}> `> b8 4z> s> t> 0ncĀ`|P$c` D 8`> > `  DE Hp@ 8t n84@8`^> M> > %> `8`4 `2B> ?> ` @ d@e`8`)> `@8`#> > 8 0$ h$ $ 0u > 8> b@*@@Hp@q<Hp@ !> !c!@$cD> { 㿘    " >  `( dH)@ 0h9 > Hp@ =Ho$4?Ȃ(@e?Ȓ@  0` 0@& 0CHp@ ݰ   @@9 @ 0` & 0@SHp@㿘   0a#  4`" | P  2  x@: x@:  4`2 P |` 0 > @ @" 0 ( 8`C @9 (@79 8>`0`ఄ ఝ㿘`\ $`  " " ۑ.@ 㿘 'ȑ㿈 > 'b(F` @7` i`耠' a@@ *    S V;@. N? >@ $?,  0h 0& @2`>  @2i>  0 `D: " 0" L> > b "  ( 8`C @9 (@7?9 8>`0`ఄ ?.$0< >  ` (8@`>(C >8<`0 t@"0@ @ 9  x#`8#`< `H< ! t@ 8`x`@@ܠ @" > > >  b0z;""쀠X > >  bPz."#㿘> '> c4 ?> a"!>  H$!8$!8$!8A $!8㿘 d4`"Z|P 0@ `2 >  $`@U`"I p @9 > `` `0`C @8` 8`0 0 0?ނb& 0Ho$(@e">`0`ഄ  p` pHp@ 0@& 0@6x `|@C `@9 p 0`g 㿈>`0`> (@e> > Τ`> '> b> > 7> /> a )8`~ Ai  8`"ѐ@6Hp@ 0he 0`"s>  `5 0@1``- @ ' 0@$ 0Hod4`(@e`  8`8C <` 8@ <$ `$ $` @%`xॐ  @0` Hod(@e"8`@ ;Hod4(@ex@ h0~x `Ho(@e 0 `" 0Hp@㿘 H`t t`y> HoM(@ x& t& x& |>  8a88 R>  ` ,@D@ې ",> 0`2G> @_ 0 @=  8`8@D 8`4,@ @Hp@,@D@ֲ 20> > >  `xv!Be>  x& t& x& |a 888 > Ӏ>  > >  `xW!C> > >  `xO!7> >  `xH!8㿘 8@ H@@Ti"@& 8㿘 0`>>  H`A> Ho$((@ P"- T T T T? @& P& T> ``p@8`p H 8& H@TB 0> mU!@Hp@e P2 T T> bH P> >  `0w!>  `Pw!㿘> 7cP > @9^b@ H` >  P"i T T T T? @& P& T> ``p@8`p`H@8`H 0 )& 0> "Lb, P> )> "D > !> "0ah#> "0b(`$"0$b( ? "D "0k>  8`8@`"& H '>B x, t@C @Ò ) 8` ,@` 8 8@@8 x& H> ``H@8`H 0 )& 0> bH P``p@8`p@!"L> > >  `w` 㿐> B> bDbD> ` #\5>  &L#`L ?@v? L6 > `  > 8`h8`p> 1> !","4 bP@} > v!x㿘 0`> Ho$(@e 0`& 03Hp@> >  `0w Q㿘> a @(@@J>  t`M>  H`O> Hod$(@> b D)8b !> "P@-  > ``"P4@@C 8`& 8& t> xHp@e> b D8b > !> > > >  `v!%> >  `v!>  `v! `v!㿘Hod4 H(@e H  & H 0`P>  8@R t`  J 0`#& H 0> & 0 0> @& 0bDbD.& P> bD P T#bD& T p@9 pHp@  P) T> TbD T @?& P& T>  p@9 p 0@& 0bD& P P#  H@9 HHp@ > bD#  P㿘 0`I>  H9Ho$)(@> ``H> @;`H& PbD`> & T` P!`p0 `@;`p 0 0?c& 0Hp@e H? <"00 0 > > >  `u > >  `u `"0`2, -"`""  "D`   ! !   `K  @"J  !  `2 ` ! ʒ `"`"7 ` ; `!  !   `*#` @"@  ! #``  ``2"``@"#`#`  "!  !   ! "! #```  ``"``"#`#`    "! k#`""`2` "` `w`  "`2R"@ L` `2 "`"` ``R `@ "  `"` ``.  `y"``"`` "` `"` ``` `@ "  "` 2" "`"` ``F `@ "  `"` "" `2` !     `K! @"  !  `` "` `"` ``` `@ "  "` 2"0""" `2` !     `#`@"  #` `s"""㿘`U`2^``2"`""`@"-"`@",`` ` ` ` `""@"  `` ` `  ``2` @"`` ` ` ` `ْ"```"`""`@""`"``  2  `2  @2 0  @ `   2  `2  @2 0  @ `   `" `6  `2㿐> cc> ` > 7c( #\> > "XbH X  k 㿘> 8cȀ"&@ `> `(  "` `, L"`8` `2`(> c `H@8`H&@??K@b> c `@@8`@J`8 @ *`9&@ "1<&&@ > r"P> r"x㿘 0`"U "`    ? @&& > 。  (    Ē ( `  0" 4L > hU"X '@4`2> N 84 N :`.2  N 9`.">  " $! $ $? @& & $"   ? @& & >  > c> c   㿘!> # "!>  (`"`P@ 2 (!> #  (`" `P@   2 (i#e#㿘 " \  > R > ` `& L  & LJ 8J`8" 9">`Ȓ`9㿘     "   㿘  Ր &   8> c<' >`0`&@> 8cȀ"`ĕ(`/ԕ:0"ՒՐ >  0 " 4 L> c `@8`٤?    ? " "> c`" ` ` 0 Lm @.V@& @ 0>  `@2  L @.Ɣ (& Lx> @> c `@8` `@?0 @."@&> c `@8`@.  ?(&`A > c `@8`      ? " " > c`" ` s ` @I  `@" L @-@&> c `(?@8`()S&?(N&> c `@C8`c  @8c >&@> C"@Ð{ L> c ` ?@/8` @0+㿘  $ + `"   `2 &`&`&` &` && & 7 &`&`&`&`$, 㿘> 8cȀ2`.%> '> '䀠> c &> #>  g,bX" 0  L" 4 L(&`,&`(.`8:/>`9 `0   fbXc > p"3> c`&@&`  `$ >  4`"N`8#䀠> c r@ ѐ 4  N`:`. &` &`$ ` > $ > &`&` @ > #`` !# > N`9`.2 #㿘` `` + @ - ; "  " ` <`.`D X`, @$  @ $ 㿘 P`8 \ `=> `D B ` a  0`梄```2ᢄ```{ E  0`VioŐ"㿀   '&`&` &`&`&` &`&`` "  <``E n@ <@P@a`8?&'`D <@>@  @,P ? " @&` >`%>` >````` @D '<@tK@#\#`[  <<@b耢@  @, " &`  >`>`>`>`O>` >` <` < @ <@  @2@`< @ <@2>``E 2#\@2#\쀤$#\ܔ  (`@, ")`` 8 +` <#\#`2j0Ɩ #\#` ۚ`&` E `>`  : +>` >` "   `"  8@ `2 @     P`` > 8 c 8   @`@" "  ?`2  㿘 @d" >  d#>b㿘 >`0W` 4`"? | 8h*a.a& 8 h " ~ |@     | @2 4 42"@ 8 h 2 | ~& 8@ b& 8  >  6y " 8  @ 2 8@'a  8> n("㿐$   > > #c > 7c(fu#\@> 8c> 8 c  @ `@ $8$㿘 $2,0  00  @? ,4< 0 $,0& ( @? , 04+  $2,㿘' `Q` `  & D'2  "  `  7)#@4   I@ 0@ O@ }}= 8 ‚ & @  ̀2   ր@ ӀրҰ   @   2  ( рʀ   @ >B     "@ > m5#(逢@ > •%   # > † 02 Ԁ0ŀ08t2 Ȁ2ހ >  㿐 '@ `V `    2T  㿘   6`6` >@   @ ` >` 8&` 2 &`&` 6` 㿘 4B 1> " bA `㿘8 ` ` > !  `c' " 4  > 9`( 0> 9`㿘 `@ "  `"#  4Ւ * @`&` @< ` $& C?$ ,> $ $$ (@ 2 `&` @> `2 4 &` C?& > 㿐 @ '>a } Q  , `   @8`  @8` ' ` e А  @"    `    @:  㿐V  `)> 9;> 9`   ,( "W' m @"`@  ` X t@@  `@  @`  " (V %  (& & ,& 0 @$ (`3    , 0 0 0 @& ?& ,& 0  (J6 6 > a  Ƙ    * @ɠ #0` @& V `j 1  0`"  @&   @9 o0V `":Q  $ 2 ,:` 0 0 @ (" " 0" , @ ,$ +& ( , 0 (Q V I  "7 @ 0c& !  @8`'4 `2 $-`  @ '& [ }` Q `21   ʐ @ & @8`< 0%㿘W`>`0`B\=@ ;?` ?@@41 Q@`Q `` >` M `@> > & & `& 6 & $ $6& (? & 8  & "@ C` @4& 8ސ``Ē 4ϐ8ݴ   7`㿐> 7c(> #\ `>  @c@  bΘ 㿘@,&@'`H`us@%  "@`4`"%`? 6 /`@`T?@M&@@& `@"> j(# P`$ݰ @ ؐ@@ Аˀ 2`P`$  `@ʰ 0"P`$@& > i#H> i#`> i#㿈 , (8  0` `'耠: (`5 b& & '@+@& ,@&` & @  & #& H`/? ,c @& ,H` `?@& , @@`& ,?c @& ,@(? @`\@"& `8`a?`P@ `@ >@& @`\@"& `8` ,a"'?c @& & ,& @$ 2  D ,?c @& ,   & D @& & I2 @& , `4```| a@ W`4` ,```@@2  @2 @2f   @& < <& DI`"f& @`/bH`G`/ & @`\ ?@ "& H`/" , @#& & & ,H`V`@?߂c @ @`W& ,I `.T?I`.P?@P& , @% ` @28 @ ,& 2 & & @ ,@"   (`쀡  @2~& 耠`v ,`"J 2@@c @& ,] ," ˲    @@P@` '@ & H`/"  & < @& `4`q H`2& D  2 ,耠`e  , & @& ,@6_&  @% 0Y`J?R ,L 쀠`3   P`$2- B @& 0>@$    @   ,@耠` `P`$ 耠`q  P`$l    @ & & @ @& ,> h#p 0 (`{& 4y>  (%>  ,`dW `"\ 8$%  `2D 8 `"?  0 `8O ,V , 8 @@8& $H`/ !`/ @(H& $ `& J@`/"  "4 U 2R  8 > ]># 8> ]8#& )>  ^(# `& 8 8$$  8 0`,> g#  ,@G 8 > `/@ P`z> & <&  2o 8 ,s`@@"G  $n& $ `:]  0  4' $'''''''''@#Œ ^ࠤd  cb( 8 % 8\ʐ& 8  @@ N&  8J@`/ @  @ 8 8(@ @#Ք $!& (V 8> `\W& `2b 8 ( 4`2] 8@ΐ 8@ʐ 8 8> \#0[ \#0WS& , >)>  8\#@  @  H&  )> \v# 8  ?> f#fސ#`"1 `2--" `"" "D`   ! !  `K  @"J !  `2  ` ! ɒ `"` "7 `  ";@#  !!  `*#` @"? ! #`` ``1"`@@"#@#`   "!  !  ! "! #``  ``"`@"#@#`   "! k#`"" `2`  "` `w`  " `2R" @ L@  `2 "` "@ ``R `@ " @"` ` `.  `y"` `"`` "` `"` ``` `@ " "` 2"  "` "` ``F `@ " `"` "" `2` !    `K! @" ! @` "` `"@ ``` `@ " "` 2" 0"""  `2`  !    `#`@" #` `s"""㿘@M` 2V``2   "`""@@") "` @"(@@9`9 `""@" @` ` ` ``2`@"@@9`9 `ݒ"``` "`""@@""@"``   2`2 @2 0  @ `  2  `2  @20 @ `   `" `6 `2 ` ?   @8 00㿘     "ڐ  㿘  Ȑ &  㿘  $ + `"  `2 &`&`&@ &` &&& Z &`&`&@&` $O  @ > a$a$ "  "  @2 2㿐 > ]`H%> w`& (`& ``` 4``> $'?c('$`@ `'  4`& ???" `"" " D" H" @" <" 8" 4" 0" ," L" (" " " " " : P:  P` ` \ ` ` ` @?" `" \` " P``" \` \ `"``" ` D`  H <` T" X X X X T @?" T" X> ," X @  H" H" H> a T㿘  P@\@    P@"\ 2P㿈>'''`۔@ . : > @`?(`2| " | @24@ 2"  |` `8h@ | 24`42`"  㿘 $  (`@``" `@ " $ ` $ 2`"  -> aĒ 4`    㿘`  `@i 0@x0p> P> H> `& l&> @& h > X!\ Z  Z!WtaD!T l㿈 $  " > >  ƀP    > ƀ  4 @ H 8 P;`#\> ƀ! X ` h#\> ƀ!H    > ƀ!p p > ƀ! x > ƀ!Ȓ  !> ƀ!> ƀ"  % > > b0(> *`ƀ \ "'> @ " \ \`< @ ƀ \ '> ƀЀ`'> ƀ"8  > *> `P> bHƀ \  \` @p ƀ \ 2 \ƀЁƀ \ƀ \㿀 D 0    , 4#\> b#h#`#d#l> ƀ"X L 8 < @ ( H  > #\#`#dƀ#X    > ƀ#`@㿐 > 〢c*> 9a@ 4> 〣 c+ > 9ad@ P |> #\ƀ#  < @ H p> ƀ (`(> ƀ h h "> >  xƀ  > ƀ  l >  xƀ  㿘%> 8 % `  @ 2  `  $@`  `&` `2`> 8 c܁  㿘 `'> 8cc  "  @d    > 8#܀4!#$ `(` @> `f > 8㿘> 7cP >  @"bP !Pc!     @& ?&  0`2 D D h@`& @  $@& ` l 4``" |> 9a@ W@ l`2@ t$ D x x x? @$ t$ x> 9aȅ08`> 9a@ ޒ㿘> 7cP>  @"b``> &` 4`?&`D h`&` h` & h h&` |` &`D` 㿘 H& D`& H <` T" X X X X T @?& T& X> & X @ > a0 T> `{ 㿘> 7cP > @"3bx (!P c!     @& ?& D"& l`"t&   Dx! xx? @ t x& > `D 㿘 < >  4`& <`5!> `2! 㿘> 7cP>  @!b`  p p`  D`(R$ D " p㿘`5> Ho$(@ >  ֔8 l`Hp@ @ 2Ho$(@ p`>  l`_!HHp@> ` a8%@Ho$4 h(@e h/` `$V``&0`/fː0``80h&03倦` h2 l M`2  2ր`Ȁ $ `  0@&0' " hHp@Hp@@|0Hp@ e >  +8 l`W0red pဠ> _I!`㿘> 7cP > @!b   p & p D`& D& p> _)!x㿘> 7cP >  @ b`  0 a"`pB     @?!P& c!& `&`p`     @` - > `$ > 9>*b(!\㿘>`0`> b @  "c> b'  @a+> 8c @  0 0@`f?" Hod(@e`ŐHp@F   ܀  c > ]Ő!]0 㿘`` @  @.!`@ @ 2 @7 !`` 2`(@`  䀎`I @ !( 2(`   @a 2`.@`  㿘>  a    @ߒ & ``% 㿘 ` @  1Ͱ 㿘\`{`89 d <`: 8@ 1  \X`l 2&\ `@4,`d.  $ , `3>  @ @"  1 1 $`0`4 P $`4 \`/ 2d @4, c@2װ 7԰ 7@2 `"$`@, @`2  7 $b &`0`4͔ P &`4 $b$ $ 㿘 d  $a& $7 $|& $㿐`-\" > 8c2 -2 #\`, `` `> 8 -cܰt 7>  x×ࠀ`> 8c` `@2`   @ ` `2`0ے % $ $$$  $ P> c<' "`4> \5 `4> (``<`@`H> \)!`8`1/`28`2>a2DbJ> `D`2O`2U`[> `8h`> O`2e> ``"i> > \"H@ a> >  @@a`8`΀`>  @@a`8`Ȁa>  @@גa`8a€b>  @@Βa`8b"`D> a@Ŕ @`D``>  @@a`D``>  @@b`D`"`8> b@ @`8hO> b(@ @O`"`> ["8``2> > [ 0/9"H㿘Hod4`<(@ e`<`;> `D9`H"`D`> ,`4`""`T `T"`X  ! Hp@ > a`4`2"`T`"`T`T X!"`XHp@ `T!! "`X\"P>  "h> \ "㿐@ ?(c`@@* @` 􀦀@ `㿘> `0``<``&`<`@`2@f`<``D`r @z > [Ɛ"> "> ["> "> ["㿘 < " 8 & < 8aPa & 8@L@ʐ`2> 5`)@*@2 <  <`& <8> 9c & 02 @ 8& & 8 H`#> 0 ?@Ր& 8"K @Β ? O  > [\#> [Y#([W#@㿘 8a b5> & 8X #   P` 4`(<|< -&4D`+Ho$((@H`v> a@aTcX XX @?&T&Xa`T&T> aT X#a&XHp@eH"<@">`A> `|@` 8h$|@6   | @ 2 442 " > 8w"88 w&8x &|T#a# &X# T 2 w8Z#> Z#p> Z#`>`0`T@㿘 8h% |@ $   |` ` 4 42 <`" 8h2 | < 㿘 <`  㿘@>`0`` 8` "  < @` 4`" < ` " ` 4`   `&`  > 9b& 0w 0㿘> `0+` <`*$ <`  @`) @V @ <`  D` >    > Z#> #> Y#> #> Y#㿘 8a`  b$ 8 > ! "  D <0`(`"&Ho$4 H(@e H`, T"4 X X X X? @$ X?$ T D$ DHp@ <$ <`ϰ @ ʀ <$ <`F" X X X X? @$ T$ X> a0 T> a T㿘 4 `>`0>`>`> @`?(`@@ 2 |3 ( 0 ( | @2 4 4@2 <`A n 2@ `2 ( 4`2 ( @  0 & 0& $ 4 K $ |"  | @@ |  |  | ` | $$@ 8$ 8 8h& 8= Β@㿘> `>`0> `8` v q > w"\'> `"08 !"\!"\Hod4> (@e> ba> aaS 0j h@1 2 T <`{ T n X! X X?  D$ T$ X$ DHp@ 4`q `XHoJ(@ p`2[> Hp@$ 8$ |X$ 4$ $ 0& $ $ <  > w> a,a,"\`Hp@>  O!4" d" "  " `$Hp@>  X P&e p$ T> c H> Xe X> ] > X_ 0X] p㿐?  > 94 &@&@ $ 4 'V&@>`D >`D >aH 㿘 ` 6````` `@0@ . > ʒ`6`㿘> a$>> 0`> > `+   Ғ  @ @+ @ W* @ W!`W٪ 㿘Ho@> W !> bL    "1> 1> V!V!( > @w"0㿐 [> @a$a$@ > a07> 9 y` "%@&@ ``"Vϐ)'P@\ (  ' P@  \ `  <6ƀ%@&@. > b(( ( @f&@ 㿘> 8c`` `.`@c 2`   H"   $ $ @ $ $ $$ ```$` $>( $ $@  /, ! Y u & 㿐> 'b> (> 7 c(> #\!4    > Oab> > > ,!$ , !!$ ` @ 㿘> > a`pHod4 l(@e l *` 0` 0 !`0` 0`4> ՁHp@ @`a00   l` Hp@0Hp@V!H> 9> 9a> b Hod4 D(@ e D t  x! x x @ D??" x" t" D?@4> wbp@ (@@`" t@ t x"@" xHp@ 㿘>  U"㿘 ` P > 9aȐ  `$` ?$`$    @`$`@$`$ 㿐 > 9ذ $   `@> w `4> w"dh#"d> wbl1 0`88"h#blbl#"d"do$ > 9aĀ"d> wbl1 0`88"h#bl> 9aă0"h@8`#bl㿘#> 9a!>    5" " > w` p$aā㿘 <`"(  P `Hod(@  t " x x! x x?  D" t" x" DHp@  " @e t @` 㿘Ho-4> (@n> b >  XbPHp@> 9 > 9a!̃0@8`@  > 9aІ!! aа *.0㿘>`0`> '> 9 b/> > > bP;> w9> 9+> 9-> 94HodԂ(@ebp!Ă$ԇ(@C ) ^ ;Hp@  `@JUHod4(@e" l ېHp@@ ̀`#%̀`" 4~a&w `> " P> T<"> T"4@ (0 0  ("@a0(㿘  R `   (`4"  `" & 㿈@ l "" `" R `"( 4`"  8`2 `? `" ``#`#\bȚ  4`  㿀@ 9 "& `"" R `&(`4`"# `8`2 ```''􀠠? `" #`#\ b `4`  㿈@  "" `" R `"( 4`"  8`2 `? `" ``#`#\c?  4`  㿀@ ϒ "& `"" R `&(`4`"# `8`2 ```''􀠠? `" #`#\ c `4`  @?' @''''' " `H@  `T `<`@Ғ `8h0P@?' @'''''뭐   P ` ```h   `  ` (`4`  `  ''?''''ؐ@`` ??`  @ې8`  @ ؂&'@㿈@``耢 ` 'Ɣ 㿐@`` `  0  `@Ұ #T `2  ( 4`"  `$ ` 4-` `$  @ 2 D`"< & < > @  @< @ D `''''''֐ Ā @bȀ H 'H(Ȃ8a@'L@ذ  ā   ``>a@ `@>a? ''5''''ܰ B`4`,,' 'l'h''p'xh 2|  `4`P 4`"  @" @P6 @D "~@/-t*9> G# @֒9>  GҐ#"@f|Ė@dӶ`@  ?  ` ``>c@ `@?>c?㿐 @# *`(@<`` @  `P`  `$@ @ ` ْ( @  ` `  `"  (`@`4` @Ր  @fڐ?`@ \( @`` 5`(`@͔ P$` ); '> 9a\#?`'''@@ * @$ ` _ڐ``@  s@в?@'?''''``3' )`@r P$`  > 9a\H?P`'T'X'L@@ ϐ12H`H`@  Ls@ܲ?8 ``?(`'''''' )`@ P$` /?쎒 > 9a\H? 'T'X'L@@ }ߐ H`@ c Ls@?2Ԑ۲H㿐`@``` #\㿐`@`#\? (`?2 @ +`(`@ `P``$` 쥐`o'@ $ @  ` Y?!? `?(`''''''> `@ } P$` W Hb`'L@   ` ``>`,@ `@ >`,?( @`* `(`@ C`P``$`  @  ` " 럤  `@  `(ݰ  '`@ аΰ @?' @'''`''  `@ `P$`  _H  `@ L H` 0뿐 '`@ @@?' @'''''n `@ `4`  ` @  ~@| H뇐`?h`@ 㿘>   4` \`` @@ Ԗ @  P@?' D''' '' `&`P  Ġ "@?' D''''' `  `$`$` (i`827, "F``E"R&Y"$@@V?@ ``P$` `@''''@@ iː`ˠ!> Ք  ڐ Ֆ ʐ2``&Y#`2&2@$@`2?&$@$@$``'&&㿐 } `(  ` fF㿈`    @Ӗ?''x`    '؇) )  @@(`''܅+`+` @@ (`'@؁?''P?  `?(`'''''' ā 㿈`   [  ` @`՚?''x` ! C  ') )  @@(`''+`+` @@ (`'@? ?''( ''''''嚐  4`  ''@`'''''''''Є '@@   ` ``>b@ `@`>bܒ?P@?' D'''''[ `@ ?İyā?6  @?`@`''''''= &Ĕ@@ [Ā  2'  p  `8  ,`> ϖ pX`P `@ >`4?  ` ``>`4@ `@ >`4?P? D '''''' $   ``&@ ( 2 @@w  Fb `"  ` " @ ߐ  ` ``>a@ `@ >a?P! '  '''''䓐 8`Ȱ @ Ȁ!4` Ȓ@Δ؁@ᨐ@؁ذ 0?0@ ?>b   ``>b@@ ?>b  %> Bؐ$  g  A԰ ''''''+ Ā`@Ā D AĠHF (8a'L@kǠ  ``>`P@`@ >`P?P5 `@ (`''''''ސ %`4` '܂ '''''ذ Ā`@XĀ @ĝ㿐`@``` #\㿐`@#\??   ''''''㌐ Ā`H@Ā XĐ S0笐  'H(Ȃ8o@'L@0  ``>c@ `@>c?  %  `   '''''ز >'ܰ Ā @ɒȀ)WH_ <`('8'Lݰ  'HȖ@؁ڀ'H 'H  ` ``>`@ `@`>`?p> c<' 榒 " @ -> ؔ T ° F `` ԰  P ` 0 > $($ 0`7!Ѱ#H> c<' e " @ '> ؔ  恰 F `` ԰ Ԕ`@Ԁ ܐ` pװb#X > 'Ь<' ` %  ```@`b , @ >  ̰ @'ݐ0쀌@"@`(@ؔ  Ԁ`Ѐ J0  F`` а ' 4ް -@`װ `bdd 4`Ͱ  @ @ а ԀdРH%'h'l@ Д@k Ԁ` `@` @Ԅ `0`Ԇ 0 > 9bl Ԁ`03 `(7'''` @' 7Ђ ` ` @uР ?  0@ "'v#h!@I nd@ޒ`@0В @P&, , `? 0:7ĝ0> c<@' 2 " @@ -> ?' D'''''] ''''''' P`? P`$n ֐`Ô Ѱ)#x `, 1@"`(``(`( @''''''?O$@ *2/ @W  "@?" Ґ}ߗ$@0 0 > 9bl 04 `(7''' ' 7 ` @ ? 0 @̖ؠ "H0ˀ0"  @`@00`  P$`  4` @Ґ (ܐ'H'L`@] "@U ` % @G'@, , `} }0xpɐ h?j'@7  ` ``> `@ `@`> `?㿐 @ BR ` ( 4`   @$@w`` @@Ѩ  |`  2 |`` `72㿐 Đ  '' ` " w!``r  `h hl!㿘`@r!> a$a$@E`? c@!ﴒ  2`:` 0 $@$ 0 "a@`8&&  ` " $ʀ@ y 㿐 @ (`P    `   0` ` > $($ 0`_e P@?' @'''''Q "ā( P  0` > $($ 0`3㿘> a$   " $   `  퀤@$ $  ` `@ $`@$ $㿐 <`= | ` %> ?> ܀`2 `)!> @``"!> ` @2 $  2 @2`$ 2``2`!>  \$ \0Fϐ#㿘 $F& $    &  $`2  `  A ` "  @"& $> a$0   @"1> @ ?$ $ Y" | ` ` "> Q / ``BB@Ȁ    @>  a$Fb#0P@?' D'''''C ` P` `$" 8R `K   `]<p> 9bh> <' `Ò  ` Z$   D ^>  'd?'8'`'h'@'<8 @ L 8`I 0``@ 7``@გ *}  5 P$```  娚  4`Ȱ 0 { `|Z 龐0# P   $2 `鯰 -0髰 0` @8 2 逍K  @ $ % $i  % $ >߂c  ^ % $` `@ 2 $> a4%  $@"$ |f $@ ?% $) % $% $ 2@  `f01  > `%!$%% !$"!!$ @   @Д $`#  0` ` Ր0" % $ "% P% Ő0@   G> 8c2PM@ 2  |`  0  ڐ"  쟨 $% % >(% $ @Y % ` $` `G% 㿐 0'`` -@㿈 0'''`<` -@㿈 0'?'`$` -@㿈 0'?'`@` -@㿈 0'?'`D` -@㿈 0'?'` ` -@㿈 0'?'`` -@㿈 0'?'`,` -@㿈 0'?'`|` -@㿈 0'?'`T` -@㿈 0'?'`` -@㿀 0'??'`4` -@㿈 0'''`L` -@㿐 0?`` -@㿐 0?`p` -@㿈 0'?'`(` -@㿈 0'''`h` -@㿈 0'''`8` -@㿀 0'??'`l` -@㿈 0'?'`t` -@㿈 0'''`x` -@㿀 0'''''`` -@㿀 0'??'`X` -@㿈 0'''`\` -@㿐 0?` ` -@㿐 0?`0` -@㿐 0?`d` -@㿈 0'''@` -@㿈 0'''`` -@x 0''''?`` -@؁㿐 0'`P` -@㿈 0'''`H` -@㿀 0'''''`` -@㿐 0?``` -@㿐 '`0` -@㿐 '`0` -@`\PD8,  8`" 8㿐 #\ "@ `?>%a| (㿘@"`@> c @b & 8      8aT  >%aH (0`D  &@&` 4` (`>&&` &`(&`0 &`&`>`8&` &`$&`(&`,&`0&`4&`H&`L&`P0 @>`@0ڴ(״ԴѴδ ˴>&c (0 ( 4  (@``V `  b@a@`  `a@`  "&&ؐ` `$ @&㿘 (`4`6  2 2  `P``$`2 #`@>  >@ @&@C >@  ̠  @Ƞ Ơ 㿘 ( 4`@?  `  #@ߒ`@> 4`  `@ Y*@$@@C >@@ 0ٝp\l`?''' '''''d 'h /Ѐ`&/Ѐ`  ` " `׀ 㿘` @& @u`ŖN㿀  ( 7''''7    *`ѓ:`㿘`& 4`    ``   b ` " !&` "&`  !  8꒢  㿘 P`$ 4  8`  (@`&  8` @  2 0 0``wddsbK a@?`@`& (& ,آ f`4\ -Y >@_bd`t`d4`I  D ' =d4`u 08d2Z`.@`&@ & (i&& ,[ ``"$``(``/r$`h` 4} -f  L& , bj'h'`'```( {`$`! Հ`0{&8$` &ʒ `ƒ `:'' 㿘>`0`̻  ?( $&@@ L` 2&@L &@ ` "&圐$?  `@c b ''(b' > c@' '''' Ki@h"X" Ѥ    Ȯ ?''''''' ''`  Ѐ 6 +؈$ $4 ` ;@@ ! 1@"!  p%@&@  @  $  "%@     `"  %@ %@ ђ&㿐\'D''``ސD!D N .D'D` @D4`|`"81`8`;@"P` 'DD "_ޯD " DD'D& "DD 䡐`d 4D!@8`ɐ?+ $D`;:4> 倠`' /(''D@? 4` `z> x`\ ŘѰ ' /(>}#> >z#㿈`@)` "0`@8` s ?',?`#\ 3   $&@(ߐ0DX㿘4`"| `E `((` > ]`L 㿘 -`|> ] `L(( ,`  @㿘 `  D> a `4 @4 ((> \ aT  ` (` >+      c  "          㿘  | `` ((> ] `L " |  |?@`00   (@)y( 㿘  U 㿐`|  @D9  ` 8@`2  (@ @5+` `| ?(`# * E "  '`|`|(` (! > ]`L@ `  `| (@(   8 @  8X `" "`| `8$`d$`8㿘> =<#㿘`4`| (`> =- (`   (`> \ aT     (`> ] `L 㿐 `|    #\  㿘?`|> @ ` 2 <0  8  | ` >%` 㿘  8  | `  ` |  `    }  8  | ` >%`@㿘 | 4` > < ( 8a"R     ܑ  8aA`+ "C > ]5 `L(($@`( $ 8a $@`  @̐ 5  8aЃ5 `(`(`> \ T   `` `"> ]```"> ]` `> ] `  `㿐 | P ` $`y 44`/ > ]`H@j> `$` ,`,`> \ aThݐ ,`,` > \aT@> ca @?*> ]`&> ]> `$  ,`,`> ] `L$< > ]GՐ?  ،  <`0@b &> ],``L,` @$`" 8(` g  @` `$ 8r p `````>``z4``v> ; ``0`"`> ;} P``d ('|> ] `H (> \(T @@` `  `h@  w|`= =`?;| `ؚ@,E4 < @ J v| 8`m`@@aԕ=%%  8`H֔ V` ǀ   | `` ((> ] `L2`@@ C  ?#`#\ ` "|  (  2  @d( ` `2y| "v|"s|m'S> : @㿈  `  ` >4`'` > : `0`"4> : S | `` ((> ] `L Œ` `  ` |> ]`HB` (?? (( , 4` < @ f@@a&@ %8H@@V L ` 2  ) ) > \ @T@` ` `h@  2  ` "   (  2  @d+( ` `2  " " ɒ : : `> 9 p㿘4`M> > `ȃHod4l(@el "!  0` 0 " 0` 0`,> Hp@f0Ԁ` َ l` Hp@ܫ0Hp@ 9    㿘 8 > `& 8 ɖ  8 㿘 `    0@㿘  `04㿘> 9e 㿘  > 9Y!㿘 2 > `8` ? 9H! 㿘>  8|!0㿘 2     㿘 0d 0Ho$ (@Hp@ e0t 2  `` `  c      "    - `|P  > :`H 8  `<  ,   4! ,` 1 4> :`8 8 <ഀ2 @2  ?" ഀ`"༁0  <" `  ?@2  ?(@82  @0` <쀠2 @2  ?" 쀠`"0  <````! 4" `` ?@2  ?(@2 `؀  㿘> 8]!H |> ` `>hb!`㿘> 7! > 7 Ё㿘 |  )'  & | 㿘|   ` ` `#$  `"  `$  `"  `   ˾`$|   `  㿘   @ ` `A|@ 0| `'  S|@0 a `|`  R'Ƞ@  b~@   `2`  `|  S`'ȁ `| SW'Ȁ  㿘  `|#  `2  ?     ` ` ~4 a4 > 7r!㿐  `|0  `#  `"a4      #\V` ``#~4`| ` `#> 77!㿐| u `  ``L$ ` `K :  `   `$ ``  `%  〠`0` $`֐ `Ն!  > %` X`` `i `0` $` `~!  > ` 2``  Ð $|  0   $ & $ 8  "$ $  `` h0|z? $|㿘> 'b> c(( @ @%> #c <@a3@aϒ <.* @a-@aɒ *  @ađ4`> T0c@aa> $ '  `?am:"> 2a (@*  " %> (`'4> c6  , , , &%@`<b.6@8D(` 4> τb ?> `(@"*@> b(@*@> > `((``  `  `*      @@@  .> ) >  (b(  @`  `` (  (㿐  ( 2(.` .`?`t n .   e` `.    ? ` `.n?   >  c(  @ @ .@ 2 `2 +@   `H @S>  c(@ @ .@ 2 `  )  5@ ; _@`  6 ` `..`.@   ..@ "?$ `2 $`2ɠ Ȁ _.@@`v  0 .@_Ґ@ !`2 ` @   @ ~&`@ ~@)(@0`  @ ."`g "C&.@ ` `.2** @ @ ?(  2( "@*@*  * 2*    ((??  ((  `@*   ((??    ((??   ** ܆ *( `@*㿘@ ? ? @??(`(` &@`$? @` 4?@> b(  @ @ @``ݸ ` @`2̰?``2Ȱ?  @  `` `@ ߺ  2?` Һ   "`? `? `a`@?" ` ` (( @@*`?`` @`? (`(`  (`  ` @ *`@ꀢ??`/" ( `֖  (?` (` ` @*``/*(`?? `(`  ` @*``/")? `` `( ```/")?`2??  ?0 (?㿘`?` `. `2?` @] ` 㿘 > &&$@7> ?b 0` w0$!n  `?m> 怉 La !0` O> 怡      @(` (`> !) b ( #c > 'c (`(` d$@]ܠ6` `(`(``!g) 0 @(( @@ (` d@^d&* *  ( @@(`@(`&> b !0`  >  2/!Ȃ @(` (`> !) b ( #c >  b>  c,  $> (3 @ @(`@ @"!  @2$220`" ""     `" `  " "㿘 h`㿘> 9aX  <`> ڐ6 "R$ 2 =&  v!(0㿈 `P$ 0 `` ` `&  4` `2`2& `  h&  0`ݐ@   \  d`  h (`  (`  i(`  j( j0`( l( l0`( n( n0`( p( p0`( r( r0`( t( t0`( hC(` h`: ( h`2 ( h`* ( 4`x: (` 4`x/ `(`m&  r pL  h` m. h0] x y xǃ0` { l j8 i f&  n 0 [  t u㿈 ' 8` h 4`xc   $ >  0ؐ!P @Ţ x@s`>  t?$ t''`d`X@x2@$ x `$$     fB 􀢿 @+? `X$ 0$ `E`x2@?@`d`X@ 2@@O "`X`d@@12@`\@"!`X`X```H``d @(  d찒 @X`` `d 6@(@< `d`H"@s > |㿘> 9aX ``<`> \`   0`$`P p  핔 \`hԐ! \`$2   ? ?, \㿘 `8  4 xc  h`  x%>  d X@00@@"  T@   @H  2 x & x`$&    00!㿈 x'P>0@f>6`0/> ;>   @@,c( (` 2   " @2 $2 @2 0`"  e ,P @  > :- 1 = P    < > B `$ $ $ $ 8  $ $ @ $ $``I "$ 4: " `" @>P @  $ `$ 0 xc"  @@: "%@c 8` 8, h xc" @$ t  D$ x !4 j, i4 p4 r4 lI4 n \  d { ` , h` , i(`@4 j(`@4 l(`@4 n(`@4 p(`@4 r(`@$ t((`) @@ @$ x 4xc&" h`  4 t ?H P @  `4c @  X(@$ x``(($ t$ t> .!㿘> 'b ;0 > : 䩖,> c( 㿘 l p@Z   8 < &$@8(` &  l@Z'  | 8  `) @( ) `|  2|`@"`" |@8 ?" | @8 ?"  @ ?" 㿀> '` 4 @̤ t ~'  d''&@ '> ` @  x2?c @Y q쀠䀢 " G   y x@>H `(' xo$  ' x3'@ <' x3 2&  $$ 3 ' x h`N &H (`() @@ @'(> 4`{   x3ǀԐ  ? H X ` @(  >2&$$| 䀢 Ű   X x.@@   D ` 0&   ` @ .@ >2& x d X.@ @8' 㿘 6`)  `?(@@" P @0  .`  0 ` ``   "??0㿐 |2: 4 * `& #ݠ  @$  8`<     `<' H8`H @  @4 8  $ 2(@   T`H( T0`( T( T(  b & | 㿈` P@'?c?/<;<Pp@6@8@` P@ |` @W И`d  K c T `6`$ T( (@(  x€`H`() `H ( x`H```((`H+`( `H (+ `H @0`( x`H`(` @`0`(0`H( x@`  7 㿈'T'X3`( (@  T`@ $T`[P@@V?c+<6@W2  ?x@@Ho*쀢耤 j蠄?`x@3``H( H@(` ' 2O  ``H (`=@<@ o@)0`H ( '`' @`H  (`() @@ @@@+ 3``H(3``H3`(`H('`+`dž@3 $hT`T X` @e㿐`ܔp.` P.` "* * "*  `9* `" *  @W 2 ",  ?@ (R8, ?= P @2 , "  2 ,  ? (@@/8, ? @8  `  @Ґ 8 @㿈 >  *v"   `P( `>  *a"@ߐ@U`Ș` L蠒 4``xc0 H/(`{@@ 0@ (&  `x?cac7"! H0 '&`hj0g H(`() @@ ΂@ (`D@ `/ *0`H( H  ```<() (  + 0`H(0`H0(`H( H7 (H@(`耎20`@ /< @@㿐 T 6``(& T (@( $)   $ T& T&㿐 t  4 h`>  )"x> `   & & `  t `('?Z ဦ&  t`t & t & & @ t`"' `' ' h`"!`````H`X @ `'(`d   c  H <@lՒ $ @&۴ `X  `d-  K `X`` `  8@   ̘ 4? " Ԩ 2Ѩ > )"  ) 0 8 (@@  j  `"c > c0? c0c  JR ?<  0>㿈 P' 0`` ) ? P  0`@8c$T c8   Kx/H/ `(4@ 2PT`5 $T( (@( P @ '@Sl@T Ēx2HH (`() @@ Ђ@ 2̓0`̀@  㿈 4   *`. $ H* 0"  `  ``g c ֐_  Y 㿘`$ d X ` D!  0@(@ @80 \ @ 6(@ @  2  \`H' X ` H  (@ @Ҙ 耧 &( і@  `  $>@b 4㿈 4 `` H  r 4  1H: ` 0@ ` `2 @k" 2 Ϫ``˦̐ǐ  ``  㿈 4> > bШ   <`J 9H$  @ " `@j͔ " @jƔ " s n Ői  `?_ 㿈`0 ( 4&`0  X6@  ˜ 4  2 \ H@@ "` `(@"` ?( `  \@ `?  ` \@`2 X 㿐''`h` h`2 t > &# `ˁ``t " `44@l`xcR> bШ`X```H @`(`d  { AH` ` F@j 26 ```x(`!@t@7 )`@@#4`'  `h`"`t``(`@(`ܠ`@>    >   > &"㿀`(`x `4`d`X ` "@ 2@ ' `X`x`((@&`x`X1 ˘ ``(`\ ` ?`@ 'c`(`\`H\ @d <  h , , i, j, j0`, l, l0`, n, n0`, p, p0`, r, r0`, t, t0`,  h ,  h` ,  h` ,  h`} , 4`x , 4`x , `,`I   &`(^ 7`,?`1&`,`(`\@c s `(&`(`X"1  i`O䰒 _`\`(`H) 2`,9 M h`Qt'`xcA F C`x ?5  x y,  h` } xx0`,  h`q  y {,  h`d xz tp uH > c<@'  ''  ,%  '`4&@`h`  > <@ &>   5 @ >  & 8 ` '   ﱒ耢     '԰   '̮ `2 `?/`?@'     @` `.2'ܬ'''Ȥ ?ȐЖP M~؂ @آ  H @@`?`4 `` ?`  Ȃ`' ̀`2ؒ@g '`('`,  x(`@c䀠`"`'䀤c ~؀`?xc`t@1`J܀ A`  y  @% `&@ "> @ > P`'?8'Ħ Ă%(`'`   `@ϔ `2c`  YZ#H   ' '`("i'`,f'`, J`.s  2@~  @(`@(`` Z  tc@M   > `t@`ܰ ``&@  @% N Ic@"  ߹ u> `t@wܰ i``&@ ha% ฒ \> Y U> QPl J `.h'c   "N `0`"J   u 1> İ?'`('`, h%%  { @% 6ܠ & ` $ (% "f&@` \[&@ʒ`  (% ܰǠ`>    2@  "`$"`㿘"`n  4 0&& 㿐"``ۖ &`&㿐" ʔ `&@㿈"'''' h` `&> >FÒa(` k` : 2' ڒ #$#X㿘 4` ``<" l` `@   `` @ 2&`@ ߴΐ `` `2@0㿘" 0d&`d&`L >`T  >`T >`  &`0&`, &`4 >`( `} Z!`y Z!taDu | `` @fc 㿘 6`e  "``|` ``?8 :` `4`ƽ`T <Q ;$$($$㿐 |d`  > c\@ ߶` `  e # `$`?@? `` լ'   *`| ` ߁`?@? `Β` a " < ;&b!0 ;` 0 2`H "   (2   ((`@2  *   (`@2  (2 "  (`@" 8  (2 (  (`@2 * 0* $" 4 " O) 0``@8 O+`0`2   ) ((`@@ @ " , (`() @@ @" 0 `2"`2t 8`2p   (`@`2i  c $x$$    ((`(@@@$8  (`"`$+ `"J @2F r@2> 0`": 8 "6 F44$0B,4$,>49$84$<4xcغ +.0` $@a0` @$D$H0H` @@L8 (` $L$t$P;?/  $x$$/ 0(@$l@LtP 8 l?>  v#p$Pl-` 0` ?$p $d$`$\s? (@$XҰ Oа @$ " 0(`@L" ,c $x$ $@$l'|234P`0`  ?@K  ,  <  $$$m 2`|`$` @$/  @$` &b&``&``| `$ 2(@   2y`|>  Hc@c   !$| 0h& 0I'$h>  @cc 2$|!+>  @cc 2$|#c@c  $|@P/  ! " # $ (((`@@@J$@4$H % &* B $| |t +@ $) "``@?    $ -``Gt`  `ʔx  W Zt Y^    Z  @ &,?&(&&0&& 逤4`"| ߀> ]`H t 20`` ($` " $ $3` `   ?!ۊ ܞ $@`@W ` !`k "`0y/"`$` $`$``@$`$` Ɣ Y Z  @b$@ ! Y@c $@'@b!t? |0G`xc2 $`Wƀ, " =`s` @@$`É(T(t(T(T(((T(t(    E  `4 (>I     $     @  ` @?  㿘!#8#В@cC @F,,ӣ('@(00@ @F1   P  > :a( 8 <  " > :a8 8 <2  @2  ?"  `@"  @ ?`2   ,@`@ @ " "  @ ?@2  㿐 `  x   #\ǐ 8㿘> ` @  t > 耢 ` 6 ? ` > 2 ۔  < > Ր Ё> c `4  " `"` @ `X @ "    8@  >:a  0(8(@ @   >:a  㿘 4`W  @ "  ?/`  | $ D0@@  `4```X  ;+ 83@(@@    : "" ??<  H <@a  $ @2` Hod (@Hp@e02`  2`  H>  `>c4 < `` <>`  ` >` <㿘 m -㿘 c -㿘 4`  "t `@n @  Ѱà ʰ㿘    t z  B``@  B : "2  2뀤 )   Ŕ ᐄ㿐 <` ص  $ `` `&  4`  `2`&  &  r p漖  h` . h l j泖 i &  n 櫖  㿘 > `#`"Ғ : > <' ` t`  ( x  > #!@ tdq  X@_u 2   ` 4`?` / 'l'h'd'''ТLh`"` `3'h`+h`9`'hTܖ 2"# c T  @Ĕ!h'hʔ ` /> '#Ɣ   h> k >  > <' ` t ` 4 ( x  > #@ >   ?P 2  X@_G ''hHh`"``` `'h`h`2ɐ`" Ĕ崖h'h```H`XP @`d`(    `d H@_  H> : @Ő XP H+`P0`+`+`ă0`+`+`ƒ0`+`+` +`ƃ0`+`+`ʃ0`+`+`ȃ0`+` t`xcC0` ) ) ) ă0`) ) ƒ0`) ) ) ƃ0`) ) ʃ0`) ) ȃ0`) `xcP  PdXE PPE H+`P+` t)  t) `@ @ 0  '̂ 'l'd'А/T P"" = T @ʔ ` 5/Z Ɣ  5h> #> p P   > ''Юc<' P`b> `0 ` d2P> R P!  ͐Ԁ[Ԁ U׾  Pި ۨ W` 2Ԓ '`h`  `"  @`@2 ``@2 `@'`  ' ` `(` `', ւ'В זttx  / / |  " h`c  ]Ԃ f θ 2訒 J  ` @$ `z3Ѐ w '@`('> _ `uА4 Д 4N`'`G0CD4> N H@._  {0 tԒݐ 2``Ԑ 2`` ` / m/  /h/ B `Ψ ېj ܔ6>  ϒ 0 ɔ`\ صر &(&, ")`0ؠ `2n!`1`X0@  `  "!` "А ֊`&`('`0 `"> Ő!8> !``\@'`$`+А c" `t B?`X```H @``d(  ՘̨ -̅4 `H) ) t`xc2  ((`xc 4 4 ) ) 2 2 ((̨ `@@2    > f!x㿘 `h`?  ``?ށ㿘 @` ` ```( `L`P"`T  `D` `4` `   d `,"w`4 4`"Đ " 4```͒  ԓ  4`"I`,`4`4 r pb h `  , h$ `?"`H 4``  ` 1 h, h ` $ `H?" 4``@ @`H h` , h ` $ `[ 4 `, n  `4`, h, h2 `,2 4`㿐 ` 4M `" ` `$  4` `2`$  $` hP t "x x$` h`@?m$` 4`$` h`  $` `S $` 4 `4$` 4`$`L$`  x <`  r p 4`2T n`4`8$`<$`@$`,$`0$`H h` @$`H$`D 4d$`( 4 x \(@ <`P`4$@  x`2$` `I  X ` H (@@*2  @?  $0`@ҐB $`@ ( @ (0`@$`c  @y$ `,   l j iz`<$`H r pU h` , h 4` Y` @ l jD i T$  n < J ``4`h  n ` a@ (  @ (0`@`4   > c X '  ''̀``4    `h`'Ԃ`d'Ą  `x @  `X;  ;+ 83@(@;@?`d `\'`x '`X`` D z+@''`@L`X``  ,48,0@,@`dؒ=` `d @ @@܄!@Ђ @  Hݔ  `3 Ԁ  P `$b``%``X`x  K+@ 4``  98, ''`dĈ #`#\a 3`'8+0@' ߘ ` z``w  2͇,8,4,0@'̄@'ȃ3`8+0@+@@BH'> <' `'`h'`' `4$  @Y! ' `{'̄ v ' ` ̒ 0 `.` @ `t0`{ @ 'Ć @?  `\x`dĐd$ @ ``X :* 82@(@@ @ " ????ȔؖG谒 `uఒ  H@ @ @8@g @`T0 2R?  `x(`@c" "     '/s ` ߒ/ ``7 (`0` Nˢ > `&??? H  D@@ ``2 ??? H  D@@8 M  $`\x`dĐd$ @ ``X 8:: '' @ "_]-Ѐ2Вd"?  @ ?  ̂ @' `x  `z @> <@ > `xc"q`@'''``2 HV `@B|   (`((@@@` 䀠`2'`X`@@ В|d `@* :(@'2@@`'2   2'V?4 > c' /!@XJ``7 (`0` *@ʏ ) D" `&  Z @`x@ '  / 2 > /c@@X!`@'쒄D8Вd e2 @4 Dv 0$> Ą  d`'DD  4D''`' `4'؀`l > y!Ԁ`"`x =] `Y @T ԐI L`x'܀  I D@@8`CL'dX @ @ ;+ 83@(@@ܒ@ 2@ $@ ۘ p'Ԁ iԆ'耠`"M`x?n #@`=%Ђ%(ؒ C $'`x 'F Xd܂'Ђ@'̃0@  ?Ԟ` '; ; & '쀠( `xD@`̀@? ``x܀@ D``w Ѐ``"@ 4, \ @ 2~d@C : :*8 2 (@: @.  68.0@.@4 d ]`x X@ d  ' < H@Vp  `@  @ "x  "h \d@ 8 < @ F`x  '`x@l@`H@耠`9'd@8X`Ђ`'` cX` U+ 8 3@ (@; P@(ddl 'H8,0@,l@À  U``(U`-2Ѐ& #'Ѐ@ 2 X`  38;; ''Ĕ   $'??8`p@8ZdQ "e '?$ 쀠@2'R+ ;(@'3@@'Ă`X '(Xod" `"`"` >  c `"" 4" " " 4" " " 0> c2h"h@2l㿘 <? 2  & :`"  @&  8`&6 㿘>  c      @2`   @,  2&@ &@  l  p! pp? @ l p>`p 㿘 X`"& X  " (   " ޒ  " (ؒ  ( " ,Ғ  , ̒ ́㿘t   t  > " h㔈㔀`" l㔂 l p " p㿘? 6 ް   > : XH`" " X  " H㿘   &   7    &    7& &  㿐 `   -;> :aL'՘ `$ 'aL;> :aH'Ƙ  > :aL4 'aH 㿘> c Cc/> ]>WLaȺ0-> c'> "7& D @%@ 0L@   @0`@2 㔀`2@`@2`lh R  㔐 2 & Dߢ 㿘  Q  > " " " " 㐂"   @" > 1!㿘 2 > 耦 >   ”@! 0>(`D 㿘 ``  ,@b),` ` (@`Ho&(@g"& (& ,?Hp@    `?   }  @S "Ho&(@g"& (& ,㿘 8`  `"2  " & . 8 @    뀢 > !` & > "㿘  @, > c   "  @2 @2Hof(@gHp@ 㿘> c @   @Sf 0 2 `"`  ( 2 `(  `&Ho&(@ @ `qksHp@ g  & 0㿘 D` H`2 L͐ \& \ P  TŐ \& \㿐 ` 4  9 & & & & & ̤  @N&$@@$ $ 4 $  :`!&  $ >  @   & & & & $& &  4`& 4 $㿀/ d'7'' d @  !>b  0 =`& 0 (@ " 2 0㿘`1   '>X` ! 0 =`& 0 (@d "Q <`"``6` 2 0p`` 2`Ĕ ǒ` ``&7&` ? a7&`7''7'А`` ``@&` 6`&`㿀 '''7'`@6㿀''7'`@6㿘  $ >(`D  0 =`$ 0 (@ "Ϙ <@ 2 0㿘` _` ``" .P` `i`. (  E`*.`F` .e $" "    f(`` 7e{$` &`) `@8 ` 2` !k  !"`k$ .. .   .̰ ` ` @$` $` 㿘? 6 Ho&4 (@g `rHp@ 㾈> c<@' ? 6 l    \` 2``  @ 5  ,?  l @(!<d (" ( @ /Ho 4!(@a!@ Hp@0> "0㿘 <? 2 Ho&4 `(@g `2 @2  ?& bHp@" `㿘 ?2 V` &`<> :aP&`8Ho(@ X ``" X&`" `Hp@ g X㿘? 6 Ð `)`A&`Hof4`(@g``2 `:`2`` `$`> a"`$`\Hp@`"` Hp@㿘? 6  ;`Dbk@"   ~@"XV  w@"g0bf@0b{@ bl@ s@"8 HPb@>wxn@Vo@M`w@2  L & |@8@j@dqv@f@h@Ð y@"r}@3}@,z@  `!v@ 7hj@ւq@΂f@2   &o@hn bp@m/ bk@f  "  h~ @|@xt@2u  @ q&@i@k  `gHo&4 8(@g 8` Hp@0Q@Lm@5 `v@2H  & L `& P `;& T@`u@Wp@22  .. :@ b@`w@  Ɠ @ . <> '@6b> 'bР & `  &   = & < &  ` s ` > :aL8& &&   @ & @` 8֐ & HӐ   66  "ʐ   & &`"`& ? &  . ;Ho4 (@g `  Hp@ & 0 & 4& !> '@6I"&"@6 > 'Db&  & D `. =Ho&(@gƐHp@p n @I i /a@`A0a` bm@90b{@6V   @J`  . 8㿘? 6  `b ` ] Hof4 X(@g X `$ X $``> $ $> '> b( !`# `"U  :`"  2  1 $@ + L  $ $ $ $ $ Hp@  Hof(@ $ $ $ Hp@ ,?) # ` g a$ $2 ~Hp@ tHp@ jHp@,ttttttttttttxtttttl tt(tttttttt|ttttttttttttttttttt0ttt(tttttxtttttttpttt\Htt<ttttttt4ttttttt(ttttttt tttttttttttttttttttttttttttttttttttttttttttttttt " '"@ ( `@ @   @ ` "` `"& @ ` `(`(@(@@ " @ ` ` `((`)  @   ((`)   @ `(`()  " "@ ( `@@  "  @@( " @(`a2` > :>^aL8`' (``@"@ H```"@ j``  `0@ ` @  ]``ރ(` `@"?7``퀠`7```倢@ 0`  ``0`@@@@@π@ 0ˀ``!`P`pƀ`΀@ Ĉ "`DŽ@ ` ` @ 0`@@݀@0@  @ 0*`@`?P @K˔ @ ?>^?cX   `((` @ 8 2 `  @`2! `!` :@``ڡ(`ؐ֐ ԠҐБ2 ͑2ˑ* ȑ* (`@ (`@    8@ `  @`2 0` ` :@`@"   (`"  (` `:_@ `"   "  ߃(` s `e@ oX`"e h *  Ń(` "_ @2V  8Q@T `  @`2 0J`G ` (@`;@(  (`’2  ` @ @ (`& *  (`@2   (  }(`ȡ   `@@ @ ```) (+` " @"a  f(` "  (`  (`@  (`@   `ԡ(``"1 `2--" `"" "D`   ! !  `K  @"J !  `2  ` ! ɒ `"` "7 `  ";@#  !!  `*#` @"? ! #`` ``1"`@@"#@#`   "!  !  ! "! #``  ``"`@"#@#`   "! k#`"" `2`  "` `w`  " `2R" @ L@  `2 "` "@ ``R `@ " @"` ` `.  `y"` `"`` "` `"` ``` `@ " "` 2"  "` "` ``F `@ " `"` "" `2` !    `K! @" ! @` "` `"@ ``` `@ " "` 2" 0"""  `2`  !    `#`@" #` `s"""㿘@U`2^``2 "`""@@"-"`@",@@ ` ` ` `""@" @` ` `  ``2` @"@@ ` ` ` `ْ"``` "`""@@""@"``   2`2 @2 0  @ `  2  `2  @20 @ `   `" `6 `2㿘Hof!> :(@g!> :! )!    `!?! ! `! !   $    `!?! ! `! ! 2 Hp@> :pp`"p ` p" > `    ? @"" > 㘂 㘁 p> c<' `  \ 2` @`` " @  > 2 \! 7a@ @`& @ \6 \` ש"@p> c<' Hof4 \(@g \Ԃ`F!76 \ a  2 ` " ``" ``2 @Ḑ  2 ``> D`"'  \! 76 \aHp@ (> !76 \ a \@( ـ@= @@ π@ "ɀ@M ŀ("P㿐> :?ϐ!d 4> > b(.`2   @ 'l ` g`0    `造`@ Y ` T`0  2 Y @ D 㿘Ho"(@g" @F > c@``,`@@, $"``2`,Hp@` "`>` 㿘     "  㿘  Ґ &  㿘  $ + `"  `2 &`&`&@ &` &&& װ &`&`&@&` $̰ x''''''''<1> :'!d؀  @@ 2  > Ґ#!d`"> > :!d> 㿘`` `? @@&`&`\`` `& `㿘 > #<" " " " 3> :gad   `2 ad`2&Ӓad$ Q㿘@`&` `&`  & @˔\``  ` &` ` &&``& 㿘`U` @_`> "`  \       - H >!b  D>*b( @ >!b㿘> :ah $   @E 2 $    `$ ! `!`!@@`2`  㿘> :ah    @Ew 2 $  &  㿘> :a  0  0@E_ 2 㿘 `#; ` 7   "1 `@2 " "' `\`2# @ 0 ` `( $@ @@@(``Ԉ ``@ 2 @@Dϔ  `Ô@DƐ 2 2 㿀> :ah> <' 2  @D 2 $ `2   "  `&  `   &  ` ''''  `0@E   ݢ` ؐ > k"`㿀>  c<' ``  & ``  %`  ''''@ @DÐϔ  ``ޠ?  ِ > *"xp> @c<' '> :a0a"y@@`( 2&@  w> > :al`i0 aԸ0 O"@. @`7$` k  " @ @ ِ0@ &@R@  `7 @ ڰ  5 ϰ &@''''& 2@è  &@ӄ"㿀> c>  c<' &`'   # (> :ap   ''''  @C    ? 2`  ap ܰ > @" L" L>`p 㿘  2  "N @Cn 2  H   ? @$ $ `2`"`@2 6! ?  ؒ ``#``$"`(`( (?($ @ ( `$H   &  > : al#` 㿘 & &     & $" $  `   & (" (  `   & ," , `> Ґ#0㿘  ,ה   @C'  & & & & > :& $h $& ( @ 㿘N@`@ 2    @B 2          -?  4 ``$ $@$$ $  @$ $` $` $ @(@J?`/`9 > :ah 0Ԁ Ґ@By 2 $    h> :ah> <' #> cP "'@BY 2 $  " 'cP Ԓ 2 '  '''//@< > cP < "d@ْ 2 <Ȕ > 9#@" > cP < "J@ 2 <  > Ɛ"㿘 ``  1> 9@A" `@``"@A   `瀦`@```p㿘 (@  ` " !&!U (@ 2 ( " !&!㿘  "@`@ ` 2@2"$$`@ `@&`@Uo `H`&`H$㿘@=> :a <2 "`  "`2  㿘@> :a` `" a<2``\`"`` "` `  "``2  `@@ @ 2 x''''''''@ܐ' > :L!d 2 㿘 "`@`$` ` `   `& `@ `" &`@ >kaȀޒ @3&`@㿘Ho&4> :(@g> :a`V`Z`Z` 6`Z(``2 `a`@``2V`ZHp@> 'b͗㿘@ڐ@# (s 㿘> 7cP>  @Jb \ ܂`@s4 \ T`" H@I H`@{ @ ``@^@QÁ㿘> 7cP>  @#b \ ܂@r6 \  " !Pv   2!`2" ؀ 2 T`" H@  H`@zɐ@w@! @  T (`@ a" !T!&!ք a" !T&!΄㿘 @`M> :a F  U!<2  `2 @ ``" @ @2``       @@(``    @ @@(``ܚ`  8 "԰@I  "`Ͱ > :> :at> :> :a|(`> :ax㿘 L`    & L>iԒ`(> 'b L@& d̔㿘N`Ђ``    L` Ђ``  `  - =````0"EL > :ap 2 0< : @%2@?۔ 2$`# ?Ђ`` Ղ  @ / ?Ы- ``` =` $@&L --`@`Ѐ`&@`> :0㿘  % а  ` - \`Ho&(@gHp@`㿐]    " @   + 㿘> 7cP > @b!䀠`! * ` \d ``"! "4     @ `?& & `?& !@`"& `> :& ` & > @ pH`` > `l@> : a 㿘> : Xax( Ho&(@ @ &"Hp@g 㿘"` 0ې 0@$ i `1 h   ]  * (`0`(, ,  i> :,  X`4  h, x X>k(!&` &@a&`&"&` ,`?,?9``(`(Τ㿘%> :| ?)> :'> :!tᐚ c$$ᐃ("$ᐆ ``o ($!> :6 X!x`|`!t2 !tR> :!t** 6* %!t**   !x !> :!x !t$!x*  ܔ | !> :o!|w $!| & & >  ` |(` !䀠> :!&!`&!&!&"&!> c@ @Ba`&! "!t'> : )> :$ᐂ > $#X㿘 h`> :2h& "& h`2& &   N T&  &  @N H㿘l> :ဈက` & ဂ   & 7  ! & 1㿐    #\> > #cp1> w>k"tbq"tsp> c<' Hof4> :(@g> :a %    \`"  \!4 \7!@  2 \Hp@ > Ԑ"(> c<' 0@ $@ a@"0 b@`'  az@ > @@0ax@j   aF@`\@{0 @"T2@I1@:@+@@[  @"10@y@v @"t @b@ 8 `\ (@a%"`\6`\`@n`````\`Ho&(@g@=Hp@0~ zv\rnѐj@"O@"H@@ aJ@2 ǒ Ma`@`\?"Ȁ@|p @j@Ȃ@2g  (  `\@a@`\z4a@"a<U0 @3@+@2A a  @ Д @<% `\V@@2& `l` a`$@`l@8:`\@~G@:a5@2 za@a@2 0na@*0 @2 iaa@ @@;ِ @`\  `\$`p`hԔ `\ &`\͒ `\  @c 2`\a@ @ @;.@; @`\`p &`\6`\ΰ  f `` Ho&(@g@wHp@ ``̀ +`0`  2#`؃Ho&4``(@g``a`$a$``>Mb$aHp@``  +`0``  "``C Ho&4 a(@g``a$``@ Hp@ ``# `!Ho&4 a(@g``a$``@ Hp@ `` (`8`@@$``/`\A  8ð `\#,a5  8 @_ @M2 a<"XaHo(@g@@3@Ɛ@```` :$``> ``4`  0i 4 4 4? @$ 0$ 4  `X$ $  l`\``.Ho&(@gHp@`\`2aHo&(@gxHp@`\a?bR @4`\ `\  > :`Xx(``" @" `2 `2   `h` `` ` " b ``2 bc  ]@a @a 2E`\`` 6@`\ a &;`\M Ӑ Δa@+`\@2 `l &#`\ -@ aF@2 e) a@ `\a6@T0aK@2 Oa"`` 6`` [@" "P @2! @ݰ9 `\`E$``0 2T`؃Ho&4``(@g``a$a$``$aHp@: Hp@a@ "H`\$a<`2 . @@2%#Ho&(@g@ߐHp@``ۈ @K%` 0@ 2@Ȓ^㿘Hof4> :(@g> :a   Hp@㿘Ho4 \(@g \ ,>jb6 \&!>d>da&!&!}  h` H`" T@` T` h`@!`!`<!@@J@ݐ@ѐ$> ےc> ג`>4Ӓ` "    ? @ `& & #> : "    ? @& & #> :> Ŧ``  .`" 0 Xax(`"  `d$ $   `2 X 0W 4 4 4? @$ 0$ 4 `2@ Xax(`  Xax(` `>" ax X ( @ $ (  , > c@  0 (`@b`"   2 0@~  X> :|(` Hp@@7 $ 0@0ax!C!> : ao > : a\ @! Hݨݨݨݨݨݨݨݨݨݨݨݨݨݨݨݨݨݨݨݨݨݨ|ݨݨݨݨݨݨ`ݨ > w> bp   0` (  :`( (@ + >  `0  (`@0(`@0 㿘> > c  6 0(. 0@(`(  >tc? >u`?㿘"? 7  @  "2㿘 `A``  /    `2 ` ` ` 3 > :!> : !  3.`.@ .` .` .` .` `  > :!> : !y  .`.@ ^.``.`.` .`f 㿈Ho (@g   b Hp@ @6t  "   @6j  2  Hp@`$  "    ? $ $ # 7b&b@6D  b&bHp@ 4㿈Ho& (@g ( )` Hp@ `b`2 `@6  2``@6  2```$`Hp@  7!  + `  $` $`b$`b` &bb$`b`&b@5є  b`&bHp@ 4Hp@ 7 2  1  P\`  -8 l  @ Y@㿘? > w."??.".""> '."Ȇ` !"@4: ."." : ."."㿘"`  !8. i. h. j%>w& l`&!&!8" i `"`@ &" ' D 㿈!<`(@=" `h`(@7!<>  0# `h``\`A`A, 2`IG "`\ `k``(`\a<) " `\ @2 `\@%`A`A`TӨ 4   h"+ 04$" `> @ @! *0>  /8#`>ta4(@f 0<@r $ h  4 A` ` 3 ``"  A v p  7  K 7 z `b ^  W @"H `h`ݒH` Nu H Nm   @4m  2``Ho&4(@g` 䀠`<&`(`@a" a (`@ a $ఙ<@ <`@ <`"@<~Hp@@ d? bz7@N V`a (\h(`;`g( a7W `װ A  `cP? `HM7`(@   A 8 4$ 8" R@   N  7  H M @S. @ 2` .`<᠟@ "p`$Gа 7@{$HY`< `G7 沖 J(7  @#㿘 E!<`_&( h` @&   `h` G`\@`F`@C @<` @C > > ` pp`ͥ+`4 `?`  ["@q `H`ǂ6 2`Ѐ L4`І@<`GMEM  h> :` " ` 2  `   @3 > :!@2  a6`@@<` `@>   B<``2`H"`"``T` ( `h`2r` `U(0```c`\ab \a@2  PHo4?݂(@g?݂c4"!*H5b GH(Ҁ(  %`"FHp@ 4H``%&bx6@_! 5`@{$  `h` N` c IK   > ;bу4"> }c@> }`lH`@%> @`l @ D6 H<&(`@"$ (`@ ` @$ @`@C <`H``%> @`l>Ѡ``\`dH`@%> @`l> cH``%> @`l> ``\`9@{07H`@@%> @h`l>4``@2&C˒  H   @0`0`0`0`0` 0 ` 0 `E$ H L`0@wV 6_<Cϐ@v .4@g0 ,dt dp| X $0<HT"H#("H""H""P"P"P"&@&@&t&P&t&H&H&H&H&$/(L(L////(L(L--''. -. -(L(L-----,,-0(L(L''--\'+'-(L(L..''..x.<.,()$* )),(+***l))l3h3h3,3,2 l"#"$ "#$"#T"$"$"#> 'І "$"$ "$"$$>  c `  )  "`  㿘# ` @ M"#X"$ "$$"#("#\"$4"$8"#,$`"$$"$ٞ@ "#d"#4 "#`"#0 2   `2""`"  2"`2"@ >  `(>zx> `> `> `> `> `> `> `> `> `> ` >  `(>z> a0> a> ԁ` > a> a 㿘 \`>  0a@튐 @ '㿐$$&$0&$,&$$ \w   0`$$$ `&$$&$ " $$$`&$>  ^aX`&$$$`&$㿘 \`)#  k`` . kHo  (@THp@aFHp@0y# > a ! 0# 㿘 &# >  c`'  2$ @ `2 $,`@" `" @ 2$@ـ 㿘&# $|`@㿘 &# $x`@㿘 w&# > c$ `@ `" `@$,"`@ `2` @ `@2$㿐> w6 6 6  #\ `" > I㿘.  00` !> 造a(  #> 造"# !> w> a`! !> w "*> 2""> a㿘>   a !> w "> " > aȝ㿘>  a> 逢 a؀ !> w "> "> a㿘  *!> w "> ">z> b> b> b> b(> b8> bH> a㿘0. #6 # `!> w #> #굔> 逢b`> 뀢b> o> b`> obh> 逢bp!> w> b> o> bP㿘  *!> w #> #ꂔ>z> b> b> b> b> b> b> b> b> c> c> bx㿘?> c>  c(``^Ű (0`@㿘> 븐 .`` >  c0뮐 (`㿘 \`3+```'``0> c0+`2@$4&$4@& ` `@`"  w ` 1> p >  c89 0ˀ㿘 \`\T````> > `xx> ch`3 `@&< ` @`@`2&$    &$ (`() @`@ @$$`"@`$`&$0&$$  B$$`"@ꀤ``1>  >  cPє 0$$㿘 \`/'```&`> `x0+`2@$ &$ @& ` @`" R Ґ ` 1> >  cꔔ 0π‘ Ё㿘 \`\G````D`A> > `x> c`"$#`7`2@#&#@&)` `& @B`" " ꊐ `†`#``$V``$#&#@&4ݠ`1> #&#&#@ W@b0>  c* 0X#&#R Ё㿐` 2  l# ` b b` " { b$H$T` "  }J   {$`$ 1 }9  ) 00 "}+  "$}% $$$$`@+  } `#b# }  }  "4  4.!@u   {S@, "$| $!` !`ʐ  {< *$."@S   {1@, "$|͒ $p> ''''''''c<@'   2 J  F `2    `2  ``2  `2  `2   `2  `"     }    `2  `2   `2  ` e _ `Y @ > "㿘 <@" @  0` ` @ 4`: 0㿐`   b @bA`/ " z bHT @+V"@4 `4 `` >`0`  ".``ɔ" , |   zV$$$ $P@*| $\@*y  @*v$h`$  {  @+!` {ذ x> c<'   ܂O/`܀"@//`   > 88//ː"(x>  c<' 0+) `2 " `2 ``2 ' ' ' ' ' ' b' $  > "@㿘> c @ " ` @ #" `a 㿘 (`  `&"  @& @> (` 2 (` `"  @& @㿘!`$ (@  ` " !&!>] (@ 2 (" " !&!"! @ "㿐# \`     / 0`@  @>  ? $`/ 2` $`$` #` 7`?0`(@ (`` ,,2` 448.`""􀠀6N! `<$`(`@b"Z b (`@ b" \dF&"` `# @C > 0@` ,,2` 4"".`2 S #\ >  0!c > M"p""􀠀& `<!`=&!  \@> d !@`y>  ` $4c<'  Д    //<  # &#.#:`W  H > \"X㿀> $ c<'  $$`$$0'  ///00/0// # &#.#9`!    >   #"h㿐'D'H \   xD V kDHm`GD> > `xH> `8 `%`0  @$@`. `$ @4""  怐 `ဥ`  ` " o k  y?`> HD`-` 3 `!  y~ >  ` `0H> D$`D,'􀥠DD `  `"  K @$@`P `L "  > " `2    (`((@ @ @   D$`  3` 6>  3`-@3`-3`//@ D$ ,` $ '> Ր D`.`10`HD`  `!`?x > 帐 D$`  ... . 0`..> 垐 > 囐 ؃.`͙0`2$> HD. 3 `! ư 9>  ``R`0L H Cz 8Dv PHr H㿐  \ v = > ```/`,> > `x8 ? `"-`&``W` > ` $@`T ` @  xW?% H `ހ `  `  "     `  (`@0(`#0`@"2 H`2) " > !( ـ  `ӂ $@`4) > `-3 0 `! x `% π > Ð!  `䋔0\` >  `'"[ ` ʐ '%v@ ``r` $ @`"+ ``倠``H`2 ` ` ` `(`((@@@@ s 2>  w!`  @> o x @` ``4` ````1` ``. ``* " > T!x `(`@ %> I! ` `H(`@(`0`& S0`-`H-```` 3> ,,@./`/ T`@ I%T q> `>(0b#2t `` G c-`R> 8 `500-`-`0-`U-`!, 2C> %T5`.3 0 `!& $T!> ߐ!Hې P` 2&> `(`3 0 `! > Ɛ! -` А > 0㊒a@㸐!h㴐!%T㰐 㬐!㿀J \ :  <  " " " ?`5(0 ??(0  `9 0'0""􀠀65! <$ (`@b"9 b (`@ b" \d)&"   # @C > ?0`#\) 0`#`#d>  b" 0""􀠀& <!`9&! \d۠ !@׀  <㿈 'T'X`\:  i$`c` \`? ((0 ,,TX' \' X  0G 'B0@ '   @$`$` 14bb􀠀6Fa `<$`(`@b"N b (`@ bb`\d>&b``c`@C >` 0``9J   #\ > `0⌒c #/`> ⸐"pbb􀠀& `<a`9*&a``\@>`dƢ a@€` `<    ܓ2`> p#$P`&#@ 2.#;$L/@ -  #\ /#`#p#l#t `#h#d>  #̘ 7㿘 \`>  b@6 0Ð##$$$@P㿘 \`>  bP" 0#$$$@>㿘> w`6> wc`  @2c# ")> w .`.`"#h``.`#$L "$PuR $P "$XuL $X "$\uF $\ u@ k# ز 㿘 d) @c@  $ d) ) 6&#h@q㿘`\` (`@c$ݐ  > `0᭒b` (`@  c$ (@b a (`(`&#h)@ (`(` |`#0` > >c#́㿘$T0`#" #$H0`#`"$H$> &#L#̒ $H$##4` > >c 㿘$H0b#"#`@̐$&#P 1> y 㿘`\` (`$` (`>{dc c@   &cW (`@?c$ >  bp`0 H D  dc(`@ c@ &c f  ,@,  4@> >b#> >b#T> >b#㿘`\` (`@$`"#`*`  0@ (`@c$ >  b೔`0 (`@$`〠` @  8@ە p$8> <@'  \&$8& 䀠`耠`$8$4`> &$8&$4#@@ > `2$8`2$8  0>  hb0"x> >c#T$T` #`"##"#> >c#"##"#> >c#㿘`\`# (`@c$` (`>{0m  ,@f b  0@[ (`@Cc$ >  b`0 > >a#> >a#T㿘`\` (`@$``3 " @*  8@ (`@ c$ >  bݔ`0 > >b#> >b#T㿈`\ `2, + * 2 $  @<>{ * `0 3> ߖb  (`@c$#\#` > `0߁c }?> ߭"p؀ ̀ (`@c$`"&y `8u 0`!0`! 2 1> 0y  c8  " > 0j#x c8 (c$` 8(`>{0`!@h (`@c$ j"l> 0B f > @(` 7`@G2  @ ` 0 -  9  (`@c$7`#d> #`#\ܒc耤 "   (`@c$""  (`@c$ 8# (@c|`"  (`@c$` 8(`>{ (`$` 8(`>{" > 0ѐ#@ @ (`$` 8(`>{t">  cނ0 2~   ߛ  c@  ,@  4@  4@  ,@ 8 |  8@ @ 8ߔ  c@d 2  (@X  8@ c@M    w 0> 7!Q*`v2`> >  c00 + @?_ (`$`8;(`>{X@?  ²@?@? c@  8@   > X> `̢@ 4!1> 0֑ @ $@  7> ``@`((@) @@@24 `@``((@) @@@%3`/@/`0`/`/`?/ 7 ە >  chi0E (0ݖ `> 0ݐ  > 0`xVw㿘`\Hof(@g2  (@`+ @ (`@c$` (`Hp@>{D, K#$#@ >  a `0 (@` @ (`@c$`A=``ՒA  4@0ΐ& 8@Hp@+  8@Hp@c` `  &cGHp@  4@Hp@> >a#> >a#T> >a#㿀 \`` & 0``@ @!D  0` > ܎b8`> ܺ"p @ꀢ0>  |a@# 2 Ho&4#(@g#$H0#W&##`S$`OHp@` , `  %   !4 /$X@” "$\ /` > a  #d#`#\> # 0  #`` 0 > ap`M> B"pHp@#  0 > b` N@ " > > $"P, `J2`>  Ё>  b `*`V2`U> >  0ْb` N@ " > > "P, `(2`>  0T`*`;2`> #0 0敖 #`` 0#\ > ۱a > ݐ!А> א"pb@( i #0`` " ` > ̐#@o /` > a#d#`#\> #̔  q#0x $` #$L  /.#<&#@C #d#`#h#l #\>   S 㿀> #c<'  # Q  /2 //2 2 ///  $  ( (( 3`( $T@ (0b#) 0 @ (0  ((#+ &#.#83  0 `! > @ (?„  (( #(#&#"㿘 \`J````'`$> > `x> a> > b`: `@``C`@&(` ` @ꀤ`@`2&  (``P@?"@(#&$`&#@&4ޠ`1> Ց h А `ƀ``%@#` @`2&    #(`((@8@ @ `&#ڨ@ڤ0>  bhl 0{ڙ?&#@ڎ0> ` \c<'  . 0 ;> ``@ @ 8`   C  0 > .cH`> > Z 0@  `>  b0E>#4`#\ 0 >  ``> 9"p0 ?$@ `#< ŀ 0>  c0l Ho&4#(@g#$H0#K&#Hp@컐0` ?$@ q2T @|2`@Z $P@@R@N@$L @/` #d#`#h#l#\>    0Y>  ١c`0TА"P`*`2`o> #`$`Hp@0<>  0لc0`w> > ٰ 00i"#`` 0 > rb, ʓ2`> ٜ#ޒ> ٖ"p 0L"#`` 0 > Ub`$K> `*`ē2`D>  05"#`` 0 > >cx`$4> $X@ @R 0 > .c-`톓2`> Y $X@* |2`> O Ѐ@ʔ 0>  `H 0"<"P`*`a2`> )#4@0"#``#\ 0 > `-`J2`> #^> "pˀ@f  0@{<` @~d$\@@~\ @~X$`@~@  2`#4`` "``h >  @0`  #\> > a w0T`> #\a>    #4p>  \c<' kb```"`> > `x> > `ШԀ`G ` @&E ` @` Y> @` 2&>'7'''  $4``/&$4$8`"@̒@Ĕ  .`"&gb $8 [ `> T 0>  ` 0@vG$8Ԓ$8`&$8͒`"$80"`> c<@'  \   i g z> `|``x``ig> c  `'` `2> $ $@`* `& `G@4F`" T  `߀`` ` ` -`" > א!  Ӑ!0 0`"`> ɐ P`- 3   `W j > c<@ > ր`   jװ?>  aq`0``r>     `   ܀`   $@`? `:`"  > q# `2  ''''@ Ԁ`?`J>؀`F>܀`B>>`??7Ԁ`+  $@`4Ƭ `[ `n`-  3 `Wkp`?+ А 틖  > `0a8@uԠ > !X ζ  7'''̀'Ѐ, ,, , , , , ,  `"s @uYԠ> !Xg DĐ̒  ꀥ`` `.3   `Wɐ > ϐ!h`@u*Ē> Ð!x`"㿘$$` $$$L  >( "$ 0> ]!$$$9㿘  h#  $  ] $$`"$0 ` "$,  >d  i 01> /!$ $ $$㿘 \`A`@r>  c`P  2#` #`J  &# Ѡ `6  2# `; $ @ `" "$$,`@" `2 @ 2$$`"# # @# `"@ʀ @ &# `   "$` @ 畁 \`"> >  b 0> 㿀 \``  0 %`@S* 0  0> Ԑ"x>  ՜b璖􀢠 `@`#\`  0#``> #d`b8#h~ @06# `#@&# \`A`@6#׋  0>  eb#`6#&# >  0T`x \6#` הf"#㿘#> wc`9!> w 2&#$c&"&! >. hc>&!&$p>> c6#6# &#&#&#&#&# &$t , @, , "#h  2, #>|`氐 # >`# % c㿐#` \Ho :(@  . kHp@ l 6# &#&$6&# "&$&#%ܐ<\&$ \&# &# / #$@"6 \ 2-> #`j&#> #ał #$`2@V6 \&$ "> ڐ >  0Ԣb \А"#㿈Hof(@g<> wc ,> > bȨ'0#" # \`@"#2 # # `(## @`$4# # `"4# # `8&## 2#Hp@> w x# ֚l"# 0# `ބ# $##'#! $#,$   좚#0 P4# e $|`"#@#㿘$ \&#LHo4$(@g$#`&$Hp@> c>  ch 00Hp@ց㿘 \Ho&(@g#L` &#L#0`> # Hp@#0#L>  bŔ 0#L`&#L#0`|>  #0ߝ㿘$$V&#P \A > # `> c  >  0Ӟc($V`2,> > Ȑ#8Ho4$(@g$#` &$Hp@Hp@# `UӠ#`0$ !!,# 㿘 \Ho&(@g%#P`.&#P#4` ` " $Hp@&#Pǐ > v Hp@X#4#P>  c) 0#P`&#P#4`>  U 0ϝ㿘Ho& (@g 2@ 1@  Hp@a@ >90:@N~@"I l @@ @  \ A``@`?`?@ \`?@#`;*``'` \#`@6 \^ @@ ``4%$Hp@ "`鿐0肐0" א \ 6 \ (6 \ƀ`"& l@ & l 㿘Ho&4 (@g b耢 # `""#`"` !" Hp@!`  a؀ 0"!@ 0㿘Ho(@g 耦 ?2ې "cb`"aa Hp@`b`aa`  ba@ !؀ ? (@ a& a$a (`@ b& b$bHp@ b& b$b aHo4(@g` `?Hp@㿐!<@qC`( `(@q=!<>  0К#Ho&(@g9% \ &#(MHp@ 2  @@@"` #` /B"v#(. @> Hp@ސ /`(#``` ` `2#(Hp@ ``` Đ 1 *ߔ  2# \`h>  @> Hp@ 7#@?x!h J4`!`T`!!䀠g`<&`(`@a"n a (`@ a!&! \d"V!#  @> Hp@x ?ဈδb̴ W6 \Hp@Ho&4n(@gg *x  " \`0@ c 0  .`<"!@ " \ !膀`@&!> Hp@05'x 7@#` `,` ,@7`< ?,`,@/㿀>  \c<' Ho4$$(@a$$`E$('  20/  ,`2   !''' @'$$`2'耈`$($` @ mHp@ >  T   $ 0 0 > Mc0Ր"p> c<@'   `\c Ho4`(@a` 20C  @`2   5''' '' ' ' @D' 2'耤 $d('$$ $ $  @| Hp@@ > `$i 0`0 > Ԓ`0\"㿘#` \Ho (@ . kHp@a > l# \  > #$`# \&#6 \&$ف> ސ#$# `xύ 0#$ `@χ 00㿈 \`\``8!<`a   Ț`C @> > &&`(# 2!` `$` `@ ) `R`a`"O#`"   >  aL 0  /#/ ?//` `@ : * 2 `>   Ț`C > @> ȁ`# @C 6> &# 0> `  Ț`C @> > %#`2$ `"    >  ah 0 ``#`"[ `"x  >  ` 0  n  `5d!b݀ e>  І@> > pH/`@@ > @`l>4` \`"E Ho&4 @(@g @ D&L`< H`$ HHp@`q>  L`2& ћ"  `W"j# 8O0W`!!"h#(#$` "#`2  І@> В%'pH`` > @`l> `&`(`@"$ (`@ ` @$ @Hp@ `G 0 #e#[!2#$> i#$ a. 0 L`> X#0` 2 > pH`` > @M`l> &#L# `> 5#T0#,` 2 > pH/`@@ > @(`l>4&#'# `h0d# `a-0]}`< >  a(Δ 0L 0`!&#   / =`` a"`\㿘> `` ׫a  㿘"  __ , 0 > OHa?`$a a$`l>a\4`\$a> d,`h$a> b\$@,`i,`j`$aҞƐ`D  ݰ !> Ҽ$ ` `l0㿘1> : !!㿘``>  D  \`2y&`4! c  `C > `!8 @ `B> !>b\@  & 7 3` @Ho&4!(@g!`h !!䀠o `<"`(`@a"r a (`@ a! &!!@Hp@"`2!!PJ 0> ې#Ȑ# /0#4@ `@?A >4 `Ho&4@(@g@D)H`#t HHp@ 7*`<"!@ "!!`&!#] 7!> Ś ҆`> Ά` `<`<&` (`@"3   (`@ `@ @> pH` (@ @ > @`l  `C > `8 @ > Hp@j  P`<㿘 2@1@* /- /@" @Hof(@\`@^0\Hp@>c& l g\ 㿘>4>`> > `p!)> Ho&4b(@gb`͒ Hp@  @   u !p )> ې p"a` nb(@  `r & a$aHp@ 2  Ho&4 @(@g @ D6F H <& (`@"6! (`@ ` @! @H` (@ @$@ l```C <` 8 @ <`Hp@0o  `@ 6  <@ q`"#! HHp@  " "" " " " " > :a؀" a  @(@   @`㿘 2 00`@  $ ?  ^ 2& 㿘  8  @2 2  2> 2 㿘 {`yw0a5'0 a6! ` `k &`&`&`&` ` @``` `" &` ` F`C&&@ <&&@5.  \e  @ "`$ "`$  ( @@ 8 `$ " ] &`   Ͱ㿘  \0  " > " " " " "   &  㿘@ "& 8 > >!``/ 2&   Β# 2& > !0㿘  `` ` ` `X@? "P a> '<a'  H !5#<' H2 Ѐ  L @bQHo&(@g 쀥`2`"` Hp@`` ` `'@`` ` `"w \`  /`  0 H`o``  `@ ` ?  %  i 2` s V  @`= C }=  $  < @C=  V ڐ `ۀMb    @@ =  A0ş@ H4T  U> @" @@} ,@ @ = `  @(= !` #"?G؀`"?`) @ a a%`!7%!(`@ b%`"%" @)= @ $ b%`"%"!H㿘l ܀`. lHo(@8$c& cc4$c$c$c`$c Hp@f$c& cc4$c$c$c`$c  Hdc8c40> > ; `d>da !(㿘# aZr  A $"`  0> _!!(`$ l$! ?`, h4 \>>aL$!$!  2$"$!ͳ$ېa  Hof(@ >  da$ ` da d ! d$Hp@  g > Ho& (@g 2@01@   / `  /Hp@ a{@"" Hp@ @9@ `2 /  `, ` ` ` ` ` ` ` ` `$ `(ଚ """"D" H"$L"(P",T"0X"4\"8`" c@8c> `ܲc<@' ?"  t#`$#@ #> `2   "#  \@< ` > $#$4$#   ܀ ")### :#($#$# 2##`2 #`$# @< #@$#`$#$##`2ݰ #`## @ $#aה # `@ʀp  \#" p2 '$ #@{#< $  \@4 \# m  $#  (# `` L @#$# $`$`$` $`!<$`(`$  Ô  `*  Ho&4(@gq Hp@ ΐ @!< .-Ho4> ł(@g> Ű` @ D6f H `<$`(`@"p& (`@ ` @> p& @H`` > @`lHp@;#$#6$##$`" # #(4`@$$#$# 4`@#$`` $#$`0B!P> a4$#(4$# 2: \`O6*#@z#< 4H# O$#`& H  Ȇ@`C < A<  L`ɍ0 `<㿘#`  Hof(@ a a  ? $ $Hp@ b YŒ g㿐`0> =!X`А /@<`Ё!<@e`(" c`(@e!< 0> $#c2t 2`2 `\ 2`\אܐ A `` `ːА 4Ho%4c,(@fc,c`HaHf4a(ga`3 aa䀠E`<&`(`@a"C a (`@ aa$aHe4(f!,@c H`%$c,Hp@~ .`<ba@ a`$aHp@`@g<`^ 70`<,aa@@  @0` c0c`u$c00㿘>`0`` P`l`L> `d`"H c` c `"c @`2c `S cL@c<$c @`$c@{x$c&`$c`ă8$`|$`xHo+(@`td &`tHp@ Ho(@`LbQ$$c4$c4$c8Hp@f`LbQ4$c4$c4f`t```H@ $c8#xؔ 0-   $cb> !p`\4`\ 7  W(c"b@`2Lb$㿘$ "$$@&$$ $ @&$㿘"ԟ@> c<' p * > c0 `  + ' >0` )`  )  `  |)  2 )> É `  >  >)  ) #㿐` @`` `` : ``` ``(`@@: @"@1> M!`(`>"̀ހ`"h$$ $ (@Ho4"̂(@g"(&"̃Hp@"̂`@q```2E$$ $"` @  \Ho4"̂(@g""̀JHo(@?c&"̃Hp@g"̀ s-$@ g@$ ""#\$ Ho&4"̂(@g"0@(@&"̃Hp@㿐  2"`!!` ؀ ??2؁ (`@ c& #Ȃ$##`$#  ` `(` @@ `!-` `Y0`! ` "$ 2X'`2 ˀK "| & & "̀"$$,ݒ` ` "$  ` `2$0@w  po b !,р0`!  & & "̒ ""!@  2# $`  l` """̀` "  `" ) @ a& ![$! ʰ((  c& #ȂL$#  -,@,`,`` -U, a / /O,㿘> 7cP>  @7cX  \&"Ђ&"6 \  T2  p W2p   "#  (`@\ c" #Ȃ@&#<&##܀ 2 #؀ 2&#$ &$ &$Uڒ &$ &$$( "$,UҒ &$(&$$$, Uʒ &$, (`@ b" #( &#( (`@ c8" #x&#x b" #(&#( c<" #x&#x c" #Ȃ&#㿘> `h 8"䀠@6@"22"Ѐ &"Ѐ`2$$"$"$##%4" ` ` ` ` ` "SÔ  $$,@x #$$$$$$$#$#> a4$$$$ > > ; `h>da !`㿘$ S  H $"`  0> %?$ l` 4 \, h>>aP4 > :$!$$! >, jc$!!`!$!!`$#|!`$#!`$!$#,#  Ho&(@> hh`$$h$ h$$Hp@ g> 㿘Ho&(@g"> (p&"̉H/`@ > @`lHp@㿘Hof (@g 2@01@ % /`"  /Hp@z@!{@H@"; Hp@@@t @ `2ٰ /װ &"`"`"` "`"`"`"`"` "`$"`("`,"`0"`4$ "$$`$ ,$ `4 0 $ lHp@& `4 ` ` ` ` ` ` ` ` `$ `( `, `0#&#&#&#&#& #&$$,` `&($,` &,$,`&0$,`&4$,`&8$,`&<$,` &@$,`$&DHp@ \`@6 \h 㿘"Ѐ` Ho&(@$$ $? @$$$$Hp@ʏ S g$㿀> 7cP > @c(Ho4> (@a> `h!> ?aȰ7  !0`Ȁ`8Ho (@ğ$̃Hp@ԟ@08(`"Ho&4 (@g (@耤`(Hp@`"'̂`$ @``  (`@  4`Ho4̂(@ğh$̃Hp@  ̀2O  `"S ̀h -,  @t Ho4̂(@ĝw$̃Hp@ - /. 8$```d $`$`<`$`(`@(@ q ( g "`> a4$`(@ ؔ  !Ò Ho&4 @(@g @ D& `< H`$ HHp@@+> Ȇ@< L`.`$(@`<2̃Hp@`` $`($( W8@@K  `, -@̀9> Ho4̂(@g̀h&$̆$̃Hp@2̀` , `  #\ @r# ϐ   % %``8ג ``"   `|ה ,`$`4`  !*@*`*`*`}4```% ` $$`?$` ( % ! @ \``"`ku(`` $`$`$` H`> p` > `l@~!> Š  `0 `2 ̀` *, &` #\  p@q U ! !,  $`(`@"G$ (`@ ` @$ @Hp@`<C <@ `<؟@ (a    ]$  ("XȆ@< L`50@> "0 `<@>  "(0 h(Z`:$`0 `` |c@  ` @% :%`"(`  (`@$̒ې!0ŝ㿘bЀ` \`@` 22<` 2<@]^`(" ``(@]X<> 0#`(6````(   ? 7 Ѕ<`(@(`(`(``b̀` 2c` (d f " d( \ "`> a4$d`(@c ͔ Ho P(@ [`xa`Z cc̀&`<`2c`<&`(`@c" c (`@ ccȄ$cbԟ@`=`C   /'!X0X``d P a 0M6`a 0>  "N| c` @&`$c.`<ba@ "ba`$aHp@`c`@$c<`` aa䀠`<&`(`@a" a (`@ aa$a 7a`<` 7$c0`<> "p  ! p> c<'  Q@\ S@"R"WZ@`J@V@""Ƞ? G@F `M@0`L@K@?`!;0 @*R"ݠ *  J  `G@$$$Ho4(@g  Hp@  OȒ 0`N@b@2?#x &`L@W $Ho 4 &$(@a&$`d> 7cP > @}cH#ܢ#5! "z" ``(!"$ $@ P" !`7 ##̀6# <" (`@c" c (`@ c#Ȅ&#@ T&@-Y@N?WW H` Ho (@"̀`@ @Hf("<?c@&"̃Hp@0%W/  >:$` (6"0Ho o(@$> 4 &$ &Hp@ "̠ &W   @4&"V ` 8 Дx р> ;a@a@Ѐ@j @"f `2@"@Ғ 0>  X"0 &Vǒ $, Ho (@a$,@q30{a$a^"́ge"$ &  LxQ "N 0` ``  $@@   > #`qHo4$(@a$ "$@&$@ &$Hf4"̂(g"(&"̃Hp@09* <" @ "@!`&! #`@&#> @!` !!䀠P <" (`@a"a a (`@ a!&!@&#@0 ) N  0Ho4$(@a$ "$ @&$ @ &$Hf4"̂(g"`,&# (!"@ 7>  0X"0"@n 7>  0N"0hV < <㿘Ho&(@g"`<`@6``<&`(`@b쀠"% b (`@ b#(> p&#(H/`@ > @zh`lHp@`<㿘 > @z~b>  `l> #h㿘> -`p+@)%#p 0H`(@%> 70 )"   p&p W y퀌 @%,怌=߀@6؀@р @ʀ@À >  ` @* 0@`(`0`@ * 2 > c<@' p` p> @`s !@ * @ > `0` @ @, , ,  ,> [ `@ >  , 㿘`$|(dj&$|`   0> :#$|$j&$|㿘Ho4"(@f"``$X$@`   `2 L`@?,$@`4Hp@*   & ]( 㿘 Ѐ` ܟ@!` H`c` t`    "Ѐ@ 2 t Y0㿀>  tc<' e l`: "7 Ѐ@23 `l`,*9``n  =$` ``$ e $$` `c  (0ݰ ( )>  `" " /`v `` `"`"` @ ް*0   0 㿘Ho%4$T(@f$T "$X&$T$X ""&$X"̀d""̂{&"̃Hp@㿘Hoe(@f  ܀ . l& "Ѐ@ Hp@ XHp@ 㿘>`0` St iHoeN(@`l`"S` @4 2 "܃Hp@ `@">Ԓa$0$$44$d$$X ` ` ` ` ` `?$$0>bp$$<$">>a0$"$"$$P$"$$T \`@4 \`Ē $ |8$ xv&`܃Hp@f`l`2 `܀`" bЀ@2 Hp@㿘`܀`" bЀ@ >  #@9#c@`/&cb@@2> @2 Ho%4 `(@ fb`c솀@@`>`&b&cHp@ b"ΰ   b  @ @ Ho% (@ f ib@&ḃ> > (`@ (`@&b̃Hp@ b2k ~lb̀N  dP(@@2 Ho (@fb̀  } Hp@dd(0dX z! dX`퀈`@! &d\ ?&d` v6dfb̀`"h(@@b > `0#єZb@@&b̚@&b̀"? r t Ђ~4" t 01`0#=be ~d|dd`6dd[?b 0@ , 0w<df`sHo%4 (@fb@@T&b@@2df`c솀`@&c>`Hp@  (dd&d`6dd `! dd(0`n 0` 0` b6dd(`0`@@b̀@ > `0K Pb"  ta2 ra((" t > ]`L  0+@&b̚&b̃Hp@ 4Ad\@@> Ho%4`(@ f`cb̆ @>`@&c&b̃Hp@    )&b@@b̀@~ > `0 vb> `0#e` ` dX@2&d\d\!  d\dX&dX b b̀@Ho4 (@fb+@&b̃Hp@ "Ubd`(@ddd\`&d`6dd ` ddB(2Ebb@@% d`> H 8*`0 bd\  $+ > `$ d`)df (0`(`0&d` 6dfAdX 2! b@@ > `0f#b̒`0a#0C&d\ `@ &d``@ &d`2&d\b@@ > `0= hb̝㿘"ЃHo%(@f"̒ {4&"̃Hp@㿘Hoe(@f"А   (MHp@㿈"> 7?c<`H' `Ha $T c@@ @ @ @1 (`@d0 ("`@(Ho% }(@f }Œ 8  0Hp@#`&#ɚ)#$@&#$ή `""$h  "&$T$h`` 6$hHp@`?2%% &$Tz  8;`(`@d0(U$h`  }//(088;`(`@d0 (=  }*`  * ~+Hoe(@f 0 ? " :  8?  Hp@$#@ &# 2$h,&$T*ɘ /|  `H`2 # ~`&# u6$hHo%(@f  ` "̀d" "̂d&"̃Hp@ >  㿘 ܖ ?"Ѐ@2?`P@"0$0 U@^X@"X$0   `R@JW@; `O@T@O  6$$P r  O 'Ho%(@f$0q $8$$4($$8$$ 8` )  "А!@,  l`(#x`6 t  @   ""ЃHp@f> 8Hp@ Hp@ # ( p`&2pHp@```  ``  hl " 0`(`@ c8$`#x$#x c<|d 0 `" 0!" (" " $ " c" 4* " ,㿘  , "c  $2 "2`& "@& $   c & ,`* @+ (@ ϰ  @( 2 (& ( 㿘 @&@ <&` H&` D&`  8&` 4&` &`c  $(&``@`&`2`㿘6 & 0㿘@`"` ``6``` @``"   L! 02 L ` (``L0@0`* " " \` *  㿐 #\#`㿐\#\ #`㿘`   (` @?߀`  4 `& 46 `  ` c   X2 (( TP*` + P@ J   : (@T`PP@ 2  2 @ Ң@`"* $``   (@ , .  (T@"0T1 3`#@ L * & , `1 Τ ̐  @0& & $ΐ 4 8 < @@& @ & 4& 8 (@@ & < @ `. x'L  &`` @``  *     `2   @``` >  M" 6 o  '"  @ @ ' (  ,, , !'? X ''ܴ '''؀2 @`` `' ܴ(@'ܨ @ 0!ނ` @耠@    L,`@ @@'䐢 h@`,`@`V(Q(R`,`(/@`耠"F @:B ,@@) `TP@    :! ) @T`P@؃-``(T@?03`,`@  L`(& -` (@@ 1 @ .  @'ܴ(@''b  '@H | % @ (% Ő,q'c0T) `] > [#@ >  T#p'@  $ @& $~& " H `2<  H @ D <@& @& H & D& <L @ 1@`` @`* `>   #  `>   # > # H `2`   x'L ` `(`@?'H` '  H '  H '쀢   "  ` %' @- `?,,, 0`, ,  `'`6 L`   X''  ''؀0L@/@,`T`'P/ @*@P@{`  @ @:$@,`@T`P@P@2@ ՠL@`e'L`` ''ܦ$, - &?5 `,@8 $ % %   ," '- ޠ? @: (@@*؄'. ؃.`(T@5`0%@`& u  p(m c0Tܢ$,@ `,`&?4`,@8` $ % %   "  5'`,`ި? $ @& $`& & $ 4` ܢ$@ !(@@`,`&?4`,8` $ w% %   "  '`,`ި?` )'` (@@0`,@ $ M% % "  `(   Ԗ( Đ%$%  (@@  @( @ `.  @ <@& @& <`@6 DH " 4 H  4 8@& 4& 8^' H`& D& H (b   (E   ( 㿘 L A A 㿘`4 `  ` 6 ` `(`>$'c  ? ހ (@& L&& . & . Ӑ"`ϲ (` ?  & LAG  b]8נ Fc)Ѡ >bL >bL 㿘 X&@ \&` `&` dc&`  h@&` l&`&` +`&``@ `&`2`㿘`  (`@9 64`&` & &  ,>  c`" h`& ` & ` @ @ "@ ` 8 1> c# X \@ & X& h& l& \ & & > c㿐&``    @(`?(`@  `2   @``` >  & ( &H    (% z%l ^(((& & @  `?& ((`& ,   @  22 ` , Y  ` ` `& ` & ` @`G  ,& ,`ۨ . ( ,& (& ,@ܺ Ԁ` `"  8? >  X| % "%  x % #  ( @& (& , $%  X ` d@@ & `& X & \& d& H > –c">aԐ 㿘@``"` ````0 `@`` & & \& & &@# 㿘@ ?Ó  >`p 㿘lĒ > 㿘`" `` ` ` `0`` x =  >>ap&`(&`@&`D` >  @@  `X&`&`X&`\ ` ` ` ` ` ?u 㿘  (` @c@ ``4  &@ "  ` 0   ) ?) ) ) 8`) ) & ,& (``&&   @ @& Ѐb@ `?(`@C 27 8` ,9 ` &  & " K $ Y $ D@'`D"  & (& ,@ π` 8R> > n "6@ ,$@/$ ")  ` d@& `& d X \@& X& \&@$ x" (0k & (& ,  ( `2 `@ " h&@ h l@& h& lϐ& (b@ & ,` c">ȁa 㿘@``"` ````0 `@`` & & & &@ ʰ 㿘@ >g 㿐`" `` ` ` `0`` x <  >>ap&`@&`D&` @> c#`#\`?   @   `X&`&`X&`\ ` ` ` ` ` >! > `t2"耠@2" \ `A2"{ `2 \(`0`` ``"5  T`` ```2"H ` `` 2"@ `"A``"=2"`2 `  ``"+2"` " ` `"2"   2"2" ń2"`ڀ`Ղ``" ނ (`" <"  `l"  "` h@? k@>kcH* k㿘"@" 2""" \"yp6""㿘> 7cP>  @kX`"h2"!`"`"! l!`#"h  D "   @> ` `  a؀`" @!֒㿘@7tbH/` /bb؃Hp@Ho&4b(@gbb b? @$b$bHp@bhn <а 㿘# ;#  O $$"2" > ֐ 0V>ÂcL>$!>c4$! !$!8$$!, k> :`$!䀎0$!"?h4" 4 \W$ U$!Ho&> (@g> tt`$"t" t$"Hp@ @9""%܂w$ l 4"4 \? , h, j&N D f $!㿘"h   ` " ``  2  >> ;w"@ %<;  :   @ܔ   `> ;T"@  -L`` ၒ`2N@ǀHo4"(@g"{4"Hp@ >a@ 㿘> > ;"@ `t@7㿀> c<@'  ?6  * ` `0Ho&(@\`@D0\Hp@ @  g\> zѐ > >  z ߐ {0㿘? 6 k  Ho(@Hp@V`!  g0> ;"̂b &`8&` ;"؂b0&`8㿘? 6 -  Hof(@`A `"`!j  #`2Hp@g`A"`"!` a؀"Ȃ`߰ ݰ"!@ Ҁ 㿘? 6  ' Hof$(@ ]@")@8 a @"b8F0v@ `[@"b@6Hp@g ]@```.`\c3`\?`53`\`\@"F`l% }@G~@ΐb`uba 3b @!@bbh~bHp@ b@`w@bb&Hp@ b`Jaiْ  "& && `h6`\6`|&`0b`3bhȐbeQ 0҂cҀ#`l`\+`h?` 3`\ ;`x#b `#b `#b3b~3ba`  @a؀ @&ba@  e 0㿘 \`A`A\ @`s )   7 Ho4 D(@g D ה  ` @3u F!`+`!!䀠E `<"`(`@a"B a (`@ a!$!Hp@  @@< <`CP<   *`<"!@ !`$!Hp@ @< Hp@  7v `<㿘 (`&   (@g> ` !"`"`!gF `4"!W @4"!lZ ""Hp@!` )"ဈ؀``(`@< a$`!$!Hp@``   @< @ ` @8`2` 2`倦 Hp@ #Y~ a㿐? 6 Q  ` lh@?    `!| 'h2s ` @8 YF$ $@  "@<` @  ` D "Ho&s(@  Hp@hN> pH`` Ho&X(@ Hp@@< C   7`!   ͖( `j(``$   ( `(; 7 ( 7     < `(  ; /gDg> Ś `Hof4 @(@g @ D" H`$ HHp@@< L` 7>4 ؠ` 77 `<(`@"$  > < p(  @`$ @H` (@ @!> @c)`l@<`8 @ ``B @> Cb>``@>` `6``@>`@8`C>` .<ba@ "  a膀`@&a>  a膀`@ 7&a>   ?77&7  ]     7@> <    6}㿘 "   . 5  " `& &   5  2     4   `& &  4   2 㿘 %b쀠" `@ 2`@? `2 $   @ "4&"ڄ H )` > ' b쀠2`"`@2!0 @$ `2!0@( 2`@  >ȁ` 㿘 %b쀠"``? `" ``@ $   @ "4[&"݄㿘   2 '`" _@ `( _< ` , `!, N`.`4  $`, ` $` $`, ` $``.4 㿘* "쀤 2    @:  2   ? @$$ " &"3  㿘 7 `"" `$`/  ) `" ``  @ 2 @  2 ;?  @  "  2  @  2 h`> c< '    0̮ܬ7b쀤 *,,"!'&^   0^  ^  `/ @ /]D ( ,`&` ܢ`(`@҂,,@&` > r 㿘 #b쀠"  ``" `$?`&`  @ "3E&"2  ߂"Ā` `?( ( o"㿘"""" %b쀠"` ? ` $  @ "3&"""  2 `@߂㿘* "쀦 2   4     @    㿘* @b쀤 J" @ޔ   !`2"" \  " , $    `2 $  , "":   0  ސ`]  $`M,` ,`  $@$`  @$ "`&"":ȴ   0֔   ]k  $ 1, , @쀠`$ ` b$ "&" 0  `]M  $`,` ,` `$@ `$`$"`&",` ,` , 㿘 H"耠2053@2 +@`'``````` `````†  . 㿘bH 5沖  @`    9 \ޔ `+ 膀`@&> @``\`@"@ b `䀠6   @`2` @> 㿘`  h > Œ 沖 a "- &a<`&(6`D  0 `@>```2 0 @20 沖 7 2& @> 㿘 H` ` `  t 7 C`Ho?(@`\`@D`D : @<`@8`CM< `+ W "5`$@b }Hp@ tHp@ g`\`@2`D  \`@VHp@ 2`` b耤 Y -!䀠&)`!膀`@&!<` F`  \`@"   `†"2!`c"!`"!`3  ~  ' w  `2 `  % r0n`@<` 㿐 沖  f`d\@ؖ Z  $ $  `,` @&& 4 @[t"@4 @&&  <)@$@4 ?4 , 4 @[[4  [D [@[<    i  [0  _   [&   xtp㿀0`` ( 0a"` .(<T`؀``l@Ho(@g9Hp@ /  `8/  2)`ƀ  }*0b(0`c`h    `2C`l`l@ L1    =Z    3Z{ Hof(@gȒHp@  & #\ #`#dʚ 7> ńhD` DHd> 'c<' `d\`#\#`̘ @ "M !@R! O `Ӱ 2H; `> =a"{ v ! ro> a4!8@ `  #\#`#dm 0 ` @`    ΂``T l"R'ذ @ > . 0`․`  ` @` ΂`` l'؂ '/'''''/ؒ  p 2 3 l2 `֒c ֖ l'*  !@   @L 0'؂ '//'''''  C `2^`3"``l Ho4a<(@aa<@آ _`$`[`W``̀2*> 4$`̃8`$`'``؆@ C B<@@ '`$` _``І B ,&@ '`$dW``@Hp@F ` ޺  `ה  2 ݂ c'ǂ@ c'ăHp@# m5 `В`  3 `  x ` n'Ġ`@j5`Ġ`pj-`㿀'T `  (`4 !b݀  `   4 !b݀+T Z  i*0b6(TT `뀧  ` <@> ńhX` X `'4 ```<>0c`@8` `ǀ b|@ @9 T0`cT`(`4 h@ T  4  p ('T ʸ>0c` @8` \  T˘ T  ` b  ~'T  X(T V  r'T  XzT6 'T > ńh  `O 0`<8 > ńh`Q [ $ \> ł`h`t` `t? `> 7 $ht` t  5T @2 @6  \ @2L"@'  T ` \GT T\ T "  N `  4 @WT4 T (#d#\#`k j ’'T % @W " > Th`  \#`#d #\B А > ńh ` 'T  㿘> 7cP>  @Za耤  )a䀠+a膀`@$a< o `X`X@"  `†2`\ c"`\`@"a`"a  ; 2 7 Аu`M  ږ  K "Ӗ  B`2`.  & " `  `؀` "`l@Ҕ 2 32 $˶  @s<㿈 \`@e  `@> `"蚃@8`C > 0U S @2 `"` `†F`` B  T `"` `†-`cĦ b"*  \ @  `  ` `^" `  ` `^" ` a  ^  m  c2c "` \`@"耢 2 y "v @2 `"  `†h . a = a` ؀` "l@QHo&(@gN Hp@` ``W  N @> Hof(@g[Hp@Ӓ@a8` 㿘 \`@fސ"̐+  \6 \㿘 \`@""`@@6 \"Ā`gX" > c<@' ` 1  H`5@2+ "耤`2`% `" `2@`  @``@`` ` (( @ @(`&` @ >  @   0 T n ` &`  +n @r n` `mg @``0@ܔ  / / 7 7 7 7 7 /7  "`$ꆒ`$`B- 0- @ @(` S” n ` &` 3n @. n` `m# @ٝ``0@٘  / /777 7 7/7 "`$B`$-- @ @(`m&` -- @ @(`f&` h 㿘"`" @`b@`"`@``` (( @ @(`&` X  '  b耤  `0 ` SG X n-`&`pX$$ $ $ $ $ $ $ $ $ $$ ($ ,$ 0$ 4$ 8$ <$ @$ D$ H$ L$ P$ T``WV @`0@   $ X, $ "`b@ , % `, &`$ ( `, 0 `, 1`$ ,`$ 4 (< H 0$ P B$ T 8< 8 @$ @ `񀠠"` `$ ``" ` ` $ `ꀠ`"` `@$ `` "` `$ -- @ @(`) &`b@`B--`0 @  @(`@د` `0@ت` a$ ` XX, $`R օ-`&`@`ͤX$$ $ $ $ $ $ $ $ $ $$ ($ ,$ 0$ 4$ 8$ <$ @$ D$ H$ L$ P$ T` `Wɐ-- @ @(`㿘` `` `H`@` ` @`?&@&`( @`` H耢`2`0 ` `@2@>ԁax> > ; `x>da "X㿘# b &֤  @ $"(p  d $"$"Đ">Քb`(b$"$  b²$"  0> %>Ղa$ l$!>>Ƅc!$!$!?т , h$> :, j`$!$!  D 8 Ho&> (@g> xx`$"x" x$"Hp@ 㿘Ho (@aHp@㿘> `x 9Ho4(@g ؀`2؃Hp@`""0`(`@ a"`!$!Hp@`"  ap> c<@' Ho (@g H@>80 a@"~ \(m =@> A@B@?@T> S@.P0 O@t800aC@D@w >`0`/q or "j H`5@d !"  XZ @S M@>A@F@N@F >`0`/@ >A "9 H`@",1 S@;P@=>@@bE@" >`0`/  > 'b@r# $` cɒ@ Hp@@ > b@` >`0`.  0>@SB@0aX@ڰ  H`"6 ``X6  R0`. V0. T0`. d. b6 L. (> 0&$ B6  8>(  &4&0aG@<@ >`0`.  "  H@` b@`>   H@ 耢 2 0   2 &  `X.$ `"n @.% `.&`&( `.0 `.1`&,`&4`>8`&@`>H`&P`&T ``"` `& ``" ` ` & `ꀠ`"` `@& `` : `6& `0`.5 36 ".  H@2* 耤 2 $  !   2 ?c  `2 @ 䀢 $  $ 2     2b2 h" h2  +`0`-ݒ 耤   Ұ   0@՞  2 ް>`0`- $&&>`0`- ">`0`- b      0@`  2"    ? $$ % x>`0`-v tw "o  H@o`2i b2 $ $2X `0`-S QT "L  H`@2F 耤 2 @  =  2 ``(!1 ` . ``$Δ ;`h`0`-  (z$d5!c \`20a0 `8`2  $ #N y " " " "   " " $ H耠`" `$"  #5 }! "  " " " " " `" `$"  \`9Ԓ @l \`4 \7!/     @W \4 \7!  $ 0`"$ @  $  @ [ $ Ւ   $ ( {P! h`u  0p㿘 "耢`"耢`b?   @ $M 2Ho&4"(@g"" "? @$"$"Hp@"@װ Đ$' 㿘  H``6 H\`@耤20@2D  b  c `"`†g耤`1``@`,` h`2@"@  "  T @ݔ 2 @  b``T ܒ@̔  "@V ܔ  ? N Ho&4(@g䀠 <& (`@a" a (`@ a&Hp@> pH/`@ > `l@PR >  @Җa 2  ``݀`8 氰 ``† 沖  ޒ v  ِ N= Hof4(@g䀠 <$ (`@a" a (`@ a&Hp@> pH/`@ > @O`l h`耤 2 0  h`2&  a<& ( `D ߔ  `6   `@8` 1Hp@ `B ݔ n``D  - ``@8``C > 8 @ >`& `<& ( h; `6 `D Hp@ <` x  > ݐ!(_ <@  T|444XP@tX㿘`` ` `(`` ` ` `7` / @2*`3` ( /`+`*     +     *@  >`````(````7`6 / @3`*`(          /`..+ +`@   ;````) (`@(#``(`3 ` `!(`3"`"`#(`3&`$`%(`3$``(`3 3`+(`` ` +/00`+)++00`+,+-0+*+. 8```  `"0+/ +/ +/ `%  뀠`2@ h`2 怠`2%"0 䀠`" ```"   @ ۅ(    䀠` @+ @& 8 ? ( `  8?`   8 ?@` @    (`?(`?㿘` ` 倠`   倠` p 82  82 㿘 . . `#  `"   쀠`2 . , e  (     * , .6   > > > > 6 "6 $6 && .   ".   `  (  (2(  ((2(* e  "``   㿘 `.  x   2% 7c(" 7 @ږ#  @*b@8 `? c@  `?c   2 " 2  "a@4  H & H(`@*`>܁bT2`>܁bT 㿘 h`  ` `Z\@.`6`ۑ h" . ha*`ғ2` `& " 2 2㿘`   P . . & ``N P . & 㿘 †@. `` `Ր 8 `&  `" . , 8 2" 㿘` `  6 (``  ``"``` ``" `` `䀠` *`    "㿈6 . /6`@. /6`6 . ...//66@ //////6`6//ѐ`?㿘8   `Ͱ ` @o`?㿘`/````` `   ϐ   ` ` `$`$   L `†` `䀠`  `` ` 㿘 ``> M !@㿘 "  |    |`[c h㿘> 7cP>  @M;a `  ,0` `. g . 㿘`Ho (@g o \`@k!` !!䀠b⫒  ] B` ....."*> +`+`+`+`2+`22`A`. 4$` &2 ` IS &`$`$`  ,`<``.`!􀈠<`!!䀠E `<$`(`@a"@ a (`@ a!$!  `>C B< < Hp@".> ސ!X.& 5$` '2 ` 'I ` ,`<"!@ " !`$!! ` aa``44 4  B 4 ///// ?//`Hǔ Ho&2(@``.`a􀈠7aa䀠, <$(`@a"4 a (`@ aa$a```>`C B<`<`Hp@g`a`$a,<ba@ 2a` <㿘\`@``@`` d```䀠`` .ݐ @ $ @ W ., 㿘``2`.`䀠` `"`h``.`@``&`㿘. ``  (`>ڄhܐ h . .  . `. / .  . $ `& Ɛ  .  h   . . . . . .    . . . 㿘 〠`S`#`" ``S ``W``O`瀠`"```O``  `? 􀈀 瀠` ``(` †`͐s `n ````†```^  `` 耠`R  `"`J `F `B `㿘 䀠@C `B `*: *`/`") .. . , e 䀠` (`>ڄ .Ր @. m! < `. e  `2 8 . . . X X*`2` , 8 . . .  8. /. x     R T V > (> 0> 8> @6 Z6 \6 ^6 X h& H  (؀ "4 倠`2  ? ? ? ? @'' 2 2> (> 0> 8> @ a6 X "6 Z $6 \ &6 ^ 2  2  (0*F % ( 0  < $ < 4 4  X 4 ( Z4 * \4 , V4 .倠 2@  2 (7 0  /  `" ` "# $x         0 & H`$ `倠` *`>@㿘  ..`5 *`/@㿘` &` \`" ` k" ``` " ``?.` `倠` `ϓց㿘``   & `".  . `߀ " `@".  .  퀎` 0`&  & & 怎`@㿘   0yb ` ` @  &   " 2   `b``@@``````|0*,`3`       ((@2`+ +`   * *`@ &`6` 6`">`&>`@`\@2`|`   X(o4 C 2 h` /`2``hWM `>`hbU@;㿘b@`"y  H@F "耢 2 0  2 `6   Z@"R0aP@"`b@aR T@IU@"j( @"pSP@BQ@ `L`   (`K4`V* @6Y@ ` 9``,`d(`@`2(` @"`T*+`VaS@`R0`. &`װ `, < 04`b0`. (`:b4`R  0`. b 3 $ `$ (`<b4`T`"` `,`L"`4`V .`.` `Lk> y _`X@`  6$ v$ 㿘  `  "  ( ":     @ ?& . && > ̐!h *`>` 㿘`䀠`8`(`>ڄ```2```2.``†" ``쀠`2```"``` `퀠` `` ``` .`.`>?``2`8``2`8``` &`.`#`*`0`†"&``8`"```쀠`"````"````퀠`2``쀠`2א``2Ӑπ2`ђ `퀠`"```" ```"````"```2``†`"` ``&``,[`8`% e`"c``뀠`2_`` .`&`.``퀠`  `` `` .`.`.`7`†`" e``X e`"D``뀠`2@``.``.` &`.``†"``8`JV] `†2````.``퀠`2 `````` .`.`.``"``뀠`2``.``"``뀠`2`.`h`v e`"Q`4`` "``X````  ` `4.`T`.㿘`h`  ! ?  .  0. & "`"` *`  L̐ ڒ X&  `& `$   `&  & . `(  >9q& 㿘 e`  `2䀠`  2 * ee* e㿘`` 3 * ׁ>ڄ,`2k`.`*`") .`)` .`-` .`.`+`" *.`2* .`*`") .`)` .`. e.`.`+`" *.`2* .`*`") .`)`# `뀠`(>`>`>`>` 6` "6`"$6`$& 6`&ܐ ..`g!.``".` .`.`  ".`p`" `&8 L ' & є 'A`pÔUp`` `%8 - & & Д &A`p6?/㿐  'P`P``2  P ;`P@ ?P  'P  AΒ`BP`B• `ހ (`؀ `(`  /`@ " .```Ph.``0+#` `PP"@P2PXPP㿘Hof4(@g`\@  Hp@l O Cb H ,] P .X 0 0v `",  "(G hE `C 8A X? @ ڐ8 H ؐՒ1 P ֐B* 0 Ԑ?А`\@ hR 0  Ґ / 㿘 h` HHo&(@耢`` `"@`@"`@`2` Hp@g耤`` Hp@0㿘Ho&(@g  0 "2 R2 V/?2 T2 b!#2 `2 N  "* d* L" z Hp@㾀"> c<@' `0"?`8 ?  a2  @-a@"    ? $$  "؀ 2 @ > T!㾀> c<' `0"Ȁ%"؀ ! 0`0%   ? 02??!@``0a??1@ 2  > 0To!㿈"Ȧ`e J⸀   $@S  2  @L  2 ؀`2` ``@2@ 4 ! @a2 @"`` `? $@$` 㿈"Ȓې 4N!  9 C` $`` $`@  2  @  2 `?E`؀$@ `$؂$`! a1 @"`` `? $@$` +㿘 \a"䀈`""ȁ "䀈`"{Ғ "&" {Ȓ  "`&" " kk `x* k>kcH: x㿘"ȀG"䀈`2K \Hof@(@"܀" "? @"$"܀`$"5("쀢``5,` . kHp@%$"$"$ l X> :x(@ `(`(`(@@(`(`(`(`(`4"$" g"ܐ~y6 \0㿘`h` +Ȁ@$`؀`"`l`l`\$l?` 4\`h`x`,h  :ax((@@@ `   *`*`@ `>@ @> 4҃Ho&4ւ(@g"`X> `|>  ,0 (`@$ ܂ (`@   (#@   (`@$`(>5 $`, >5$Hp@ ҃.0`v $`؀`2|`l`l> !$l0~`0`\?` u4\a4\p`h> `㿀> c<' >`0 `2@@@"{b*90!@n:@"Q7  > @u1@9 @2 bȀ`"  \`6 \`"x @  ۔ <ǒ O†`j}   `Ȱ   \`@_4 \0bȀ` 77777777bȀ 0 > ~+(b7< b = 0   ؀` l@-$ $ l bȀ`" |bȀ`x isq @\ 0jQɐ!ЃHof(@g/  \` 4 \Hp@0Ni \㿘`` Q`> `|?`&> (0`.`<(` >+``0` 8"Ȁ@2""Ҁ@2""ր@2" \`A`AN`` N&`6` D  o `c2  `\a"  \a-" @< ΰ  ` ` "`> `|`@6`&-  2 `@<` > `@3  " S ``6 ` ``&` &`&`㿀 \Ȃd 6 \!a"`"!AF  "" \`\`A`A"! D a膀`@$a>  "`2!`l ؀ 2 \{6 \ n `؀` ր@"iҔ _ 7֒ 7 <҃(` @7 Ô  6  | a`9 aa䀠X <$ (`@a"Y a (`@ aa$a `8`@C<` b" `@<` @> |" @v> "@ x, <b@ "  a膀`@$a_>   < ( 4 4 & (`@ a$ !W&!ԁ a膀`@$aB>  < a㿘 3  >c""㿘" i  ( ""$`  0> |U`> @k" ??a4"!>`$!$!> c$!$!? , h, j `4"֝㿘   > 2v>  `|> ;w"p   > 2i>  `1> ;w"> }"  `" Ho&> (@g> "#` 2 HH" hH h l H" lHp@ `?> (c`@2" @2p@ 2p㿘Ho&4(@g  2 #@Hp@ > #H> #P> #X> #`> (Hp@ 㿘Ho&4(@g  2  Hp@   ((@" Hp@ 㿘Ho&4(@g  2  Hp@ `" h#@ > #H> #P> #X> #`> (2 Hp@  l l l? @" h" lR `(`8 ?с &?*!*!?с*!`   ` *  > ;>*b("   >Fb 㿘!,`  V `? *`@Y,@ > > >  b8P|P+㿘V  !@Y 㿘 `@  > {"p` "  `  `@ 㿘 ``> {ِ"  㻈> 'X'P'Tc<@' {o "->   @>   b> b> b> b > 0|1"P'$z> |% `@ > |#(PNp"x㿘 `^ `UL  "u>  ? 2 &@ `'`%`"&@ `(`` :@ @4+ "b> `(`@`"&@`"&@ &@ `(``@(  @  "<>  `D``C: `52  &@4  2 0ԀbҀ`{т  `D ``C:ʂ `52&@ &@b`{2&@ &@> >  b80{S+;> >  b80{L+[> >  b80{E+L㿘  P P @81ֱ "Z>   `?`(`$`@ ` `쀢```0` 瀠`""@ ``40ѽ  2 0(`̈̓>`((`.`0`  8?83`ے?c 88@83`> >  b80zӔ*㿘 `  "cDcD`&cD=  "cD @``퀢 lb@&b㿘 ` 0 ` 0! "7>   `*  cp `( `@@ `(`0`+ 0`+`cvcr(6cv ) 0`0`+`+`c| @`46c| 2 0. > > >  b8@zm(> >  b80zf( %> <' @)@0Ӕ (> ;@0Βb@0ʔ (> ;@0Œb@085 > L̐"x> c<' ޒ !@АV !! ’V @VV @W!,`  ? * 8@ > L"㿘 @!0`  @&4$&!,!  786 ( !V VV @V  6 V !tIV @V  6 V !g<V @V    &!,㿘 " ؂` & ؁㿘  ؂`& ؁㿐```"   `-   ϳ(`0`" `> ?aL* @ 4 , 0`#5 2 x#j@"  x #@2 x㿀@!> '#<'  / > K"㿈>  <' `@  @ # T(`@` (``0`@*` @*`2`0> K"㿐  .@@?`` ` @ D  @Dy C>   `:    cl(`@(`@(`@@ 1 + +1 1 + + c!`4&cch  (`@(`@(`@@ 0`* *0`0`* * ct &ct2 r > >  b80x':㿐 `   Ö` s> ?aL* @ , 0`#J 2 x @ x #㿀@!> '#<'  /ƒ > J#x `   zܐ ` *`s`  0㿐 `    ] (`7 2`㿐 N`؀` .  @&`?x!> #<'   /ْ@,~\ > J#(x!> #<'   /ْ@,b7 > Jo#P㿐clc`@?` `( נ@ V  hc (` (  cl `(` @@+ , 0  +`+`0+`cj0`+`ck+``+``+`cl`2I  c2c 44`Ԑx& c``"R >t,` ,cXcP@`<&cPC>cX  ( c@ c0?( (> >P`] 4c#\   @ >cT`&cT (`h(`0`+ 0`+`cv0+ cw) cvcpcz6cv6c|6cp(`0`0`) )  ` ,, c , , , 5# c  @+K 4 @)h (4*  2#\?4#\    @j >cT`&cT*(0023 + 0`@@@ @?(`00`@@8 @4 $`6 $      & & ( > > >  b8xv'㿘 (`z`  e "cT   /6 . 6 . ?. c& cx"& ?  ) ) `,`) ` ) . 0 0) ) )   (``@(`0`. 0`) ct . ct. ct0`. ct. ctch`&ct&ch"`  (@`(`0`. 0`) cx&c0+@c+`c0`+`c+``Ԑ@ $    @Κ 2!cT <cXcP@`&cPC>cX x      ͩ( ` cT`&cT $ $ u 㿘`Ԑ @ch ̔  , .  @ >  Ё  ((`, 0`(`0((0( & |6 cXcP@ < &cPC>cXac@ cT`&cT㿀> `آc<@' !:``+? //>(("@ { 3ה````!̑cT`&cT@ > ۄ  0@' !0|00HL#x㿘 ͐    " " (`(@(`(`  #T`"cT 㿘 `" `h\@e 2   "lcT .0`0`, , bKbb`Gb"^(&bVbbc*@R<b(`0`0`,, 6b (@?o@(`0`0`,,  (@@(`0`0`, , @R8  `@R) 􀦀) Vb 沖 L " cTذ ή  2 cT`&cT(`0`0`,, 6b (b@o(`0`0`,, 㿘`Ԑ@v\&  D   e Hof4>4(@g>4`@D> <&  (`@"L   (`@ ``@> p#`@H/`@@ > @5`l  `C << @ < cHc@ `@ &c@>cHHp@H` H @< Hp@ "cDLcD`&cD <㿈` @ &  `W8cD`&cD "cD`؀"28 ``!2` D   e" Hof4> ł(@g> Ő` @ D&6 < H`" H @<  L`yHp@ cD`` `"`'@{>  0Ϩ  2`> > >  b80t!$U& (`@"F" (`@ ` @> p" @H`` > @4F`l  `C << @ < cHc@ `@ &c@>cHHp@'  b`o`m&c` 2l DWcD <v0> >9a,!0㿘1> >!0aHA > ;bC!0㿘Hof4@(@g@D $H`&HHp@  ~   !$ $  <& (`@"& (`@ `@&@Hp@> ;b@3Ű  <㿐`@  @9  8`@C9 `2 02` "cTcT`&cT|6 > L  cT``؀a` 2cT'a `"&c``؝p''' > /Ք/!> #<'  ?//''''' > E#x`"   <8@"'ܶ$u 2  $m   @ɐ ǎW 㿘Ho&(@g @b"> !H ?  `(`& @ ` h l l l @! h! l `!H`.Hp@ 㿘Ho&4 (@g `5>  p t t t? @ `& t& p d d d @ & d(`0`8& `0`"* x> c <Hp@" "ǒ  ð   @ 2 p> > >  b8rG"S | | |? @& x& | x | | | @ ?& |(`& x`0ĝ㿘Hof4& (@g& > c   Ԁ@  ` 2 ԃHp@s 㿐`` @` ` ` `a``" `` + +o^`D  `a`#В   2 @ 2 ` 2 ` 2 `2 `" " ` " ؈`" " * * `* " * ` `" ?"   @$ ```" a`` #/`` a``" @` #/a`@`"s$#h`"$#h`"o`H``2cTb`` 2ZTbt ؀`@N`0Hof4 (@g `2' > `?`(`$ p p t $ t>  `$ `  ` d $ d@`d ``Hp@ >  =ȁ` ``a`?@@"a  `0  Tbv}bx Tbbbd`@4#h`J4#j`D4#r$#l4#p`L4#v`P4#z`T4#x`X4#|4#t`\$#$#l`L$#|`D$#t`H$#x`P$#`T$#`X$#`\$#p$#k@ `````ڐ#> ?aL* $ x x |"$ | > Hp@ M 00~   @  2S Hp@ 4 㿘0 @8@ `@)`@!@  `@! `@ `@  @ p ʁ{  &ā4Մ 㿘 >  h> > ` H ! h !> @#` !> @!L!> > cT  > @0Ԓb> ; b㿘Hof4> ;(@g> ;b> @}!0> c &> > c L``"%  ` `#```"#` 2 @`2 @`2퐔  2 Hp@"ݐ #``@ "#`Ԑ 㿘Ho&4> (@g> c 2 0   `2 ` ` 2 Hp@ 㿘&& Hof> ;(@g> ;`! > ;`  > "@ @ > Hp@#В   " @" & >  @Ғ > ;> ol#㿐`) Ŗ ؀( )  W W% !  WE`,;#D `&#D`2`Ԇ҆ `܄&/``@# Ł``Ԓ ` @&&`&` >   > > >  b8o>$㿈 &S ?7(`0@?``2` @@*F  >)  0L(`I         (`"@"F `Yz, -`0`0xv#\#`+ 3  > ɔP "DŔD`&D O j ) 0  @     x(`@ (  `) 0`#@v#@`$6xz(0` $ (`6z8` h?r @,0`,vx"pt,0`, @6t  (`8`u r6r> > >  b8(nh((> > >  b80n`(3㿈 `>   `(`  ((00`(`` `    4 ` @ ` `c|(` @(`@(`@ $ ! ct%`> cxa c#d@#`#h#\ > @ "cDȐcD`&cD &c| `+`cx y c@  #\ > ݔcxK$  *@ 8 n`c|ctcx> c cl @0`0`-`-@0`-`-`]ctc|"6chcp00,,0,,  (` @ (` @ (`@v `) h`cDcc$0@8`&cx    %&cp00,,0,,@,c| $ ct> a`> >  b8mz&Vcl@&cl㿐 ` Ç   cD`&cD > > >  b8mS%w㿐  h`؀ `d ", , ?$ 2   !$ɸ  ! @ !T WE ``d> ΐ,  "@  `π"`Ԁ "cD÷cD`&cD @F@`D `h`"/``Հ ђ` Ȁ `؀`@ {1] ђ> >  b8l$<㿘 `@ ".cD (`@@)oV `(`0$00 @4``` E >  f 4cD`&cD> Z (cD`&cD `  2 > > >  b80l[)``6, `-` 1 @  `o6``怠@  b `e `?V``*`@I @ #D  @I#  2 ``o6`ӕ 0`4-`-`1 @1 %p(`01 0@  ؐ o$@6` ``" Ŵ`V``a@HȦ #> `֒ 0`@  `ܐ`.&`0pޠ V`> > >  b8PkԔ+㿘>  bL-/> +0;沃Ho4 (@g (``C(`Hp@>  cHo4 (@g (` a2(`Hp@Ho&4`@(@g`@`> ;@`> ;@+bHp@``b$$`@$@Hp@$ D `@G  2 `09 ` 6` Ԁ@2 ` @" `b Ւ "C#T; ` `/$@$ `@$`@Hp@$Ǹ %  ؐw0ؐ  T> m   `$`@$@ `$ `@$`@ߤ`$#T-@ R ` @("  R `6  R `  (``"  (``"  R `6 㿘@ ` &@ @((`9 8 @((`9 8`@? O@` `@N@`` &`?8NN`  ` ``+> w @#  @ @ (   @@@(``    ` ߂c@ڂ㿘@` T``&`` ` ("``T``6` `` @ ` L J  @  @HJ   ` ```2@`8`` 8``"`-`N8 "` `9V A  2 `@ 2 2@$%   +@ `2T `  "   "  @2 @D " <  2` `:` 0  ( * " `?" 28@ ( 㿘@` @ d L@ N`@  ` [  ((`@ & ?!@`(8``` ` ("``T @ ` ` (2``T @ *` ` (  $ &`"  (2" "  $ &`"  ("" " "  &㿘R ` R `6 2 T  `T `  T `6  2  ` `  l@ ` `א 㿘  p@> wc< : "   P* " ( 80& P& T& X & \& `> w& d>@b>& H>a& & && \>>@bH& &  㿘`  p  l $㿘> c@ > ( h4! h2( h`1> 3>  hc(`  G3> w  &c< h (`@  hc<> w> w @ c8?) 2)>   ` > > h#h#㿘> d    d$$ $ $  4 ,  `" $ $ &$    >  h@`0㿘@    @:  @0`㿐'> h4" ->  %> w> w8c@` &k8 &f$8J?`" "`" *J" 1> ;> ;@$ > `` #p"8&#,)>  `@`[@ `9`7h  0  /> `h @k08 0&  `)`H`" K (  2   !(`. @86  (8  8`@ > aH@8 !(`86  @   @ 8 > gx` Ւ @! ͅ(㿘c  2 `2   "     "  " `D @"  ``! ``2h  "` $` ` `  `   #           @"   `  , )  > f`  ` `! T P8@4 P@ `  " ``` > fђa ```   "   @d  2 k@ @;" T` `"``@"  @# S `H `"#```2`# @ "3  $@ $` $` $`  $` $`  ` ` O `t  $  @>  fh`0"|@1 $`<W ! ! $ ` >  " @ `  2`" > > `Дf?  # `" `"$` ( ` >  f'`P0> d!  d  ` d"! dʖ㿐`   n`D 0 , 8`@" ``" T ? ?  ? `@T  @…` `` ` &&. @$` ? & 6. `   `6 @& . `A `b-T 8`@]  P@/ O) 8`` `> m =R 29   "4W4 &- `2  "̠  8W `J +`P8`@ $$$2P$"$ ! q 78? j`" ``&&$``nl ``&&$` `d'  `' &p+`8` "  @""  W @4 `Q `U2 `뀠' `  @2 @8`@g "`4w @p v@@  @ 2 " >  dĒaP daW $ >  > d^!0㿘 [ x`   Q 2   2 0 h  2 ` v v ``@  v@ @: 0@v@  @  2 㿘 Ē 2 㿘 > wcD 'ހ`a  @'ކ a @1 @@ !(`! @0  @ 0  )  @0`  0! ! @ @/`    0 @1 '@ @ @@ !(`! @0  @ 0  ) @0`  6 !! @ @( & @0'@'1 '@@ !/`!'@0 '@ 0  ) @0` ! !6  @ @(    & @ 1 '@'0 '@@  /`@ '@0` '@ @0  @ ) @ !7`!'@0@'@ (` @ 0`@`' a6 &@'ނa @ @@& (`! @0  @ 0   ) @ !7`!'@0@ '@(` @ 0`@㿘!> w#D`  $#D "@ `h 㿘"  <`" 4`N  @ f  & 4> =a> D ` > D`6 `âɐ?c @ɐ `?  @`  @ @ `j @`@&`8`$`8㿘 ` @   `  ` @ @V   9 -` @$1`v v ` > `# 0`0 @2@& v`v @؀00Ӕ&@ ʀN`ÀH`0㿘  v`@ `   @` 0 " @2@͒ Ȓ  ꀦ@   㿘 v. v  R  "R  @J`>  @b$`$  @"   2  @   2   v@E@  /`2(``& & $` `2 `C `?@"8``@" 5$ $` 6 & & $` `"``& & $` @"  $ x2 @8`9 `4`2 aa!㿘 " "`  `? @&@&`  `@㿘   7> ;> ;c Q  > $  ` l4 4  l`$ l `! l$ "`#(!!!!"#",""!#<",!#D"4!>  `l 㿘` '    `  -``.`> `!؀`Z` `>( - "߰ 9 } & ``԰ ϰ `ɰ 8$ ` @$ o&у  `" 9bx l B    2   9㿐> `lT'T'X'H'L'P Q' #沀 B  `` 2 @2 " `2  "  @B 2  @8 2  b*  % Ζ H  2    Ѽ 6 > ;c  > `)   > ;c> `x* @  㿘  > `.   -" > ;c  > `x*`` > 0(@㿘   @> ;c* (0`@"2( 㿘> c@)> ;  " ` @ #" ``%#@ 㿘 <"k ``( 4\`  4`" v  ` `"  v& 4 ` ` `& 4 㿘> `x+>  c0)> ; ``%#l "`# "` @ # @ #" `@ * 2  )> ;c%(@ ,(@,` , "! ?  >`p c ` *@ *` ``@  ` @*  #>a\ 㿘. 6       "@Ȑ ".`.@`@7 㿘N`2)> ;# `%  " @ߐ 2 , (`$ ,  (,1  (1 0cP  0    @  ,6 (`  & , &&   @$  (&#`& `  `㿘'> |   *  )> c@ > b0 "   $ *   2 % |`  (` `l |@8 㿘 p 0> > `  S̐ p $ ?  @$ $    ? @ $$ `]ZS p 2    ` 㿘> a0> a4 p& ` #> (` $#>  @2    ? @$ 9$    ? @ $$ `( #> Sk`` T^ 7 p" " " " " "   $p p"" "   & ` > \"#>    㿘``4a" >  ` >@c> ]"@> ]"p㿘  > ` ? ]"㿘 >>  8,& 8 4`(# `2> p$ p( @  `" % t 42 H  1> R!\`߀`  1> \"0]I"> ]F"㿐#> ;c `   $ #\> >  Uc> !> w `t#H>+bcd#H-  $c > ]$"㿘> ;c    # > "" "  " t" tt   t&  㿘  `8` (`      %> x '> ;1> ~* x*x  } % x& $x.``  '> ;@%> ł`> `> `x3㿐 x   > > !\cU#\M> c@> > 0 4 0+`|      ($  `"( 2 +`| > \|#㿘 @ 2 㿘` ``'  ^S ``7 Z 2^ 2^ȓ_) 2 @  8 4" 8 `` @ 2㿘 8` 4 "  8`  $ 8  " 4 `2 4^ " 4 & 8 "% ] $ 4 `"  8`"  Y$ 4 4 2 8 3`` ` 0m$ 4`2 8 `2 8 3 3 0[$ 4h> c<' Ho4`(@a`  / `0` "` h "`4 Hp@@ > &` `` @  N " ``^ ް ``` @ ԰  4at `i>  h "  l 8`" 8$ h l8$ l 8 2]` 4 @ $ 4` @> p` p&  4a@ `"&`4&`4<&`84@v@&`00&`Dt&` t4&`,`4ݰ +>  Qa\ `0$ 4``, v@$ p a\Pb 7 aL `` @ " 4 2 4`4($`4`  `Ӓ 2r`0`, "`0 4 t`0@"2 4`$")`  Ք $ H h " 8 o a\PG 0 8` `($ 80 &`0@@|&`-#`!ؐ  4($ 4 `$ $ @ G$ <` ` v@ qP 2W``@" 4 8&`$ 8 4aA` [`0 $ h` @ Ւ "  h "    a\O 0` 0p@ `ZP8< PX v< X``, v< `"8$ l `4` `` @ " " r`4@%`4 @ K' `$  4@" h l " h hZ#("`@"`@*  4@[$ 4] 4> Y+#@`@ `"  @ `@ `="  `@ < `$    4@)8`/ 86 k``( 4\`  4`$ 4`4('%`4 v$ 4, v @ے` ` v@Ю ӀP> a0Ho4> (@a> `t`9> > `x` ".`@ @$(`   ? @$ -$  ?   @ $`.$  @N``` $```2`Hp@ )Xx` ?$`   @ $`$   D@ `  '  `v] ʒP> > `  "+    ? @$ 1$    ? @$` $  `(  @N `  &  "    ? & & 쒒 X  &  D@ `  '  `v ђP 'D D@D D''0 '4'v< @  D8`` 8D㿘 <@  4 ! #㿘 4@ l@  P'Ho`4 (@a '''''''''''''''''b   @ "  `"1'    >  ` ` `''''''''''''''''' @ Hp@ 4a` 8`$ 8Hp@`2 8  8> ' 8 `$ 8"'4b ''''''''''''''''' ''0'<" 4@'@@'<4 @2 0(>  c<'@' 5>`5 , 0` '''''''''''''''''`L '' Җ̀`@ `   `    7 ` h ,0`  "  8" 8 @@"   2 @`~@?ǦA'j ''  ̦ ̀8@!&8> Vv#@ ` @ @ `" &@ &<  `&   ̒ @ٔ 0&@ `̀   @ɖ 8```{$ 8`n0j> )א 㿘@` ``` ``0`"  @`- :1  @    $ $0w qy h " 4 8`1" 8$h4` ``*   Q$0h} * $hX` \` \@$\$hP> 7cP\>  @E`Yj L`  '@:Xb A "T   `?`;`8'@0> `"'@`$@'''''''''''''''''@  "Ȑ 0 @ 0Ƥ 3 > ` ʀ@   @@ "'' `" 4@` 4` A`` $ 4  >   `  l''''''''''''''''''  8>  w` 4k`?㿘"  <`" 4`  F &㿘"  <`" 4`  2 &[8\0\0\[[g hii4i4g g g i4  ` " `"" `( ` ` ` ` ` ` ` `  `$ (9  ` ` ``  ("`"` "@"`"`"`"`"`"` "`$"`("`, "` "`  "`:@㿘 @ &` =  XA , ` (@&` ``@ Ф   , `! @ ``  @  6.6.Ʀ  ¦ 耦ä †`߀ `'  `ր $   "蛒     ' '  ` ' P  D@> :a2 `f " _ `2X  'Ȓ  f`` ``"'` `$FX'  "8'Ԁ @2 '  '  'ԘC ```" ` `4  X0   $  `` `@&`  ΀ '''2` h4`< 4`T\`$`$` `ʔ `@&`> @c<' "j`| @. D  0  D <'''` '` @''`\`2& t`(  428 H   ͘`` `  ` `$: 4  P' t`" 4  "@ t "&/Ҁ ђ @W' 4Δ H !''''/ /''/ 4 0ʐ P$  v (`m,  8$ < <X4 |4 $ , 7` "`&`@&`> & 㿘 ] K T  X X     Y    ;( `K 0 & & &  @} ,  @`( @@&@```@      ,  ,44, X  Ŧ         S n 㿘 4`   > ;  c4ĺ 2  44> 'b@}A  #) $ 4㿘`  ;      * 4 *! '  " `8    '  " `0   `" @?  &`8հ  `2ΰ  &`0x e `a   '''܂ ''''`w   }Ho`4؂(@a؀`(` Hp@ C U' @@&& >_ 2L7Hp@ >    Hp@> `p  "`  %Z  `@ " 0 i>`0`(( "@|C"&7  㿐 T'T'X'H'L'P'> `l` #@`g `` 2@`@2@``" ``"`@2@` " ` @Β 2@` " `0 @Ē 2@`0e   i`8"`4 2@`4`2@ % b  "`    ! 4!$   9 Q 4` 4e `'    ! 4! 4` 4M !$    " Z  (@@"i@ (`88`8`4?"`4C 2W@`48P`㿘> b,  0 X4  @ 4 5> ;3> ;7> ;cD46`!$P> b,U`  /> ;`?  `? ` D @ D`? 2I@`? ? 5 2) 0'''X " `X04 v `(  a<0`":7  `7 > ;> ;cD4˖$` 2뀥`̀À @`'``@''' `X 0`$ ``?  a<0˒㿘> b,   h X4 !< 4 V \ $  `$ $ 3> ;5> ;cD7> ;6`4x$㿘> b,`ڒ @  0@ X0  3> ; cD0`5> ;7> ;cD4R$cD0`> 'P'L'T'X'Hc<' L''x ' `!    7 `>  `8   N @ ` +`W h (  ? 7  >`0`(` 4& X 61 @&g b - (@a^ `빸 U  2_ `O   "& x` `> ;0cF"````@  > b,.` 24  m  r @ "@̐w   > ;> ;> ;cD4$ l j4 h 7ca 0_ "   > " 8O H`. `"9`?8 t  D@ 'tx'`# |`"``#8  "*  眔  "   @ @ :  q 7`@t&`"ɢ @^ h"¢ 8t@/`  ' / T * >,|`H `x̸ C ̀?P$(̠ 8 8 `Dv`. <`X6`4(&x%` x3 " ` `   / `?̸    8`$ 8 'x 0'| ' D' t`]  4"'' !'''/ / H@'' H`/. '' `0" <"@' @@'\`"' @`'X6  l $   " 7 U \ S  4&(&&, v P(4. t&  "@ "/ t  @'J 2 ` 8`$ 8 "  `?`?2z   vK p|`  0  @@5@  ] X E ɒQ4 ` `À "|L`" @ "   ` @ @ `" $ @` `'` $ <Z`V H "J `"*  4@$ 4>`" $ 4($ 4$(c P <`X6 v`.  4& @`" `` @`2$ D`x t `4 txN X$ v(@$ X0$ @$ X.  Ҕ $ Hʸ 2  H>` H   4"_  4$ H($ 4k E|`"=w 2 8 p`@ v`@" 8 `" 8   |On  |<` 6; @J$ @1` 4  2)` G`2T ǀ `Ā `` 㿘Ho``(@a`> `\`K  G <>& ` i>`0 b  2]  `r$ 8y!> ] > ;c4$ w  `@6 Hp@    E I> !Q  Hp@ 4   ``` #@4@ ? Hp@} Hp@ $ 4` >     >  `  >  ` ||||||||~D|||$~|||$㿘p ":   `7 ' ?  / 7  . (@8  0`(`@ 8 @* (($, /p 4/l `' \'@ @ `' `@V  `2 $  ++$@@(`@pop()   2`G  `* ` B`2` * `` 2  (` @@2`` 2  (` @"`(` 2  (` @" `m  7  /  * $@@(`@olor "` <$@ M@  $@@(`@ot( 0ot#@ A$@@(`@ol0oz 0or? 0?@@0`@8$@@(`@0oz'@ol\ @@(`@ot0ot$@@(`@olor @""(`@ot 0ot* ``  (` @V2 @`2 @" @g" F2`' $?㿈 `@#\ǚ   &  ? $   $@ 㿀> @`c<' ?9 `'5* @ ` ``2/ @`&`  "/`" &`   `  @`(`@`耤 "&#@$# @ >  2 @`(`@`2` @ 1 @ v(`` 2r` 2m@ < @2e Ҁ`r ` g`(`0``(p0`0`/// ` @(`0`" `(-@-`-@0`-```"?c@4+`0``(N-@-@-`3`-```@?c) 0``(;-@-@-`1 -``<->,&&`  0`@(`   p.` f.4 X `*@& 2 ` / `̪`` @ـؒ`  (`0``(3-@-@-`0-`` 2`Ő)%@ $ .$ @.@ @(``  @ & & 4`.`.@`  `& Ԫ`.@@` ? *@ǐ` (`I`  @@2`  @@ 㿘- ( /@@/h @/@`(( ? (@.(  ?.`. . &.`. . @ @6 (``(& (@  ڲ 㿘@  (.z- (@   ?.t. . & . .& (6 ` > bX@>  > b` " 8 > b\) bd*` !<@2 㿘!< ؐ > `, #. k> X`> bd (@  <@` ( #(k㿘Ԑ  `&`%> \@1> ` * # 1> "`` %> \F*"`ܹ $`$\"`.` @ , k ?㿘 @@  @ a@"  \ @@2  \`"`@2 \  " 2 \ 㿘 ʐ㿘!`&! ؀ 2؁ (`@ a" !&!! a" !&!!㿘b Ho&(@> bd(7 Rې> Hp@ gb㿘@] "  ~ U?> , hb> x$!$!$" $, j> a$!` > ֐ 0G`Mɐ`"2`L  7 D (`%> X@1> ` *  H? 1> "d` %> Xk*"dޒ $d$X"d.`  Hs0Rl ΰ?㿘1> ; #B#2`    @) `3` (`@3`?c @@0`8* 2  #%` @? k@>kcH* k#` *#%@㿘#`#%`" #`## &# ((`@.#%&### {"/2### @&#`&# .#%#㿈'D \`耠`2  2D`@8``!<a`( D`([!< 0> F# L DE "  @E   D`a ʐ     - D `|6`DD 8L  $`7'`/D> ;c"D逦!D`/  /D`'  7`  > ;c耠D`` `8`Ӓ  D`` `(` ''' (`7' &耠ޠ `7  ' & ֐7``@ @@:`  ?  ` ,``&`6```(``$` > c$`$```(`` &` ``(` &` \ $@` U  4  `RD $`/`+` $`7!  @+` +` (+` +` @+` +` > =+` #@+`a+`+``(`0`0`+`+`D`@8`D` 8`@C9 H&`(   @c D0Ґ`^ ǐ   2`D 7` ? bݐ $ ` ``(``? cH G D0``@&`&` &`  ͕*t`+``, (`(`(`00+`+`x $  , > > ; bh>da #㿘#(   T `  0> E? , h, j%>!>$c $ l$! /$!?`@,#$4 \"$, i$ $ $ $ $ $ $ $ $ $ $"$",#%>! b(">#cK?Jg D 4 Ho&(@> hh`$"h" h$"Hp@ g> 㿀> #c<' `Z#$/"  \ _> `"耠`"쀠`   H `$$ $`<(@@(@$` , @Bh4 4 4 > =, , "$ " $ @4 4 $`' '''/Ho (@ Hp@0"#$a @>  h㿀> c<' >`0`Ho (@g i@ 20g@"'>~@" lhᢀ@L0aK@ "耠` 1"쀠`2'0 @1I@y2 Hp@ 6@ 5  /``" 0怦@ aJ@0a@2٢ # &# &b@`΢ k  e@ f@2s" o$"쀦@"7 \ a@ Q Ta8 `saq$#$# "$#"䀈` $#"## >"0+ $"$" `6 \ },#$``/`7" \s + p& '''/ /"' a  \ 8X ( "S $#"耠`M"쀠`I" "$" 8`" 8$"$""     \`56 \3 @"Z'j@2,  #$ (6@% b?$! & l @@ J 7 / ,#$ '/'' /"'& ` ` `"&' ` `  ` \@6 \ߏ `2 /`2 /`2 `2ݢ $"$" '''/ /i"# & ,#$$#$# ,#%0>  (6 \ i$"w$"㿘Hof(@gw"u""" "? @$"$"Hp@Mΐ 0 888㿘"   "  `" ,@& , ,  㿘 h` L `$`@ > " *@ 2 ,0$@ " , 2bl "@ 2 ,0@   , 22 㿘Ho&4 \(@g \`@{6 \# `@Hp@㿘Ho&4 \(@g \{6 \#$`@Hp@㿘"̀`2# @  @>   "`"`bk``( ,\`",``"`,2">*"">&ct`"#>&c"#"#"# "#$"#"#"#("#,@>&" ؄"# ""  @ " >&c"#,"#"# "#$"#"#"#"#(>*>)$`"#"#  " >'`T"#,"#"# "#$"#"#"#"#(>)>'`\"#"#  " 㿘@ ?"  㿘" @ , @ =㿘>'>5`&#&#>6>5a($&#&#>)>'bh&#&#>3>3bH&# &#$>3>0`<&#(&#,@ D  " @ , 㿘" @ " >  `  0`@ ` , ` \`",`0A,`  >'a  >'a 㿘`\> >  `Aa 㿘" ؒ??,`؀ `\` ?> `0@ ?2㿘" S  㿘  Ӧ  >'>)c&#&#>'>'`P&#&#>'@b<&#&#&#(&#,&# &#$o& $&" 㿘 h` +t L   `b̀`"``D ` 2t c@ `@<`@<`㿘 @    @H>  c<@'  *      . @ . @ ` 2 &*  2 ak 2 !b݀3@ q> . 7˂@@* (`2      . @  . @0Д (̀   . @  . @   ((`(@?)'. @0 Wƀ . o7 ˄*  (@@i!@㿘`@k``8*\`, " "k``8*\"  k``( ,\`2  , 2  k@B* k`װ @2"`k`"" @""Ѐ` `k㿘"Ԁ@" D@`k   @" D*? D  18 & 㿘 `  #`@㿘> 7cP > @Œa!``/`!!䀠#`<&`(`@a", a (`@ a! &!D  < @Cb>  @> ղ 7!`&! .`<"!@ 2!0`<㿘@  2 㿘" )  %k``( ,\`  `o `@ , 2`   7@? 㿘"A@j"Б*   2h [㿘"֐ 2Y L㿘"`C " ,$b : 㿘!"`"%!B  * D / b̀`bЀ`2cb̀`"" "@`> !` ؀ 2؁@ 2  @> "@ Ġ (`@ a$ !&! a㿘" % >  0` ,  0w  (@ " , \` 0= , 2㾀>  c<@'  0 R` > `Ь0 ``F (@ "a\`2a`2 `@  0=> X!P㾀> #c<' " a2  #2!@2! ?$! # 2  > &#!!h㿘> : Xx(` @ ("(װՕ 㿈`J ," )  %@  2  @  2 #`2@ `" @@2aJB 4  a2 " # \`"#>  0=  #2a@2a ?$aц 0&#㿈Jr 4 ! є  J `I $@` $@@  2  @|  2 `B`$a$ a1 Ӑc㿘   0@``0@  &` #,`@`("̀` (`>%@b&`$ &`$"Ԁ`$`&`$ &`$ k`` \`&`$㿘8~㿐 c`@ a2 \`W83   (, h $ $! ($ L$!4 b2,F ,,@2 , ,?& ,bbԂ$bВ Đп E $`؁b"*'"  $b $bԐ ,  Й  $`؁?x$b7ߦ L @㿘"Ѐ` `\d     `h` + 7   0 λ W> bl `h 2"``($` $" G 0`h`,`a&`L?.`h$`$a>&`P&a$`(>/`&a$@$`b% "`"'&""Ԑ@)b"$`,"&"`&" & ؒa1`(  >)<$` #  ``$`"ԝ㿘#0  S <""Ȥ ""̰ 7bؒ $b>'>&dq⠔  r  r>*>&`ЄT$a$a>-?b̄$a4`\$@Xa$`؂`$a$a > ֐`0;AI~> l$b l϶ > > ; bl>da #㿘Hof4"(@g"`? ""Hp@p"GF"> l2"@2" ?$"v Hp@  lH> c<' Ho(@g @~ H a@>0 0a5@J;0 @ӂ@>H 4  \(`0``D`@> Hp@ @"w"! 1@<2@ג3׀ 4a@:0a@10 a6@ƒ"ؖpĀ 4@@ \/Ð " G  \`6 \2(`@L \X 4N` 0"&#(`@ &"` `G  H H@ ?|@ t H y 4`&`,`2{ `o`,`2g \`0`֕ 2h 8d +"̀`2Z# ] >  a,`@"V \``,`N +`0`t "NE >`0`j = N`9 8g "4 ߐ% 4`- 8[ "( $8: \  "  T 48J " $8: K  "   >  _!@  4 \`> $"̀ ,`> @`0 09!($"̝㿘Ho&4 `h(@g `h ` Hp@(@`L`0a@ N`  Hp@ڰ 7ߐ $8 : ސ@  0ԼԘԄDՔ |`@  <`2 ` 2  <* < <`* <" 㿘  ` ` `x@`8   <`  ?`X(2  `x   " G  @ `X k(`@ +@?((2  \`?(2Ђb@@(&%b@݆ }xa@؆ 沂b@ӆ ˀ `X k (`@њ \@†     @(   <`* < <`2 p *`2 p" p`$ *`@?" p < ** < * *" l d`" d@ *@`" p@㿘>  *a v  <``@. <"`@   `"`@  "    @  㿘 @{Ӱ  `@{͔ `?㿘`<``*`  8` `  * ے`.@ >`Ȕ >`Ȕ 㿘  2& `` *@`2& `> >0b4a㿘N <`f <`. <>0b4`㿘`Ґ . `& <@` T㿘`` * <`2`&` Ք  < *. * ? . <D`` `Ŕ `& <@` `2 * ? . <0` . 「`2 * ? `.02@02```1 `1 62`82` :2` <*`2`2`3 3 $2`&2`(2`**`  0 `X`*@ `Y*` 0*` ( ( ( ( (*` *`*` *`  ?`*`*@Ⰶ*``) ) ) ) ) *` *`  X*` Y*` <*`㿘`n    b `m nư >'>  @z  `2 `0`ߐ n >   Ր  @@z  ΐ d$ d``D2d $`"$`d`"İ  n >    ````` . .@.`.`.`.`.`6``1 1  㿘> a  l`> "``$ l``  @`"`@`> >  a7&T㿘 |<` <> > >  a 7%N㿘```` @ &`> > >  a87$> > >  aP7$㿘  @z0{ `` (`(00. . 㿘 ` *`.`<`. 8㿘 @ /   " " " <""  "  "  & 㿘 |`  t`%> ` 2  " `  & |& `ǒ  > >  ap7($㿘`` `&`>  @!> @ ` `? &@&`r & @> > >  aP6$&> >  a6$+>  a6$,㿘 t `  |`& |> > >  ap6ڔ$㿘!P `?,,@`H  @yo  @ `H ` "@` @@`H2> &!P> > >  a6#㿘"` @yC % , *6@ ,`6`  0 `0 26` 46`  66`  8.` 6` 6` 3` 3` 6` "6` $6` &.`㿘" ` !P. . @@`H !T@ar`H. @@(`@`L`< "> `> >  a6N#)㿘" ߑ ,㿘" `>  `> &"ѐ ϐ , ɜ > >  a(6*">  aP6$"" >9ct ,㿘!X  ڢ $bc" $!T$  $ $ $ D>/a ,>7a|`\`@ ِ㿘     @ > ```` | $ $,<33 3   3 ` 1 `?1 ` 3    n@xu  ,`,  H `& H ,`,` @ b4Ho& (@ fHp@g 㿘 @" D ` & `d`&`d``2`d +㿘  6   &` `"I` `*18.(@2 2 @2 2 `"  ` `> ``>  @& {` ۀ > >  ax5>#>  a58#㿘 < |`   > `& ` &    <` . < @k: > >  aP5"㿘 |&  <` "`+> 3> *>   !  ? @&&    @  <. < /E <> >  a4ʔ" a4Ŕ">  a4"㿘 \@  |`.`> >  4ia( <. <h  t`$& t <`.$ <& t& \>/P]& \O& \ <`?. <& \ & t <`$ <& \> > >  a 4l%%㿘 * \0`0`` ` | > >/ad(> >  4 a8 /`  \ | 뀠> > >  a84;$뀤 !`   `  <$" t   0ـ  0Ԓ ͒ ʒ `ǒ ’ ` > > >  ap3$㿘 > <& `l. < * <. *. <㿘 `k <` 6` < 6 6& ` < 6 6,`* @2& `0p>  ````> <'  "''777''''''//@   4 > 0>  2aH0$   W $$ $ $ `D`$ `D  `D$`D$  . @ , <$ |  >  㿘 &`l&`p"&`t]r`"` ` ` ? &`&` ƻ 㿘  f  I > ```` | $ $,<33 3   3 ` 1 `?1 ` 3  ` n@uΐ  , ,`,  ., `  , , `&    , -, ,, * , +b4Ho& (@ Hp@g 㿘 <`" d`" * d`  P` d`& d P Xp     d& d㿘 <`` . ĒŒӒ <``@?W. <& l㿘`nc  `m n >  @u`  n`>   ? 㿘 ` "` |<`,  @0`@` `2<  㿘 D`2`< ,`" ,`<`"`dِH``2`< ,a @"''''  !'// ` '''''''''''''''ܴ'/   `4  `` 􀠠8 8 􀠠 8`` 8㿐 @"h @k@@"# @N@  \`"b`@ 6 \!<ⴀ`'   В c8# ( '> cp "ⴀ"Ð ⸀`*S  & \` 3 c8 & l 0`  ' 6 \ +Ր> > < cp>da  㿘"   A $"$" 0> 0` %4 \>7cD$ l$!>9>9؂cD!$!$!? , h$> :, j`$!$!6T5| D  Ho&(@> pp`$"p" p$"Hp@ g> 㿘> ?c̀" &  v  @`(`o P @] ",`4` @T4` & a<` & (`D  ! Ho&4(@> Ŷ`@D69H <& (`@"C& (`@ `@&@> pH`` > @`lHp@g> Ŷ`@D& <H`G&HL`2> 3>     <㿐!< `(" &``(!< 0> /a!h&`&`(`  . @> 4 H@'`> ? 3c̀2H`> ?@' Ӕ  A  (      Ho4!(@g!`( !!䀠7 <$ (`@a"2 a (`@ a!&!3Hp@ @' 7, <"!@ !`&!Hp@  7 <㿘> !bpHo&4"(@g"`"#! Hp@`7`@z  1 qHo&ނ(@"`2!` Z"؀``(`@T a$`!&!Hp@`2` @r. ,,` ;  ֻ  D` `` ``$`$` $` D $ `` `$`$` $` !, <@P 8` u$ 8@ z0l a㿘Ho&4"(@g"" "? @$"$"Hp@9,  㿘> ?cЀ" &  `'` (`& a<` & (`D  Ȗ Hof5(@>4`@D6:H <& (`@"E& (`@ `@&@> pH/`@@ > @#`lHp@g>4`@D& <H`{&HL`2> 1ǐ> 6 (  (` <   "`"`㿘 2@1@* `. /@? : 4& 0a5@ 0 a6@ ;\ @@ \`"`@ 6 \ k@0. k  cu \`6 \@逈`@ 8 \ 6 \:Ā 4㿘! Hp@ 7 @> Ho&4"(@g"`!` "؀  (`@ a" !&!Hp@ 2 @ 0 a㿘?b̐"98 j 㿘"   0   0> ,?`:4`\a>;>;`(t$a$@$a> :a` $a$a$`ؠbȒ >;>; bt  c_  cr2: > <>da  > <`< ?  0`@2@ 2   2@1@*  /@"  @@  b" l  `"1`2- -"`""  "D`   ! !   `K  @"J  !  `2 ` ! ɒ `" `"7 ` ";` #  ! !   `*#` @"?  ! #` `  ``1"``@"#`#`    "!  !   ! "! #` ` ``"``"#`#`    "! k#` "" `2` "` `w`  "`2R"@ L` `2  "`"` ``R `@ "  `"` ` `.   `y"``"`` "` `"` ``` `@ "  "` 2" "`"` ``F `@ "  ` "` "" `2` !     `K! @"  !  `` "`  `"` ``` `@ "  "` 2"0""" `2` !     `#`@"  #` ` s """㿘`M` 2 V` `2   "`""`@") "`  @"(``9 `9 `""@"  ``  ` ` ``2`@"``9 `9 `ݒ"` ``"`""`@""`"` ` 2  `2  @2 0  @ `   2  `2  @2 0  @ `   `" `6  `2㿘Ho&4cH(@gcHcL tcL? @c8&cL&cHc< dc< @c\&c< &c8cPcT |cT @&cP&cT> c %Hp@5 `(1> <g @> <  H "> `"`` `?  @&`1&`> ct 10*!㿘!> <V 4"/ 4㿘> <_ @> < `H? 2  05   @  >`Ȕ 㿘    "   㿘  ܐ &  㿘  I&#> <"" `@> < Hː`@ߒ 㿘`@   !h  @@m ` @@m| 㿘`@Ѡ  f>`f >`f( >`f0>` f8 >`(㿘  $ + `" {  `2 &`&` &` &` && &  &`&` &`&`$ 㿀> @c<@'  `a`Ӏ`"z`` +@ >  +'_`D  `a`'> t  " $  4X@` ```````X4\ 4^,} ,m( 4`4b$d$$h$p$,|,l$$X ؂?$p``@ $p h硒``a``" @` 疒a`@`o`Z`"F`T``2 < ؂`0`0tͰ 0` ``a`?@@S 0~ܐ@ O`@-> <$$$ ѐH Ht 0@0fVbvbxVbbbd``H`J`D`L`P`X4@4B$D4N4R4T4L4J4H4P`L`D`H`P`T`X`\$L$P$X$\$`$d$H$@$D$T$@``` 0.@ "@ti 0X > > 'זh``$$>C?(`$4><>B@c|$$  $(,$ Ho4^(@g^> `?`(`$HH t> c !$L$8c 8 d#c @`$<h> ?aL* $PP |"$T8``--l 1 H`@w4 Q> `$ $``''`$    ''//f p> " 0`" 4 0! (`9(`8`(`I `<(`H`(`Y `L(`X` `H `, `\`8 @`X ` ` ` @  "L> !'iHp@0  00( !㿘 (` < 0@祖 (2  @2  ?& @|$ (㿘 (` < @ 2  @2  ?& @`$ 㿘HV` > < `L &`8&`<@j&`&@G > < 0`\ (&`8㿘) `@& `@"60  `@- `@"' `@b@`@ & @@a@`0]ߑj㿐#> < `4  %> < `4R<`1>   l  @ϐ  0@̒  & & <> <&<< ` <& #t`2   O > 7&#tc(> #\b&   Ք @㿘`A  `2 Ho(@`|` Hp@炎`3` g`|` 㿘a  AHo>(@> b  t 2t< $`! Hp@ (`@ `<$ `|$`|Hp@`` " }g> b `@$ `|$`|Hp@ #@8`2  } ``؀ 0E㿘 \`@`  } . @> S  N !` Ho+(@!`0 !!䀠@ `<"`(`@a"; a (`@ a!&!*|Hp@ }Hǐ 2g!`"! *`<"!@ !`&!Hp@  7}& 7 `<㿘 \db`@_b-!* Hp@ Q @{   D  `!H`W2      @@> 8`C> /Hof4"(@g"`ɐ!` %"؀  (`@ a$ !&!Hp@ 2    @  a㿘#> <W`44 ` `   ? @$$ Ho& (@g (@<  `$ <"  |$ ||z (@< 2 (Hp@ > <`< `4  @"  |$ |!> #t #t `4$#t (` <"  Ho(@|`  Hp@"  Hp@0g|` " 㿐`g# (  |y 7 P`aA '`@8 ں$ $@   8{``   `y  ( D{ /|   7`aϒ   |s( `c(`  |i( `2)`{ 7> Ř `Ho&4`@(@g`@`D`H`#`HHp@ 7>4 `( `<(`@ "#@  > < p( `@`#`@H` (@ @!> @ `lHp@ { 7p     > >hcL"X㿘 > #"  > > cȤ#? 1> # #1> #"㿘 > #"> #" > #"  $  1> #"Ё㿐> #" P 4 8 `#\> ##> ##@ > #y#H > #t#P 0 <> #n#X <`"> > `0#f#( @> #b#p @ > #\# D h H> #U# H#O#h @㿘  > #E#   >E a>  #7#㿀> c<'  {&  A $$ $4 4 4 4 4 4 4 4 4 4 4 4 4 4 > :O!?`57 (4 4 ,   , 4 " =9 5   //a4!  > T"(㿘+> c`- > 1> cx>  -> &#ؠ %> 'cА0` :될? #?c&#䀠`  3 > #  㿐ɒ㿀> c<'  z  D $$ !<`$($4` 4 4 4 4 4 4 4 4 4 4 4 4 4 > :ἐ!( 7(4 4`4   , ,  ᭐`ᩔ `ᥔ `ᡔ   //a4!  > "8㿘`<" `>Ja&`&`P > w@ (c`c`  `0`(`M  8 4 $d& 8 0`" H` @  D@e ' 0'  ' v ְ P  )>  8`$  0"`"( @ep D ' ' <` a< v ư &  4$ 4"l#h > ''Ըc<' (5``  yX >  ܲ > ``8  ( <@2 0 h`"\ 2 04`A`A 2 05``@Ԁ †!؀"`<@20 @ 20 `20`2؀`""<@d̔   `@"E' (@`?  D5`A`0`=` `2 `<" ` H"hH" `h`"T h` T@)N'<- 0 0>  !a0I@)>̠- >  !`('܃5``:܀"ǐd (   - `<`h `h" `0    ܒ  (44 Ԁ`2'ؒ ( 7/ /! 0T'> : @da Y@('> c! 0"H` @d  & 4j<@t h`@('<, 0 0>  !b`02T h ``  ,` ߪ ``" 4> > <a4p@%`4/> %4$ ]5` ` $ $|%|! @2 `$$`$|w%| $$  mؒi T@(['̠,( 0>  !``0Y@(M'̠,>  `  0 %` `㿘 `` )``."> c䀠>  cx@%> `1> b`@c]  ` > #c` # $S#wr ` `" >a @(``@  @㿘> %cHo&4 (@g (` 02(`Hp@ 5 `"B>  `/ `   @(`` ' h@w00 `$@" `@$`@Hp@ 2 {  2 0{ 2 0 `!H㿐aQb2A `"`H "P`V```0 `"  \`I9> #| c4P > 'b8086G      @$ $ #|v'#| `"$ ` $ `$ #|`2'#|/ / ^/ `/ / /  > : !9 @'+'> aPڐ v $ #|v~'#| 2 $ $ vv```F> `4&`4 4``@B4&`` > <`x $ `<`@h@H"` > 4(z \t `4```> <&`4t&``  $  $ #|v6'#| 2 $ $  > f!> 4`&`` "Q \   !< C "4 b@&'> aW ~J$ 㿘> `0``H  > !4  2> 1 c!> w>K#pa #p[ `4  "&`<.   ``&`42` `"= 3>  a!4`!!4!> wh`ڂola&`\`>  @` `? @$@$``4&`H{&`4` !>  $` #|u$#|` 2 = `(3> `<`h,`<X4    &`H> > #` !#"" " " " " " `4> d&`4〈 " ` " > `` a`< \ @2 0`  <`2 0&``  ", @> <`|"`@> ``&`<`@= `?"  `$ &`@ `<` X `<` a<> <!`<`0h(`<X> 04`<&`` h``X`&`\a8!&`\ l@8&`\3>  EbY 㿘Ho 4> <(@a> <S`l> c #>  ``a48 4 2 Hp@37d7t7t77t> > w c 㿐 ``"  *#\> <  0 9>  #  $㿈 t  >> `c $` $`$` 1 ) 1 ! 1) ! `` $`$` (,  $ 4 @'4 `` $`$` > = b @ / '/   @9 >  ` !  `8@  ` ``\`  `>Kc` > wcc0  @2  >`p 8㿘!> w#2   @2  8   " " #" $#㿐> 'T'L'P'X'H ` L '  @ - `` @ :  x "    @& @@ۊ&  2M   @& & @``G`"  @? `s' `' \  <`8@@2# )  @F &> `` $` h` 0`%8>Kb+> `` "@Ѻ `s' > ``2  "   @20` < `' \< 8 @2E `2A ` ?``($` ``2 0 @20h |@2  `' p (@`&l j  `' \c< 8@" ` `s' `' 2 ` ?> ``F @(@"(02 @"h02 0.Ӑ  " " `8`2^ > `` ` `h `0 %8'> `# ` ` ` ``@  2I'  ' $ 9` h` 0`!`] `h `0 @`@``8(`` @ I'` '` %c '``r' ```ܲ  0$` `` 2|0h @2  `' `" `   w 0rG`   㿘#> wc ` 2 $ @"$  2  8 0?    ` " "c " $c$ ``  㿘)> #`=Ho:(@> ``%# `E `h `0   `"1   ``$  %# ` `h `0`2`h 2 Hp@a> ``%#`  +  $ ̤ 0 "  $ 㿘Ho`4(@a & 8@" &  ` `"& `\` & Hp@N?   2H&  & >  cHo4> w(@a> wc20 `2 `b    2Hp@< 8   ? @`?`? *   H`" `*     2  *  8@@"* 2 * p> c<' Ho`4 (@a `& Hp@ +>     ? @ & &  ` "   '/! a2@Ԑx 60+ 윐"Xp> c<' Ho`'> ł(@a'> ` 2     @2 0 h    @2  `& Hp@0P 6  D $$ `96 @20$  h` $ h   hh$ a'  /䀠 / a1 (   !  ? @ $ $  `"  6Hp@   > |0"h㿘?+`-> :`@2a< "" a<2``\`"``2`"``2<"L2 aՈ 㿘> ``2  " a<20,(@20 㿘 `H  \`2E L < \ > `` ?  <<@  L 0 5  \`? < \ <@ 2 02 02 0 `2 0  @ ҕ*  & \ @? Ŕ  `$ ?@  *  & >Pbh 㿘`"= < L> `` ", < "& <2 0\`" \ L@2 0 `" 0h`" h  <@2 0"  0 2 u   `&  \Ś `† @  b* $ 㿀> c<' Ho& (@g `8&`8`<&`<`@&`@ `D&`Da'''쀠' a &`D&`8&`<&`@Hp@0:Hp@> 7cP > @ٝb@`,` @e?&`,`,&`\@`X&`(`p&`$`\```,"Q&`L`( 0@&`LFT`\`;  M> 2`8` `I`  0&@`8&@`,`2ł@V{`<`@`D&`H&`L&`P&`T  T`\`ɰ`l`ƀ 8`'&`l 0 @"??&`,`,&`\&`,`,&`\9"x":`0@ 8`  ?+@`@2+@` 0?@c 8@* 㿀> c<@'  @0a@@~ > `` 2      @2 0 @"0#@%!@   "g 1    @20<20 a@e0 @"\ @7@׀ Ho(@aa  0" 4 4 4 4? @ l$ 0 $ 4$ l `$ $ "$Hp@0  `"  @ږ@ > `2^ H @"  | @A@  `>     pHo`4$ 0(@ a$ 0> ł``` 0$ 4` H ` 8$ X$   , 9, 8$  , X\`"$ , H, I$ $ hHp@ Z  `B  a!@" 8(2a#@"\*\a%@. X & \& `& d&a@7 `j  a@2  2 { 1@&  @2!  b͂@`[i -᐀`e@`@V@\`V Ho4 H(@a H' L' P' T'$ H$ L$ P$ T᐀`@ " $ H$ L$ P$ THp@0""9  0   @" < 0蕐"@Ք $ , $ \Ho`(@a z 45Hp@0Ho`4 9(@a 9`"' 0`j \!`"!`m`2  $G Hp@0`2d 8 & <& @& D&  & <& @& D&`"  H & L& P& T&`" k 0 `;Hp@}  0fa F 00 $ X4$ \8$ `<$ ,$ d> `d9 00 $ H$$ L($ P,$ T <u r p  $  $ H$   0m  $ H$$ L($ P,$ Tc\> ֐" cP> c<@' Ӏ @K0a@@"E -@  27` A @F0a@B@ -   @ @W6 2Đ `2o  /&/ :a0` ``"`" `"` 0' G0a@    4  1`2  0 @2 0a@0 @ @WՔ  8 8ђ\`5 Xɐ X ݒa0cb 1Ҿ  T > " 8 8ҫ\`" H Hңא \&&? > " H HҖ X @Vה!0*`2``` > >a+`0@ 0> `( (@ @* > 0`(@ (㿘  :`?>, ` ``  @.6@(`@@1  , la" >@2 <`2 ,@Vh  2 `2 `2 $`2 (`29 `Ă@VK  F> <A6 >> < la" >@2 <`2 ,@V0  2 `2 `2 $`2 (`2+    @?&& @`&@ `$@&  > <`6> ^" >, f`㿘 @ ` / @0.0@@(`@ :@  "3  la" @UΔ  2 <@2 >@2 ,@U  2'    @?$$ `$ `$$ > <`> # .> 2`#@/ > 2`#X㿘  :`y)> Ķ ` `.6( z "  la2 >@2 <`2 8@2 (`2U "4 F ``( <6 8> < la2 >@2 <`2 82 (`2$ 2@1    @?&& `& `$&  > <`2@6> _#h  r)> ā㿘@  ./ 0`0@@@@(`@ 9@  4> < la2 (@2 <@2 >@2 8@2 2@$    @?&& `& `$& > <`./ 23 > #㿘 Hof4 (@g   ? @& &     > @(` &   @(`    @(`    > @@(``&  #`  @ l?& 1&    > < (@ (`&   (`    (`    < (  >@@ @ (`& Hp@   ( < >  , `&   ( < >  ,  `   ( > <  , $   ( < >  , @& Hp@㿐\@  / 7 @(` a .@ `0`@  `'  R @2  >@2 `H la"  ,`2 0`" 4` ,` `   `   , @S 2  `2G@ `2C@ $`2?@ (`;@`2(``2$``2 ` `a2  (`    2  <@  8`+"􀥠" 􀤀6 ?'`  ````",`  @S9  2u  <@2q ۀ"ؤ2j Ԁ`2 8`|` `2 `2  @ `֐ 㿘 H & H㿘 H " & H 4` 8`J" 8& H& H H" " " " " " " "  @` "  H (" H . Q& L & T. P  8 H`2  `2   $`2  (`" H   $ ( & X& \  & `& d& L. Q. P , HI& H` "` (    ( >0 8 㿘 <8@?@  4`" 8` "W 8`[" 8&@2   .` .` &`&`  @&` &` <`"  `\`2  @`  6 E "7`6 `8"@> `` 2  1  1 2 0=<2 0 8> ``` 1' 2 8 <`2`\ &@4ɂP H   D& H@R* 4 P'' 0 '  ' 4 <  4`2  v \ 0㿘> 7cP > @ڒ`X``"``la2(@2@` 怦 @ ` `"` @(@ ` ` `  (` <0` ( `@͞@㿘> 7cP @>  @Ѝ`hr6&` " He H " l3 la}@ @K Ho`4 (@a "   s  ? @& &  Ā"   h  ? @& &  ̀ " @kA Ѐ " @k; Ȁ @t(Hp@ ܀`2 `DHof4 (@ g   ? @& &     @  &&    @" @ `?& & Hp@ 1> ʑ @#} 0    @  @   㿘 @` 2 6 <> 9bb` ``& & & $& (6 <\ @`8& (㿈 @  (`2  b> `` >` 8` b  "\ l `    ` 2```<8@` . 6`" . 0`"7`o ``+>  #\ `  "   @a"  0 #\` "` @P``B$ 8$ 8 l`2b> <` 5 U!#"X!;$4`- ,0`0> Ĭ 8``<`(4`0`=*; . 0`w 뀦` #\ N ߀`4 > '@  |. T` ` ' p.  1`2j"i.  4`> <`,- 0`0@1> Ĩ` 8```(4`0`@* . 0` 뀦` #\  ߀`4 >4`; 4`@> <> <`h- a㿀 @` @e` lae> ` `2 ``. /``<> ``" 8``"7<2  8 `\" 8L`2&` 8`C)   0` 8` >' '耢  0 8`2` >`>`0` 12  1&` & 8`& (`6 < #\#`   @p  @ m# @ P`  H   8 ``  8  1'㿐#> <``!> Đ  Ͱ 7 > => =a> =a> =- - - - % % @>`0`% Hofq(@@`% @u%   > `` @&@ @(`%   `` @(`  > `` @(` (%  <`` , `% ` ( < >` ,  ` ` ( > <` , $ ` ( < >` , @% Hp@ %?% @!% ԰ g@`% @% &`% % l #\     > ` X$`㿘 &&     &     & 6 >   >   0 `   ?( * ? ( *㿘00 8"0 @`"0` ?(0    (     &@㿘&@&`&` `0&` `0` `8"0`*`@``"0`` ?`(20`.`   .@   ~ &`    ?   >]c    >^`Ė 㿘 a &@㿘&`&`&@U &`   ?    >^b,    >^b L||||h`( `| 8|||||㿐 ```` ` *#\> =   0 9> =˧ Ԁ  9> IJ     9> =˗ 㿘Ho (@aHp@㿘a^㿀> > `< '  `f  "Z`- \ ' '''/倦`3/䀦`L> ``@"` `>`@@"`@`@2`>``a$` 7>  { ``a $`0 `2> Ā> `2'j`@ ``$`@˒ > ```$`0ܾ > =`> >]c( 㿐'T'X'H'L'P& & `T'& (` :`@`. :"> = "   ( > Ą``  1 `H"  @&M " A> Ą `  & Ho&4> ł(@g> ź``@`D6-`H <& (`@"0'@ (`@ ``@'`@> pH`` > @`lHp@ ``Z'`H`L`2>  >  <㿘` S  L``.`>  @ >^z `0`+Y  G 0 瀦 ) … -yװ ۀذ -Ho`(@Hp@ɀ`İ  a0`` Ho (@a> `Hp@ > => =`w `l` l   p,㿈  @`(` @ `  @ `` " ``` @``* '0`(''  // /7 c  _s 7 `c   ]  &  @& 4  @& & 4` > H P >  4``  D@K&   0 4 v` '''' f ( @> c<' G>  4 `"  X`"& \ :>   0''''''''''''''''' v'` ' ' '& > b(( @@> <(`@``˒`  @ 0א!ڱ!P㿘> =a> > =!ѣa `?P I 2 4` ` *> =''''''''''''''''' 0 ''  8Ҙ  P8`P X8`X `8``> =aȖ>aua Ő 0ŝ㿘> =!8  A.`0``2 X  \ 2+  > "# <>  av"2 X!' <`l  \*" \`"" \" X`l`(`Ո! X!'0㿘> =a > = aH㿐`- @``" % *#\ > =Ȉ! 9> Ķ! u!l;> =a9> =!H a`ђ '!Ha '!H㿐@|_T@2ϒa(`(`#&@0. 㿘   ,  @& & 4 @v"@4  @& &   @#Y p > c<'  `'VԀ ? @@ ] A > 8 p$<?$ , (`쀥`= `&@0   ` ` I  ` 0"4  (@ % @ @4(@$   `& ` `|6  &@  @&  ӄ``D`2 & @є % &@ @`2`> ``2 '䀦"'  (a<20<? `\"0L`"0@20s? '''''/ / ( 'r  '> ńhT` A\ T0Fع!h]=    % ] @ P @@: P 8`" 8?<_ :9<㿀'X'L'P'T'H L'` ` `$> Ą` \ @@(  ae F>    @& & @M " > Ą`   $@@( 0 @ & & (R> ć(aȤ` `D(`>` ``#(  `(`@& ( <8@@" `)`C`> =a8$  `h. `> Ăb@(( @@> <(`@`` (@`@('> =`` $  > = !L"  `  . \& `2   `\`퀈` L ?'  `h–  ` `$ (  `9 <> =a> =a` c` Ă`$ Āk  `$  `> =a> =a4 `#(i (`@&b (_  > =a\$`> =aL$> =a8$  `h ' (#\   > =a)> =W 0Z8 .>`2  > =a2u. c2 o.    (aH>aO` Ғ0ӄ` `$ `$$ a@쀧`#(  g.&E& a4{> =a0G  @ : !L" ( `0@&  `*`_@ "!   `(`Ң"  L'  @  a ` '  @  Vf'`$ 㿘  @``> ` `?  ` `(c` Z   2``8   8   h8' [  ւ `8  ( & (l&  `(.`> Ą@` ` ` z*` z"`b*Y  `  @쀠@ m>  `& & &  & ?@(@!?*` ` "2" 2 * : :`. :Zh`~  *{ @`"w`s` q` o` m`k`i`g`e`c> Ą`b   @&    2 Z͖( `{Z*H"* >  !0!@㿘  a > 㿐> w`1> w  %@> wc 1* @, 0@4@%> =?c0 l @!@(`@(@4@4@ (0 $lc%> =$T8hh @> <@' `H l`:``@"n' N  p &@  l`@d ':`1В  #p &@@@ V>   o <&@ l  o 4&@ l@w  ?oۖ &@7 "ϐ ''Ԃ '''''''/Ԅ /X7///ِԒ  o &@ l l  /'''''''/ !㿐``L > ł``  #\Z?`( (` $9 - #\> = w!>ft "[ > =b   9> Ű  h U   9> ¼# !> =!> =aȀ D! !> =ߘ!!`-!> =!Ȁ`> =a$!ȁ  9> !P  9> ˆ 耧 > `$9> =   ¶!9> Ų "L  4!> =!Ȁ k $!ȁ㿘  @``(`"!   @&   @& @@(@$@㿘> =a@  + > c?> =0`> | 㠁> ! +㿘!> ="|`?  YL  9"|'> =*` & Ā`3>  c   +> c, ,   `ϔ   @ `> b@$@  Ā`"@O@c$Ā`> E#> @""|> (c  Ā`Ȣ > @/"0‚ 㿘%> Šl? ! @" @ 8`" 8#> $ad  $ l, ,_ $ad   @F#> $ad#> ŝ㿈  / '/7 E Q 4dd" 0 8`A$ 8 `:$ 8 `2 8y> :a` 8`" 8a<2```"` 0 `"`@@2`  @@CW  2` 8` $ 8   㿐%> =Ķ` c>   ' |>  `> Űal?(?  "{ 8`ڂ&8'> $d  . . $ & J dͰ D8 D Z  "   `D8 D[ / <"f4   > =a @?d  !@ ?> ņ`h(` (  "E > (     ז> =ad   4 8`" 8$dh(` (Vׁ   >  "Hp@28'> ņ`h$` $,` ,= 7Ƥ  "> =V> =`02  ` " > =a" `2 ( 2 @" ( ,2 4`" 0`ĸ `v >  "hp> =d \`2L<`lL `  L   T -'> ('> Ų   I $d㿀> c<@' '  '''//>䀢 2  <@  @@? > !㿀> `:c<'  `0"`(D`" @  l> `"`( '  '''//䀢 "` < > =a2  `" `a6` `\ְ` 0Ѐa80@;  E? ?62 > ``?`?c80 0" @20!<`(20< @  @   20 ѐ!DŽ> ŀ  쀠 6 > ŝp ` @`(`쀥 B' ` >`> ='Ԯbܴ`  "  ` ` @  ] > ńhP` P 4 @ D"Z 8 % $Ԣ@ @ ր Ԁ`> =a ՠ @ ``  > =b (1 " <@ߔ  `, ̆> =`"  `Ϭ``% ( o/` '$@ 怢 倠 @90```(``'  ژ > ńhP` P @  = ('܀ 3 <`%`  -`<@8@@ i'Ԑ?n ``L`6`2Bߨ%'@\ `N/怤 J 0  (i  (  5  @  y > ńhP` P `@ > =)b (q `/`@zؐ%7   < `/ (o'܀ # < ߒ %ܒ $ْ 㿘 `> #> =a|` TI@@?` ` @&@&`a $a"    ? && 1> #㿘)> "@ %'> =%> =(80`@8`@> Š 1`h(80`@8`@ ? ``$`"@ ܁㿘#> b@  > Š`h `$ b@ 2 㿘Ho4> ł(@a> b@ > `h !> `* ` `z$` 2 !> !d  8` " 8$!dHp@+$!d㿘   `(` $ `$`  `` @`9` ` ` (1 @ H ``@ 2 `61  @ @`/  @&  > ńh`Sj > !|> =  > Ȁ`"> ŀ`) ` QU @0  @0 7     `@@-"@`@τ+> '> =a| ``@@ @` S$?    @$$ `$ "` `& `& %`    `   @ ``?  `(`@+>  S&ga|'> =`$a|` [@R$`5`% `%@"`` `? &@&`> >#  `(`&    `(`  &    & > Ē # > @"`@@ ` @&` <.`  .` &` 6` &`&`` `&` `&` ` i&  3` 0Pg R > ńhh`  h㿀%> `'D`> `h `h `hD< @0`X`$`XR:V  'D` `$` `< (` 1 `"  `"  $``2 $`t`$`t  #D``$``R $``\2 $`p`$`p`t``$`t$`V 'D  @``$`@ " `D`$`6   @" D `D `h2   `  @  D    D2 D > =  ( b| sD 'p쀢 2SD <8@ID `h"j > =a_> >`x-@ W[ Ho&(@g  ` `$@[ D#\#` @` Hp@`CD@@ ``$`OX"@D ?b `> b@ "   "  @2  @2  @2  @2 1 @6 (`0``"```2``) 6 `%> => =a܆ $``dD`$`d> Œ !|  (D $L 'D`@`$`@  `(`6 D> >`x">`4 ΂``(8`4`l3`1`)/`-`+ V Ho&(@g  ` `$@Z D#\#` @_̘ Hp@`D`4`$`4 > Ăb@ (( @@> <(`@`  ) (y6  "D<D> =a`> =b䀠D `U@ G'D @ T  2U`( `D`$`$`$`D  @20"h@"h02 `|`$`| 8`(`$`(D`$``U  'D  "`| @" 2`|`(`P.$`(`> =  @  D> =`(D`P$`(`dD`$`d㿐    #\> > !|eb    #\> > #[b  K  > <`> Ĉ" 9 ) ) b  ( @(` @@(` @(`!+@ `a2+@ > =```@ '> =#@ @ ! 4`@2`4S`"`4`4; ) )  ( @(` @@(` @(`!* @  4> =bx> => > `> ņ` b@ @`< >  `@;> aԅ0(0 (@@&+` > a0( 0 (@@ +`  > >  @;ݒb > > !P@;גb1> 3>  #@;ѓb> =Ka> = a> f"㿐   > #\# > ]㿘> Š`Ho&4 (@g (` 2(`Hp@  `"> 0 `$"  @$ @Hp@ 2  `"@@@t@> > aH3 3 @ @2`@2` @@@(`@ 2 0  2 @2 L`2㿘> =b䀦  03@ 4@ Ho`,(@Ò , 4& 8&  <&Hp@ > =c@ (`(`> ńcȄ&&& & aӐHp@?&&&  1`> =2 c> = 3  `( *@ `@ (P 0a> `L" p`" p㿘@& `& & D& 4& 8& <& H `` `2 `2   (@@ " H` " L" 8+" <" " @" DЂb? ?/ a@ 8`0> @Ԃc @(`"  " 㿈Ho 4(@a`"     @ Hp@  ' //  @ > =b쀈> łcȂ&8`(`***  > :bȃHp@㿘 `& c(`> c2 ` 2   & $& > "!& $& 㿘 20 ϐ\ 㿘 t L`" @@M`I 8 2@@"`` `? $@$`8 8㿘   g Mw?WG 㿀> > ؤc<' `2 ' 9>  ؂  '''// M  $   $ $ > =P,`  > Pܖ> ŢbL`> =`$`䀢 ѐ > c@`0`$`0>  |c0!㿘@` H L B!3> c؀`9c> &c  (   "`  (:`:`   8 @:`"`,"`(:`0:`8"` `` "` ````"` ````"` ```"`qcТb@㿐  +> =c((`4 2`  *> Ń*Ȃ@@ "I > =b쀈> ŀ   **> ł@Ȃ@` >  cp> ŦL`$<> &<c܀&c4 "(> Ņ(Ȅ `   @ ` @"@ ) 0((@ @  + 0 (`®   `! ! 48`&4`&8> = 97> b- 0``\c Y ``@`&`&` @ & L  D ,`@0$  $ $  "O  $㐂 @@4P (> =b $`$ `$ ` $ `$ 4 4 ` `$ `4` ,`$ `$  `@*`4` $c (0`p`P@`Pv@jqHD! 2  ,   q) )  ( @@(`@ qb@Z `(` N !``")` P &H&D` ( (( > =`$ > =," 2 > c0`$0 7  `"Ns   ``(` @PU "cdct` @jt?b@HL=%@ A @`C`@" " 8 @>H&8&<&@&D&8@@ >8D @>@`` 8`"(@ 8 @ ,@ HL @`ˆ`"@"FG "8`H`8 C`";<58@@ >8D `>@8 7`"(@ * @ 2,@ : @>H&&8&<&@&D }   $Ɛ`@(D,02<$(ŀ`"$@}&Ђb@@Ђb@ۚ@  `! A!  7Jc<(V`@0֝㿘'> =/> Ţ c P @` @6r P P) ) @@`((@@d`2> 4b > `" "H) " L2" @2 22L !2 p> c<' "  @6 P > > ` '/ /! ԟ@a2"㿘%> =`> Ţ c@  P @`Ɛ@ P> ň b> `" "H) " L2" @2 22L !2 㿘Ho#> =(@a#> =c`> Š cȄ (0`, 0`(`(`@@ csc (0`> > = c 04c> €#> }"> Ű "x#> bH@ "   $bH! > @5q"bH3 8> $bH cؒ > @5f#> => = c4 Hp@> =b쀠>  cȁ 㿘> =b䀦 * Jd `k.&`k `m`j"  *Ip`n *   `> = 0 @ # @ "    `#   >  c  "  㿐> =c0> Œ#i"@g> Ѐ@ @$ ЅH`$( b @> c?/b?4 , O$ L H    "# "% `@ @80` L(`$ $ $ Ѡ@  အ ) 8 $" <Y`?25Hp@> Œ#" $ @ ( D ,0Ԁ 2(  am$H`h (0> c<' `d> =b䀦` (` * Hu l>qX#> =b쀠`WV`"  -   `?> =c0 נ -Ho (@a` H``^ te$ tHp@    `?> =c0  -``" ` " ` " ``H`  `2 Ho`(@aג` Ut. P`) P@2`2 `2$`2(` 2,`$2`20-> =c0@? P @ I   PAHo`(@a > =b쀈Hp@"    `  1> =@#((> ł@Ȇ@  1Ho (@a#( ((0` ((`?6#Hp@> =b쀠2@ݠ  ڠ  `ր  @`р ` ̠ 1(`(`> Ū@Ȣ@``  0> = #"  "B``2 U \`>  -3   `8c     `+  ,В @2Ӕ $> =b쀈Ho`(@a͒   t$ t   ? $$ s 8Hp@`  ]  `X> =c > c܀2"> bH "`"@  @> @ 9 cP`2Q - "  `( @ > =& # > ˒`p 䀠`6 0  8 !> > Œ bH!> @2Q">  c!> >{#c#  !> >}"b"#!> Ŕ ">wa"#b쀠`  > `` '/ /! @a1 2Ho4`(@a``8-@`,``$`` $` $`$`$`$`$`Hp@ > =@#(2@ > =1#> =b쀠"`> `0`> `8``  #\2> B`@ VP`>  9cV> " ,В @1ǔ $0@Hp@x 1>  `EHp@g 1] t = ``8 2 `2 `2 $`2 (` 2 ,`$2 `2 " !Hp@ 3& Hp@ > /> aH1 33 @1 @@@ @ -` `T> > b ;> =@`F`@2@` 2@`L (0`` #\ > > ``Lb쀈`qÐ&`L&`@ /@ ` KE ϒ 8 @>  ea002-`> =b쀈UH   x @2 @2 @`"o$ @> ń(h$ @ x 8  %q$ @$ L$ tH> `$H H%HM$ > =c 0"o  `LHp@^ 7>  aH`0`   `> @c#& H& L` `$> (> & & & 8& <& @& D& & t&6$t0Hp@' 1 t㿘Ho`4> ł(@a> > ŢbL>  aP'> )> = `"0 H, `2`@(  "% `@`@`&`@ ,`t "   &`t`t 2 "`$  2`@ !2 Hp@1> Ų w#``  v0㿘#> =b쀈`U ``$`W> =`Q8@"\ Ho (@> LL` L "Hp@a> LL` L  b`$$ ,   8~  -Hp@ 7 >  ax #` @    > a >  aѐ  沖 Fx 2 N 80ʄ ``( @: HV  > ȅ3 a7> H3  @2@2 @@@-@ 2*9> ='9> =2 2L`" `````$  8CWHp@ #> Řc  `) 0(( @@ ` @` x 8~?   8C,0Z E  "Z``` @:`Gޒ M` ( (( > =`$ > =" &4  %` %` %`@%`4%`8%`<> ń#` ( (`(`P`?> 5`%`t%`pH> @`%@H@ H'@H%`L@%`$$}$> !c0`$0{ 8 㿘Ho`(@aJHp@1> Ų#"0,L4l                                   `  D  (                         d    H㿐   `` (`(`2@" 7*   ` `" `" ?7 `` `(0`(  Eʘ `(0` 0 㿘 $``` `؀``H`> $6 $b``؀`2&`H $6 $2   ,  @& & 4`@"@4`   $@ & & 6 $`| $6 $㿘 沖 D;   ` 4 `@}*`4 㿘  `   .`@Щ` @4   5~\ 5~Z㿘 B  &  (   -" ` `*  " `  @`> ``2    @20<"  " ` `* " x> @c<' ` 5?`0 -(`>}` `3`@) `/8 ;-  5|Q G`* 5}4`$` , x$  7` `4`@`"` >   `2@@> $@ `@@` } 5@} 5&@ذ  `"\@ϰ  `2@ ,`ð  `2@@`8@,`   `<8@@2@`> ł '/ /'L   '7 < " 1V \`&m` 1 {  5 { <&@  $` $@4`,`,`H4`<8@@s ` > `` 2 h 1 "e 1 ba<2 0 <2 0 U 1`` `   ` "      2  , ` X@` @ $+`` `@ `   #4`(`3`  ` "`, @ @2 2   0"(`` 2  1 " 1 a<2 0 <2 0  1P\`6@$@ `` 2  1 " 1 a<2 0 <2 0@ Ѱ ;㿘 @$`  `  " `@ @a`@ &` {` (`(@(`5(` 0` $ (@ @$   Ψ `ʆ`Ȑ` ` ?&` (G`?C`؂` `,$ 㿘``(`쀤`  ` `$`>  > {"H> `  $@``造`&@ .@  `.@ `@ 㿘 ` ?c:``2$ ` @  @@:/  ?  '  ,r     & $& 6  $ &  $ > c@$ Ĕ    & @4  @& & &   㿘  `(`&> (֒  > ź`h %94`A  e$$ $ ` 4` `؀`"`H`"R $@4` `H@`'`H@Y  ?(  F> $@ c$ $$`$` $` $`   ($ (4 $ ?%@84`@"4`@6 `4` v 2  7& ł`h6 $x` x 㿐>`0`` `   =!6 "Ր  "А j  *  >@ 0!e `` `4  =s`2@` ""Z 9$r#6 > '  "   $;#`` `"R` =n`` ` ` !@* >}J >ɒ ' " `!((`   @  6z"s`Ӏ` *`0Z> ' P" Ȁ2ߒ >}$ &l0` В`l0` ̒`l0` Ȓ`l0`’`l0``l0``l0``l`xq   @C~ ` l hw&l?`8s .p l di&l l bb&l l `[&l l `T&l?`8P .xM l `@F&l l `?&l l `8&l.q5 h *`` `* `@ %Ā`"Ho 4(@a"n ? @&?&Hp@`Ho 4(@a"R ? @&?&Hp@Ȁ#> =@A* < (@&`! *`h` `Ȱ `@°  `@` x " &> 0`!] = '  "   ِ = ' " 造`\`0 Tð - *W`=g '`"" `  "  ``` `n `@````l `&lAΔ$ =3  '" l` ` @ (  @ u(`>} 7"`V` (倧 ( &`   <(``&` `0V   ? 7Ȁ`ٶ `Ȁ`Ӷ `Ȁ`Ͷ `Ȁ`Ƕ `2   Ȁ`"  nv̔    n' ' ` 7  7`  ;""B Ā`"Ho 4(@a"  ? @&&Hp@`Ho 4(@a" ? @&&Hp@0(`0``:W H` 5 n `"" @A"  ;j 70 Ȁ d `@@[ `Y 7l ` S&ll ߂`M&l nwذ Ā E  A@@< `Ȁ 8  4@@/ `ac (`0``ِ `"W" @@Q" 0;> =a؀5. "0.   @F  &` (`0``W H`  n `"" @@" " > =aԀ.m ".ܰ > =aЀ._ ".ΰ (`0``| `"" @@V"  à.@ 2 .     &l &l {&l w&l }&l &l &l &l> <''H'L'P'T'X'' '\`' la~> -'``j`   '=` `(` `2  3':%̀@Y> c<@ > ''`L 2N "*'  4`" 8` 8`'" 8&  -`-@%`(&<8XW ``\`@`<`l`P@8`P4`20<8  <$ `?'|' '' ;> >''x`x`|`UHo(@g ?r ``(‚``` `$@CĔ` Ƃ?? m?y ! `" `?q ```` ` !$!` @%?  Hp@ `V`<`l&<8@! :~0x@ ` ` `X` 4 `x`  >   P : ` `!!(``   (:Q 2"'  4`" 8`O 8`" 8&  -`-@%`(&C<8@  ``\`@`<`l`P@8`P4`2 0 `p< <$ 8@o"@ 0 ,`t`vT`\`q >  `N>  `> = @C<@"?02 @"A h 0 2 > =`" > =䀠``" `_`\`[(    ! 'Hp@9 <8@ <$  ` "> = @2 0 h > =@2 b _   2> =" `\`2  !@ v0 u,Hp@` "'8`(' `\`ch `l^a0<)@$4< ((@4$> ńh8` 8 `X> = \ <'̀ >  8`" 8' "`> `` `l "  @2 0 (@2 8[`(  `l ,#\#`  @F b " 0n ?(:`x`""> =a2 =@ 2 A7f'B̀:4 ^ (`l'"> 4`" > X`2> `l\@8 \> ńhL` L`(@ `> =a @WY0 Hof$(@`(@AW  A!!   O  c> =a "!" :> a4!8@  ! `  ! @`?Hp@2 3 ( "' 4` ' '/'' / '`(  $ \ ` 8`+" 8`(@ &`" (* ('q `؀``H`@]4 `$`[`> ,` ,a@o'gb "`>  ` `l8 8 @2 08(@2z 8 'Hp@0U'''''cr&`(  `l <,@A- 6H A"'"a>t0` 0|N `2^`\> ł`h`T A' `T|@ `2Z`\> "82!@8* ! |0 @Vw 'Hp@`( 2u > ł`h`T 3' `T ='`2`@> @' 2'` ``"a5 '''''Ӵ>  (Ր"> Ґ"G&CȐ"x>  $h1 $x` x''x `> ńhD` DHp@̐`( 2Q > ł 1x' ( '[ q' 0,/$///// 0/0/.0///0/㿘`   45k d   ` 2*     `  @ l`$ l ԰ 5b6F ' "  l`  ° œ$ l㿐'X`P'P'T''H'L``l`  ?c5 ( ?c8* 5  7ܔ   7 `q`y(( 0 `x0`8   (`& (```H "Ӑ A0?@ @"``˃1 `<` > ńh\ "` \ڻ6㿐`  + $``.`> ݯ#>h ` 9Nr > =b䀧ǰ `4߀` M - `> :a 1 `` /`$ (Nܰ `ͥ ڀ` `> :aа 1`"5 ˀ` P>  `ð > => =cHLLo `> a̰ ` (`yX ` `# 8 (  M `o` $ 8' Ɛ  $ 8" 9`Dz> ""'  2m 1㿐 ' > > =c8̀@%` -`@[`@` 2``la2`|`| (2` `y" : 2` :`x`8"`(2``( 2`) 6  "Ǧlf@ h @ N& W3 "'3'"( lf@ h ٖ@ N  3| 3v=F@ `   M > ł`h`0`4 `0 `4B "g``8@2b``(3O> =@'> Ȓ >]c(!㿘 > "(!"`d(@> Ȃ @(`'U4`$4`!$``td!|` ` )`4Y <4`84`p` O (4`4`p!"`t @!|$` ` `$ ` ` ` ` ` ` ` ` 4`p`4 @ <4`p^^__l_ _^^]P^^^^^^^^^^^܁" "  " " `` h 䀢   耣`쀠" ` Ԃ `$*  И  " l& 䀢$ Ԣ  Ȑ   `@  Ԁ@,    ߒ`Y ?` 쀡 `4`Y `$<   ` ?5M  ` 쀠@ +  @  Ԁ@  &  ȓ, `@   @`& & k Ԁ@ & & & $`*`ؠ k `?& 耡" &  & 䀢b4"> ` !@8 ) 8`1 @8*` 2!@(``8(!B) 88`! @2!B(`(!D"!8`@2 j`8 !@) (`88`@8`*`8 2 l2 l2!N`(`(`2!B2!@` 2!N2 l 2!B!B 2!@8) 8` !@2!B(`ʈ !|` (`  <taatd2  ` ` > =cx 쀢*    l  ("|`@"` l*> =`":݆ ( l׆ (P>  Yc<@' P` /1i@ >   ( ( <  <( @? @  @? @?`( `   1>3> c, 0hא 1  c`c  1Ɩ(`` 1# 70   ˜ (c`$`$` $`$` -$`( @7  Y``"`         ` &`  (<)@&`  .` &`> =`"  D `" D R.`  D 6`* + 0`* +@ `" @A`$  <@0@c$  `` @B` > =$ T@$  P$   ` 2n Y Y``2 %(`0`0`-`-`6`7 "@1 6` Y  |``` @%```(-@00-`-` Y``" /` `<@ڐ -`#\   @M  ` ` ` | -` Z`(6` v`<5`(`=`>`?`@a  7` \$ x $ ,  Z(6` v)4*+,L  X t u'''///'''''''''''Ԁ /ـ C `` '``'x  ؖ@9̘  B  ,,  Y #\@ʚ 00 0`24 `x `q,,z Y%46`@6`\ Y> =a @ *  ` `(`Ē`# 0# , *, /ݰ 0t> =a,K Y㿘 `\` >  b > `ch * @ @~ *> =c@* > * c &Ho4(@a 2 L0& $ L@2  X@t 2@@m t 2xexb 2Hp@Hp@ >  b> `h * @ )㿘@ >  @* &@` >    @> P#H `D@L(M`(L @"  & 㿘 `&V h`"` &@`$ >   @` 4  @`4ͦ  & & @<&  @$$ & 㿐 `` ``   ! `> ca؆@8a &&  p`> b4%> =w s "` "`$` `,!"`4 `"`$2   ! `$ P p@[":$   `9 E  $  $ `$ P p@="*$  @<    p$$ @'"P8 w$ $ $` $ & & a@< $`` &  `ʒ  W    $`$`$`! `N$@$`   $  $ `$ P p@":$ $  ``& `̦& ͘ & $` p" $$ $  &  @& P8 &$ $$  `$X$ U$  $  > #`㿐> =c`>  c((! @@ !   #\> > "cp   $ 㿘 " -  8` " 8> bD y#㿘 `%6   > # ? @ & &&      H& (`(`&  f0>   H (` > (`#  㿐Ho (@a  @` Hp@Hp@> cax@8ax㿘+> b` Y`` X& L)> = L@#> * & Hc*  Ho4`(@a`> =@X> => c@ <hI& 6 > =c(( & 2  `3 > ' bБ0: ad`& ad &ad&ad& `& ` @X`b$`@b> 'bc> cp@` @( " > բ#```> > b vh@* @ P *\& L X> ``h>  vb* @ ?M& L>  ch> > b w& > s#x㿘 `@  G ! $!8 ` ( p p @$!  $!  㿘 `@   ! * &!8` p&  ` @@@p&!  $@`&! & `!  (&! &! !  p @&! 㿐 |+> =cx " !|+ <) (`4422` @`*R ؀8 @* @taL402?쀦H> =c`X`2-, $ 4p  \ հ\`2ql]"|u"Ơ|`"r|lcx @쀦*<a*9, @82$ 4p @?p$l($h  $t@f e*$ 4p, a ,, 8%$ 4p|$ , @($ > =a2l``('` "l @$ , ($ $䀢$ @"``l ` @*cx (cx`` l`" @ @f쀠@: @`㿘 | p `@ .` ȳ0`@  ?@ܐܒ> 8c A@͐͒> 8c A 㿈\Ho 4`(@a`` 4``"oHp@?`!`?`D @ @`4*Hp@ D "`  f  0`(`<($ Ȁ`" $ `  ̀`" $ `  Ѐ`" $ `   lla@a$l w,w"` :``$4> `` `$,` $0`$4`$8 `H`  $$`  +t  " $     *{`D`D<t`&t`@ 0`.S` `0&t.R``ta&t@ &x`> `&`T&X`P&T`&`&&&&&&`` t @&t0`$0``` tb&t`` "td&t܂ 6h&&> =c'> '> =&4cT0: 8`$`````"`p& `&``&Vl&&&Р0`: Ԑ`D `4&&``@<`0׫ "9` 7$Hp@ب laԒ R)ː(  #\@T ) 1{Ր> ca?@8a`C$8 $`$$`` $H`$$L`($P`,$T`0$X`4 $\@o 0;` 7@)k0НP> 7c<'X' `&\ @> a  /> = T $`t` `td2Xa| @ (` @р Xa|ؚ @#\ А@j  > ca  @8a  >   `& `  `" T`h`4 `t a$`t $aT$a\@&$`t@`td a|'''''''''''''Ѐ`'Ԁ``    // /'/ 'q` ؖ@2n  "T`h`td4z`t( L`  `` 2@ ` T`h`4@`tb$`t  `" T`h`4 `t`@$`t``8 ,aS   `" T`h`*` u s > ?`G  @ >?a  /٠ `/ؔ   /`/ 0~  6 H7``t {$`t #(\ `D    `td"V'Р\ @!> =ca|`@?``'`t'؀d'd' d`#\ 7`#` 2,? `0  `" +> c!@  ?!਀ "&(&&Ph  h @`' h' @ `Ԡ ςР>  L" hX@dt `&&&6h`@d `&6଀P Y%%@G6஄?c4&D ag&P ````D<&> =c  ``ং`6`dbdং`6"&ং` 6&ഒ '> c`h`@ `h `@ `> ca@8a +`(` &ఔ  > 8c `+ *&ఀ > =ং`76&T2wd M?'@㿘 |V h `@     @> ax' ő`"7 t` @0&  ` `" $` ? @$ $  | "  la"  H  @0 `  @͒ &  t@@0& t t@(& t㿘%> @x "  > ` @`$  >  @` 2 ") >  `` `! > @ > #  `! @ ;`@ &9 x $ @&`&` > #  Ȃ`! @ ;`@ ?9  ` @@`$7$ x@i@  ? $$ `"$$ `` @@`@O &? &  ? $$ Ŀ`2`$  6`$`?$ `$%` Ԁ ^$ `&$` Ԁ`` Ԁ7@> ` % @ 0# $  6`$& #  Ȃ`!  @ ;`@ 9 Ȉ#  Ȃ`! ;`@  @ c9 %   @?$$` Ԁ"0& &$& 㿘Ho 4 (@a `"  Hp@`  >   > =& cT > cah@8ahÐHp@ca@ 8a > =c6 (0@((! &   `  > 'bБ0: T0& >b  & 㿐Ho (@ag " ঃHp@` 6ঃHp@ऀ`rHp@> ca@G8a㿘Ho4!d(@a!d "&!d   > @`F'`2`&!dHp@> ݐ#㿘Ho (@a> ["Hp@> c|> c<' 'L'P'T'X'H$|'7L'   0```,`'$ N> `  `  *  @g' &  0`(`$ `$ 0Ԑ *   `*>  ׸@`$  @ ``((`@0` /` `2 ``?c`` ``` ?c":` `` $` ߀`@2)(  (@ " `$ <8@|'  ( t  $/`  $`@X(`$(d$`2 ```2 ```Y `w' 'h'l 0 ` D`d'p7~ `"`D Ip`D`'p`h(`@p'd  aP('`@`2'؃8`>  0` `D 0'`ܐ) Ho&(@g  ` `$@-ܔ #\#` @2```@( `Ȁ " `"|a`̀`"oa`Ѐ`"WaHp@p> =Ph 4p `2ܐ h`‚p#\h (l#` p` `p> =!X#  '' ``ppPh`hp`p#@!'t  @ 88`p (*8`` ,` `"i" 2  paT" @ > = " ,d  ' ` 7 ?4p `9 $@ <t 't@'  ' 6 ߂ @7 `XpS`h`Tp`"Q @А 'p`$3pF`'   (p@ #\ @m 0p  `倍! `8d> =c `p`tp`pp  |`@!|``~(` :`>  B 0  w @  'l  'h $~ `2z  @B`  s 0`2p 0h ' ' 'h'e 6 $( `$(,#86 $( `$( 'p7~ }2  0 >`"X%` 0``" `D 0'`2E` :`$0 ` >`"XZ`20``$> =cX> > =#c\ qp<(v   *>  @ &'~p(> :`l  0G@-  W'`ȃHp@Dp''''''''''''Ѐ'Ԁo 'p`$ >'"X'  ( @{ "+ ptd"K;> '>bTp0 8Z: $p]%h`` `? @'`'`'`p Ԃ  @@@ Ђ`$ؙ?`@pC<Ѐ`  Ԁ"gt`p!ep t`@! t0` // //7ڐĒ`  7``ph=7~` (> c>  ޒc` p hd(`/ن / ' /7/' 7`8U (`P23`@"G`> D`Ѐ"  U2U4ephl#\#`#h#dؒ?LpS ؅<  @ <ؐ  '@'`p!T@  !`!` p !`" p Ԁ`&pp h(`0` 8` (@ebp2 6`t> =c = t p =58p3`h p`@$ 'p `Up`Q`t@p t<`=$<   (p#\ @. 02p  t`! t` 9 $@ {<i `F"  p!T p  @ `8p^  *p @@ @G''p'dp`p$[7 > =Yppt`ʀ`p`'`a` >'  ("Xg`"`'`a` `"`" a`  > cl>  c m`#\ؒ '"T `D "!'p h(`oFpPh`"値` ․> =c-@*p`t @"!4p̀,4 p@u 2 rp!!! ! !!$@! tL`$L4`$4 pp@ t(# t8`$8p `!`p`"pPn;> =cPp!p3`n "@`p`$> =c`> > =#Qcd p ``p` pp @ pE  p" 9pS j`p p#! p`t```#a#`Ԁ#`t#`> =c ` Ѐ`P` `"pp @``9$p> ' >0hbTp0 8: p t```` !S !R+!P+!Qppa8`p> = "@p p@  ' p Ѐ@8c @p  p ؀2}  p (`2` "`pPh` 4`> 8@Zp7  ߀`ppP`h  `Ԁ@ 2t@`utɐpp`t`#`tp`^ "%ph) 8`$ 8`8hpp  t h`# # t) 8``"+p` `2p 3`h` pp!|``~ t`@0ۀ d p @     z  u ` p `"`p p !H#  # #!Hp `tX#`t``؂ `$j#`g pT@ p  Ԁ@ "7  `\! `W   1 hy58@pz'p2U2``@   2 U2`k$p`! t`$䀣`" 2 !@2  !`"` `> =#!\#!T`p  ` `4! @*Q n`2`$`e> =pa8  a<"@`> =c 뛒"@ pp"@` < $@ < | "  la"  H  @ 4Jp t p !p @`(# tpah8#ahp ̂ ` {p !_p 4` > 'S lbР 0': c@pa"p@`t'##`tp`t@(p t`p t@{p0F    @```$#!Tp#aT> =pi \`7$p> ' >1 hbT0 8: p t````" !Sp pB#`@g` "   `" >'pp .pp  pt! !! ! tpcPPn6p lp;> =PncP%pc!`' `Ԁ"lpaH gp`?$p!$!#!  pp#a p0`nt  pap0`nF p!$!!!  ڐpp#! p3`np@f:. p3`n* @ ͒ ='p p`Т'@`< $РD<   7~E  ؆ `p!   @@`%H`@5$Ip !L+!L (`2`@a`ta\҂ @@$E#aT p ? `t0 ` $0`$p1 n `@  ;`$@ $<> = n`3 nP(`8`@"T $ p!  p@@L!! p 0  `#@ @ 4 @p `"   䀠`"   p`$ `Ԕ#``$p 9 @ `<`|  p la" t H  @, ptp> =c 2 jp `"g `"c`\`"_p! t` /`pa,(p> 'bЄ  Npp(@ (4p@ t%c! tp@ t( `# t0;p` 2> 'bp0@:`*` P*`n @  0`hp @+2 h> 'bp0@:`*`P*`Z @ 5+@臐 tptp> =c 2 Ep `"B `">`\`":p! tp ` 9 @  <p`$| "  la"  H  @l ` tppt@$! tp@ t (G# t># tb@ p`4?p(` :`>  禘 ap~p(> :`l 皘 Up|`w$  !  1 p(`0`2 @} ( zpa`#a$#``p`t a8p tPp`@$P@<pPn]pp!$!! 3 npw p#a8`t `p#`#a #`t`Pp`@$P@<`pP`n<`pp$$@`  `"@`$@ <`@ `<`> =p!8  p!< `> =c 8"@ p@p 4`p> 'S lbР 0: <pa a$`p@pcPPn@ pP?c(@8p!! p " | "  la"  H  @k @p`  @#`0@papp`t pp !p @`(! tp!h@8#!hp `̂ `#`#`p``@pp pQ h`"3  ``․ "\ ` p3> '>bHp0 P: p 3`hD >` 2À> 'bp0@:`*`P*` @ C`"1 p @ f2 h> 'bp0`P@:`*`*` @ 3f ppt@@#V! tp@ t(# t07p @x ^p  t9! t !R+!P+!Q (@U'pO"@  @2eU2]#B"@ ># tb@S @ p a( a,㿘@! `  > =cP  @&   <  ,    ,  <"  " 㿘 !@`6!B!D((`88`8!V j> =(c@  x x> 'bА0@:` V j`  j6 j> =(c@  ဢ x> Ґ 0 | t> <' @`@ & t'p> p#<@  >   ( & t @"!> =!4cV l * p(`&!  'x t(& t  ' '|''l'h 'd   !  V h> = h|"V nN r`  G@  `@ @` pȕ(`028'| '|@ * ? @"4€ x@  t`|@ N r`2!|!H0; !   !|``` . ( 2  t  ``ဍ d  . ( (` ) )   '  (V h`l b (X> !0 @  ?'|#> chP2N r t` +> c`h`%`h 6  c`8 c$ @$$$ x,% &> ` x`   t` !2  2  4`"! $` " ` <$`` '|@&` aaК`C =aȄ@ =a Ԁ +$` > =#`",`  t@aD @`%aD t2  t   t@@"S?,` 0`  p& !Q! Ժ  ?#+#@@?@4`  ?c ` > 4`` ,`  td!|``w`2N r$` 4$`( ?0`#@@8 @4`N r`"  4`"  ! `4&!@ `2V h> =㌀`"   t " 2   |`$(!|``A`"p`0 |x( |q(`( |> =a@  't* Hx 'pp t!l8&!l`@`%`@ t``` `%`  t !@ `4&! &!` `j& t|`' "!  !< u  > =P@&%N rN " N r`  ` p @  ̘ '! @&! 'p?!Q(! ԇ2 @!@6N!|(`@ 6J!| t2F!| 2C!|  @`4=!| "8!| "4!|! @`  `  4`΀ "'p `2'p 4`"6 j}'p t`& ` `$ "d `ad!X!T> = @Bc &!, ` `    &!, <`" +>  ! N<+> c`H`D `%`D@ =`H a  c` c  (`c$ @z$ G @$ @2$" $ :'x(> =l !2 @!@6!|U(` t& t)'x*N r"!|N rH ?   ..遐d7 }I  À` t `  ``"!R`@`!R@@&x b ( 䀠` ( > #! $@9! @0`  䀢> `  耠쀡 " #@#```  (`@A`@"@ a@    & "  t`& & t "$!`" !` @"! `' !0> 'V lbБ0~: !h 4`" l6 j `& !8` &!> =c&!<&!8``%` " 2  `  @> 'V lbБ0~: h 4`l6 j/٠ / `| //Ē`|  (' |]` ؖ@z  J!| @@#\@x 6!| 'p_ ؐ @p@ (4`؃(`0`0`, ,  ,  |@q `,    ) ((@@0`0`, ,0`, ,  |#\ H't @W 'p'''''''''''''Ѐ`'Ԁ``2 |  // '` /'/`'`|`  0`(`$`   B> = $& t|"4 +> c`x`e%`xc`l`5%`l  Q$K p'pj&! l6 j &  (`Pc p# & taH `%aH @`>+> c`p`/%`pf$`!  N r`"a@" |a@ `%a@2!| h  4& `,6 j֦  pX"r @q t tb>  @A  9&藐0 c`t`%`t@ &\i(`V & +> c`X`P `%`P@ =`X 7p (/p` pA2"V h t`"> >b@ >  H >  x>  h A'pV h`$ tp6!N'p 'p>  +  |@A?'pV l> 'bР 0}/: k'p_'p?*!Rc `(@ *!R   㿘@b3 > c<@' \p@^`.`<`"* '`?P 'X'\7`@bP 0` (` G\@b@b4 @ C>  @'d 7n 'h/l/md@a ̒ '''''''''' z/  z*@p@p  @'/@aŔ (>\? "0 㿘!\ @ !\Oz L&!\ 㿘 ?(`0``O  L*  MÑ2 $!\   zU  4 (> %> 0c<' 2#> aؔ Xy֐ |`>@ay  |`<@at !|`, |`8@al  |`(@ag @a>< p <&!X@&  >  !> d#@^!aؒ#a@aI  $0 |`,@aB  |`@a= ג2 㿘 D*    4`??㿘 D   p 4` X` ? & W? `&  ,` p0`" X? & p '!> #<' '   '/ل >`/#`''''#\> 9>㌐"Xؔ  @V   >  x> `c<@' " `@  ` > =. b ?` >Y+>`bX08 . 1>ڀ+> `(`@@ ''ܐ"Xܖ e> @` D @0>+>Ș``>+>Ęc> =à+> `(`@@`''ؒ`bXQ D   !!l~ߏ!h5 t@/@!p@ o$!p$!t 4!x`f4!z> !b_`A`3`@W '7'  ''//ϐ0E$ t t(@$ t>T`x``"@```"L`  ?>Y`R耦  K> Da@xY>` q ` ؔ ''''';>`"X  T >>  @` DN J> Da@H@` `?`` >c> 9c#`#\>  @Tѐ"Xc > 9cb> Da@`A`3`@ 2 @z@ >φc㿘 DPh` @`$ Pj0NC 66)`$0NPN`"0N6 8`A`3`@20N㿘 ) >ax?   @ $>$ ɐ   ?&   @ $*$  2 㿘Ho (@a> "Hp@> ` 㿘 |@@ t`$ ` > b4`~ 2` x " t t & tܐ!)$D  & t0۝㿘 |V h`@> ` `<"V!N4 8` <4 86 h>  ` 㿘>  "2 O"> =& cx>2!02 p` Ҕ>  a, @, , " Ɛ@  , a>a0> => =c> =c|@?``($`t8( $`$`|4a@4`l4aB4aD$l 4`ll$al$ah$a$ $a   $a|> D`$D,w $a|> =a$D,xx\> '܂c<@'  Τ |@````! 4!|H   3>  `@& `4 44& & &  <((@$ $$ , !Q?=444 |`& (`j`( `> c<@ >  `(v (v  v! v v < -----   |@l% -(`0`0`--4  * @ @jI (4    |`> < W '\ @~  ?`vJ vF    ($ v$ $4 $ , 4@vI44 > =a> =, a @ (`  |> <@ &  @<@ @ ` 8` K v  ( ( (D v < < <= 6!8> 3!> 0!(?c44F& (㿘 x`_ |!| 8 2$>`, ut  up p?(@, 0`0`0`,,   , , , , @kx , ``(4 > 4<<((@$ 4 4 $ $ , 4 `  ( ( 0 8 (0` `?0(`(0`0@`@ @ (`0`0@@   @ 4    !|``` ` > `$` @`(`(!|  f(``2!|  0 $`  ($` 㿐 >#\ b<!   > > " aH !> !x  #\> aP> =c!x   !>  "4  #\> aX> =c  "4> =c>"X> D`;8>  < D> `<`8 > >@!ߓ@s!h㿘>T`2>`@ T>D`2> D>P`!>`@ P"@`> 'b@c $"@㿘 ` > b4`Ԑ & 㿘 , , "   , 㿘Ho 4 t(@a t Hp@I" tHp@㿘Ho`4 t(@a t Hp@V h`  >bH > =!4c  > 'Hp@> '>bD0v:  P͐Hp@㿐Ho`4 t(@a tB> `4`#`4V h B>bL"% | (> '>bH  > =!4c>T :.`<`8`#`8 x  Ԙ?#\ A > '>b D`@ۀ > '>bT0v::  8uHp@`<` <#` Hp@c`,$`,V j!@` !B!D/ i. r. rHp@> =!4c>bP!+ +`8`8*@08`*> =uc䀤 `0` <=$`00h> c<@' Ho4 t(@a t@(@ |  !p   p,!x j`6 j(`8`` >  6 j$` $V!N` <Hp@@ >  (`% (!D!@V!B(88 V j> =(`un6 l* : &6 l > ' 6 l> 'V lbР 0u[: > =a"; j | "7 jV h`3 j(`8`1` @`+8\ " !| 4`"!| X`2 j!|`2 j'/''' / (' ࢒ "  j`X`|`V֐ j(`8`H ! h& & ̂(`0``1&!8 t !  p2 @ ( &! t&!$& 6 n@& t!Td%!T0_V j> =(`t6 l* : | ~6 lM0L> =c t@2 @& t |!@!B(`6!@8`@6!B!{7!t(7΢+@& t)@' (!> =!8$  |z` |`> ("X>˘ 0Ð!x$`X 0Ho(@ a> =c>>"<D`(#c> bH#" = c쀦@ p ?@>t> }> =c쀠 2 p!(1 ( @䀦@> => 8c@8۲ڀ@㿘 | v`@ "`> =c p?@t`Ȁ@` K> =c耡2 p! > 8 @8 pX> c<@'   2 @`   "  @bP @ > "p{ `P`   @gi Ԓ @ga 2ް Ho4(@a`P` >"X˖Զ %" D " @`2  50 2 "p2 0Hp@0Ħ.> @2?''ăHp@"&@p"'@'''>"Xzf!` ӂ?>Ԑ"X  2@Ƃ?'>"X  㿈 `?`( (`  * #\> = s̐#0>>sb"L0jv 0ߐ> r 0א 0ѐ> =sH#0ʐ> =sA#09> =#'s8 #@ >!x% '#ʘ 09> =#'s #@ > "4 '#  > !rW#0㿘 h`8 (`> 6 h V h`4 |"`@V h` > '>bH0ry:  P 6 h6 hް㿘 |V h`@``V``"x b`  㿘 Ȁ`4 !> =`!#> =#c  >(bX " 22 h ?4 4 7 #耢 # c쀢 ސ#!> =#> =`la  "!|"!|㿐` ( - `)7 `.2 la0@L!  `,Hp@ `ӗHo4 (@a  逤` D ` h> !@YM ,`>C Ƥİ -``"> Y$x @> 87 p>  ` 4h> '> =bT0q: 8$$$$$ >`  la@M~    }4h la@Mot q 8  m `"  W `2  x7  _`D la@K W 5 P H`2  `@H  aD  L`@`> #` &` M(@ L `2,L &`HHp@  `,"     ! 4>M: 7 `   R  \ r UQ  $  8  Hp@`܀` ؀`:`  Ӿ 0ݒ Ӏа ˰ =   @,r$,r 2 `2 `2` `Հ2  > `2  >?c  >` @L @M6 0ʔ ~ <8@x' v q  >`  gٰ] 7]㿘Ho`4`(@a``Hp@    6`D` `* /@֘Hp@ 6   J ' \" !"t * `  ۰ٰ J] ΰ *< 0P2ǰ *      `Vh` td @"O&&ܰ   `Vh`Ѱ  @8t&d &t p    ` @p6p t d u s  ` @t `&t &t {&t 4ph,h㿐 ```"  *#\> > o \0 9> "t n 4 ;9> n 㿘Ho (@aHp@㿐```"@ ``` > =b. ?@>Y:`耦 5ꀢ1  `(` > =a"> >a"> >a`"  (`0` >''" `@`@0>aD >ߐ"0@ 0H> c<@' ``" @@ >   ?>Y`o耦 j > Da@>` '/'''''/'''' '@NL' @b > aDs  ''  ' //Ē''''''kŐ@N!'Ԓ @a  U!>#\#`"@H0>aD `@``` ``'''''''ؠ @a k   `@``` ``''''''' @a 0Q!>بaDȨaD#\#`> 9>㌔  @H`"0<"@n@ 㿘 @0`8  @ @ ܁> >`t>>]c(" #>> btc<' 'L'P'T'X'H''L'$bt 0```'  @ >  / `@   @%bt`% bt` / `@   1   *;>  2bt` Q  @@ Bbt (@$' ' ' ' '+`2  `2 ?c` - `-  ?c- `bt $ Hbt``( `v `(`r  `n k "   @btbt6 $(` (> >a> >a`" (`0`"d ـ``#''/''''' /7 @`'/''''''Ԃ /7 @`֒ `ဧ < 8@!>'  (ې !>;!>" 0``bt `D 0'`bt  Ho&(@g  ` `$@  #\#` @ۚ``倥 `@` S@ `Ȁ  `"i!`̀`"\!`Ѐ`"o! 'Hp@'`l0?2`@` @} $`l2`@` ̖`l`@`2  ! $`> ;`lh> ;`@`2  $Ֆ $> ;b`䀠`͐H`@ؐ  bt `I `" '`!` !>""@!/沲 a" `J`J ("`>`@``@` 2``la2`02`"Q`8`,`Ӑ`,`0`В`4``8```2`` `2``$`2``(`2``C   <0?`l@`@` @| `lf`@` `@ؐ 0 T >>t ` '`@``0?`l`@` @| `lf`@`ɖx`@ؐ  2bt =`@0- `5bt $bt``( ` `(T0l}.!? c''/'' /7  '''//''7 ' ` @  2`6` @\6*  > >bt`( @ ڔ  b'`ȃHp@0bt` @۔  2``<2```$ :`%`$0")` ``%` ``%`28 07 @`7Ґ0 @g6*  > >bt` 0 !>' "' (º"`( 2``(ɀ` 2``< t`@0 ``ِY  h5  >Tق` T  2@ 0} 0v 2: 2-0 "' (`(` `? @'`'`'` ,`@'6  @wp 0g`"`'`!` `"`" !` !"`' '  '  '  ' 60A㿘@!㿈`l'T'X'H'L'PT' `?cF!`(`8`  89Ho 4(@ Hp@0怠` 9 , `lh)`"y   &`8Hp@ː° (a ؀0ʤ    7 و`## + 3  + `8# `(# `>3 `<> >3 3 `P!3 `x`q+ + 3 >t, ` ,``H"(`@```0#\+@  A$`2$    (0@@?@@ (`0`0@@8 @3      ~@z u2``2``$눡`> B!㿀`   &``.`> /!> la@Px  ݀`  la" ( ` `  $` (`ް 9Ho` (@a la" $ 8> 9bb` ``$ ,$ 0$ 4$ 8Hp@` 4` -  䀠`" l" l.d`-V  la@ʰ la@B  la" ( ` 8 ` $` (`{Ho`(@a@E Hp@ 2dߐ` \ Ho (@a>bHp@ E> >> >`TXs <` lad> => D`2* wHo`4 l(@a la@DHp@ -  la"@B@  ` 8Ho`4(@a6" ; 퀦a" ( ' ' $' (//'6-'0a* x㿐 ``䀠`` #Ho 4 (@a ` ``8` @.' -Hp@  ``߀``   ` *  > ;>*b(#`      *  > ;>*b(#  > ;>*b(#㿘> bh`! ``b 2bb2b c$@2bF8cF5 (2b`\`"b㿘ՠ "  `   7 $ a< $ (```C <` 8 @ /<`  (`0``2/  !(݄@"0> C"`>T> ; I ?݂c`C> pH`` > `l@f !>(` !(݄@ִ> pH/`@@ > `l@fb >4 `  > Ų ` ° ] c䀠> Ł `D  QHof4 @(@g @ D6 H <$ (`@"& (`@ ` @& @Hp@ `|& H L`Ȑ0 <㿐> ;cL'L'P'T'X'H'> ;b -B 7G  / L /J㿐> ;cL'H'L'P'T'X' 7  `&    @?   @8`C? ````````) (( @0`0`/`/` 0`/` /`@ `(` : `ɐ  `````) (`(@00/`0/` /`/`/``\ڒ*  N@ `"*`*`"* *`* @@c}  & ` @7`  & @7` `@c*`7`  D  Ė Ho&&(@> ź``@`D6+`H <& (`@"4'@ (`@ ``@'`@Hp@g> ź``@`D& <`H`'`H`L`Ґ0B 2K&  <㿘)> >!,`*    %> >@ !!,,` 8"@8@@  @ 㿘> >a$> >.`0`@" ` ` 8@ ` @ > = ` `?(``? (@` à > =a> =a  ` @` @  "``,`-` ` @?"`"`"`"`"`"`" ""`` ` @?"`"`"`"`"`"`" "" ` ` `` ` ` ``?  `?㿘@ V ` @j `?㿘` ! ;  6 a / ے # a| $ В  " aa  Œ  a` a@. 0 \ a@& 0`?㿘 ` `&``6V  > o" 㿐#> >a(  : 0` "$a(   * #\* !> #> a(. . 㿐 ` `> b`@A  '㿘 ``@& <" 2"! ഄ? @ " ""ఀ &"! ༄? @ """฀ &"! ̄? @ ""  $Ȁ &" Ȑ ({]r& $r @r Xr p! "!b&!! "![&!! "!T&!! "!|M&!!| "!F&!|! "!?&!!  " @"  @" 6 K56!6 K㿘 K 4n"0"" """"""> "" """"" 48" " "! (>pbܐ @>p}b X>pxa p>ǰpr`ā㿘 $d   ̀ ${& $@l  ${& $㿘 $`@`  $& $X> >a,`E> >a8''''''''''''''''  (@ `"(@(  ` > R"> > b > b, @ 2?  , > 6"㿘)> >!@`'> > %!@'> >< !@$< !@@bm@ # * >@0` @`2bU @  > >bI @> >a8aȐ8 @     86 @  @ . 6@(@ 6@ @ 㿘#> >a,`e!! !Ho $](@a,* "b"! " !@2 !!&d > >a0* "Q 2 !" !@2`  !! K!$> >a4* "F 2 & " & @2`  & > 0 0Hp@aa,* "!!& > >a0*   "!!!$> >a4*  "㿘 $d   ̀a@ ]㿘 $` `Q@ M㿘!> >!8 K.` `$!82* !8 K  2* !8 K  * 2 /> >;> >9> >,-@`a0a` a@a* $@" 2aa0@`!4a a`a * $`" 2a!4@`"a a`a$ * $`" 2a,,3 Ka0 K3%,!4'a03 K'!4㿘Ho`%> >(@a%> >,`)> >N+> >! !!],* `'> @` > >08(`(`@@,, &"!A!!0*  & "!!7!$a4* & "> 0a49 > >$0 `` `Hp@D! !ϑ* !> >!8 K  1* !8$,` K(`1ޔ !8%!0` K(`1ה %a4㿐!> >!4`1  !4* @ 2!0# !!@2 !@2  $`2 @!$@| 2 d`#\   " 㿐!> >!0`1  !0* @ 2!0# !!@2 !@2  $`2 @!@D 2 hd#\Ԙ " x> #> >a4c<' 8   ~a4* @ 2!2  / !@2 `"! @2 !@2  $`2 ! `" !@ 2 !$@ 2  ?> '/'''''' 9a4* @ 2!0倦 !@2 `"! @2 !@2  $`2 ! `2!%`2 0Ɛ!@᳒ 2 !%q#8㿘!> >!,`% !,* @ 2 0  @2!@2!@2!@ᄒ 2㿘`lh\   \`(!le?@` c$&`C@̞?`(Ho (@aHp@ 2ޢ$]]$$,`,$$> =t` ($$$t$ഃ8`$nt\  =  \ ;c` c@88@@㿘Ho 4 (@a  $@     $(> " $48" " Hp@㿘Ho 4 (@a  $     $@> " $48" " Hp@BPBPBPB$@`BP㿘 0 .`}.`a.@.`0.`.`1HC 6`6`2 ,> 9&` 0|#  4|# 8#  # # $?#  ( #$ >3* <3, @` ++(#8#<#@#D#H#L#P#T+X+4+|3Z3\+` ,#h 0#l 4#p 8#t # # $# (# 6`6`2 8?&` ( &`  >6` <6` @` ?6`B.`.`@+4.`|+&`8&`<6`D.`` 8&`d (&`> >`2"@2㿘 @  @ 2 㿐> >H`)!>      `$ ,   2, , `<> >$ $  $ $ Ђ $ Ԑ>#\ > HcH  ؔ  ^ ϐ  ! p ` `,  %> >L`j7>Ȓ i [  >ΐck ` 0 , , P, !  , Q [W  ` `4`|``````4 R, $, T''''''' 4 " 2 ``8$ ($ X`|``````''''''' "`  ?$ ,$ \ ` `@, 0v, ```B``D4 24 b4 4m4 d#\ > LcXȒ   ј  ` `4`|``````4 R, $, T''''''' 4 " 2[ `` ```8`<`@`D$ ($ ,$ 0$ 4$ X$ \$ `$ d`|``````''''''' "N`    $> 9c|c|` ``$ 8$ <$ @$ D$ h$ l$ p$ t `X `(, x , H`*`Z`,`\4 J4 z4 L4 |> =al> >$ $  `$ $ $  $`@ǯ    > 9c|c|` ``$ ($ ,$ 0$ 4$ X$ \$ `$ d?$ (E$ X`` `$`H`L`P`T$ 8$ <$ @$ D$ h$ l$ p$ t`<$ ,H$ \㾨> \c<' ```   ˰ "6`Ă? & ```(R ``Ȁ```@ހ``Ȑ̖ `a a$a$@n | ݂?   0#\  ς?ꀧ 2 `  (  `'`, ;>`$ $` !Z!)0``8` ```8``Ȁ > > `7`"0`> 4! 8`! `Ȗ i;```````|#d`0#\#`#h 1 "a"]`Ā U @> ``J`?`Ȁ  ˔ $`Ȁ  | ` 6&?3&> mΐ#h`Ȑ ``a "8a$> > ``X> 4$ 8`$ :``Ț````|#``0#\#d ?`Ȑ | `Ŗ? &  $`Ȃ 7 &  &a$@݅ | > >   0#\  ؀`Ȕ Ò:i`H#d#\#`#h 2   \` @>  7&㿘jY  "   ? @ &  &    ? @& & 1>#> > ` !  P  `&  `"G "  ȀR  ̄? @& &   Ѐ"=   Ԅ? @ & Ѐ &  "  "  "  `> >x x>   D@  0''  8>1 > > `  ȝ>  (c<' 9\> >`x"?&@ 3 '  0'''''''''''''''''''''''''''//`#` / &@ e2'2'& '  H   &     7 /    ߖ''܂ ///؀X/"V 77C' "!#\ 0" 8`T 8`" 8 A &7  /  塚   // //@M@M ``" 77      ~t  o`" 8  A `8h (`>˄L`2#\|` |x  ` #\#`&0+ }``'| a``"y h'x  $`  Ȁ  @$ ?$ $ Ȁ ` @| |a$@ۃa$ ` a"d `> > a| ȀK  @$ ?$ $ $ $ > > `#`<|> a4 |8$ $    0#\#`#d  $ $ "  $ " @ `"n *#\`" `Ƃ ? &`2'x l`2'x p`2'x t`?|'x> k#x&#`a: A:7  `  ` > 9 `    `U'| > 9 @c|`?L'|   D'| d`?F'x`2a   " 2  |``ؐ@Ւ | "[& > > `q`  0 Ȁ"   @$ ?$ $ $ $ |`> a4 |8$ $ ` "  #h#\#`#d 3 W$ $ "  $ "    b #\#`&ژ 0ِ " !!` | a$@ua$ "6  Ȁ`=?|` |x  `& * 0 0` @(   ` ` 0` @| `_|*l#\``| |x`  `X ?  &$b  ` @8 |  Ȁ "  a`` "  "  a`"  "  " $  ȀM  @?$ $ $ $ b  $ b  'b #\#`.&<  |x`  ` #\#`&E  | | @¢ 0 2 Ȁ`   0 #\N " #\     "   `     @   *  >!P>)c 0> >>*b(!P㿘> ݐ# 㿐  a 0`/퉰 />&P(` (a%`"ea(>P,` u ,&a`"aa%`"a,>P,` 7b ,&`2a%a`2a%a`>a%`"a0"  ("  2i >P` & 7`a4`ꀠa8`怠>`H`" `:`ې```Ւ (((`>a `P   > @<(@@(@$@ > =4`a4` ,`a($` a $`4`  0d``(( ``2( (  `. .. .  a$؃(`0`0`. . > = .  @J3  a @J. `L`6 ( ! )0`/. / @.   ) (`(@(@ 00. .0. . >P `! &a `"%`` `@",   ؆@C 9  ```2S( O(  ) ז. @ `솃@C >`  솃@C 9 a `؆@C >`  뺖 )0`/,` 4`/ @.,`  륖,`   럖``?@4`㿐'>P` $P 됖0```"  P(` ( ( (0``" `"& >  #   ɐ 20``` `/ `P` `@((0/ `쀦)P ( ( @ ဦ)   `"> >`\`2DP> >aP"?P4 (> :a`7 ``"2Pa<@2`` ` 񀤠 `2   "  `2  @i  2 P$` $P  8 @ <)k> >4 `  D  `m Hof4 @(@g @ D6 H <& (`@"$ (`@ ` @> p$ @H` (@@ > @T`lHp@ S    ((`@0`/@-2 O   ((`(@ )- 0`0`-0`- `- ) (`(@(@ 00- -0- &-   /  @,B?    `(`@$4    P` P ` @Ry 4 > Ŧ `I `$ H `$ d <㿘> >aP l>@ n!P !` 㿐> >aP'H'L'P'T'X l > LH' L P `w `     @   *  >!>)c 0> >>*b(!T㿐a% " a > `E a ``2>2>> (a"`*` 4  >`  7  `N >!  (`!   8 @ 9 (a `#`a  `, ,, , ,  a؃(`0`0`, , > = , Q2  a,Q. a- &  <(@@(@$ > =4 a, , , 4 4 4 a($ a $ H4>   "@& Qm  >4// U &#X > ''''''''''''''Ԩ<' @0R 闐> ` @ V>   ܐ  ////  >,a\ &>؀  >" """ "" \`A"" @: 2" @3 "䀦 2">` J 0 //// 襔   蠖>,e 㿘>```$`  d @ "``k T`  8 @ <`  |4  D  ! $ !<$ (Hof4>(@g>` @ D66 H <$ (`@" p! @H`` > @R``lHp@ဂ` Á`$``! H``$`Hp@ <㿈>```$` ဂ` ခ ` ``$``2` G "V`ɐ dH`[`x ` 8`@ @ <`   Ζ ?`6 耈`:> :D  ]  Y& < & (@ ` !> >aT l >O@!@°! ` 0?@0㿐 L'L'P'T'X'H' `a `> ` > >aT l>㿐 'H'D<> C>0` #> DHD(( @@(`@` !(`Ĕ`@ >0DH 6 >0c`@8` ` b|@ 0@9 0D}  ciD@8ip @@p> c<' !'  [  ''''؂  ''''////ԃHo  (@a ܘ 2 .-> 5+> =&`22$@@2 @@ 2 $@ 2@?$&4a >ᘃHp@0> bא 㿀> c<' `  W > =a<@0a'` '' ''//  * NpHo+(@ 丒  $#> ` 1> =Hp@0`@?&@'!a4! ?! 2 $0偈a> bo 0 ` `  `>فa̘ 2 ` `  `>فa̘ 3㿘Ho&4> ł(@g> ň` @ D> H`! H Hp@O 7 <" (`@"$! (`@ ` @> p! @H`` > @O`lHp@  <㿘Ho&4> ł(@g> ň` @ D> H`! H Hp@ 7 <" (`@"$! (`@ ` @> p! @H`` > @Oi`lHp@  <㿘Ho&4> ł(@g> ň` @ D> H`! H Hp@孰 7 <" (`@"$! (`@ ` @> p! @H`` > @O`lHp@  <㿐 ``"  *#\ > >O! 9> " Nԛ H㿐 ``"  *#\ > >OĐ!x 9> " N X㿐 ``"  *#\ > >O!d 9> ! N `H> c<' > a4 8&`&`aa ```c`z`"y`$a`l  (  &a L a ( `$ a $ 2 3 l" a?`$@"a @6 aDPa `  @:   D@8`C : `''  ' D ~ʘ `` 3䫐 . R `'{   @(`0`0`(( ˀ`" ``)" `$@@2aˀ``2a  k7ȨȐ   `2pa "@? 7Ȓ  aa @:   ς    4  `4 *`@L 4 `4/ˀ`)2`$  @`'0 (㞖aA`" aH`"`$/ `2(>L `} L ( 2  `28> `o @56   @`~  `2> `[ `2>  `Q 3 l 2GҐ0Fy lo 2>~0<``"` d6 ``"a h6   @6 ϐ `2> ` @` $aA``0+ @`' (aA`z`aH`aL` aHaP`aT`"`$ԒaH@q  e `$ aA`L`YE`)`2> 7` 00͐00  ]7ȨȐ  `j` " @>7> _. H`3D>  ` `3K> ` aD `)aD``aL` aHaP`aT`"`$ԒaH@  `$`35> `d >  `] `3,>< `T <> `N  " @I7Ȁ`3> 7`> 耠`3> `6 > `0 >L `) L> 7`# > ` `> 'Ģc<'H@' 2t 3>` Ā [ 2n 3 l> >H  @ `M 2 3 l"`'''''''/ـ؀Z   /@@H Ho`4Ă(@a+P`(Д즖 $`"w2sHp@`>\ ` \W 2> ` @ >,` ,> >aXH86 2> .` >(`u (> >a\耦yHH͐ a`݀ kH>< ` <  /ؔ i0}@YH ` _[Ā` l" Apᤀ  `̀2> 4&̃8`&'̂@'$ [Ԃ@'$" MȠpZƐ`HHp@0mHp@Ā 2Z>4 `] 4 'Ѐ 3,> `N > ]v `Hp@Ā 2Q> `:  3'> .`1 Ƞ@Zu> `# Hp@iĀ 29> ` > .`  3">$ ` $Hp@HĀ 2(>L ` L 3> ` >0 ` 0 3> ` > `  3>< ` <> ` >L ` L㿐@`'"`()  (``(``(@@ ` R 3`(`" >` &!   !> ΐ x㿐@`'"`()  (``(``(@@ `  3`(`" >` &!   Ӱ!>  㿐@`'"`()  (``(``(@@ ` ږ 3`(`" >` e&!   !> V 㿐L'L'P'T'X'H'   l 㿐L'L'P'T'X'H'   2q 㿐L'L'P'T'X'H'   3`  !`2"`3` ? `?`  $(`8`` @ $D ! % (  ? $!`2 `" `   $D2 ! 0`㿘Ho(@a 堔 ")> '> =&@ $a!4ἄ  >``2`$ߑ A> >aX2`߇ A> >a\2`} A " a u a`ސ`````̀> `a4'&`'8 &```̀$@'耦2A`a Wǀ"`   ` 3a `'`$`@@&`$"a `.`"t`a`l2 `` ``  >`` @2a @a "` ` `ҥ(` ( (  ` @ 㭒 V 7a `   `$`@ ``̀``a`2 a`2  a`2 a`" ` a@ʑ  m` (`  +<<<`?`+"  ``(` `ߠf`ꀠ+ _` `A   7`` 4  `4 *`@F)+4 `pWd`@W\`$` }D`@5 D`' (  7`?؂c̐`(00(`(`  "`$` `  " 7``0`C`㿐> a4`$8&`&`"(a > >a;> >  a`  t  Fa 22 a22  >2 2 X` Xa `` `'؄?cӃ( 0`0`((`$  ( `$  0`$  ( `$    ( ` aݹ  (ٔ ` EU a`( `'`ao $``?aDa   #\    @za 0    - a   㿘@@N!``?&`@  # =`[&Yc$! y@78\`)v  (@@=@ ݀$&c<\`9 ` "P`` (@=@  <  ! @6` \ .86(@@`\`造  (@@=@ c `  =@ (@ $\`΀ ` "`` (@` =@@1 (8)0@@ / 87@(@@ (@ =@@1 (8)0@@㿘 4 8S L@PS>P ` PHo(@ 0 澔  "F ,``#+``􀐀 <`Hp@@R1a 0 L@P`$`@2+aFHp@0  L>`  ,Hp@K@O L> ` "@۝axҐ㿀aa``; #  @:   D@8`C : a `''耤'$'쀥`h' D v" `$+a`  @ `8@`@$`  ` ->0`$0a `` @ .`$ظ`?@@@@$`АH (`$H@?@@@@$ `ۿH (`$H  8@C>`@   8@ <@`$27` `` l@ے `$~&`$   `" `( \@% `  25 v 7`%`ʀ  @ d  沖 ˔ `V%x 7`"$@Nϐ``ݒ `B `$"ah ݪ  2`$3U 7`` @'>ah  BȒ`1P  2 ?` (@*n  2/ ޚ @ @ ` @PR  P 7`$P ?ݒ֖" < < $@$` a`4%$``$`@2oa$`a``$``(`d$`  @ @$` 4 LΔ 2 `ڽ@NoP 7`$Pa$a , a BT$ 0  % % 8% 4% 0>c % @`,= %  @%@%a\%`(`%a`$@@ ah' B+  ` % " `"a  @ @%`$ @P+0'%0$`ax aB` a  @ 8( a @` `z$` P>  8 4c<' `(`$`, L@M>P ` P ܰHo`=(@`0@ ` R` " ,`7    L !` $@M $D!`UĠ >>` Hp@ 0a`0`#  􀐀 = Hp@@O L>`  ,Hp@@Ms0`Ā`j@ @ *u 8$Đװ"@  ` @"@$$  @t>` A L> `   $ !@  !h#\!p 1>K  ( ` ( В @ ʖ @ġ`4 "J   L>$ ` $> U- R `"@$ `z " @@  @"@$ $7"@  @ @ {$ a /W 0 $ Ȁ > `" ?"@ʐ ܥ Hp@0˝㿀`$``a`    @  >`  a`"a 2>a`"$` 2!` /`$a#\ah@ apd  ضՐ  `   8@C>>`a 8    8@ =8`$2(``` @̒ `$~&`$@ @  /` @M  vP 7`%P`ـ$ @ d  `4 4 Lf  T@LP 7`n%P LV ``ْ v' ,`<% 4 @%%a\%`(`%a `$@@} " `"sa  @ @% "@| 4  '` '`4'`0>`'`@`'`8?`' (' $` 'aa/ a ?' 0`%a$%`$`@2.a%a``%`(`#%  @%@M0>( ` (ِ> ` ``IA`<%* a`' @` @8(` a`' `% $% ?P  ` % 㿘!\ " !`@ !\M L&!\!` @ !`C L&!`@Kj & & (>  <' ?@   *` (` @ >> ?`  ?``&   $`@6!(0`6! `*` א (`>> >݆c> >چc> >׆c> ?Ԇ`> >цcd> >Άc> >ˆc@> >Ȇc> ?a  &    & &!p&!t a>!h L(`6  #2  &!`> ''''''''' q''(`'') L (`6  2  &!\> '''''''''! ' $@@8  (`''Ԁ ; @Hɔ 0T<$$2 . 6 e& > ?a> ?a> ?`> ?ap> ?aH> ?a > ?}`> ?z` .  ''''''''''ǒ'> Rl! .  㿘 8 4` ( L3@J3>P ` PHo (@ 0   "M ,`"$`#+􀐀 `  ,Hp@*@Iܐ  4ٻ ؐϒ L> ` 8> c<'  8 4`(`$`, L@I>P ` P > Ho`"(@`0@ ` ` " ,``#S􀐀 ` Hp@ Ց0@ L>`  ,Hp@Հ @I/0~"q   @@ *} 8$k"@  `2 $  @$$@Hp@0R  ԰$ @  h#\p C>e  7  7`  ߒ L> ` Q! `4@_ " ʒ L> `  , أ [   `2  @ @$ 7` n "<   $  @ @$ @   @@ @ l$ 2 7+ .X> c<' ``   >   (`y>` (ԫ 0l& > 7`  *`*``82` 2``Р```> b 0  (F>A $8>뀠"" l`( ('> < ߀`@2`*ն̀ "  ?; >` ; 0y'Ă`/Â``/Ԁ``Ր  (׼ (_  @  آ`(> bȀڀ+8<*`@ (`@6 @` @(`@& @ `` *> ;O! >`  0 J@`2G   "p  `` ``20 *'`'';Q'  ( Ԑ&@ؒ &`ܔ (&`&` '''') .`(`vՂ``^[7ł``QN7ƴؒ L  2 7>`l 0``怠`"?7>``倠`"170Ԃ```20  Lp>`I `  L0 (ҡ $€`"v  ( ʐ Lް 0j㿀aa'D2` '>  @: D D`@9 C: a `'' D' D m  '>`,`$`,ahal`$a` +D ``$`  a ` ` D .``$`D  ?c$ `Ұ (`H`$`H  8@C>``@   8@ <`@`$``" ` @RDҩ `  `` "l`@ג `$D~&`$    `" `" \@2`    2! Dp 7`$ 沖 Ԕ  D` 7^$ "'D&VDD ѵ 4 @0`, `$ D > ٖ`$"Bah@G  D3 7`P`$`P` `<$ $D`$ $ a\$ `(`$ a" `$`$@@"iah`$  44 L  D 7@E`P`$`P@>ah$ (% 0 L  `$ N 3D4 Ha `L`c 3,@D/ m a D  JD `%`0%` D>%`4c%`@`%`8=`$($$`$aa, a 9Y$0`$ @Gg' 9K  ` $ / 0 D696  D@@7    31 L@E189  D@@7    3㿀`$!@` 'D` –a`` `$@D (@3>$D`F $  Х`$a#\ah@ apژ쀢 >= ,D 7 D`%  7D` ؐ 7D` >## @b>`8   @C <8`$``"` @=؟D  0` `` >@# `$~&`$@F:  2 <DP 7`$P@$D`$ $ $ a\$ `(`$ a"  `$@@"7  L 4   2 ЮD@D`P 7`d$P``0D   4 D >/a D˜ ' L ;@D;B 8)  ` $ D `$0$ D>$4aX$@`$8<$ ($ $`a$a$ ,, a  8 $ 0@F0㿘!\ @ !\  L&!\@D0 & & H>  c<' c> ?I`> ?Lap @24  & &  &!p>!h&!t  L(`6   52  &!\7 ''''''''' !(`''܀  ' $@@. @B  0  > ?` 0> ?a > ?b8> ?`aH> ?`> ?b ''''''''''> K!8㿘#k##h#i#j@(`#|````` 'ނa(.0  /`.. '+!!  ) @ !0` ! @0  @ (  1 @ !0`! @.  @6 㿘 @ #X`` #``# ``?# @Ò#,@@   !p` 0造` Tb& !p& 㿘#X`# ``?`# i@#,@@    !v` 0!v& 㿘 @ #X`(  c`@#`  @_# (@@`?  `  #` 0@`6@"1bc "-b쀢"# `"# ' `"# ``#" 2 @" 2 ـb쀢`΀@     `  " 4 㾀>  Tc<@' `(`0#?`8 ?  a2  5a@"    ? $$   # 2 @ > J<!@㿘# " &#   2&#&#㿘 #X`  @"`?㿘` 2 \ "  \`A`A2"#X"##`(""@  2"2"쀦""`2p@  2㿈 T6`ה J"   $@Ŕ  2  @  2 #`2` ``@2@ 4 ᐐ @a2 @"`` `? $@$` e U㿈 TT J 4N!   C`p⸀ $`` $`@`  2  @Y  2 `4`㔀$@ `$㔂$` a1 @"`` `? $@$`  㿘> ` @m   a@  20  @X 2 `<&`&`  2 㿘#X`0#&# &# `2 8# (@&# &#> >a > >  `vN 0#> v|"1> vy Ё vBb#㿘 @P `-`#`/ > >a4&  K 0> v)` .`(>  a@@> vP"(> vM &  `)`)`+ , kx#Ր #`> >> >a4&  # 0> u` .`(> a@@> v$"P> v! &  , kw , kw> ub > uےb 㿘#  㿘c`T2cXk  3`2`ᄟ@c㿘#  E4 E2 4E0 L  ! T`"2!t `2X*!p ^ *!r*!t  *!u*!q*!s!~*!w*!| >(`D!p`2*!p *!p2!t"!pX``   `!p>(`D >(`D p X'7> c<' '؂ '/ل  ''''/ئ?/7Ԑ@9 3?'' X''7 7''/@' "&"`$ "  &""$ "耠`" "  &""   > @ G!X㿐#<8@ 'Z 7   " @4"ւ?,"$","԰ 㿘"?c(0`@(`"@Z"܄$(0`@(`"6"ր&"?  @ @ "耠2&"Ё㿈 `T 33 7 " & D  ea @> c,(!\#\`" " ͗ "&D  e5 @>e쀦2\ 㿘Ho`4 (@a  > >aĀ `2  T 0 @| 5#  2Hp@㿐Ho`4 (@a  " `2  < T'P4ِ#  2Hp@㿘!   $" " "  >AՒa``4!>AВ!!`LA̔2 `2$@$`  `$$` `$@ `$$`$ 㿘#  }  "#"#  ?  ," 5 $#d$"$#`$#\b < $"4"$#$`  0> rP?>`@4 \$!>>b$!$!? !, h, i %, j$ l> :a`$!$!xwǐ D  a$" $ >(M $"Ȱ 㿘> sG!0 1> > `" m!`       ?` ** > >!@ >*b(  >"h>)c > c<' Ho4 (@a  >J@a|"#X  w```  D@!<' '   !<  "!<``@    <@" 4@@ 1@  !<`@'  x`<@ `?@s "`t`G`2  m2L`4  a D$ $ @_'!<'  ''   `$ !< !  2Hp@ a> `8y `U@r  "//d`t  @`a2   D@!<' '  [ !< !    "@   ~ D$ $ @!<' '  '8 !< !]2`4`2% w @ DŐ!p㿐  T`; \`. `+#\`"##`"`#@4 \ `8 +`|#d'#dW  U) /B'A `2"4 \   4 \  `R Au #d(`'#d`/ D( a' ``?$#`-` #\`<#``(أAj L) )  @(` (80`@8`'(( @(` (80`@8`'؂AI 4` ( @@(`@(`@(` mA4 4#`㿘#  `I 㿘#` "ڐ@`"#aq@  ap"` "#@  2""?2#ap" /#@Ӕ  "  ``/@ / @"2 _ 㾐> `c<'  #  v> `@ "  @!``Z~   ``~  T   ( T 2̰  4`2 ư `$ .`t`t`#X` .`t4.  @r  @ ` @ @ `"@  4 @ ( 4(8`.`t= ڰ 0 C7!0#> c<@'  `.." . @' @':@ p@' @@& @'-@ > C!㿘`h`l`h  .Ò  P > c<'  T`") Ho`N(@"`S?#d  '`  @ @ /B'  a"`"#d??       8$$!<$ $($ ,<@@@@@  4`l,`4`4`4` ? p,`,` '''' / TmG䀢 "$`  <$` #<$`8@@"4`. $@ 2$# $`@.$* 2 2 ,`,` ܂$  @>`8< C bh< X@ >a$ /> >  `o 0> o"p> o  #@c<  $##(@> $# `"?#`#`$#`27#`(?1$#` @ @ ) )  @(` (80`@8`' >@bh< `h@8`h@ < ?   b4 L$ $ t (,<$$@ t?``,t,` p,`'''' / Tl䀢  0|-[ ? ,`,` T`(X,`Y ,`,`'-K $x 2$# $`(@-P$* 2 2 ,, ܂$  @>`L< C bh< `#\@<`   "@bK "R#`7h> >a$ k> >  `n 0> n"> n  #@c<  $##(@ > |$#@ʒ 2$#@Ē p$#b4#(`&#$##`@$#?> @$#| @ s?#(`&O$##`@J$#?> @C$#@!h@ `0m."`! ڐcX`  `  &c  ` >bh`x@8`x >㿘# 2 0   `2 2 ` \`A`Aߞ@㿘> :a`"`T "` `h`"` 2 \` "` \`A`A2""쀤 2 \``2`T㿘 h`"A `7> > >` > b> >  0`Ѐ`)@@ "` @,$ $ `$  ` `$` m@ mːmɐ``2@ @,  㿘 h`0 T@ +> c0)"쀦 # Tk`"\`  \6 \  &"ْ 2" "쀦 2 Ty &"ƒ ?y"㿘"`T &"&#c  \ 6 \HHof4"Ȃ(@g"Ȁ`" T! $ T "& T"̀`""! ( T"쀠. T" "? @&"&" ` $ & THp@ Tg  T `TV & THp@> 8"$ "㿘 T@ `V`\` 1`h`" `T`s M `T`"c\c\`vc``~ 2&`T$`T`T c`  `&쀠 2쀠 .`c\`"%c``\`4`\Ho&(@`( >!d$bHp@  g`(``\"@$bb쀠C$bb b#b$b `# c\`2`\c`    7  g $ $$ D "c`     J$b b$b  # b# `\4`\ 㿘`` T` `"O`>4`h4    ` 0@@2  `   " h`"P\` 2`"  @  12"   T`" 1#``! \`6 \ `>4``>4 \`#`` \`6 \ / 0W 2Ȳ T`2 \ܐВ #`㿘`  T \`@#\`2/ \  > ``9  0!` "0h`"0P\`60<!<20,( @20`"0`6 \`"` ` @   1 #\`Ð \s  T`" 1#\`  \`6 \ k9 2 T`2 \㿘 T@ "쐔 㿘ߐvun by 5v 㿀>  c<' ^@  "   2  > =|!㿘 h`"\TT< 8"E`"``@2@\@"\@`2`쀤ꀦ>bh`H@8`Hp`A`A>Ր@< @8`C<@`` 0>bh`0@8`0> >`C <a0K@@`?"쀤>`T > j`@ 2`> j#@> j -`h` >bh`@@8`@> >`C <a̔0 > je`> j#`> j  `h@  2"`T`\>bh`@@8`@> >`C <a0 > j>`> jm#p> jj `((` @) (` ) ( 80`@ (8` `d(80`@$8` z"V``k9`Œ ɒ ` `_ > >a ".  `2``d  * @"   `  ϐ&`{sׂ Ղ `0㿘>bh > >a` @ <  `h"  ` @`< M!`"%@ ` @`<  > ib  0 > i#> i 0 > ib > `0i#> i 0א`$  $@@'$*  "@ (` @`!< ( 0 8` @`< 8 > iRb> i#> i} 0 @$ T 0 > i=b> `0ij > ig 0՝㿐!>"h> >a`'X@L  'H'L'P'T' <"h` `h<8@@`?  ".`T"h`` @ J8`"h``"$@"h`` @ 8` > hb`  0> i #> i `Ԃ"h``"h@ `(`$@$"h`8` @ 8`8 > h͒b  0> h > h 0 > hb > `0h#> h 0& '@@'&*  "h`(` @ 8`(M"h` @8`  @&  > hb> `0h 8> h 0ߝ  /]> c<'   /^ p  @/_@#h&  p`6(p@`.`.` @@Ŕ @_@ ^@  ``]@ 'X?X'X &X  `2<@:X:'X   @ X?'X  ''''Ī''''?''''  N   / `2  0' 4' 8 ' <&'Ѐ -Ő@X  @R  6 ''''  ְ  @9 ł``ݐ`" 7Ƃ```Ґ` `p`j,`p@` $> % `@BDDH@%#|LP%# `L!p" @ D@ ?: !㿘#       > c<' >`0` a@:@" a@ܔ.a0@t@A  bc@Д  ː > @"c 1@P2@2 ֐߰@ܰ b`Ӕְ @Ӱ ``߀`̰ /`\`6`\İ` @`T``0d@ c t)) ) @ cd'cX L/Ԁ chc'$ c8 b` # bOd` dd,  `2&c8`&cڐ w`` `@"cx e؀` `4V &cd?c8@  c $ܔ cX@:43 u 0b``2( Ɛ`\ `&bN6`\`\ 6`\&b ذ b` `\` 6`\bאּ b.cXѐܒch$ 4  b`\`6`\>Ja&&$ @8!zՐ0r5`@  ֒ f㿘    #\"%0" #\```#\@'<#&#`8 @+&#\#``" \f\ `"1ښ```2֚` 6 \ I#`@ 8#&#`< @&#\> ``2 "؀"" @20h2 "؀""2#\"&" T&"6"&"Ѐ&"#\#\ 㿈a`  %>  @:   D@8`C : a `''' D V: %>` `$` a ` `" ` .`$` ?c$``8 (`$`8?c`8 (`$`8 8@C>``0   8@ <`0`$``" ` @yѐ `  `` V@ `$~&`$  0 `" ` \@ `@1  2 <`@ 7`$`@ 沖  `$} 7"$0    @   4  L 2`s@/%`@ 7`]$`@`` a$a$(, a$0#   $ $ 4$ 8$ 0>b$ @`@1 < 0=㿘 @0`   4D>@` @ 7 LF 2  <5@.>@` @ 7    @ #`,@a    $ 0$ 4$ >bt$ @`$ 8< #`(#`$` l#@+` a` #`0"@0ā㿘@. & & p> c<' ` `   > ?b& ''& &!p&!t'''''''@ 'В@,Ԕ 0> ?b> 6 h㿐 8 4 ( $ Lv@.v>@` @ Ho^(@ 0   ;>` 8@C<`b`(  8@ =`(`$``" `> L @ː, 0`" ,``8  ,@ `$~$`$ ,``#f``􀐀 <`Hp@@0a 0 L $ ` $  C 7 R@\/ @ *a 8k$-"@  `2 $  @$$@-А   Hp@ L``%` ,Hp@@-``8 ,wb `'b L> ` ޒ  `$" !t  $ $Ȓ"@  ` @ $㿘 8 4 (` d L@-d>@ ` @Ho`(@ 0 ϔ  "c ,``#H􀐀  2 22  ` `= .` ` l` *(` @-:Hp@0 L>`  ,Hp@?@, L> `  7` ` l`*(`㿘`@``(`() &````(((`@@@& ` `` ` (`((& ` ` ``(`((@@@& 5>  > `x x? c??7`c7`(`(`7`c    #@#@#  (#  ````(((`@@@& ````((`(:& >  > `x x? c? ?@##7`c`(`7`(7`c     #@#@#  #  ````(((`@@@& ````(`((@@@&  >  > `x x? c??@ @ @@@@#@###6c6((`6c @   `##@#1 1 # c( 1 `(`` 㿀'* * @ @#@ #`#` # `#` # ` #` # ` ?`> x '  0c 3`c 1 '0(` ((`1  `((`3`3 (c 3 3  #1  #>  x((`03` c * >  x  > -`x> x+>  x `**`@ > * `x> @x , !>  x '` /`,@+ > `x `,`@'> '`x>  x!>  x , `@+`- >  x!>  x ` -`-!>  x@ @ @ ' ''   ' `@c'`'DD' D'   ē*`     (`/ @. @@+`D .-'*`>`+*@ > > ''''P+ *  `xx> >  `xxN' (5`'Ѕ5(`'Ȅ `(45c@''ԃ4 (`(55`c@5 (`(54c@5(` 5`c@ @@ @ Ј    Ը Ȇ@(6'܃(`5`5c'@5((`05`c@ 5`((`60c@ `0((`56c @܈     ؈?'@ @  @ i@ 4(`D9>  ` x(5c5 *`1?#@?? @  P(`P0(P050(`) ) 5 (`5`cP @  00* 5(`* * 0 5`(`* 4c5`(`@ 5c*  1 (4c1 1 * * *    `00* * 0* * 㿘 ?  $ $ 㿘  ? & & `'D`D'` @`DD``'` !!```` `` ` `` (` @Ă@/`@*. @> `x > / +`xD-*>`+ ' '> ''L+`* *` x >  x`N' (5`'ԃ(`45c@'̄ ('55(`5`c'@ 4((`5`5c@ `5((`54c@@  Ժ@   ̆@    @  (6'(`5`0c'@ `5((`06c@5`((` 56c @0(`(5`5c@@ @     ܈?'@  @ iD5(`9>  x(5`c) 5L1?#@?? @  0* *040(`* * 5 (`5`c @  00* 5(`* * 0 `4(`* 5c5`(`@  (4c1 1 * * * 51 c*    `00* * 0* *    > ` H;jc"" &. `v" " " " H 'D```(`((@@@'  @`D``'` 5ک'@x'@@(0:1V@ĉ( 0Ȉ ۄ @(0̂@0os@@@(0 Ђ@=_@(0Ԃ*@@( 0؂*  @(0܂@?Q@@@(0 @`&؂@(0"=@@( 0?ֈ @@(0@"W5@@@(0 @"@(0?f@@( 0)P@(0m! @@(0 @=@b@@@(00,@@@( 0 Q@@(0:m@@(0 @5ĺ@]@@@@(0S@@@( 06(y@@@(09Ȃ@@(0 @xs@@@@@(00ւ@@( 0=5C@@(0V@@(0 *x@@@(0?;@@( 0ق@@(0?B@@#J`@@(`0` (0!}b@@(` 0`@gX@a"@@(`0`@?yN` @@(`0` )/bD@@(`0`c@@(` 0`@=Һ@c`@@(`0`@/`p@@@(`0`  &߈bƄ@@@(`0`:Ic@@(` 0`@5;̺@`@@(`0`@"a@@(`0` 6u4`9@@@(`0`9a@@(` 0`@蟺@`@@@(`0`@1+be@@(`0` = HbD1@ʿc. 6 0@*c+ 30@?$`9*@2@ @7@@@@VւaÉ+`3`  1@#3`+ 3  0@?`}* @2 0@@@!aaѻ*`2`@ @7@@bO* 2 1@?9b, @4 0@@@(Pc,` 4`0@a,@4@@7@@@@=߂bD-`5` 7@,4#@/Nb51@- 5 #`  b0@-5@D#`:ᴂc0@@@.`6` @#`㿘 6 .@ + @ > 3`@  @ `? @@?`ƒ&?   @?`@㿈`> `1 c<' ) /1 1 /2@) ) ///22 @/) /2@ @? @`/`@> >aؐ   ) ) 0`) ( @ X > ,{ Hc;j"&.`" "  0va" " " "  'D```(`((@@@'  @`D`''D''''DD'| D' '@D@|'x` '@ ( 0|( 0'@(  @) 1 0( '@0@@/`7`@@@( 0І) 1 @@@@ @ԉ(/` 07`@( 0.6 @ز@( 0.`6`@@@) . 1 6@@@/` 7`@@.` ) 6`@ 1 @@/ @ 7 @/` 7`.6  @/ .7 6@ @(. 06 @0@ (. ( 6@0) ( 1  0@@/`7`Ժ@غ@5@/) @1 (/` 0@ .@7`(( 0+0@@@( ) 1  .@0@@@/` 7`@@ @+@ Ї( ) 1 /` 0@/7`@( ( 00@@.@) ( 1  +@0@@) @@/`7`@@@.@1 @/` (0 +7`@( ( 00̈@+@) 1  *( @@0@/` @7`@@ @+@ @/ ) 7 1   .@(0 /` 7` @*@@. / 67 8 @( 0. 6 7z㡰 @  ( . 06 0@ ( . 06 @ @0@ ( (  0) 1 10@@) @@/`7`@@ 7@1 @ (00@؉( /` 07`@0@( 0@) 1 1@ ) @@/`7`@@7@1 ( 0Ը@(0 0@ /` 7`(00@л) ( 01 @ @ 1@@/`( 7`0@@@7@@ ) 1 ̸/ 7 7@/` 7`( 0 0@ / ( 7  .660@ @.@.`6`@@ @@5#܆ ( . 06@.@ @  @) 1 .` 6`( @ @@/`( 7`0@) @ @  @/ ) 7 1  /@@ ؅(/` 07`@/ @ @) / 1 7 ( @@@/` ( 7`0@@) @@@ @/ 7 ) 1 /@  @( /` 07`/ @ @) 1 ԗ/ ( 7 ( 0  @@ @/`) 7`@)1 @@@@/ 7 /@   @ ̅./` 7`@/6@@(0а/ 7 .   @.. ( 660(@@6. 6  ̟. !*T6!N@ 6( 0. 6 0(0@) ( ( 01 @00Ժ@@1/` 7`@@@) 1 @7@(0/` 7`0(0( 00) 1 @@/` ( @0@7`1 @@@/ ) 1 7 7@ ( 0 ( '/` 7`7 ؉( / @7 @ 00 @*`( 2`@'@00@@@@0@Ї,` ''2@4`@̢@@* 2 x7(|0 @(0@ ( 1 Ԃ( 0@0 ) ( 01 @00@1/` 7`@@ @) 1 ( 7@0(/` 07`@0( ( 0@) 0 1 0@) @@11 /`7`к@@@7@ (0  (/` ( 7`0@00؆) 01  @ @/` ( 07`@@1 @@/ ) 7 1 7@(0 /` 7`7  0. Е/ @( 7 60 @.`.6`@@ @@5t$ ( . 06@.@ @  @) 1 .` ( 6`( 0 Ԃ@@@/`7`@) @ @  @/ ) 7 1  /@@ ( /` 07`@/ @ @) 1 ̟/ 7 (@ @@/` ( ) 07`@@) 1 @@ @/ 7 /@  @(/` 07`/ @ @) 1 ؗ/ 7 (  @ @@/` ( 7`0@)@@@/ ) 7 1 @/@  @  @./` 67`@/@(/ 07 .  @ . . ( 660(@@. 7\6 @ 6@ ̇( . 06@0@( (000. 6 @@ ( ) 1 10@Ա) @@/` 7`@@ 7@1 @ (00@Љ(( 0@00/` @7`@( ) 1 10@ ) @@/`7`@@7@1 ؄@( /` 0 07`@ ( ( 000@) 1  @ 1@@/`( 07`@@@7@@ / ) 7 1 7@( /` @7` 0 0@ ./ @7 66@ @.`6`@( 0@ 5]@@ +@(0 . 6@+@@(0@.` ( 6`0*@) ( 1  @ /@0@/` 7`@@ @.@@ () 1 0@@.@@/` 7`(( 00@@+( @) 1  0̺+@@@@/`) 7`@@@/1 @/` (0 .7`@@( ( 0.@0@) 1  *@@( @0@/` 7`Ժ@@@@*@/ 7  ) 1 +@(/` 07`@ +@@ ./ ( 7 6 +0@ @. 6  @-. 56@@) . 6 1 @- 5̬- ) 5@1 @@Բ@@-` 5`@@@- 5, 4@@@) 1 @ص-` 5`@) 1 , @4@@) 1 @7`/` @@@@) 1 @6 . @6- . 5 @@0/`( 5  - 7`@@(0@@@ ,44, |* 2 @D 3`@+` @D4`@,`  /` 7`@@) 1 . 6 *` @2` @. 6#@D@ 4@@2 (0@@(0@#D) 1   @㿘 .( @> 0@ @? @@  @ @  @b @ &@ O`@ 㿈`> `1 c<' `) /1 1 /2`@) /) /2`2` @/*//2@  @ ? @`/`@> >b   ) ) 0`) ( @ʒ ` > #a Hc;j"&.`" "  0va" " " " @> c<@'  @ (0غ@@@ (`0`Ȭ(0@@@(`0`''@@((`00`@(0@'@@(`0`'h'H@@(`0`'Ԃ @ '(0@ @ (`0`''X@h(0'x'$ @ @(`0`'HX   (0$@'4@@(`0`'4  @@(`0`x'Xh(0'@ @ @((`00`@'$H@(0'h @@(`0`H'4'l  (0'L lx@ Ԃ@ (`0`'  (0L@X@@ (`0`'ؘ$x@(0'X'| 4@@(`0`$ '\|l (0'( @ @ (`0`'L\4  (0(@@@ (`0`'8@(0'8' |@@(`0`'  \l (0 ' (L@ @ (`0`'  (0@'l@@ (`0`8L@(0'p'P p@@(`0`|'  P\ (0 '(@ |@ (`0`'  (0ܚ@\'@@ (`0`'`8(@(0p', P`@@(`0`8' ,  (0 '<̂@ @ (`0`'  (0<@ '@̂@ (`0`''@@@(`0`'`p ',P@@(`0` ''@ p@(`0` ''<܂@ P@ (`0`'t'@ @ (`0`@'Tt'Ă@܂@ (`0`' 'Ȃ@@@(`0`'`'̆ T` ( 'd@ <@ (`0`','Є Є  ('0 @ @ (`0`@d0t@00'''d'؆ @ @ (`''0'܃0`    'Td'  0  Ђ@  @ '+`'<@'D(`) '@(('' 0@@ @ '3`  ! @@@@ @+(30 @ @,`+4`3 @@  , ,`4 4`@@ @@  ,, 44  @@  ,,44@@@@ @- ,5 4 @@ @-`- 5`5  @@  / -`7 5`@@ @@ 5 -/ 7 @  @@ .6-@5 @@* 2 @.6@ @@ +32 @*   @@ , 4 3+@@ @ @@ * 2 4 , @@@ @@ *22 *  @ @  +32* @@ @@ @-53+@@@7` /`@@.6-5@@ @@ @@h z#H@ /`7`@@ @.`6`.6  @*2@.`6`@  @ , 4 2*Ԓ@ @*`2`4 , @@@@ +32`*`x@ @* 2 X3+@  @*`2`2 * $@@ @ +32`*`@  @,`4`3+@4@@ @* 2 4`,`@ @, 4 2 * @@ @(0@4 , @  @+(30Ƞ@@ @, 4 3+@@ @ @* 2 4 ,   @+3l2 * @  @L*`2`3+@  @ , 4 @2`*`@ + @3 @4 *, 2 @ + @3 ,@#܂ @  @@, 4 2*|@@ @2*\4 , @ @  @@@+*32(@ @ @4 , 3+ @  @ @* 2 4 , @8@ @ @3+2 *  @ @ @*`2`3+@@ @ @ @2 @* @ 2`*` @ @ @+32 * ̒@ @ @2`*`3+@ @ @ @ @ @, 4 2`*`@ @ @2 * p4 , @  @@@P+32 @@*   @ @4 , 3+ @  @ @+`3`4 , @ܔ@@ @ @ @2*3`+` @ @ @4 @, @2* @ @@4`,`@`4 ,  @ @@ @@3+,`4`@  @ @, 4 @3+ 2@!ւ@ @ @<,`4`4 , @  @* 2 @4`,`@  @+32 * @  @*`2`3+@@ @@ * 2 Ѓ2`*`@ @, 4 2 * @  @*`2`@4 , @  @ +3t2`*`@  @, 4 T3+@@ @@* 2  4 , @ @+32 * @  @*`2`@3+@  @ * 2 2`*`@  @, 4 d2 * @@ @@*`2`4 , 0@ @ +32`*`@  @D, 4 3@@+0 @'@3` +`4 , 3  @ Ĉ ('+`03`@3 @ @ @@') 1 @& > @ @( 0#@ @ !'&@''#<@  >  㿘 .( @> 0@?`?    &Г@ @ @@ɐ`? @`@`? @ &@㿈`>  c<' *8`(` 2`80*@ )  8> ` `> `А `    ?@8(0)   ?@  >  㿘   > Pc   ``@`@(`()  ."@*6 @@.6@6..66 .@6. @`@``@    ` `(```(``` .(`.`(0@00@(@@7` /` 7`7`/`@ @ * @+  @ 3 + 3 @3 + +`3`3` +`@&3`+`  @      @  @ <$$$ $$$㾰'D ?  P? ? ( ? 0? 8'?''''x'|'p't'h'l'`'d'X'\'P'T'H'L'@'D'8'<'0'4'(',' '$''''' '????       ă0*>  a07`  +` /`     ((@6./   .@  *`5   @ ĉ-`5` :- 5 -`5`'- - ''5` 5 -`''x'|xD @@**@D  D-5-@55@@-5 'pD 't'h?--'lph55-'`'d` @   @ĸG@`?'?G`S????  ?????  `(` `) (`@@)> +!0@0 +@(0E@(0'X'\(X('P0'TP(/ 0C07`/`@7 7 'H'L/` H/ '@7`'D@/ @7`@C7 @C=@(`02(1 '8'<*) 2'0'480- 2 5 *'(',(@--@ز@ @F @F@ F @ F?Ѓ,4 ,  @44@@,4'$,,' '' 44,''@@G@G耢PȄ3D@GF @F(@C0B8@Bࢄ@DD@=@=`8=`=`=`=` =`(=`0㿘h @ D+`0`!   @@ > @2 H H@> H` @ * P@| @ , @C2> @@&ڐ̀j P @ .@B> @@ H@> H PU@ @ .@B> @@ H@> H@(в@ H@> H@㿘A @ D+`0`?!? @ @ + P# @,`@C > @&?@ @`@@> @?  P @.@C > @ P@ @.@C > @㿘  @> ` P @- & @& D& H& L㿘 @ D+`0`#?(P`p`( P8 @ ~ H @> > . P p@"@  H @> > " P @ p H @?> . P> Q "@ Բ P㿘  0@* 㿘  @@ 㿘  @> c P @ & @& D& H& L㿘 #`@`D+`0`??(P`8`?%Q P @ 8 @> N @ в`P @ 8?. P`P 8@"@  @ @@"@} ٲ P㿘 > `” & P& T P `8 `< ` ` ` ` ` ` ` `$ `( `, `0 `4& @& D㿘7@@7`c$7`7`(c(,@``( 1 c1 1 (c@ (@  @7`c7`7`(c@`( 1 c1 1 (c@ (@ @7`c7`7`(c@`( 1 c1 1 (c@ (@ @7`c7`7`(c@`(  1 c1 1 (c@ (@ $@7`c7`7`(c@`( (1 c1 1 (c@ (@ ,@7`c7`7`(c@`( 01 c1 1 (c@ (@ 4@7`c7`7`(c@`( 81 c1 1 (c@ (@ <@7`c7`7`(c@`(D 1 c@1 1 (c@ (@ &@@&`㿘7@D$@@7`c7`7`(c(,@``( <1 c1 1 (c@ (@ 8@7`c7`7`(c@`( 41 c1 1 (c@ (@ 0@7`c7`7`(c@`( ,1 c1 1 (c@ (@ (@7`c7`7`(c@`( $1 c1 1 (c@ (@  @7`c7`7`(c@`( 1 c1 1 (c@ (@ @7`c7`7`(c@`( 1 c1 1 (c@ (@ @7`c7`7`(c@`(  1 c1 1 (c@ (@ @7`c7`7`(c@`( 1 c1 1 (c@ (@ &@@&`㿘> a&H*`2`  (* 0`@   @  `2㿈 .&076@$( 07`H''C$`$@`@ ,`  4`&(&0``,` 㿈 / &077 @$( 0.7`H''0 ''$`$@`@ -  j'c'Ր`'(' 0   㿘@.6\㿘.6   `(0`@㿘.6   `(0`@㿐0 ````@```() +`+ (`(@ @  @ ''z00.`.`.@.`1 1 0.`.`.`1 .` ղ`㿐0 ````@```() +`+ (`(@ @  @ ''00.`.`.@.`1 1 0.`.`.`1 .` ղ`㿐;  @(2() +`+ (`(@ @  @ '' 00....1 1 01 ... .ʴ㿐9() +`+ (`(@ @  @ ''00..0..1 1 1 .... @(2˴() +`+  * (` @@ @''ڒ00.0...1 1 .1 ... @(2㿘` @```( (`/ $@0(> 0Xc> X> 00(`X D`@``/`> aX@. ++`  &$@ 0( 0c(0cH@0($@ !1)(`0@0(`L0 @$@@'@@@0((`0@0(`P0$@&0(0c(0cT@0(@$@ @!1)(`0@0(`X0$@'0((`0@0(`\0$@&0(0c(0c`@0( $@ !1)(`0@0(`d0$@$@@'@@@0((`0@0(`h0($@ &0( 0c(0cl@0,(@$@!@ 0((`0@0(`0` !^p0$@0((`0@0(`t04$@'0(0c(0cx@0(8$@ !1)(`0@0(`|0<$@@@'@@@0( (`1 @1 (`1  # 6 6 ++6 6`++6`6`++++㿘```@`````(/`/ (`.. @ @@`|`< '@0@(@> aX0c> aX0(`@> aX0> aX`x(`8'@' 0((`00(``t@0`4'@&0(0c(0c`p0`0(@'@!0(@`(`7`7`(`7`@c `l`, &@0((`00(``h`(@0@&@@'@@ @1)0c(0c`d`$0(@&@ 7/(`00(```` @0&@!&6.(`00(``\`@0&@'7@/@0c(0c`X`0(@&@ 6.(`00(``T`@0@&@'@@@&6.(`00(``P`@0&@'6.0c(0c`L` 0(@@&@ @@1)(`00(``H`@0&@!&6.(`00(``D`@0&@'6.0c(0c`@@0(@&@ 7@/@@`(`6`6`(`6`@c 0,01 , , , 01 , 1 , , , > aX> aX> aX> ԖaXh   &  Ȁ @ȃ(`  @ (`@  @ (`@ $ @ @ ֈ > > aXX> > aXX޶ Ђ `2`(`@2`2`(`@0ȃ(`   3  c(@3 3 (`@0c@ @ @@ @3` `(`(@@3`3`c0c@  ( 1  ((`@1 1 c@̆ '؆' '܆' '''' ꀦ3G1 (`(@ 2(`(@00(`@ 1 (`@3 3 (`0@2@ 1 (` #3 @ #2@  @@@@ @@&& & & Ѐ݀(`(() @@   @    && & &    ` && & & İ #Ԁ`| ؂ `2`(`@2`2`(`@0(`   3  c(@3 3 (`@0c@ @ @@ @3` `(`(@@3`3`c0c@  ( 1  ((`@1 1 c@ 'Ȇ' '̆' '''"'(`3`c2(`1 (3`(`3 3`c@ 3 ((`(@ 3 (c1  ` #+`@ @@@2 + @ @ @@@@ @@&& & *& . ?% ސ@| @| @| 㿘 Âc7`?c(0  ̂c3) 0@@?`@/`1 @ UUaU(7`((0(@0> ax` @1 `@ @f(0@7``@ `?g(1  `@ b ?7`(`@  c1 7` ` @ $e  7 `@ f.61 `@ ?g(7  `@ b ?1 (`@ 7 c 1  $ % @2*UUaU2`*`7  ?`) 0@@ ̂c3@/`1 @?c/ 7`øc(7 $($@> ax x |@1 `@ @f(0@7``@ `?g(1  `@ b ?7`(`@  pc1 7` ` @ $e t 7 `@ f.61 `@ ?g(7  `@ b ?1 (`@ 7 c 1  $ %?@l2㿐       () +`+ (`(@  @ @ ''0.`01 .@.`.`01 .`1 .`.`.`㿘 (`(0`0@o > ax` @1 `@ @f(0@7``@ `?g(1  `@ b ?7`(`@  c1 7` ` @ $e  7 `@ f.61 `@ ?g(7  `@ b ?1 (`@ 7 c 1  $ % @*2@$*`2`@$@> ax x |@1 `@ @f(0@7``@ `?g(1  `@ b ?7`(`@  pc1 7` ` @ $e t 7 `@ f.61 `@ ?g(7  `@ b ?1 (`@ 7 c 1  $ %?@*2@$*`2`@$@>  a (2㿘> >b`  @{9    㿘> >b\>        (`() +`@ @Âc@+ (  33 0  +`@ @@ 0`?@((0?UU0!U   (3` ) 0 @@ @(`@@ @ `(`< 0 c2  > > xa U'?36 +. @ `??((`@ @d33`<@(`@3a03 `(3833`6 (6 `<6 @(`@6 e06 `(     1  @((`0`&@@ ``@ &``@`36 +.   a  2' "= ??/@㿐       (`(+ ) +`(@  @@ +Ã0c@ )?@#@ (`3`@% ̉0`3(#? `!UU !U) 0(1 @@@(`@''`?ܔ1 (0`(0 ) 0@@@(`1 @0`.`0`(.@.`00.`0`0.`.`.`.`㿐#> >b`@ HofV(@> >bb "*  ? `"` `2``("``'?@ !?(`@`2 `  ?-!Hp@ 퀢`2@? , ,  @ `8` `  ހ? 0߁g> >, ',  @@       >b `! Hp@> >b쀠*> >b䀢&> >> >b  `" "  `"  ` (@@2   "  " >`d`  >;a 㿘 Z d`VHo&-(@> >b䀡 > >> >b ਀`"฀`" ฀`"   (`@`  & Hp@ g> >+ & + ! `@;`  & Hp@  㿘 0``& 0 @@> @` ՛ 㿘>`    >3 ǖ} 㿐  > `">#\ ` H   >> #0. b>#\#>  8bȔ  - 㿘Ho&4> >(@g> >b䀠 > >Hp@ "`. .  .`@`ꀦ`  `"" ` "Hp@ "  @xG `> >`(` 㿘 Hof(@ <` >c`4*& < <`2`4>*#0Hp@g <㿘%> >`1 > >b+ Hof((@+`+` `" `` @  `Hp@g+`+` `"ׂ@w 0㿐 y @`uHo$\(@ <`` > >[> > b䀤@:0`4,`,`  ं `W`" <@:  8`@C9 ` !?"& ,  < `4" `! 04 <`  #& ,Hp@ g <>  & ,Hp@  8  <Ȉ > >b䀠` > >"`Hof(@ * *   ) "@ @@   `@ `Hp@  g* 㿘Ho%> >(@g%> >䀠`P䀠h> >b   ఀ`2 ਀`2 `2   b+(`. B. .  l"  :!> >"** @  (`(`"@v̐.  .  @@(` `"( lDŽ$$"Hp@ #$ lϔ > >  b **@v @ $Hp@?" Hp@?㿘Ho4>(@g> *#0 E $@$`$`$` $`$`$`$`$` $`$$`($`,$`0$`4$`8$`<$`@$`D)> c$`<" 4"" " " " " " " " " $" (" , " 0)  2` >b䀠 > >b+`+` ` Hp@ >`     >4 D < 㿘> >b `;> >b`Ho$(@. .  ) b@@@   `"@ `" "@ `" Hp@ gۅ. T8xl`THdddddd<0ddd$ddddH     -> >b耠` ?    @ 20 @  2 ` @ 2@ @"@@`@  ` `? @"@"` " @"@ "`  "`` 㿘?  $ " < L < " L L㿘 (2 ! ?   $ ?  2ڒ L& ( 㿘`  L*   " $\: " <h" l7`" p4`" t" , /  @& @& (㿐0cd@2  L  "&`"  ș , o ,  0` 0 > >b  (& ,! , ` u L㿘  @`˰ @`((` >6X  `  h Lð @" `>8" `a2 ` " d2 "  @  (  ``@ @`'  (`0`@ `() `0` 0 Lx $`$U(`0`@  S >  ذ J`2E@@>,``@ `(`() 00` .`0`"`? # 4 `z h0/ - `s h0( k 0$ }  %`  $ " ` (`@s62` $ĩ L`` Ģ L㿘ɰ 㿘 8 ,x" ,#  & 0㿘`?c  ` " @\ ` 2 ! X l @ ` ` ` ` ` ` ` \ && p t& X &@s&` L `® $@  @  h&@ R `\  <` 4`X` ` < $`$$ $ <$ @(`$"``` & `&& & $& ((`&`>8$ 4$ $ @ $ 8< `   `    ,` " `X  L `  < `ђ  &`& `` D$ D > > $ 0"䀠> >) )  @@`2  ``"  @ $ , $ 0Ho4 0(@g 0` > bؐ %  0`Hp@`x` ,``` X`@ ``  D5` }`U&  ` "` `&  &  && > c<@' 0ce@< (@(cg@'0ch@ @ > ci@  cf@ ܐ ̐ ےذ԰`а (`>6l> ?`<`İ ''''''''''''''''''8'('8 : L  8`2`@@qe:`ؒ L܀ ԓ8`2`@@qY:`̒ L0 ":  8`'2z: > >b`? #\9 #`#h#l#p#d#tə8` "! V&> >c> ?`> ?``> >c> >c> >~cd> >{c@> >xcv " ` @  @ `@ @ *  `"??* `""㿘 `;<``"2>  @: &@`")>  @&@` `>    @8@ & > .b#P.`#0> .\"> .X#㿘 `;<``2>  @: &@`)>  @&@` `2 >    @8@˔& > .#.#> .#h> .#㿘J`E>   8> @6 &@ -,`@&@`    , >  ` @` 8@@  &> -ː > -ǐ @-Đ#> -#ttttPPPttPPPtttt((L(|8((\THL dTTTT d(((((T d((  D d(((TT  ?#> > ,$c  t@pJc '''''''''''''''''''''''''><><>C) > -6 p㿘> >c@q#> >c`m.`@ i@`'>;b  `(`   @oN`  l  "@oE`  l lc ބ    @o2`  l lc ˄0   @o `  l  "ڐ@o   l lc 0 ` @ w lc 0 㿘 5`3#> >c > >c `   ,$ @" (,#cc l*  > >c  '> >22*: l$ c`&,@>;> ?(b> ?> ?b`> ?> ?a > ?> ?`А  lv $ ]@( , > ?b8 l_ & ``D l`8` 2 R: $``"8 `80`@8` `` 8`2ؕ:`` `` 82* 2$`  `@&` ``  l $  հ 7> ?`" @&` ` > ?a` l & ` " `@``` 8`2* 2 `@> ?a> >c``` 8` 2: &h  `@> ?`<> >c> ?ap` l” &  ` l` & `" `80`@8`` ` `6)` 80`@8`@4` `@`` ` 8`2* 2```` 80`@8`> "`ؕ*2`80`@8`` ` `j)` 80`@8`@4` ````` ` 82* 2```` 80`@8`> "aX*2`80`@8``\ ` `\)` 80`@8`@4` N> ?oaHm#> ?Q`" @> ?b` l$ & ` "  `1> >7cLJ#> ?G`> >+c> >(cd> >%c@> >"c  U#c` 0`  7  7㿐  l`  bb@`` `2M  `@ lz L&`` ``2I@` )"M& "@   + @7+`  @* !& ? l: `@ l0 2&` @`ۖ` @ `   l f <> c<@'  4    #> >h c(`"  @2`@`2 > c<@  >  ``2 'L  ` `Ē` 4 2 ۀ "ڰ  0 ` `? @ 詔 `2 ``[``,2@h  ` FX-`0`'P 'T  &'H  ` %@  Ho%@@l ` Ph@T   @4` ҆2l z `L@O "`@` , h2`8@ @$7 "4@`@  `L` , h@2L@ր` @lH倦`@  @   耠`8`$ @l. -`(`'\('d` 2@h`$h@` D` а >  `Ȗ&` `   > W  簔`i ` `> c<' Px 璒 J@` ֘ ` ` 2D ` ".`D w X>  (a4` $@ \  @ $ 2D` = 0Ұ @` ` @ `ʄ 2 $ `"  @ $ @ O P`> c<@'   @T]     (`0` ' w'V< `2    ``@f?K $H к -` :) % ` `"  `@d@7?6*  > @0`,`$ #'`@ > <@ >  'u  '~, 4 ` &` ` `"  `@'< @@@0```@`   @(2 `@@` @   @(2`@_`   @(2 `@F` @   @(2,| "M  $I `  к  \@"N@`"9 `   J`$0   `$ `"i  `@ '` @ 1@$  ` `j @刔` @ $ޮ @(2Ӯ`2'@`2` '  }  `G `".  `@C  { "ư "ð ` `@' 7Y  # R `@  @(2 `@v`   @(2 `@3 Ȁ` @   @(2㿘  `< % `4` > >`c " $`,A `4= $`, $`$ 4 # 2 $`,(  )> >#( >;`0` `? @ @2  `@`  2܂ 8ڂ (`@$`,`4 $`,ɐ`4c $`, "  >Eb  >Eb 㿘.2ߪ 㿘.2 㿘.2 㿘.2Z 㿘.2q 㿘.2} 㿘@g#- l&㿘@g!# l&㿘@g! l&㿘@g  l&㿘@g`H l&㿘@g! l&㿘@g}  l&㿘 @? l <#$.ca6 @:`[@㿘 l '!&.N ?> `h 㿀>  c<@'  cЄ)  .ǣ Ђ@)  2   #Ѐ(@ @)#К` `#Ђ.#@g @  > Ո !>Da >Da > bܔ 㿐 X  () 0`1 @  ?#&#&#ܐ!M 㿘 = &  . 㿘 3 & 㿘? l !.$@W  $!@ ?  㿀> c<'  ``( !  @(2@f  > !㿘 l D &痰 >+` >)a 㿘 l / H&. 2>(bd >(a 㿘 l !$뵐 `믒`  `a먰 ?㿘 l  &듰 ? >1c   >1c >/c  >/c ''''''''''''''''H @` @2 @>>ɂbdP''''' l  W'@> ?b܂  @'H> c'Ȣ'D'#\#`?  @  .` l  :'@> ?b؂ 'Ȣ> ''D'H@o @ HP6 @q   `2̀`9 l  H` &@ l ` !@oԐ L$?  'Ȃ $?$?'̀ΰ @| ̀ `HА@yQ Ԓ l,  &1@oH`(D᳐&@@& l``` @ ថ@ l& `&@yH㿘 (`    ` @@ ` +`@N'( !..  ``* * (( @ ``+   2  ``* * ((@ ``+   2 ` ` `* `* ((`@P> c<@' ݝa''''''''''''''''` `\(@2ݽܶ @ ܲs@dw @@ > #@P> c<' @(<ݙܒ ВR &!!''''''''''''''''୒ `6(@2pi @@d1 @  >  &!#XP> c<@' Ӑ`''''''''''''''''``m `\(@2;| @ xة@c @@ > #pd@P> c<' @(<T `؄ &  '''''''''''''''' `6(@2+ @@c @  >  `& 1#P> c<@' b`''''''''''''''''`Xܒ `\(@2  @ 8@cY @@ > #@P> c<' @(<û X &  ''''''''''''''''ߋ `6(@2Òƺ @@c @  >  Xn& #㿘` @``      ./`0. @ @ >`@86`7 8.7`@``/ $` $@$`$`㿀> a0c<@'  .a/`0a J @ `)  @@b @ > J#!$* >(`D2㿘6       @@&`%`@$ ` `$`@ 㿈.6  ''''  $̒  $$㿘. 06.$!0! ެ !0Ǘ" " " ""   ` ` `"  ` ` `"! ! " " " *` `@ ` > `# @ *`2`@  ` ` @  `  *  㿘  @&M&  & M > 4bX& ,㿘 c;9>  ` @& 0`@, 2,`2 *  4 ,  @* 2 !4 ,@  " 㿘&& & & & & & & & & $& (Mp& , & > ?b> 㿘> ?cА  `' ( (` {? 2 H   @ t=$a ``"  `z  2  0``" v `zڒ   ` (` `  'p ' !''// z "Ӑ @`" P 8`F! 8 8@`B9 P! 8(  @<(@$@ 4`4` @݁4`    & & 4 `@u4   & & x   yD  > ?!㿘> ?c̀  "  `(`@@> , 4 @7 4 z= ? u?z2  ? 㿈 ``5 c1 ` ``('-> ? ! '''/造`/ ;p`'0`@`` ``I`u-  Ů "PH@`M ł(@g> Ţ `@`D6`H <& (`@")$@ (`@ ``@$`@> pH`` 0D@`"} 0```v `I Ho&>4(@g>4 `@`D6`H <& (`@"$@ (`@ ``@$`@> pH/`@@ > @`lHp@`h `y  2 @ H< h`" 0```ۀ`et?8`$8     40````ƒ ` 28Ho&>4(@g>4 `@`D6`H <& (`@"$@ (`@ ``@$`@> pH/`@@ > @v`lHp@8 ` 28 ``2y!sӐ8sϐ8 `$ ``"8!@8`s$`H`L`2>  > `s$`H`L`21> ->  < < ` 2]8Ho&> ł(@g> Ţ `@`D6?`H <& (`@"D$@ (`@ ``@$`@> pH`` 0ђ ` 2)8 `륖 `"80@8`sS$`H`L`2Y> U> `sG$`H`L`2> > ? < <㿘>`Ho&4 (@g (` 2(`Hp@  `"> 0 `$"  @$ @Hp@ 2  `  `> ?`!c 0```> ? cЀ `'80 `> ?c̀ `80㿘 0 $`2  `@ڀ*`4  $6 $㿈"  ````! ``" !!@@̐' ! /'''/)> ?#`vH`p4@?  ``A`;`  `rv@Ԑ`P1` <`3'  " A P 8@< P$ 8#$ H`"`` 4@2 ````2a̰ 3@yҲ@β`!$ @$``" 3`|6`'a@ 7Ӣ -㿐` -`` >` `O#\#\> ? r#0㿘`  `>  (cހ - Ȁ`> ? `  > ?> ?cԐ ؁㿘 ` o @ `(` n@ vz  2 0㿘 t    (`(@(`(`ؑ 㿘 o `vY 㿘 ` `"&@o .@.` .`.`v=  2 㿘 rw   "  !! ! ! ! 㿘 ` @4 @p ` oK`.@&qA v  2 㿘``(  r5     qÖ( `  & "@`”q7 㿘> ?`1>   4 W 4X ` /'  ~|   쀢 pq '  " `  @%?{ 쀧` qߐ '  " {  qϐ   "  @ {  2 q '  " (@0`(` `> ~p  > ݐ q  "  @ {_  2 q   /%  p  " <"   <@\hf> ? c$$ $ $ $ $ 8$ $ 4 $ '   ' $$\ m < ȴ#@> ap s% '    2|> `'H쀢 I؂$@`   ``"#@ 2\쀢 "p' "p''''#\  #Ѱ? > ?#݀ ``2*` ``8> 2!Xр \'\ <oo쀢 0` {'`> !>  !@ t '  ڰ 7 ր  ` `m `'''@㿈ab@+ p '  "     o?6 #\    `8  tN   ' o6 o6  7h  0 ''''@@'  H  < 0( ''( ''ԇ0 @'>b`X'@'8`XȔ@i ` 0& 4d& 0& @Ho$(@e֐Hp@ 0 > < H''''4`s`> !b`P> `` `0`    H C :`PB8` @8`0 0"4 ;,` , @'C'''` @`?Ђ ' 0Ȕ& 0@h!0``~ 0& 0@FP^ 0(& 0``y 0d& 0% & 4 `5 & & ~& @@EEP0z>b`@'@8`@@_c >" 8> ``(  `8@*` B`8`(C 8`8* 2 @9 8''Ԑ@_Ȣ `؀ w&  <   @(  v  H @Ze& `*`8`&`  LY> !xɗ `s' 0`& 0@F" 0(& 0 0`"& Ho$(@eːHp@ 0`؀` 0b& 0>b`h >   ('' 8>`0`@:`hB`9 (C 9 8 `@_̢ <&  P @"ŀ`> & 㿘> Abt #>>bbH@8bH %>a `> aaȐ ' a  0 2&  0@& 0& > & $ a ` $a$ 㿘 P b $`@ > 'bЪ!(>  a`4  "  `"   @5 - ``4  " `  @5ΐ  v `  `4   U4  `4  4 I 㿘 Pb$`@ !͚ 7> ' ś+`  @5    'D'H P`'P`' H` ` $bHg```'%`DPѸ %`%`a PuP%a`8'| |08 8'xD8`"D4`"OH``{> ">b`0|@8`0H@<5 @<і> Axt?`Ǩ   @DX "K `0aHH``< @c 4v p $t` "q```@j`0`h$`0v`0`> Ҙ D DP&  `cDP  eā`4>b``D@ 8`` $  `0aL H`@`$ @8 H`HD4`` Ϡ  H`ˀ GD   ` @&ڠـ `0 @$`0  g WD`Ȁ" aD`0 @$`0 HȀ`8E@; @;  `@ D@"`@D( Dq d  0a  0 @ $ 0 ȴF`E@4`DP@St=  0h$ 03!> !P@]~ `P` ` `>`4`  ඀`" $4ඁb 2` ` R ! "$ $ @ 'h`%@ 'p=0@?x8`8` 0''t'l@r>b`H@8`H %@8x@:=`@ @;2 < @3 'p `H4$ , @6C H$ ,' "( "`4@ F ؄ @    2 (  't ń  $@Rp `0`"X`4> ݐ"8 Hɍ  $x $ @$  `:  @0 4-$ 8$ $ `Pb$E 0$ 0h6M``pt(@? `=@ $ $ > "( $ $ ;`0耈`23$ " $ /<$ ,z {l 0` @Aؒlh@$ $  0$ ,`$ 0@U  } ʀ  0$ 0@B4ܐ 0d$ 0Ex> ` > <@' >  8'쀢 J@  Y'䀢 8'q耢 3'#' )' && ..&i& " 8  > "0 > "p@  > > "Hiǰ H> 堐 @; '?#\%a   В  @  #i’  i H8 `nZ $ ' `j4 iڔ  > "0@;O :.i  (*`J@*`  @*8`*@>a> <' > :  ">  Đ 0> "  vĖ 0aH `% 7Ԕ= Ò '> [#'Ԕ'''   //Հ }?!' //3> '&` ''j '  "  %a$`$`$@$@  o$` 7#\'  ۤ` > `8 m ' 7@fҒ `7' > &` e`8 #'> > "@c \@ '$ ' "h `h`>  0>  HՐ a  >  \`A   2 \> "ؐ$'> 8>  X#   > q#0> n#> j#p> f#P> c#> < 㿈  $ ( 0 8> ƀ `2 4  ,    #\#`#d> >  ؟ƀa㿈 V   > ƀ! `2!! !!(  ;`#\> ƀ!H!8> ƀ!J>`f>h>X! `?L>[`J>`f>h>X"`?L>[`8`"1 `2--" `"" "D`   ! !  `K  @"J !  `2  ` ! ɒ `"` "7 `  ";@#  !!  `*#` @"? ! #`` ``1"`@@"#@#`   "!  !  ! "! #``  ``"`@"#@#`   "! k#`"" `2`  "` `w`  " `2R" @ L@  `2 "` "@ ``R `@ " @"` ` `.  `y"` `"`` "` `"` ``` `@ " "` 2"  "` "` ``F `@ " `"` "" `2` !    `K! @" ! @` "` `"@ ``` `@ " "` 2" 0"""  `2`  !    `#`@" #` `s"""㿘@M` 2V``2   "`""@@") "` @"(@@9`9 `""@" @` ` ` ``2`@"@@9`9 `ݒ"``` "`""@@""@"``   2`2 @2 0  @ `  2  `2  @20 @ `   `" `6 `2㿘> 9aX<`*`8"``%#> ?Pb\c,5c "  I>'! $ > !> !㿘> 9aX`<`,> `8%``'> `4`"`` $`>`0` @T3  ` `4`   S!T!㿘 V`   V  $   2V  @P` 㿘 ,  V`1 `" V $  `2 &`&`&@ &` &&&   @P`怢 &`&`&@&` $@ H> c<@' >"`0`'LL> A`Ī> ?c9'@7d _   &> <@ \> K e 8@` 8 " 30> ?&.c>  >#! `8$`($`8" > !0FbpL@L /$ 4 S > ?c?e$ &0@PR L`4`2`8 $`4`8`$`8F"P> > >  b0  㿘  V`  "V  $   2V  @P `  <`@ ` 4`$ " @  ?`2   ,@`@ @ " "  @ ?@2  0 >T `0`L > b$ 8$ <''''''''''''''''''''''''''`ȍ)> @ '>䀠`6 #> @`2 $ $@2` ӫ $ &  P> b$ 8 ɔ  " " " " " " " " `"$`>]  > -` 2ܐ #> @㿘 <`26 @2  ?& 1> @'> @8  2 0"   @2 >  bp$   ԫ  `$  $`2@2 ?$  ؁> @ `0> />5> @b;> @` 9> 't Z` @=` 2 `$  ``ǖ F`k S  `$ $  ̀@"O  ` $ $    `"$  $  $ $  2 ``"c"(@ 0` :y` 2 P%8 (  $` `f 0Ѐ@2  Ā@"  ` 0Ȁ@2  0`"0 P 4  8`@  ! ` (@`&   @`  `$" 8 4x     ''''' L "`ؚ@. ܀ bG& ؚ@. ܝx   `'''''& `ؚ@.v ܀ b"& ؚ@.h ܝ㾨   '|> 'x'''c<' $  @ @ '` H &  Hx@.; | xa x'|L&` ` K ' | ` ` `  ' $#\ @;1 a `2& x@- | 2xax'|& `"  H+ @:֠   @" a`>" adN" x@-, |> ܶ"㾸   '> ''''c<' $  @ @ '` H |&   H@, |` 'K&` ` J ' < ` ` `  ' $#\ @9 [ `1& @,  1`i'& `"  `H @9   ~ @; n @, & H@,   & @: Hi Ò1&   @,^ 4` '&@9>@8k 0`  P@" $@` @@" " " " ""?" " " "   " (" ,@5/  Y_ۢ 0&> ۲"   '> ''''c<' $  @ @ '` H |&   H@+ |_ 'K&` ` J ' 8 ` ` ` ӂ 'Đ#\ $ @8 [ `1& @+  1_e'& `"  H @80  Ű @:   @+ & H@+}   & @9 ui`P `0÷&&  `r@? ? @+H ^'& `H`J@? @7H`4`1̠ @.Ԑ $`$@̒@.̐ $` $`@.Đ $`$` $`$`$`0$`,$`$$`(`$` @3  ,^ 0T "̠ " " " I" @7Ֆ@*ݐ > g"㾸   '> '''c<' +  @ @ '` H &  H@*  ^Z '&  ` `  '  `L @ @= ' @ @D ' $#\ @7 "I `& @*^  ^ '& `" `H @78  @3D   @ @‚  @8  $#\ @7L 2 q 4``  r 4``    @ 2, WŤ&  \ @) =]'&@6Ґ@5 <" @8P =E  H@)Κ " $& @88 %@) X&! 2   ,]K 0C&> ""P   '> ''''c<' $  @ @ '` H &  H@)g  ] 'W&` ` q ' Ĩ `T @ @E ' @ @ L '#\ $ @6S x `N& @)  N\'& `"  H   @6   @1   @ @   @7b \ 0ސ @7V  @(Ӛ &  H@(ƚ a & @70 B  gj&  `5 @( \<'& `{Hy@5|0q@5t@4 > ``"` `" @(^ > "x   'x''t'''> 'c<@' %  @ @[ '` H B&  Ht@(+ x Bt[ת t'x ` `  ' k ` @ @ '`" @ @! '    @  $#\ @5  2 5 a @ W @`   @? ?@ @ ''  o ?X'P' ''`'h'l''d 'T '> P`X " ` ؖ` ܔ```@@@` ` ``'@0K  x`F @ @o ' $#\ @4Q J `& t@' x tZt'x  `"  `H} @3 > c<@ >  @5m gߨ  Ht@&x t #@ @5T N @5J D  @5@ :% ?   "&  &  `!t@? ? X@&x tZRt'x#@ `" `H@3 xZ> > t @&x gtj#@C `& t@? ? X@&ix tZt'x  `W> HT@3BN> #@& @?t ? ` @&<x tYt'x#@`2 9>@ @8Q``V@2; "`3'.@`"` `` 䀥 @2 !d"`Ά "  @2Ȇt@% xs#'a@1 >`""Q`>ad" 5 2 > @1 "+ Bt& @? ? h @%x @tYat'x#@`"&@2@1 @"D " >a`> ad t@% x" S @1 @2i@1 @"DG"  㾸   '> ''''c<' $  @ @ '` H o&  H@%E  oX '?&` ` > '  ` ` `  '#\ $ @2; N `%& @%  %X'&  } @3g ` @$ &  H@$ؚ  & @3B ;v `2&  `4 T@$ X\'`& `@? @0`T@.  @-  sX? 0 `Ӑ Dѐ T@$ >  #x   't''p'''> c<@' $  @ @c '` H K&  Hp@$M t KpW p'tY&` `  '  `Y @ @J ' @ @Q '  $#\ @16 V `& p@$ t pWp't& `"  `H @0ܔ'> c<@ > @,ݔ   @ @  @2C ׂ  $#\ @0 2  ' @ '  ' '耈`   @?'  @ @@  C ?X'P' ''`'h'l''d 'TՒ '> TPX `?`````@\@@@`  @`@' @1 -p @#t p& ``H!   Hp@#t p & @1n tV' `!& p@" t VpVp't& `> `H@/'p@" Xt`24  H`?7 "  &  `qp@" t pVNp't& `"2@/{Ҥ &\@''& p @"st pVp't& @/S@. ؄d"܄"  h h '@N'I`" `P ` ɐ# p@"3 Xt'd'h'l'p't'x'| P'd'h P`$ fo _ܬ  ?$`@@Y'@. >`">`>ad" W T U&ip&  h @!t -pUp't&@. @- >"ܒ " `>" d" &# "   & ^I&&@&' @-ǐ>d" "" @3̐@+">ad'''\ '`'@3є 7`H`?Ϥ   '> '''''c<' +  @ @< '` H $&  H@!Z  $U '& j` `  '  ` @ @ ' @ @ '  ? &"H`? ` & @!   T'& `"    'l'p#d $#\'x#`D@.r   `ؔ2GX `& @? ? x@ ǘ Ts'& `"k Hؖ @-p ^ +0Z@)   @ @x  @/  q`4`h\ l\XMK   ђp &  `@? ? x@ d T' & ` H`> @. = h'  H@ 8  & @. ! `8`; ͦ @  Oؘp@- S  @ & H 6&p0m@ ld> o#8㽘   '> '''''c<' $  @ @W '` H ?&  H@  ?S_ '&` `  '  ` @ @ ' @ @ '  ? J! H`? `4& @k  4S'&2U  `"Q   'l#d $'p'x#`#\D@,Ԛ   ``p _ `& @? ? x@( R'& `" Hp @,    @(   @ @r  @-f k @-\ E_  '`` ` т 'o'X `'\l\7    ,`}& @? ?4 @ RH'`& ``H``hp@+0r  H@v  e& @, @] 6O R  "\\l\X>X 804 @9 & H & `@! @*; $>ad"   l  @*X@,֒ ;X @,o 6,@0C @*  D@'p0> t#H\XlҖ )X  @@=wP''P`$ "D Qqj   '> ''''c<' $  @ @ '` H &  H@  Q8 '&` `  ' ͒ ` @ @ ' @ @ '  ? &"H`? `& @A  P'& `I F`'p'l#d $#\'x#`D@*  `np  `k& @? ? X@ P'& `"  HYp@)ۨ  Ѱ@%  G @ @z  @+G 7s @+= -M  H@ 1 & @+% @  PH  @ MP&P|> #X  @@<`P''`P`$ /0 (& @? ? @X P' $& `^ H\p@)0 U&  `@2  H 4&@.z Dؖ@)  p@)0,> ˤ#X@(1ؔ@%0!h   '> ''''''@c<@' $  @ @{ '` H T$  H@ߐ  TO 'Q&` ` ɂ '   ` @ @ ' @ @ '  ? j) H`? `T$ @  TOC'&2  `   @ ~> '@#d $'D'L#`#\@(   `hH g    $ @? ?4 @? N'  & `" H" ` H@(" 0@$   @ @`  @) Y @)v 3y  'ϐ`` ` ۂ 'd`   ''''p'h'l'x'|'t'd` '``@-4 `` ` ۂ ''(@,`"0-$P> #0ܒ@0,i, ܀@ =  H@  & `9@y ; @( N'@`. "00@0,@", ܀`ʐ 0Ɛ @E & H $P> v#@&P $>ad"     @''Mа H@,@( '! @( "ɑ#hM@ܒ,@ *`#?Dc'@'H'L'D  P> "#Gܐ @(Q "T6,P$PL$1ܔ @@9f,P ' 'P`$ ",,PP   'H> 'd'D'T'\'`c<' ,  @ @ '\` T  H&  HDX@ H DM- D'H& ΰT\` ` ς '\   T\ @ @ `'\  \@ @T '\`2 T \@ @ '\t  ` T\ @ @ '\ \@ @ '\` ? `XD"XH`? `.& DX@ H ?DLD'H& ` ~p $#\ h@& h `.& `@? ?0 @ؘH  DLD'H& `"U `HN @%  (@% D  HD@XH 4D 6&\ @ @\ T\ @'l ,lUT\ @' l "l-T\ @'l lT\ @&l lEt T\ @&l UlHL! T\@!i  T> T\@!`  T `4  '$'(\d'0#d#\#`@%ӚTd   ``y `` f$ ```c d   o(dh ;& `@? ?0 @H DK'HD & ` H}``"y@$ؐ(@$ jDX@ؐ H ``@ː H&E 'd& H h@ H  2`Q > 2#xh P`P@k ql$r㼨   'L> 'l'h'H'X'`'d'('c<@' +  @ @& '`` H &  HH\@d L HK H'L&@ zX`` ` ߂ '`  `X` @ @ '` `@ @X '`  ? C! H`? `-& H\@ L -HJH'L& `" 2  #d $'4 ('(l',X`#`#\@$|l   d`P< N `& dH@? ? @њ\L HJ}H'L& `"k HP @#  @#l W .0SX`@  X` @ @q X` @%p ypj`LX`` `  '``= H a&  HH\@w L HJ#H'L&X` @$ޘp Hp ~'l  HH@X\L H &X` @$˜p ,pX`` ` ? '`t  ``X` @ @ V'`Р H\@! QLL I͸ l "hh `,(` "5( l v q0 H@\L H& HĤ _> #(& `@ @ڂ '`$& (LIx Hl ',h#\'#d'#`@#@h   d`̒ ̀ 4`4`d P`P䀧d``? 0`@O"J(2#> 簐cl   lh   h 8畐c &  `HdH@? ? @B\L HH'LH & `ڀ Hd`ԖP@"*@"#0Œ HH\@ L@  :XLHl>(#> l @#rp 2Lp @#hp p# @#^p p`&_ 8'h> i# 4`2@ P |`Ad: P`.d``? ;`\@ ~L``? +`40' `2 (-|`2 d |@`@逤`<@4 〤`?d@?,ע`   '> ''''c<' $  @ @ '` H $  H@Y  H '&` ` ؂ '  ` @ @ ' @ @ '  ? "H`? `$ @  G'& `" 2   'l'p#d $#\'x#`D@!x   `ؔ8 X`4``8`2 ` \\l\ `s  $  `s@? ? x@ GT' #& ` H! @  X @ @_  @! HX" `U j>  @! 0$ '  H@[  & @!Ř p @< F 0 @. "%& H  ؘp@ ! 0 N\B`80PXڔlN@= —#㽘   '''''''l> c<@' .  @ @I '`! H 1&  H@ڐ  1F '&> c<@ > ` `  '  ` @ @ ' @ @ '  ? `! H`? `+& @  +F4'& `" 2  'l #d $'p'xD#`#\@  p E `& @J  E'& `"n Hp @7 a ^> @(   @ @}  @  v` `  '> @a(@`؀xP|> 4#\'l\ c?d&  ` @֚ E'`& `> `H@p>  @ - 2  H@  & @  @ xI  @ s~E3  ll`B\l\Xw7X "> 1>  @_ &3@ % 2Р`>X`P |> ぐ#\tl\P H P|> q#\&'؀\ P\lX@ "EP+DĠ` ` d '(?c('$xX@ $>ad"   B  @Җ @ڐ e#p'l't?c'p 'x|> #`2p@H\X  @@0WP''P`$  r @ P\Xl 2|> ΐ#XOג`&   =X\㽈   '> ''''''`c<@' $  @ @ '` H &  H@A  C '&` `  '  ` @ @ ' @ @ '  ? <! H`? `&& @  &C'& `"V `2S  '` #d $'d'l8#`#\@`   ``h _ `& @? ? x@ C`'& `" Hh @  @@ ۰@   @ @p  @ i @ wC 'A`` ` V '`〠``L '  'В  H@A  & @ :@( u?c'`'h'l'd p> W# `Z& @   XB'& `i `H d  B` `p``$PPLL H0D @՚ & Hˢ !&HDp> #P` `  '> 90` `<'Ђ ' Ђo'Ԁ: " L  'Dp> Ր#PLcXP`d  ߓ *U?ؖ ''''''''''''''''P`?P`$ Q`  ` @-ϔ  2 `&  `@? ?| @$ A'`& ``H}`L`h@ 0n @v  @l ;oLǀł`?`=:D\ p> #P `PL``'2+L L )'@  @ܒ D@A0"> E#/d․`L8''   'Ҁ?P DP'`L odDp> ͐# `& @   A.'& `߀ H0L'# @:` 2pL'@} $>ad"     @>D` ` w ' L ' 'Ԡ@ 1 P@٦`2DPL`5 KLp> W#`CLf Lm'4Y> <#d@"'LuPLP&  l&  @   @'& A 1 5'А @A 2@  >D&@  &.`p> #PݒoP `& @    @F'& ``H0@   @ z &P   '> ''''c<' +  @ @ '` H &  H@ K  ? '& ɰ` ` ͂ '  ` ` ` & ' `)` ` J '?c'$ >b耠2', b耠2'0 b耠 ?@ b耠" 'L'Pb   'T (( @@(`'X $#\ @ & `&  @ ƚ ?r'& `"y H @ n `v @D  4`   ܯ  _&  `@? ?̒ x@  ?/'& `4H2`@j0% @ט k/  H@ U   & @ S@ < w'XZ  | H@@  c `& @? ? x@  >'& `ŀÐ@ 0@  ٪ > 0`'@ ` ` ] '` ` i ' @9 &@ؒ D@<0s`? j&  `  P`$  @   @  > #i&@ h W @ט k~@24 @0   `> '''''c<@' 4 `, @ @- '` H &  H@ (  $=Ԥ '&@ )` `  ' b ` @ @ '`2 @ @ '        @@ 2  @ 6 #@  ` `@8 @&  $#\ @֘ 2 `  4` j&  ` @  ==' & `"e H"b  @{Y @r  =`w @ @  '      s@ @ʘ E H@ H ! @    @ I< Q  @  `QO  & ` @  &  @ B  &` YLJ> ~#   F | ,`w 'l'h `"! !  2  ?p` '|'h'x '=>bbh@8bhy u`2&  &  `D@? ?Ȓ @  ``!`(!   " 㾐   '> '''''`'d'h'l'p't'x'|c<' +  @ @Ȃ '` H &  H@  ; '& ` `  ' H ` ` `  '#\ $ @ $ `&  @ɚ ;u'& `" H @   4``x m   [& @? ? \@ ;='`& `H}`Jp`2^%@ "n @ @ Hw  H@` T V& @ʘ 05@G  `@8  @`)p`@&  D:Ҡ 0_&$  "@ @N" ;ː ( ;[ $$ ' ' 't'd'p'``'h'l'x!'|I@ `J$H:C$> n#㾈   '''''> c<@' .   @ @ق'`! H c&  H@  c:_ '&> c<@ > ` `  '  `L  @ @;'`B  @ @'    @ @ @> @ؘ 7  H &   H@R  &@G  x`  @ @W'  @ @Ǩ '    @? H $#\ @4 2D&  4p`cW  6& 1  @h "[ @^ $ @T  @J [9~ #>   ` @ 9j'  & ` H " @ > `  !֧   @֞ ܖ   @& ''@? ?  d@g 9'&`@v d>ad X'" '􀠠`  $$` %7` $  9 !  9y($@" e#, sؔ 'h  > 7O@`  $$ $@@$ `'x h '|'l?p]' uK  8 +80ܔ-T(\& =@ 8#@  '& `N'('#@'@ג H D'f''x|@5x @ 4 ` @@ Ԓ#@` @>>ad#``' +&> 7 a` ``'    s1 {'h㿘> '>b@ -& * & & & & & & &  0 ) > @`,@ 4( ࠃ9  ; 8#@  ࠝ㿘> @.``,@ (`@``88> '>b@ Ա: @* * @@8 (`@``8` `$` $`@$a*a  㿘 (!>b@2`"   8`! 8 ۓ >! (<` <> } 㿐 (``@& (c $ 42 0 0`$ (  `h   `")  $  `$  "n     @ 6 0 @@ 8%"";@  0&  @& 4& 0 $`@`2  (` " 4 R $  $& $&  9 <$  4  @ $  4 @ $  4   $ 4    `$ $  0@& 4`& 0 (& ( 4   & (& & & 4& 0 ( #& ( (` & (& $& _&  ( & (> Ð 0``(>V`<'沦bȢ '#\' E􀠠`"` @` `"&` `&`  M ` H #F``(`&`(``"@`(ݐ``沀"=b #\''Ȗ Eq쀢 * #"`(``"( @`0؂ @@&`0`2&`ْ ɀ `(`&`(`2 ` 0`(`&`(&`$&`0㿘 8  ٖ `(> `@ٝp  '''쀦  @ @')('>$  ؀@ 6ؐ H  @ @ '$ $ >b $> I $ $   (@  @ >$ $ b  I> b  J $ $ ې 5א ` K $ $ ͐ +   $ `Ĉ `8 L  `8 L(`> @$  a >b `$ $   $ $  $ 2 (` |  @ @ m@ '  @ @ Z ' $ @!U P $ $$ ($ ,Y  .@  @ /@'쀦 ``! 4   4 04!  @ @ @ ' $ =$ @ ]π@ i찒 U @՘ K $@ W찒 C 㿘@@`2 "`   @83> ``  @ ` @2&` @&` 2֐ X㿐> @'`  2  0H`   A `"  5’  `a.`)$` > @ ` @'    87 `" @' 4&  5!(р`㿐& (`7 3'`,&  T``"#@  %>l ($ $$ `$ 8  &&`4Olڒ'$@&  7㿘 (&(&> 1 㿘@ (&(&>  㿘 > $` @-@ $(` +;> ' 8 E `8$$ `a b$2 8$$ $ (`  %㿘 `  ``8`$@@ (`>  `'@)/> '``  `&aТ (`&  㿐 4 > b(' E > b, $` " ` >!bI! E  >>b>! ah! .! ` $` `''@ >ba@8a b  J= J#HK.L2! @    3(` $` ` >!bI!  >b>! b ! ! ! "  @@  "  @   ""    @ t$㿘 $`"/3   P` `2  `2 R ` `?Eo+` 쀦 $`"`@ &$ ?ހ #܂ @?ؐ t "`@&$2&$ː 㿘 t  `t?2 Gǁ㿘 & t` x |  t@Q Nt P` $ ` $`"F`> 9> 'Ѕ(`4$`Ai4x   >   ` P`’ ༃(`(c00J `@@44p$$$ഁ484 Hp@G Hou(@8(`6> +> '``q bА* `8(` ```8 瀌` 4(@48ܡ(`3M   "  @ =   3?   " (@(`0` `> ?2'  3*  "  @ <  R$Ā a(qc(ă(`c((fc(a82r48Hp@6> '2    " ?c< > 2    "  < 6Ր 㿘 > > bP    ? Ho(@    $" (`@" $ 2 $Hp@ a  2 $0X>`0`&&@  x`4 t .  ` '܂b@'''#\ @z # $`"'  Ђ @' 1`& q $ >> b`}x> @ aX `2 $2`t #沔b @$ 4 a8@=a8$$4$$ "$  ?"M "  $ $`e'''ܢ'#\ @   #0 #`? 2D$2'쀦  ``2'쀈` "  @ Ђ @'q n ?m0  &`( א $ Z "n  $0P`0A '''Ă''''''' @#\'   ? #`? 3 YЀ\@@ab''Ђ @#\'  ?} # ? @ : Ѐ `("! >  ٲ`02$  @ʀ `(` b  @=br  `j  g   $sW   @ \ `("! >  x`  N  `(> !a>  j80Kp >bԪ$9> " %l " ? #`t`0`8ѐ  % /'`'` ` \ '" b Ԇ@/?b 0Ho`4(@a 2 0- + `2 @2$ $ $ 4 $@<@$$ $$ $$ $`&$Hp@ u `> y! @ 7 /n0cbԆ@/g?b0\U$ 㿘Ho4 (@a `G>>b0> > @a +@`:` `2@`$ 2@`8v 25 `4``&`4 $h".`0  `,`@6@` `& `$ '`( @4 x"@="`$`&`$Hp@>b &`$ ``d&`( d&`($ `(`$ &`$ t`?&`4````! ` &@ $h    6@ b1  "~@ $`` `   "`$ k?i #"h@ `"c4`8b@ `  逢 "`(`&`$`d&`( d&`( 8``& !& !8@=!8>&`4&`$ a& 8&`4`> b Pb" " " 8" 0     .Ȑ $"/>  > '@  `x`@a>` `$''ܬ0$((`> @,$4 $$b$ @?bHo 4`(@a``"Z$`$` `t`3&``x`"'`$Hp@``' 沀 Ho 4(@a?  @$$``Hp@$ $$`&`2 $` ؐ ''' @ @  >'   @ @ z@ '  @ @'`2 +  @ @' `$b6F&&-&>b`t`b  0TO`` k $`@`a&`$$$Q_*$$ cʀF-Z,> 4'=' > > '@Y* *  @40@ r  @ @ @ `` + @ R>Q  >b` &- > -b˔> ͒a( @ .Zh``Hp@?$4ܰ&` @$$``0] $,Ȱ6''',&>Hb /    @[ cVܝ㿘> a#>%> a1 ( 2 0) '  @2   @2   `  @ @*  "  ` `.    `. 㿘> @` 4 >>> a a `㿘 ` @,q  . ,J  `㿘>a "2>a ?   @$$ h 4`!> ?  @$ $  ?$  @$$ hǒ 4`2 > a㿘 `a  `.  `. . Ӂ > @(``"  `> @b0@> @(`@    & `.  沖 . & `. 㿐 `"   >""@!>> @!`@@ 9"@!>!> aȂ.  !.  @??& &>! ? @?&&.&`. &   $ . & `] `@. 沖 .C& >6> !a0@@(` & !a0@@(`  !a0@@(`! a!0@ @.(`@*& .   4f> !`$!& !>* ! &   $ . & `` .& "    ? $ $>a`$ ` ` `G`.> `1`>bb0 @8b0,   `, , !$ Obb8 @8b8 沖 - &bb( @8b(>bb8@8b8    > Ӷ! @`"  H` "` &@"` @ "@ H㿘 >  Pa4  @  4``````چ  @ @   @ @ (@ `  @  @:  ` ` @` ` @`2 ` 0ބ    @ (@  ``2 ` 0˝㿘`&` & `& `"0@@> @(ap@&`o&` &`$&`P&`T& `N?&$`L&,0`@&(`&4&0`&8`,&<`0&@`4&D`8&H`<&L`@&P> @(`L&@ 8) `> 9a0@&`$&`(&@`8?`L&`P(0 @& `&$`&(`,&,`0?"8&0@ے#&0`4&4`8?"6&8@Ғ#&8`<&<`@?"&@@ɒ#&@`> 9a@&`$&`(&@`2`L?&`P(0 @& `&$`&(`,&,`0?&0`4&4`8?&8`<&<`@?&@ " `@@`?Ho$4 (@e P@l \P@2 l\0```2PHp@0 0` !8! !(9!9!!!8 !!(!!8!!,!! !!$!@9!!(!@& @ !@ 9!!!8!!(!!,!! !!$2!(!@(!(9! !8` `!`0(` ` ( "!! :@ @   ``@ (! `!@* ` !8` `! `0(` ` ( "!$!( :@ @   ``@ (!( `!,@* `㿘 ``!8`/` @7`8`) @2!>!>!&!8@ >!!@4>!@" !2!!@:!>!@8>!㿘 !8`>`!`0(` ` ( /@ !> @*" @9!(9!f ` 49!@9!"@9!ဧ(!(9!9!׀9!㿘 ``!8`/` @7`8`) @2! >! >!(&!8@ >! !(@&>!(@" !,2!(!$@(!(>! @*>!(㿘 !8`>`!(`0(` ` ( /@ ! > @*" @9!((9!(f ` 49!(@9! "@9! ဧ(! (9! 9!(׀9!  `  `F> b@ ?(> b`@P`@Pc @㿘 &@*  @$ $( `8 > " $  @$ $u!㿐`' Ր>ad"`" ` HȒ >ad"` " `F >ad"`" ` "E`$ >ad"` " `$" `,E> a4l  "`," `0" `4<> a4S  "`4" `8" & #>a`"`y #>a`"` `$#>j a`"`,> a "`4> Y "& P#>a`" H#>a` "Ba`"=  "&5  "㿘` + >a`"# X>ad" 㿘` ` >a`"`  >ad" " $" 4" 8" <" @" ̕㿐>`0`&kf F   `0 " ` ` #` ``"``2\\  `  c(& sj`   S && +`@ `S ! `   6 `+`  @P@2`20՝㿈`$'> \ Ť$`8@ @ @  '@"9 H "J`5 `/2, '@, @`&@ $@ &`8`4$`<$$`#\ W 2 `8 4`t `8`8c㘁  2`8`8n$$` `,c$`,dd$`0 2`8`,@``tw``r $``,a$`,"`8$`,r``㿘 ` > >b`@8` a4$>b@8b8  ` < hdab&`,&`0b&`4&`8  2`" <8<8 @< @bO Ґ(<<8㿘   &@ & H$A@`A &*  " $ @$ '@&`" 0ߒ  @ ' $@`'   @ 4 `$ & &@ '@@&@ > !p''  @ @'!>!d  @ @'!d  @ @'!d  @ @0'!d7  @ @H'`L`  @ @N'`R`&$@  7 S!d  @ @'   @>`   @ @  -``5`,  @ @  ``4`4&$@   H$؁ ژ !>!dC  @ @0'o5&`  !dF  @ @+'9&`  @ @'&`     &`    &```&``  @ @ '&`,&`0``&``  @ @!'&`4&`8&$@  K g A ] 7 S㿐@`P b$b@?" T `@> @a(@ ``8``4 (( @@(` ?`4@ ` $`4`4`(`P&&&d&P&L&`P`&, `  `(@ņ?& & j`"``P`8&@`g`& ` &$`&(` >8` 8`(` 0&l( &h`(&0`,&D`0(( @@(`&H&``<&X&T`@&\8&p b&t e> `2`>`" >8 >82>@8>8> @_Ҕ > a4L&@`(> @(a`'@``D`H?c(r@&@`` & ` &$`&(``  @>8` `   >h`8&0`<&D`@&H`L&T`P8&`&X&p &t`">> a4& hda2b&4&8(&@&,&0M&@$@ <?8?9 > Aa$`0" `4[&H5 > 9<`@> AaT$`0q  `%> 9b$`p$`0p&'@㿐> aa#\ `!@   >> ! bw 㿐> 'b>(  b >>  b>>  b>> ah>ab > >> a`?>! b d@#>  b b@  > 7c( <#\>> "b  ; 㿘 "    "o($ 㿘 &`&` @ T`` o@` @$` & " $@$   "=($@ - ``  @@ ` @$` &" $@" ` ''Ԅ '' ''''''p '''''''Ё>c >c `P``>c ` >c 㿘  @c @``V@R ` 2 ! H  "````<` @@ &`>`$&```@@8`&@&`%$'@``@2 @ @ @ '@% @ϰ 4@@'@㿘> @`1>   dO  d㿐\>   'V` `,4,  ` @   ` ڴ& &>b>&b >&b&  $b/ & 0> @(b0@! ` " " " "` " `"   "  ` `! !`( `  & 0! > >  b @ɡ"0㿘 > #>c%>0!> Ab< 02(* ?' ?(`28` ( 8&   `&  \!$ \c  \ $ \ b< $b<㿐> bL @P2 +> A`8-  @  >> bPO?  . @   {  . `6  @  0㿘> bL (`27> AO: > t` ; %8&t0 3>  @ 0(8a @  !a +>@a&a />?ަ`  e  ^ $ $ $? @$ $ $a%a 0 L Hod4 l(@e l 0  0@`2  0`& 0GQ 0@& 0G p` pHp@  2 > ! 2  ta @%&a &tNǒ >& t! >  k(!&a   8`" 8 (` "  ! ?  >`p 2> b4㿘 (  & (  `$  & +O" 3g        㿐'>H`q`$H)> 2"0"0 20*   ? $$ [| 2` (` $ ? $$ [b 2`2fH%"0$$H*!>><> b@b@ < ` < 2Y "0> 8`""08 8 %"0 `> 7c(>#\!l>  tc(  ٘ >U bH>8$> o#㿐'Ho`4$(@a$>b@5> A$ >`&@&al>b`Q (``iHp@    `,   `"" ] d π  @`  'Ho`(@a釔 $ $`2  2 (```h `$(```"d'$ $  (`@a@@8a@ @` ?@-`$`8``$` Ē (`r` v  `?8`? `"   r  T '`>!lPHo`w(@{ ? @$$Hp@ 4Z`[&> > A(``7 z"@ 3?" `$ 84   &F,$( B e 9    i   ` `  @ > #0 a&㿘 ( P`C T@`4 2AT`S  @";P  4 4 4 Q4 ! !  `& ! Ho`(@>b$ $  ! (Hp@a>>b8("T 0`2       "  'V      " ?c'H   < 2W >"b0`" `  ` @a 2k!>"H>> b0$"H  "H"   N"`l x B 4 WF " "  `?8`?` ,`7m &耢`쀢'& ` 0؂ 7f   ` / -    - -㿘`    -Ȑ > A   "pbo "p & &3>"p2b ـ@ `Հbp`Ѡ ϲb"p㿘`+   ' P@ 0@2  2 \ l` j  2h \ 2 P㿐"`p`0 `&@㿘 6`"a  }a`@` X 㿘Ho 4 $(@a $`?@`?@ (& $Hp@````,#>!> '"@Ab @< & b@7"Ѐ&& * *  4& ``"  $`0``d4 d&  $`2` e& `" `  `` @ " ` ` ~ `& @@  @@&  4& ``" `$` ~ `& @@  @@&  4& ``(`}|c&  Ā@&& `  `4``$& , `8``$& `H ?c$u6 Ԃ?6 `"V `LQ?c$M6 ւ?6 ``P ?c$N6 ؂?6 `"? `T`:?c@$66 ڂ?6  t`"  "  ~ x`=>  &  &$ &( &, &0 ,&4 &8 &H &L &P &T"  &   ր86 `  ڀ86  t``$o& {```& > cPP>  `X R  <  "& "1& 㿘`$@   U ܢ&b^> '$`(>b@at $`$`$` $`$`$`, $`  $`p4`4`Ԃ <4`4`  `0`  `@p`ax Z`t Zp Xl$``$@$`$`` >`0 $`x `$`| &`8 Ւ  ÐVX 0> c<'   `s`  K a X (' 5@@> A`N  $@"" D $}' !t0Ҁ@Π Œ ȐP Yi   Z%@4@Ԗ Y[  %@'4  '$>      $ H? ('8> #pj * X$@ $@ ' '' j ' ''   $  > #x> ސ#> c<@' >`0`!(̒ @kܐ> 8a? x > `1> <#\> # > !$$$ !$"!!$ @ iw`#\``}E V> @3> ca> ia` N1> l"?"> Ő @@ 8 > h`XK  2#>  > _``i>Ȇ  `4Ȃ? 8&"% ``} 2 > > x 0 &"%  h> > ( > I#G#> D p>ba D@^8a''Вݔ ''ؐ鰒 Ԁ`'` ` R '`2Y D` ` /Z 0' : ~& :`R&  :~& : >`F&  Ā|& Ā: $ <`5&  $@& $հа  ` Q   0t & & & h"`$b'`p`0 ]`2 耡 `$">bă@8a@? ? D''̒$''ؐ 耠`Ѐ`'` `  '` ܔ 쀦 e` `䀠@? `4@ ` ܔ4 j``@8 e&`"&``@  3 + &` @3` @&`` `  3 + &` @3` @&```   : 8 0 @ 0 (8 @ >` ``   >`(`$`    @ >`8>`0&`h]e\V `4@ 'Qܒ  tϰ0`&``&`8`&`` &`8&``&`(8&`,&` &`$&`0&`4㿘 ` @   P `82 @欐 <    E㿘Zց0`  7*d4 `<"`PT`$[ ab ' ' b"  ' '  {5')  d4 `<`P'  Ȃd0㿘`ඐ਄'0㿘`ඐࠄ'0ҁ0` cd4 `<"`Pz`$[S ab ' ' b"  ' '  zǐ[㿘`ඐ਄&0H㿘`ඐࠄ&0b0 `  P`$"  4   z "   4`[(@`&   zw  㿘>  !`,`0 4`>   Ё_>   Ё㿐 `    #\S 㿘 0`>  0` >`0` 0`  !8x  ''ؔw܁p Pb`$ >ba( D@8a( ''РВ Ð" " " 'a 'ܐВ Ԁ`.` ` f '>d@hԀ`'` ` 0 '`  ?Ԁ` ` ! '`̒@   Ԑ| a1 ﻘ  ﱘ  ܤ`̐ 律 "ݴ  ` `  '㿘 0 0>`0` 0 ?b& 0Ho$$(@= `@ ( p` pHp@` @`"9 `z` e< `@ ܺ`"  `%  0@& 00 0@& 0<}`` `% =  0T  0`S 0I 1o 2G,5- '< @-  @  0 > @ & 0  0@`C < < 0> `0` 0(& 0 ) #S 0& & & 0Ho$ (@>Hp@z`e0  – @L0 @S< a12^` ~`PY`> !P>b 0 P  'b`$'P @@ `?@ ('> ??` ?''"Hod4 l(@e l A   =9  0`` ;[ 0@' 0E,@    1 (` ) : @ @ @   8B ˀ ǀ ?Hp@Z 0@`C = =0P a1  @= < 8, ? 0@' 0 뀤  @= Hod(@e; p`& p 0' ' 0 0?ބ@' ' 0=Hp@ ̓, Ho$4 l(@e l  0Q-L 0`  0`W`: 0@' 0EHp@x0 0`2޸: 0`' 002ָ 0@@' 0>  pHp@ P F> 'Ю (`Hp@ P `$ ( ?> !4Ho$(@e> [dHp@ PÒ > 'Ю ܷ(`  P(  l` `0඀N ``>b p P >b"`$ b'@@? `9 ` ?h ''В6 ?   `ං`0`0 ` `Ē`А`'\'㎒ 쀠`ZԺ Q ` ` R '3>adbԺ ; '` ` f ' WԺ & ` ` \ 'adtԀ '` ` ] 'LԺ} Ժ  w  g   ] Ԡ ^ ` `  '  <  2 + !  ` `  '   Ԡ>  㿐>` `0```#\#`֘ p P >b" `$@b9 @?܄H' ?=''В0   ? `0 `{''ܐ~ 쀠`4Ԁ & ` ` 1 '>d@3Ԁ '` ` = ' * `0  `00 y 2` `  '5 "  X 2Ԑ L 0  4` @`>a`  h P>b$`bC @?܄H' ?8''̒U  ?`@`6 Ð''ؐƒ   `耠`0ж 8倧`耠`) ` ` \ '   @ ? ʸ H ɐ^'@  ` # ` `  [ ?'@F' `w0`耠`NЀ -'` ` [ ' @`и ^0ܒ ꌘ >ܔR /쀤 "@b`T`@"8` P ;`ܒe 'ܔ* =`;@и 5@ܒ B @P 2 PX0'l0㿐F` ' Jn $T $`$@X`4`C> `  a`@ؚ SQ F $`@d@$``  " `]T@KԒ `@ `>  M!`p P`b`$@ b' P<`@ b  ` > bд`@?` @@? ?  P''В튐H 쀠`"`` `"` " " >0'  L'쀠`Ԁ`'` ` z '`22쀠`< @ @[ ' @ @$; ' @Ԁ  A d쀡  1 " "" $@`4`0' E @ @  5 ƀ O H٢$@    `–  }&!0p P >b" `$b@9 @?' ?4 D''Р쳐>`0`''ܔ߃ `Ԁ`'` ` @ '`2. ` `  ' ԰ H셖肒  ԁ 脘  K Ѐ   n h P`b'`$ 'L''Pb'`c2> `    >ba솀@>b@?8a ?렐 X''В 쀠`ے ""   ࠆ !! ȐĒ  `L?쀠`Ԁ`'` ` v '` і S쀠`` ` c '  ` ` 8 ' A ` ` N '`? Ԁ  y>`"` 7`@@ @  @! ` &``"9`̘   8`P  > ܐ!E "u  쀠`` `   ' ?` " `(`` 7`@@ @ @ ` @&`8n "l@*@0$,4 ,`@&`@`!@b `  @< @$@@(@@ @ @ ` &`쀠"D` ` `@ @ m '耥 C"$$$ ?쀠`` ` G '?`  ; H``  @ @  '` `@ @6 '耥 „@ _ & ˘ ?   淘    椘 2q" " s  擘  托    0y`w> !0sp  P b$b 'ZnZl`>  '#>b`І@8``   ?@? ?ܐ H鬐''В,`\``'` ' 쀠`dԀ & ` ` Z '>d@\Ԁ '` ` 8 '_ D`> ΐ# `0 ` "( (ے AؐYY  ! ?`> # `0  ՘ 2#Ŧ  Ș 2` `  ' 崘  `x h>Pbb` $ @ 8`  b@'耤 7 ``L@ <@''̪̒e -耠`bd$!   ?> 3#`0 `(G Yf ``(@̄ 耠`C' ' 耤 Y  ` `  '`s Y ` `  '   @I ? P Hٔ d$ ⯒  > 9D>@"" " "  ,"  0?"$ @?#$  4$  8?"$ @6#$ Ш   "X> # `s0p # ` `  ?@'P ` ` `  '䀤`|` 'ܔq 4Ѐ  ` ` + '>d@-Ѐ '` ` 4 ' 80ܒ T а   ܒ b ` ` 5 'ܒ N ܒ D ܔ  R n`` ` S T'ܒ  ܒ  d`ܒ  Bܒ  p P >b" `$ "@9 @?' ?K ''ДВɐ쀠`T ᤐ~ >a`"''ܐڍ 쀠`.Ԁ &` `  '>d@Ԁ '` `  '`  'd ʰ2 `?*`4`\> 9(`0$` "%>$ `"'>$ `$$ `,$ `0?")$ @۶#$ `4$ `8?"$ @ۭ#$ >b"` 2$ >b$ `2$ >b$ `$$ `,$ `0?$ `4$ `8?k$  7 z` `  u'> 9a@  w  `0㿐    d `d2P> =" P  GUJ UEVV`` @"  P2  <`(  `"+ 4 ``#\#` " %  "4% 4`ƀ  4`>V `֐| 2 "% V  >0p  P $b'`P P" > Q#ITְ   lÐ>b`І@8`  ?@? ? ̐''ВLH$& ?>  #` `0 `  ` `"`%/ `%* TVE ' ' 쀠`WԨ : '` ` > 'FԀ & ` ` B '>d@DԀ '` ` T ' X(> #``0  ۘ %Ԩ  㞖  Ę ` `   'Y ᫘ "԰  ᝘ c 0  `dP  <O>  4` 0ఀ`$` `kT !ఀ`" `> 0#Um$Uk "$E $@ %`(=3` ` ۰``` `O Ұа > r" p"8㿘  4`  ` Pb$    $ (0`` 4   a  4 p P`b$'Lb'PZ'P `` <@ `   > bЪ`@?``@? ?ܐ X2''В䲐쀠`m `"` " " L" " '>0'   m'쀠`*Ԁ`& ` `  '>d Ԁ`'` `  '`2 쀠`f` ` k '" @@$@ @ @9 @"``@@c&`>`+&`$@)m, $@$$  `L`P ` `x$4Y`L ے ` " " "s" 2$$@ې@8  "ݠ P  l Ԡ ' g    [@=   M>d[ ` ` + '  1 F@  Ә *`N ᗖ  FL @&` ߶      @ L> ݐ"X4`"    >S`Đ4`"    >S`Đ㿘  H`3 - " `P`$, ?R`4 `P`$ W ђ  | <8<@A (@`2  4`  "V ,?? <   A "   ", $<<8@At 7 `C" 2`4 4"L ,`4` ֪  쐄` | 2< @8ݒ ے  k    ̀̒ ? 2?2?  2h`P ,2d`P 42``P 2\`P_ 2`4  p`P`$b' 1 ` ) >" @9 @? ?  D''ԠԒ≐ ''Z   'b삒 ؁Ű0 4`D  ``a " I! $a`  `"`a " I $a ` ``*  h< !`"8` 4`";$`    @AĐ $`$`$``> "x    @A$` 4`" $`  h 0$`Ȁ2 4$` $`p P`$$`" 48 (@`& > a4ؘ$  ``"n "f>b` H@B8`''В `40`j2 @2 "` `''ܐԂ Ԁ`'` ` U '`2Y @` ` 0 'Ԃ,@?֠󀥠  > M > a4$``$`$$Ɛ "4``  p ԁ2 @2 " \  #  Ѭ \"2``@$ "$`" `T :@`L :@ P`'L'P`'p 't`c2> `''| 'l 'x ܪ >"! \@a9!''̔ ̐ڟ "|"  `""" t  t pĒ !༔! `L'Ӛ'Ѐ`'` `   '`2쀧 H` `   't t!  I` ` ! '`?Ѐ  "x >> ѐ"`` @ @z'` `@ @  '䀧`P ` ` 2 ' ܀܀ 0` `    ' ?`  x"` (`l'x0@@ @ @ ` @&`8ʬ @ @-5 -%`@&`*`!@x0 @"''Ă`   'x @$@(@@'l@ @ @ `܂ @&`` `@ @  '䀥%'|%@`O`` @ @S T'` `@ @'N`` ` т '`xЀ`@u `@ @ t@ 'P@͠  P $````'''ܐ\  > 9''`(!0l<@8` (Ā4`7]'>```  @ @ 1 '` `@ @ n  V [g L Q ?` } HK` : ?ռ 78` ճ T .` `@ @R  K  ` `@ @  Շ `3`N  , tP@7@ 21 PHΐt4'"   Ƙ  t ڼ ` ܀ 耧 x l" 0@@ @  @! ` &``"`|t   8`P   ڂ ``"`> "}` `P`b  '`4 `  2  a'\ `Ӹ  ` \@E   :*   @  $b˖$  :  'X 'Ȃ$'''?'''>0'$@rȔ c@" `" ;   `2u  @ = `u> \p> @`\쀥) ?5  (`0 8X) 0`(]ӓ2` e     `  ' `  `2@  4  ((0`У0'Ȕ )$@@" c@` ";   @    @b`( @8`(  ! $?@&$g"s=  { @l4$@2  @2   `cD 2  2  2 >b`  @8`   !h'P  >`$" Ț b'@ 9 Ȁ`` <`Hܑ@''ȨȒ`$H_  ?  `0 ``#   Ԛ  ` 4  "M> Đ#M "ؒ 2 @> #Lܔܓ䀠`C֠ ' 'Ԓ ό a 䀣` ` ` % '` `Q` ` 6 '   @{ ?ۨ  H} ` g`$= `> 98>@"" " " `," `0?"$ @͒#$ `4$ `8?"$ @Ē#$ ' 'Ԓ -  䀠`ò & ` ` s '>d@ù '` `  ' y ` 0`?`?`?  # ` `  ?@'P`삒 Q```` ` K '`"w`2'耠`?䀠`3  `0€ @ؒ  ` `  ؒ Ҙ `?̰  p'ؒ ׻ `ؒ ױ lؔw eؒמ ~Pؒ ה 䀠`` ` S T'ؔL yؒ r ؒ T i̠  #9 h' Pb$b` '`PbI -L>b`䆀@ /8` ``0ښ@''ȤȒ$0g  ? "K.> # `0 `K <``Tm@''ȤȒڴ䀠`" Ԟ> @(ap@" Է`Z>`0`r ''Ԕ ͙ E䀡 آ   # ` `  ?@' P삒 ` ` ` - '"2'耤J  ` `䀠`̀ ' ` `  '>d@̀ '` `  '`̶ =2V:&@  I) > 9a0@$>$ $ $ ,$ 0?"$ @Ύ#$ 4$ 8?"U$ @΅#Q$ ` ` u` 'p ` `  '```@H ?M  H> 9a@Ԕ&@ >b̠8 Ӷ ؒ   qؒ  o! ` `  _'ؒ Ԙ eؔך ^ؒ  Pؒ ն 䀠` ` ` S. T'ؔn ؒ Ք w5 N"L?0`@" ؒ ~ Ѐؒ T Ѐ> > >  bЖ$  # `'D'P b $b'`> `` @ 'ĥ(` Ȭܴز@ =` <``L؝@''Ȓ`$&`k ?䀡  "`I.`> #`0D` IÐ䀠`Ү ""  "ҦCA$$ `>0 '` 'ˬ `䀡 ؠ   # ` ` / ?@'P삒 ` ,`` ` A '`2`` ` SH T'` `j`(|Y `2 '耦H ``` `X `䀠`.̀ +` `  '>d<ؠ ̀ '` `  ' Ā2'' +䀠`"`2 ` ` D> # @``&0` `  ' `ӂ@ ʒ `[> 90(` $>$ $ $  ,$  0?"$ @V#$  4$  8?" $ @M#$ Ŕ `` ` P` '`! ` ` W '  @  ? H ͘ g> 9a0`  Ӻ =Հ BLӧ P ӝ ~ ``  ӆ  | ` r ?İ < T ǀ1 ߠ@ > > >  bЖΔ%_`L 2!`` D  #X 㿐  Ӓ  ` G. `P b $ b' ($ $֨`4`! ` '/D )   "W ^h` "K $" $ \Ȓ` ``-.Đ `>b```C @8`8` @?܂`H  ?'@''̤֦̒ $9  ?"$"$ h$ ($   \v @ Q   \x` `>.twDې$9 ' ':  e耠`Ѐ '` `  '`  "= "Fa]? 2 $D$ܔ `P`$"*`4`$ | y`P`$@?p Ā` ` ` ` V '@ ?8 HD # ` ` Ԃ ? @'`ڀ P@"D"`P \ɐ $ `P q耠`Ѐ`$'` `  '`Ѐ`'` `  '`쀧`"  ($ " $2$T$Ё\   )$ b`@8` `` h$ À \L  耠 `Ѐ`$'` `  '`4Ѐ`'` ` L '`=쀧`2 \  $ ܒ l+E8$)"'PP@"`PG z耠`Ѐ`$'` `  '` Ѐ`'` `  '` $  `h$ [  $ ܒ н UDp$ܒ Я Jа G  @ᴔ >耠`Ѐ`'` `  '`ޤЀ`'` ` ǂ '`" ܔ;   [Β`  ($ @g J 'ܔ 'ܔ  ܒ / ܒ % gܔ a'ܔ :ܔؖ ܔϖ Wܒ  JܔѼ ܒ  |ܔѩ tܒ Ϙ iܔі aܒ ϼ VBܒ Ϭ F6ܔr 2=ܒ Ϙ  'ܔZ  а" 㿘 \@ɩ " t.@ 2U8t` 8`4H B@Q.<@  @O,@ɇ@< ,`L` 0`(``@' 2`L@  `@$ * @  @^8^$8@ @X 㿘 \@4 " t.@ 2T8t` 8`4V P@^.<@  @,@@u<  L,`@` %`(`@`2` L@  `$4(  8@8`88`@B @Ǔ8`@ԑ: 88`@B@ "`B @ 8` 8@ü8`8㿘 @ 7  ,` .@   & @ " , `@ȁ   ,@` @   @  㿘%$``l`h@ @.6@ @ (@@+@%$`p @{;0`8@ @   @(@w   @  `(  @  ,?> @0`8@ V@   @(N   8@ &@&@@ 4 (` @ ( @ + @ %$(@ @  ` `2` #P(` .6@ @ (@/@v+@  4 ( @ 㿘 @a>: 80 0` @(@ @ U9 0`c؂@8` @ 8> A(`8`?0@` @@ *@] `@bUc 8 (`8`0@` @* @D  @(`$`,8``8`L@(J 8`/ > > aX|@  @ @"@8Ucث:`A>  >0@(0 @  >@  `8@@(` @B ( @" $(@ FՀ2π > V#H> #`9 @F``@`, `80`@8`@9 U0`@c؃8`[ @``X@``q@   >  *#> #(㿐 ,<@B @=  `8 @3? @ʼn? 0`@8`@=`0`@8`%@ >`>`0`@8`&@$  4| [i&   0[`@IJ `@Ī8" . L@@$ 4  4 H E  L @$ 4  4 H + . L`@ (``@ 4  L`@0 @ 2ZZ0Z@=$Z |=`0`@8`%@ _>`0`@8`&@_ ] ~| n , @\* L* @ 6 @4 @4  L 6  @4  @4  Z Z0㿐'H`H'D @bUD#` '" (`8`@ 8`Ѐ@ (8``8   ' (``= =@"v? ' ccL@?c )   ! e\UaX `d t-`8`@˔ @bUeP*`'`Ԁ`/ @`8` @`@O8` @`@D8`@ @D>` @9`@8`*` 6  @bUj T(`  /`` 8@8`D `EP`$ H-85(@=r@@:850@-@`-8`@S @bUeP X `-' X 'Y* 23 (`8 8@x`` = =@!x 2)```8 T-82@(@=@㿐` ` >@8`  @ 8`BYc. d@ : *D  28*0@*@    ̘ @ HbUԀ@   㿘  0 %@>  $8`4 `"$<> `# > #> X#@>  8`@  < 8`@ 0@9H T>P@ bU ؃* 2`@  ``8@B ``@ `2`* @  ``8@B ``@   `?> #@bU `:  :* 82@(@:@@ `?`ܰ 㿘 ``,Xk@—" =>  H4$ $ 8`$ @$` @bUC"Գ4@ 8@`(@bU"3@ +@(@( 0*$ 0 -``$ dcL@  @̖`L`Ҁ` @ bU"ц@ \͆@ \$ ccL@ `p > m `㿘  P`${@FȰ 㿘  0 %@>  2  8 T>  8@@; C8`4o i@$8`p 9 @  x > H4&&8`& @ĕ8 0@   8@ bU ؅<08`` @ 8 @ 4:@ @v? T > K @bU؃*2@  8@`t@3  (@@B -)@ `($8  >  > ʐ "$< >   `  ` 3> 9> `! `͈;$-@&$$#L @?$ @! @bU@ 88  @ :@ @  `<@bU8lؐ@3 2$ /  8 @&$ 8$#L@ :`c?$  @ !  `&##L@?# `! %\Uaق  d ,@_@bU%P* `Ԁ @5 @1V @EV @&V@; * `5@bUІT-`` ``|Z`p@ܕ9 J  `<  <, 82@(@<@@bUؐ@- @bUؐ@v -`&##L@?# `! %\UaX  d ,@4`8,0@,@@ 8`@!@bUZ*`%P `Ԁ/ @V 8` @M @8` @ @8`@ @9D> @ @8`*`@ `6@ @bUT. ` `i  > !> n!X`o`xT%PX  V* %PXV* T1  > !> F!8x .`L@`'T  } "  H` `> a48%`%`J%```0@bU$8bԃ0`@88`08 @ 2``@ bUbԐ @ߠ "`0`@bU |b@ (  8`@Cj`C ) `@> !X> ܐ!@{< `@bU łbԵ. 6`@`8@`2`0\Ua"Ix `P$2`@bUbԇ6`@ +@@(` ?%` L@= T! < -`"0UH: @ F  %`0. ``\k@`\@'`x8`@F< 4 `t @(`t  `U''@j 8`@T: @8`B?U,8B@6?@N`d* : B +@3`8+0@+@@0  0 H@  x`H c! 2  $ Px!`x@O%`x`\<@T@CL``\6`@N@``%`L@=`Z%`\@>  !x> !㿘 .`P@   " H$h/   `"ༀ`$? ?@@ P$9  `?2P༐8`@>`?@   lp@@߂@ `  `Q*  Ԑ "  > a4 8$$B$@$bU  ؔ@ @: i`&2@`Ą 8 :  @`:  H:= 8 3`@@  C   + (@3` `S $,@6+/  @8`N > "0> 8@@< * 82@(@:@> !> "㿘 .`L@`0@" / " H "z0> a4' ' 8' 0@"T8<@r,`@`4l,``8`h 2ɐ8 @ 38`@Q@@ bU#؅;`0@(@  (@@)8`   @톃@  `;`0@(@  (@@)8`   $"@ ' $L:@ C< *@ !  ,4`p 4@>   @_ `+@bU #؇3` ` `(@(C ) @ +  `+ 3`@ ` `(@(C ) $<` @' $L@c<   @! ,Ї, 4@ 4$(4` 4>`@8`  PF`$ }  " @3c0㿘 .`cL`T@` '@8@ Z`8?@ F8?`B > J  E  @> H4$ $ 8`$ `@P8`T?@2@  bU#؆ 9 @(0@  `8@` `  ` 9 @(0@  `8@`      `8 @@v@ @ bU#؆@ ;`@(0@  8@`" #@`@T   `(4@ 4#@(4` 4`T?@/@ bU#؅? 0@(@ ` (@() $ ?$ $dcL@ >  cHZ    > > `-"> b"@   ,Q @~@{#H `*>``Ŧ P ` 2l`  @@ ``v`   ``  Ԕ > Ð" ` r ` ` `V `X ` L`P@ ` O`P `P 8`P`?` Eg *$ P P`" x v"P   ``*Vpє0cl`" ] ["l`l˂`?`l@  `d`h@ `l `l  $ *$ l  `h  `h~8@ > ?"P> "p㾠'`'d` %$'(',' '$'`s'    ``?@+`` 08@8`f > "   d, `` 00(8(@8@L 2> "` @ `C @" > #`  8  d( ; @ @" Ò  8`::@-`@ !`8@8`@&@  *8(@:2@@Җ-`@ ``0(8(@8@@ހ@ @D@S쀢 @@@=`C  h@S耢 쀡 #@`('8@D8耠`b(`X``@ $['T쀠 ("}@ 0%@ 'TS nT@8`(@ @T> @ `C N*@ @@ C>  @ ?@ + `@I*`@ `9 @ @ > ې#@`@2> `'T'< @< >b,?HHL T`8/`@ TT 'X8`''\' @|  \ d+ @ "'4`8@8`','( 0(,% "8>   d` @ 8@ 8`'d'``8`@"> #``0',8((@,8@'(',  8 ) (@0 9 @'`'d`8`@d@> `P`$"XT   8`(@%`#h;`4#\@PXF`C ?X$0 8T@8`D< 0`#hd#d#\#`@HuX)  0@@Q   `H'88`(@ j!> A"x` T@ `"x``H>  ` /";> A,@! !   d 1`8@8`'' 0d }b`Xe 88`@D`P`$;  d ,4`80@!  d,@!   d ``0'(88(@'@ '`H'<`2@> #p`%"x2T`   T d `8@8`'$'  0 $' ``0'$8((@$8@' '$  YeTb#i`> [#㾠'`'d` %$'(',' '$'`s'    ``?@+`` 08@8` > "   d, `` 00(8(@8@ 2>  ` @ `C @" >   8`  8  d( ; @ @"   8`::@J-`@ !`8@8`@;&@  *8(@:2@@+-`@ ``0(8(@8@@ހ@ @D@QI쀢 @@@=`C  h@Q;耢 쀡 @`p'8耠`^(`X `@$X'T (`@ "z 0%@ 'T  lT@8`p@  @^> @ `C X*@ @@ M>  @ I@ + `@S*`@ `9 @ @ > > ``@2> `'T'<8D@ 8`@ >lb,?HHLT`8T/`T @ ';`'X'\' @{  \ d(@ !'4`8@8`','( 0(, "&>   d` @ 8@ 8`'d'``@"">  ``0',,(88(@'(@ ',  0 8 ) 9 (@'`@`'d@> d> `P`$"XT  8`p@%#h`#\;`4@@MߔXF@?X<. 88`@DT< 0#h#d#\#`@EӘX)  0@@  `H'88`p@b!> A"x` iT `"x` _`zH  /,@! !   d -`8@8`'' 0Ő q] 88`@D`P`$8  d ,4`80@!  d,@!   d ``0'(88(@'@ '`H'<@ 2 0>  `%"x2T  @M T d `8@8`'$'  0 $ ``0'$$(88(@' @ '$  cc tTϐ x`> Ȑ!> Ab| ` `@ [@xd'`\ @ 0@_?`@@  2Z *W ?   2Q ```"  `` " (@ <@@B@}8` @ז d@ d4  2 (  ` -` @`pd )       '`@e  > w!(> :!h `<`'8` 8`'ܐ' @g 2Ԩ ༐8`@ '=?쀐"I8 `  `@C8` d` & d  (@ @"> !1 ( 8 ) 0@m@ > >  cHS  "`` > > `,"> a" -`(j8@4@"b<  @<0?@:  @ d@&䀠@P $>aܬ @  `P$4T `  `8@C8` d`& d v-! ! 84>  <0 a 0H@\@d h 2$90"@8  @  @c> 84~>  <0 a 0H@7@d hh9 > u"8> 8"`08 0@) @2(@ <`|@@'8` @ @q@" $k@ ($f h@ h-580@! d-! > `> 0\a> ! h@f h$?8EP  >  ! > ڐ!ؐ"֐"㿘`%% 0@ C\@?`@  2= @ "`??` `` "o (@ <@@B@8` @ d@ d(?` "> >  cHR   > > `"> " > "> #> ?`  @eh 8@/"1 @Õ8` >륚a܀ . ` $> `@C8` `& =1 ( 8 ) 0@@"!<   @ג> w h@ h2`8 @cs > @ߨ > #('D %< 0@'T'X@>`0`'h'd'l'P'T'H'L '`@\h P`2&@; ;   D P   2 耤 `p@Ly 􀠠D`x'(`@`Ѐg?  'X'\X ` 0`   H*@@D 0TD#\#`Ҙ `? 0   ' d b ." "  `<@x`H `@``P$@D@I \`&'\,@`(G=@ D   T 0D#\ #` + 83@(@;X@*82(@2]@ X  R @O L  D ` `w  F -58-0@-@ `0 - `PD%<%D L 0 @@ D p鹒 0#\TD#` #d#h? `P`$" PD``.@`p  0@D #` #d#h#\@A" PD -`-! ! D``@˔D`.@8`pD`  X`6 @Ȁ  찒 0\2@'Dd`d` B\`@-`p`I`  d` x8` 8@8`'L'HH@ܖ @y  @8` 8  ; B @ @k8` DN8+@ 'h'l D h`l  ˚ ' 0`M \@l`j 0`   ' 0` 0h" 0\.680@"  d." 0a] ؘ k 3`0@++@@'l'h  8) 0(@9@'H'L 0h" 0\D` `D,`@ `p P`D  * ƀ`#` 0  f@`D a8 *'T'P P@*e%D@",  0D p|TD#\ #` `` 0`   ' 0&" < d ! (@! X&@`P`$D` @D#`#h#d#\ @?ҔD`,`@8`pD   20@*@*'P'TP @%D L@@28*0@@u*%D L%<@@ @@`` 0  l@ `<\ 0(`@?x q ?H(`  d\`@,p 0`   ' 0h" 0 @6D$ 0 D 0 dTD<  < @`FD `9 D` d`d` @``P\$`?)` X @ `D` ``P$"\D  @  \0(@80@!  d(@! ``m\D ` @  ΀  rDT@: 02%D `<@`H `@? 0`  ' d  ,," "  `<@g`H `@``P$x 0D 8#`#h#d#\ @>iDx(8D` 'X'\D pTD#` #\#d#h `P`$D` @D#`#d#h#\@>vD@ 8%D9`^DҒT 0D#\ #`8 b`? 0` s ' d ,," " X*&@`P`$`(`@ @D#h#`#d#\@FX`(`@(r=@  `<@Ʋ`H `@ ` H`gX% 0`삒 h&@Xd\`-580@!  P-! > #P`  ' d 9.." "  `<@l`H `@@ 480@"  d,"   Ddd`` ?l 0 Ve480@"  d,]" 680@"  d." Ұ> A#p> >#'D <0@'T'X@>`0`'t 'pP\2 ; ;   DP   2  p@G찒 쀠D (`'@`Xi  'xX?'|  @0p% %` H*8``XZD0TD#\#`  p'@`0 8 'd` +." "  `<@š`H  `@pP$@`D@D,@ x(`#% Φ`D ՘ 0T: D#\#` + 83@(@;V@*82(@2[@ V  P @M J  D ` ` ` D `F?h.@   l86`0@h.@(@ `( @ % `D``<DL0 @@ D (f0: T\D#\#` #d#h^ pP`$"PD.ഀ`@ `(0@D;`#\#`#d#h@<@PD l l! +@! Dp`@D .@ `( \ ! X`"p\  $,OЀ9xtp` ` = :x0 D8`P0 @@ x`|&@`Ttp  ` =.680@" d." `` Ę : | &'|܀ D` apD-``@ `( P`E  * (\`p0 \` E *28*0@*@ @*D@"{ 0D (y: TD#\#` R \`p0  \&06d" <d W" (@" X`.\p P`$D\  D#`#h#d#\ @;?D`-`@ `(`#` 28*0@@*DL<@ @@h\p0 \ `<@:0DL@0(@80@" d(@"  SD'0p  'd A-" "  `<@`H `@p`P$:0D 8#`#h#d#\ @:̔D( XDX `# s'xD (⪖: T\D#`#d #\#h p`P`$`D\` \D< #`#d#h#\@:KD 8[D\`Dp: 0TD #\#`I V\'@`0p  'd ܇,,@" " X\ p, P`$\  \@D#h#`#d#\@B X(``% `<@`H\ `@D<`<` @[ D h @ h $!  \G`(`0@p?   ?H(` Xi`(\`X(0pʘ q\  t|?phl.6`80@! Pl(! > o#p ޚ 'd /.." " K -580@" d-"  Dtp` ` ;N?'|'xFB`680@" d." 4`80@" d,@""  `<@ `H `@Z> #>   Ue\\#\̞@@@'XX`?'D''''''  'ܨ` t ?``@'Ȁ"@<: D0Ԗ8` ' E  0a">`0`> ం` `(`8`C @8`(8`8 0 < 8 " 048> ;:  D ` `"`H`H''Ȁ0  '0`H=<t) @) t `@D ` 2 #@#`t `@ P`$@D' ` `'tܢ?@?@ : >d 耠J H / ܤ@`/ <`@ '` `"8`"(@`d P8/@ ''D#d?#`#\?  2'0D溰@E>#0`Ȁ`D ` v.8 2Qd؀B d @D` ` `27`0@//@@''`D '؀6'm'-'mD' ` `_]' Hd @``0h&`09d @ "8+@ ''@B:`D#`#\#d 2'.3`0@++@@''}{ P'T''''''`9 `4?`<  ` `р 4``P`(8`   Y`&`h!%G``p@+  ` ; ` ``&   "  @U @*&0&4&8&<&H&@&D`P`$" $>T`0`9  I `  `?4ye0r@e<@' ` 8``0`P=@@ O8;; ''= @?`t誣@: c=?: @ e ?` 'Ȅ@? `M) @``:??  H` *@`p*8@瀢`B2 "l ` `5 2  3`e0@ "Le4T#\@?D   5 ` 68`@g@ h`&   `P`$>>a >`0` `8?@:08``&     *@`pЮ=8`p w ` 2* (Ђ `8%! ( ` ` ` `(`?@ 8`>@ > ` ?`?  @W*@:ٔT>`0`   `&   ("`) @ `p `t*( 8y` w>n`0) @ `(`h‘80  ` *@`:@8`Ж` `  8` T>`0` g ???`t @: c@<'? : @ e@? '̀`D, @`Ѐ2`d`&D? `)) @`Ѐ  > {F , ' @-@   #`#d#\/ 2 ' `  ` ``0㾐 Ȭ' ???```-@`p" X`0`8`"`0`"=> " ϐ`T8@8@㇖ ` < 'Z 8W VT2  8`0 ` ``PE "ք8+@ '' 2`0 (`0 `e<eD`L @@` 8`0```PE 8+@ ''  ` 2`0@ (`0``e<eD`L @@*X"`8`"@ X) X8#>    ) `Ь `p  > zU ) (8>   ) `8` ` ` 8@C8``&̰8?@U| ) Xؙ8> z p ` , X8`) @ ` ` ??:T` `P'#\T@?D ?  <  <,84(@<@`P`$"  ` 8` `0@`4``H$ @R `<`02 ` 8`0 ` ``P` E +@3`8+0@+@@   2`0 (`0 `e<eD`L @ @+ 3@(@;@''5`8-0@-@K@h @I h:8`8`, @W `X`0) (e8    U`    E `"H-`@`p ")`D-`@ `p `t` 4`0 ` =``P`(@8`   @ `0  і ̃=  '̮E " (`0 `e<eD`L @ި@-`(8-`@ `(`` 8`) @ `X 8`3`0@++@@']'3`0@++@@'*'8``-`B`2e@` 8 e@e8`L`0 @ 8`C9    @>T`0`4͔  " 2 @ ( >` x 0` ` 㿈 `P`$  & `` `` ` ۀ` @8 $  ` ʀ` ` `D `` ` ̀ 8 , ( `   `@ ` @> ``"  `  8 4 0 `  H  & \FaT"m, @ 8`@? @8`B8,@D @x@ `d*D 5+@0Z ;`P`$B  `  P`> =x@b  `H*  6>`P`$@7W 03`80@++@@! "`Pn0=`4  p0 t0@1w ` @'  `H* !6ƀ' ` `9 + @* # F ` 8  $V  J  `D '0  `  % ` w 㿘 8> A/`b@.``-(`> > aX| ?`0@` @@>`" / @ @ @& () @2@&8(@) ܴ 8 "  * @ ``?2@ @  * `?*2@ @  +` (@ `?*2@ @  +` (@ `? 8   **@ 2@ @ *)*@*2@ @  ((@)*@ *2@ @  ((@)*@  8   ?*@ *2@ @ *@*@*2@ @  ((@@*@ *2@ @  ((@@*@  8```* @ `?2@ @ 8@``*2@ @  +`(@ `?*2@ @  +`(@ `?㿀 < > 8c9 D@9 C "  0h2     3C 2  ` `@" <  怤 "  4 &9 @ 9 @ > _   <@9 9 @D#\> ;`u!> vO!@2 ( > @8 ك9 㿐  P  < "< 0' 0i HQ `<%<H@&',86(@< @ 5`  ` 6 `` D +@3`8+0@+@@  2 0 ( 0 `%<%D L' 0@@# p8 0 ` `'$<Tl҄ҜҴ,D\tӌӤӼ%\UaFaT" 0  0@g h 8`(`> A@ 㿘  @* &  %L& %,`$ 0$`>$` @&$  &%P%,`4$ 0 t*8 *$:?< @n>%0@ D@h>%0@  D @`>%0 H L88&%8$@8B9 >%0&%@&%<`&%D&$㿘%\Ua*N   $`0 (   #e#c\9 ?` ` #d0#d8? >#d@#dH>>`#c#c> ;;c#d#d+`#d4#d<#dD#dL#c#c#d#d %\FaT"$4##$$ " " " " ā"   2@"` ` ഐ `P"` `l"``   `(` ->\  > B>*b( p  > B>*b( t  > A>*b("|  > A>*b("x  >>*b(   > B>*b( >bܐ >!b >b  >!b >` >!b >a >!b >a >!b >b̐ >!b >bА >!b >` >!b >bȐ >!b >` >!b   >>*b( x  >>*b(!\>aX >!b 㿐> `      !> 7>#( $#\> lc    #\>> #`lc!   >> "cl#\@@Q㿘  `4`@J? PcL`8 +@    H2̔`.`8@1@`0`44А%dH`d@ =`@  83`0@++@@ t  H2`- `8@Զ"`T`T`d ` * c8@ 8``h O > ,`4`h$d48`$d0 H2ueL He,`$%H!`9%0`^cc) 0 8 9 (@Ժ@!%P 2¶0%8%H 2 㿘"` ``,4S`  F@P㿐'D"> A>b$> > A'L`@B~L D `0T  %i   i l%`   `%`%`%` %`@B&%` " ВaL @ @༤8`@; @8`B3,@D @x@`d* D +@3`8+0@+@@0O c` ` j >i#`%`x@]* `H @19`P$N`P`%`D> A> AcP@Rఒ ` ` 0``P`?`" \]` *$ P` ` I`P`"C @ `P$2\``%`\FaT"',L `lӂ`?9L @!D>i&"%`x@* `H!@0ѐ0`` p` t Pl`"   l` *$ l㿀" MЀ`MҀ`L''''쀦`# `䀠/>`?a@` /` .W 2 . @JMЀ` $@" @#ʔ 2`" '''' > q[!X> r 㿘 4` ``2` l` `  "`  ``.  2&@` .ư 㿘"`F\aT Ua"4> q 4 &`0&`@>`8@ۑ8`@B>`<@@ґ8` @, d@ d>` ,2? >`(>`8>`0㿘 $" V`   ` @K``2 B ".ʒ`` -.9 㿘" $6``J @#N AN`Ҁ`2 e`` ).`Ѱ "cH "cH.`с  | ` .`    ?>N` @?? `,Ғ`[ cL   `$$b($`$w㿀 |` '?'`'  t > c\ .C`    - `$`'@?? `,r` > 'cئF%@aT 7' 2U@N`<0@$0d'5 @8` 8` H\@ܐ @@@ | ` >-`쀠@? `,/`-Q ` `K H &b ٰ Lт,Ѐ$耠``$> o 0L耠  !hh | %`\FaT %` ``H/ hhc0h 0'`Lр``$4,Ғ@S?$`,(` C $L C8  .`H'8@$6$@040ې%Hd@ <`+@@  3`8+0@+@@C ԦL F| >   o/ O<|$$,$P`  ( @,4$&b&``"`` `"\` &``$ &`o(&`(&`$%`%@%`t%`$d%`(8%`%`,%`| `耠"Q,$HԔ!Ӓ- `!Ԓ "@0> =a`a0@40(8`0`(@@8<0"!4- ,,`$#$@  İ `&` %` @ဥ<0>   Xn | r $H$@ ڔ 2L  H |㿀 $'`7 `,z`   + + `< 8 0@(0 8 @\ f H[  LP h$cL$cP,`Ґ-hc0h 0(%(X04@? 5L8   `H-l8@@&@@04/'@Hd@ <`+@@  3`8+0@+@@ E`"$$',P`  '$ , @''''> c> n @ $㿐 <`2``0   ``  c 2X> @ @%8`@e @8`B/,@D @x@` `d* D !+@0 @`x@* `H @,qP`%E03`80@++@@Z "@0n!( l+ ) $`@@a " L`Ҁ  e`: $ L`Ҁ` & $e"+ $ "4 $ & $  `  $`& $e@@?k`@ $ (& $ր L`Ҁ`Ҁ (& $2G4 $P`"r   Z Y* Z I @ &,?&(&&0&&| "  44`"| F񀦠> ]`H[    ae  sL`р`2 e $`> l 0e`" `, `@  2X`,  E $cH D 2K`H@ $D HҀ@(( $` ؒ 00Œ " $ $*C` `   ?!( ) 2 $@* @M`|| @Fn *` !`(u ) "L`>   Xl0  Y) Z  @$@ ! Y@ $@'@ 7!t+T l ` 0w`q 2(! Y@' Z"@ xpH`` 9(mi 㿐> ca>`0!> $  D`  > > lb#> <c\ 1> k!  834 3> a$ @  `a$&  ! " ` Y ) P 0@Y$4> > ̐!H` c\ c\#a$`  Ւ  c\㿘  @;M  `"  ` " >>a#`>a $& a">a $& 㿘3ف`'D ' `'䀠`` % `4`` `2> kې!䀈> ` 0@@ " 4* "  @܁ `` n'`?'@ +(`(''`<0@ P6`D#\`  G< `` @ `    < < , 84@(@<@@܀ W0@"@4H! 쀠0@> Bt` ``̀ % `耡 D `"S``"Os0`耠F܀ "`䀈2`'`"``$` 2v`2 ` 80 ` _`P` E +@3`8+0@+@@   20 (0 p`<DL @@`@? ߒ` g< 28` ` *`ܒ@ޔ` Q' `   H'x t  `H@X1```8`䀈`  ` b`?` ` `SX`@ ```M` M  +@ ` 8`'`耠@V쀠2;P`$"J`>>a$C``>ܖ &m 9`D@ ``#@`?`''`jM!`d`?``0l`   > j5!P㿐 ` ` 4``> ` e0r"l ` '"PJ: `0e<@ %* <  p k "m``` D+@3`8+0@+@@8G`(A ]<`( @% T  H LZ'"J ` ` 4`` ` 5`P 2:* 82@(@:@e4( `(D@`,@ ``` ` 4`P ` "P P `$"```$`8`P ``P`( `2D` ``2=` > i[!`$`` `h> .` > iL!iJ!㿘 4`" | Ho4(@e l?/c> > `?a  ;W0@ 0 l 0J`( @  " 0@$ 0`< 0@  0`g"  `&` `  ` 0@"硐 0@$ 0Hp@$9 聐Ho4 l(@e l`Ȁ21 l `G  Hp@@b Ho4 l(@e l*! `ސ w > h!``"X `$"S  @ N  4`>  !Hp@   ` `?  0` Dt /.D-.x.x..x----.x555P55655P5P5P5P5\<[Y[lZZP\YYYY\jjhjjjjjjtjdjTjDj8iii|fihiTiDi4i$iihhhfP4pP`@4tX@@@@DXD?" " " "" 㿘>` (("@ ">2 @8`@>>`쀢 >̰ ` ́P> c<' `4 .`(Є Є@ς (2( > Ѐ cX(> B`x@ #\> "> ƀb( `  (`> > ƀ  > #   > ƀ"0 0 ,   ;`#\> ƀ"0 $   > ƀ#0 > ƀ#H0 ( H   0 4 @ D#t#\ #`#d#h#l#p> ƀ#P0  > ƀ#0 8 ( ,   #\#`#d#h> ƀ#0  $   #\> ƀ 0  , (   #\#`#d#h#l> ƀ @0    > ƀ 0   > ƀ 0  > ƀ 0{   > ƀ 0t9#`㿘> ƀ!  0  > >hb!㿘 0d2 > g!H 4`P > f!x㿘 b>b 6  `,`2`H! ` ` `3` ` `" `H``` `2` ` `3` ` `2`H  ڂ > B`Hp@`> > !fb1> e!㿘V `) >?6 Ԁ>@&@  @& > ` & & >>` > f"㿘> 7cP > $@(>`  (`6 0 ?6 `8&`8 `&`8`8&  2       @?& &  D`&  D ! D  D& `㿘` > 7Ho-(@%> B$> 7cP > #@'cp p`> %> Bb@ p D`& D ._ $ p`2 D` > B`Hp@e%> B㿘&`  @ .: &@Hp@ >`0``4  " @Hp@  . 㿘 +> 7cP > #@'c 0``> 3> BbP#@ 0@& 0` - &` 0` 0` jΰ  㿐Ho$4>(@e>b> B`= >> Bb ( ` * "' (`" "Hp@ `  `!~  '   ΃("Hp@> L"X> G"p   h㿘>`!>"` + "`> B``1>56" 51"㿐 b/b  6 @x`H*  ` D > 0?? `"#   4? 9 > B`Hp@> e " ` O  !& #9!!@ # (`@`Ѐ"7@ > B`Hp@ #\#`> > B#`dݒc@> B* ݂* @`p"4@ > B`Hp@ #\#`> > #dc@> B ``1    (@ @ D   4 0(`@ ` ` 2 2> B {`  (+`@8`p 4 02<    -ဦ 0`D @u>`@ր @Z`* `p h @`?$@ ? %: &`&`2 (` Ӏ (@J8`< @B>`  ( `p@  <@ `6> B!!   `   ``Ԁ""`Ѓ)@0> B"`"`Ԇ`}  (`@ 8w `> B`Hp@ > d#> d"`Hp@> c#> c"`Hp@> c#㿘 b3b  6 @6x`H*  ` D f> 0   `"7   4a [ > B`Hp@> c" `!> B Hp@ O  & Ho4$ (@e$  !ؔ  @ 1 $(`@`X > B `"> B`1    (@ @ D   4 0,(`@ `X 2 > BԖ* ς* $@`( " > B`Hp@ > >  xcMc@w`  ,+`@ `( 4 02<    -Ā 0`D @.>`@ @V`* `($ @`$@? #̒: &` &`2 ,` Ӏ ,@8`< @B>`  ( `(@` <@`I> B ` `  `X`""`X(@M> B"`X`d  ,` @ 8^ ``Hp@ > b#`Hp@ > > B bc@> B`Hp@> b `Hp@> b > B`Hp@> b H`Hp@> b#P`o ,'''''''''''''''耠`^'  /`HL$ @9 C?@8`C? @8`C?8`@C?"   $ ,``E .@88` @8`B"-@d@ : +@D  3`8+0@+@@T-`  @  㿘 @. `8`T?>  8@@; C9 4&>  @> Xq!Ђ 2   `? `(2  " $ P"  : " "  `p((>> aΐ!㿘 >XL"  " : : 2  2 0& (㿘> 7cP > $@#oa 2  !> B !> B `2 Hp@ >X  2 " " " " " 2 Ho(@$  ?@2  `" `&  " e$  ?@2  `"& p?\   `t"?Ho!> B(@e!> B$  ` '  ` "{  H> a-! H `0`Y @ ` =  H'`0`t'촄? +8` !ǐ, , @ ''ܢ8`"2$`d`0ə@' 耠2 0@" 0k  H ' ,@4`8,0@,@@ܚ#\<C] 2'`0a?)0   @?  Ho$#(@>`  `  Hp@> ` Hp@o e> H> `x!8X 'x'l  ' $' | `  ?+'В '̔ '>U!Ё㿐> ` d82 : * * @[>> `> `> > > c  > > ` >>#> 'b cP @ , 8>  `@5 N >p>  bؖ >> ѐ" bb O >a >  b >> " lbp P  @>R> a >> ѐ c >>".'`x H   !> 7>#("#\> XBaX X#\   >>  $X8ah (#\   >> "X.ax #\   >>  X$a P#\   >> ! Xa #\   >>  Xa @#\   >> "Xa (#\   >> !WaȒ #\   >> !HWaؒ #\   >> "Wa #\   >> !Wޚa #\   >> #TWԚb #\   >> #Wʚb>#\#>  b   W 㿘  >`0` 4?> _T"0`&&&,?& 㿘>>c> %>@@(`@2@2@2@2'  "> U"" : " `" `&& '' 㿘> 7cP> $ @ a8 >Pb >؃> +>@ %> B@@b(`@@N I@2 @2 $@2 @2 '  8(`0`` >UB" " " : 2 " (" D" ," 0" 4" 8" <" @Ho4$(@e$@`& @ &@&b8 ' φHo4 ం(@e ' 㿐 1 *> Ho(@7> B&$ $ 􀠠 ` `  "  ఃHp@e^L"H㿘``@> Ho$5(@> B"  ` ! ? @ ` @` @ ` #@ 2ఃHp@`  ` `&` e> B^"p㿘2  Ho?(@> B ` - >` (`0` (`Z> B0> Ѐ cX(> B`x@> ]ߐ"@ `2 D`   D``  2  > B`Hp@e> B `耦` 逦` `2  2 ߀ `,` ` Հ` `2 2`Hp@ (`㿘  "k> Ho$K(@)> B%  l :> #%> 7c6`P`  @- 0`2` 0`C  `"```2頔` o Hp@Ho4% (@e%  l`P` Hp@e)> B  Hp@H> ]#]"㿐Ho'> B(@e'> B$  `Pe8>8  =&  @@>`* @`, :D "7D @2 & < @Ԓ @"     *  @?& & `,&  ,  `,,& `ఃHp@2@2  㿘> 7cP > $@\`X ` ` " 8`X>  ,      @??& &  &   !  & 23    H (`;@    ? @ (& & Ho>(@e>`& ` & Hp@ H (`!\8#(㿘 0 > Hon(@%> B$ ,>`H'>FaT/-> ` H > Ѐ UcX> \ #(` e\̒`2 Hp@`2  a>  `FHp@ < S $ Ho"(@$  `4  Hp <  H`Hk <`2 e%> B(> B`x@> [#e$  `4  HL <  H`HG <ݠ`  0@" 0 4    ? @$ ?$Ho4(@`$ `$$ Hp@%Hp@Ho(@$`2K j{`2D ce$e[N#X[L#8  b '| ` X'''T' Ho>(@e>`& ` & Hp@>  #0㿘> 7cP > $@В` @Z>   (0 `0/(0`` 3`    ? @& & Ho(@>`& ` & Hp@e>`0 (0`` 2 `2   @?  D`  D ! D D `Z#㽰 '' `'0'8 '$|` ', ` 8`$`  , `'   ? t` 8`B ?@@B? 0'8`   شࠀ2a d  " ` 4 0$` i` P`(@8` =  7@  0  < @'ݤ (􀠀> !Y{ ^Ho>(@e>`& ` & Hp@( 0 ;`%<%D L @@4`,@  -`@#\`¤ 0@'`80,@-`@,@#\`` > !А H0 ,K `p A8` (``0`` ` " 8 ` <` @` D` L` ` `    ? @" " Ho>(@e>`" ` " Hp@>  㿘> 7cP > $@A` ` 8`" < `2  @`2  D`2  L`2  `  $6  ( ( (? @V & (& $& ,  " O& q  > B`Hp@> !Y: h?(6     @&& 㿐   >`0` `HoJ(@#> B$`   @K ` `@A 0  `$  P`@ P` @ `Hp@ > Ho>(@e>`& ` & Hp@e#> B0  `$  P`@ P` @ `Hp@ `   g `HoL(@$` 6  &   @#> B 3`  .` ?@6 @&@ ` @`@& `Hp@  `$  ` @ > !T Hp@p,e$` 6  &   @#> B `0> !1!( H> !X5 `H> !X+ > !X(!㿘Ho%>(@e%>#> B Y$``2   @&` " T "   E` ` "  ?(4    ? @$$ >R>` Hp@ (`0`"2  %  0` @`?(0`> Ѐ cX> !> !!PWax`Hp@ (> B`x@ @b`?@`? @'`?2 `2 㿘>`0>`J ,F>`@ >b@ ,H`@$`  > B`Hp@ 9  6 H`($>܀``+ ܃Ho(@> B `    T `" > !> B`Hp@> !W&!e> B `  > > "` !">>a `#> BHo#> B(@e#> B$`1>"> `$&"`" (> ! *"$``&"Hp@ > >!Ă` !!>>a > B``&`&ƒ `㿘> 7cP > $@a(>>` > 9>@'> B@ (`@)>+> l@2 @2 @2 & %` 쀠@` ~ Ho4 ం(@e   ɺ &   `>$ L $ ?2  ? D: 0 L" " " " " ," 8" @" <" D" L2 " H" PHo(@$@`$ @ $@$  l &e$ఝ㿐'Ho4>(@ e>` +> B`%`>> Bb   ""('􀠀 ` "> a$a$@  `$@"@b`"@@ 2`$x 􀤀  & "?A> !> !aȨ9`  "`Hp@`` A' ` Ȗ *q Ho4(@e%``Hp@ `  0Hp@ > !t!l> 0㿈> 7cP'D'H'L>`0`> # @/cLHbo  `/> B` vఃHp@H` Z  `R / ` I & Ho(@e%ఒ s ' 2ఀ"` 2: ఃHp@ $HoL(@eL%@" 2 /> BHo$Ԃ(@%ఁ` `   `2!, 'ఃHp@ Ho4%ం(@e%L@2ǬఃHp@`` @n`8`@{ ``@`8`Ba,@D @`x@W````d*D +@3`8+0@+@@`0Ø찒 vڼ찒 HoL(@eL%@wHp@> !Th"`ఃHp@D   `  bHoL(@eL> B `@2K ` ` Hp@> !T8!Hp@0#> Bd찒 Z03^: 0*e%ఁ- /> B0Ԝ0అH> !T"@Hp@> !S" 㿐> 7cP> # @c '> BఃHp@Ho4$ం(@e$ఐ  b`D 2 `L  `2  @ ( 2 `L 2   `2  @ʐ   2 " ఃHp@ !Ho4$ం(@e$0   Ho4$ం(@e$ఁ㿘 ~ 2 | P`$ Ho(@+> B%` `M` $>`Hp@`` `$e+> B%` `,` `> `xԒ  l 8 `"Q` (``H> Ѐ cX(> B`x@> !R"  "`Hp@ Ho4%`(@e%` 2  "  `2  8 `"7@2 ߐ`Hp@VHo (@e %``2wHp@Ho4%`(@e%`v  쯐 "`Hp@`L JHo4%`(@e%`t "`Hp@ ``  ,`,` Ԕ, "``Hp@ `2v8֐0Ӱ  l`ఃHp@ E  |` c  | ` ` 㿈 >` `0`Ho%> B(@e%> B$` *  Hp@ @`<`" DH> !QӐ"`L`8"`  "` $````  ` 0` `8aHp@ U ``Δ t`  `    e` h2X 0ָ찒 k! 0"`<׭ ]Ho4$(@e$`  =82 8 0 ` : ` P F +@3`8+0@+@@   2 0@ ( 0 " `%<%D L @@`  2 :Hp@ `` ќ0H> Ѐ cX(> B`x@> !P"H> !P"㿐 P`& Ho!> B(@e!> B$        @&  Hp@㿐@?Ho3> B(@e3> B&`    P`@ P` @ `Hp@`H> !P#㿐  >G" " 2 " 2  "  P" Ho5> B(@e5> B&      ?@6 @&@ ` @`@& Hp@Hp@㿐Ho!> B(@e!> B$ `  r   `, {0   `$ `$ ( "  ( Hp@ H> !P#8㿈>'D`0`Ho> 7(@e> 7P!> B`$ > $ @aH%> A>>`>>cT>>aȨ>>aH>>b   ? @!!  Hp@ ` *`> !OĐ#`@EKHo(@e $  Hp@> bD>`- +>aĀ`)>"`f7>⬀` D>`?>>c9>D^ #``2?aĀ`#>"`#>B  @0``2?Ho> 7(@e> 7P`$ > $ @aH`"a@` `? @"@"` Hp@` (8(sD0wD0sD0oD0kD0gD0cD0_D0[>D! 0V>D 0Q>D $0L>D"0GDHo(@e`$  H⬀`4bDD`]>Dj0>Df#T0>Db!0>D^"0>DZ!H0>DV!0>DR"0>DN 0>DJ! 0>DF 0>DB $0>D>"0b>"$b 03la>"$a &"">"%" 0Wa>"%aܒ )>c>㰄 c 㰀W>`?` 㿘'>#>`c> !cc` $c c㬂$c?$&@b `)C @@ z&@ ` G   c`$ 㿐 k   ` ?  " 0㿐> 7cP > $@ƒ` ?(6    ? @ & &    @ & z&    b  k `0J>cPn>c ;0 @ (6   0 ! ? @    @  Ho4(@e`  `" Hp@  0`,> BHo(@>`& ` & Hp@e>  `  ` > B`Hp@> !M_#㿘> 7cP > #@c b} (6 ! ? @    (2  h"M D   D `,`"3` ` ` => !*   `5 `H``!` `3` ` `  ` ` ` @?#` #` D`#`  D` & D #` ʂ " `0`?>w > !L#؀   D   h     ? @& & Ho>(@e>`& ` & Hp@ ` > !L#㿐>!>`"0@8`@ " `>$"C#@ (`2  2  P" " 'Hog(@!> B$ ` ``Pe<;@8 @ w ? @0 `􀠠 @` `$` `>& @xU *  , 2 !`D "`D @2  D  3"   ' 2 "  `/6   @"    @"  2 e!> B {"> "L  H > "L  0H> "L 㿐` `e< >B{!Ȅ  4 $ $ 4 = h  `2 `X$ `   ")  ` ` "<`@wŒ * ,`$ ,  , `,?$ 4  <`$ < `! <`<$  `4  D$  D ' D  D?$ 4  8`$ 8 `! 8`8$ > B`Hp@`"  $   `  $ 4 㿐Ƙ ` (`" (  ( > B`(" Hp@ (` (`  ( ( `> B" Hp@㿘> 7cP > $@ `  w4 (``6 D D  ,`E2,T >`!    ? @$ $ Ho3(@>`$ ` $ Hp@Ho4(@e>`& ` & Hp@>T e>`$ 㿘> 7cP > $@ `` `2 ` `8`< <`<? @&`8&`<` ~` `? @` &`&` @?(6` ` ` @&@&``H [? @2 `D`H<` `D`H`< `H`D <`D`H`< `L &? (2    ? @" ?"`L`;3? @2 `D<`"`D`< `D <`D`<" Ho(@>`&@ ` &`Hp@e>`L0& ` > "J* P㿘> 7cP > $@ `x ` ` " @`,> " D  D `00"`"  24  ` D` `  . 2 I x㿈> 7cP > $@ `8 bA} 6 %\FaT$ x @u( `H * `$ `X! q O& `0`>= `  x @u `H *  ` D6 v  ` > ".@*@`Ѐ  8` ``U1 `  `` `2  .(@ XB`2> " $# X  ( Җ( (@`p @ ;`#\> " !> "> "a IT@2;` 8`p* ҆* (@(8` " @ #\#` > "  2#\ $#(`0` >Ȃ`  0j`"l  @"7 < ?? > 0Ƞ D >c  < \` @2    ? @ "" (0` > Ѐ cX(> B`x@> "H" @2< ??> 00ȃ(`@ `2 ` ` 2 <$ < <  <H <`= <> "H `> "H!Ѐ@" : @"̈́?: ؐ %> " 0> "#\ !> "> "a Hp> "H !P 2ۤ  D`դ > "H!H"P㿐 0d 0h>%>'c4)?;> `` @@4` ` `? @`$@(0  $`0> Ѐ`  X> "HU"ȃ) ` $   ! ? @  `2`"+` 8` @ 0 "`  H. <` 6 S` `$` `4` ې`2 ` 4` 􀠠$@ `'$` 0`bЂ`'b ` `44`  eb$@c$) > B`x@> "GH"> "GE"GC"㿐> 7cP > $@``( "`,> B`Hp@ `(` > "#\#`G"$> B`40> B``4> B`"2`(4H>`( 0&`4`H&`H&HL"" ?( 0 ! ? @ ? L`? @0 `L `L `&`L`L  ` ((> B(,2L`H> "Fϐ#8㿘> 7cP > #@c L D D"& "#  4 "N  P    @?$ $ $   /" L 2` 0$` ` @?"` "` H"` H @ L`& H` `` & P`` @?"` "` H"` H @ L`& H 2 L+ L(  & P 㿐Ho!> B(@e!> B$     2  Hp@  P`y> "P`  q  0 R ` ?2 `􀠠 @` `&` `M D`" @ @' ?c @ 0   @ ? 0 ? `< `<  <`<  @2  `   , Hp@ ` > "Eΐ#Hp@EĐ#`H> "E# "> "ޣ#㿈>'XdX! h<* `" 0  : : : (" 4" L2 2 Ͷ㇔&H  A쀢 > #Ho{(@;> B'`   &D "  $` &@ "    ?  `  ``&8`8 <#``&<"   ? > `" @:쀦? &@6 & p&`P` "&  @6LLP`@&H @"A& & @."@2+`ʒ'`e;> B'`   6&D 2 $ &@`6 "n & P &P @"P @"[ `Hp@@: 2`H> #Dʐ @58" H'`  <@@`? 屘 ? @0  @ &p `( jP &P "P`Hp@@2`E`@8^L& H> #Du h> #Dr 8Dp 㿈'H` >P'T >.86(@>@<>@!:ޒ \" T " 2  2 @ '쀠 : ` !> `0#T4 :Ò   4` #T$`  :4` 2 " $`2 Ho‚(@!>#P> B `$`#P` $#P`` ?$`$@4` '``$`> B`Hp@Ho(@> B `H 4  4 Ho>(@e>`$ `$ Hp@H ՘ ? @0  􀠠 @   & `? $@o * ,`$ ,  `,T`,$ ` ` `  ?@4 `<$`< `"`<`<$쀠`a> B `Hp@8n e> B `H 쩖 "x e=!>` ` ` j#P$  > cP?$4 `<`$`< `"`<`<m$@> B h0  % ?5  L`% L `! L L%> B`Hp@  `4 Ho(@> BA `e> B9 ` 2@` Ʈ @2 > 9# 2 2 xi2@` j> B@> B` 'HHo(@>`% ` %Hp@> B`Hp@ e> `P > B @"m H> #B > #B 㿘> 7cP > $@]` ( 0 4 4 4? @ & 0& 4(`&:    ? @ (& & `7? @2 `<"`< `&`<`<" Ho>(@e>`& ` & Hp@?( 6  !  ? @&& ێ0՝㿘>)>ad+?`<" ) `(`> B`Hp@ > Ѐ RcX> #B!w  a a  4 k   `& > B`Hp@> #A!@> B`Hp@ > Ѐ cX(> B`x@> #A!  `, " ``, `` ,`(> B`x@> #Aː! D "  ( D  ( "%     ? @" "  `e" ` ` ` ` @2 `<"`< `&`<"  ( 2  h#`<2}> Bz> B` 2 @2 @ 0 ! ?  ?  4    ? @ $ $    @$ $ HoB(@"`$" `%"$ Hp@ ڗ ( A> B <> BH H < @4     @  ??$$ @4  $ ` !  `$ e"`Hp@> #A !h> B`Hp@> #@!㿐@ > 7x!H   2 2  ` ` &`,&`  &`P&` `m `>` >` `m `&`( ) @`p:0 ` ) @ `p `t    `2  ) (8:0 ` ) @ `(     `)  @`:` `)  @ ` `Ԉ  ` ` * ` ` ` ) ` ` @k: 8`@gx @8`B+,@D @kx@k! `d*D +@0œ  ` x@k  `H!* Ho(@%> B$  t bߨ`?` @6`  <&@ < `" < <&`X D`  DW D` DHp@ Ho(@$ٽ  l +'$+ 30@ 0Hp@wHo4$(@e$ l '  2    [  ` `6` ` ` jHp@ C ) @ `X ) X803`80@++@@ۘ "K > #؋"  ` Fx@j  `H * ǐHo4G%> B(@e@%> Beuː `>` >` ` `h `p `h `  ` ` بH> #?O"@> #?L!㿈 `> #?D"h>+>b   )> B  0'>'Ho4% (@e%  2 `2 Hp@`} ` Ę "> #Ho(@e%  `"  $` &8 "    ?  `  ``&0` `4#``&4   ? @ ` @4X &,` "&  @ @" 2&  ` `$``&` `"y`` H (`;@ Hp@ "&```Ho4b(@eb`$b `%b>b$Hp@$`w> 4  `$`  2 2  `B  $ @.$   < ƚ $  H < H0 @ G  ( (&(> " ( ``& $``&` `2``H$(`! @2   ߚ `  2 ? 4  $ `& $ &8`+6  @  H> #="F ="㿘  Ho> B(@e> B  ?@2  " `&  " ఃHp@~㿐'X`XhHo5> B(@e5> B& <@@`? 5?` @7`  '@ `'  '`Hp@A ނ ߀ ? @0  􀠠 @   '  `> #=k" -@㿘j ``@  0@!taD t t| "@ $"  "`L Ҁ@? x` 2 L Ҁ`A $2, ҁ > BĴ  !>  `4  `??c @ *`ㄒ E  .` $  $ `" " " 4" "  " "?$ 0Ŵ` Ԑ! !Ԕ"@Ȑ ~ Z|! Y  Z"@!tn t0> $<Đ!h㿘" `+> B > $a/Ho4`(@e`?(W XHp@?[F`o  "  `,1-   "?`,?뵐 ?(@8H`$ 렐 ҒҐ $`Hp@@@'0  㿘> $<@!㿘`4 > $<4!㿘> $`  ;c!㿘 . Ұ $ 㿘 `(> $  ð <"㿘` `<+` #  &`< `0 " `H`Hd&`4`4`"&`@`0d&`0Ho$(@eHp@M&`4㿐> D`0 `؄ &> $ <`"!> $   4 @Ho4 (@e & X" Hp@ ;"H0㿘$`Hp@rHo4`(@e` 2 XHp@    g ``> $:"`?J$`㿐 P b'` F 8 >  > $;S"> $> @b v`$ B?yt@@b;@eQ     ~??@c@>& C @ @C&> ]'􀥀e '`$ @al @ae@a >E&& 8@a@ `'d22`$@2`$ ' @@ e @aߒ @ `  `$ (窥@    ր " > $:" 'F?> $Ā @`?'D PD'P'' \`"`> $:"耠`? `` &@ 8@eC@? 2`2D '@ ' ` " (`@`И? `'>  `L @  '  8D ƚ  0a%"m> $( ć--@" " 0 @&0`(`8@`C ?`(?`86>0`7 I ` WH )  8?` ' DY "(( 8-@ ''???P8@c> $9" ` ,ം@`p( +@3`8+0@+@@P8P??8@u0H ( ?` 8$2?@?@,,@@@2?`@?( &@D $2?@}?z?H,@ @@ o``@ l?⦄5`80@" (-@:" ^?`[  8$2R?@O?@ J,@,C?(>?;?H,@@ 1`&@D $2'?瀠@`ID 32@` .@ : D2`` 3`E @- ` "!അ,`*pp,@@`` &@5`0@--@@'',`@*`((9 ߅8`അ,(8 (Xz8m'8ݐ#㿐  " ` !     #\  㿘'D a * @DH* @D@d`a ~ @ `  ? @&? ?㿘 >`(``?(! `@` @>`(``(" ` >`(``(2 ?  `&   >`(``(? `> > $> $ c@h8# 㿘 >`0`@8` - $*>   `C C80`@8`@(  `C C *@`(" $*@`(& `(" `(> > $> $ c@8F#z  @ `C C@ 2@ `(?@ `(㿘>aP1>.& |> > $> $ c@8$5㿐> 7c( #\  !>$ |> 0#a |(̒" >@3!@> '> aPaP `> a\*> `x㿘7>@?@->9>X!\@T/>P H>P`|@@. `"P> !@`D$!@!H;!L L!L @? $!H$!L  $!D$ $ @ @`  , @- ,   @X!\,` ,`@@ %X P @@Ͱ?&!H @Đ@@?> $> $ c@7#㿘 `E1>@̐!@@ʐaD`21aH@@!@` !P`` > `|, ,` @` ʒ `ǒ `` (` P(`@ʽ !@@$>X @ X@z!@" aLaL LaL? @$aH$aL> aTaH㿘 @ ` $(` 8     $ $?(!4" $!4@K@I@C> > $> % c@7 "㿘 >@P `4 $(` @D>   (80`@8`$``  ` : (` (``6  `? @ P@@D `$   `? @ ;@> $> % c@06"b㿘  !?@ `!  $`2  `0`?<@ (` @?@㿘   n    ` : (` (@> %6 x> > $> % c@X6T#㿘 $@ `  $(` @@4 `> > $> % c@69"` : (` *  @[@W㿘 @j ` $(` @``B` @3@/x> > $> % c@05"㿘>aLV R@5 `Y >$ 0`@8` @ > %5 !@ A?> %@`" F   ! @"/> %(`+<0`@8` C8 C D (@2> %5S!) @`("> %@> %5F!@5@!8> %5=!`5;!㿘 C@ǐ `9 $+ @@a 8`0880`@8` &% !4 ?$!4  @"> %` `@ 2  `( ! 2$ $@r`$!4@m> %4"0> %4"> > $> % c@5,"㿐 `4@p` `h`80`@8`C(@`(?(`,@? ``C(@5?` @> `@ > $> % c@X4!?@ , `<`  K`"``!'"8>`! @0``8> %$@@&@/?` ``!'  ! `"҄`ְ?2"4B"㿐 'XH`!>@ɐ!@@ǐ `H @!@D` ?L!!LL $H!H$L$HH L!H!!H$L@!@ `@`?Â` ?`P@8'8:8`; < " ` 9 (`@ (? ?<`$8(`@ `(?Q?"@@H &> % ` N `< 8  @> %3" <`(`@ `(> % @W  Hn !" @i @'@2 `g8`p`@` @<`(`@ `(??@   `@vQ X` .X @8`2 <@F  ``@$<'& "  =``  ??$@m?Xǰ?@ː' @ "?)$8H> aT$8@ݰ?> > $> % c@3Y!W㿐 ' { `   `>`x8   >>aX\  `  >?` ` `   ` `a8 f 6  ` @[*`@ `0`8a8D 4` , 0`@,`8`0-`@-` P8`5>@9@3>!>aX!\@"-`aX@@&aX!P Ğ O Ę  $`  ē` 9$` "`U> `|,(  $ ` ?! $2` @` ` "``> `|, `" '`  ,  ` "  % @Ր@aX@ @@&aX? `  `g ac` @ $`$` $` $`$ `?(2` @?  ($a4$a8$a< $a@% Pb 8 ` l `< @ @@>$aHPaH$aL  @$aD@[ ꀢ 2 H " d `  j H`b !" @\`2 `  ` : (` (`2```$`@?!  c @ ` `͖  ` % `>`x8 K  `P(4 0A@@!\0@8`9Đ aX021 `> > $> % c@ 1 >>ad`@@(` 2  "   @ 2 @2   `" `  " "㿘    l >>ad`@@(`@@"@2@2   `& ` &  㿘>`0`)>%>!d` @(` 2    @2 @2   !d㿘> 'b  >#d> a`㿘> 9aX"  <`> % k ` " ֆ `u@ Ӧ# 㿘> 9aX ``<`=> %  `2  A   ` "`" @(`0`` `P`$ `"ߐ `   ֐`Z# @Ð & @   ? `  `p `t @0@ `$ `P$  `  ?@ Q    `(`  ` ` M `N>ܬ`0    #l #d#h#\#`   0`- (` (1   M `." M `.1 @D 4 802M 1  `>>ܝ`` `'= : >ܦ`0%?# `4   `5   #\#`#l#d #h `&@@" $ӭ`P @ ' > % ә > %.# 㿘``" @ > % .# ` > %  @`  N``> &H`` @H`@ > & .x 㿐  `9  @ # @ P(`(``&` P$`0``&` P$`@ `& >    㿐    ` 8@ > `  `;  `1 `0` `   "  a  @ `P`$ ` ` &`>ư $ `$  @ǒ@ @``&`0``&``P$ @ ` 㿘  `P> & -  0`> &.y @㿘`h &`.`` `P($. @0 .> &.\ H㿈 'H``& Ђ P$##\ :`   `" " P`$`4 ` 8`@ฆ9 ` P`$ـ`(฀8`ฆ9 ` 2P@` ` @14`@`J @$@ @`Ȃ@[> &64`@ऀ` @`"@"aऀ`~a"@P`$@ #\" 3: `$`2   ``$ @"@ z P`$ c` qംb8`   `$ `@c"6P`H8@ ऀ`"PS~`H P`$" <@6  H"@ 0`b <@ 4 H #\8讒 gฐ`   `> &=6 ```8`ംb8`  ` V$"%(` j`:`H@ =` 達ऀ`"ฆ @:` H`` H`)Y `` 論Hђ`P`$2  )```臔 > &,x h`,t ,r X  ( $''''@< @@@   @   ' P`$`( > `?'`?/ǂ@'2D ' Pb '?'8   ` 6`?'Ԑ( ' &'    Q H@@ '$ ؀$ `  ``@ @ ^@ :7~$ǀ` 2~@  P `耢 v܀` S @$'@C@Ԕ0>2#$"$ ` G`8   2$($$> c `8@8`8 '؆  '' ``@0 ('І@ ( @\؀ "9 `      !2`H?''`H@ `b> BT`2X ` ` ` ԀY'' `" "a' $ `@؀ G @'  ` '{`` ` !`_ > &B !" @j$`І̀'Ѐ@` ̂ @'@m  2$' ` ^a~$  ''ǀ ̀`" 3$@  P `趒 ! ` 0` ``"'@`  ` `@ "'@k 0u`> c `0@f8`0$  '` a~ @$ P `袒 i܀耤 "'@Y  ($ؐ}'@C> & ` ? ` 9 `.$唒 @   P `趒 ܀'@h$撒 @$`  [> ` 9 ` i(e$` 4$'@܀[̐"`"9 J- ` &`$@0 (@( $a8`0$܂h$,?;&'@͏0"`p`p` $$@&ܲۂàa$$̂ $ `" p>`0`^``'(``Yw``(> &`0`6` l `( ٰ  `( 6`?؂  ` '''''`$'''ؔ ` " `` 6`媒 Ӑ`> &( > &( 㿘``(`&```&`&`>l`&`  @ x`㿘   X` א& X   p.`>``0`' `@2'>>ahx<`@@(`@ @"> > @2 @2 ` "   ? @$ $ & 'l >`m> B!taX %>l ol> & D( ' D m t`$t@`協$ `&$ 4 $ $  4  .`@`#@  $  '?'Ԅ ''''' $'  ` f@Ӓ  `X (4  $  @?$$$ '> 'b!t(!taX`#aX `> & `"B > &'! 4`2  (`2   0`2   $`2  4  `"d' <`2  @> a40@$ < @`2V'> `84$ @' @$ $$$$$ $$$  ? @$ $  $  @ ?$ $E$ > ap   㿘 X `  \`"  ` ! ` \ʖ   "  ` `  X " \  \`t`p㿘> 'b  >ܮh>> al xal `㿘"``   >B ̒`㿘 4>`0` E    , @`X` ``  2 : ː 㿘 4`2@ !   `(`@`X `X 㿘 4` @`   Y p "R S% L`> &a 6  `( ,(4܀ 8 4> .4@`0&<4 8(&8耣 8 &8.@> `84&@&8@&, ?68@   ?6 6 p " nǘ g`> &a 6  `,8''`<@''؀`",@(`H> .4@`0'䀠`8@$4`1.@> `84'$q ,(@ 48@6  260`"$66. 6ْЃ.> `6㿐" C   f $ 㿐bĐ ..@`'  @`, @''>B^a@ ` 䇐`:$` @?, @ $```$(&`$> &%!0Hb m @?'''''' ܔ  N4`  ` I .@ @ @ N`,@`$&`$8"`&8&   @ `  @& 8& & 0 2`<`$`@& 0`@`& 8k>Bגa @ ,@Z> &%A!P㿘>`#&"` ``  `` `  퀤#&!%+&%$ ِ"2 n?ްذ㿘+  )> & a (@@2` X 2  `4    ` 8` ߂`4 ``  $ 8> &$!p㿘  4@%> & a (@@2 X 2  4  ̖  `  ,$ ,`4    @$ ,8$ , @$ ,> &$u!p㿘 ߼ "#> & `"  @`"  X ` A`" \`2  > &O!> &$Q!耠`" $J!㿘.`X 8 0@@*  4`" 4 ` W ` P `M> & Pc$@`> &#! ` 4  E@ 9`7*% >  @a4/ ` / ` ; `%> & Pc$@`> &> &"X#x ` 4  E> 48@$ @ ` `"  `p E> &Pc$@`> &> &"(@#` `p`p㿘[> &``'> & a (@@2  X`2 ` 6`  ```8`6`&`8      (@@2` X `J ``Ǡ  㿘.`X , $@@*  (`" ( `W ` P `M> & Pc$@`> &"" `4  E@ 9`7*% >  <a4/ `/ ` ; `%> & Pc$@`> &> &"X"Ŗ `4  E> 40@$ < ` `"  `p E> &Pc$@`> &> &"(" `p`p㿘@('> & a (@@2  X2  6 ) `,@6&,    > &`> &  (@@2 X`D    㿐 `  &@㿐 `` & ` ` P`&Ʃ F&`l㿘> `   㿘"`Dl  4 0&& \ HHp8\8` ` X`@ `  $  `!  ` 0d   E `(` >G  `P 8    @     $    @   >   @ `P 4      ?    c      "   P > Ba| 8 <  " > Ba\ 8> Bal 8 <2  @2  ?"   <`@` ` ` 4`$ " @  ,`"  `"  ?`2  ` `@" "  ?`2   ,@`@ @ " "  @ ?@2  㾈> c<' `<&  `谒 2`` ` `` ` ` `  ``  2 i 2`4 `$``<0@> 9`@  `4`$`0``P$` `` 0` `` 耠`` ``P$2   2 "a> w#`$`0```$` P`$2W! 406   `谒 x> T#ܐ0# `(` ` t` ` w `` p "x > 9#``` ĻĹ (> & `t t L`tǒ u` "Ġ&Ϻ > u`{o0h`tP#0> #0> & m#p㿐` @> 90 `(@ $`43$`0 ` 1 `tɐ  `&> 9b$`$`0ř$  ``8`$`8  `< `+`+` @ (`@@ (`@@ < `& "$`0 `(㿐` `  `   #\ h `   #\ h㿐 h ` # `|` $` $` @$` $` ` `$`  `  `$` `  `t$`L `  `<`  `  `$$`, `  `D$`0 `  `,$`4 `  `@$`8 `  `4$`< `  `H$`@ `  `X$`H `  `P$`D4`"(`@P`8$`( `  ``1 ( )  <`P4$@ `<`X ` $  `  8 $  `` `  8 , ( ` @< `` ` >  4 48` 0 $  $` $` @$` $` `Z `p$`  ` Z `t$` ` Z `($`L ` Z `<`  ` Z `$`, ` Z `$`0 ` Z `$`4 ` Z `$`8 ` Z ` $`< ` Z `$$`@ ` Z `d$`H ` Z `l$`D4`[`($`( ` ^ `h1 9 ) ( @ <`P4$@ `<`X `" ``$    ` ` !  ` @< ``r>  a4  k$ )$`(>  a4  a$  H  7 㿐`<:` ` 5 `0`` &  ` V 8 $  `` ` E 8 , ( ` @> `` ` ,>  4 48` 0 &  ```&    ` ` !  ` @> ``>  a4  & >  a4  &     㿐`<:` ` 7 `0`` $  ` X 8 $  `` ` G 8 , ( ` @< `` ` .>  4 48` 0 $ 忐```$    ` ` !  ` @< ``>  a4  $ >  a4  $     `>1c8 `>1c 㿐`<:` ` 7 `0`` $  ` X 8 $  `` ` G 8 , ( ` @< `` ` .>  4 48` 0 $ ໐```$    ` ` !  ` @< ``>  a4  $ >  a4  $     `>.b `>-cD 㿘? > &   @ `2#]  P` > &V#  @ ` ` ` ` ` > &`A# 4`m l > 7 Ё`p ` `t ` > &`'# 4`䍐Q l >  Ё`>c4 l `` l>`  ` >` l ` %` P`(@`  2``>` p` h`" ```>%` ` `>` (㿘  @a $   ? 2 `" `> '`"o @$ `  `  ""_  "`@"   (`` 0`@C 2  -  -  < @ 7   @   2 @( @" D  2 @8 ֦ 0` (``Ƈ0`ͦ @ : "㿘  > 9(a0@   `"@ @`  L?  ` 9  t p@@ `4 @$@ `(㿘 > 9a0(@  L `\ 㿀  ` (7 (`" G  @D P`(  ` * `p. ` * <`   `$   >`0`#\ #` #l#d#h  ޚ  `( `  <`  㿘 `4` `` ` ``X"  -VT``d2  ` !`X2  `, `" ʒ  ڀŒ )`d2Ȱ  㿘 `  ː `|`"   ` `"  B`  겐  B ` : `X  ` 7`X۰  +$ $`P$@] 붖  % `$ $`P`$"`Ӓ В ` `d"  `d"  0 -`P`$  0  `$ 0`$`P$ `@`?* `"y`u`Ɍ ɉ  ` > c<' dU ``cP@@  > Ð#K => &` `  2` ` `  ` ` ``` n 2 1 2 `$0@ `4$0``P$```$``0``$``P$Ӑ`$`2  2``P> B`(ۈ'  '  ' "' ' ''`' #\  2i` `  "8` `$ `@`H5  P`$" #` .,0 ``` t``t= -`P9 `5 / ``t t͐#@> ' (> B&a"H8`O`㾈 > c<' `d `4`PPO  > &B 0또#P  d Pc@@ S` ^X`@ `P`%`0`%P$G$`2  >%0`%P$2=`>  #"     0> 'W @ְ 󀤀Ґ0ΰ 뀤d{ Pɔ "`h `x   > ''c<'   d``d2 P> ' XP!  Ԓ耤 耢 ԃː@  Pޠ  ` `XҠ  ` `XƠ    `` P` c@@  ``X2 `  `X2`<@@ `? H ` ````'``0``'` P`$2 P``$2  "  $  7`'`Ԗ  ``'`0``'` P`$2`0M>`d"_, p O0< 4`# ӳEC`` @$` $@  +> &#```d"T  Ӷ  Ӱ `d$  `d2C`ҁ ӕ  {@ /߂@ # f   ˒S U耢  " > '`"N`> '  =  N ϒ b0 " ` % ``"``@@``2  ` '`H@.뀤  X/߶  > '` p @ p> ' ` 0` ``"  `" c`@"   ` X `@Р  <@@`?x `$( B`> '`>Pc@@  ം`%`0`%P$"ฐ@ P$`2  "ം%0`%P$  0|n 煘 "琄`lം%0`%P$"ฐ ฐ`   0PL ``@0 w @߂`E'؀2 %P$" Ғ  !' P`$ؐŒ ؀&`P$ 2  0`%   0  `' ` @  x萁  o`` @$`ޔ 䀢   ߀2> '  ID 0/`> '$ ؀`"`> BPa  '`ސ` `'`W   B D`> ' Đ0 ` `p`p㿘~ ` ` uo``X ` ` n````@`?" * > ֐` ` n` `` ` f` ` Jِ` ` _` `` ` W` ` !|:``@B``@  2` 0``p/``` ` *```h`t`p8I  0`p `p `t `p `t^`tY`p`t읐 &@ @ `` $`` `w0  ``{0> '  㿘  ` C `  2"  4`b( O ` - `} 2 d  p0 o@0@ `$  8   0` ```@  `p`t㿘  `     ( L  T D" H "_` P`$-` ` `` @ ` `  `X@@ ߀ > `$ڀ  P`$"`` ``X  H?c  ?``X `X` ` ?` H Xc! X``$` H` ` ` `X`@ `2  " P`$ 6 z ?` ` ``4`l ``"P` @   \ @* @"i $  ," 4P`$` `}``" 4 " 4 ``8 k 1 4" ,``$` ,  P`$:``8``` , 4    P`$IM``d"C H `d@"@ ` HO X@:  `$```pQd H? d` H dc7! d``d& `da`2Z` y ``p2BPL 2sP 㿘   ` `  4` `@`ȁ 4 ` ` &`X`@ `   4` `t@`p(@`&"`  P$` ꉐ "` 0d㿘  4`^   @" -`  `|` $ D0`@񀠿  γ "+  0$ 4d$ 0Hod0(@Hp@2` Ho$ (@vHp@ e02`  2`  H <@T  $ @e0> '!㿘   `@/.`@3``< `(@ '$1!(` (  (@; &,* &@`&( U 8 (@ ''!XL&` > ' @0l ܐ!x $  > >ib`㿐   @  $ > '! > @;w&@ &,* `&&(     $@<&@: `H H8@ ` ) +( &,@$  `0 ,& $> '!> '!㿘&    > $>  "<@@":&` (@;? ( >Z" " P ` >``"  28 @S) >| > !4`@ |!4 || d?@:ɐ?&,  4   @6 Ҕ$> '@!> '"(㿘'?   > $>  y"`"   : "`  $@:&&>Y^"Ȁ $`&8`  ``$`' ` (@:{?&> '"H㿐 .`f,` 2  f`(f ߘ Zf,` T``$`H&@:O@l   0`%@ N`B(``< 2  N`V  `P*2J_   %@ @S@ "Z @N(`   @`(`d> !X> 'J"԰ * < N8@`P )@ .` f,$`  0 ,f8`$`2  < ކ @:u: H 8@`Ԡ " "@:g2 ~@:b&2  @R d>  2#> '"p < 0?d> '$"> '"㿐 .`f,p  f`(f   _(`H`(@:: H 8@` )@+@`f,$`0<@G,f`(c `(> 0`@ 8`$ 4 @Rw " @L(`   @ (`d>  !X> '#H @R[ d> ' #> 'p# >   f,`0 'X '@'T` ` 谒 x耠ഄ(`'@`X?0(c!?(`0@@@ ?''\ `@f_ ` H*0> 'c(#?(`@0@'@ < ޲`؀@   `&"`U @/`f  `' 0`h" 0o 耠@6` 4`  @  `  T ǘ찒  '@`%f .'f ," 8`" `<@PH `@ &'-@ ) ( 4 0,  &Ǭc`^`2ഀ 3ഡ, `(?0(c#?(`0@@@(f |X T X찒 %%छ0(0(`@@@ ! (%f  \'`f(@8`" "  `<@P`H `@  vT 찒 J%'f  'f (@" 8`" <@OH `@: ?''ؠ  %f @@x Z4T ݘ찒 %'@(`?%ਂ ? , (`0@4 @@) &\`of , \'f,8`" a" X f(@?ؘ Y?H(` \`\`*f Ӱ  x0`X) 0(`(@@@ #@@'%3' К 'f ,8`" " Zf `<@O6`H `@> ' D#p>  @ P  " ` ! k  P  b %`8@6@?<`е R`2Q  ,`@`((?(0c?  0(`@@ @(@ `> 5`` 2 .    ` ` %%"`  (@`(((,(`0`@@0`1 ()   (` @1 @@ @ ۔(`@`X?'+`c3` @ (? @0`^>   HP / % `8<    0a`"> '( 0 -@@8" 0Ȋ: >0 `! `(@>`( eH+ @ `(0(`@?0@"@`'`<  "((?-@`?8`>` ހ`$ @؂ Ӄ,`,@@̂ H,@ @ ` %$`@??>0M #> ' I#> ' #㿘6B?c !?@``` ``(0(`0@@@ 1 " ) ( 1  7` "@/`.`. +(`@@7`@? @ "2 >>22`` @ǔ `` ``p` `*```` `d`h@``x`z`''6 3 ''22''2 4`''ؓ45`''Г5'`l0`'ȳ.`?@8`@3Ġ  , 89 33` @,- -?`? @3x>3z35?. (`6 @ @@# + ( 3  # *(` @2@ @ # * ( 2 #*  (`@ܐ 2 @@#؄ @,`( @4`#Ԃ ,(` @4@@ # -` @(Ъ @5`#d- (`@`l 5@@#h) Ȅ ( 0` #l@@(60`) (`(#p8 <0$2    3`     $ ( , 0 4 6 8 :'23 '2 ''24 ''؅34''Ѕ4`5 ''ȅ4 (`''5``(`?1 '') ?  (`1 @@@&@+` @( @ 3` &`+  (`@ 3 @ @&`* ( 2 &` * (`@ 2@ @&`*  ( 2 &`+ (`@ܞ 3@@ &`,  4 (؂ @&`,`(`@Т @ 4`@@ &` (, 4 &`$, 4(`@@̄ @&`(- (Ȩ 5 &`,-` @(`@Ī @ 5`@@&`0 (`?  ' < @ L . @6`:==6`46`6`?`, @6`8 D T \ ` d H > P R X Z'1 '2'5'4 '- 8@6`>8`) @6`< (`@3`' 1 @@ @&`@(+` @ 3` &`D+ 3  '(`@ 3 @ @ &`H(* 2 &`L,`4` @'(`@5`' @ 4`@@-`&`T @ @ (`5`@@@&`\- ( 55'&``    /`/ ..:: 6`P6`R;<6`X6`Z-  (5&`d 6 ,, &`ȁ <    l @ <  @  ` "!  ! l L`d`2 `  d(  ! 2 `&   ! ! 㿀'D'P'X   4  P`@26D>``   0< '耈a#>`0`> ం` `(`8`C @8`(8`8 0 < 8 " 0>" "  tP H'䀠`'  '" 2,"@*@Jɔ'0`?ȏ` @- , ?@/???0((`@0@@" D. ?u 2'Dؤ@ݠ? P`,` ?0(?c(`0@@@ 2䀠`#9 X @ X @P(@@3oD?5 2'䀠` 0h% 0X @0 > (X 㿈 `P$` o  ````& `o @  ` `j   ` @> ``2Q> & `ۤ   &  (`@2u@1$@1ѐ,* @`, B . & LH $ X  ?0  0  0x  @2D0z Ǥ# a4  c00@ 'P'T` T 4`QQ7 rq l@P@? `<T=#\; '!@@$`H @Is@`v `<s   z @  \`&  P`(8`  `` `e  @I@ ( ݔ  ` &   (P@?D  !;T<`#\ ͖ @,@J  S + 83@(@ޢ@<`@@ ;+ 83@(@@4`'$Ƶ' $<` ''X`( <* `& ?` 4   (@@ `(  ` &  |  < (`q `(l <O T>`0`  ?'\' 2 $?h' $ ? '9? (`@ (?0((`@0@@2[@@`6*`X??` "? c)?@ , @ `(0((`@0@@"?#`(?8`  @ `X@l`\@h``@d @`([  0@Ӓh`> (l`̔F  ` &   0- ,  2'\5 @T `( X ( (?4!,84(@r@ L 8I HT@ 8` > ( > ( h > ( 8㿐> 9aX ``<`.> (  `2   " `X` `"`P  `"  f   `$ * lk    ` $ d    ̘?ppppppH<0H$HH HHH`` `'I F >?`0+?% '?`4`B #l #d#h#\#`   ̚ %`/@@+ 0((`@0@@@ $`P`P @ '  > % <> %X#> (  `>?`0ܠ  -?8 `@ `  #l #d#h#\#`  l /`,(` '`3  L`.3 L `.3` @+`( @0` 3 `@) 8`@@D  㿐 8`@p ?`0(c ?0(`@@@ ` L`2 `(` `& ``0` `  ) (`>d` )  )  )  )  )  )  ) 㿐  `2  8`@ ) 8@  `?`(@8`@@(`0`@`8(`3`M `&  @8 `  @' ` 'f'`'@'`'' ` '؂` '  ' P`$@` ܐ '؁`?`/`?@' ' P`@8' $  'X'?`8@'B@+@)Ζ? ?''''̀  Ā`E $ 'Ѐ ; 9;   @\   ` ?''`H`(`4m> BT`"& ` (  `8`@ ] S` 9 O> (,  (? 4 0`B> (`4`@8`( @ ``  ` >` '' "` `"F`4'Ȅ`@(8`@@$`@`(@8`@om'"; ` ` 6'$'> &ӕ  S$ɀ '@   @'@Dƒ` 2? 0`4 , ? ( $`@`8(`$r `` 8`Z6> (M ` 8Y `$@ `߀` @$ 䀈``2`6@ , P ` Ԁ` B `@%` `"ܐ@؁o' U`  ` ܐ a'_'ؐ< 8w$6 $Ш o'ą;   @ C c'> (a@?0(? 0*> (!xh> (+!> (aa@a`> (`(<$`"``"` P`$ `  '؀`$$̀6@+ @$`$`Ԅ%`?`' `@%`?'؀`)`'`m '$@  P ` '@଀ ` ' 4 ' @ ' P ` ' @`h%`/ `@z%`6  "`@%` P `  Ԁ`2 ` S'`(N%`  `(%`'؁@@)B@'4$$4 D'؁ @Ԁ2&ߐ @ @P$X> c<@'  4` `  `f  > c<@ > (@"?` ?`?`'?''''В  `4  /` ' @' 2]Ђ$S? @`8(`@(``v0`5?j > D"@`5%@(1=``(`0(`T0` !@B?0((`@0@@'  // @C``7`(`0`@( =`"  ``@  @" `  $`  [ @ : $ '}  @ @I  =`Ӱ"X>  c<' )& 0(? ?c0/(`@@@ ' L@`/Y` K?8'  '''?c'ą- 0(܅8'7''''ԐÔ `Pb4 ` > ( ``" @0 ` g(` /` 8`@}谒 ` ` ) ?c8  A@  8(`4`@` `` (@8`@@ @Ԕ@&@`@  <@= B@'g@%   `$>d@`/@@ l(`?0``@(8`@7g` i$ eʐ< 6 8` wU9. ?0``@(8`@7  8(`4`Ϣ@ S/ P/ M/ J/ G/ D/ A/")@'> ( !> ( "> (" > (<"`> ("> ("@p'D `` '``` `4` ` `> (> ("b䀋`> (` `) @9 1 (@@ @ w`8'?`'@ O(``@ 6 ;+ 83@(@@D=` #\4 2-``= D8R`L @@ H@)쀠`N@Mr  `耠 D` ` ``  s0"I`䀈`UD`%`"` `' ` 2`w `@D 2` ` @/0Z | 䀈3 ` "9``,@  耠@쀠   ` *``#@`=`%`> ("ba=``> (> ("ڒb㿀 `4`> ( f(8`0`(@@o"j ` '`"P9 f +@3`8+0@+@@8T(N@Θ a=( @$@ X  H7 P} '`"N @ b =f;  ;+ 83@(@;@D?ff $@*<  @( (D@,@f #`'#\K` "P|P `$ `%8f 8m lfP`(@  `2E `2@ > (> (#c> (> ("c> (#0c㿐 `@> 90 `(@` $$ 4`;`$ 0`?(?0`(`c@ @0`*`@@N@   &> 9b$ $ 0$``` 8`$ 8c``<``+`+` @ (`@@ (`@@ <``& "$ 0`㿀 < > 8c9 D@9 C "  0h2     K 2  ` `@" <  怤 "  4 &9 @ 9 @ > g   <@9 9 @D#\> (;`#@> W!@2 ( > @8 ك9 㿐   '>@;` v H@&'8'6.`(@@ ;` ] 逦{'  2@ "``d"` -㿘    $ y  H`z /㿘  `8   z @*    d  (8F,`H ?p` @۪ `2㿐"` ` "`( F`(bf F ` & `2 F&`d`&㿐"> B a>> `s& `~J  t   _ l `% %  % % % % % " `( Ғ@%f$@$ @$f,* f@`f, c [`L`H `Xf$@%u֐ >"DN% z % x(`@% z(% `29 > B> BbLܰ "  & ` d`2) >!|> a4`@!!|a4!!|!| dP`$2& `% &zU& 0@ M Đ&㿘 8?c( p8cS  L?0 ((` @0@@`> (֐#x 0 ((` @0@@`> ( Ð#`$ T0 ((` @0@@` > ( #` d  0(`0(@@@Ȱ   `0 ((` @0@@> )  㿈" Lf`/''''>pƒal` m` < 2 ܒ Lf`2,f> a4$`0+ d> P!X>  㿘 4` ``" l```   ` `` 2&@  ```2`0㿘"`;8cSh> )L(`,d`) &  (      ) + @ +` @  @  〠  i`&`&``_$$$ >`  0 >``>`   >`(  >`0 `- Z!`) Z `` @< y 8㿘 " "```` l` 㿘6`ޒ ` -b`L&`)` 4` | ``v`L&`@?? `’`K`&, ߒ ܒ `$$b($`$.  2` :`2` 4 :  `㿀 $`v b `  w  $}6 _`$`H `; Wb` @?@""$ $(?$?8$8`4 $$ $@"$ L$ ` X@"(@"$$ `-$( `Hx, ? 쭐x? @$'  (8|٘ x&''''>rc> ) H㿐 |` ?`N ѐ > c\   V `$`?@? `ڒ` '  $| &  wy`@? `ƒ` `` ߒ &bo`H ٺ   ,!h  '&0'``Hw'` , '` :` 4: , @?@!"$ $(?$?8$8`4 $$ $@!$ L$ ` X@!(@!$$ $(   `2$, `H, ? 뿐wQ' @$` d  (8{`ڐ,X Z` &b&``$` <&`&`(&`$'`'@'`0`'`$ '`('`,| `4:㿐 <`2``-   ``  ` 2;> )@ (@!$@!` @!,* @`, { @L`H$ X@!?{vO4 `( l P@ $N "Lf`#!@? ` 7    `:`  4`:  ,f $2V4Lf` $ 2V`:`g,f 4`: ,f`  DU   Z Y  ` x Z F @ &,?&(&&0&& 逤`4`"| x߀` "Lf0> ]`H ˒` !`& :"`:0 4`:,f. " $ $` `   ?!  $@@; Β!" $c" "@80 L`%  Z! Y@8 Z'" @8O&`c` :`/&> a4' 0/ W`̀  ?n @ @ @7 Ґ> )E x㿐> ca>0> ˒`  > lb!> Ē#\ "> )> ) > ̐ В` :#\a +> a$ @  `a$:  ! b `"d@7 !! `L``ڒ 0@f`0`  d ~#\  @@7 ?  #a$㿐    !> 7>#(!#\> )`ؒ > "D  > )`#\`   ` ``?㿘> 9aX <`> ) , ` " / `">"D>!&  L!( 㿘ԁ㿘 `M`? ` `? 㿐dz`%<?& 㬖 2B `$    $ `$ 3@1 > 9`@  4 1  d2@   첖  "'> 鍐# 0 `$  4   m > q# 2"&b   {0> I#0> )!H  @`(> 9a0 @>u`Ԑ㿐`      #\ h㿘 P`(@ `2   `"    ?    (0 㿀  ` (9 " @@P`( `(<` " i  >`0`#\ #` #l#d#h   Q0`L$ 0㿘  4` ` 0" ` @97` 2  縷 @`0`$֐㿘    Ȑ ``"  B  ͐  B`  `` 0d 値 0t$ސ` 0   e`0ϝ` d   `c  a@"  > &# `` `$`$``$`1  `4` 0  +  `0   $  2{`''''''`?0(c ?0(`@@,@ 7'܂ /` L` .``h  ./ ?(0 ?#(`0@ @@ '   /(`0`@`9 (`7` L`" .``2/ .>//`0 `#\ #`  #l#d#hܖ   2  P b &`419 鐐 "` `0` $ `0``$` > {#/`$` 2 `@ > )ؐ!h> )Ր!㿘   d 4` H ڐ`PP @= ΐ> )!  7 c* `0  @ԐE 00 ` %  5  " `0` %  >  #〤@ ހ@0/ "  `   ''  d``d2 P> )V! P  ѐ_ Y  P  ` 0ަ  ` ؀_ Y Ғ cx `0o` k <@ @ ѐ ` `` 0`  % "V  ``%  `0`%0 4`u D֐`` @=$` $@=m T S N M/  Ct@ @  `"   4    `"`> '"G`> 'Z      0 " ` ڒ ``"``@@` ` #%H@.뀤 Ϧ Β  > )@"` `" `଀"`` `<@` 4  `  `0`%``0`0(``i    ``'``` @N$`P I` d `_> )` Ɛ u 0mH> 'c 0` % :  H H`` 0`  #%0> )t!> ) < 04> )k"( P  B``zx }dW"U"H2`ސ 2   0 `$ $ > )?!Tt`>`00` `%` #`#\ #l#d#h    Вꀠ` > )? @@7 h / ??0`( '#\#`    #d#l#hk |㿘  ``      ( L  T D" H "+`P`$  "v    H` `@ (@ `$ H`Ր  `0А  " `P`$̀ ` "  @" =   @@ % % @ ``"  ` %  ` w0"   `"  {0 ?`4` ``"`P   v w ," 4`P`$2u  " 4 " 4 ```  Y 4" ,`$ ,  `P`$R`P` , 4泖  > : `P`$2< `    * " `4`  O z 2   p1 0 `$ `8  @0`P`$  `$@  .2g`4w ,@" % B 20 0(T% 2`PP 2g`P 㿐 U``"```$`` `` ``! ```@<```2X> $``$ `$ `o$ `$ `$ `$ `?(c0?(`(0@@@$ L< ``$ 0$ ,``$ 8$ 4`` $ @$ <` ` @ ($ H` `@ ($ H``d$ D4``$@P`8$ (``( 0$ T$ P4$``< X `a4 `($ (``( 0$ T$ P4$``< X $ (``( 0$ T$ P4$``< X   ` ` `4 > cଁ `4 > c㿘   ( > 9a0@ @`  L?3 ?+ ?  (0`#`(@@ `4@$@ N    "  ,@ :  2 ,㿘   @ @@ 8@  @@ * @ 㿘  ` > )" ``@> )"㿘  6 > )> )bȪ> ) c @:  (`"  $ƀ ( $   ,`@   $ (ƀ ( $ ,@ƀ@   ( ƀ > )ƀ#0`"1`2- -"`""  "D`   ! !   `K  @"J  !  `2 ` ! ɒ `"`"7 ` ";`#  ! !   `*#` @"?  ! #``  ``1"``@"#`#`   "!  !   ! "! #``  ``"``"#`#`    "! k#`""`2` "` `w`  "`2R"@ L` `2 "`"` ``R `@ "  `"` ``.  `y"``"`` "` `"` ``` `@ "  "` 2" "`"` ``F `@ "  `"` "" `2` !     `K! @"  !  `` "` `"` ``` `@ "  "` 2"0""" `2` !     `#`@"  #` `s"""㿘`M` 2 V` `2   "`""`@") "` @"(``9 `9 `""@"  `` ` ` ``2`@"``9 `9 `ݒ"```"`""`@""`"``㿘 3`, ,@?@8   `"  ,@? ` @ ?@ 4  `2 "`"`"` "`&& &   &`&`&`&`"   `, ,@"  8  2 , ` @*@ `4   2  `2  @2 0  @ `   2  `2  @2 0  @ `   `" `6  `2㿘> )cX    ƀ`` `< `:> ) Ւ? 2> )> )c`(`$`,@@ " ƀ ` ``" `$``(0`"* `,: ƀ  `a 2`(ƀ#ǐ 㿘 >߼"$> +"a8" " 㿘 >߰ > +"a" " " 㿘 >ߣ#> +"` " " " " 㿘 >ߔ"$> +"`" " 㿘$ ! > b?< @$ ,㿘 >w#> +a "" " "  ! @+Ӱ㿘<` a`2 0   2 "  2 > )> +#ŒaP㿘` > )> +#跒a㿘` n > +> )#覒a㿘` ] )a($,@`@"  0` @8  :  `2 > "  2> *> * `返%@> +> * @oah㿘>`> > *> * `觔#z㿘>a` $2 > ْ > +"`" " " > *> * `莔"㿘\`:d& @ 4@ 4@@J> `@M@ 1 @ && @ @ @ & @'> @@ @ @ &&@  ς> > *> * `0B ڈ @ ւ&ц> *> * `02 > > *> * ``* > > *> * `" 㿀@`'L'T'P\`dh> aa(@ $@0`*ۑ6*6֦*$@` `l  8`6 ```(`$`,#\#`#dK ဎ ``2`(`@>  > ?/> *> * `绔$`˱6 T P Lr ` LL  `TL@ L#  ? T@L @L#  i&T  @ > > *> * `焔$7> *$@8!㿀d` L %# -`@ ., @  (@ `%\ `$/ ( ( $ ,\ #\#`#d  \&& &@% \#\#`#d#h-`@  $ ,@8\#`#\#d \&& &@% 㿀 \`  > a`   `(`$`,#\#` #dn   2`( &`,`(`$ #@@ @ @8 & & >>^c#>>^c >>^c!`>>^c#>>^c"$㿀? @$I\ &1>) , ( $# #\#`#d  @# &  㿈`0> h" `@ &`"``#\d#d#`\@ `&@$ "` `@`> *"h> > *> * `PR!㿀dhl8@ @ d> bX> V> *@T> *p@2Q t@2M x U @G? P ( $ J ,@  @#~ = ( $ 7 ,@ 2*8`p#\#`t\#dc  @#ڰ> *> * `ޔ!q> > > *> * `Ԕ!n&  &8& 2& > > *> * `峔!m> * `孔!r۸`e!> !   _*   *m? , (" , @ 0*` 4@#@#` #` # #  ?#  !@ ! 2  ך  #l\#h#d#\#`#p#t    xd'P ?\` 8 $`@83@ 3% @ @ -!> !!,`!*,@*@P @?#\`#`#h#d#l#p#tĚ  P @ф% ժ#t#p#\#`#h#l #d P#d#\#`#h#l#p#t P#\#`#d#h#l#p#t 0˝x `  > a`@ #@  \#\#`# #l #h#t#p#dg 㿐    !> 7>#("$#\> *ܺc    #\>> *!`ܰcȒ    #\>> * ܦcؒ!   #\>> *#ܜc>#\#̒    > *ܒc> a>> + `    `, ,@"  8   2 ,` @* @ `4 㿀 \`@d` W `@!@ N {@O@> a`! \ @Ra@ E @@@,@* @ 2 d   d8  ( $ ,@@@ J "4 d80 `2 2 ( > a> > *> * `0 ڄ @€@@a@a @ (`@$s`@@π@2  ( $@ ,`8#\#`#d 2 @ !&@8&& > > *> + `㒔"B> > *> * `㊔ > > *> * ``ゔ & 㿘 >  !  D@;!  @0@ @` )>>,`&`6 `(@ "$@`@4 @, #>>@ "   b$@  > > +> + a3!㿘>  @& 6@@@&(` `$> +!  @ ( @ . #@  (`  # > > +> + a$> +Ⳑ"0ⱐ"P㿘>  @4 6@@4 .  "2> + "  `" >>b$   . `> +     (`   `$  > > +> + aⶔ$> +k"pi"g"㿘>  @ 6@@@(` > > +> + a⒔$Q> +G"㿘>  @` 6@@@(`.j@> > +> + ao$g> +$"㿘 @E @' 0B,  `!  @  ( @ + #@  (`  &  `" 2  , @&  $  ԉ(`@k瀤@ 㿘  b* sڔ &  8" "`"?& 㿘> (6+> +  @ @`$%> + ` &``"&@ &``"&@> > +> + aΔ#1ᄐ#႐#@㿘`D> +`> +c @ /`-``(@ U> +``$` 4`2` (`5 (H`` " ` @ &`@?ǒ` (&``$H`!@Ed``@"     @Fk ې@@MO` #h㿘> =@B'>@ `׆ -6@4* * u @@   * $` $`$`$` $`* $@ r b$` &`*$`$`@#ʒ >㬀$`$`$ ( 㬂$`(> > +> + a > > +> + a  K 㿘`>  `> + `> , t] b ?tV b1>."> +> , a! a0ݔ!㿘`C>  `F $ ( ( (? @ & $,& (  @( "(> , ` "> ,  @$& ,  (` "> , `"> ,`" @  @4 && N p> +> , aX!@>c''''''''''''''''''''''Ȁ ] ̨ ('' ( @ $$ (' $ `(  $$ $ ''  ` `@i$  $ :     +` (` @〦@` 4 "$@  (? @'' (Ƞ @'Ā 'Ȁ" (8> > +> , a$=㿐1> ,"   > ,> 7ac(#\ 3е㿘 ` < .``@@  + @ @ `  @&@ `8"#@ 8"#@ @ , @ @ ` @ 8 " "  @ `$]    ?Z2.`@(`@@, @@`7 @6&58#@!&@,8%% 2@`8#@!ډ, `@8'@'#@ʄ8%#@'@8 > ,!8> , !㿘`+&`"      I? @ ` & ꀦH-?㿘`& `&  `     @ 㿘 >  ! $  D@ @!@  06@@ @$  @`   ް .`.`s:"@ ;   * .  b"p  `ݰ r b bpr  .  r b?$ @$>  * $*  &* ,`@!0 $*y  * @!$$`  *j *  @! ;$ &@>?(`%@@ `$$ qɒ b? bq°  8$ &( &@+(? @ @ `$  > > +> , ah<!,> > +> , a4!- @<  (` %@2   ( "> +> , a!}㿘`D`|@` > ` ! @Ѥ!@ 1>`9"貒 d7..re"@f  * &`&`&` &` &`* &@ o b &` D@&`&` #    @ @(`!`"`` ``!``(` ``&``  `@" @ U*`b' (S H$ @$ D>$ H㬈㬀&`$`$ (&`( 㬁P> `$` '0@ `(+' (@ @ ,T:@( @@7(H>  $'@( $ '$ @ $ D H$ H $  @"2[? H `" ' `$`  H@$ H&@8 ${"> > +> , ah."_> > +> , a&">> +> , a"A " 4` `" ( (H`@! 4" 4㿘  @`d & 㿘  @ $ " " @`Q  (& H` >Bc\>>b$ @A > ,u"8㿘 "#  4` `"% ( 4`I$ $ 4`3>  `61>#~ 2  `> ap`4 p` (H`` >>b$ @;10> ,> , b`k > ,> , b`d > > ,> , b`\ |> > ,> , b`T 㿘> Ҋ#  "" " 㿐> 7c(1>#\#    > ,Lb> b 86`@>`# `" @㿘  >`(`@>` @   @2 @2 >  @ t@`"@ `&@" : 㿐> `  X   !> 7> #( t#\> ,b> #\!8> , (b   㿘> a```.,0 > B#`Z>  `  ` `!#?` `%   @$5, : !8! c  @& ` & `)> B`4 ? > ٰ> B@5ݒcl!> B@ߐ#> B㜈㜀&  $ & $@#mE c & > ,4#>  !8ѳ " " > ,(#> ,%#h> ,"#0㿘 `<  `@.` @ @/@ 0`(`@` `  `"   `"    ? "" > q t" > ,#> ,ِ#؀Ȱ > > -> - `8!S㿘  @^~ 㿘`X 3> a` (@ 8`` .q> -` />>`@9a@8`D  (``"  .` (  4> -ڐ `$b 4 4`"B 0T  (H`` " a8`@d" 4> -e 3> a` `8(@F 88`8 @   > -ى H `(@8``2$@ @>` > -` ` > - ` 0`$@ ` ;+ 83@(@@K@9㿘 `& !> B@# " $ $ $ $? & & $@o#> > -#>>a    ( (`=b$H`` "     ( @44 c >  a, @  @]y `p$`p   cmb1> ;!8@  ;+ 83@(@@Ԑ@8 ` * > > `t .`@`"` "@, @`  @]= p $p@  `@2.` cm1> !8T@㿐d'X @ y>     aH`` &`>  8`@D@7 " (`܆ (X ">  %   `` 5<`@;,@`X @>I  ֆ (H` H` @  (' , 8(@4@@`@$ ɂ (`@`  '> -> - > `  !` > @!8`D2`X@􀠠"` <,84(@@@7  ( (`2) (H`` &Ð@6  (  @= @DH`` "  (H` @ 2`` `@A/`@`@; (H` >BD@f&@dg   ( (`"?@ZŒ  (H` @7 `(`@`㿀> b .@' 8'#`#d#\|   @[ (H` >Bc\@<` 㿘'> B@L> Bc`a Ȑ@# "``@4;` `, 4  @ ;` 4`@` `+֢  2 @`"?  @$ ` *` ` ݃+ `@@` ?0@Ґ#` F@Ȱ  `"  㿘  H\`  0 D @ٰ  > ](`L(`    83 &@@` 0-> ``8`@@D,`2@"@?`L>>@   D@  `D@  > -@C 㿘 `A `6>  `2%> B> -a & "  `) `>  `> -@Q ``    ? @ & & @  jX> -> - `Ж!& y㿘 > ](`L(`   >ua>ua< 1> F?!8`5> B> -9> Ba0@# 2 0  @2  `;`& "t 0@Ő  hU @ې#2> B > B@2@i 0ːc@0 & & #> B& `#㤂   & @`@&  `@&  ` > B& @# 㿘  > `1> -`$` !@@E'   !@'@ `ܰ `$`܁㿘 `@>`0``> ` @" @> -> - a@`"!> `4`)@8#`㿘 ې` 3> -'@a@3> -'@“a@㿘 & &  `  @  $<> - %a@@'Y  @i (   $  *&  H`"$  0 &     $`ܐ@Ŕ'[  @C ܐ   & >b 㿐 `W @8>  $@ > > -> - a@Ւ&@ Q#>>@<%> a@ 0 @89>  $@ X $@8 X@  $@('> > -> - a@8`&`@@3s @:,@a> > -> - a@E&> -> - a@ >&> -!㿘&Ƣ3> -@7a@a@@&㿘> a$`>`0`ऄ > -> -bxh> -->B7b`! (H`` Ђ`$ fO "  U  "     @9 @ g`$    4`" ( 2 (   @9̘ @  `$@`n`(`*`(H` `(` J4D@@8     " 0#׆`( ܖȐ`@@l$0 ϔ ބ `0`਄W ਀( @V&?@3%& ˄  Ą >>b$  2Ԅ `$Ԓ  > > -> - a@@!㾰> aa`.@! '''Є'H'L`?'(','0'4'@+ ``rH L 'L X (@ `?'<'L H`"  0L2X 0`S Dz'H@  \(( @ > . t> .t@>   "@0@8  $. @ "@0@@  @ '@    @% : \`ˀY 'D  P'$5>>@ ?$ > =Ѐ"$`P?O$ "  4`2  (`!2 @7r>  >>`  8@!$`X @? ? 0> D`"%'쀧`""'@` LL @#\#`ПP 뀢 $L$ 'D   r _,`@  耢 2> -`4`L`>  `>  `     @8 2pVa> ph#`FD> > -`#@> L8 ` #>> " " (`2  4`2 0`Wb$`@  8 > ! %`@.C 8@DĀ > . $.     `H` Ԑ > L`s ܔ   `H` > -@>u"ސ>#h @ @6ِ> `' @H`8  ?\L% #`@ @C #d#\P`'쀤< @? 1>> `0> ?8 (` "'@6#> ` H@ 8!@? @ (H` ɶL 2 > `  >><@L`8)   'C> ph45> > -@=͐#L`7쀠L` H0`` >>0` ` > !!`!!H`24`ئ(>><@L8(  *,(`H`$H > a`p`h> > .@=r h_Lu  `Z   @6y @/>>b$ "4 4 `(H/`( @5?$$``(H`@!`(H`    В   &> .֢   8 `? + @6 > 쀢? (`@4(H` O > ph`43 > 2> > .` X@< LL`̐ &?> `@/ `>> (` (H` @4'H  @"@ (> -c"?0? '@.ܒ`(H`  "@ @햖  $ > > -> - a@8Ѐ# S@4g(JH`$HВ  > > -> - a@["J > !! `!!  0 `  > `  '@H8  `\ @?@LC `  @#`#\#d  倢 >  "P> . L   @5 b@.C(H`$>>b$  (` ( (H`    @6 @6' b$ , J@3В  > ! ̂`! ́ K> -> - a@Ϭ$ (` (H` @3В > > .` @;v cLې> -@;m#ZL@2`(H` xР * &  @쳒"@ Д   (`"@3=(H` L v`> > -> - a@3%:Ð0@2H(H`$> a`  ;; '4'04H(_λ (8+ ;(@'03@@'4> -> - a@&n> > -> - a@&> > -> - a@%> > -> - a@۔$㿘@ #>   a  `9 0  `9 8  `9   `9 ( > a```( ; P> b܀```2`㿐>>a>B#  > @,  > .> . `y!> > .>  `q!㿘@ > B& !Lc@6&!L㿘\@ &` @+@&` @%> b8 @ @ >a 㿘> a`8@@@" Y `$.@3@@L> Bc@> b8 @ @   1@㿀> a`'T8@@@/ `  (%`7%-> c +>>Ā@  RT`` a@,@  `  ;)> B#ؒ@ "` > a'',> ccĂc` #\#` @.R 5쀠 '>B! ? @ 8ㄐ >   'T @T&@@ @ @@#ؒ@B` > > .> . `i!㿘%> B ش> b@ '> . h@ _ؔ@`8@ ؒ@  j㿐> a1(>*@/ b<@@G@i^ƺ@6,@ T> Bc $  H@> 6c $  H@z> .ː 㿈`i` @a =c^( @7> (` P8@@@@@> . `-> B=:> a`4 (@80 @h ꀦ $81@ؒ@ ͔ ؔ   '@'ؒ@  @̒  $Ԣ  㿈N`5N `@> N`R'쀦$'>Bc'>>#> @ a@* F""  a'@@- @@ N`2@#@ &$$@|>)ސ#0>B@Ȑ#@@N`> .!> b@8@ @>aX @㿀-> `(@'??c'N` N@?c> N` `> .N  @ (,` @> . `N ` ݖ @`@ '#\#`@  2N`쀤 &>B)>>c'>B 8@' N`! 8@' t> N` `"N @)> @## `N `5> . a`/ h  `"N (` '@$ >`0 `    #>)#@#@,  @#@, N N`?   2@`@ #\#`@+ , 0> > .> . a0P:#b> .> . a03#> .> . a0h,#> . a0x&#> .> . a0#㿘#> a@?!> @^##   $ (@@5 `@)@.> Bacؒ@ @)㿐>B%>>c!> @@ !@( " > .@)!@ʇ!P>) > ܤc#/> B-> ;@ p$$@ߐ @ $$@ϐ''''''''''''''''  $#\#` ??@  8,```@Ő ,`@`(@ ``$@0$@`,`` ``@@ `@   > . $$@h@Հ'>>)> .#ܖ>cȒ 㿈>  #@N >>a> 80`@8`@% 8@  @4h% _((% %  9> c# -> B!c % ,`@ @` b"% > O" @4` , '#\#` ?@? 4!,`@ @ `@$@-?' @8` @% % 㿈>Bc􀠀#>  $b @ (@@ > cP'> .b8h'#\#`@ 2 > > .> . a0v"q c  ?>`<?㿈>Bc􀠀 > > bc'@'#\*#`??@~ "> > .> . a0E"R >a( >a( 㿈>Bc􀠀g)> !>  cP@h(@c''#\#`?@L? E > Bc؀` ;"> > .0bH'>>H`  8  !@8`&@D`h @- ݆ (`D@4̐`2h&@ z @s&  > > .> . a0Ɣ!㿐#> .a0@͔!> b  @ 8 ' '@@ Da0@!ߐ@Ē 㿘> Bcl` 3 -> > .bx@&” ";`(`"&`(H`` "h 8`@d @ D ېג <, 84@(@@H@'8` <, 84@(@@7 p%pЙ8> > .> . a0X8!㿐E`c'\c'> b#`(@#\ ?@M? %> .@&@@ @@@&@@4 > .@@@֖ 2@> .dz"DZ"ǯ"㿈>' > !>  c @e >Bc$ 䀠 Ec'&#\#` ?@? > .> B c؁DŽ#㿀>Bc􀠀h ` +>  a'*(@c##\#`?@՚?  ~`   > Bc  @'쀏 ' 2  ץ6ph6    2`\`d#\#`@( RH%>>0'>B `? @'@'`@%֘ `(H` ``8 @ a@@9 D@`'@`8@ a@2쀠` >  @Ű > .> . a0!> > .> . a0H!k> > .> . a0 !h   @ 8 ( $ ,@@@   2  ,d@*   d@*㿘 0    d2& d`HH"`$  @ `X`X``LL`PP`TT`\\݀"`D`00`8` 8#@@<@`D`"D@` D` @``?㿘 s & H`  @  $@@   "`  P` P> a 4 `@C>) 8 "  (@* ( @ 5 (@:" , 0@   4@* L `<  ` @  @  @: 0 L  @*  @: c@* 8 `$`(@@> a ( :  `@2  8>)c@ q 8`" L@@ _`@:( L` @@ G`@:( `<`@@:(`@" 0@:( 4@:( (@ ,@ @ Ј 0@(`@ (`@ (`,`(`$ (  ,  `0  `4 ?  `" 㿘``":` `26`8 "@ `"-$ @"Z`$`  $$ i`i$ @" $[$  "`U``2`  ` $` $ `" ` "G `  "I@   $ $ $ 2`8$`@" $$$`` "```$@ ```<&``@" $ $`  &$ $ n&`$  ` `&` " $$` "&&㿘"  `2`  "` `g` $ " `2& @@% `2$  &` &@$ ``&`@" &&` "@@` `x  `"` `"`` $ &` `&` `i``$ `@" &`A$" `2#` &  $ $ L `& @" $ >& "@8@` $ &`  `&@ `)``;$ `@" &`$   "2& $ &` &`$ ``&`@" &&` "q`m`Z&&&" `2p`   $$  ؐ `& @" $ & "``M &&&`$&`$&㿘@"G`` 2R``2   $`" &@@"$@$` @"@<`< ` " &@""" @` ` ` x  `` $`"&@@"$@$`]ꀤ` 㿘 ) ` `"  @?@@  `2 &`&`&@ &` &"" 3 &`&`&@&` &   ` `  "  @ (@  2   2`2 @2 0  @ ` 㿘 @ $@@ @"&  2  `$ (,@L@   8H  2  `2  @20 @ `   `" `6 `2㿘> a  $& <ɐ& L 瀈" >0a$  `>` 㿘 ` X}X ` >a 㿘 `  `   Wْ @`?  `$  `>aH  `>` 㿘 > 3 a  W "  &  ʖ   `& 㿘 `@2 >)c@B 8 L>  6?@I>  $ @ !`@   8 L@? & @ ( $ ,@@@ *&r &0> /> / `l#.> /> / `e#8㿐'> /@`>>> ah@_`` @@Q  B'' l ]`5  "s $ ( $@d  ,! $ (@@( 0 ,@  0(2' 4@-  @8@@* (! ' ” @8@` @ @@ '  ֤ &@?{>>> a@ @' 2   N?'㿘 `@6>  x | -@ ) @ @@`@@ ` &@ > b6@> @  Ոن> /> / ` z!㿈 `  @   @  $> /`h/ \   H`ڀ`"  $> /`Ӏ`> / $  ( ,@> /\ 8 H q  m ?  ''HD` 0`d`"c$> B䀠`"^$@ $@@'e$@ c>  _ "J@k (j 4> /! #쀠` P`H`@8% @`C @C @ "  > / > /0]$ʨȨ`4% 4 0`>  ܅$@ `$> @"$ ` c > / 4`>  0` (@2  `> > /> > /` L> / =>>$@ @#Ȑ> > > /> / `@d/j > /> > / QY㿘 t> b1<*.㿘 > /ƀ! ";> /> /ƀ"`3> /ƀ"  @? (` > /"8ƀ> / bH@F `ƀ` @˒  ƀ@5 `@꼒  > ƀ Ёƀ"ɀ`㿐> /ƀ"P 8 ( , 0#\ > /> 3"`ƀ    4> /ƀ"> /ƀ"Ȓ @> /ƀ"`@ (@7 ":> /> /ƀ#> 0ƀ @"1  ` @@"P> /> /ƀ# (@8 > =X> 0ƀ @`> 0`ր2@> 0ƀ ƀ#؁`> /ƀ#P`@?  > /@ > /ƀ#h (> ̲cP> /ƀ# (> IJc`ƀ#0 (x>  $ c<@' > 0ƀ p ( ,> 0ƀ  0 4> 0ƀ     > 0ƀ > 0`4ƀ! `@+`2C  8> 0bs> 0b   <d``  L> 0Zb@ > 3 X \ P T> 0ƀ! ` d> 0ƀ!P p t> 0ƀ!p x |> 0ƀ!`" 8 ? > 0> 0a> 0> 0b(`> 0> 0bx D 8  0#` @#d#\ƀ T H L P#\ X#` \@?@?#d@? TT ƀ`T H $` ( ,@? @?  `TTƀ dƀ H`@? ƀ`T````@ƀ 2 DZ 80 㿐> > lcP8> ! \a8 \! \ h2 \    !> 7>*#( #\> 0b#>) hc   #\> 0bؒ h   #\>*> 0!lbc(ص㿘@ H`   X2` `"s L$ Xf'> /'`'  H`   $@  LZH >'ݔ'`@> 0Ր"` ` `$`X`M&`X'@2`H` H`   $ X$ X2 H`42 H`'' ` 0`   X''`@   $0'ށ'> /'K '`ޒŔ'㿘@2 `X0`X``H`` `$&`X㿘 `u9> /( `D`` H`` `+ ? G>  X`  H` $ @@r 2 X> a7@H @/ (B  (<  ϒ?  $  H` (   φa?  $  > > /> 0 `(㿘 ```Ho&,(@> P\> &P \ PHp@ > 7cP> 3 @}ba1>*)!lcP> 3 @}Wa1>)#䁈g> 㿘`X`" H: `>Bc􀠀22>   &@@" 0` " $ @4` `$&`X H>Bc2>  @% $> Bc  $ 0""@ H$ 0$ H> /> . `&> /> . `&㿘> a* @@ܐ">{ڒ㿘 @ F`> 'bȀ> Bc؀i> 7cP> 3 @|Œa>)#䀢 $* `Ho&(@> cP\ #> aP$\` PHp@ * ` 7t`"" " g> a> .> .c> /x 6> 0a@~ h  h &a@u h ?`h. .  @@(`$> l> B!8c耢 > 0ߐ#hcP> 3 @|^a>*!l * `#8㿈 ( $'H\`ds ,3> a @ @>$ @ 8?@0{0  @[$@ @u  a$@ `r > 0$ #`G`2n @2d  2 ,&H @ ʒ`z  @&* @& @8^ @* @8 q@ 3> a܂À  > 1  H< @> 1 3  C?ߐ#@@䪐zդa> 1  > 0#@> 0# ( $ ,@ @j @ @  @0$@ @$@$@ @J@ ( $@@@?> 1 #\#d#`T 㿈\`d `<#\#`#d#h;    L#\#`#d#h*  㿘 ` !@ 7t`&@&`&`O-  > 1X!X㿀@7t`Ѐ> 1`"`> 1I!p@> 1 `  U 2`,O  #`#\ ` #d $`$#h (`(#l ,> 1#p$!㿘H@ ` > Q2!>  `  ```@H&HN͐  > /> 1 `0<!> /> 1 `p5!㿘? 9D ,7 `"  $"  , `, (@@I$`,$ ` $ ` @&`㿘H`>  `` ```@H`&HNa `> /> 1 `Д!㿘`  `H`3`)> +>) @ 9``2/`$QH$@" ," " $" (" 0" 8" <" H" P" L" T" X" \" @" D2 ``(`,@"&` ̔`,` !`(@`$&`(j "  n!&("&`(&`(`@2`,c逤 `,@ @&`,> > /> 1 `>㿘?ː  ( $ " ,`D 2 (㿘\& (& ,& 0& 4߁㿐 `@8 x t | @*> b22@2  (@ " ,#\> 1#@@  0@  4@ > > /> / `WԖ 㿘 `@: ` .> a7>) *  2  ," $ " $ , $ (@*.,`* $ @8&`aԴ&Z> > /> 1 `P $  >c 㿘> `@A"  @D   & $& & & 8& <& @& D& H& L& & ,& (& 4& 0& & &  > 1Lǒc@>`& H ` Ȑ ` M @ > 1#L > > /> 1 `x6(> > /> 1 `.(㿘  H P"㿘`@& AB `& P@@@㿘 >*<  ۰㿘;   ( $ ,` @@@"`$T 1` `$`(`,ΐn&``&` & Y &&% ` `$@ђ "`(&㿘\$(,> C$`8$`<$`H$`X$`@$`D$` $`$$`($`,#&`(&`,uŐ&&@ @$` @`(`$@ ƒ&``&` $㿈 ''u C\#\ 7 @ H H \ 0 8 L P T> @ D& 0> 8& L& P& T& \`& H @ $ > `b" 2 6 @& @ H 0`  8@> 8`> 2 (㿐 $#\#`"   HD` " H`2X`"%H   Ț DX`  H`2  H $` @ @&` H`" h"PH2 HP`&H $ & h`" H>B Lcl@  $  H>BLcl $ H&H㿐H`% $ #\#`" 9  H` ` $` @ @&` H`" $ h & h   T  㿘> bw> 2`  > `(`$`,@@* > /> 2 `M)j>ݒ ` ` s4 @`$:*`,D&`$& &`,&`(`&`@@0`H`2` `& 8@>8`,`)z#&$&(`$`(&H&8@&< @&X&,& &D&@&@ @&`(&`,"`,0`" 8``"8@8@>8 `㿘֐u%` @ `(`$`,@@*  > > /> 2 `Ŗa @ r ĴP㿘` @ `,`(`$ > > /> 2 `8 4㿘@ @* `$  @   `$ @ /1> / ` k "*  $@ ,@:'>  @w $ \k      $ $ \/ ; > 2  9/㿘@ @* `$  @   `$ @ .1> /" `   $@ ,@:*>  @! "    $ $ T 2  . 6$ T߀ > 2  ڔ.㿐 $@ @  @ .T #> /Ӓ`G "#'`,`$@@:F> ` @` D> `$ `" ` @"`$ `.h `.hߔ@ `0``D`2``H` 2``"`H `0 8 < `$ > 2` m.W> 2` @g.X㿘> b8@mt   p  $8l  ``h> / @ $V H`2S  "   > X H`C  $  , (@@@8 9 2   $;`@`X`"  X`,`$@:}> ` a X`  (>  $ IG `  `> /(^ߒ``(  ">> G`2  X`,`$@8> ` 8( X`  (:>  $*ӐS00> > /> 0 `( X X> /> 2 `X(@> /> 2 `h(f> /> 2 `h(M> /> 2 `(m> /> 2 `z(T㿘 @  @* $ @  @   $ +s'> /d N $@| }  (  $  H` `j  P@e K 2  c G)>B@"r P ,@q@Y d "R$ L L$ P$ L"  H`@? #l X`2$ X#l  $@ ` X@    $   2    $ H`  L@2 ,0+ư ݔ >  $:  @2 ,0> > 2 +> 2 +㿐 @ $ @` `^> 7cP> 3 @sa ꁒ $`V`,@:i> ` @``?'` :`?5'` 1`$@ 7s`H` ꀦ` `@"`H`0`"'`H`H``$`   @ & E`2` cP> 3 @ra Bs0Ȁ` h` `$c$& h0`> /> 2 ` '㿐 `&   $  '['@ ` D\ @  > > /> 2 `.㿘 @> a"   0``" @ #   ? $ $  $ D   $ ` @"g2 H`ـ` 0  &   ? $ $  2 D㿐`*@  P@* > > /> 2 `!> /% 'Q'Ù@&@B  s > > /> 2 `kp+> a`@@@:  '䀦@ ' $@8 /V-> /Y C & $@+(,@H`0@( H ( ,@   H` > 2 $ /͐7  H`  @  H% /> B @ H`   H` ג/> Bؒ/>>aha` @@&#\#`#d 29& @(2 7> B @+  H`!@ &@ $@؂ ""@#\@#`e ؀`@  P" L쿐 2  ؒ혔/~ؖ    ؝㿐'> /횔- $     (`Xms X-& h''` ? 2  .!셐 '  $ H`0` `0> 2 T`뀠` T`Oa 2 .;7.W `T`> 2"`"㿐 `2  8 D @ G> 2 86 & 8 <1`$ <`  L* & L' $'$  $  '1  ! !  '   ! !  '   `2D  @&"㿘 P`& P T`Ȑ1>* 㿐> a@Q @T> @'' P`   & @ϐ  T`ז,V1> /줒    $$    X @, ( 2$ > a $ $ $ p,{@{ > > /> 2 `g,9> /> 2 `0`,;㿐> b@ > > /> 2 `O&j#> /`''V&l  `7&nW 㿘`D`2%$#Ðk($>`(&`$'&& @&  @ "ْ 㿘s 3  `D`" D`  20 2߲0ݝp 'P`\8`> 7cP > 3@oAaЀ?9>>> ah@`'䀤 z@> ''쀎(?s' `@ ,4 ` @" > 7cPϐ > 3@o aЀ?>>>>>  '8` @4 ` @ _> /$V  '@E'@> m> / `@ >)c<" 냚 x   `@  @>)@U Pg '@ ''䀠`w?"u@@ >  `@    >  "<  8`7#\#`#d#hf  `@> / 8#\#`#h#dO  > / &' > /ϔ$  `@#`#\#d q `@> /#d#\#`˘ > /Y ?_@#\  0<`8$`L$`PP$`0$`X0`4 $`T$`\Pu`H`$`H26`H$`@ >  (@ $`D`  @@ & P @ h@뢐& h}> / `@zIt> /$`H $`H2@P U> Bc@  "P`@ @" > > /> 2 `$$ WK@> /#$'``H`$`H> > /> 2 `#> > /> * ``#@ [ > > 3 X$> /> > 3` x$i> /> > 3` $v  ` `    @ (@  2 hhH$h8"" " " " " " " " " $" (" ,> b܀$ > B," `85| `2 "> ,b21 (@`逈``22,> " , l " l@"  " " (" " " " $#: `2 X=c'`7  ( - >c=> Bcc5> a `'l  \ X@@`_؀ ֒ d$ `@* $ T> a \'k  X `@`_  d$ \@֑* $ P> a X'kؘ  \ `@`_  d$ X@Ժ* $ L> 6c > !Tb-b% >* b0b 0\ #\@8㿐> a4@f  > > Bb |0@8`q=> b' 0 (*` H1` ``g`2`X"``` @) ` 2H1*` j #>*b0jܐ'\> 3b04 a$b0 (jА"j̐@4` $ 2>`0 (`@  `) @+`+`)  )  @(@ (` (@0` # `  2u> `8|`80h4P㿐`` > a 9  @ @` "@@@h]'@@H\4`~\`j\@9? "\`Z ( /  @@ @@#\#` 8!> 3$Vג!``K H  6(n@!糔$a@@W  lc`??  A@ S@??  / ( @ @9  @>`\ !s$t``|`? ҍ  \? |? | o4``    @  @@ (@F&@㿘   쮰 㿘@` D   `d   #㿘> @b`8@@$`@@8 Dk  @    㿘> @a `8@&@$`  @@8  6@ H @@ #D6  @ c 2 0 > @b``8! @8 * >X >`  >`   >`x`@?&` # ` `" > b8"@@8 @   @? >`  > @b``8!@ 8  >a `@`` > b8"@@8 @  >` 㿐> @b`8$" @ 8  >@c8  "#> 3a6 a"   'I'aߔ"  @`' `@ `` f`c` ` ? Z (hW`U> aM8@@L  @G8@D@>@c@<'9A5     ``    h (@@c =@ #\;` `d#h#ln `&`&` &`  @ `d@ @  ` V` ` &` ߰ װ #\`('`4`=`1`ϰ $`"$  `` `2`   "`2`2` 2` ```  2` "` ?۠`|@aw` 2(` 4D   Ā ``bY 2` `"Ĭ`"` u &`       㿐-> @@ ``(@@?20@x   8 pؤ  g> 3 ܒa䶐4 P > 3 @( H`@ ; $@ `"9> 3`  4@8 H`= 0 > 3` 4 @ ,@  @ R' @O> 3 H`^@> 3> > 3a  ] > 3a!+` 9  D0@Ҡ  ,  @Ñ$@ ` ,L`` `8$@@C @U ق ,> 3aޔ!+`ǔc<9x  > 3> > 3a  > > 3a 8 㿐@`' `@`* ` `@ `%( P `"` w &􀠠  ` u'?`? g'" "" " 㿘 9> @Ҕ "> `(` 2> @ p!@8`D䀤@ 2`(> > 3>  bh > 3> 3 bhx @> a`f; ; + 83@(@;@ #y '  @@ `#\  #`#d w`J "a> (` d @%/ @S> (` X> 3@" (H`  /   @'`  @` `` '`@ @> 8`d&(@@8E2'(' > 3> 3 bhՔ ]> > 3> 3 bh͔ ^`"1`2- -"`""  "D`   ! !   `K  @"J  !  `2 ` ! ɒ `" `"7 ` ";` #  ! !   `*#` @"?  ! #` `  ``1"``@"#`#`    "!  !   ! "! #` ` ``"``"#`#`    "! k#` "" `2` "` `w`  "`2R"@ L` `2  "`"` ``R `@ "  `"` ` `.   `y"``"`` "` `"` ``` `@ "  "` 2" "`"` ``F `@ "  ` "` "" `2` !     `K! @"  !  `` "`  `"` ``` `@ "  "` 2"0""" `2` !     `#`@"  #` ` s """㿘`M` 2 V` `2   "`""`@") "`  @"(``9 `9 `""@"  ``  ` ` ``2`@"``9 `9 `ݒ"` ``"`""`@""`"` ` 2  `2  @2 0  @ `   2  `2  @2 0  @ `   `" `6  `2 ` ?   @8 00㿘    "ڐ   㿘  Ȑ &  㿘  $ + `"   `2 &`&` &` &` && & Z &`&` &`&`$O > Bc >* b@1 @8` * *  @@ @  ?  1 @8`?`# "@㿐> b6հ ? * * >* b@) ) H ?u㿘`(H` >>c>  b> Bc10 >* bH@` ` @  2@㿘> &  & ' (`AH`@!` A ( (``(  (H``!  A` > > 3> 3 bM > > 3> 3 b E 㿘 ( 4  (H`  (   (H`@#@    ,& & , (> "a"    ? @& ?&H`@(#@> a $  ("" 0 }"    ? @&& H`@(#@ $  0`" & 0 $  ` @& H`@(#@H`@(#@ (H`?b! @   $@> Bc> xq ( `=> H`@(#@  @& "    ? @& ?&> cTU> cdx> c\> > 3> 3 b0D$> > 3> 3 bP< > 3> 3 bp5$3㿘> Bc m> ctk>*,`,`@#@ ` @@ ? E:> + )+ &   `! @ F" :㘃?> + (@&+  @@ ?  A@ "c  (`(` ?]Д  @ 0ׂ#@ @` `,** @@ !蘃?< > 3v#@ "c  (`(` ?]  @ 0> 3_#> + (+ & `"@ 퀤@ "c  (`(` ?]|  @  㿘> /#` #`  (@#`@#`#`> 3#@ U@㿘@\<`?@@4@`D 09> ! > 45  !*@  .@ɦ_'`67'\266@`2@ ` > > 3> 4 b#> > 3> 4 b8 #> > 3> 4 b`#㿈'> B> 4  `>*> 4b@       #\   ;` Ӑ@ > 4ː!81> 4ȑ!H@"@㿘!> !`Ӧ> 4+> Bc  8>*b@  (` 2`.2  `?c`b@  w.` o 2, ,  @@$@$`$` U$` $`c`%c `? w> Bcؤ$, , D@ d! .  " 8" @" D" H" L 1@*`@8` m (H`b  " 0` P@!>* b@&* &* @>*b@,,@@$`$`c`%c, ,  @@.`.` @@ \ @? \ @?$@> 4"81> 4"x>*  _b@> 4!  > 4 !1> 4"!> 4!X > 4"㿐'> B)> `!1> l%> l)`!@D!@ (@> 4`> l@( @#>B c !> 4w"А!@@f֒D`!@D@8@@$D&!@ $> 4e#㿘>  cP cP```'` '`'`'`@d'`@/> B`> 4 >* bD   @  +> aa`P@(@* * @ `U>*b@b@``  I $,`,`$ `?((@  @ `8 @@ `D H@ `L?1 `? `$ P@a??? * "@* @@ %   @ > 4$@ِ#X> l@> l(@&D> (#&@@d< > Bc '`( $($T $L  $,$\  $`$X$P'`$#(㿘 (H` >>b 0`2` (> #a"V    ? @" ? ("H`(!> a`#` (  ` `#`  0`" 0",    ? @""  (H`(!`#`"    ? @" ?"> cT> cd> c\㿘`5>  a'>>-D$  (@2,`@  ?8` (`` 2  (H` `@ bѐ ( ;0σ+ 8(@3@@0Ɔ (H` ^ ` ("$ 0 W`    ( @?" "H`(!>   0` ( (5 > P  @?"" ""  H`@!> > ` "P"    > d> P > \㿘 (#"i     ( @?& &H`(!>   (? 0`I :&> cP`& ` ` (H`@$> >B\`  (`>Bc H`$> cP` & `  ` > cT> > 3> 4 b+% 0`#" 0"> P> " ! ` ( H`@!>   㿈   > > 3> 4 b#> a 88  > > 3> 4 b#> > `> a4  8b k9  <b8` 4`> k@  @8` 4J D@ 2 (`" ,` " ( ,4  ( >`0> `%>  @?`'#\#`'     @    > `5> 3> 4 b#b۰   D `8` 8`B > `#    @ > 8>  @  Đ (b! (H``I! H`!> > 3> 3 b0%#㿈''[> a`@(@ 0#\#`  `>  `? '@'`7i `',@E  '`0`(H``H `(b > @`'@> 3> 3 b0Ô#> 5x 㿈> c> cĂcĤ`.0@''#\  #`N  B" 0 (H``H  (b( 0>  ? @"" .  @ D    (" 0H``H  (b  '> > 3> 3 b0Z#a㿘  ` (`N   (H`    ,& & ,`! , (`> & ,& `  (H``  ` > > 3> 3 b  > > 3> 3 b  > > 3> 3 bP 㿘> 7cP> 5 @Zka>Ԃa1> $ @`7#> $ cP`d`H$ $`d `d_u#@` 㿘.!+>  a`  />B->B  "P ( (`2@@7 (H`   \ ޴@D@(H`` _' (@@͆ (H` `@ " (  `" (`  ; + 83@(@@㿈'X X`` `#\;`@& `?@ L``? J`" r`pJ d@`68! ` 9 `(@( ` `ဥ`?@o'@ &  @$`? ` 2'@0'`0> a``  `` 8@ nҀ ɔ` `$) 0 8 (@@'@  & } @2`0㿘3>+aL 8  2> > 5> 5 `8 ձ0` #!>+@^!@8`$ (@(aL^"&`"@^!@!@@^&`> Bc5F> > 5> 5 `Xo > > 5> 5 `xg 㿘> b.@>B@c#㿘` >  `> Bc &> 5> 5 `D > 5> 5 `= 㿘)>+@^!@>+?aL>`0> > 5 !@P`@ `"`@`@# 8`)   8`@2` '  _߀@@` `@  D@@ 8`2ݠ  (@@!@@^$`@, @!@@^ 㿘+> a`@?.@@@D  /`-2> (`'->B  0'>>@!> (` 8@ a@c, > 5> 5 `! > 5> 5 `! > > 5> 5 `!㿘>+.!L >+@]!@> > CcP `` `` `d@` @ 2㿀 'X`X` @?耠@4?耠@> `` ;; :`4&  ` ;-`  &'  + `/>>>  8`@D`@```'>  @@e䀠`X2 `(@` 쀈`` ` `N`(H``!`(` Ո`(H``! $@ `2 ?&@`D&(` @H`` !$@@>B@ `(H`!0(S & &+ 83@(@;?@ + 83@(@F@%@!?@#> !?㿐>  8a> c<@' 8@8@(``#Ƣ`> 7cP > 5@V̒a 0d  00```  H,ư,   @ HԒ@ (2$l   / 9>B97>B@@ " `B (`@} %#\@D@(H`` (H`  . " ( ̀` @"Ȁ`> > 5> 5 `(ߔ#@ ( (`@" #\H``  ֤O`"  0`  "> 5(> !@@ > 5 4"Y 0W@@`> > 5> 5 `H#Qg*!x> > 5> 5 `##㿘> a`` 8@@K *`,`$`<$`<`< @>, $`@ $`@@6 $`H㿘>`0`> > ΦPa> $L`@ PH+@[` 2 $` ]( ` $`$d@[tP  0@"   8  8@ %  Hod4 (@e @Hp@@[m ,@Z@[G0㿘>`0> ` 3> @[Wch> #Z1> ch" \ݕ"> 5!> 'b3> 8@[Ech> #Z1> ch" \˕"P> a@8'> c<@' '(> `'#'Јp'Ԝ#'''''ĸp'   7> `2X > < 4@ 8``  @ (`8`4>> `$ @  `(@2````20(`$(`(   2&p>>$ @>``$``"> %@5  ' `M耥 &'쀥 J'4 `$4#\#`#d    =`Z '> 5`(`W`(H`$`(` 3 `/%@x$`>>$@ @   (@2[X'쀥 '"@@48@$8$`(@"@?@  >B >B#\@Ӏ H  -Y`(````4`%`($`4H` @ `(`2P0$`$$`( C @(`4ph "ll@ @W `( H``$>>b$ ଀ `]$଀`"` 2h-`'%``$0k,`$,>B\@>BDH``$< `$p@Ӓ %` ``  @ǒ ` ``( ` `` 8@ 8`''-`(z'4''`$4#`#d#\ И ֠ߐ"P@8'@   2 H`$F `@> > 5> 5 aȖ#K` "'` ` 8@ 8`''f> > 5> 5 aȖ!` "` ` 8@ 8`''Ĕvp`> 5dl"`$8 ) 0 (@9 @''`$8 ) 0 (@9 @''> > 5> 5 aȖ!` `$) 0 8 9 (@'І@q'> 5> 5 aȖ"> > 5> - aȖ"1> > 5> 5 aȖ("D㿘> > ` > a4 9 ` ߂`@ @ @6`%`d`2> > #` 2 `2d`> @@Dlh"p > cP 7#<`< @ 00`+7>>/ (2'  `"#   ` e2=0$  < @0`<` @ۉ0` 2 (`݀  4` ($ 4H`@  (2׀ Ā  @V<`%<`   8@  @_  (H`   $) 0 8 (@@@E   ( `H`  ( o+ɐ#X 2N> Ð#` 2H># M I! I> #X8> > 5> 5 aȖ#> > 5> 5 aȖ#㿐>`0`> P%`DHo@> a > 5> Bch> 5> ܸ`;> +@W,` V ` $ `$ `0 x$    ? @$$ V@Wv@W`8 V`@  `$ ' '@Wg " @@$D`$D "    0a4@@8`b 9 68` `4?1@D ` -8`8`BՒ?@  ̒?` XØ `8` $'' %`< ˒ (? Ԗ  (2  `"1`2- -"`""  "D`   ! !   `K  @"J  !  `2 ` ! ɒ `" `"7 ` ";` #  ! !   `*#` @"?  ! #` `  ``1"``@"#`#`    "!  !   ! "! #` ` ``"``"#`#`    "! k#` "" `2` "` `w`  "`2R"@ L` `2  "`"` ``R `@ "  `"` ` `.   `y"``"`` "` `"` ``` `@ "  "` 2" "`"` ``F `@ "  ` "` "" `2` !     `K! @"  !  `` "`  `"` ``` `@ "  "` 2"0""" `2` !     `#`@"  #` ` s """㿘`M` 2 V` `2   "`""`@") "`  @"(``9 `9 `""@"  ``  ` ` ``2`@"``9 `9 `ݒ"` ``"`""`@""`"` ` 2  `2  @2 0  @ `   2  `2  @2 0  @ `   `" `6  `2`"1`2- -"`""  "D`   ! !   `K  @"J  !  `2 ` ! ɒ `" `"7 ` ";` #  ! !   `*#` @"?  ! #` `  ``1"``@"#`#`    "!  !   ! "! #` ` ``"``"#`#`    "! k#` "" `2` "` `w`  "`2R"@ L` `2  "`"` ``R `@ "  `"` ` `.   `y"``"`` "` `"` ``` `@ "  "` 2" "`"` ``F `@ "  ` "` "" `2` !     `K! @"  !  `` "`  `"` ``` `@ "  "` 2"0""" `2` !     `#`@"  #` ` s """㿘`M` 2 V` `2   "`""`@") "`  @"(``9 `9 `""@"  ``  ` ` ``2`@"``9 `9 `ݒ"` ``"`""`@""`"` ` 2  `2  @2 0  @ `   2  `2  @2 0  @ `   `" `6  `2`<"1@`2-< 4-"4@`"" @4 "D`8 8 @4 ! 8! @ < <`K < <4@"J 4 8! < 4`<2@ `@ @! @ɒ 8`"8`@"7 `@8 ";`48# @ ! 4! @ < <`*#`< <4@"? 4 8! <#`8` 4 `<<`1"`<<`4@"#`4#`8 < 8 "! < 4! < 4 @! @"! <#`8` 8 `<<`"`<<`4"#`4#`8 < 4  4"! <k#`8"4"8@`2`@8 "`< @`w`<  @"@`2R"@@ L`4 @`24 @8"`@"`4 <`<`R <`<4@ " 4 8`4"`< 8`8@`.4 8 @`y"`<@`"`<`@ @"`@ @4`"`8 `<`<` <`<4@ " 4 8"`< 42"@ @4"`@"`8 <`<`F <`<4@ " 4 8`8"`< 4"" 4@`2`@ 4! @  8 @ <<`K! <<4@" 4 8! 4 <`44`@ @"`@ @8`"`4 `<`<` <`<4@ " 4 8"`< 82"@0""" 8@`2`@ 8! @  4 @ <<`#`<<4@" 4 8#`8 <`8s8"""㿘`4U`824^`<4`28<@"<`""`4@"-<"`8<@",`4`4 4`8 8`< <`@ @`<""4@" 4 8`4`8 `< <`  `<`2`< @"`4`4 4`8 8`< <`@ @`<ْ"`8`<`@"<`""`4@""`4"`8`@ 8 2 4< 4`2  4@2 80  8@ <`  4 2 8< 8`2  8@2 40  4@ <`   `" `6 8 4`2@   *`   (@ ` ?@@ 㿘    8 "  4 㿘  א & 4 8 㿘  $ + 8`"   4`2 &`<&`8&`4 &`@ && 4& 8T &`<&`8&`4&`@$I  $`$? @ 8`8 ?@@ 㿘    "   㿘  א &  㿘  $ + `"   `2 &`&` &` &` && & e &`&` &`&`$Z ? <`< ?@@ @㿘    "   㿘  А &  㿘  $ + `"   `2 &`&` &` &` && & . &`&` &`&`$# 㿘c (& (㿘֐`<`* `P @" `` `? @&@&` (`@ `@㿘ߒԁ㿘`<`* `P &@ (`@`&`` `㿘  > `8 0@@`*>  b0@ 80@`   xu P@  P` `80@8 8㿘  &`," 0 ,   ?&`, `,&`0  $  &`,&`0 0`, & 0 > c| @( 42 8㿘>  8a`0 h "  ` 8 < 800@@@  /  㿘 > `<a`8 0@@  ,> a 8 0@%? "  m  8 <0@@  80@ 2  뀦Đ $ &  8 <0@@ 80@(2 Ӑ `  8 <0@@ꀦ 80@z2 㿘> cP`8 @ @( ` `  $ ?  L  2$`<㿀>`0> `PD4> 5> bȪ> 5bТ 'bВ; >  " > 5 Nȁ㿐> 5#> c`A > 5> 5c H> 5c``  , @M  1?   <&? "  < 2 <`` `$`( . @  . |`,`2˲`1> 5u#p 㿘OM C&&  >  <b`8 800@@@#) &  > `<b 8`800@@@) &) @@2&|2&0) @@@2&pm2& &> > 5> 5 c(!%㿐&`"sg`<<@&`< <`c <<@ <& <(`&(㿘> `8b0`<H& 6&@(`(`@, @,  ( @@2 <+> @(> <     ' P2( 2&`<@@   &<8˂&/@> 5> 5 c"㿘y㿘> cȨ > a "(  :R, "((K,(`"G,, @``,` `80@`: @ ``80@`@`,@``]`T  `<`8`0@@*V @@ 72, `8`0@"$`<(`(`@$@  @ `<(`(`@@&`<((@@@  `ـ Ȑ~@& @  ,9`<"@$`<*` *`@@:"`< `8``<0@@: >  `< > 5> 5 c”&㿘`y> `8a 2K-*@") 88 0@ */8 8 8`8  @:@28 8`8  @@0@` ?!  @  ?%` @ $`<  8 800 <*&> > 5> 6 c0="0㿘 `> `<`" @`P  ? .?  > > 5> 6 cH! 㿘``.@`  ?<@8   (`@`.> > 5> 6 ch 㿘> ct D D  @ń D  $$ $ $ $ $ $   > > 5> 6 cpȔ%㿘+> @Jch } y :> @Ich@Ich "k> 6(g> 6 $($ $$n$? > `8a 00U 0@Q 2`8  4>  8a 0Q>  <)`  80@R <@@F$ < - - @ @"`<`pΐ `$ > z#|> #@Ipch1 @Ilchv> 5> 6 c2%<> > 5> 6 c*%X> 5> 6 c#%b> > 5> 6 c%s> > 5> 6 c%r㿘> a``8`@66@?='> @IKh?>  Ր#| .> c 0 0? @ $   @$ ,@$ $$ 0y  ` `" , @  , 0% 4 ,@Hh&@@> > 5> 6 c(%㿘!> #P 8 0$ <$ 0$ ,$ 8$ 4> " b?0@` ,$` ؒu> cc̀  c̠`   P @ @ `@ > > 5> 6 c@{"耦> @'̀`  `?@> 5Aܒ> ``> ` \`  ''\ 0`'> @Hch@ '`?`?''Є ''''Ѐ > ` > 2cP\܂cP`0{آ ( '(`"n,` @:g,(`,''@' +> 'Ȫa> 860*32> a`<``80@@`8  @8 [&& @8 `$@ @Ж@{' J`Ȣ$@2(``\` '\`   ``2`  '\'  Ӗ ```\`> `..k.@ DЀ > @Gch  v'`'Ԁ`a'܄` @2U2,,`$$@`2`> a`> @h@Gq%`` @ U'\ 6"02`%`\ ''\|'V > 6' '\'``?'؀؂ ''؃(耠`\ \'' '''> F7#'> > > 5> 6 c#㿘`N> 6> a > 5> 6 cN$d> > 5> 6 cF$\)> @F#h> a> EԐ"  8.@ #h@Ff)> #h@F~`8`80 @$`< $, , @@`80@ 2` > > 5> 6 c@ $m㿘 7 6b %@H`@ H`~  "%>  (@ (}ϐ (@چ (> > 5> 6 cP~є$%> @Fh> a8   ``* $`|28> " EJh@E㿐> 6#!> !!   > 6#     > 6# P \ T X L `#\> 7  0 4 8> 7 ` < @ D H> 7     !L> 7 !P    > 7!> 7!H    > 7!`     > 7!    > 7! !!!! > 7"> 7"X!$!!! !(> 7"x!<!0!!,> 7"!4!8 t> 7" d x | > 7# h  l p> 7#H> 7#> c> 7#㿘  $(&@  $ (@'`>`(``$ (@('   $$( "@8(`@(@ >+b)2$@ " $@@2$D`$D$H!$H$H@"  dD?> "$D"$Hd d2  $H@$D ?> "$D"$Hd d>+b```"` $(4$D$, $D2$(` `2` 㿘 $$@"$$㿘 \ `: E* `&$>` \.` .`<@&$㿘>+b > a  "  $`"  $D2$ 2 `8` 0`( ( @ 3Ȓ$D+ 83@(@@㿘>+b20  "$ ?   \ 2㿘 >+"C 0.@+ 2 "" 2"  `"   " &  &$D &$H @>   dD$ d` d݂ R \& $ $ d` d`&@&`&`">+" `"│  " Р㿘>+b`5> a``@",` d`"$dD`d8` 0`( ?@ !( 3 0`(`(`@"dD? `@ Yd2?dD@2d` `2`+ 8 3@ (@ަ@㿘?F֐> adR "_> $ @S$($0$ dn  25> 8$ @&$ l> C`( %&l @b "`$($&8`(`(`@@ " `2 (`` `@@" @`@{- $ @&$ l> C`( &l0> > 7> 7 c|(&O> > 7> 7 c| &Q> 7> 7 c|&P㿀> a d5+>+b+2 ! "  `"$D$ $@4$D$0    #\#d#`f "$D$D 2`%  /$H H$H@"$ dD$$D?$$H$$H@"$ dD$$ @$$  l% l$(&$$ @$$  l% l$($$H@$D$> ̒`\ >;a 㿘 `#`$T$P& $X# `&$T0p` p8:$T$P6 C 2$T & 㿀>+b   #\#`#d f &$,&$(> 8{ P㿈Ho$4>+(@e>+ qaЬH`<" " " "&`@ " `H>6( . 0$X`&&&&&&@Ho$4(@e` `% LtHp@|<`@E$L$@8`'@ 7e 耠\$L< @@  ;R"@4Ho$ (@e >+q">+Hp@`0`,`@&0>`@`&!Pc!&,&<< &@ &<@ &8&4&H&p&}>`<`  @&"@`t&`<`  @& @j&2$L> 8zA `Ho$*(@ %>+`0&`4d&`0>+oaȐHp@Ho$(@%"oee%㿘`d(d, &`E "d( ``&`d,  d d$ d@ 4`*d@> c\ ` 5dd> h  @ h*d@ "> 8ΰ >+d(d,bb cd0 q \*d|d@y (`> \((aT  >d@`@! -;> c\ ` 5 4`]`"  c\`5   > &`a< 4 ( @ c, 34`b ٰ > Cd4` > 8xb #\ ? \ cz `x&d0c\G>  > C`w`&d`&`h&h `4ז c\P  0` c\P`8> A&dL0`Ā"W  &dP, 4` @dX  > + 83@(@@? `\P`4`@2 @ < *` :`82`( < @@ $3(d0b!  $> 8x! '> 8x!@0 b  c\> 8xѐ + 83@(@ۮ@&dP> 8x > 8x 㿐> lb?U> 8  2K> 8 \  $ \    $@$` [$d@$d [ \  ?@$d4 S ? dd?> 8 3`@3` `w`a@d $d >`0 ƒ " ϒ vd@d  \  \w!xw!`5 d> w]`0dd> 8wV0ɝ@> c<@' 9> C` @`r`, ` > c\ ? 2 @`> 8`ڒ Z``"r` 6 @ > 8>+b`< >  a0`-(@ ,4 @$ 5k$ $$5d` Ҫ`$Dd" $  8`0`8+0@+@ۤ@ 2& > b` & `2 `4`"`|  \ ` ɐ   ٔ0   \   $ \    $@$`4v?$`4`"l  \  $$ 4ݐ f> 8˒ ^ Ր|`4`T # \  \0N$4쀢 G$ R D 'Ђ?'''''D 25'@  *``"& ="!$4쀢 "@> 8w6!J"> l`   \ ݰ 0 `$|`|` |w!㿘`  , @ , 㿈%> @>h'> ``,@>|h$ ''7> ccĂc` #\#` ܘ 퀦`5 ? ``@@  ` % &(H``  ?'``@@  `   㿐> >+> b ` &#\> 8 "( \ `ǚ >+ ! b    #\>+> 8!nbX >+ "  > 8b`n#\ˁ> cOa "#\> 8v~!> 8v{"0㿘  Ho4 @(@e @ <`@ @ $`@ $  4`2$  `>+k" `"`@`0d$`0 $`4 `2T `T$THp@`2T `>  `2T>+k!ƐT> 7> 8 chve%h> a`6``> <'܂`?' (`'@68@(`'H`'#`'Ԕa '耠`/> C(H z;`+@ ܃, '̧4` @4  > c`8Ā@}   w`8@ r@p 2  Ho$(@e  >`0> `v -> l)@Hp@ ‌`\\Y THd(d 8`(`(`@ 1 d(d 8((@ ` @s〤3`8+0@+@@> C`> C(@ '耑t/HH ;`p+@Ԃ C @ . > < > 8 Ԓ >  Ԕޕ '̢j Z @'d(d @8`(`(`@ >` > 4 !  , @,> ,< < @Eԃ-@(H` @ > a` (@@Ѐ`2H> 3ɒ > C `  ݬ'  /  G"܀ '`@> % 0!P% ,c!`W% % H% p= % Ho$#> (@e#> `m% Hp@> ̅.% <% 8 > C (% `0% Ho`(@e`p` pHp@`> >`0 0``@ @@% 0>Ђb% 1U  > % HHq01IP 0܂d@ J( 0d|䀦i " `>  *2c` > @!W  (@8` 8`@@D > C (`倥H@Z ݀d(d$8`(`(`@ 5>  +@@ZѺ`גHo$4 (@e `k̀` @ "@@icHp@>  אܫܨ0ΐܡ0㿘>  t'D`$ t  pD $ p   p`$ p> > 7> 8 cs۔&   `?>aD*㿘>  a 0(`    ( 3  $$( &58`$@ 44` (@`, @9`9> 8s]"+ 83@(@@   2`0 d&`4&`0Ho$(@eHp@80`0@$@+@44` +`@, @ˢHo$(@<`&`&`Hp@0e$@㿘!> C `@>+!@@#`$ 㿘@7 > C$` $㿘!> C @` >+#`" $ #`  $ >+#``#`㿈> C(`  (ؒ 8'8'''!>+ p#`7`耧`#`@&`&`&` `@X&  㿈> C`(9 8'8'''!>+ <#`7`耧`##`@&`&`&` `&  @&&&& > 8r`"㿐` @    -;> C`3h' `'`> C*u`$> C*o` 㿘 x@> l>(@ @  `0  >` 0 0@@#l 4 00(80(@@(#l㿀 ?ِ` "V ' L'' H`P=> c> B%>c!@" 0G "= ' L'' H`8> 8 L`"  0`" @@ ' $' $'쀠@8'`x `l``(@$(@*'쀠̂ 'ƀ > 8q#p  (?r d H`y,0,`0`@=@> B>  a ->a@" 0ܐ G H`]> 8 L`"  0`" @@  $ x  l  (@%(@*@c(`aH@#@' ''#d#h#l#\  #`/ " "#`D#\#d#h#l / `&D> 8q#㿈 @ t> a`8 @8(  ` `$&@  d`(@@@@ @ @'&@c#\#` ?`? &@ > 8 pm#0 $@: d  @@` d @0@ $ d ` d&@0@$ d 㿘 > b8> 8p#X `" p @` `?`s> 8 cx& "8͖   @d`?(``?`S `& #> a` .D L' G  ''?''''>0  @['쀧 8 ` ,@ `@829&a0 "M`  & `-@ (` "    #@` +@ `@̤>`0`,’ ŀ aϤ @~06 Ԁ -3`   [|.  @ٔ">c  㿘> @  @> 8 @8@> 8oՐ#@> @C?b 8 8C 8  ?@8?0(  > 8c & "7     4`   `[``&  b>,XX`& X $ X & $b& `C& >`0``+! 2' > C`,  > &  & `>,XX`& X $ X $ $b$  " 64` &  6(&   |> `0((`  > \aT  `h  2  `(    @@$B   |`> \((aT Ǡ m >,>,> 8 aX!H>`tc㿐d`@K D `   %> H`` &`8`@DR'  ( (` '   ר '  > 8> 8 `cتȤ />B )> !8`@D2`"  ' / ( (`H`` &H`` "6   ӥ' ډږ    (H` D& (`5  (H`  `> a > <' @8'܃('؂`#p` '  8 8; @ @   `(` 쀥@ ''  ; B 8 F  ;   @ s `2s' ''; 2`b(c`(`2>>>B@( 8H``$(`C`0`f>>> 8`@DÐS䀠`>  `> 9 ` `"& 5  `2  a\~& > <@ e܁ǀ```À` '䀏`"> "/>>(H`` "> 9 5r(> 8`@d@l($ @ǐ> 8`$ @ > 8`H``$>>b$ ` `ކ'';`#\ߘ` ```"ԆH` Ԁ 쀠F `.` 5(`V(H` (H`` 2>B`0`#>>. @2`20"쀧 쀧 2`>>$ @ˉ$ @D@΀`3P(H`$0m`@j`M 'm Ɣ  (H` > @8`D4@g'c' > 9kb x> 9k_ 'H`<` $@ g(`> <2  @A'> 9l 8> > 8> 9 clD"> 9>Ր!@㿘 `   Қ > 2> (> 㿘 `*`2;`H&       `> 9 a `"& 3  `2  `  &  2"&   $! $ $? @& & $& & > 9k!㿘 `F&  8 B& 8&     l   & `-> 9 a'$ "3  `2  "    $ $ $? @$ $ $ `>  ` $     . 20> 8> - ck!㿘)>,ސ!H>,aX#>,aP$aP K$ @"   "aP 2 P `2  `=`$ aP3$ ($P 퀦 aP  0&o ( !     1 ` b?  $ $ $ @ & & $P&  ( i!H ($P$  㿘 ` ` $`  ` !>` 0$`   'q(  '`㿘 @'Dǂ D{ " @ @{   @ > 9jaP 3 @ ǵ    D)+ K 㿘Ho&4"(@g"䀠" "? @$"$"Hp@t" ""  " $" $"  >,> C a\>da  P㿘" L  ? `  0> i:%?`$ l4 \>>܂bt!$!$!>?H, h$!> :`$!$!o$n D X̖ Ho&(@>,\\`$"\" \$"Hp@ g>,㿘 aF@@ 0H@"^00H aJ@G@b aF@,2@1@}@tI@"b" @:2@@ @ aG@"9(aH@#0aK@" ("`$ J(B" C(; 0b`ـ`װ /  0aH@В0HaH@[  1 0aG@0HaG@  @ (  " &"   $  ;c& l aF@n aJ@  aF@ 䀦  " /@g"&  @ 0  ` aF@ aF@ >,a\ d `"""`"""`"" `2" @2"`2"@2"@Ĕ  | 2"`2" `2"`2"`2"``2"` `2"``2"``2"0C i$ H   ] `Y aF  V    'A $F   '2$Ho&4\(@g\`@j4\Hp@ a>, /]>, /`2]"``2Y"0@8 w 0ܝ㿘 \'H`" H"``" `HD 2 @> |6`"``HH3 / `@H2 Hs 2 Ho&4!(@g!`.H!!䀠5H `H`<(`@a" a H`<(`@ a!&! `@8`Cl> Hp@0 `@rH (<"H! 2!HH 7!`&!Hp@㿈?!Ho&4"(@g"`*ϒ 'Hp@  \d`"  "`` @" H0р`" D `" D|2 "`` 0@  ͐ " D`"6 `t`   (```)r`)``a`y     @"  @  @  DXX @  @ @ " @> `.` #\   @[  0j!`" !o&!k؀ ' `  ܐ@ ['     0@`2  ! ` ``)   @q    㿘`#! " @  $ @ ``@ ```` `?. > 9fĐ!㿘`  .@  $.@``.@> 9f!㿐L ''L'P'T'X'H@  (6 >,a\` b`2 bb䀧`b`"bb"b``2b`2bFbC (2b`\`"bb `2bb `2b䀧`Ő& a<& (``@?` @8`C?` @> "c<@' `"  ``" - /@ P> 9 !<( (!< 0> eM# @"0'''''''` '//'Ԅ?//'̂`7 ( @``&`! L   "g"(08! ~ x a㿐' lC>,a\ ? `` :" """`"" `2" ``2" \`"" @{  2"`@t  2"䀤 &   @< `@9 C< @R!ѐ!@> "c<' "   `"  f / K> 9 @C"0'''''''  ' /' /' /' /' ' ' ''܂?7`̐ ( @`ŀ`&`! Ή   " f07!Ѿ Ѹ a㿘` &` @(@ ` ` ` ` ` ` (` <0`   `  `  $ ``( @ `㿘` &` @(@ ` ` ` ` ` ` (` >0` , , ` 0 `  4 ``8 @ `x> c<@' ````" ` @ `"` > 9 '''''''``@ `?@> DaЅ.@/ 00``(`0` la, ,`0`"I4 @`p@@"t,@>  2۶@` >@϶`䀠`,耠`쀠``<@2` @,@  쀥`8`H``4`X@  "ۀ``f`"5`?c]> 9 cB!0K> 9bb` ``''''쀧` c >Y``@̔  `cc```` ``''''''?'`, > 96"0㿐`@M` ` F`l`H `  o 8!#"X!$4`, ,0`0>,`,a` && 1`?4`(0`@b@*` .`0O 뀤 #\ R  6`>Qϰ "`l`l` > <> <`,, 0`0A4>,a``,  1`?4`(0`@: 4` .`0Om 逤 #\ RE  6` 14`[4`> <> <`, y㿐 @>4 `h y >`c  ,`_ 0`[ 4`W 8`S"S  `"J` `H```E /`@h 2< `&` `` `?`cA 1``626`` `"Y`6`&`  -  d̐ "* 1 `& 1- 0` ##`& ,` & 0`& 4`& 8 , `  2   `2"-  1)#\>, Qa` "` @Pڐ 0`& ,` & 0`& 4`6 >P& 8͐ `26```- 6`2 "#\0h> ` c<''' 3``0 /`", 1`2  , `?c" 1 ,` ,''' '''@' "    > 9  '#\ H@ "t H 4`<'@u, w@ ` 0`2  > 4`2 > 8`" >*#\2 P 0 @` 0` 4` 8` >`;>@$ ,`$ 0`$ 4` $ 8 p$ ?$ $ $$ (4 <$ p> D`̀P 0 0`r? 4c2n @1?*@$ p4"@ x 1u'Ђ`0` @`"@ `   @ `@`+`   8@@     8@@ ?2  +` `"?`8+`> lbȀ 2 0  @ 2    `"   `" `2 !   0"`2`2 ``2ऀ@ > Ch `` h(`(`> l H> 9c  .?`2 ?2 0`. 0`0 : : ) `` )? ?0` ) ?` )  ?0` )  ? :`)  )  `2 `2` :)݈  :)) ؈ )ш  @@ `  @   ` (`( ` \  h`A`A`? > :a. |"#\`2@)l``"@:@ ("` ``" 2| > C `И  ߂`㿘`@]     㿘!> l"Ȁ @20@2  6F " " "> l"`" ` " 㿘  1   ,  $ '!$ @d$ $ $ 㿐 @*  ' `2  `" @k  2㿈> 9c> ?c<@' `( &@ % 3> 9`/c& & & >`0`@8  ?) 2).@ > 9> 92"P2"h㿘  > :`` >0`>@~  @ @ @ @ 8@`?㿘` ` ```  > 9# @W   ``  ```耠` 㿘Ӑ?  `X㿘Ȑ > :a`~  ?;> D`Ta<@2`ސڐ2`` 2 `  "` `2  2 2 2 \ X, "Z`Ѐ`" `" Y" Gh<"`\ &< 0iĨ$>0 @'>0- c jh@8jh kh@8kh` k膀@8kj膀@8j>0ci@8i- c i膀@8i î`2> : ] @0ـ   4y 2u p2o  ` "h  4Ԑ_ 2А㿘  20 `"  ``2 `@S  2 x@`` `!<'> c<@' '؂ ' /''''/ِ    4@a2 < 8`>" 8 @ 9" 8H"  h H`" 8 h " Th"T 2 82 8T T 8`" 8ӂ 2h 8@逡  8ł > 90" p> c<@' Ho 4 (@a `& Hp@@ 6> 9@WȐ   ? @ & &  `"      '' '''''/ /! @a2i 60 0"㿘 " 6V 㿘> lbȀ`2`0``@2@` ` @"`` `? &@&`0 6p> c<' Ho4&(@a&` " ,`" ``"<   2 , 6b  @$`$ ` $` $ $$` `" ``"2$  2 6Hp@ 1 & b> 9 2 Ȑ , Đ @  2 `& Hp@0  `$ $ `$  $@` ``a''' /'''' 7/ a1  &" ? $$ 6 ` $ Hp@ 20@W0/"Hp@ 7 & &㿘 6    1 & 7&  6P 㿘  > l`" ``"3   2> lbȀ 2 G> : D> : 2   " &  `& `$ & `   `&    "  `$ &  `& `$ & `  ` \= x㿘Ho&(@gX>4h2? `22  `"  @"  +& \` \&  ` & Hp@cHp@> :[+  @rX &  h> : `\5 > 9c c > 9` ``||'''Ȃ  //>  c<' ''//''''''''''Ԡt @ D@$'x ''|` '<   > :a> :a`0> :a [   H  8 8 (> 9@ `" ` `&`  @8`` 80`   .3"㿘>4`h   0@#  2 ``   0`   4` <`\ 8" 8F 㿘 @c ` ``Ð Ā?  @ Y  Ā2ǁ 5   & ڐ 0> : aX[?`00՝㿘 a<n  4`2  <  8$ 8`\ 8$ 8 㿘Ho&4`(@g`, ````2$a `h`"a Hp@`p`&`$ "*`a>jT`\`a` @a Hp@`p&`T`\``؀   ``&`> 7cP> 'c<' > 9 @cȀ``" `\`2`-```2 /`H`造`" `H`P@ $ `0`,`4`8`<`@`D`\''''''']`\`-``p`t@h> Dc_  `H`|`^`H&|`L&`P&`T&`X&`\&``&ـ`Ӑ`h&`l&`p&`t&> 4@&> 4@& B'`d&`d"&> a4& |&ـ`2`-`2`-``2`-† `X"`-  > 9 > Dc  0> :bxY  ' "]  Ȓ 뚔   (* )"" Ă > * (4" " `\`k `" |& &>4`h2w `h`2 `&(`&,` &0`&4` &8`$&<`(Vm&@K`H2`H  "T`\ &T`\`&T`$ `d` @e; X&O&`뀠`"``| /`> :bHY{ h@  ",`h`&&`&d&h&l&p&t&x A  "> Dc"0> :bYL +Ӑ"`X''?'77 ?'''  //'/) > DĀ`"Ă &> 9> 9,cL,cL` ``"`Xa<''''/'/''''/''7'/''Ԧ 4  `@l   8`҂$ 8<  D@a<('T'D!'@'H'l  Ŗ ' Đ͔ m> DĀ`" Ă  &" > ` > @`8 > 9cc``Xa<` `''Ȃ  ''7'//ߒ   `@  S 8`$ 8<  D@1a<('T'D!'@'H'l  q .'z > DĀ`" Ă  &" `H> Dcf > : Xia0a" c > :`0cXY O`8z$ 8``9$ 8cא`0> : X<c01 '> DĀ`" Ă  &o"  c > : X!b0D0<@C<|<8c"Q> 9> : cX`0F> 970> c<@' 0 ak@ 0aj@ƒ00`l@" 0H0 aL@"(F0aN@W@   @]@ > 9P@!0JO@뀤 M@瀤  i@<0g@:   d@f@4  > : -WcX0ւaJ@1aK@ ɐU@V@ @@E0H  1?@@ / 80H ae@ @K0a@J@D0H"@qI!@Q H @"M` @EF@C` 0H"@eI!@ l H | 10H%@" |R Ha@! a@"$d᐀`@`^ - "[ @U@  ʐ b@`0H`" ``2 ``2` ` ``"w` `#0H)"ؐ@4-@ׂMG@ߒ%@2 ڀ`@" Q%@0H @ M a@Q @0H @R@20H M  1?> a4a4  ?> a4a4  " " " " > 4@"  > 4 @" @"6SI@}Q@2] & & & &   c @:&&   c @:& &@V@S@2 O@łT@2*ᐠ !@|`!: 0@("@2\`"z  ` & d& h& l& p&  t&$ xj&( & & & & &  &$ [&( ( & ,& 0& 4& 8&  <&$ @K&(  G&`lD Ho (@aMHp@ , '  `@P' / ">$ $(PTX\'''''''''''ȈP@!  tpd'' 0((@@hi' 9' `/@js$ 6 0" ذ " + $ + 0Ϡ  @1|@ z 0À$X `"`X }"`$ \` \ @k G` > : Ukc02` p> c<' :8 @h0a@@"b -  2T`^ @c0a@_@ - L "ې 1`@D `?  `ΐ L x @i  e\` `'l`'p `2 / (' a0` ``"`" `"` 0'''' m0a@    Ĕ   QĀ n 1 `2 `  ؚ @܈ 'Ԅ'''@&  2 0a@]Ԕ x @-  ( (ߒ\`"E' ` `֒ |Ґ | '8 Hwa0#" 1Ēx k  ' e'" Đ Ț @̈ І''''А @Ӣ  " > 9&ΐ"''' ''' ( (\`" ` ` 1 &  &> :SӐ#Ȓ @!  x @ k \f   ] ]L ^ ] ] ] ] ] ] ] ]D ]$ ] ] ] ] ] ] ] ] ] ]㿐 ```` ` *#\> C   t0 9> C p  9>, !   9> C l㿘Ho (@aDHp@㿘\ x>,> `< '  `'ጐ ( "``X+ ^ '؄ ''''''/ـ`0/>,apap@"` `>`@@"`@`@2`>``$` 9> :ؐ Đ ``$`0 `2>,>,`2' '''`@ ``$```$`0%#> C`>,>]c(!p㿈'T'X'H'L'P& & `T'& ( :`@`. :> C `"> C` `  `  ` `T ( >,`  1`2`2 #\`H"  @Fa <>, & Ho&;(@>4``@`D6@`H <& (`@"C'@ (`@ ``@'`@> pH/`@@ > @`lHp@ >, ` g>4``@`D& <`H`;'`H`L`2> U>  <㿘` S  L``.`> ;R! >    ,  瀦 * … -¸ ۀذ -Ho`(@Hp@ɀ`İ ) a0`` Ho (@a>,ElapHp@ > C> C`lpȐ `l` l0> c<@' @0Ȑ@U  20, "  ` j 2 `> ;->4`/> D 0@`` ``2 ` ``"<`Ģ2@ɐ@Ud> 9c,c,`` ` X!<'''  '''7'//ِؒ `<Y@ x> ; "! ?   `Ā2``2"!<M` `$` h@2R``D@2` ` `8$` wh`(  ے  D@ 4`|' v''r'!<  / Ȑ  D@ې`4'`  '`0 '`'< `vV0C]`"`  Q#` %h#"> c<@' `?"$?`2!?J@`% `." !    `q`.p @2H `? ?@ Z> ; `/G@)G(H``8 (H'H'L'P'T'X'\'`'d'h'l'p't'x'|'''''''' AGG=m && &.&& &&.?6 X 6 .  0#"І (%> <' ''''''''''''''''''''''> ` > `8( `` ``.` > ;"ِ"> c<' |  x@ݐ  0@> 9c|c|` ``> 9` '   / //?''''''''''''///'' ^  > D > ;c? > ;O`80""㿘 2? `2"" h G   % %   ? 8  %  G  `'> C@ฐ@? > C@8` ހ  2` @.` ?.`  .` .` ?.`  .`  .` .```Ƃ`` .` `  `` @   2 0㿀  `!> D#`2= 0 x (!> D> :a` @ k 2``@!> D``@ ˒ B!> D#`> ; 0 aOH##`ϖ`0 0> ; `O<#> ; `O5#`      #l#\#`#d#h> ; Oax#``0 0> ; `O# 0> ;?M!P㾸> c<'   x@ 0 @C X \76  /-'8>/,74 '<'@> 9c\c\  't 'p` ?'''  'l'x/d/eHo`j(@@ Hp@ u // > ;   \`  ` h` `߂`&`  `@?l'쥒 lp't''x,''04''8<''@D/'' @! ?'' @@@a*' ! /a4 v> 9> Dc? > ;NSa0 @dٔ ޤ> Dڤ?c֤? > ;N?a0> ; Ɛ#M" 㿀>  hc<'   ld> Dc> ; 0bHN   2> ;` ld> Do h` \(`` 0`> Dc 0> ; Mb0݀`> 9> C`c 0 s#(c c ` ``''''䀢 > C > C0㿘 {v````.`㿐 @ ¸ '' /' ``" ````` ` `` @ @@@ @ @ @ " ```````@ @@@ @ @ @ @ @@  *   &2     & 5-?0@4#@ (`+`? ? &`  @ @@@ @ @ @ @ @@@@@@@߬` `@@@`"%-50?4%` ??5-?0@4 @?(`? @ `0???5-?0@4 @((k  rq& ``>`2;`;``` `2``c "w ? `& 5-0`@4 @ (`(`? ? &``@```` ` `````````@` @@@ @ @ @ @ @@@@@@@߬` ``@``@`@@`"!-50`@4%` @?`0?5-0`@@4 @?-(`? @  `2 ?T5?(`0`N``H?> ;K#h @?`(0`q2@ (`ٸ@?  (0`Ϭ ``2`` ``2c`c`2 (` ?  (0`> ;K#8 ` `> Db|```"` " `" `" `" &"  ```'``` > :a|) 2 " ``䀢 `2` > :at@> :a|+` 2 `X2  @" `" `" ` " "  @`"`" ` ``` > :at> :a|) `"" X@" "   ```"  2  ``" ``` 2  ``㿘`"( `"$ "  > :a|( \`2  `"  `2`   A A>0c`@8`` ` `   /`i 瀦 A>0 2'`2'@"  Ұ "ϰ  "& 4`" 8 ` 8`$ 8&& ` ` ` ` ` `&  &  & & & `&&& `"``   A <l ``   \`X2 A` 8`4``4 8`_&8&`  &` &` &` &`  &`$ &`(` &`&`,#<@I] 2 ` `  8` " 8&`  Ah  e <&`  @  〦28>` `  AP 4`"<8`&8 8`! 8&  Aib& @Ɣ  w`U 8]&` Y&` U &㿐\#\#`ߚ㿈 #`'#\њ 4` @`` `2'@? Ap> c<@' '@`` $ `\ `" \'Ԑ'@ D @  > ;`\ `2'Ԁ  ` ` ` `   > : " `Z` U  @Gה /\ < `00'؂ ''''''/ل /' ' ' '``#\K؀  1 ` 1 '@'' ' ' ``\X7 ```\X7… 1 " & 4` 8`' 8&& ` ` ` ` ` `  & & & &  & .  e.   A @\` k " ?0 @`" 19`0`@250 A 1'@a|(\R ( 0 1 ``P`  .> :at> :a|)  2\  '@``뀠`" "  \ ,`> :a|(0 2\"`O#"ꀢ`@A  2w 8 <`2 @w&Ԑr&㿐@   B `N` `(` H A`   `>0 `@  $ @v?' $@`&@ >0c`@!8`    *>  `2`!m  @ *>  @G >, aa `㿘> lb̀Q  ` /      @ }  `"@`` `? @`$@$`f  `2@"    ? @&&  0>, @ O >, >, a> ;> ;#cFȔ"[> ;G#㿘 `  7 }      `& &  㿘Ho`(@aHo-> l(@g-> l̀`j %̃Hp@/>,>0 c)> D`)> D 9`* 9(@K<(`2 9)> D'>, ᬀᤀ`>,>0c` 0`@< 0 .@ ᬀ Ho(@%̃Hp@!>4 l  8`" 8$ lHp@g%`$ lHp@> ;> ;#cF"> <Fؐ P> @c<'   @ E@ ":!'؂   //''''''''`Ц`Ѐ    @`2`  8``" 8' ` `(`, @  !|!@ @9  L> < ̀   *x>   2'! `. >0c@>|@ x@9 x  (`?#!h@>h|@ @9 &@'Ѐ`Ӑ  @Z 2|!Ho> l(@g> l̀`< > l ̃Hp@> D`>,a>,a> D    ((`(@> D4@2 @Ӕ  2@̔  2'2 `?%,-8 ` `,(` ( ?c? @ Ho> l(@g> l ̃Hp@5!9 5 ''@?@@" `' '#`? @ K  ϐ  ː  @ `2,  ׎ * @ ` ` `((`@(#` #`#`#` `#`3`2 ` 0``0`2`"  "  |@ @9  @I> Ho4> l(@g> lw b `>,ᬀ݀ᬐ <`  7 >,$`7 >, a$ $     ((`@( x, 9$ 4 G  C ?$ 0$ , 'E ?c<? @ Ho(@> l( b Hp@> ;> ;#cD > <Dݐ #@ `%#`+>,a `%a0%0` ` 0{x`"|@Ho> l(@`T` ! ˈ `  M`@  2 >  @ @ `7 :    ? @ ${$ *  2 0@ 8`@ >  "+! ? @%%0>, @   >,  `@ @`Ő q`#@ `#`o#>, `` `? @$@$` `   ? @$$ `" $ ʒ  2` ’ Ђ@(`0`0`, ,   @  <  8t  "Z! ? @%0?%a @%a@t* "J! ? @%0?%a @ ׂ%a>,ᬂ " h  $h@>h|@ @9 '@&@Ho4> l(@g> l b̃Hp@0>, `>, `㿘Ho%> l(@g%> l̀` $̃Hp@#>,a  >0c @< a 2 Ho (@$̃Hp@g$ p D  h <  ` 4 P \ D ՜ Ր`"0 ```" X `@: ``2 ` (@: (@: X@92 ` @@: @8 `*>&P 0@: 02 ` 8@: 8 @:  @:  @:  @: @: P@: P H@: H㿐 ` "?퀠`   *#\> D Đ!0@?^ 97>,  ̗P > < 4``  D@ 4  0  v` '''' Z B P !> < 4`` X`"& \ @ D 4  0  v` '''' 4 A P v = 4`)> D'''''''''''''''' ' 0' v   P8`P X8`X `:8``> Dap>' 㫒aH - ( 㿘> Da> m> D" ~at`?㿘:`      "`؁ *  *`   '  " `ؔ  ڰ ( `   `؀`  0ܝ㿘( ``(  X @  2   & & (@ ` Ӗ( `퀦  + &  `  H`.` 2H  p m K@``.  ` `@˂`>ɀ. `  ``Ђ`` `` ````Ђ`` `J `` Ђ``  (8``- )? @  )?   J`. @ @n(@`@2(@ && | ߴp> c<@' >0 " > D`  ` `4`2`< n@  > <   'ؔ //ؠ'ܒ''''''@?~؀ ـ `Ԑ  π    Ȓ  Ӗ(% % %% i` `0@ ͐  `0   `4`"  `"    `0- :?- ---- ?-((-`-`-`-`-``4`0 @  @>u`( $ i`  @ $ 4dd" 0$% @ ~%  '@ 80`@g , , , , , , < , ,  @%  % @%  `"~ `"s ``"h ` ``"] `  :؃(`0`0`---`-`   (*@ * 2 2 -`-`#\    @3W |` @9 |>,` @9 |` @9 ``C :```P P d 9 0Z耦 " S 0 @ [``2 -`-```2 `-` -` ``2 `((``2( ( $*a,  `J$ "H% `"C$ 8-`(,   i `*6$㿘@e``^HZ@HV ]O*  J @*``E   : ?<8` ?9 = 8- +) & # @ @&$      @*   *``ŧ:  @{ `   @`?x > c<'    ((`(@ @d  > <> Dzap`?> D> Dah`&'؀'؂ ''''''/ل /' ' ' ' `"K  ([؀  > D 4`2 X 8`I" 8> Da``@@`2`0al`ǀ'؀`2 8 \@(` <|``l@ @`"@:@( 8 >,!`@9" \``2 ( `X72 8 <q> DҐ H㿘אԐѐ> l"И$> <<(㾠 > c<@'   (`   > D`> Da@ *Ɛ @`ϒ` Ē` Ԁ`Ā䀠`> Dc >,!`@90f   @@``2I'8!> D!xݍ'4> D`耠`O  ''p'T//U/q//T/px 't'''''''x'|''''X'\'`'d'h'l \ #\pT  Ú44 !x>' 6`߻4'8  @'<'@'D'H'L'P/9/8۔ 8S /@ F> <``> D `>> Dc" >, > < =eau >,``hXd7Ƃ``]XY7> <a@=N ^ >,i4  4 @ *H>  2@>,ah @8h  `2'> Dc"? >,> <a=$ 4 >,   //'''''i' (F > D0 c `'> Dc8`; %8< c" >,> <b<  >,> <b< 8  @c "8> Dc"8e> < <ƒbX8 >,` %8Ԁ`J @; `?> Dc" >,b> <b<  >,ÐԒؐ`( @8@:M *(` i` > Dc" >, i5> < ,Ղ```?> Dc> <c(<\ 0ق@7b@> '\c<' `'`(> Dc > <  `/(  : `(.` `` `(/W `'Ȓ   ''''''//ȴ  " '''''//'' i   >4`h  0@~s  2  `"X 䀠`''''''''' (#\   ԚX   8`9" 8 2> DcrJX> = ;`0h (`Y `/8   0 Y  (b > <> <c#  (;'0Gt  `.`.`.`.@ :.` `"M> Db|`.`ؒ : (-`-`* 2 2 -`-` |<6 #\    @.\  \`b|` @9 \` b|` @`9 +`>&d 0 2  0``2a' `@['`.`\`b|` @9 \`b|` 膀@9 \`b|` @9 \`b|` ؆@9 \`b|` І@9 \`b|`!@9!\`b|`!@9!\`b|` @9 \`b|` Ȇ@9 \`b|` @9 \`{b|` @t9 \`pb|` @i9 \`eb|` @^9 \`" Wb|` @9 W`P\`Mb|` @F9 ܮɀ   x0> c<@' /z>, `0@  @`@`? c 3"  .<+b,2*  ` Ȑ @ 3  `(`@ `@  @ w>,  (`2 Т"  _ @`a ' ''''''//``@'`'`'` ' ]'Ԕ $  > Dc> =?0; ` ] @,>,`(`@`2 @ ْ @>,`2 0``"(`m 0 M>,ah ?@8h @ > < 0ۖ  0*>  ? ̖  *>  ^   *>     *>  / `0*>  M@ `(`@ 'ؠ //ْ'''''Q' ٭ ' t S> D   ((`@(?)`:'''''/?: ""`>0b@(( @@> C(`@``l @0f 9)`@%Ē`     ```((`@(''Ȫ- >  * >  @ah @8h   8 p> c<@' ` '   @  ''/''''' / ت`D><cc`9沢 70?Ԁ^` la"  v`:2  ,` , 0`"o 4 ,@{9  2  `  `" $ @{*  2  ؀ ` 1 (` (" `" "  "`l@3`@Ԓ  p$Ԁ "''Ԣ 2 l`V0?`l)`@Ԓ  Ԁ @ K!` , 8`" `@0Ԑ@ `@Ԓ ^ 0Ԓ GЀ  *#>  7`v  (`"y q>0c`P@8`P`@'Ԓ@ > <  7 㿐`  (``   `@`` `J ` 2 B  >`2  `= 2  0 C < 2  "  `" (R` 3> ?'   0`"9 1 쀤 ǰ  =; Ȫ 0" ``"  "  4$'4 'є ̔  0`2  1``"4 `(`(00.`.`  > :(@`iခ 㿘  (`"V  > :aU @  E  "``2 " 0N * + 2 `"  `    `2'&Ө@y  ې'  ܀ "  "   `> : p>   c<'@' ` eY '؄  //'''''' &`(8m   `(` , `-` -` -6 ``[``` <  T`  b   ($HE 08ݲ ` -`R> 8 @ > < Ѐ  *>  6 `  {`À` @x 6 0> Da ԃ* *  8( (```u ` >   8 ` ``  ``@`   Ʊ-b6  > Da  f <0 < ` ^ 8  N( `e` & & N ( ( H-0``"&, `, , , ?,0\ β t h `? 8, & & ԖՐ 8& & , ,  8'А ڂ?,  , , (`8> `8(`(`(` >  8 &`  @& Q0``?``;``8`X57```.`57 І   *> U$ݐ㿐@'   @|`@9  >,ah @8h  ` b|` @9 ! @ ]l>,  :w > Dc2 >,ah(@8h( `b|` @9  `hq >,`(`@h@@8h@  "= "j̀ "  ?> D   "|` @9  `8_h(`>&   *'>  >,ah @8h !B  $*` 怤 "`> Dc(`  6 h@!`>,  ;  " T`` b|` 8@9 8mh@?h8h 8@h0@?h0C > D   "|` (@9 ( `H  `2h   ` b|` @9    > = 4K`p>,o'& > D?8`~> D@! `` b|` @9 (h0z@`` b|` @@9 @2hk@  (h0  `  b|` x@9 x沖  "@-M@` b|` h@9 h2`h '(hh0 沖 m "1@`` b|` `@9 `2Ch (Kh0 沖 P @A@` b|` P@9 P2'h (/h0 沖 4 n@N?@`` b|` X@9 X2 h (h0 沖  E@?Ԕ@a `"@ π (h0 沖  "@ "@h8dx`C @?h8?dx (@`` b|` H@9 H2h 沖 ٔ @OД@ ` b|` 0@9 0   "|` @9 `y 2ht r  沖   `22V  @8.V  ?*  *h8d `C @?h8?d  2R@0є ё `` `X > =2`1   {? 5 c5 ǔ , & 6 2@%# ( (  0 @`(%% r%?,`, ( (2g `"@2 h P` "@$ $ > ` ?̀4  ( `(`0,`0(`(`(``4>  8I  R4$ $ ,?,`( `v b|` p@9 pn@,% "'' @R  ' `*>  C@@NՔ '! '@> '@@d '@LҔ '?( 2*@㿐'>,>0@"<Ḓ `'x c  ` `}ǐ```"V `?'  )@- `:"e    Q dk$А 0v  o> D `/e  ̐`` Ȕ  `h`" `j`" ,`(6`(6((((6(& ḃ.`@`@ (h8``2`2` ( 2 `@O8`0b  6  RJ`T `@p8`8"@ 0 2 > Dcc> = `1v!x ``2 , , ``2,`(, ,    `*">  @``쀠`2,`(, ``܀`2r , n, h @8h  2> 0 㿘!> D! @20@2  ٔ  > D" !"`! ` " > =0 㿘@+> DӒ`> D> D apӍ> D ax㿘`+       @W@Yz ` , @W@Ym , 4`4 @㿘 ^?^}& 4 !$4@ ^v& 8 $4@ ^o& < $4@  ^g& D $4@  @ D& @ @[ 2    @[ " & D ^_ ,`@``  > & H& , a4 0& L`  (& 0@[z " ߢ` @[r ڠ㿘 , >  La4^  , @ D  4 @  @[Q& 4 <  H  8E& , 0o ,㿘> D1?ɐ!|* l T < $ 8  `(`  (`3 `(`  ``,   `(`㿐 `?`+( (` 1 -#\> D !0>9D>,a b> ;c \7> = m> Db P "   9>0 # ~,x9>; !@ x h`> c<' n> = `2  ? a> =&?<8?.>9`*? ;ʀ& ˂`(`@װ?`*Ӱ? $?cǀ&ð`(*? (̀Ұ&`*? ʀ& ˂`(`@?h!.!㿐 ? x ?'㿐   ((`(   3` <   + `   3`(`@  &@`  `` (`@(``@ @`&@ 㿐3 32<"> =-F!0 l3*`(`      ( ` & } K& ؐ+2> =Ԓ`ٵ(` p @> <@' `` l@ `'ܔ@?ܔ  7 ) & l2 ```5 (``+-/ 3 33 < = +u  30` `(``  3"  < 2* + uހ 3p>0c`@8`@@ > =Ғ" lZ0 `ӥ(`Œ l@" @@?  @" @@?  ) & 1 3`Ҕ `f`\ဦ` ``2`X l@'@?   ) W& lK@  ? :&8 @(`(@0``'ܒ  =v ) 5& lD (Ҕ y>0  `(`@n l@@? ) Y &ϐ. l l````7``"7` l l!㿘``@!`@ ``` >0? c`@8`` ``c ?>0c` @ 8`? ?㿐*?c  = H *"?I &  6>0 `& *>0 `0 + ``(1  `9; 'ӂ >0 ` Δ  &Ă >0c`@8`? +"  2?>0c` *@8`"  #?>0c` ,>0c` ,@8`㿐 `) `(`">0` `(``(  `(`)>0c`@8`? ( @  *">  ڂ (1  @ *>  ؂@`6? && + h> c<' '̂?'  `>0cȆ@=Ȁ`Ӏ@" > ``>0Xc(`@h@8h ` cb|@@9c@;c `'!  ```"/ @= ` b|@ @9 R > =   ('̀ ܰ@ ="|@ @9 `h `(`@`@8`  " 2  `"   w `s `o `k `\"~ `"   `"   `  ?c"f @= `b|@ 8@9 8 ` b|@ @9   0{`X`>0(`Ecc@D=c@>=>0c@7=`:    Vv 2  `2  `2  $`2  `2w  $`2s @= `5b|@ @9 -?c~``q  `@"k ``:> D L` > D̒  蘐̺`  b ̀   `@m#``` `2 ```2```"# ``2 ``2  ` `2 `$`"  `\` `W" ` ` `~`" `"A ` `뀠`"3 ` \`" : `"Z ` : `F `l'>4l (`l`4`Ȑpl@=p 8` " 8$l>4 " t  t" " " " " " ,  ,  $ `l4``"< `hV> D`"@   ` `(` ('' `" ؀@ *v`( ( ` @2& ̂`(  ``Q `2  `2 ?c"`2 P`2 P ?c"P@=P|@ @@9 @!> C>0` '> D(( @@(`@` !Ā`̢`@&v  "  2  `'  \ 0! `@= `b|@ 0@9 0 ```2  `X,``Y,` ` `` `X,` `Y,` ̒ؔ   ` `(`2 ܀`2 @= `b|@ 8@9 8 `" b|@ @9 ̐   0```2  ```2  `X ` ``2 ` ` ` (`" `@j=̆@=@ `bb|@ 8@9 8Ẑ``2 : ̮ ` ``` ` `(`~"  |@ @9   > D`" ``"y   2> D`"> Db @= ``" `@@=@`)l`(z؀> D`2 ̂```2. ` ` > D`> Db  @ ۔ 2|@̀2 0``` ` @k  27p @23ph@M=h}"@̮ \ `hL@ `2?> D `O @@ 0 2 > D > D @jҔ  29  ( `Ԁ   *0>  '@=S$l@=؂``2o@ c"yƯ`Ƭ> = (aPl̆@~=@0g' ̒  Җ 0_㿘>4`Ho&4 (@g (` 2(`Hp@ 0 `$"  @$ @Hp@  `㿘><>oc`P  c& & & & &  ځ㿘  zR  O> C`>0" 9 ) ) b  ( @(` @@(` @(`!+@ `a2+@ > D`h``@ &#@ `@ ! 4`@2`4S`"`4`4; ) )  ( @(` @@(` @(`!* @  4!>4 @ `\@$(> ='!`> '̴c<'  ' c `> D`" `,->4'Ȫl  7> >`x`ŨHof̂(@g̒  " `(  ` `$ ?͒ =̠ !  "    ``    !$! @iz  ̃Hp@   ($В c `l`"%``4`"`8`@"`8`n$`8%l%`Æl`>0̒``<``4`0`<`c` \`" ` ``" ``" `<  ^v ̀ :!`!+ +*:B `24 `20 `2, > D>0c`@`> > D4@  ;`@} > =4" ``0> = &Ia02 \> D` \0 `'Ȓ@% ؂ `<' \l` `4```8`‚$`8%l>4  t  -`-` % % % % % % >4 |%`͒?`J>0c`@8`  ʖ 0K ! Hp@ ``2S`<,O, ``2E , A, Hp@Ԁ` "'|{> D`h!>4 l d 4` 8`N" 8Y$ l``Ѐ`2`<,,``π`2 ,  , @h,  2|`8`@2x`8ܰ~'#\#`  (Ԙ T w@$ '`<`" >0b|@ X@9 X>0c`@@8`@Ԁ`74`"Ȁ`(  5 > DLj@%lDŽ%l*:`<"|`0 l  "(  @`@8``<"|`@ l`" (  {Z> D l>0c`@``C 8`@@8``<`" > Db|@ 8@9 8> D> `a4 > D cے  ̖ 0ՃHo4̂(@gt`(ʔؠ 6!! 0  \˜ (̀s|0̔ ޖ 'ԃHp@{u> D{qL`> D    0SHp@̂ A{X'3*|s`a43! 0`< `0#\`0> = $b(> = ($8!>0c`8@;`8`<` b|@ H@9 HȀ `H@;`HƔ $ l"h> D`Hp@逥5  & 0/!6!7|!7!7!7,!7!6!7T!6> Db ((!>4c@)   :  (:  0:  8:  > m  @  > m b `   @` *   >; !>)c 8㿐>;a'@@8a a!l / 0  @@ K "[<@ @!z<@@  g K@@@h #> D> Dbb@@d< ?c@_ 2V/$i ```X (@ ;z\<(Ȗ   @*[>   2@<!!@z=<@!z4<  0}  x- b(( @@>4(`@@`> D V '@Cn!z! `(@!z<((`C @<<(y!" 㿘Ho4 (@a     $ ( , 0)>;!@>;a   (@`C =!@  $ !@ @e  2  $@e  2  `2 !@` @8`Hp@    ` > 8 h> @ p> H0 ak0aj >EaĐ >Fa 㿀`Ho(@a 沖 |L G``K` `'8 ~- ( 9`6` "|`" ``"T   2|`El"*:'` (    !> m", , p  @ Hp@``\@` `ނ ۂ > D`؀1 / Hp@*`  | "| @dϔ  2   !> m", , $ @ ( |xHp@ '/ #\/ > m ؘ@ 0X  4        $ ( , 0'> 'بc<''''''?''''' Ho4(@a>;@@@ @ @ @`(`@ '@Ā`!  @d^  2  $@dW  2  ` $$ 8Hp@  Hp@ 1 > =6"p> c<' '> D⾀r(( @@>4(`@ `"C HoF(@ `"K  & `& d& & & & & & & & $& (& ,& 0& 4& 8& <& @& D& H& L& P& T& X& \ 4⾃(0` (( (`?4⾃Hp@ @ "> =a `2 > 9bb` ``'''' /! Пa2ܰ "㿐#> Db`$7>4 c@ b(0`7(0(( @@(`@`ab(0`7><>;a @ `"`+`@ "` 2 "  @2 2 2 `a2 @ 㿘V`. P`:)`% *> D`  0> D b $>;@cY! !><@cT!> m!> m # b>Oc8> 'bА#8 2`@R:` -㿘   ˖ wD? x>;a`0 > @#<8`0'  w  d>  c ($ $  沖 y W$u @@I{ؐ "< 7`($ '؂    //'''''';   >4+`#@>;&@9 ) a@)  ( @(` +@@@(` @(`!3``> Db@<` `` 7@<`` > ={ `( 7vİ 70#p> ;> D8b<' (` 2`A >4(c@( @(`@J>;a@ 0@< 0p`C >p`;> mb"/  `@3  (yb  "$ 7``"` `2`\ {D (  7> D`dЀ`l vs 0 >;a@`0 `C 8`0p@>p > =  `߂ @(`@` `0:@ 8` D 8`0`h@@>`C`>h` `'Ԑb (0`Ԩ`h- 0(`@`<0 (@@b) )  (`` 8(( @@(` 2`( `l`(`8 @@@<`(C`<`8xb@z ` `'|> Dt ` ** b @   h(0`@ -'  ''''''/؀dI/ـl2  2' ''' > Db@k<  6S  ` 7@M< `"'@ʄ '` + +  <`8" >0c`@]8`,Ԡ(`>0~`( + ' ' ' 'Y#@(`@`(`8:@ 8`(D $8`8㿐     $ ( , 0%>;@@>;@@@ @ @ @`(``C 2<@  $ -@ @a"  2  $@a  2  `2 Ho`4 8(@a 8 <4 8 <f Hp@ @`@8`Ho(@     $ ( , 0@@@@ @ @ @ `- `><> =ax   $ <``m-`@`͔  2``$@`Ɣ  2```(0``Đ 8`> #\ #`<$@ $`  $` $`  $` $` $` $` $`  $$`$ ($`( ,$`, 0$`0 4$`4 84`8$``$`d$`h$`l$`p$`t$`x.` "$` ` ܔtG 82 $````-`"Hp@ af J>< $a < C  @`F  2  @`? $   <$ $  $  $  $  $  $  $  $  $$ $ ($ ( ,$ , 0$ 0 4$ 4 8}4 8 x$ `$ d$ h$ l$ p`$ t @-@$ x Ð   88  2 Hp@ 7 <$  <$   $  $  $  $  $  $  $  $$ $ ($ ( ,$ , 0$ 0 4$ 4 8<4 8$ `$ d$ h$ l$ p$ t$ x$ $ m&p> c<' ?$ (( @>4@@(`@` 0  f> :atb> :a|)  "   `Z%> DT \`  - eHoA(@> 9bb` ``'''' /! a1Hp@ Ho4 (@a $`,@$`8$`<$` $`$$`($`,$`0$`4Hp@ > D"  1"a> 9 ?>4@Ϡ>4> = b@_ʔ  \`4 \4 X4> =9#p> c<@' Ho 4> =(@a> =b䀠H>4'> D#@ @_,> m4 b> m#>; a`"` " `sK ڒ 8 2`Ӓ 8 2 @_$> D?> D0b > D bHp@ @ 4> ='> D⾀`#@> 9b b/ `(0`,`0(( @@(`@  `` '?' /!2#( l > Db@ ?`(` -  `8  >E @>Hc  `[>Gb  `[>Jcߐ  `>Eb@1@Ґ  `>H`PȐ  `>La㿘> Db@   ss & k -x>  c<'   `"  .  ` ` `> D>0c`@`> > D4@ s;`@[ Ho ^(@       # ''>;@@@>;@@@ @ @ (`@`C %<@   " @ @]  2  $@]ݔ  2  `2 Hp@40@@`C <<  8  1Hp@ 7 a ```2u  4 "   `0> =aڐ  沖 t 2Y 80ƀ`"b `\"[ v_ (        # '@@@@ @ @ @ /`@ 6   2  @]T  2  $@]M  2  `"  ```:`8@ 8<8qZHp@z > =,#@  8W    8qD0c`'8   (t   8q2 80N $$$'؂  /''''''/٢ U > Dⴀ`d`lH 8q 8Hp@+   ) )  > Db7>4c@` `@ ⴄ(0`@2`hⴀ`d `l"3 > Db؀ > = )b` 8@<`pΐ%  ++ ʈ ) ܄  @ <@\   .. ..$  ><&x?`(68@&%@s&㿘Ho4><(@a><>;a>;a@/ `@ " `"  x`" `& x @pn` 8 2@ @ @= @, $@ 8@Hp@1> m>O#c8烔 > 'bг86`@>`B#!MD!M!L!LL!N`!M!K!K!K!K!K!K!K!K!K!K!N`!K!K!K!K!K!K!N!K!K!K!MD!M!L!LL!N`!M!K!K!K!K!K!K!K!K!K!L !L ![`![ !Z!Z!Y!_!_H!_H!_H!_H!_H!_H!a`!_H!_H!_H!a !_H!a<>Ic"><>Ib"㿘 `( &@  oR  n 7 ? 4  c 4   , & 6  2  @$   `$  ؄(&  &  ($$ g (&@㿘 沖 q 9``` `'8 `so ( ,` `'&`` `"# `"`"%J  ``2( ( ````((Jn n}``뀠`2( ( ``퀠`(㿘 2 0?  @   2 5㿘 oV  &     -" ` `"  " ` @`""`X"  " `  `" " > D`" 㿘 @Z p?& h&& d㿘8`? 2 `." `/?`= ?`0"! `1"1 0`#"7 4`3"= 8`2"M `   { & ? &? & d "   8`;" 8&     { &  0  y { & 0 4  p { & 4 8 " <g { < & 8 8`" 8& < `2 ` "& `T {& `& & <㿘\> = ɐ#P?퀠`@ 퀠`+݀`8  (~` *`+(`>P` @ a&d ـ``(` 1; {R &0 n  @`` / `/@ a& `."`> :at > :a|) ``   {  & ) Ԡ `(```0`| 3ϐ { &8  7 Tki``(`c`#4`2``U  {Ŕ '@ X H@ `(&h @&h :``";` ``2`"S` ``,~ 0@ { & @(  `" l@`l`&l &l  8`4`T `2```2```2`0 1B  3<  06 ``> :`at> :a|) `6` `````@```` ````` ```2` "`@`````` `"`0㿐 #`#\c  {  p&#`#\R 㿘 ?в {㿘@`d`l`&& d& l   {ؔ l& `"" "  " " ``  {@Ô$  V`W `0` {``(`$ 0 B`0F`4` {``(`$ 4 2`42``` {``(`$ ` &``!`8` ` {`(`{$ 8  `8  2`0?L 72``㿐 B`A 2>`28  3 . `% & "@ `)2 #`#\  `ߴ  1  "0㿘>`0 8`?`$` ``   P` $ {   P` "$?| { p {Д ɠ㿘'`" & `4`C `8`o&`8&& & & & & && & &   . . & & &  & `(H |``l`"@:  `''@@* `@@VM  2`8"`<|`@l`":`\`"ׂd(%:҄ `X`͂&`\ ˄  Ȱ A*`\`&  `> @'̦c<' >`0 `  5 8 7 > D&@"` " * * `(` -'`"   > >>PL> D@ ` `@ 5&@  `"~ '̀  ` `2`2 `2 ``  > :at > :a|)  T\`& 1'̀˂  `ǂ V Ȁ`8 ,   ` E a > D{,   ` 0 Ā  > :at{ > :a|) t P\` 1Z$`2`2 `2 ``s   > :atQ > :a|) `J `"n  ` 1 ` @2  @U  2  "    ? & {& `m`"s `2@T`Q@ @2` @T  2` 0' ''''''''''  //''' !'Ѐ 0 1` <2'T\ 1'`, ``"6  "x ' " '̒̀ " `"    $  " ``2 X6```2 X6p> c<' ?''Ԃ݀`(`> =#p>P` "' l` 'ؠآ    .  4 "*  `(`h ( iz &$&` ` `  m> >   0 2  i\ &      h(&`   ` 2     8 2   - d`*  d   "&'  ""'    Ɛ    "Ԡ h   'آ      ''''      А 㿘)`   h   *  g0  ` P`: Ԑ hВ '  " ݶ   "ٰ `" gֶ @ ` P`:  gȶ g¶ 㿘 h  8  `$  5&  h%( ``g 7 7㿘( ؒ (jJ  &@`2` hm    " &&  7e (  @& ``& &` 㿐 ` hJ  0  " , & ?„ , , ` 'ؔ `  e 4` `   h'     g(`g 7 7``@$` ,  ,``(`Υ$ f& 㿐& & a (^ 2 2  `2   gB O$@e  I>  㐔 ($  ($ J 7$(`0`0`(/(%@(`0`0`,`,`i  `2` $ (`(((( (@  f  2$@ 7(@`(`0`0`((@> `c<@' >`0`' @ )`   @ > > f|0   ;)  * (` ; : *fd0܃) >Q>P l   ' g7  '"    Ho4 Ă(@a Ā`$ ` ' Đ  ' ''''' ' a/ ag''  ( (" ͞Hp@0 f ' 6G" 6=752  '  u '`p 9  H   f?c '''''''''fÐ '   Z 0K  F f '" ? 퀠`r (`>P G/ 7c ) >P B "   `"<   `5 0$ 䀦   `()Ho 4 (@a $ o  jb Hp@0   `@'6"> =75> =j * < (@$ Ȱ  ` @'! ݰ lհ   `   ư   `@ *'   `@`X'`O` l $ l  7@') >P* >P l0``' l0``' l0``' l`' l @@ ' l0``~' l0``y' l0`u' l0``p' l0``k' l0``f'> ;c@ `' ]' l@$ l` =$ l ; l@$ l`0  /$ l l@$ l` #$ l l@$ l`%@ $ l  l@$ l`  $ l" l l  @$ l l @ ($ l >`  ,` 0` 4` 8`> ;cذ a8԰ $ Ѱ " l l @$ l lð  $ l l  $ l:`Ԁ" l l  @$ l l ] ($ l l2   /Д  l  $ l l{ m (t$ l lo G (h$ l߇ 0 <2  ' ' ' l ` S$ l l ߂`M$ l#<T> =a؀N, 5 < "N' K'à<, # * > =aԀ.,  2 aЀ!,  2   ( $ l ($ l ($ lݰ  ($ l  ($ l ($ l ($ l2  > \c<''|'x' ``la*``S 'T'X'\'``L'd`0`$X `j* 'xXc c\b`bdb @À@"x U> >`4`" `8 `\C* 'x`8`" `` ``7* 'x``` > > `d+* 'x> >`x`j Ho(@g h " `(+  ` `$l֔ ҂?h <h !  "  h  ``    !$! @NQ  Hp@  xx 8`q" 8Hp@x`k  X` ` \`"`` ``"d` d``   AT E'x1' 2 8;@ @ ?c؀,   T ! 'xT 'Ȓ  'x,`,`0`0`* * d  > = d @d ` <(,X` > =` (,X X"X\`  <` ()\@ \#@\``, ׄ +` ()@` @`#@`   ``2`  ``*Q `(`@    2 `2  `2 `2 `2 >0c` -'x@ 8``>0c`X@8`X v'@` `8``<`d`#   ((`@(  ` " @ (`@0`0`,,0`,,@"] ,@`uHof4(@g `(L k_ N!! H  BW @0|0` q@ 'xHp@xȫ ! 'LHp@@   'xT '"'xX `@ "a> D tHp@ A`'x܂0'xFx 'Ȓ /'D'''''' /(#\ښ| $'x A >0c`@8``"b|@ X@9 Xt @#\#`  (x o |`"`P@8`P 'H` |b|@ P@9 P| ``"4` `"4`|0`2'@tp k'xte( ݆%`" `h`"'t  ˀ``\` `Հ`" `ǀ`" X```@0l `*hܫ F`0`   AL ; :!`! `*:< '''''''''> =#> =#Hp@`z|b0 " T \"|@ @9 T \`>0c`@ 8`"|@ X@9 X 3'x`2P0O&& &&&&& |`2`P!`U`"J `?`Z` ```S`  > :|(@(``2GF``@,> = (~#%`h`4%'t/  ``;X,7, ``- , ), *:`(`l`%p` ("|``  l`"@ @@: (G'x``Ѐ`X,,p`]t[@0'x``` , ,   2> D > D`" ``2  `D> D`D`@J۔  2@  `> D7 ` \`  `` ```^ޠ 'xW  (`"Q?c8't``"\` ,(t( ǐ 'x`"  b|@ `@9 ` '^$  2 gxc`x@  8`x"|@ p@9 p@H'xM' " x`>0^ ('x|@ h@9 hz> D`"~ > DbxH2v  "o  ``` ```2  ``2  @ @x`E>0c`p@>8`p (>0c``@8```2f`X`2b`  ,a,`"q b|@ h@i9 h㿐@  `  &>0 `)>0c` @8`"  ! df   *>   2 >0c`@8`! @`(`&@ Ր 㿀   z ं`@? ^'  p ^ǒ   (`$@$`!< $`($` @$`$` * , , ,   :```* ,  0ޔ t  ה  $ ........Ȕ `"9  : ( * 2 2 ..> Db.`>,a  '@ '/@ 9 '쀥 /"|` @9 ``*` > m#\`?c  ' ``Ȑ. . 퀠"|`!@9!䀠"|` @9 ڀ"|`!@9! e > 9 b^ ]>㿘 > D`X2` > D`X6 $` @H   ``. 㿐 ` C  @`P>, `" \``@`F` `@``` ``" X   ``" ``"   2 ``` ``.` .`  c$   `*>  @`2 >,ah @8h  \```"`` `2```2`````"`  `@`"```"```2@0``` ``2  X.` Y.` `(`#,@/q  X@ > Db2`` < +> m`/``, K (`@( 3_ $ ( %c "!` @H   " ``$`` `"`@G  2Ҁ ``+Y`  `N ` K ` @G  2$ $$ (?` +  $ ($ $.` Y$.` 㿐> m !> m#,  c,   , 7, ,  É > m cP㿘Ho 4 (@a > D`Xbܐ 2`@G  "& $ ``  2ݐ 2  & $& (> m cHp@& $& (Hp@㿘)> m#`6Ho3(@>4`h%# `; ` ` (` `$$ ( %# ` ` ``2` 2 (Hp@a>4`h%#   $ $Ϥ 0!!!!!!!T! h`G`` ```  `5` 0 """"" """ "$`" "" 㿘Ho (@a   @><c`  4 ( (@`,  ( $ $ $ $ $ $ $ $ $ $ $,  ,`$ `  $ `$ `$ ` `, `4 `$ ` X4 $&@@? Hp@&@ Hp@㿘'LHo` (@a   @> Dc\' 78?c "T<* T < (`0`(`(` <䀦 L&@@@? Hp@ <@F[ $$$$ $ $$$ aL@@@@/@0) @@@$ X, 8$$<$(`X488" $,H':$,$,\$4P,!$0T , `  %`,`0`(`(`  @  ) -@ !  ! ! !  ` Ē`` ߢ+`m4:ݐ> >`PD L&@ Hp@㿘 @    ް     * w     퀤 #  0>`p |㿘b  hY ``0 `" > > xY  3*`*@ *` *`*`*` 2 U 0> > Yg   㿘> Dc` > m( (㠂?(2(1><><#0 c c>n ` `#cs.ү3> > `㿘 9> >7> > 2 ` @: $ (``@ @    $        $        !! 㿘 z> > `x> > `g> >> >a %> D#> D`b c $>, `U  "8   (@`62"*`* `"@& & $c $ >, a @@> Dc@ +;@ > >a& `*`"c c`c >,!`?@9& $&& & & & & & & &   & $ђc&z!Hx!h0   '> <c<@' ''  /''''/ؐ'Ԁ  4d2M8`"J8 8`w" 8'Ԁ`  @ o> ? " ''''''''''''''''' <'zd'> mc''  QԀ ϰ ԀH?08 8 4dd` 0`" H`" > Dc א> >b0> > b8 0`逦 @` ` > DM'Ӯ 㿘 `A> Dc\ 2+> D (> D@ 2  P`"   ( 2   , 2   0 2   4 2  `><c"X  @  ``> D `X> D0><H@  @ 㿘Ho``(@a`> '> b4@*t& & Y $Hp@& & 2 $Hp@㿘`H D l  4``X dda H b `> D #`  ' '  ``\ (`8` 8`"7  " W `'  `   \̔ `\` "Oa aӰ V a@ 0  O `\`ڐ A * `\`ΐb|`2ɒ  > >  bHɀ(:  " A 8 <$ 8 4p , 2p HѸ (`48 > '7 > DMcs  2`\ h "  0 4`M 0(  $ h 4A> '7 ' > D(c R(`' b|> 'b @)l# @ ɘ p> c<' `0`H`<`4    M  7 .! )> ?`4 ` !> 9 "@A  `  `"  "@A  @ 2" $`4̀$"\`"` \`` `0 `8 h0> > ?b0 2\ ;&`4,X4`  < &`H > m#> mc` $c @A < $$ >na ł?4 $ `4> Dd&`4  $ $  > D`܀c ` `<` "`4@ϐ?. $ ` 4   i>@ i,> Dc a> ```@\&`< `" ` `$` Q&`@`N)> mT\`&` ' ''?'7X 7''؂?/ > m`" ``"   2> m `@? `$` `4&`H{&`4` "U= 0 ` > Dd< h`0`,X4 `4a"*\02  `` "q` `"m`     "  # "&#  `R ` ?2 ߐ 4  <`4? $ 4 T\` ' ''?'7 X'?7/^'耢 > DcЖ0> > b0> > b0 l> m i> m @@  2^> m)` 㿘 0` 4dd" H . 0`*``&V `񀦠2   > D`& @  6  <> 'b|8` א  2 4@ > c<'  ' > D'` ' ' HHo<(@ <@  "BT`  2ET` <@(@b4`@Hp@  < @''''''''''''''''' v< _  ;a  <@  2 T`` <@0ŀ`2 <`" <> '1> b!4> D!4$Hp@@cr0> ?Ͽ 㿘 Ԁ`> >@```""` [ "[ 4h dd H   0` ``" ` H `` `ݒ  @ @ @ X 2} i`0 "  , `"*  > '4> DCc ` $  2 @E     4߂ ? 4 "L`5 "4T`> D`> D`@ ` i`@?@ " %> > c@0  S0 $  π`"4`ɀ4 `,` i`@`   4 4> > "#㿘#><c > D $` @Y 2 $c > D $` @F 2 $> Dc\ "  X@6  2 X><H@=> D`> D> D`/> Dc c  0 `  X퀢 @ 逢@" \ː @ @ @> D@  > D㿘 h`` l&``> C` > > 0 Βcp`> C` ځ loav8&`&`"|`Ӟ@㿘  |k 8  @* a0* )a"  #| "@& # $ $ $ 㿘Ho!><(@a!>< #0>ng`#0ˢ.> :a)> D|`` "`q`$`2|Hp@#`4 )$``, |# @%$` 㿘Ho`4 (@a ` &  Hp@  > > <> >| H`` @> >z> ? `(`0``߃(`>eP > Dc6-& > ' |b@$Β#F @+ 0 > Dc6 &  <$  Ö  2Q& + 0   `* > '6 > DGc0 ` > ' `  0& > ' 1b@$# @ 0v  & 6 b#`#] Z#㿘Ho!><(@a!>< #>o|`P> Dbʶ#><c #> >4 >4 a4: @' 2 >4`h #> D#> `" > D  a4 @ - " a4 @  " 2 > Dc\ #>  8"   Ha4 @   2 8Hp@ǐ @Q 㿀> c<' 0l0 0HP\&M0JaJ1aKY  aL"b&`(?0aNׂW |`$` ƂO Ho(@> Dc\'>4`h   `@  @ 2 @`2Hp@ UV ><cH&` @ Dc\`m8?7c/c> ?`p  ` `L,,(  @@ @@1 @ +`@@@ # `X. $`8 & (`<& ,@`X6 4`@& 0`T *  .@#`8 `8#`< #`@#`D `9``" 3`: 8@^    $  6 6. %`` Ȁ $ Hp@, d ``2Shb`@@B `````'''쀣`'`"`Ho Ă(@S  H R &`( &` R &`$ &`,Hp@  @;!(Ho(@><c#> ?`0 ,`" @ , 4 "$ $ X4 ( ``     `,` ``܃,`4 Ho``(@@X><c @` @Hp@ @ `0` `4 ` ` ` ` ` ` ` ` `$ `( `, `0|`l@* &``"8&`&`| `&`|`&`|` &`|`&` |`&`$|`&`(|`X.`,|``Q 8Q a0ad> Da> D``%怠`"X7Hp@" ````> ?ʷ  h`G `` ` ` `5`" > mc2"@2>9a, 㿐 "H3> ?  0``` 0#\ > ?a  `&  s 0 > ?ؒah  0> ?Ғa@""`` `? &@&`$ | ` >,&  ͐>,  `> m c@㿘 " > ?  `" I!㿘 > ?  `2 `" 3!㿘> Dci u"    ? $$ ƒ | ` & >, o>,> m c㿘 >y c/ i> #> c<` ''''''''''@' `@ gL N=  c`8В $!<$(@" @$$ c :$),,, ```),?,@` ``'' ''''''''''''// /ـ/  `Ā` X 7Ƃ?'7''ж. ĐÒ) (#\   Ԛ ' '' ('?,(.`0 ``l`"` "  ```"h`  . h`, 0`0`,,66.`6 : (.`.`.`.`.`Ð* 2 2 .`.`#\   >,"|` @9 "|` 膀@9 >,adX@ 8dX 8`q" 8@@ t> A M(`2.$M0?b4/'*/` `` .` .`  i2 ``@`" i  ?@$$ `@8 <  ,`.` i r`~ h}| |,   8`%" 8L0> Dc"> ? bh```I .` F.` 0Ð0p > ?(ʐ"> ?"@ > c<'''''''''' #>  ic` `@ M Lϒ  c`8ߒ $!<`$(@`" @$$ c :$),,, ?```),,''  ''''''''''''///؀`/` @``''''ТĐb  y v `(rm h H '''' <?,((.....00 ``" o  (`0`0`,, : (..j* 2 2 ..@ #\ 褚 >,"|` @9 "|` @9 >,adP@ 8dP 8`" 8 > AM (#\    W' ' ' '?b4/'./ L"(`2$K0  i  ?@$$  @7Y<  ,`. i  y ``p . l.   X'7Ƃ? /'7$'̂```\ . Y. > Dc  8`" 8K400~> ? zc > ?(["> ?"0 ` `  \``@2`0`  >sc 㿘> D㈀`2  > m  c ㈂c ` 5> D& Ȁ` `l> ?`\`Đ 0 > Ѐ cX 03> ? %cP  8 |ה A & ` ` ` ` `&> m>,& @a> Dc  #a& ``& && &&.&@ > '!b&@bБ0!:  x 0 0> ? ݒc&m 0 > Ѐ cX 03> ? Γc{#_ > 'b|,`@~#l>  c<'     Ԕ  '> D *` @`7>, Ē`  `3+> Dc`` >,!`@J09 > AP    *>  @`2 >,ah @8h `耠`쀠``?c +> Dc`> @ H`H^c "d+> DĀ`ŀ`Œ`h l  (``R `O`K`GE+> Dc`> @ a%c> @a > Dc"x >,> @a o >,> @0` c`^ >,y> @a Rcc`O> @ ג`xc h`* 0 ' ''' `D"a i` @"[+> Dc`&C i> @ aHc z Ҁ '' ('''  ''//  `4`0`I(0+> Dc`> @ q`c``4X17 > Dc> @ ^`0@4  b` 䀠`耠`쀠``0ʀ`2+> D܀`2+> D`2+> DĂ``?`- `耠`*쀠`'`$> 9c,c,` ``''''X7怤 `@ *˜0  Κ  > @a 0t ]  l`0'   8>  c<'     Ԓ  `(> Dc >,!`@Hj9 > AFC 0> @ a >,  b @`k`Đ ````ć((`@( ``4``Ń4``Ԁ`a> D`1 oԀ`^  (` j``8> @bZ H0ł``σ4` X`7> Dc" >,ې> @b0B } >,N]    *>  @>,ah @q8h 0ς``Ԁ`2> D Xc"Y >,> @ b`S >,2> Dc"K >,> @  bE >,> Dc> @ b0È 7  > Dc"0 >,> @ c* >, i` @> Dc" >,s i?> @ ؒcH >,   x`H`t`0`p`(` 04` i`-` ` i` @ `&`6`6``4'`4` N&`&` ` ` CGG?&` D  ``   ` i`@3@@ @J > >c@ s 0  i `-` i`@7` &`v6`V``"6`26`` Ho 4`<(@a`<@  "i> D@ Hp@6``42-`0@ ` 2V` р "V` > '6`> Dc]V`2< `耧 0倠` > '6`> D{cG0@`4d\'`4`<> 'b|h` 4K > '6`> D\c(?"|> '`Q V```<@g0㿘Ho (@a   > @ = b``L> D`` ```@ @  ?> D& `2 @"`` `? $@$` | `V& >, Hp@ 0 > Ѐ cX 0> @ zcHp@c2G @"M`` `? ?$`$@ 0 > Ѐ cX 0 > AS`Hp@> @HcHp@T>, 9c0̒ > 'b|`@#ِ0> A0`X$ @%0> m c@ 0 0> A `m@> m cn@  T  @ 20 @  2 ` > 4@`  "@> 4@"`` "@"` > :at > :a|* ` ><H@   H> :a|* > m cā > m cā㿘><c 2  " @2 @1.  2P 0` ``"` @1  2  4h`"   D@1  4  0'''' @ _ 0㿘 ) Ho 4(@a`"  Hp@```X6 >{`x0㿘 < 8  > Dc  > AA`  > 4@ & D > 4 @ & @& D& @ >  Xc<' ܐ ` }\  x@0 0@1T   /m/l tVtx@ |@ 't'x'|`f' `'<(@x(@t@(@(@|@'t''x'|//  < 8'Nb''TaI`@'Ho (@a Hp@ 50> Dc=0  ?`0/(@'t`4/( @'x`8(@ '|`<( ' < 8'''@s"X$'> Dc"Ӑ  > A[aȐ  > A#aHR  > Cؐ!㿘> Dc\   @2  X X2  , " 㿘 T    _  "  H "R ` 2   ! ? @ >`p |㿘> Dc\ 20.,@  `"&  P`2  T`2𠔠  2ꠔ`"研`  `@"` @2`_```2 PΠP  D@/^` `0``<'''`@''`4 Ú  >  Pc<'@' > Dc  .  X> A 씒a@ m> Dc\   "  P`"  X X2 k  " ܦ ݒ  "P  ( , 0 4''''''' /`緬!   >'''''''''''''''' '@''!<   Ԧ > DԀ`" Pg  P`& P``8"`8> C!c Ԁ` > D@`" (``2@> Dc"w   X 0 > A a0k @ X #\#`#d 0 > Ab@ԝ>  Pc<'' > Dc  i  X> A ϒb > CO!('آ  //ؔ '''''' '// (Ĕ ''''''Ԡt  D@.<؄'x'<   1> D P`& PŐ > Dc\ > A0b/> D"  P`2  `2  X X"   8`` 80c" X0> A c8WJ "  " `" ؐ X#\`0 ; 㿘%> D\ #  L " \ L@"  " \><c L#  @"  P`i "  P$ P  "\ `2 L ``2 L  2 \ &> A% c'> D@"  P`\2  L@B  #>4 `2 L ``2 L  2 #>4`h ` `@"   "  2=`h 2 `hK`@" 2| < P`" 0 " `" +  X ꑒ  " P` P  `@"  "  J 3 $  2 `$ P  X ax P  @"   P`" $ P  "X\ `2 L ``2 L `$ 㿘 ` 0`F`  (`2  `2 `@" `2  %  X2  0 "  `2  @2 ` @" \ \& \Ғ  " "  \`& \ǒ " "  \`& \㿘 Pb|& 80& < \`Ho`<(@    ? @ T&  & }% | 2 `*$ Hp@ |}{ː " \> Dc" \:  X 0> A 青c \a > B0`鏐 0ҝ㿘  |{C "  T`" T `& T T" C㿘!> D  "|` 0@8`K @E ` |{ >G `2& X$ T ( ( @  Ho  (@> D\\`$ \   \$ Hp@ L``` `$`  a> D ` q 耦`> Dc"〦`  X 0> B `(ր`xHo(@a  (`?  `L@  L@ $ L`L@@  L@$ L`L@ ``8`<`D`@`H$ 8$ <$ D$ @$ H`L@ ` P`` "ؒ`Lu y `  `;> \ `2`2 `X20 "`@"''''``" `8:`<:? a4 @   a4 @ 8 '쀡* '쀡8'쀥`"'''j&&&&!4&"`8``" " `8 Hp@`8`  \ ` $ \>F   \$ \Hp@y Z`> Dc"U`  X 0> B `xH``8`'`L0  > Dc`@ `X#\ 0> B `0])`L > D L`6" 8 `<`8`<X V`<> 'c<' WX   '' ''''''X'h'l'p't'x'|'''''''''''''''''///  ' ///''d'\' '`'<  8s`" & $ 8` `& $  > C 8& $> B!!@㿘><c  '' '//'''''''''''''''X'h'l'p't'x'|'''''' />  c<'  ///'  '?؄'\'d ''`'Ho 4 (@a Xa<  8`C 8 8` & $Hp@ > C}!X㿘Ho`4> D(@a> D`P> D> D`K> D+><c J> B a "_  $@ `" C` ’ 퀤Z   H R ` ϐ@Hp@c> DHp@ 0` > B|a8Hp@ 䫒 " $ H " $R `4 $cc㿘> D `b|> D`: $`+ ".    ? @&& > Dc\` 2 "`#```" ; `$ y |Sע >< c  $ > B0a   |yk㿘 b|Ho (@a A h`|  $. 6 U& ސېE"L  %><  ? &&  "!$@Ő "$@6 $@$`  @$  `% Hp@`$``  `> D` > D` ,Hp@0%>< ``> D`䀠 (  |w;  (d%><Hp@  >  c<' "|``H > D``2 `<@ > C > Dc  >,!`@;90ːȐ` 0> B ,a >,䀠`> Dc" >,> Bb  >,``> D   @`0`⽐ `` ` ` ''''''''''`5> /4``(`'܄7֙+ +`) @  ' b8` "` $4 |( #@3> D$ c`$` ` ``(((`@2$` 2,< +T(> B3> Dc\p (` D `2  Fc`"  > B䑒bpT!p>,ah @58h D"4`"4@?(` i` 9> Dc", >, i?> C d`! >,AX X  *>  I@ `(! c`"  > BGbT> Dc> B =b@0    0݀`w`p`` `@  `@&    /i/h '\ 0`(`' /0``(`' 4/    ((`(@'  ((`(@'' ?DT((`(@d8> Dc"\4i> B ϒcR4 $ l %> D@F$C4 `` c`" G 㯐  TT ޠ ܠc"$41> B 㖒c4kc`" ! > B ㇒c@T2 X>  c<@'  `^ > D`> D`2 `:@ > C > Dc  >,!`@990ݐ` 0> C A`X >,䀠`2 耠`0   D @ 8 ަ &A@(` i` :> Dc" >, i?> C  ` >,`2 ` > Dc> C `0>,ah @8h @    *>  @   婚 0pb!ℐ "#"#$"%"%"%\"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"%0"%"$"$"$"$T"$("#"#"#"-0","-",".X","/"/","-",",`"-",","-".D",`   @` -   >< #P>)c 8㿘): ' #8ݰ i e`8  # )Ю  % 8> c<@' 'X'T'H'L'PT 'x''|`$`` `P`2 '  8gR?8_@ `` P`: (;(  , 7   |`'` "` ' ` `@ (;  2  7<  2  7'`'`#\`H`,q V K `H"`p4`2I<`p</ (@0```0// 0/ `v/ N|/ `  P`: `Ԁ`  `( >Ut  t4@ e (4@``l& (`2#\ Ԡ` 'P`:><cP`0@[8`0'|`S 1Q'> C!|`(-b|` @9 ->|` b|` @9  -|`" >,b|` @9 ->,a @9 |`-b|` @9 |`-b|` 膀@9 |`-b|` @9 |`Չ-b|` ؆@9 |`ʉ-b|` І@9 |`-b|`!@9!|`-b|`!@9!|`-b|` @9 |`-b|` Ȇ@9 |`-b|` @9 |`-b|` @9 |`}-b|` @u9 |`r-b|` @j9 㿐``"@` ?`(/> 9 + > Da@3"> 9` '>< >Y`㈔  ̵   v  @`?+>Y> 9 c'><>Y`#\㈒#` z p> c<' )>< #P'Ԇ@=#P``2`` `"```2'``"` '؂ '/''''' / ت`;><ccЮ` #P" , F @` 2  la"  v`@ ,` , 0`"Q 4 ,@"*  2  `   ` $`" ( @"  2  Ԁd`@?`@ " Y`@?`0?l=@4 @Ԓ P 6Ԁ #P6 #P`(@ 8`(` , 8`" ?@@ !?c2f'50?c2V`0@3@Ԓ PY 0€'沐 8  0?l@T@3Ɛ@Ԓ P= @5Ԁ "`(5`('Ԇ@?`(?`"p g #P @9  b; @9 ; @" `b|@ (@9 ( #@   >0c`P@8`P?M@'5u>0@> CH!>< >]c(#h> 'Ԡc<' `   (``0`> CR!.`> -'Ԁ5D O`#> Db`؀ qޒ '`Wဦ ` 'Ԁ`  Ho`4> D(@a> D> D`M& 'ԃHp@y ^T 9 `Ђ ''`' '''' /'ԐxВ `> :aR 1` /```#\`H`,Ԇ '`,'`0'`4 '`8'` '` '`$O'`(dNp` > 9 9Y'Ԑ0X; 8O'bb` ``'`('`'` '`$ B6 @'> :a 1`" 14'Ԁ`2Y` `2U`?c򀠠2M``2I`'`, '`0'`4'`8'؂  ''''''`//ؒ '> C#!`ؐ><c 5'ԃHp@ ?. v& Ԑ  o9 & ؀ # ?( 2(ۀ  1 `" 1'> C!Ԁ`Ȁ 1'> C !4 'ԝ>  @c<' `'d>`0 ` h2 Ț 'd 3hђ?3ސ d "  ` 'd`n /'d`2 < `2  < $`2  < (`2 < 9'd ,  06   7` >`(0`(?c@E4 4 4  p`<.(@0```0..0 .. H`" `4`" `<ܐ.    (4 *  >?4 t, l` , 2&`( #\ H 3 y'd4 `G 1 ` 8 `  8 $` 8 (` 8_'d''' ''' ' a   #\ H ,d  d >`mxG g'd0.`, 1*'d('d> C!㿘> DР  @ ` @ @@". 4(( J" m*  9> Dc `  4@6 `& 0 4 2> Dc  "$ o J$ $   JmӔ  > D#g 4> Dc  "& oj J& &   㿘 > c@> D c@ @㿘 > D(c @㿘`  +(`> Dc 0~$ (`$㿘   `2 2t ( J mv   1ɖ`  P`> D(c@ @㿘  沖 4 #Ho` (@ > DcL  27Hp@ 7Hp@ ;aߐ 㿘 `(0`B> D8c`;`%`  m &   Ho&V(@  y Hp@ "K``n "`Ho&3(@yӚHp@ +@Ho&(@   y Hp@ gg̐g> DcL `` `@4`P(` `"<"t> >a` l.*@  "> >a\ 3"*@  " *@  " *@  "> >aX΂ 2*@  " 㿘> >`   " @2 А@ Ѐ 2 㿘> m o#ȁ > m> Ȅ>b\  >>b >cX 㿘> E` `  "  @2  > E > E  m J 㿘  Jkܔ   !> E  >" " 0  `4"  y`$`$ p>  "c<''''''''    > C $  //ؐ h Jk 'Ԁ  `&&`Xـ`s`  ( , 0 4 J''''7ڴԒ@q`l&`Hـ`"m X`  X \ ` d z''''7@Z`d&`Tـ`"e ,`  8 < @ D L''''7@C`\&`Dـ`"] \`  h l p t |''''7@,Ԃ &`P0ـ`"U `` x`" $ H( $ {( $  //  ( 2'7ڴԒ@`&`Dـ`` X b'7@`&`Xـ`` , 4'7@`&`Hـ`` \ d'7@ڒԂ &`P0ـ`` ``" $ 0(F&`T"㿐 ``" a  a` p`` }`" `` `" P``` `P```2&d J j S& a'`d }`Z  0@>`0`t- F `&`( Q `'Q ``0`0 0 `(R `  `' &`, Q `'Q ``0`0 0 `,R ` ` }`   | ( (&`@' | &` `@! } '` @`UT  @G " ` k J@  ''  ''쀢 2E/ 3? lB > @ 0`/7[  `@`&`&@ (@`20`"(@D @`@ &@&`   ``@&` // /㿘@! 6I 㿐 ` P  ";  P `2   "&    䀐2 !%`"! !$``! `"!A!``!A`"!!@``!`"!P```!`"!|P```!|`"!P```!`"!P```!`"!P```!`"!\P```!\`"!` ``!``"! ``!` `Ԁ`  !`"! !`2 H!`2 2& Ji '  &&`@9&`@  `  " &`@ڔ  `  " &` @˔   䀐&`@Ȓ!$&`@Ò!!@`!`&`(@9 !`&`,@0 !|`&`h@{ !`&`l@r !`&`p@C !`&`t@: !\`&` @є !``&`$@Ȕ !`V!`L!`B!`  2ې   ܀" Ԑ  Ɛ P  Ԁ 0 P&`@t !`6 p4  ܀i  "j b ԀO  "P H&`@Z!&`|@:! !!@!&`@!@V!&`@ A` '􀠠! @`MT  @Z " ` i J`  !0`''@/7  ''//L  `@`&`&@ (@`20`#(@5 @`@ &@&`   ``@&`㿘  1  &` ? 㿐  (@`@(`#( J g 1  )4 4  ` 0` * (```#    `n`=`"  @Gi  J   @;  -5`% - 5  2 > E`  `"  " @"m 2 +c,'ʒ > E` 2 0& $ @2  ,  @  -5`% - 5 Y 2  22 + 5> E  ,@  `" @2"  " @2 {   ``2 n !`3``2 b` $ `@ J`p f K 'h @ 'h', ,  > E,5 4 $`'l! @ ˒'p@ { .`0``(``? h@ o'|@p$'@kᨐ   Θ   @Oh J`l -` - > E > E&`! 7   ```` @```P@P``@``"`P`````"`P`````P``` J f  l@  'l, 4,4$ ``2<`3`lJ '0`4 `@'`04@``` `'P`0`4`6`R `l ``'P`0`6`6`R `V ``"`'P``06``߀`2R  6`R Ԃ`@: ``"''P``06```"6R ܂`@! '  .6 )> =+> =/> =;> =-> =9> =(1> = 4 4 ,> =|`$ !$ a$ 8`$ $ $8$ a$ ,8`$ ($ 48$ 0!$ <8`$ 8!$ D8$ @@' H4 > =x`" ` 4  ``2/`l<> > > aP @%7> ŀ Ą P> C @b؀ 6  4 4 ,`    ~l @fÒ J ,> >  b@  $  , 4 !4 > #b@  % 4 4 , P> C @b耢 -  4 4 ,6b`> > C b@Д  +  , 4 ! 4 > > C#b@  > ł 4 4 , , 6&`P> C @b ! 4 4 L,,> > C b@    4 4 l, P> C @c ! 4 4 /,> > C b@   @ 4 4 Q, P> C @vc > =" 4 4 ,> > C b@g   (, 4 !44 > > C b@X  ,> ł  (, 4  $4 @`!  h  @7@'h "`h ``a   e J㿈  ` /''耦 '>`0 q```(  m =Ho (@a>-apHp@# @&Ho (@a>a Hp@&&㻰> c<@' '''  @'> E 2     @2-> E `D  Jc  ' @  4-5 >-`0``4%3`' &```"@`@"`@`2`'(p@Y e J'@C' i Q O7"N @`@2 @8 @-  :'&h> >H`!>  M  @"  $ $   0$ /d   0/e7f'h 0Ȕ 0$ h``(`>ƣ Hp@ ' "d Jd J> c<@ &> C  ` (`>Hp@ ' j@''Ho (@a>,Z`L'Hp@" 7a '     (@ ق  (@#( > E(`8  > Ea@  @ G0Ho4 (@a ``  3`  2` ` ` l1 ͖ '@?``Hp@ 0Ho4 (@a ``  3`  2` ` ` l1m g .Hp@В l`~0d`h`p`\``` ` > >a  `2'Ho4 (@a  `  3`  2` ` ` l1#  'l`R0d`h`p`\```` > >aņ  `2'Ho4 (@a ``  3`  2` ` ` l0 ۆ $`4`W8 n' "0@ / , ' 6,@ 0@ X``#\0ߐ'    Ja ''''X@ |2` Ԇ '   0Ho4 (@a ``  3`  2` ` ` l0q jdt``x  3`  2` ` ` l0Y RQ  `"  J `` " "  "" "- " $  h ```  ` -h0` `,` `dl\p`#`#\@ 'd'h'l'p't'x'|'''''','0'4'8'<'@'D'H'L'P'T'X'\'`4k 0Ho,(@a,x'0,   0 8A`" 8@ 0  0  ]"Hp@  >'    0@ `@ʀ"$   `% '  j  (@c$`"d'Ho`4> >(@a> >`   `  @ 2 Hp@Ho (@a>)̒bHp@ْ  ` @`> E$ `  J`7 C' 2 8 > C\b& 8'T J`& 2'`  (@$  0@ 0 > CDb^ 'P J` ' 2> C b3  '@ʔ 0 K `H  ``EHp@~ " $  *(@" '&' l`@0L`J@"@`@2@"` 2@`\ @d` h`2'p`2'\`2'``2'd` h`2'p`2'\`2}'``2y'3-) 3)'$x $   % >30T , `` `, ̐ | a `    3  2  ` `l , )$  @)$ @` @ n(`_9 =$ `2  0 `   n  R`’` D` n@(` _ !$ `2  0 `   n  R`` "$ $ , $ `$ d ` ` ` ` ` `Q2Hp@ 7'  D@ʐĄ''d(''Ԑ  8 q  !' "   Ȁ-  ̄? @$ $  " )r ")l>< 0> >`$  $ > >x` x>( 0  Ȃ ! $ | | ` ` ` ` `2 ` #,   ,  ,  , , #\ > HcH  ؔ  ͘ 4 n `Ć *''''' !,! ' )T'` <`2'@`2'D`2 'H`2 '@,  @ (@ $ @@9@l@D0)''''' !,! ' @,@ !$0@!4@!@ @s (@o $@k 8@ <@ @@ D@ @J @F @| @x dhl\p`#\#`!@!@ِ@ @'8'<''$ 'x d'*[$ +w|'@,@!$0@!4@!@ @ (@  $@  8@ <@ @@ D@ @ @ @ @ dhl\p`#\#`!@7!@w@@'8'<''$ ' ' (T''+Hp@ '"y"~"~"~"~"~d"~d"~d"~("~("}"}"}"}"|`"|`"|8"~d"~d"z"z"~d"~d"~"~d"z"{"{"{"{"|`"z"~"{"|㿀> c<'  @ `( & (`@2  `2  ` ` >`0` @4"   @ `> C`7` 7+`> E `(@ `R?`  (`@`(`3``"݀`ۀ` P  (@  у3`>  `?耡 "8ư ) `2  ``(`&&@`?`( (` (`3``"``   (@  3`ʀ "  (@  (@  H@` (~ ``8z ``u@` (q ``(`k  g e@` 2a ``[`` (W ``R3`@` @  `D``@  &; `27   y@ (. ``)? H@z # H@֠@ "g` ````8  `"[`  (   ` ` @(``@L` ( ``8 `` >@L?`2 @`  ? "3`  ( ```??8`(`@"d`ٰ  (ְ ``2Ұ  ```2Ȱ  \D ( `@` ` ` 2  ` `8 "  ` `8  ` `8  ``@``s#( (> E`@  @2 ``` ` 2  }2|  `w 8   (@@ `( `k`(` fd 8   (@@2' `2Y '' @ '  O``"("""""("("("("("(""("("("(""("("("(""(""("("(""p"d"X"L"@""""""""4"(""""""""`"l"x"""T`G"? ` ` * ` * ` *`" `*!` `` $h" $` `` $`@" $` `` $@" $` `a $@" $` ab $@" $` bd $@" $` d2  $ ` ` $`" $@" $ 1`!  a) `$N ) a`l"O` ``"`@`V(```"`$@`(S(``$@ `! `$@ `! `$ `! `$ `! `$ a! `$2 " d! `") a`l2`` `"`@``2` ) b! `$>> )  )  )  )  )  )  )  )  )  )  )  )  })  z)  w)  t) ?q) ?n)  k)  h)  e)   192 ! ! ! ! ! `9 ` "`! `9 `9 `9 ` "`$ba`! `$a``9 `$`d`9 `$d"`9 ` "2`$```! `$```9 `$`` `9 `$` "`9 ` ""``` 0  (.) ",``! `! ` ! `$! `,1 ` " 0  ( ) " `` ! `1 `"`! `1 `"`! ` ! `! `! `*1 㿘' P 1``A) `,`"+`&' L 0`"-`2((`&' T ' D ' X ' H ) `&' L 0`ـ`((`>T )  )  )  )  )  ) ` ``0`"2 `0`" 2 ``2!a 000`"``"!a  0`"㿘a`@  $`0`4@&㿘`B`6!㿘```0`0`(0`&a`J```&```0`0`(0`&a\3```&㿘aaP`00@`" 0```20`&R   P`&20㿘aaP`00@``"0`&R  P`&0㿘aa|P`00@``2 0`&R  P`& 0㿘@``0`0`&@`@) `&㿘````  ` `  .  {.㿘`/%! n*  Wѐ?&@(`2  " @2@@ 0@@  @ n @V`O` ݲ!"@@YS n&@㿘`!!| n*  W &@(`2  ``"@@Y5 n&@ 0@  @ n @ V`` @ 0@  @ n @ V` ` 㿘`!! n*  Wc &@(`2   " @@X n&@@ 0@@  @ n @V`` 㿘}\&& & & & & & & & & $& (& ,&@&`&`&` &`&`&`&`&` &`$&`(&`,` `   `ZV``R 0 .@.`. . `K`G  yc  y^ eeޔ` 6 ?.  &  &  &  & `& ` & `& `. (& $ 6 *`6`6 ,.`&` &` &`&``&`` &``&` `&`$6`*`6`,.`(ee` 6 ?.  & `. &  6 `6`6 .`&``&` 6``6`.`㿐`6+3'l``t&  $ & $`j>  & $` A>  @ 8`@ h& $c'+_ (1 $`& `> `> `> ȁ``@&  $"& $`6> !& $` >  @ 8`@ 6& $c'+2 X $ ?& $`> ؈ & $ ?& $` > Ј$& $ ?& $ ;& $ >& $ $ =& $ ?& $ $ ?& $@ @ '@ @ '8@ '8@ '㿘`&a``&a ``&a`` &a`@O&a$ +`+`>Ț`c$   ``&`!&`!&` c! &`> &`a &`! `!8 @  `$`  @$ `+`$ +`>Ȅ cp       !8 `@@ @88@$!$#``#  㿘`&a``&a `@0` (` &a`` &a``@\&a$`+`+``&` >Ȥc `$ a$ a$ c%a $ $  $ ``@B`+`+``&` @ @`@$ a$ a$ c a` ` $ $ $ > `aba (  ``@``&`+`+`>Ȅ cp      ##w``#s``#o``㿘`&a`&a `&a`` @&a`&a$``a``  @` 8`j ``@Y`+`+``&` >ɦ` `$ a$ a$ ba%>  $ $ $ ``@6`+`+``&` @ @`@$ a$ a$ b|a` @$ $ $ ``@ ``+`&`+`>Ȅ cp `  `a @   # "``"``"``> Œ"   @2  *@ 2"=#`= c   0 $Te '*(`` $ ,(``$@d`X L`/` U 5H/N`/2. @ '؂?'''''Z 2 /.`X @  Z'w "U' U0J'''ܨ @ ''?Y' 2'd''l'h''YՐd !`} x`}y   `` gxg'g`gx{ ?U^ 0 '''`@ (4` >`0 };X @8*  S ~` z' '''''>`0`''܀ ?U '}͚ sФ&e  쀡 $  /   ' $.@ 쀠`-`II@` 8   5 2 @ݨE#@`?'$@  `䀦 ">@ >T >`0`} T 8 `@̔E>@ "   x@`` `d{  ?` `Nߐ @ 0 , +@`  | ?` @c ?`   ?"`"@"`"` b  @  "`"@"`"` 䀂b倂`@" ``` ?š@@)++@ @@ (@ x` @`` +@(` @ @ @`  < <` ` ` @ ("`(0(0 *"@"`"` b ` @"@"`(0(0 *"`"` 㿘  3` a` R 2` !`"`"``@!` bV$`` ; x@@2@@@@ @9 2l  @@ @@ @@h@> E@> EbH(0` @`c ` @@> C#@2ɒ`Ȁ 2`2`` `> c<' t@" 8 c@" (c@@|@h?   @ @u@2? . . . . . . @ O Ȓ } ,N`倠`'N`4 '`> D(` '/,/V?? c& xD  ` @0b@@{@2?  @& > E: &bH2> C `@"?' ?c@`  ,}5 ~@@}@2 ?(c @& xo `0a. . . . . . NR P. `"Đ`0DB > 49& . . . . . ,. l 4 &%  & Y`b0  . . . . .  . 9> C8#t? . . . b.6  &> D(` '#P '#t? > C0#h(`k& x(`*f& x㿘> D``> > D`X ~    . "   @"cf > [ ,@   値 > M ,@G,@ˢ` ?=0€ 7??  @ " >`0 ap㿘>`0p!|@ڒ#) ) ( @@#(`@$* ( ( @@$ 4$pc$p >a\   @ `@ `@ J` @ 2 0   J`@   (``   (``"8`@ 2   (``28`@ @ @ @ @ @ @ @  ` @  2  ?  @ @`2  ?    @((` @`2    +@`` (@(` 2  @) "@2 ! (`@(@ނ`(@`0 @ @J(`8`` 2  ` @㿘+N`(`" 2H J `  (?H` (@@     ((``2 ( (`` " ?2" (2 @ @J(`8`` 2  ` @  @`((``2 @((0`J`2 J` " @@:" @  " @ 2" `@2 @"  ` "" @2" 2 "   z`  @ @ ````怢 ``` @  Z   㿘?6 c`V U a?GbP![          @@@@ @ @ @ @ @@@@@@@@Ϯ@##@a@aN-@@`@?c?`@’c* ````````` ` ` ` ` ``@`@@@ @ @ @ @ @@@@@@@@8@ @`@!?@|##@x-@@c@?`(?`(@㿘 ?@ᦖ!? # {@P##6`6 @#@&$8$c…8&?c8&. > D d`S @8> D`d @ ``(`@2  `(@0 ``(`@0 `(@0 ``(`@0 `(@0 ``(`@0(@0ƒ`"8> D`d @2 `(`@`8` `2``2 㿘 $  2㾘;;n c  'x @`@(6>@ `, 4`< @"ɒ..6>@"$"$""$"P"$"$""$"$"$"$"$"$"$""㿘?N`1 @ ,*`$)?`4&? (& >& 0bd& ( ,`2 0>ɂbP$ , 0  ?0  $ $ " 4(@" ," $" 0" " ( ?㿘 2 $?` ,`@ 0& $ 㿀 2`$? %` $$,$@ '`4(  `(`?%`%@><   @`'(  @ 'ް?$(L!LT ( (`` ``@'LT( (@ (`@ @@@ '??( *>4   ? ?5 @`'(  4@ '?`    @`'(  @ 'e?" "_ ]??5 @ > E%`   J$ a5 `$``5 $d``$\5  ?򀠠8> E$h` > E@`('  @ '"?> E`%`   $h> E(a@\ ($h0p5 ݠ?80(@ (`$h@0`p0'$l$L $Tp'lT''  @  "`> E`%`   $ 5 ? $%`%@%`%`(,$8@ $<"@$,@@`'``8<`y(``@  0`( 0@@(`@@@  (`@`'L( 0@@(`@@@  @~@ '? $5  `"v> EK` $1 w?$@K$ (4$,   v;$@'@& $@`'݀ @ ׀ 'H?$0`5$@ "?(@?-  4$`2> E`h%`  $  $ $ $0`5$@` +`@  $ $(`0`$@$5 `0@ π b<$L > E$Tἄ  $P$X$4$, "@?" `> Ea@%`   $$H'`@'H( @ 'а?@ $(@@5$@PX ( (`$``@'PX( (@ (`@ @@@ '?:(@ (0`@0@@(`@@ @  #$@`'P( 0@@(`@@  @ @@ '`?$5 5 @k$> E`%`   L$d$h  8 TL( ( "(`@'TL( (@ (`@` @`@ '?(0``(!h`̀`` h@`'( @ '?`d`$(`5@$h 0`p($H0`$D'`@'H( @ '˰?D $(@@5$D(,@ "@ > Eax%`   $`@( "4D"@&%@@8 @ & $@ ( @ $, 2?(h5$0`` ` d` @ ^`) )  @$h 0`p  aa` @h@`'( 6@ 'L?` h@`'( @ '1?h$ 5) `n@? 5 `h5$0`` `> E`%`  $  $L$l$T @ * > Ea%`   $l`$Pd *``p$X  @ X  > Ea(%`   $h $`(`0'`4 ' `,`T`X '@> (@(@ `8`<`L`P'&@?'ܲ#''''Ԁ   (@ @( @ @6@o(` 0(@@@(`@@`$4@` + a 4  %& &($  @ & `&    @ " a& %`< (@@%`8(`0`  (@ @ $(@ @4@ (1 @(`@@`$4@`40` (($4@$@"(> Ea`&  %@ "> E %@ y 4  (@ @( ɢ@a@&  %@(( (@ @ (@ @(0 (@ @@$4@#5# "耠@ D 䀡 r@   ? .` .` `.@'@< ?* @@̘ E  + >:`?+ +   + / + ($`$ؒ#@ ܀ @!    (@ ܆ (`Ԃ !@# & @   (@ ! #    (@ > Eax&  %@""ߘ"4""""""""""0""0""P""""H"|""`"""""X 2 $?  " " " " " " 8 0  ( , 0 8 < L l P  2 $? ` <@`  8" < (@ @ (@" 8 㿘?N`128?@25? 2? (%$  ,`> 0  ?0 !`$ $>```/"```8 ,"`$"`4"` bP$ ,>$ 0bd$ ( 0@?$ $  >b 㿘 2 $?` ,``4 0@ $ ,@ 0& $ 2 $?  `" "`0  ! @ `"    `! @ `  @@ 㿐 2$??2<`?`h<8 `$<)$$8  * 8<1 $8$<`$hh @$@<$h`ð?ܐ  << $ 2 $??`  <`?㿘 `W?`$`2`(?N?`,`J `0 ?0 B`4`@ `$`(`0 *@ "1`0 @pƐ3 pa0`Le0*`la,@8 `l`P0  @$P$L`l @e0$l`$`4 p*$4$ $ `,@?˰ 㿘 $ 4T ("! $&@@ :( 0"@ +"@p{@26 0 (@@)$ 0 ,@ @$ , (@$ 0$ ,$ (&@@ * 0p["@  ($ 0$ , "@pR 0 (@@$ 0 ,$ 0@ ڰ  4"@p@ ($ 0$ ,  $ ( 0  (@ $ 4  㿘 2 $?``` @`     & `( `4@p"@`($`, $`  @p"$`,` ؒ   `ڰ?$@?㿐 2 $??  `"  y  8< 8?(>`">  @?(@`   `!$> GbX&  $">  @?(@`   a4`$``4 $d``$\4Π?򀠠> E $h$h\ (> Gb "g>  @?(@`    ($h0p4?@ (> Gb(`$h@0`p0 $L$l$T p lT@ " > E`&  $~"+>  @?(@`   ,44?c ( $& 8   $ `   $& 8 $`2L> && ($8` $<`  @"        & &@@> C > @$ " ` "@$& 8<` @ (`?(`& 4`"?0 8 ">  @?(@`   `2 `b4  $ ">  @?(@`      4 2/  $   `  ` $* @``   @@ n|2@% @@$@`M $@$"  D  @```  ` @)$@@2l@(% $@$"   @```$  `(@)$@À@2@@% $5  8 ` ,   0   $& 8 $:">  @?(@`    `$@ `2/ Z ">  @?(@`   ?c> Gb&  $ `   4 ?$">  @?(@`   $4`9 ` $0? $H$H :@ ">  @?(@` @ $(@ 4$@ $XP (@ (@` @` "d>  @?(@ ( `  ``-( (0` 0@@ (`@ @   "=>  @?( 0@@ (`@  @ ` @$4 4 @7$> Ea`&  $m$`&D:@0 @b4(  @@@8 '@ $@ ( @`@B$'?(0`$D$H $H"D:D ">  @?(@` D $(@ 4$D, @( > Ex&  $$@   $@` @ `lʔ@ @%$@@'@   $ $h$`dh  TL( (`@`` ">  @?(@ (  `(0``(˃+ `*`C:$ "c>  @?(@`  $40` ``    h ($h@0`p   ?  4 "9>  @?(@`  ?4@ l> E`&  $t ?$ (Ta(T> && $8$<u  8<[  $S">  @?(@`   " "c  $? 0x> G4  * @ o> G `B> G$4 `> Gbx&  ?$+  $( ` #$">  @?(@`   @> G&  $">  @?(@`    & @> `@  $`G ' $& 8` 44?c (`,f> Gb&  $`"k> @/  $>\'O4/c $ Ѡ *, >*  $  "@Cg$`"yi?`/  `$,`  `L (@ (@` @` ">  @?(@ ( ` ` ` (`   0`( 0@@ (`@ @  ">  @?( 0@@ (`@  @  `(`0`$@$4 T0@  @"= > E@&  $ڔ$Ք$$ 4/ʔ -$  !@> E`&  $$ @40`p$h 4`2> E`h&  $//44// $$0`4$@ $І&$8"q > Gb&  $b@&  $ $> G$Tc $L$X> G c$$P l $/ /d  $$   Q' $:$ "<>  @?(@`  $ @4+ `n@? 4ֈ`:$ "!>  @?(@`  $40` `` H $0`44$@4` b25/  $E & > &$<$8+ > E&  $<U 0$L$l$Tl pT@E *> E&  $#> E`&  $4/ڔ $ (@ $ Ȕ $ & 8 @? `` $l`d$P *``p $X @ X " > Ea(&  $@ 0@`` 20@"@ (@ ( `0@ / @ ?/  0`(` @`(`(@(0`$ %@ " .@ڶ.ڂ (`@ І`ƀ 7@0   +@ ( ?`1?(7@+     (@'''  '?  '"    `(@ (@. (@ 2@ @" @(`@`0((` (@ 0 20T * (` g` (` @>0 @8"'@@(`@  (  @ . @.  @ `` (@ ( +(* (`'@$@80 }@ @ ";7?H> I> Icބ''? `? (@U'"&   @@   @2@(`(@@(`0` (@ 0 20 -@$%@ @ @ր> J> J`\}''! 2 $?  `"  2 $?  $  (@ @ 0 2 $? " |" " "    2`) (" 㿘 2 $?`` * E I [ g q"`"`D , 0@ $`D"`@ , 0@ $`@"`8 , 0@ $`8 , 0@ $ ,@ 0 q& $` ?㿘 l 8 , | x   @@4  6t8@ (`@@@  @  `@ @ (`@@ 8@ ۂ@  ւ@  `/`*`%` ````@  !`Ո!a@"p@  8 l@ @@E@ @  4 / * %       2 a t "p a 4t 㿘`  "l?`$  @?fِ 0 ( %?@ Zf&`$`,$@`(`0@ `,$`8`(`0@ `L$`@`(`0@ $`D@`(`0@ `8 6$``@`"3`D`. "-`, 8f* @`,`@f* D`L`Df*` f`   `@ @$` ?@) $@ `$kij|$@ $k$$k0 d?㿘 $ 8 2 ff  $&  @!    $!@& > ` @#` $ ` & 㿘 , t,A `p 8 l t  $@ $$ ``a`"e 8f' @@$<  t@ & t 8 l X T& H(@ @@& H!< `7 , l < @  8e p l \ L D @ & p& l +`& \@ 0 @@ !0 ` 8뵔$ 8칔$ 8㿘 2 $? ` ``B` 8뗔& 84 ,~1& 8e 8$ l$ \ X$ H T( ?@ @$ H X T H(  D@ 4@$ H(` @ (0 H D(`0  : 8 Ҳ@ `* 8㿘 2`$?````> J@`"``@ ``*($$(`E"`I"E`["`g" ``2 @42l> Je`2 t`2`> J((` ?`" "~` z `G `C `2`8`8 (@$`8 0`( $`8( $ `8( $` ( $`` + 0`@* $`` (`@+ $` ` (`+@$T` $`? ,` q W`8 (@$`8 0`($ 뙔 $`8 qi$ `"F> Ja$` ?"E`> J``2а ?$( `> `)0 l((``  q` @я$$Ql`  `8J`8?cD@   G $`8`׀`֐ @`` @А ِ``"?` `p?  c@( @ ( `$ $ @@ ( , @2 ,` 8   ,`" :  `8#  $`8  " I ` [  $ )`$ @2 ,` # `8ђ $`8h   ,` * "J"t> Ja$` ?$ $`W g $ `$ )$ @2 ,`@*&+   ,` @* " M`8# x f$`8 g$ [$ $`8# k@ $`8g$$  @  `"L``_ׂ?$   `8$ V$3`8?c-@ 0 9 $`8 ( ?( ( $ ,   $@ @ @ @ ( ) ((`@@@@*$ )$0`($(@$(@$ `o ($ (@`$ `" , (@`$0`(`$ ,`2&`8 E$ $ I$`8# 鿒@ $`8=@ 50^`8# 鵒 $`8D(`@0LD* f0L$`8 (@((@((@$ ` ( ( q $Q$    㿘 2 $? "?5`   `2?> J .``.`$@+``+` "    @  $@```& & & & & |& ג   ς 㿘 t> J> JbЬТ /bbb! ( ` l 8 H X T D(@@ 4& H @(`@ (1 H D l((`01 ` p & x& d`& ` l`( h `@ 8 h d t" (1 @+a(`&@` 0`+`3``ϖ (`@i0i t x l  @?& t& x & l 8 H X T D(@@ 4& H @(`@ (1 H D l(`1 l x(0?& x`ވ & h& l2& ` t!w W t`"9 l h`2 8 \  8 l`"`?@  l & \`, `   \  8"@   l& \`2 t `"@ t 8(1`(&(`0@"7 \ l t?& l& t`!    l ,"~+` `*Z& ` ``(5  x l?& l & t& h l3`@2a  8 l"@   l& \ l  `" p x"@( x x & ` l2 x& ` l⠂  ( ?3 *)`& `0>& h㿘> J> JbЬТ bbb ta΀`` l 8 H X T D(@@ 4& H @(`@ (1 H D l((`01` l ,"~8  ` `ϐƒ l& ` ` p p" (`0? @+a(`&@`0`+`0`0` (``0 t ` ! `?@`& t (^ l& ` l 8& l H` X T D( 4 @& H(@ (`0 H D l(1 `+`& ``3` l& l"u t \  8"@  l& \`2b t  8(` 1(@&(`0 t l& t`?& l l 8 & `& l & H X T(@@@& H ta``"˰ `*` \  8 l`"`?@g lb& \`, `  @Wa27 `24 ` l-& `㿘 ?8 t> l \@& t& l` 8 ,"& l& t  8 @'  l"& \`"  l \ ,"~* t  8@  l & \`2 t ) t`?`" l`" `" l \  8 l`"`?@ l& \`۱, `  `0` `?@0  @ $  0`" P`>сc\ 㿘 2 $?  (` ,` & & & & & & 4  $ >$ @?`G`*1$    & 8$ (@ , D L(`$ <(0 L D* 㧔 > J(( @@```$  $ $ $ |$ H$ l$ \$ t$ h$ `$ x   ̐ & 8 $ 㿘\``?H@`1@ 2 (?`& ,`>ɀ" v  ?`8?2~?${?4x?`߀` 4s?`ڀ`n?" (0 )?@" a $$ ,@$$T,@?$P$L$, $4$$$0@ $X(0@ ,$8(0@ L$@(0@  $D,@"$(0@ 8+`$$$ @`!> JD` "" +`@ ,$$$$$  bP$,>& 0bdy& (> Ja"$$ ?㿐 #\#`  P > #  > J a(@ >`p 㿘` 1ו  x0` x0i L0j|" 2$⬄""" > EbL"+"+ )> Eb`"+$"+,*|> Ebt "+0"""+8" 2"" ʞ@㿘;`P..@;k\*`X@k\/ (`@7`@8*@@*@ .0 k\.) @k\ .\./ ((`07`@*@@@7`@ܸ@ k\ @ @ @ . k\.@ k\@  (@㿘`(`    +`?@`<0`0 ? |0| '    @(`` (`7 " &( (|`0|꼀 `3꼀    @ܲ`4 `3  ̶ `3ĝ㿘`(` `   `0` b? b(`4  "7 9*@|   /@6 (   0/@  &@& ?6 & ~  &@@| (@& @6 l      @m k !* @~ &@@$||   /@6 (   0/@  &@& ?6 & *  &@@$s**   /@6 (   0/@  &@& ?6 &  $R    (@6 /@   0/@  (& ?& 0  @8 6 1     @48**  &@@4{** &  ( 6    (@6 /@   0/@  (& Ȃ?  g  (& Y6  (& 6   &@@4&** &  ( 46    (@6 /@   0/@  (& ? (@& @X6    /@6 (   0/@  &@?6 &  &   (& 6    /@6 (   0/@  &@?6 &  {&   (& 6 bb(`b0`(`"*`0@`?b> Jc@ "(``02`> JaЄ(`0@`?> Ja@ 㿘`Р> Jc> Lb> L> J⸪ܮaД ⤤☐d%⼅.` ` &@$    /@6(  0/@  && ?6& :d* (֔  (` #@$  /@6(  0/@  #& ?6& @ $2> L P &@#@$  .@6(  0/@  #.0`8@& 6& 2`6` (` ` #@$u  /@6(  0/@  #& ?6&  "> L < &@#@$a  .@6(  0/@ .#0`8@6 &  g& d` #@$Cdd  .@6(  0/@ #& >6&`b&(@& @b6(@& @.6(@& @6@|a.& @p6.& @6(6&`b&p`@` @"=PT&&?'КX   `( (` \'&   `0 b`P`Xb  ` `&ЀEЈ   (@ k\ 5  (@& `@  @&  ``&` 0@8`  ?,`X`P`T`+`(@k\&+`& +`(`&@( k\( \, @@4  `@,3`1 &+``ͤ`T+` &(`@ k\`@`'  0k<  T(`@k\(0`<, "k\@( `(`` `1 (@@k<`3k< ԃ(`@[В&  [Ɛ@&<$@`K- ? -`k8<`  ) `?`+`(@0k<<0<+<`3+< ' k<@`",kX(`@ @%[&4`?`+<  @(`0Ѐ!  ` Г) @   @ #0(`@03`2Д`(`'Ј  ``   ( 0`" 2"   ( 0`( " 2" 㿘 $~⸖    +@ @6 )  0) ? &  @ & ;@6 > K `Ж"d  "@$T""d   , @6 (   0+@  "& <6 & ⼄ ` @ `+ ?⸆ (@ @ 6&  6N⸚   ,@6 )  0) ? @ & <& 6 h b&d@ , & @6  & (@ @6    +@ @6 )  0)   @ & ;@?6 &  ⸆@,& @6b`` b  )  0`( " bb"2b  (@" bb"2㿘 $?⸚   . @6 )  0) ?.& 0 &  @ 86    b&+@ 6) 8+@ 0) & @ @ (@`@& . @ 6& 㿘 `G2+1.+$+ +()+0#> L  @(`@j~`2 @b b`(@&  1 0:@8 `t+ @` `ր ⸆(@ @6& ++(``      ?( @6 +@   0+@(0&  @ 86   ` &    .@6 )  0) ?& &  . 0 @ 8 6    ?( @6 +@   0+@  (& 0 &  @ 86 3> LbȖ b (`@j~  + @6 (   0+@  &  @;&6 `   (`@j~`( &6  g)bi@`4`+ ` 2  ̀`  2 ̂ `?#`4 ⸆& (@ @6> K> L`ДPА0   ( @6 +@   0+@  (& 0 &  @ 86    ( @6 +@   0+@ (0&   @ 8+6 +( & ``  ?(@ @6& ` ⸆`& .@6 ⸆?& (@ @'6  { 2  2 @@X@'Ȓ?''''>  @ J   흐 ?Ԑ&@>сct?><c>  < @><c2@ *`@?"0 `(@ # 0 0 ><`c> a` < @"0@(`  0 0  4@㿘> M, 㿘> M' (㿘> b@ .@s> Bc> M P㿘> 3a Da`> B؀`?(@(  &`'` @` & 1>B> M`> M`8#@ @ @` ܐ > Mِ h㿘`,`.> M` -> %08  yHo` o ~ Hp@ "  ߦ&`,&`(㿘`>  ֐# 㿀@ @> ,a> dc? `$H/` / ` ``  `#` #\#dn Hp@'@\ @`㿈> a&`,#\ # &&&`0&`4&`8@`2`8> M> M`8ݐ @''@`` &`(&`,0 㿀``,> a #\  D`@>bl"=b`,?(( 0`,(`(`@@ `4`,(( 8`,>B`&`, @5>> @''@@ 2 b`,㿘&`,&`(  2 "   㿘&`(&`,p ’㿈#\@X ` `  ` \ ? `0 ` 㿘> 'a􀠠 `؈``?@><`H c>< c`>> #c\> +&`Ll>ӂc&`P&`T>>҄|a&`X&`\>>҄ bT&``&`d>> ,`&`h&`l> +>҄0ad&`p&`t&`H> +>҄`&`x&`|8  @W30> M&`0`@B>&`Db"&`D`D/> >< c> M@Ba`0&`4@0(@&`8   @''#\#` ? > Bc@ > M%>B 8 &`@ 8`@  @>`"̂ (`@`@* `8@@* @@>-?@>`0$U|:  0$ „D$`@>`"h?&`8&` M `!p>>a&`8> Mגa ( '@A֐ > )>Ҥa(@AԐ @BU@E+ 'n' 0> ML! '䀠`" @`b  ƀ@ Ġ@ZS㿘`>  h# 㿘 `" 4 > Z# 4> MV!> 'a􀠠 > MK!ȁ > Ma& 㿘> 'a􀠠. > !@* >`%(` !  ?05?c8Ɓ6@2@ 2  @U  <݄.㿘 <`*?`4@ -?(@` Ј =`?`( 8 @     2 &`0> M!㿘> 'a` ` `ִ``?`֬``?P> 'a􀠠"`> #`4> 8  @U0&`0D  @Uy<%> M&`4@@ɐ ><@  &`< %k&`8 2@A>< c`0> M" `8 > Mhb( 2' '> Mb0#>Ւ`'' m> Mb8'`'m '> M(!> a?@>B > 6`#㿘``> '1> P#a􀠠" > I 1><#`"$>k"$ށ> M`b( > 1> ֒ % &#> M"@㿘``> '1> !#a􀠠" >  1><#`"$>k"4> M`b( > 1> ֒ $Ҕ &#> M"hP!> '!````$> > # В>ؔk^"D!`"``4> > ֐ 8 N> Mմb 2' '%> M@? @@  &`8 $&`4 w@@0@?> MHbb(> Mc>aL``@A R@C. "@t 'l% '쀤`> Mc> )> Ma>ըa9> \@@3`O 2@? @B =  Ԃ`' @5 'k 0> MD"> M"㿘><c` cc@>b200@02 8 #  >ׂb" "@Qԗ ޅ.`> MȐ#P> MÐ#(> M"㿘> Ecd. > '@(`)`2><c4?"'> M><c*    `" 0@   @ 0 2 @< 8@TK?><> M#x > M~#`P` @S> ' ''쀠s'.> EP'耠`  > a?@@Sj ` 'C'?'` '`8 'U]A'@'` @"'쀢`#>հ j<<@  `2>b '''' '>հ j> M$b 2' ' $*> Mb0 2' '> M b8 2' '>ׁc >ׁc >ׁc 㿘> 'a``$`"  > M#`?> M#ް  > Mؐ#؀`?㿘><cԀ> ccЀH`> 'a􀠠8><?8(؂`(@Hp@H`> 'a􀠠><?8(؂`(@Hp@> '>*b01><Q0(2 `l#><c?8((c><c?8((c؃Hp@㿘1> '!`'5><Ԁ` ,1>  ?8 @RT !`5?8`@&Ԅ><(c><>ؐ#b^n > ccЀ"1>  1> > M>>#aHӬ  25><> MC#>< c><c`21>  ,  @R &@&Ԅ><(c؝㿘 ><#Ԁ`> MH`><#Ԃ(@()Hp@><c؁# ><><c  H` @( )Hp@cܝ㿘H` > m> mc c` Hp@>> `?Hp@>>><b> a>B # @ > 'a><c>=** * * * * g** * * * * ><cH`><c ( * c(Hp@><cH`><c ( ( c(Hp@> F|> F `x`x>0a$ |㿘!> F> M b x#> F x!`   WR$`|$`|  % x㿘'> E 2 )> F `1,> M@b#> '" ` N@ 2(`8`@ .@b@ W@((`"洆  `    Ѐ㿘> 'a6  2  -#> Ec`' %  Ô `  c@(c% @@8DX  `  "H _㿈2/////`P//&㿐> F`> > ` ><cj`><c쀤]   ,@  @, , @ @, , @ @, , @ @, , @ݐ @v, , @Ґ @k, , xP@ * @,  `,2㿈/////7B㿐><Ya  ƀ a@ > F`;> aa`> > N`0> #(> N  @8`"b> N@X> N``T@a> N h> > cܐ#(> Nِ 0ΐ  ' @,' ' '`0`(`(`@@/ ' '`0((/ ' '`0`(`(`@@/ ' '`0((/ ' '`0`(`(`@@/ ' '0((簄7 ','㪐> a0> N s> F> N> `0#(> N| 0~㿐> F`=!> '!``?> Ec̰C!><c ?(`  ` '0><c><'!c>< `    ><c(   > N 㿘> F`!#> '1> '"Ѐ`d> N) !><> # c d &"> ' Ԃ  L) #  L(# (bВb@@ǐ O1>  쀠` b&  @ + >  `@̐> Ec̃2 @8``d$!> '8@&8#c!> '!`;` c> 'b?(  (` c><8`"; > Nΐ! d&  >  `@> Ec̃2 @8``d4Ӆ8!> '> N  d c$b1> > '  쀠` b><> 'c><(` * !c><8`"L+ !`L 㿘>  А0  @NW%> E> F c 㿐#> 'a` 2 a`#,>< 5> F &t%`&t d'&@MC@8 < @`dtt1> NT!h? @N  ?` ٲ`> N!P$(`(`?" @N 0?  @N   ?! ? ><>< c 㿘> F0    @M `>=`` `` `(> ) ( 5>< aD&K 1> F & tc  (`(`` (`` (``Lݐ  (` t` `$t t> N`a> c1> N!1> N!㿘> 'a􀠠 >`( `> Mα#`?> NΪ!  I 8@ > NΛ!؀`?㿘> 'a􀠠 >` > F > MΆ"`?`<  Ib 8@ 㿘> 'a􀠠 V``>`> F ``  IC 8@ 㿘> 'a􀠠>`> E Ec耢  I( 8@ 㿘'> '> Nba> NJ!> N+b 30  @M0%>>#>B c@ $0c  ` '>b>=!`  (((`@> @@>< D   @Lޖ(>>b >B# > E  c> F `  (((`@> @@>< D > N@8a㿐H`> F`> 'a``?`'Hp@ ><c'0><c 'J?J1 0> F`:H`> aa"`" Hp@> m#܀@#܀@ "@#@`Ђb?#` ?/#@a#`@##`"   K;@> FH`><c"@(KI@㿘 0 @L2 ><  c> F1> (`Z 㿘> 'a􀠠 > N4" `?㿘 2  8@b > c& 8#Ѐ`"& 8Hoo> 'a`"  8`#> N 8 4b0@1Hp@ #Ѐ` > '>*b0 <J(2 Y؁> Nb0@ƨ@0 8b0@?8(0㿘`<&`0>ߔWap> 'a􀠠" 8> cc> F 1>  А0 @K &`4㿘``"` `  > 'a􀠠   > N̶"(`?"&  ->&""b"""" ""$""(""8"",""""""""ȁ"""" """"$ "" ""8""("","" """"$ "" ""8""("","""` """"$"" "" ""8""("", €@ @ &Ā@Ġ@㿘> G`  H`> Gb H  Gɔ" 2Hp@ >= `(!`H!8``"""!"!"""""""""""""""""""">`""Ё ""  F @@㿘> G``@2@2 @ 2> Nǔ@㿘!`ĐH`4 < )> '`!?`?> G!` @"  "  @ @2  @2  @2  @2 &!&!&!&! ``@!`" !Ԁ`2" `&!"`2" @&""` `&" ` `" ""`2"!`Ɛ"`" "`" "`" "`" "`" "`"z "Ā`"s "Ȁ`"l "̀`"e "Ѐ`"^ "Ԁ`"W "؀`"P "܀`"G "쀠`"" > N?@5bP?u> N?@5bh?V)> '!?`X? @`O4 < P``H&"> N?@5ԒbP?V> N?@5̒bh?X?> N@5Ēbx> Nb?@5)> '0> G`D&"`&!`@&"`<&"`8&"`4&"`0&"`,&"`(&"`$&"` y&"`r&"`k&"`d&"> N?@5bx?*> N?@5b?> G< `4 >a> N?@5vbh?>a#> N @5lb 7&"@5b@5d 0&"ا4 㿘@5> '`> N` b @5R &!&!> N@5Kb> N&!Ԓb@5E &"㿘 @>@`,#@> N Ġ@"㿘 ƀ@> ""  &!@&" &"!̀`  &"> "a &"&"!̀`  &"> N_"!̝㿘΁㿘>  M "8`9"0#> `c> Nb> @#("<` c"D8`2> N#3: > aX"T` "\8`2> N#(%: > aX"l` > N"t8`2#: 1> ! `> N"`p"> Ncx" "$8@?2` @ h:` > N#> נaX""$8`> N2`#@@:` > ɠaX㿘`:@&"0> N@4cȔ &"> N@4cؔ > N@4zc> N&" c@4s &"$    (@4> O"&"((@ &", &"4&" @4Y` "`&"> On 㿘!!!!> Oe 0㿘"`> 'b   1>=@d3> O ( ɵ`p㿘!>= B   `"")  `!`#0`$   &""&"&!܄ ?&!Ԃa0&"!&"&"$ @&!&!Ԇ!} b@&!&"&! d&" &"&!Ԅ!6y&!܂a@&" !,&"!&"&!܄ _^&!Ԃ`@&"㾐Er'pp8```&" >= `> c<@'  \&a &a>D 0>D"> 'a```^> Oa> 6`b`@Ő>=`> 6y`b@57a` d> O> O В >=> O 0>>H>=H`L`> ސ b`Aa`#&`0@ Q> P> O @3n` &aăX8``` a`> '> F` >D"b`H/` /b@@dHp@0Ia> O > > O> F`z > O> F`u abe (X! `㿘`^``?㿘`> O@2`> O&"0`@3    &"8&" !> O@2!   %> O@2 2D"8 > O@2a> O&",a@2 &"$@     `  (@" 2z> O", &"(> O@2ΒaВEE&"!> O@2_!耢 2+!"`1> O"@2ۄ߀`" ! @2> O&"La @2 &"D@  J  @S "R&"H> O!8 @2> O&"|a@2 &"t@     `  (@@@ "&"x> O"&"x > O@2lb("|&"EDEB&"l2瀤@X&"8{ `  (@@2@&"H > O@2FaP"L&"PEE&"< @2:> O&"dah@24 &"\@     @ "&"`> OC!`  (@@2쀤@&"` > O@2a"d&"hDD"H"`@&"T"D"\&"("<&"$1&"㿘> PM p> P> P F> P > P?耎`> P> P!㿐>b ''Ԕ㿘 + ` ə  > P!`> H`  > P!(> Hࠀ`+> H@" ࠄ €d ޶ 㿐>b > P2`! > H @ > H ? ! > H `> Hਂ @? ! > H `㿘> c> ab(> P> P!> P> P"@X>=`؀`" > P@> P> P"x> Ph"㿘> 'a􀠠2  >=`؀`1> &  А`>=1> ` А0  @EW >=> PH"㿘> 'a􀠠2`  > PW"耠`?`O``?>=> H`?c " (" `>=`   " " 㿘`" > =" > P7# 㿘H`#> 'a` D a. C Hp@>=`܂ߞ@㿘H`#> 'a` C a `CՐ Hp@ >=`܂؞@ > '(@`>*b 㿘 > '@`( C  > '(@`>*b 㿘> '@`( C  㿘(@3> 'a`( C (a`C| (@㿘(@3> 'a`(Cn a`( Ce  @ 㿘  ߐ  0`*`@: @C`㿘>=`%> ' @` C? `> eax@r'@/ X`> H" X`   >فb 㿘 X` !> H!`  $!& X   !㿘`  > P@@.`? 4 @: <` ,<,= Ґ#㿘'> H`  ,` `@ 2L `L ܀`"@BC 0@㿘 >=. `@ `  @2  $@ > nc> <' 7> H`^LHH@H@ `> P#?`(`  ``0> Q @/   /`> H> Q 8 "/> Q>=& `܈ , >=`( @ @ > Q>=` /`> H> H> Q@s 8  >=> Qi H0@/^!> P@# 8D> P # p@  @ 2c> PH#`?> P> P> Pccp@  @ 2%> P+@/!@ ( > P?#0_@#0?> P@.Ԓ> Pc >> a@N @.Ȑ> Pc 2E?Op`H`2H`:6?H``2?`z/-?> P@c > P> P@.c> P’c 2?Op`H`2H`:?> PH``?`z~> P|?S`! 㿘``Ü '``> '`(>  a >r&88@ > > 'a􀠠> > Q?@.8``V``?㿘Ho%(@f@Hp@㿐!> n#`H`#``  #Hp@ " Hoo1> '!` #`P!`> \`$(Hp@ > \`$(#`P!`> \`Н㿈`>=,`@``2a0@`> Qa0`> Q x`> Q  > H>=`, > H> H7> H;,`> Pc'@''..$$,  0@ $$ $$ $ $ $ >F 4>B `Z?$,H$,K ,J\,G> Y^ a â`> m쀠`z> mc耥>`4`h@@& &`0H/` /> H` `  `  Hp@> 'a􀠠"`> Q @-.`؀ y>$X>X$T$P` `T `P `X$ఄ?$,H ,K,G,J  > Y 2` Ho+(@l Hp@> PcO'@/q $@  > m > H a@>`2>@> Q`9'~ h> Q~ 㿐`/H`> nc(T@ Hp@@Hp@Ho4 (@l @* I@6* G@@? * J* K * HHp@  * G@@?@?? * J* K* HHp@ * H* K* JHp@  * I㿘  N `2 D   \. ` , , `""*  4  * L * L * L㿘  ۲ ٕ ` % 5`* %* 5>cܒ  5* %* 5>cܒ 㿘  4Ԑ 8 ` 8 2%` 2` `@ 8 2`D 2`D "『 `D@݀ ` 『 @ۀ ` 逎 @ဎ 㿘 g`  B p ` I 0` 㿘 0@ߐ 0   ;  !  F $B  *>  # 9  %  4 &0  ',  .  ' +#  ,  -  .  /    #   %  ! #,#P#`#p###Č#####t###Ġ# ##< `p2`` `" `*`*` > H a؅(́> Hb 8`(`    (@ऐ @ ࠄ( @ ँ ं(@ ࠂ@ ਐ??  P`  D` ``  (@`4`" ` (@@( h(@(@`4``䀈`2  ( >فa >فa 㿘> 'a` $`"`P`?`h (=`h ( Ő  =  㿘ab= ? ` `` d (@?㿘 P`" ` h ( `? (= `(@ P  h(㿘 ! 6`Ă (@&(`Ć&8`Đ&,` &4`&0`$cpXt&&H\ڂ`d  ];`ao 4 p \!  aW! 6r&&! V$ <6  ?(1?0`#. 3>6@7cL㿈 D> Qa0  L> Q{x!8` ` `21> Q1> {n {l"`   | } ~ #`> Qb #d#h#\> Q> Q> Qh!{Y! } |5> Q1> Qh{P!P㿘`" > Q {E" >> >`#L >> >`#L㿘ab  " `d ?(|`` @Ѐ <?2`` > Q|%b?$`?$`> Q?|b㿘  P`2: h 뮒  &   c#a" <Ð# ``Ѐ`<bՒ  2   2  |`怦 `  P`  h( (@(< Ē   k |`` `?㿘  ?p  ` d    _   P` u E 0㿘  $ ``&  & !  ? & & `X` &  H&  H $ H А&`@& `X&!X!K $ L А&`@& `X&!<&!X!Kr $ L㿘 D!X& X 쀈` ` T"1 ` `0$`4d$`0 T& T&) & L& T  `  @*@? > > QcY> y А> Qxbք `" | & L& Tɀ` `" | P`@?& T& L > Q yؐ" `؀`@2 P }`" P> Q yʐ" 㿐 p`"o L& p& l '' D"/& LX "N 0@" L H' L` (`> Q #cP>JC P i& L `"8 |] D2X& L J/ P `& L0 WȔ  ` |``  @ }(:۸$ $ ? @$$<$``  }`Ĵ0$䀈`0 P`" 0@" @ @ ?$& & Lp@Wm Qc8 `& L& T$ <$ 2` * *@ *` @0:<I䀈 `(`@`4 " 䀈`$ P & L.$I?   & L& lJ& ؒ   Ґ Iu & Lq: d  & l& L В!I& а I] 0 < @ 0 V @ x D  &  & l& L dI 0IB < @ 0 @ Vݐ ` }`A` |`"  T` 29 } \`@"5 } T`2o X & X \`@& \& XȂ $Ԇ$В 8@ <`D  D` `` & L $=`@>  a С( @ @ @%@ 8 $"  <$@9'@99@:`@> Qx # H 0@& t `& x, ( & l& LV2& I/ 􀠠) M ē,`@ `  `     MÒ 怢 ,`@ `    `  ` ~ x r l f0> Q& H$:$50y ŀ N&0l` Ag  < & l`  5 Z / @8`( P %0` \`$ X``& X & L 8(@ $܂``@& \& X> 'b@   G  H5 GĐ! $ $$` @6:% @`  @*@? > > QcV@> v & T & L ᰒ H  L`> Q>hb#`"@ $ `D"!<" `H " `H #`H>bА 㿘 > H D"`8`@6 "(`    <` (@@u  4` 0$  & 4 0d& 0Ho$ (@ Hp@e0<, ,` @@ ۀ `$@`* !80`@8` : 8`@ 3 - ` ` 0( (  7* @:& @Ho$!(@Q\G<`$`L`> QvS#x`0( "& @`(` & <āeޒX0㿘> Hb 8`(` Ē   7 )$,$D`$0@`77``7Đ@`  7*@: 0`@8`8` $$`($H8$<ؐ  {㿘> Hb bA @8`(`z@ a@"SR$  )b=@"`m b@@"_'ee@Jr@A b>@2 Đ 4̔ 4 `q@  `h@2ߐ  "( "p@s@2ΐ   |! Ґ5 !   ` t    4!  `n F  " $c@`   W  e`g@6  ?(1?0#@`@`@. 3>@@0cL㿘>acDDa%>D? "-> Q 0  > Qu;#?&`&`&`,`@  `4/ , ) `&`X&`LT̒`02&> 7 "X+ &`u#ۄ?㿈 `"8&`0`P&`L`&`l&`P&`p`D&`D&`H > Qt#؄``> l bt&`>  b|@7 "`> Qt#``]0 >@6^bx`0&`Ȃ&``&`d&`hX `P 7` &`P X)&`\ Z`P`[ `7> RtĐ P8 !'> 'a> R``> ͒c 2``T` 0"]4` `"'`Д>Cc\`>Cc> H>'aش`'O( ``' @" (`h`2`P`0&`h&``&`d 2> Rtq k> " `7> Rte 0 `70 @7/ R&`0` <@ @2>' @'㿘> 'a```"> ͐c      3 8@ > R`` `> ́ 㿘Ho$(@e  $& Hp@㿘 p```> R Ls pHo$(@e,Hp@ L> Rs 0㿘Ho$(@eHp@㿘Ho$4 D(@e D`" LaX`"& L L`& LHp@ p> R s & L㿘 $Ho$4 (@e &  D"  LHp@`0㿘> H` 8`@E⼃(` ?? 0`@ `p06( 0 䀈"  Ā  ( > Ha؅( $ Ą?$ 䀠`$ ` (  @$   @$    $  ^  `㿘  > R@!Βaa<:  `> R s!(㿘 8`26`0> `4a  +@ O> '`d> R`0&a@&a<`` +@+@ @ &`4&`0  @`  (+@ @ ! @! <``@  `4`&a< &a@  8 `0 4 @ !  @  2` 8@&a<  +@(@@&a@` `4@"`4 4"`0`̒` 0si!h㿘> 'a􀠠`"  8`y``?` & 8  㿘` > R r! > P@!<cJ`> Rb @! !<: "!@> rj#!<!@> R rd!> Rr_!> RP``$ `> rR##> Nb@ ? s&`0@"`0> RrA!Ȑ> R @ aؐ ?&`<`"Z <8> Ra耢 V '#> M@ La @  &`8  N&`4a@ @ B > )>a|> R!> 'b@# @ 6 @ !`ג @ % ˒ 'L| 0&`8 @ &`4& 8'@ b_^@ u@&`0> Rr!㿐Ho%(@f 0 & P/ & LHp@  * 8`80``"@" "@"㿘 `- &  8㿐 <`   0`?` /  㿐& 8`(````2`2 0 //  @ ` * @ ``* @" < ` " H* @ * @* @ > R>hb"㿐  /@@{ :Ho7(@ L` P`9 `ZHp@ L`> 'b2@#贒 $  0 & P& L  TAHp@f L`̀ PA TȀ`0Н㿘 c @0@( c@ c@" ?@ @> & ``?" p  H`    & 6 & 㿘 H`  >`$& 4>  K<D& l>c& 4>  K1D& l>  lc<@' ? p`C> RbX lh 4@h "`?@ (x@l`G(x `Ho4 l(@f l@|pHp@@ ,> RHo(@f@lh@ 4@ llh@`@2@Hp@0Ղ (xC"H#####c @?  "Ho(@f?" @ P T! 'Z'  Âa?7 ?& 0& <``0 & <`& @@?```& 8 & @`` @`& @  @`& @ X& <@ d < 8@@* X p @ D H?#\& < @ & D& H H.`8` 8 & H@& <0 D.`8` 8 & D@& <0و?'b@'㿐> oS Ђ & 0 a& L X>>Cbw P''>  Iܔ& p㿘 | k`?") F,``& 0"" F D F@` . D E@. E | $ |. L`쀠 4``$ 4 |$ 0`$ | . L㿘 (9 1. 1㿘    0 `(`,@   3``@(  H `p`  0 0 |`$ |$  . L㿘> Q `  ` 8`  f?㿘 xHo+(@l1`(1Hp@ 㿘 xHo+(@l1(1Hp@㿘(( > H c((&@&D4&`xHo+(@l`  츔eh` .e.h 2aNHp@>ap&`t3> Wc㿘 xHok (@l0f  L ( &  & Hp@㿘 Ho%(@fHo(@l|$|Hp@(@, @``  *``2`> W$. EHp@ Hp@ cn瀌` @@ 8`?㿘> HcX . `0> 8 l`ȅ(㿘> HcX . `0> 8 l`ȅ(  4HG(F `"?I(F?F  ? ` ߁(? 4H550`*  D`2 @` 2 㿘 4Ho4 E(@l E D, EHp@ G@2`l H`` . . `l> 8(`Ȃ@`> 8(`Ȃ@`  H㿘`t&`t&`t`l> 8(`Ȃ@` `P`H @ `l> 8(`Ȃ@` 4 K `` % 5@* %* 5>cܒ  58* %* 5>cܒ 㿘/> H l8 t`l (> 8` 4 |s`t` "T-O79@ 8( x(  p  @ P X`& Ps& X @2@ 2@@?2 `^,@ 8(`$& lHo+%(@ t h @& t t  `N `2Hp@8 l t h @& t t 0ك(`$ T X`& T& X 8= <`t . NHp@ `. ̀= < @ . `1 /`1/`!꟔ 0㿘  0Ho%(@f ` ` `. Hp@. 0. #0㿘 ]0 L\``,``!> 7`2( F D@ ` ` ` ` ` ` F ` . D E@. E$$ ,. LcL``" D F D @? 4` l@m@k@" 5 @`  `  ! !  " @@(@* 5 5@* 5 5`}@* 5 4 J` 5(@* 5 @` `   " @@* 5@㿘 @`*  `2  12 `,  , . L. 1. ! ” `0 @  $ $ S& @ $ $ 㿘 p|t ..(x鍐   髐h`p`?n 0.$p$t ` ,,`L ` d   `, `1,`1,`!g  `,뀤 㿘> H scX( 4Hoe4 t(@f ta ` Hp@0 H` H P Hk4$ (l$ $  t `& t, 1 @  $ $ Hp@,1,!   㿘> H scX`((` 4``$`@" `  ``z  \`w  Ā@ @ b 쌒 Ho+(@lِ 3 5`?cpj"f 4,3,5d` `@"@2,4& & & @` @ `9 $ $  $@@@*> H $ d`$ h  , , ,L `* Hp@` `ڰ @(@c<> H$ dc@$ h @,  , Ӑ@``@ 㿘 4 0Hok(@l `. e . tb \`"" 1 T X`#> W 4Hp@ > 'b> 82  \`2 T 1  , 1, !  Tjv#㿘> HX` X. @0> Xje 㿐Ho4 P(@l P T& X& P& THp@> c> c> `c> c#\ > X j`h> c<@' ` `8>8b`$`,`,`> H$cl (! D! @ 4&`4 > H&``&`\``?c(`\  `  > H! ``\> X`P  ` x > H!> X `X@ `> c> Xi( `> Pc "\> Q` U> i { >bh" p" >> Ђ`" " !> H&`0#8 * Ӕ &`x#8&`p`p&`d&`l&`h(`&`|#8$&`t @(`@ s `\`;`@` Ho+(@l*  )Hp@@ Q> X> OhÐ >  !`   ` !  !p  *# L P'''Ho#(@ e`. eHp@&ĐȃHo+ (@ > Xh @B`\l l e& P< p㿘> H sX`(`4 K` Ho+'(@``(Hp@ ` (() L`(%0えl`0`(0> H scX(Ho4 t(@l t`   ta`" tHp@ 㿘> HcX . > 8 0` l 4( &z Ho(@]@" `" y@"B*zx@"  l &Hp@0  `\@'j@2 .& @!{@2 % ݐ c@`8ؐ Ґ  ΐ   $ `   h > H#X> `<' ?0` @ @I#X(`"' 0 I4 td d ݒ 2 Hoe(@ t`  7` t` 1 Hp@  <> Xf t`  $ p`P`"'@ "'Hp@> ɒ (g) 0ڰ ,`M`` `M- (` > 8`2  t @Y  t`Ub%$ tL`M`2" Hok (@l Q>Hp@ 2 t``"  t`$ t @2L`M t`L`M`2!o   `M(`  2 t `M(`"  t L`M` Hp@ "s l t` e0a `'`'``` '```@@'``@'ЃHo4 `1(@l `1`,`1,Hp@$ Đɒ\`2C$  c $ $ %$ ) 2 t`$ tHo+4x(@lx$pp> H$lc8$t* ,0Hp@뀤> 8(` 2 t0$ t$ $  ` Ho+(@lu Hp@ t}O$ t2,`M t}R$ t9 㿘> HcX .  0 t`  4  l> 8(`Ȃ@`Ho4,`M(@f,`MHp@ t` ߰  tHo4 E(@l E D) EHp@ H@@ `" *(ہ*(ہ`>=`   t J` 5(@* 5 @` ـ`   ȁ" @@* 5耞@㿘 @`/  Ā`2  12 (ـ`!,(ق ,(. L. 1. ! 㿔 (ـ`0@  (Ђ`$ @$ ($ K& @ $ $ Ă t K h؀` % 5@* %* 5>cܒ  58* %* 5>cܒ 㿘 tHo%(@f(ۀ`) Ā`%Ho4 (@l .( `1 &@  (Ђ`& @& ăHp@Hp@,`1,`! ?  (& 㿘 ( ` F D `. D E @. E$`$`Ȃ ,h. L㿘  ..(   ֐`p`?ܒ 0.$$ ؀` ,,`L ؀`    ذ`, `1,`1,`!Փ  ؐ`,.뀤 㿘H` t@ (@&JHp@㿘> P Ac  ` 8`  f?P> c<@' > H c  t%z  49;@ x( ?$@  p  @  `& W& @2@ 2@,$`@2 @ڤ$x& Ho+((@   @&  Hp@@ ?> X(؀`-(؀`(ؐ.(0䁈l   @&   04 < @  `& &  x4 < (ؐ.(1 .1.! 07L!H㿘 Ho%(@f(݀`(܀`(ڀ`2.(ڃHp@.(=(܀`.(0㿘 t$Q "  > Xcr  sc ڤ Ho+Ƃ(@ tHG(F(ހ`"?I(F?F  ? ` (? `3 `5 `4`@`?`,`3,`5  ,`4(ـ`  & & $`@(& `& (؀`E Hp@(ۀ`xH` )?& 8& H #@$#蠄?"K@``@ @` :#@$Ր#蠄?"4@``@ @` "$ <`2%& H$# _#@$#蠄?"@``@d H ?> Xb Hp@(؄ .(.(,`L(؀`"~(ؐ.(Tvl tHG(F(ހ`">?9I> Xb .(Z0h{0O8@H` t@@Hp@>c 㿘Hok4 Ă(@ l Ăh ?"   (Ԉ (((Ђ`@"((̀"(ԃHp@   㿐Ho4 (@l  & & & Hp@> c> c> `c> c#\ > X c'`㿈> `` &`0`T>0cx`x> 0a`̄h&h&h&`&h`,`,`> H$c ( D @4&`t > H&``&````  ` ?> Hc @(`@a  `!> H# *  &`#&``&`&`&`(`&`#$&` @(`@ ```@1 .$Ho+ (@ Hp@l` Ho+m(@ܒ Hp@ ւ$ @(`@`e`U(`eǒ Ho+a(@Œ Hp@> '&`Da􀠠Z>=`DҐ`H` @'`<> XaV!`<`4``H`H> Hca '(> Wb@2 > Hb''> a> ЀC `a> a a> bZ > Xa( F` ##0sl> Xa `H> Hc a'ȅ(lU c0> X@Ē` > X` 2`D &`D> H@Ɛ#> X`!0`H㿘` @ @`㿘 $ & ,& 0   "  P@  " 0㿘 $   P@  0 2 P㿘 $ & ,  & 0 P@  0 2 P㿘 $   P@  0 2 P㿘`"   (`: > X @2`!X > X `z!㿘88@ @ `" /> X `# $  ` 8@ ` 0 " 4 4$ 4 4? & 0& 47  ` H@2气 뀤 a!㿀8@ i`i` `@`&`$&` [?> > 'cd c`$`$" `480@f28`4@  3䀢0/``1`4 @`4' ` '`@''': "`$`" 0`$ 0 4&`$" H" 4`(`&`(` '2`4  > X`!㿘 (`Ho&(@ X T 8& X $4  P T@ Hp@g X㿘 P@ ``"   c(8` 8@``"  @@2` `2`   㿘 Xa0 T 8`4 $  T`4 $ 8  X`2,  $ $2`( ,l1*  $ $`b ,h bbb  (" ( ## A&!  ! &   X`" X>9a, l L>a T㿘 X`/ l 㿘 X`P T \h2X L!@2` L#@2< L5@!3 @2- L `<" \i2x X2 X2O X \`2 L .`` i  L(``&@  `  \3 @" ` L*` `(T  `*` `&L  \ L*` `"C  \h! L*` `#8  \!@# L(``#@  *  \ @& h& Xa& L`0(    \ X L`& X *`& h`+    ` X L`(& X & h`+    ` X @& h& Xa& L *` `0 `"o \ X㿘 T`,``0  k@" x, k  x@" |< x `0  @@ < x  㿘 T `0*`А`<@ $`0 & `,& Ho& (@a+Hp@gaHp@0 `,Հ`㿘 T X8 $ 8`! @? !  T  d"  L T 8`4 $ @# L` X`" T 8`8 $d 㿘 X '` ". \ `  @ (``@!" T`2 T $`8 8* 2 T $`8 8 `S  X`;`Z??!b8` 2 `2 T $`8 8* 2 X`@" T `@0`ba T $`8 8   T $`8 8 À``> '& XВ : X> X&7s?a  T 8`4 $ ` # `& X l> ,c.)!?㿘 T\`- `"4  8 $@  T`4 $ 8   h2 d & h d`@ & d P& d`< ??㿘 T ``7` B)  > X)  @@` `> X]!@ 8`$`8 `T`$`8`8 `X`@2`T`8`8`$  4 $ 8  Xd > X]X!㿘 T  $`,$`0 T 8`4 $ ` T`4 $ 8 " T`,`$`, T $`4 8 $`0$`,`$`0`0$`0"  2  T`0`$`0$`0 8`4 $  T`4 $ 8  X`@ !3"`0`$`02 `Š!$`0 `   T 8`4 $  T`4 $ 8 " (!`0`$`0 `0`$`0$`0 @`0`$`0!" `0`$`0 `0`$`0`0`$`0 $`0㿘 T  $`,$`0 T 8`4 $ ` T`4 $ 8  " T`,`$`, T $`4 8 $`0$`,`$`0`0$`0"  2  T`0`$`0$`0 $`4 8   T 8`4 $  @ `0$`0$`0 8`4 $  T 8`4 $  !" "`0`$`0$`0" `0`$`0" @`0`$`0" `0`$`0"`0`0`$`0㿘c T 8`4 $  T 8`4 $  T 88?b  $: 㿘 (` `"`" `z  L0`@=   L0`@"` T 8`4 $  T$`8 8 $  ` L0`@ `\ T 8`4 $  T%b`8 $ 8 0? 㿘> X1bЀ@?? 㿘> Xb&   > XZ" (> X&`L&`8&`P&`T &`X&`h@`T`$4`8  ?b&`\㿘 T  $ ,$ 0 T 8`4 $   T 8`4 $  T`4 $ 8   ,`$ , T 8`4 $ $ 0$ ,`$ 0 0$ 0" ` " 0` 0$ 0`$ 0$ 0`$ 0$ 0$ 0㿘 (` `"`" `   L0`@0   L0`@"` T 8`4 $  T$`8 8 $  ` L0`@ `\0ِ? 㿘> XNcH@?? 㿘> XcHC   > XYА" (> X&`L<&`T&`P&`8&`X@`T`$4`8  ?b&`\㿘 4 @? !" 4 @  0 㿘 T  $`,$`0 T 8`4 $ ` T`4 $ 8  " T`,`$`, T $`4 8 $`0$`,`$`0`0@$`0"   `0`$`0$`0 ` $`0 T $4@ 8 ` ހ  `0̐$`0㿘` "/`   ` L0`@ ` L0`@"` T 8`4 $  T$ 8 $`8   L0`@?0`\0㿘  `> XX#x (> X&`L&`8&`P&`T &`X&`h@`T`$4`8@ ?a&`\ \?b< `Ɓ`T`$`4`8 &``$A$@$@$@$A$@$@$@$@$@$@$@$A$@$@$@$A$@$@$@$Al㿘 T  $`,$`0 T 8`4 $ ` T`4 $ 8  " T`,`$`, T $`4 8 $`0$`,`$`0`0@$`0"  2  T`0`$`0$`0 8`4 $  T`4 8 $  ?`8`0(`> `0`$`0`0`$`0`0`$`0`0`$`0`0`$`0㿘H T 8`8 $  㿘 (` `"`" `p  L0`@0   L0`@"` T 8`4 $  T$`8 8 $  ` L0`@ `\0? 㿘> X4c@?? 㿘> Xc)   > XW" (> X&`L&`T&`P&`8&`X@`T`$4`8  ?b&`\㿘 T  $`,$`0 T $`4 8` `,`$`, T $`4 8 $`0$`,`$`0`0$`02 T $`0 8`4 $  T 8`4 $  2`0`$`0 `0$`0 $`0$`0$`0㿘Z T 8 $`4`8  ? Ā㿘 (` `"`" `{  L0`@0   L0`@"` T 8`4 $  T$`8 8 $  ` L0`@ `\0ʐ? 㿘> Y?`D@?? 㿘 (`9 @2d( #> Y(`D   > XV"`( P& L& T& 8& X @ T $4 8  ?b& \`2ڐ> Y`8& P#Ӑ> Y`,& P (9 Ƃ@㿘` "'`ސa V ` L0`@ ` L0`@``\z0 L0`@>?0֝㿘> Y`@?? 㿘> Y`   > XV6" (> Y&`L&`T&`P&`8`&`X`T`$`4`8  ?b&`\㿘 T  $`,$`0 T 8`4 $ ` T`4 $ 8  " T`,`$`, T $`4 8 $`0$`,`$`0`0$`0"  2  T`0`$`0$`0 8`4 $ $ `0$`0( $`0$`0$`0㿘 (` `"`" `  L0`@0   L0`@"` T 8`4 $  T$`8 8 $  ` L0`@ `\0^? 㿘> YӒ`Ѐ@?? 㿘> Y`Ȑ   > XUU" (> Y&`L&`T&`P&`8`&`X`T`$`4`8  ?b&`\8 㿘 (` `"`" `  L0`@0   L0`@"` T 8`4 $  T$`8 8 $  ` L0`@ `\ 0Ԑ? 㿘  `> YTڐ  (` c> Y2:` !TВ@ (> Y&`LX&`T&`P&`8`&`X`T`$`4`8  !&`\ \?b< `" 1> YT!8`T`$`4`8 &``㿘 @`" T 8`4 $  T 8`8  $ *2 T 8`4 $  T 8`8  $ *2 T 8`4 $  T 8`8  $ *2 T 8`4 $  T* `8 8 $2  㿘 T  $`,$`0 T 8`4 $ ` T`4 $ 8 " T`,`$`, T $`4 8 $`0$`,`$`0`0$`0"  2  T`0`$`0$`0 $`4 8   `0 $`0  $`0 $`0@$`0㿘 (` `"`" `PҰ  L0`@0   L0`@"` T 8`4 $  T$`8 8 $  ` L0`@ `\֐0? 㿘> YbD@?? 㿘> YbD    > XS" > Yc8`&`@ (8&`L&`P&`T&`8 &`X&`h@`T`$4`8  ?b&`\t$W$Y$X$Y$Y$X$^$^$^l$^$]$]$]H$]<$]4$\$\$^$]4$^$_$_$_$_$_$_$_$_x$_$_" " " " 㿘`> `& &   ((((3 (  h" $" " "   ` @@     ((`@` @@  㿘  $ & (& ,. F& 0@㿘  t`& 㿘> YS"㿘#> m c  ``  & `` > r(b(@  `*` (`(>   M`p2@&(`> rbh``c`2 2 cɔ 0 > YRe 0c> Y R_`0`> r > YRU 0 > Y(RN 0 > `@c@> Ycx+ c3  > YR? `` > Y"@R40+ c2> Y R,0+ c2> Y R$0y 8 ,`$> Yc  > Y>hb#㿘 4 ``q 4 > Y@#> R8c``( N 4`&R  > Y@> Z#aHR% q 1> ZR H 6`2F> Z 7 8 : 9(`((@@@"  ;N 4> ^`> `8> ZR  ;` < = ? >(`((@@@<> Z J`0 B`(> Z J`1> ZQߑ!0  (`.`1> Z@@Q֑ (QԐ `N 6 6`& `@2 `,`  `,> QŐ  7Q!ِ> ZQ! BQ Ő> ZQ  6 ,> ZQ >  > ZQ p 6ג ,㿘 ````> > ZbPX` !  ` ?.`.` @?(`"_* 㿘 4` ``      ! 6` 8 + >     @ A(`?@@`(`$`" 3`$  `$`Ѱ   !b @ A(`@@°   @ A(`@@ V   @ A(` @26  `8   V  @4 `  @ A(`@ ?񀠤`8 0 ( $2 & (}  ~  {?" r ?b`8l `$ U3`$j  㿘  `   ,`  (`q  ,> ZPÐ!` > , ? $  ? (@㿘 p  > Z@ `& p @ёQW!㿘  @    6  @ 㿘  @Ӑ  `" *& `> ZQ4!+   ? @& ?&&  @ "    ? @&&   4 (``2&  b &   $ 㿘@  & P& @q@@㿘 @ @_@ 㿘 @u      ? @&& & @G$ 㿘  @Z ``> ZP!    ? @&& & @($ 㿐'' @; ,> a!  @??      '  &  @??    > ZPy!@20"?!  @ @  ?' @ @ 2㿘@@?@&@`?㿘@Ԑ@ @&@     㿘   @ < " ``@( 2 Ē @㿘    2  @p     @  `2    |!   @ ?  `  `    `  `2    |  6 &  @/   㿘 @D   6 (``"  @   @ 㿘  `" @#  `2  & &    $ &  @ x㿘 D㿘  @ ``& &    $ & @װ-> ZOZ"(㿈 p%''􀠠/' t`)> Z `#`> > Z` & th& p@Ґ p`  X  p`@?"& O$"x> ZO!"P㿐 '' @ |,> a!  @??      ' |" &  @??    > ZN" 1> > b`Ѐ@ " "(  @ @ > ZNА"؀@ N  @ ?   6   ' `> Z c Θ  `@20"?!  @ @  ?' @ @ 2$ 㿘@  ` > Zc   `@݁h %'''''耢 `̖> 9ِѐ㿘 `x>=C̐!  ’㿘`? >="@D!    "  G" " $ x" "  j0` %'''''耈  Ĥ> А'܀  ` @  ` Y0 yq`2֐ /Ґ 㿘   && &`&$(( (q.㿘h `\'` '` '`'`$ ` Z(((?c 2((KZ2((@O0㿘vh `\'` '` '`'`$m ` (((  (. (%0㿘K   &&`a0 c& (( 㿘 & )  &oc && ((㿘 $h?(     c ' ' А㿘  ! $    :  `  ` ` .`   (`(`(`ݐ`$㿘̰   & &c&(㿘   "> Z @L# -` "" " " "  ` > 0ct 㿘```>=B;!Ђ88`?`?` `@ `  @ -@ u@ (㿘`>=`B!Ђ88`?`?   @  ``@@ @㿘>= B!И   " " "   >  W 㿘>= BԐ!И   " "   >  xB 㿐> nt`    t!>= |! #\> ZDc@! D 1>= !Д   > ZcH#\Dz!Dt 㿘2&``?  $~F h  > `$`$`$ % $` $`( .   (`((@@ @     (`((@@@&E  >> y`88"v`E  Ey  E  i `$`$`  $`$`$( ?(( ( ( U(d V         (`((@@@&EA ` ( *    (  `    0((@   3`` 0+ +`    ((@B   & E 㿐& \dh'`'@'`2$`2$@ $\ <``W > y >`8K b #\ ] O(`@`7 ` $@`$&(` @`7`2% <``;  `' ` ` ` `(`(@@$ ` ` `((`)   ?@b #\  C ` $ ֐ & ' `   (`(@@$ְ   ()  ?@㿘   `&& (`@ `&&$((0` U((.2.A㿘g(    ' ' ' _' $ ?(66(6( (((㿘`*"2 &` `"Z U```#> Z    (`) (  >@    (`() @@@&`(`" > ZJ-#X    (`) (  >@  (`@&   (`(  c  >@  !&> Z        02( (@2`+`,`,     @@ @ @@** @  * *`@@ >@    (`((@@@&$l$$$$$$㿘`@Z   T? (`2P@ ((`(`(`(` (` 0`(`(` ( $ ` C@`` $ @`"A `B  $  $ $ " .` , (@`C .``" @`2.  C``  ((`(.`CA $  `$ $ɰ ((`  2  ` Ұ㿘``J ` @E   ? `\``$ ` <@`` $ @`"> ` ]  $  $ `$ $ .`[ F.`Z ,`(` .`[` " @`2I  B` > BҒ $ ` $ $@`ƀ` ̰  $ (.`[ @&`$> wH"(  4.`Y`(i  .`[ .`[ .`[  4.`Y`(Z  .`[` 2  `㿘 a@@$0a@ 0a@2  0> w`220a@60a@& a@"1 $> wHw"8a @"  $ 0``< @ j"& & 8" " "  #  8" " "   2 $`2 $ $` 2 $ $`@2 $  $`2 $$$$$t$$$$$$$$$$$$$$$$$$$$$$$$$$$$ 㿘`   "   "@ 2 @` 4 2 0   @ 2 @ 2 4"@" 4 4 2 @@ 2@ ?"@" 44 @* @`  `  ` `"` `*`  `  ` `"` 4*?:``   * ؒ` @` ` `\`` ``_(* \* @00*  @`88``0*  @0*  @ݐ * \ \* א  @Ԑ  `*  `* >`p 㿘  V    * * * * x @㿘 A& !> I!\     (`@ @ђ  A !\  @@    D9 L 5 `1  `   %xڞ㿐 @ڐ '> I\  "  @   (`@`@\ A  $@`@ $@ // `/ 2/ 0?` `@ `    `@܂$@` `  ` `  ` `` @ 7% x@3   㿘 x` $@d  >> y`8-> Ia\ $5 2$``(`@ 8 "   "  @```  " ? $P " 㿐N '0`?     @6@@@``@@`@o@ 퀤@` @o5 ․@`@o*'֒ ׀@@`@@π@'̨㿘`> wE!#` >  <c<'  =@@> `"> w> x> ` D p L  \   > xD  $b"s >> xD -> x`> x`> xDݐ  x`C @`?`"> xe``}`2> xDɐ! x`c`+> xa > > xa( ``_ND x`@  `` `$ @"D x`@  q> yc > xa0,> {c> !> y`8> xDu -> wE6#pE4#2> xDi  xDe x`> Y cX@`DZ x @@0> xDP! xDL! x> wAc> x>`> x;`> x8`> x5`> x2` > x/`(> x,`8> x)`P> xD h> w#c> w c> wcÐ! 㿘`> D#( 㿈 *   ذ  0 > `4` 4` $`$`$`$`$`|$`(`|$`0`0`"`@ " ``  Z `ѐ $`&`4`& :> +> Ia\  :`<4>> : " `<" `$2`0`0 `"ѐ@͐`@"`$`` "`$t `? "`$h2`x ͒ < x  "Ȑ " " > y !a@   `>> ya8@u `C`& ?4`& ?4`&  ?4`&`  4`& "L`= 4`L`=`&T`$''> !!t f`$hFa\ > $`$m `י i0> Ia\ B :tX`$`oS`$ ݔ  $`> > T`$@"4`$`&!4`&`4`$ʔ   ` ` :=   4` a\ 4` =W :> B֐#`x "`$<`$ 2M f  G <M : 2@ ` 0"  @  @㿘`< 0`"@66 ` @ 4&0 ` 6, c )$`! *,ђ $`0` `"x@x "Tܒ  xҒ `0㿘`( 0`"@% ` @! ` `     " ` 2 `  @ 㿘 0`"`  ʔ "`" 2`" @㿘  0S  d ۰  ]$j" > `  @P 7  2  > y`8( (<  > Ia\! ( c 2/   (`((@@@0`` @  ` "@쀥@(<  <( 㿘 0`"`  `" @ 0@@ 2 2  > &a О@ > &`  @> &a8 K@㿘,  4`2> > x> x a@`BT!㿘    ,   H``  h㿘 0`   ͖ 2 0  @㿘 8`   2 8 @8 8 `?`?` ` > 'b > 'b, > 'a ?> 'bؒ?㿘> 'bȰ> I a\&8 .& 0"`2 0 6" 0"6 8 2 8 (  8> x@! 0 8 @*> x">   > @ #& 4> '`X > x @!@! 0 > x@!> $$$$$0$$$t$$$T$$$$$$t$$$$$$$$$$@??  `$ 6 4``` ֞@`" > ``@ @ A(`@d `" > `   㿘 Ē(    $ $ $ $$  B`( @7`(((((`(㿘 Ē" 'z$ 㿘 Ē     '$ $  K(e(t㿘 Ē  b  $  $ \(( G((((I(X㿘 Ē }  a@ $ $  E6`(6`((6`6(((*(9㿘 Ē ^  a@ $ $ ?((("㿘( :S " A(   $ $ ($ $a0$ ?)@)  $) 0`) " @9( `(`@&` `֐`㿘  : (  ( '  $ $  $ $a0$ ?)@)  $) 0`) ǐ2 ` @(@`&` `` 9㿘( 9 % ђ(   $ $ ($ $a0$ ?)@) `(`)  $) 0|) `9}(`k(㿘  9 $ (   $ $  $ $a0$ ?)@)  $) 0`) `K) Z" `9L .` `.`㿘  9  o a0$  $ $ @`   4 9) (`> ( ?+` +@ +` ,``,`  $ $$  ?+` +@+`   $ $$ А `0`.@ `0.` ``.` `.` `.`?+@`(``?+` $ ? +@+` `(``+`   $ $$ Ґ ``.`?+@``0+`) 00) )  +` `(``+`   $ $$ 2| ``0`.` ``0.` ` 0``.`k? +@+` ``(``+`   `y,`  $ $$ tp  K.@? +@+` `(``+`   $ $\$ k27``O 1? +@+` `(``+`   $ $A$ P2``4 ? +@+` ``(``+`   `$,`  $ $$ . .@?+` +@ +`   h$ $$   `0`.`.@㿘 T 8C r 1( i  $ $  T$ $a0$ ?)@)  $) 0`) `) 2Q```T&@&`&`&` &`&` @`.@ @0.` ``.` `0.` ``.` `0.` `0``.` `.` `0`.` ` ` ` `(`((&` ` ` ` ` (((`@@@&` ` ` ` `(`((&` ``0`.` @ `7 T @`(` > (j@w@@ў@@㿘 )   $ $ $ $ $   C`(7 ( (((JY`(㿘    в    ' /  㿐2 /  7d#$ ֒ 2" @ " ``4&(`` ` ` ` (` ` ` #\6#$ `` J ?  ; J㿘 Ġ( & >  &h    Ȁa> Ѐa" &  Ѐ`" Ԅ > Ё `c 㿀 '6  ! `Ă #d#\#h#`      .@ .` .`.` 6 㿀 '`$5   6Ȱ . `Ą#\#d#`#h  z 2􀠠" ( `) @ ``Ė " 6Y  "  6M㿀 ' 6 GĢ#\#d#h  N#` 5 4`6`` ` ` #`#\#d#h    􀠠" @@( `( `@( `(`Ė " 5  5  ^"  5㿀 ' 6" +`Ă #\#d#`#h  Қ 2` (`(` ( (``Ė a" 5  "  5㿘 !~ې`Ȅ d&(&8&, &0`Д @bB d`&4``$dUaP&HcD T M 6Xct&]ao \#`#`#` `Ј && aW&<6p6r&&G 65#$  2  ` @$ ` `` (#$5E 5A#$6  ?(1?0#@`@`@. 3> 3@@'acI&т`-   6㿘 D? ` @> I2`!t@͓2`  `"    <(( @@&$ < `0@ > -> 3 >`! > -> 3 >`!㿘  ,`,  p 0 <d$ 0 $ @$ 4 0 (`0  @ Hod(@Hp@́(> (e0$ 4 ( <$ @ 0 (`0  @ Hod݂(@0 &  `#&  "$ 4? & &  < 0 (`0 @  X `֒싐`aa&` œ _ 䀢?㿘 ,`@U$`Oɐ L`(`D4`  @a  `<,  @ @e]@`0$ b6 @?``(4 (4 ((4 (((2 ( %  @?hh@% 0% `H0% `<> .`% $% t% 0% p朐a&~%$&2 ?,@2  @2  @?``4 ((((4 ( & A ꬑ㿘? 6 > I!t4`   `@" 0 `: `"    Δ!` `$0`$  $a  !ɐ 0졔  $~0$㿘``"     `@& 賰 `  Ĕ!좰 㿘? 0`@> I4 !tI  5``@"``0= = ```?`? $`    2`$`4$``q$`@?4$  촔 '  ܒ` C!$4$ ;! 2`$ `a4$H   $4$  !װ`w 㿘   > /?" # 0ϰ 㿘> (&` a$ ,$ ( 4 ``&`L?  $b> `> ya8@``&`8o В> .` a> ^cP &`X`0㿐  > z`X㿐? 0`> I@!tz4   `@"  $&@" I @"@"Dт @"Z a@ۂ `) ֐a @ D c@ a@  7`@` `"ޠ  c@"00 c@"8wc e`e@"=`҂`r @  `q@т D0 a@ c @ c@ƀ c@"-0 a@"V `h@ ` &`( [&@" S@"  P@@q  2 $E`@ {0 a@ `p@| h7`@`xr @"ڒ8 c @H  @J0*E@<@2 A @"H *K p@s@   ! `!˛  c@"^E00c@ #$1˒ c{1#$ ̐c @ a@ 2@   V n Ԓ 2    p  6 1  2`,  }1q 0y 2  (`@`ڐ1 0_! Y``     I`ɠ  19#$    @ 2/`&d? +`8 `4) @8`@4 `&d ?`(@8`@4(`0``  ` &0#$> *0    8 2``& ?`(@8`@4(`` 0 ِ鐔 ԐϠ 2 $ϐ *  2 $Ȑ@  c@ FƖ  c@`Ԃ Ԡ `0 2``'`@ 2@ @ @  ܔ  ؔ `q@ c@  2l#\` @ X 2E`" ``& ?`(@8`@4(`0`'ה Q `@ ??c+ `@ @ #``&d?`` `() @  8`8@3`3` + `ĝ㿘 D? `> I @!t2`@i2`  ``@" `Ă & 4 0 <d& @& 0Ho$(@Hp@` e0`$ & 4`?ݒO`ؐ`/ > Ia ? 2 *  0$0$ H@  @ * `# `"(`@2 " "*(@`` 2H@ * `# `"(`@2 " 4`$ 6 `` `I@` `@ @ A(`@d `" > `   㿐> I& da  9` & d㿐  > z)a㿀  /F Q 0 #\#d#h#`   ?A  0(`@$ 8($ H(`@$ < ($ L   (`@$ @   ($ P(`@$ D#d(`@$ T #\#`#h`  " $ X.  . $ \` ` (X  (\  0$ `.0$㿘 0(İ "  $ ab$ $ $ $ ?$ (6`6((7 7 ((( (`(`(fu㿘@`1 (``@H) `08 挰 !   $ $ ab$  +)`4(0) ) 00) ) `` `) />㿘@i` e`a*`HW+ `  HP*``H@I\8@ `G\8@ `B  08 8`86 4   $ $ ab$ ?*(`40*+`3`**) 3 1 **01 **3`* ``` `* `` `* Ր  㿘@ K``G+ `H@=+``  H6X8@ `4  08 8ٰ '   $ $ ab$ ?+`4(0+ + ) 3`1 + + 01 + + `` `+ v児  㿘@(`@ H`  ` -$ 8 $̬ $`-WP ```(-H$ HN  - 8 H ݀` H ` `(԰ ,,  ``  @*`@P ` ,  @ 0``Đ> Ia? 2 cF@*   cH@cD@#  C@. cF@* cE@ cD@"6 8> c  0 H@  8 @" 4cA@ cB@H@> 5b > 4bԒ  8 4 @" H" L" P"  T"> 5ah > 4c  4 @"㿈 > I!`? 6 @:!(`   0$` `0$ 0 ! 2  0 H' L> I' Pa\' Th' 2 0  `H   8& 4$0$Ґ 㿘 &`0> 3cP , (0> 1Ґ #$h$$$$$|$$$$ 2( (@?(`2`(( "   @?``((((22((23 (( "   @?`2(2( (((3 3 2(((3 ( " 㿘 6@?`) )6.6) .6@7 ) ) ) ) ) 7 ) ) 66@ 7 ) .) @)  &  @` ```_* 4 @*㿘  &a  5 (  & ab& &   $ 㬁㿘+> n`x`p> Ia` ?0` @6@a%`xa܃(`[ (@]+ V4`.` ,` @@X(<(` @ ```A`@\v.`0`: C @2-@$(%`x㎒  ,  c' ' ' V. 0`  ' $ B@ D 4C  %`x ր    㿘``?  +c"@   ` 8  +㿘``?  @"@+I ` @    (`@`<"  -* @   (((`@@@$a    (`(($a *ؒ @0㿘` `? @ +  A        (`@* * *  ͠ " `*`2   `  @`` - *㿘 "i K㿀`> `?c<'   "@*~ +  ⓒh "?''' // '//// Ԕ   $ b $ $$ $ 8G " `*9  J`@`````3` + @ 2`2(,`,       +`  **   * *`@ @>!` `` ` (`) (& `0`` `& & > z!㿈` `? $@ *~ A  h 8 %77/777`Q  b &`$&`&`&` ඐŐ     (`) (  @<    (`((@ ?@ $@$) 㿘 `>> ya8@   !`!`p'''''֒ < 䀈` )  "4`   #\#d#`#h  R 2 `"LL` $0$  $hm(```c   )4 ``2 `  `   ` 䀠""&` "~"    `@?c{! " `&@ ?f&`@` `@U `&` &`&@&`d    )& 䤒 2 `2 <``8 <```}0bb #d#h#\#`  㾚 5 "3 `?`2.    (`( ﮐ n` @UI g i0&` `J $`I0$ &@&`  #d#h#\#`  z ?  < `?`8  (`@    (`@'``&`^ >` #d#h#\#`  F   쀣 `?`2 ``#     0 3`     ((@@2@+ +` @  **@ @  >`䀠`ٰ  (` @ '䀠@Հ0㿘 D? ` @> I2`!ܒ@ 2`  䀈`"    <(( @@&$ < `0@㿘 `$ 4`, ``( 6ّ`` ;` A @(`@dd"`Ɓ ۛ  !  ?㿘 䀈` > c4  !ʐ!ܦ!,֒ > 㿘`` `"  !,`@& ܓ   !g  䀈`    !\   X> c<'  !p`&(`&0`&,`f&4 &8 d&8 6`<``YԂcI&as  ``De ``L_  > z,   pې@Va && aW&<6p6r&&&X6 6 ?(?0#@`@`@* > A@@`  cI&X؂`tl  > z!(㿀 ' $h7 -䈖 0  ' )%> I\`` #d #\#`#h  ƚ 24 `v @0``u@"&& &@",`' ? (`(` \`  6" ްܰ `  " Ӱ`((ր`ɐ㿘 & $ !@o `D  `@`L  ``\   $ x   a Ք  $&M a> zoa $&C 㿘? 0`> I@!ܧ4    䀈`@"  @ v@"i  `q@ h@*`(&` &&  $ e r@"8 `u@k5P  p@l s@p ް  a@" `p@a @˰ ɰ ごŰ`q@0a@ e`t@` e@р`!D 0a@"*V ŀc@``0  b `` r  e`g@"A` J0" `| "y a u2 $ ڐ! `k! r 0b  0\ k@ V  PK,4  (?c> A ` * @p > ;|> A >`  > ;|> A >` 㿘  ,`, % p 4`=  0 <d$ @$ 0 0 (`0  @ Hod(@eHp@(> 6d$ 4 < ($ @ `ߒ ?2+&  & e$ 4 "$ 4? $ 4& &  < 0 (`0 @   `'ܐ`a`&`  & 㿘  ,`䀈`@V $`P` L` G(`(`@``4   @@QS <@ D@U0 $ bA ] #:$`$H`0$ <> =c$0$t$$<$p`` %``䀈`3%`c`u:$b`$H> =$ <c$0$$$t$p`00 &    @2 @2   ?c @ ܑa,㿘? 6 > I!ܓ4`Ұ  . 䀈`@" 0'Ð `j ` 䀈` %  $`  $2 $  $a  !!, ͔  $~0$!`   㿘? 0`@> I4`!  B 䀈`@5 { T `  `?`? ,$`` 0  `  `$I$4$J`"в 0$`"̲ 0  `$2 $@?  c$``4$ ٔ! " $`Œ ,``4$ 2 $ 4$ [! V!$ ް   㿘? 0`@> I4 !?  ?`䀈`@"`??F  (@@)``$2`??  ?, @ࠀ2? (2     @@PRB   % ɰ?`㿘  > ?!!`> 7C"X 0 㿈> Ia\&`$> ;$,a $(bLC`&@4&2 5> `> ya8@"h`5> (FРa,> >X> a5cP``$j$`a`    T$`K = `a@S @O= #\`> z(!`䀈`H ( В&`LÐ`''`u > 7`A  "X> ;̀ /&a`0> z("`&` ֢`V  `۔ L` *$&ak4&> z '!0> z'"0a`0' B`v> 7㿐  > z;a8㿘 D? `> I @!ܓ2`@ʓ2`  `䀈`@" ` & 4 0 <d& @& 0Ho$(@Hp@`e0`$` `  & 4& 4`?ؒ`a,؋%%%%8%4%L%8%$% %%%%p%%`%%$%%%$4%$4%$%$%%%$4%$4%%@ D$b" H 0 ``>" 0 <"" 8 `, (`0"%" 0 2! L < (( `"1 0 4`9 ``"9 0bd2% 0 0" 0" 8 `(ڄ " 0  < 0" 8" 0 <" 8(`02  0`Ҁ` 0" 8" 0 ``" 0"" 8` 0" 8" 0 㿘 `$ 4`,` 6`` H` C (a 5 $(`}& (`0 `8@Q(`&b`h`@ Z $`0 6` 7 2%L 4 K ` I`> z &"` `@9 @ A(`@d `& Г `&` `4 ` $`0`$` `8~$`8  ` ( $  `2`4`9&`$`5&`8~$`8  `$`l$`h  $`0 6 7 8 : 9(`((@@@& (`0 "  (`8秐$ (`8@P (@(v`0$ (s`02T"$`0 $$ ( ` 2`4> z`& "`0㿘` ج D  ?$ l$ h @$ l$ h &``&` 0}$ 0 6`(6`(((JY " h?$ l$ ha"a$ 0 0}$ 0$ 0㿘 *  0", 0`  b0`k}& 0  DW '?$ l$ h  0` ``b$ 0bހ`܂}`$ 0` (`$ 0 4߀`逈`& 0 )6`) ) ) 6` ) 6b&& " ?$ l$ h`& 0  l@`$ l?$ l?$ l$ h h@$ l$ h`` b }$ 0  u  0w$ 0㿘 0ede` &  &`  Q   &㿐 ۖ  0 D}$ 0׭  &`a0& ((`o $ l$ h6b㿐?& l& h`    4` D{ 6b && (1(@`  㿘 D\  & `( (c & (6b&㿘 D`$`.   B 'h1  `&` &`$&` a0&`(   ($H   (`(@@$Lڒ 㿘* `D # & &$&&c & ,`0`6 `, `8`""@O2 , 2 , , դֳ6, , , ՙ֨" t P t ` `  p*  "  " x*  * |`* p ' D  ` #d#\ #`#h jఒ c `2 ` `(`` $4 $$d ` @~` ,@0  ,`  ,`k`D L!0,`0`,@0  ,`  ,`,`Q`D j!0   (`(@ @`<㿘 - ; $  4$$ $`8! `0T$`0  "   `8ဠ`0` $`03 n$㿘 D? ` @> I2`"@`2`   D`0@l > E> H >`" > E> H >`"㿐 0?& l& h D  @ 0!@` 0w& 0 $4 $  @ !@`" 0  @ 0㿐? > I2`"@2`   0 @ 8a@' <@ 7b@`(  Dږa@2 D` (`> A8 0Q  &&&&&&&& 6 8& <& x& |& D$`" 0`6 0h" >`6 >6 @6 h& l& 4 >4 @   &  Y     J )" 09 2M> zVT <`, |,  Ė   ( y4 t  n  i   0c Ô _2( H ?" 0 0$ 8`$ 0" 0N * < G !", <`$ 8 0`<$ 0  8`$ x6,  L`  ,  L( $ 0 0"$ 0㿘? > I2`"@ 2`   0`@h D   t p @ $ 4  J  4`.`$b$[  "' d |, < 0 +$ 0 x`$ 8$ 0~ "> z !C"0 0 "`$0, < ԭ!@ 0h$ 0`$4`$ 0؝㿘 ?> I "2` @2`  0`@  D`2 `$`$    `4`$ Ք!`$` 2`$ 0h `` 0`$ 0R ``$4`$  倦 㿘? 6 > I"4`C   0`@a`2 D ``"% $`   $ W6 $ 2 ; `" $ ܔ  $ ֔  $` ͔  $  Β `㿘`  0`@& 0 㿐> {a  $ `  & P & pJ& 4㿐  > {cX㿘 ɐ%> ] H(`> \ aT> Gb@ H @4%> c `> ] `L> Gb@ 0  @4  H  㿘> A&`DcL$`,$`(>   Р`> IŔ`> ap`Ē ?&`l&`h`$4`$㿘 D? `> I @"2`@l2`  `0`@"  < & 4 0 <d& 0& @Ho$(@DHp@`-be0 "& @`"`H`8@L 2 ``I `L > z`# & 4> z`"Ђ & 4㿘  ,`,  p 0 <d$ @$ 0 $ 4Hod(@Hp@(> Axe0$ 4 ($ @Hod(@0 & W `&  "$ 4? & & `Ӑ`0@`&`0 ͦ 뀢?㿘 ,`0`@ h"$$``0$ѳ` )  0@"@ 0 <$ 4$ @{$ 0`0$`0Ho$(@e}Hp@ `0`4`` "0 0 <d$ @$ 0 $ 4`0$`0Ho$4ݐ(@e֐  & `0 0 <d$ @$ 0 $ 4Ho$(@ .. . . . .  0A  .h$`0`"B < `.  <@I`82 . . 2 . `l? `0`5?   (($`l $c $ H$  <$0$$> I`$p˃$t`0($`0 .`0~`$`0$0`. . 0`. ւ $`l2 ϝ` 㿘? > I",6 ے   | 0㿘? 6 > I ",ð  `0 $0$㿘? 6 > I ",  `0$``  0$㿘%> ]H` > \ aT> Ja@ H @4%> c `> ] `L> Ja@ 0  @4 µ H®   "`0> ,0>hb %/`%/%/%/8%.㿘 2* B*@ 3`+ +`@ ` 0((@ @c@ C 3`+ `@+`0((@@=B?@ B@Dٖ   3`0@㿘b` ` 6 4!Ȁ  b0@ 2 Ȁ@  = @ ,@ * * > '*bȲ `#!0   @ `    $ $ $  @$ $a0$  ;((((Ր 2 ǒ @0b$@ > Jc 㿘 4> 'b 0@? h# Y $` @`$`  < $`$$`a0$`  < )) )  <(`0`0`) Έ) ϗ : D`$ > J c   H@ D H` $ D(` L @< 0 D@`P  `` (`  ; @?` <  `P( L@`A` $ 0$ 4$ < L@` `0  $ D$ 0$ 4$ < L@`"$ `   < 0$ < L@`" !` `"($ <  `2 D   < 0$ <2 D$ D $ 0$ 4$ <2 D   < 0$ <* D`!(Ć`2 D$ 0$ 4㿘 @ 4  )> 'b 0@? h#    $ $ $  @$ $a0$  <(((((ِ`"  ʒ @     & < & @    @@* & D *   & H T `Q   H> { cx$ H @ @$ L $ 8  ` P > { c $ H @  $ L$ 8 ʔ ` P @ @& &  `6 `#` `` & & L0`&   $ H @$ 8@$ L   P @@z&  $ H @ @$ 8$ L > { Pc_   $ H @ @$ 8$ L > { Pc_֔   @ <! & DS& @㿘 4 Ȁ`$ D D`$ @ LĐT  D`$ H   H-  D`@ P H  @ " <ư 㿘&`0`4 ,`> h А& @& D& Ȁ 251> { D` > K ?a 0&  D` L   L HĞ  D`@P@ Ȁ`> KԴal ``" @ <& @+#> {(#& Ȓ> {"# H& & D   ȝ㿘F ``A> ya8@`: `" ``1 ` 5, :8 : :   ^ $> 'b@? ͕h  c  &ǟ&JY  , :J > | ^X`  :> %98%9$%9$%9$%9%9%9%9X%98%9$%9%9D%9D%9D%9D%9D%=%=%=%=%=%=`%=`%=```  `> y`8 " > y`8 `L`0 :`0 <` ``L``(``L``(`> M> M Aj:`0  5:`0"`0"`4 a⠁:`0 a⠁:`0`L `2*B*@0((@ @c3`+ +`@ ` @ 0((@  0@C:`0㿘> 'bȠ`#`  0˰   $` @`$`  D $`$$`+$` (( D(`0`0`(t(̃@ 㿘> 'b 0@?  ̠h#  $` @`$`  D $`$$`+$`(` (( D(`0`0`(H(W@ 㿘 4?А " H  b?@  ?  2 ((`<(b``(q А `(0b$@ > NcT 㿘 4~ F P B> M c L@`8 H(`@ $ < H``(`"  P 2 L 1> |O @ $ < H`뀠`ǒ P $ < $ < P P㿘1  `  ]M  P H& T& P& H& L @`> |> |`h`>  c @ `  8h @$1` @``" `W ``O`2  X  %  , H$ 8$ L]  $ P T P$ T T @& T `@4բ`@`! ?   ?  H" P & L! TT?  P T+  PP T& TP  r ؆ ""  L"  L & L ` 㿘( G  +> 'b0@? /h#   ($  $ $$ $ +$  `((  ((( " @ ڒ(`2  ` `(`8  ``    @   (``$D  $@ "̐D@ Ɛ, `㿘 4 H`"* Pr H2" P! ?    H" P & L?  o  H2 P`"0 @ X  P % @ T T? $ P$ TS  P " @z P T& T P T? $ P$ T>  P  @ "6 D  p> c<' &`0`4 `,`"`0В`D С> | !\Y`p 2:&`< > &`<  9`P`> O r` W&``P  `XՐ P x`H`> O`p 2#`P`"`H T> |> a ΐ "`P> {X#0쀠``@`D&`@> |L x`H2`P! ?    `H"`P &`L> {.#`P2P`H! TT?  P T `P"`HP T&`TP괐 0 > Ib> R> QaT" \" h> Q> Qc(" `" d> S> Qc<8" l" p> R> Ra" \" h> Q> Qc(" `" d> S> Qc<8" l" p 8`  8@  8 b " <㿘 8> |}  8  ` > |  \@ 㿘`"!@ > #!@> R !㿘 8ddaf{  8d2? \!,|` " 8 @@> "c 8  \ 8 @@ `(" D,"! D#@ @,2& < 8 `& t& <(, D )" 8` ވw܈h׈!W> |> |!@2a`> |/! 8> Qc > Qc 㿘 8%> .L` 0`B <`)> | 8d" @da  8d2?  @,  n`@" 8` ` aÐ  8` 2? }" P)& <L`# ؒ @آ@ ؠ@ ؤ@  `, > |! a[ 퀈`"2 P@  L`q`[> 'a􀠠"c H X @  T@ ` " 8` 0> |> |  x!\`B @آ@  `@[ `(`@@ P@@ 倈`@      ؐ@  " L`" > |A"  T>@@> 'a􀠠2 X H " X L@ P Xؒ @خ@  `@ > |"0z`  r ؐ@  * ؐ@  > |  > | 8?}  8`` 0A!> |> |!@a`"<> |!> |> |!@a`ܔ"<> |!㿘 8dda֨  8d2? !> .|` "& T& X L`/?@@(@ 8& P' @,>> 'a􀠠"J P T 8@  @"O T 8@ a,b"@ ~@> |@ "h  T?@( 8:& P' L`" @ P> |l" @ t 8`  t 8  8 `> 'a􀠠2 T P` T @@& L && H 8 ` @ P@> " 8(@ 8 ` @& P' L`" @ P> |> |!@a`/!> |!> |"㿘``X  @ P `"o8,`"k8 '> |&`8WȀ p%> '`" <> |"`8 @<@&`@@`(@,@$@"> |> |#>  Ґ`"`8 > |Wc  @'젒 "> )> Qa@ @|@R  ' J@   @r0&  '> |&`8WȀ > |@Sb> |Wub 2w`8@ @e" %> '`> | < " > R?@a؀?k&`D`D> |@"n&`D`8 @<@s&`@> c H> ` O`28`> @#Ȁ &`0"% > @2d> |> |G"b> C#^> > |W#c k W e '@a f> )> |Wc "`> |##>> > #9> "5> > Vb 2`8`8( &`D㿘``V `>  a &88@ > | Vѐ#  `> @ 㿘`"!@ > ֐#!@> R ѐ!P `"R8,`"N8 &`<8&`@ < " > R?@^a؀?D&`8`8`@@8&`82`> |@#(:` &`48`5` '@ %> )> Ua$@ϐ @P@& m ' @ 0 @F & &`8'㿘``VO  7@ 㿘`0&a< L(` P(`@ ` &a@  `H`0`L @  @ 2` ` `4@&`4`L&`0 ٲ` 0㿐 jH  : " 8"   `$ .' ` j 0`"  (  j] `(  Z$ $@&@٢   j?( `Ŕ'Ô i 㿘`  ` `4@`i㿘 0  $@0Ӗ?( @`  D@< <$` `  D <& T@<{*`$`` D <& X@ |#H㿘`"!@ > #!@> R |!㿘 4#> M@a B & L ? @<& H 4a@ H ` `8$`4 L   @   @ `  @" `4 L@ ` H@Ԑ 0 1> |,#`P 0 @ &`0D&`<4&`P4`"l&`4 < " > |?@c?]&`D?`8R> R?@a؀?V&`8`8`D@&`8> `<c> c8> |2`#Ȓ@:` &`48`@` '>  $@  %> )> Wax@  &@@b f ' Z@ > |#&`@> |#&`8'㿘``T  m@ ##" #|) @ h #dd`# h#dd@ ` C !: ` ) @ 2 €@   "#{"#2 Ć ?#X"#p ##\    #d ?#d? ##l`#\ `( ! #\ #d #\`#d##\ `(! #\#d #\`#d#㿐 Āa#T `@$  $  Ā7?# 777 77 ;n c  S  8?  `3  3 ``1 2 3 (3  (@@ 0c$@$D$H$L$@$D$H$L Ă}6 ā?$@$D$H$L Ăb6 ā㿘#l``  1> |# \j g d  ` <@\ `??2<@` >@R `??2>@ KH . 0`>A `>㿐#l`#\` > | z# $   'Q  $  '0 $   'A  $  '0㿐#l`#\` > | L# $   '$   ' `@  $   '$   ' `@ 㿘#l`V`U В ͒ ʒ  Ơ >’ `??2>` >@ `??>@cl`   *_\  Y *??QOM `> |1?Ȑ#㿘c4`` H     1  : Ѝ??  c4`<`>`*@*cT > } ? *  Ȑ h??& ]$  `> } y  ̒`> } p ! b ?ʐ~ǐ 㿘 4a !")  $  ``&``#&`  ``&``&&``&&``#&`㿐#\ʐ#`  1> } @&`` '&`` '``  ``?&#l&@@'&#l?&@@' 1> } `㿘e > }    @> #t` h*` ’@ "   @ > :  @> 㿘## c#|, `Ȕ #| `(`  !#| , `&# 㿘#`%6 #T b #T `  0 | #T `2? #Tc   0 l #Tc ?)##T㿘`$ \ \d@`@"!c+@-8"`= > D"`H5  D  t `* ~|,` @ hX` a ` Ӣ @ \d6 \X $p @ 6 Z$$!`2 a؀$X $p !`2" " D؀  (`@ a$ !&!@ " @  a㿘#T#X#L hHo4#|(@g#|`#t` @#x#|+` `(` @ @ #|` a2#x  ` @a#|#x+` `(  ``#|` @a2#|&#&#&#&###(`@$c##($c##(`@$c ($c ho  $b  $bP $@#$ #h$ T#d$ $ $$  $X@$ , ,>$ (a_$a$ ?$ &#p$ $  $b,$ 0b `$b c $c  Ă`@{6 ăHp@ #ݐׁ#t @ y&#x#| @ߖ o&#㿘Ho&(@gNHp@㿘f > } ` > }> }  & ؒ> } "!0װ>  c 㿘2 `  ` `> c> }> }!@ !P> } !0`> }`㿘 >   a!@ Q x?> }@Ga&c`> ]cږc   4@g0 &cX #`@a<   &cT@[H&cL&c\ 0&cP> }?@%a?&cd> R?@a؀?&ch 8ch`0@&ch> \c  &`0&`4`@4c|: c0> Y> ZA 1 ?N(2x #l!2[ &O! D 2:c4A` ʢb\> ^`&b\> [`8&a> \b&a&b? "&bL6`Ġ`h&`hWUc`O> } !8 > Na `"&  A  &c4 ( A  (&c4 &  A &&c4  A! &  A &&c4 #  Az #&c4  At! #  Am #&c4 8W&chM&cd㿘`N``?㿘#THof(@g@DHL! @C >!"@"D"H"L$ hHp@ ґ#㿘Ho&4 (@g a"3 \80a "9 \c`h 4" \Hp@a50 a6 @}c0 4 \`@$ Hp@`A`@#`^ `6 \`S`h#  Hp@ \ 6 \ #"`c8`@ (```"`"`"`cp`  ``  㿘#8  , 0?  `   $@0?@` 㿐 #8ba# 7777;n c ? `Ms  2,?  `3  3 ``1 2 3 (3  (@@0 `MJ ژ?6 Āb 777 7? d,0w? (``  ,2? d,0_? (``  ?,?㿘e > }  e  @> #L` h*` 6@ "   @ >  ] @> 㿘#h c#T, ` Ȕ#T `(`  !#T , `&#h 㿘#8#<#0Ho(@g #T`"#L`"@  #T#P `+`(` @ @ `a2#T#T#P  `  #T  @ ) (` #T#P@  $#T  )  (` #X d$#Xh$ &#\&#d&#`&#h$$$$$0$4#@L T$$$$ $ X@$,, `$(,`  \,` ,`,` ",`  ,` ,`?,`0ʎ?"# `(`` #,`#,`#,`#,`#,`#,`,` ``@{6 Ăa@?,` Hp@#L @ u&#P#T @  k&#X㿘nS㿘@ @! @>!@ @> }@@> } @2 @2 @ !! @a>!C >!@> }@> }@> }@@> }@ h!  @a>!C > hd  @> db  @> bz> }aj> }``@  @> `@`  @> `N> }`A> }`4> }`'> }`> } ` > } !! @v>!> } ܐ#` א#   @>  ͐#h   @>  Ð#P   @>  #0   @>  #  @>  # ! @`> C >! "  @>  "!  @W>! "!  @I>! |"!  @;>! "pq 1 > } k"X> } e"@ `"(!  @>! V"!  @>!> } K!!  @>!> }A#Аɠ?0R㿘 \d@`@;d!) +8"`5  "-$d"`Q  D  L `* ET,` '@ h<  \`a$\` Ѣ @ \d6 \$d!`. a؀ a؀ " D؀  (`@ a$ !&!!`"@ " @  a㿐#`#\$#T) @ h'` h'􀠠` C !&#\> ` ) @ "6 €@ Ād&#` { h6 P 㿘#4#@`(0 c<c߀   . ?  " 㿘 @21> }U#?> ~@` &cD  8@0   &c<@<&c0&c8 09&c4?> }@ߒa&c@ 8`0&cH> b`x &`0`@&`4cw[`Œ > a> ba&a&a> b?c4"cl&b6`Đ<&`h> ^> ^D;  < # #<b\ `&bL&b\`h 75cD/> }!8 > ~IԒ`  `"&㿘`I``?㿘  > a!@>!Ho&(@gOHp@㿘Ho&4 (@g a"3 \80a "9 \`h 4" \Hp@a50 a6 ;cl 4 \`@$ Hp@`A`@#`kP `6 \`E`hF > Hp@L \ 6 \㿘> I-!`?㿘0 `@&@4@ `8><&cP `&cT4E`> &#p80 @ 2&#`D< @ *&#\"> ~`P@  )#` d@#P#`@?`@ 88` ! &`>` &   @Ė I1> ~ h1> ~ 01> ~ v#`㿘> ~HȐ `?㿘<&b `&c$4L`E<D @Ǖ 5&"80 @Ǎ 0> ~#|#x&>a@&   @| "@`&`?&` "?88`@@&`8@А @.#! 2 "1> ~ h h"D@ᾁ1> ~ 01> ~ 㿈 ` k  h"< @1 `< Y@?M `D` @ ߂`۸?쀧 8?c@.?0`  0/&/7 '') 1 @@@@@.0?c00@8(``  $`6 $ @Ÿ?# ` # @#    # b !$2!$ } !$2!$㿘> l &` &`㿘# @`` #0` `    #0``  #``#?c!   Ȅ! 㬂 㬂Ŕ@㿘#`#(.`@@$` ` @R  ` @H?   > ~   $`~    wt q  m >@i `??2>@ >` `??>$`|* xuq  ` ?c㿘#`#.`?c($  @@A   @< 1> ~*   $          >@ `2>@ > `2> > `2>$  1> ~ 㿘> ~    㿘# $c0ľ? c` 1> ~ґ 㿘# $b0Ī? b` 1> ~ 㿈#!$c '}6!$'''耈@6!$$cL$cH$cD$c@$c #`6!$?c''''$cL$cH$cD$c@$c # ܤ   2 (2   (@@ $cL$cH$cD$c@$c 㿘e > } ] !P@>!P#.`   Ȑ ^{ !H@>!H!  R !P@>!P㿘# .`.` @((@Z   Y@ 2 㿐#̤)'!# , t@`& &#@!P@>!P#'@ a   #  , W@`&#́ 2y#㿘#`-# "/p#&#&#&# @(( (@ (( h h 2#&#̚ !#+`+`  @ #`` 2## @; &##!@ @4 &#㿘B !$6!"{ l6!$#  #` l #@    1> ~! 㿘#####Ր?c$ # "p`$ #}#|(c$bP#y#x (`@$c #{#z($c#}#|(`@$c%$cc$b0$b, $b$b#$#h$#`@;`  % a%! $,!@`$  $ @ > ~"!@$c c b  l$b #`@?$@b `$b c $c / > !$`@{6!$` % $ 0> ~%  !(% 㿘 \`l 㿘Ho&(@g;\Hp@㿘@!P.@@>!P "?!`*@>!`?b  > ~> ~!`͐ 㿘 >  a!`@!h bH bL bD b@#Ȁ#!$#Ȇ{@ ?>!X6!$&#Ȃ `  #, ( `6!X&#q #Ȁ`"6!" 㿘#?b   @ސ㿘4`1> QՑ x`1> ~Α"(8  @™0&#D  @“<&#P  @H&#\  @‡T&#h  @`&#> ~& hbH@N? }&#?` !&#> R?@?a؀?q&# <#@&#> h& 4b|& 0 0  @T#x> ~`P@  } #> ~u"P> dc> e& l> db l& & < > g& > d5Ԑ???"  `46    "> h` &"> i&"T&"X> g?c"&"`6!$  &!&"q&  o8" > I3> i %c4 &# <&# " 5 5Ғ "ʒ  |&#cB &> ~Bbp "&> ~Bbx "&մp10㿘``Bݠ " > ~B֐"x  @ > ~ BȐ" @ 㿘Hof(@g  lHp@  㿘Hof4 (@g a"3 \80a "= \  Ȁ 4" \Hp@a50 a6 4 l 4 \`@ Hp@  @% Hp@``@6 \`2  Jܐ "ڐ ֐ ݐΐ %*` @%*`*@% @%*@㿘% d@㿘% \@㿘% h@㿘% l@㿘% p@%`8 %`<㿘4`"1> Q x> ~&e"&e` [&e@&e<e< &`$@(˒b@&e<`" `"8&e !> |`# A 2U`&e& 0``"> Ic&`e@`؂` .`.` .`  `ؐ@ _ "`&eDe<#@(eD`R&eL``J` I@e>bl&e\&eXeX@v ` 8 > AcȀ "? eD` eH`&eH> Ic, @ @:# &e" 0` > AfcȀ 2eD <"s@2eD `2eD @ eD@&eP@&eP@(:$&eL`0i&e<2eD  > ~@b&e@e> N?@bT&e<> ~A0" 2[ `"D x1> ~@"> ~A"#p b> I> J` `&`؀`2e@&eL&eP .`  `.``  `؂ .`  `ؐ@ : O&eD0 @ڔ &e @  Д M ``A &e80 @” I$`8<@$`0$`@> '`"' <ԐD< @ &e1> ~ؑ#0``؂`@.`.` @ `؂ &eD  P2e< &eD " > R?@]a؀?$`D`D$`D1> ~">  > ~n#X1> ~#$`D㿘``@` `">b >  a Z&88@  > ~@f" > ~ @^#p 2`0E@ " l" L" P" T" X" d㿘Ho4 d(@m d h  L@  l p  T@ Hp@ 2  L 2 T@ X@ P  ` @ `*@㿘 `   * 㿘 `ߒ  㿘 `ې ֵ.6ӓ 㿘 `̴ʓ 㿘 4` @ !  & 4@& L& P& d& h 㿘 4` @ !ݔ  & 4@& T& X& l& p 㿘 0> J ͒`㿘㿘 @㕐   `> lcذ  $ x$ | x@ 㿘  v *` `` `8  e ` `$`  X ,``$`@`P` `P@԰ 㿘4`1> Qu x> Q o &`t "70> J`\&`` X&`@&`> > l`@l ``> lcؐ&`x&`|`x @` > l@Œa1> J&` Q>=` b`㇔` > l@a1> J&` A  @ > J㿘> 'a􀠠 > ? #`?%h%%%h%h%%P%%%H%t%t%%%P%t%%%T%|%%%%P%%X%l%%%<%`%@%%%,%T%|%ä%%%4%l%l%%%H%̈%%%|%͈%ͬ%%%%X%%Ϝ%%%4%%%,%\%ь%Ѽ%8%%М h(@ h( h( h`@a@.c` > ~ p!p?- ! 8 !@8 ``?``$`+  @ ` " " "@  8 ``?`+ 㿘  ?  @ ǐ ?`0` @ N ` ?0`@ ` `F`>`"7N   `   {  `?` `? t p  δ 00` 0@ 0 [X @`2ʦ ɔ N `2Ĵ`Ô N `2 㿘`  (`> m`K`x  `   B `   : `   2 `   * `"`ڐ     `؀`А >] aP`̀`Ő >] a| ` >] a$`  &'  @ ` &  @  ' ' && & & & ؤ Ԡ `  h?c  ((("   h?ۂ`  (( ! 㿘 h , , & t㿘 0> J aa㿘@`  (`> mH``"`  `` ``.  `  ``Ԁ` h (`  h`( h(`  h`(0``֚ ```Є  h(`  h`( h ``Ú `` 0`` ```  h(`  h`( h (`  h` (0`` ``  h(`  h(` (0`` ``a`` . ` . ``2 ` @ |. ``2x ` @ r. ``2n ` @ h. ``2d ` @ ^. ``2Z ` @ T. ``P ``1`J` . ` Q. ``A `` ```7A. @ . . ` . ` 5.  h (`  h` (0 h ` . ` $.  h @` (`> m`` ``" h ``2   "`` ` h (@ h`*`  h( h`*` ``܈ ```ւ  h( h `*`  h ``Ȉ ``È 0`` ```  h( h `*`  h ( h`*` `` ``j` Lj *` *` ``2 J  @ "```2 J  @ "```2 J  @ |"```2x J  @ r"```2n J  @ h"```2d J  @ ^"```Z ```T ͈ *` N*` ``2J   F"` ( h 0`>*` ͈ :*` Lj 6*`  h ( h `-*`  h  h  㿘 `  >  f  & &  & @ 2 >  O 8& $ $ $ @$  h `( h , h`D`@@ #` X T  W  L  h`d   @   $ #`( h `, `( $ 㿘 ` h>   `  > x& 3> 0> @ 2& & & & @&  ! 8! <``  ?c!  D`!  )?)  ))  ) )`)   㿘 h@`$` @]  @" " @9$ @"# @ $ #c  @A$$`($`,` @ #@$$`8$`<x`԰ @| ``ǰ  ,@ ` 1  ,` `8 $>  T `( $ m  h ,`$$ ^  Z ˀ 㿘 䀦 "1>  @ @"   2 1>   @搔 $㿘 ܢ  @敖  $ $ `$$` l㿘@` (`> m? &``&` &`$&`>  a: ? &``&` &`$&`>  `H9   &`&`? &`$ &` `> 9``( &`<>  aX9߰   &`&`? &`$ &` `> 9Вa`(   &`&`? &`$ &` `> 9`0`(ڂ   &`&`? &`$ &` `> 9a`(ʂ   &`&`? &`$ &` `> 9`H`(   &`&`? &`$ &` `> 9a`(  &`$&` ?&`&`  `> 9`X  &`(`,> ^9z``D&`@>  9t`8 &`X &`$   &`&` ?&`$&`   &`&` ?&`$&`   &`&` ?&`$&`   &`&` ?&`$&`   &`&`? &`$ &` `> 9<a`(V   &`?&`$  &` &``> 9,`P  &`(`,> 9%`0  &`@`D> 9a  &`X`\> 9a`t&`p> ǔ 9` &` ? &`$&`  &` &``> 9a  &`(`,> 8`8  &`@`D> 8a `\&`X>  8`@ &`p ? &``&` &`$&`>  ``8ܰ ? &``&` &`$&`>  `h8ΰ 㿘@` (`> m `>  8a &`  &`&`$ `` `   &`&` `>  8a0  &`$&`&` `>  8`p  &`$&`&`ݰ `>  8`  &`$&`&`Ѱ `>  8`  &`$&`&`Ű `>  8s`  &`$&`&` `>  8ga  &`$&`&` `>  8[`x  &`&`  &`$`>  8Na  㿘 ܀`\ h   (`@\HoQ(@<  @,@ I,@ ,` H,@,` ` `Wc?I>  @`  \,@,` ` `Wc?=>  @` W,@c?5>  @`  W,@?,>  ``  Hp@& ܁ m`Ho4(@ !8 \ !XW !xς  !0ם㿘 t h`9  $$t$$$x$|$$`p  $`l` ` $`f`Wߠ$`0^?">  @`    @ ߐ     _! 㿘4`"1> QT x 1> M!8  @0&`h> R&`la@??#&`p <`p&`4> q&`pc&`0 `@`0> ,"> J3!? .`.`.` .`.`.` <&`p㿘``6  > 6" `?%d%%%%%%%%%%%%%%%%%%T%%D%0%%%d%T%%D%0㿘>=b>=b   ) `   *`;`*`) `Ё  D"H H $ 㿘 8`5`3>  `@  @`` >  c  @`a     @   @    @    @ 㿘!``  T&'&! ` !  @ !``$!`   @ !`!`"!` #``#dd"d@@ d0``E Ed0``#`?!0 P #dd@ #(!㾸#> nc> c<' ` `:((>  Ȑ8 $ 8' '$' @ $" `" `" &&@&&c` `8   2#> >  Ȑʔx >   ''@ː`"@&`ް @&h#X㿈 `& | & | 8 < 0 4& T& d& \& `%> '`=!>=> Ec P`  "`Q`h`P $ P |`@& |@20 T |`@2 8 d X T`& X: & X& &  8`??? & ؁ & X#0> @1c "#0> @*c P``" |/耢   '''' |``& | l`` ") 0 |`P& |& &  " 4 @4'耦` 0 @@4'耤2 l |''쀠c |㿘> !,c(5? !   &!P&!@ &!<&!D㿀'>=` >= ``> v!, &!\&!T!\!T''''&!X'> ˌ `> v&`> v&` a &`ǐ`㿐> 'a􀠠K T& D& H |`,`& H& D  & t t@& & t  x@&!(& x!(`"< H! `!   @ t x@!,  D`.@& t   @~ t x@!, D@ H 2& D H`" |@& x`" D> ucl&!(`2> u! & t㿐```> 'a``& 0& 4M& 8 8 0: 0`@8`& < < 4& @2 <> @c0& 8> @c8& 0> @c@ 8 0& 4@@80`@8`> @ҒcH 0 8& <: 0`@8`6 <& < 4 <& @`2 8 L> E`" P@'0``E(&@0``E0````&@0```8 8(`> u`" 8``8 8(`> u|&@%& 0}& 4%$& 0x& 4"!& 0s& 4%& 4o& 0$& 4k& 0$#& 0f& 4` @  ``  㿘> Ja ?6  (@`<` `    l> 8(`Ȃ@`㿘> Ja ?6  (@`<` `    l> 8(`Ȃ@` 㿘 0 4@  㿘> Ja ?6  (@`<`?` `20?4```$`(" " " ā 㿐 pB`><> 8)<`-8/>0`  @" `l(`@`%`@(`0``o(0`` `   `lH(`@`' ߲`㿘 p`` > 8` l@(`@``@2 l㿐Ho%`(@f` ` p@" "Hp@ @"@  'Hp@  0 `c  "&"Hp@0܁ `   *`@`<` ` `(` p`?l㿐>=b>=b` /`<`">=` ` >=b` `   㿘>=b>= b0`$`">=4@>=b`@> J>=b ` `> J> zb>= ` ` 㿘>=b<`  @04`  㿘 p ` ``  0` 4` ў@㿀 `4`0@@!@`` ``$``  ''@``耠@ * &@`` @ * '`@``@B@ܐ@ʆ 㿘`.0`㿐 $``?@ $```04@ @@ ` ` f `@ ް  ? 㿐   `@ %  `04@א@q@ ` e` ?`㿐 `@R `0`4$@@E> (`  `04@@,@ (`@f `ް 㿐 `@  `0`4&@@g@> (`  `04@N@@ (`@f  ް 㿐 `04@)@Ð@ " ` (>  0 4b@ @@ (`@ 㿘 0 & 0  $@"& [ $& 㿘 0`  (*/` `$@J`$`$`0`"0`  $`@"`3``(*$`$`,ހ` @ڀ`(`$` @33$s$` `0``$` @ 8`,`,d``,``($`$[  2-```$ɒ@$`$ L`0F? 2``` $@ $` 7`0` $` 0`0`$$`$)``0㿘 0`F  (@*) `$`"$` `` @@`@<:? X$`$(!`0`0``$```@!@` 4$`  <?`0`"`  $`@"`v``(@*`$`,@` @@Ő`(`$` @ 8`,`,``,``( $`$?`0`0`0㿘 0`2 < 0& 0㿘 0`& 0  $ 0& 0㿘 0`2" `G ( :  $Z @ 0 0` & 0 $  f & $ (: $  V & O & H & $* 0 ( & & $J   ( ѐ `@& & $& (Ȓ 0 ( & 0 $ ( & & $  (`@& (& & $ 0㿘 0` `@ `ԁD 0n 0㿘 `@@@88`@@88`  &  0` l 0``& 0a㿘 0 `" " R@ސ `&  & (@& $& ,`&  0`& 0 0㿐 0`G`2@  & $&  `04@@I@ `    $ #  $ u $ @& $& ,`"@& & & (S 0`FN& 0  0㿘 `  0`"`"  & $& & & (& ,A    0`& 0`&>& 0`&>& 0  0㿐  $`E`> ?@   6@3  `04@(@@ ` b(` ` @?Ԁ  b(Ϭ b( 㿘 0``& 0  ! @ $@ @ @:& (`& ( 0`  & `@` 0` &  0`@` 0`mz` > za > za ``  ` > ~` > a > ~` 㿘 0`Ɓ"`2"">0a$"㿘""&"(`< `㿐" &> Ka "1 > ]`L(( @> ? a``> c    #\   @A  0`@2 ? 0`@`耢 @ (`㿘 8"`@Hoe (@f" ```   *@2 2" {`  &"&"Hp@,2 "|  {J  &"  > q#p&"Hp@㿘`> b# 㿘>  #Z> @S#.`@`<1>  J#㿘 bb  @+  > 8` lL@(`@`?`㿘```>0` @```āA=9`0㿘` :`&` " 0 ` ," <&"`&"@`Z&`02 &` @&`$8` &`(&`,&`&` > &"" ( "`Ӏ ""&" &"㿘 cX@?`( p` ``8 p `  f  p V   W`ײ  㿘4` /.`@`< + Hoe(@ p@  `!$ >  \`<@"`  Hp@f p&`  Hoe4 p(@f p` > c!.  p`Հ "0ѝ㿘 0` ` 4 @ Ho%(@ 2  & `?& Hp@f "   t&  㿘 `@ 0`   ` `2&  t `2& 0` "   >9a  p   `@㿘!>="`" & \b@ "& \& \㿘"`>  樐 "` '*`@`<``"& lb$b?$b@ > 掐 b$`p$b& px>   Pb> @ (㿘">  q "+` 1*`@`<``2@ 0"` 4>=bĀ  #> J " &"> cЄ`&"& pߐ0>  㿘 ` % ,@`< Ho(@"> "a ! "~ Hp@f"  p`8 l@8`?"``Hp@ `?Hp@ $"$"Hp@ p`6? l$"` `,@`< F,@`<  ` `瀤,@`< ` `0԰$"! " p0㿘"Ho(@?"*&"Hp@J f"㿘%> J`` ,   `@㿘ΐ?* @`< ` ` <` "`` `` `` 2<  " Ho (@&"Hp@f&"Hp@㿘%> J`` ,   `@㿘> Ja ?6  (@`<` `> 嵐!0> J?  0`) @`<` `` @ > J? 0`   ) @`<`"  `` &@㿘@& p  (@`<    `) ``` )  `ꀠ  l&@㿘c! # "  0` #V2  `@ & ``?&`#V" 8 #E#L   V"20c^f0  cQ cP1`0`g&8`0``4  ` $`cQ cP ʀ cR"`ED‚K" `0`4@łL2`0`) $ `τ``"``0`4@ cUh0 c]2`0`8@&& `8(`(9 `8`) &`8@&`8`& `8@ &$   `$```.`t  "> '0b@,#``$`$` `"`  > 'b@#``$`$` `"y`  . ȓL !> '"Ѕ(`(`"@N* &`"Ѕ(`(`"@E* &`& `"-&`,  & ``?@&@ v@{  '`i`0` `ð -`4@``?!$` & =08` ` @5$   $@```"&`0`t"`0 ` ` `"`  > `, 㿘> Ja`?0` @1 @Ha(`C `> ` =(`@`<`"9 ` .>  t> yb p$ $ p0``,$ ԀD   t l($ t> 8`@ " ` @`4 @`4 `  `$`  d c $ c$ $ % a $ $ $ N  t㿘#>=b`'>  *>  `,0@4!>= > $"#"$ @$ $  @> J> Hb $  $b> >  aPxo#>  aPi#>  aPc#>  aP]#>  aPW#㿘`   l> 8(`Ȃ@` > ca `(> ]`L> `L`0  @ 0  2 <@  > ސ!>  .`Ε 㿘 p` ` `@ ` $`㿘``" N@`2  @ , @&)   ,  > > >  aPߔ!Y㿐  "o   ` ` v4 v1 㿘` 6 .`@< 0 >=b9 `3XHoe(@p@"9$p$ r"( `04`  { $<㿘"` ``  <` ``   t" \@"@ ؞@㿐 4  s *`)  s  :&`&@`0@A +&` `\#\  @ &`&`$ e $ $ >=b` #\       Q$$ $ uZ  uV 㿀 ` .`@`<  8٠    0 4`蠒 #\#`   0 4`  $` Ja ?6 2  (@`<    > 8 l(`Ȃ@` &3 ?" 0㿐\@ &"> ߈"p&"?&"` , >=b5>=`#\#`    D Z& <>=b`` &> e""@Ր  > \" <& l& p  > T  \`"X& 0& 4`:& 8@@  c " &5> 'bВ#(($, (`"@ * #& @ , & &  t> a  & #!> J",` $",> Jb(> 7> z"XH   $",$> ' > @"@k@t& 0> ߹"H> > >  aP"> > >  aPx"㿐` `  #\@`'> Ha> J !> ca ` > ]`L> `L`0   @ 0 2(``?(`@(`@# 㿐> Ja ?6 < (@`<`6 ` "` ``0 l> 8(`Ȃ@`%` @$`   $ >=b20@``2"'` $`  ""  $Ho%(@ Hp@`  `  ` $``fHo4 t(@f t`a`" tHp@ 㿘 > J p!`!(`DHo%(@ t"  HHp@`2 p `2 p DHp@f t H?0`@`(`@`<` & tHp@& tHp@  H- `0 P0S-    P`: 0FHo%4 t(@f t H& t`> '& tЀ 80`@8`V 0 `p@"0` ` 0` ` `&0㿘 "1> qْ & ]#㿘 `1> T# &  & p & 㿘``  (Ho%(@> cH ! H /&  Hp@f>  !@    @Hp@``0` , * ``&@ր  `Ѐ@  i, &Hp@ #㿘Ho%`A(@f`A`@@" `Hp@. Hp@&7L&7L&7L&7L&7L&7L&7L&7L&7L&7L&7L&7L&4&4&4&4&4&4&4&4&4&4&4&4&4&4&4&4&4&4&4&4&4&78&7$&6&6&6&6&6&6&6X&6X&6X&<&<&<&<&<8&=t&=&= &8&=<&=X& J0`?0 * @`" `\` * ?㿘> n`> n``"> n`Ā`> n```㿘> n` > n```㿘  @ 2 2 2   x@ pt` `x `"    (@ " О@ @ " @ " 㿘 \`  `2 &  p t@s  p㿘 & X& Đ  " X" > c  ؀`  X` @x \'0ؒcY2  '䀦2' \0!cZ܀6 \"'㿘.<0`"E l"; l " l@` . @ v@`.=1 ,H-9 l` 1 @1 =` " | \ ۂ(`0``+փ(`> @ G@@ A@`  > 7cL @ &@ `  \ X   l`  \ K  1 =*+@?`? W 1 ='(@?`? F 1 =$%@?`? 5  ϰ  ʰ 1 ?Ô @   㿈'H`8 `1`Ȁ-.`̅.=a  'H n(`0``('(``H`" &`H`耠`"`2&`&`H`` `" ``2&` ?Âb &  > \  a 0} `(`0``o(<0`8 b?c @`'@ ,@}(`0``oa.` `.=0a    ? &  @(`@0`@   0$(`0``o(66 . <0`8->@"*6  0(`0``:(  2̓(`0``8耈"6  `  6 6   `l 6  <5 8!?c@‚8><`@? <#"!>"5 @|  ~"q5q.`@"&`T`&`  $ 6 &  H  ` H`H  ``H (`\ "`  h`H  `H } ـ`H v Ҁ`H o ˀ`H h @Ā`H a `H Z!`H S"`H L ``?,@5 !   <$ &  @@ ܲ@?,@``?& >eӀр298>e L  9 08c6 L   -  L? % 8@^0c"  㿐> n`.> n``> n`Ā`&!> J #> n/> J'<)8+>"$"`|(@`$`|((0o0`@@" @$`|%⌀  > J0`0* `````X` > ch 㿘> n`` `\@ 㿘 |`` \     & \@ & \  `  `> `#X& \ > W#p0㿘`> P# > Jb0? 2 * `X ]@ 㿐 @@o  @"   `@` E  c@"l@? @ xc@c@"  p t` $ c@`Ho%4 l(@f l? c   `2 $ Hp@@"pI @ۂ @ c@2 p@(u( c@ c@c@ c@?c2 l Ђ@a?`߀2ǰ  l$ В( @@m @2 p> Jbh@0c @o@2 p `" `" `"  "  "   && & `" `w&`q& &  & p t` c( @ jz "\k  s > J \bh" <" "  " > JbX   && & & &  ( ̔& **G p t`  c sv > J zbXҐ   } w    @0  ̒  l ` ag$  0@  '@F' "- l0㿘 b}@&@(b|b~@ `v@ X "    @@ @" Xl?" 0  X   @ &   `" 4@ 㿘 Ԙ`& Ԕ Ը`& ԁ> Jb0 ? 2 * > `㿘> Jb0 ?6 .  ؔ`   X`> I#  Ԑ 4`$  Ԃ`$ ސ 㿘> Jb0 ?6 .  X    & & XF ``"  `  @ j@ I  >  #0㿘 > J"0`? 6 @*"0(`   ؀` ``   ``" X@ X`  4& H  & Xr0  \ ՞@㿘 X " "11>   80 @* !" >  $ J `2$  `2  `  3>  ִ`? ` Փ#㿘 `A Ā`+`"" \ l  \ < l`c€`G  \ l`. `2$ z " lj  l` `$  $ $ a &   ĝ㿘!> n ` > n `` ` `$ > > >  ` @A!㿘#> n``!> n$  > $ $ "> > a͔ $`> > >  ` X !㿘` > Jbt&`|&`0 `Z?> n`&`l`> ``l` ` `l&`p  &`t&`&`?&`x@a`Ȁ Z > J`l@"X> J&`"Xbh&`&`&` &`bh&` &` &``> n`H> n`<> Ő `\``> Լ"> Թ Ѐ  @ @ 1>    > Ԧ"p`> n  go $&`l"`l ``ԑ > T p> > >  ` Ք!> > >  ` @Ռ!㿘Ho%4 (@f  Ā`"  \ "  l"` ` Hp@h Hp@  㿘 ``" @9 `2e&  |`"  X> n@2>  X 5> c `1> cHoeH(@ Ԃ` &  `$  8$ 䲐  `2U$  `2< > 'bА* *> @  @> Hp@> ca `A> ]`L> `Ll`0   @ 0  2   x f ~  | `& > 'bА* *> @ ǔ >  !0c `"> ' Ґ > >  ` Ծ":&T&U&U<&U\&T@ ` -(`0``= @(`0`* (`0``o0 <8>@> a(@`20㿘`.`> 6 6 6 65666666666 6666 6 6 6㿘566666   <8@"` ``4@`` (@@ (`(`0``o( (0`@ 2 o@2   =(`0``o ) 0 @?=c @"60< 2`6`  `(`@ <8` @(`0``o @ 2``4@H> Ӄ"(B 㿘@`. @g' . &.  ez &@`  @50@@`0@@0`@0@@0`  p ֔  Ѐ l@2g @` 4` `> _+` @  ` -  <8@ (`*:(`0``o((0`@ o@ ?<@ #<?!8ca aa;=@  +`@@Z(`0``oh(0` "> ݐ" ` > ֐"P  =(`0``o ) 0@@"7@0@2@0@.+`@ :8 ` (`0``o( @@2`4&@**]  +`@ @8? @**0@   +`@  Ά 0`> z"   0ߝ㿘!> J"`> JTb> Jb     .`.` @*@ 0*0``.... . .  @&#@`&/`/` @@ ``(`(`  030`??ň `(`(`  030` $"  =0@8`(( @@ @ `"`0@8`=a `"`@  `"*  㿘 l& X pc& & & & 㿘 `"  |@} b}@"& X@(2b|b~@9 `v@2. l X     @@ @   b}@ X "  @ & `v@ 뀊@"  X l` p?"ې 0ِ Ԑ  `" 4Ɛ@  X` @㿘 l& X p@   > K`ᜃ* `````X` > ch > Ka? 2 * `X @ 㿘 `& Q `& > Ka ? 2 * > `㿘`> A" 㿘> Ka ?6 .  `   X 2 > (" `$  `$  㿘> Ka ?6 . `` X`  l& X` p ``"  ` @H@'  > #0㿘` &`l> K&`pa&`0 1> @.@   > ѐ"1> Α > ː"p1> ȑ 㿘 > K!`? 6 @*!(`   ` ``   ``" X@ X`  4E& H| & X-0 㿘 \@@@ X`` `_& t |@& | @&  @&  @& `` .` x@Ӡ @" `>`0@` @@Ă $  7 ` `  &   Դ ``>`0@` @@ $  7$ ` &  "  @`>`0@` @@ $  7$` &  "  @" t`>`0@` @@f $  7$` &   t/ `>`0@` @@ O>`0@` @@F ?$  (@ @@ 7b$` `  2`  `>`0@` @@! $  7H$ ` `  `<0` @@  $ $72  & x$`7```2s$```2R` |`" `>`0@` @@   | 7 $ ` `  & |  0 @D`>`0@` @@ǂ $  6$` `  & 0  `C`>`0@` @@ $  6$ `6 & .  ` `"A t`>`0@` @@ $  6$ ` `  & * ʐ`1> !"`  &  `  &  `  `  &  > > >  c8!㿘 ``" X@ X 5> c `1> cHoeH(@ ` &  `$  8$ ~  `2<$  `2? > 'bА* *> @ єH C> Hp@> ca `<> ]`L> `L`0   @ 0  2   rl f H `> '  ` > 'bА* *> @ H >  ͋#P0א 㿘`8 p& \ p@/>  c  |- t d@!` `@ 0`` `2`\@ 2 d 0`    d@ ` ʢ ` \` ` @㿘 c@"+ p p$?>  c* d `@ 0``@  d @? & |㿘 ``"6 `\`" X 0``@  d`p h h h"&`p `d& `?& d& h`" d 0@ d`p h&`t h d&`p?& `& d& h1> Α#㿘   ```> Ð#  p&``&`d t&`h p"& p t `d \`& t`0`` @  2 X`0` #  |c   x`2`0  X` `0` `d&```h h`h"& p `d?&`d&`hc`  x  ߐ `h& t`d㿘 p p> `e d `@ 0@$ X d2 `㿘& X 㿘 p p& X> > `0P> d X` `@ 0 d2 X 0` d㿘 X`>   p ``>   ° 㿘  ^Ք    p" t" p  > ֘> K& a& x& 0㿘> Ka? 6 . `X >  ސ 㿘> Ka? 6 . `X >  Ȑ |㿘> Ka ?6 .  X FI& X 㿘'> K@ 1> K!-  & !,  ^j  **(@ @`$􀤠&!_ !> s! > > Ka$p!> K>  i ؁㿘    `` X``    ```z㿘 b@Pa@ b e `v@"O`X@`  |@"`X} c@2`X$`|`X`2`p`\`H`p`p%>  a   d  `@ 0`   d   c@"  c`@ `v@`X"   @@ c@  cb@"`p8C ca@2`X``` &`p߰ ڰ  0@2 d 2 d ɰ  `4@ @B~@2m`X0c`@0Acc@2d`X`p`p  "& 0 @     d`& `X wHo%(@ `9 0` @@" Hp@ `X"q @  f0$`x ғ  +`# `` ` 3 `  & ڽ `2&  `2 Hp@   `}_ 0> Ka ? 2 * > a㿘? 6 J  `` ```"`X`X`  `4쉐$`H$`|   > Ka㿘 > KL@`> Kaa 0    2a&&d&&&H&&&,&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&D& &&@& & &X& &&&,&& & &h& & & & & & & & & & & & & & & & & & & & & &X& & & & & & &|& & &&<&L&l&&&&x&&&&|&|&|&|&|&|&|&|&|&|&|&|&|&`" "`$" `" `" (" $" ," 0" "  0 " L" H" 4 " T" X" \" D㿘7>=Ȕߚ $`Ȱ`    P 2& P & & `ڐ`    P G , @``A> "$ $ * - $ ,    ` @``  $ ဠ 2 $ 22ޔ  㿘 `` `  +   ` ` ?     ` ` ?     `" ? 2   ``2` ? 㿐``3((` > & , @` ((`88@`8"  @8 & (  ( @   `΂&  `&  `"&   `&  @` ,(`88@`8`" @8  & , @`(`88@`8"  $ ,#    `&  `&  ` $`  ( L"   @`n(`88@`8"   ("    `&  `&  ` ` L S     2D & \& H& L& T<& X    @`  (`88@`8  & D&  @`(`88@`8"   ("   `2&  `&  `8 `  L@ "@ ,  @  (88@`8`"  @8& ((88@`<`"  $@8 & , @`(`88@`8"  $ ,#    `‚&  `&  `߂ ` ( L   @` ((`88@`8`" @8  & ( @`l ,(`88@`8"  $ @8 p& ,l  @ T  X \> cК ? 8/8 `(    `@  `؀@  `‣@  ``@ ܈ ``@ Ո ``@ Έ  , $`  ( L"  U  & D X  ? n   T  ` L` ,  `  (# `  `  (#  8  `"  z  `"   0& T& L& H& X  & \}(`0``o *` <0`8 @"?c @@`(`0`` > ah(? 0 "> n(` `"(`0``  > ah(? 0 "o(`0`` > ah(? 0 "v(`0`` (1 > ? ؂@@`1 " 1 <➀> M㄂♀E> ⛂▀:> "◂╀>  P㉀>  a؁"V> J> ✀@❀>  aȁ"1☀>  b"> ق㈂ㅀ ㆀ>  b">  a"> ㇂぀> も⟀>  b">  a">  aЁ">  a"ダ> a㿘``` ,@  (  ` L  & (& , @   㿘`2  `3&  & (` & @  `"&   (` &  & (`!&  `&  ` `  L"@ " 0 ` L   " 0 `" " 0㿘 `"&   , $`& ,&    ( @`& (& , `  (  , H@` "  P D "& , ,& , ("@ ,>=bȀ">`p 㿘``0`9 @ `& @ & @ "%& 4& @`; @` < 8ޔ  & <& @(`@`8 ((Є `82 @ @ `& @ ``[ " 4" @" 8" <" 4㿘``((` > `d  & 4)   , & , , $  @   @8`ܐ  `7` C ( P@  , `& ,& Đ  ( @`1 & ( (` & ( `&  & ,`& (&  & , &  `  L " 0> ؐ"  L D㿘  >=b``&  d V   \{& `> > >  bXķ 㿘"  ``>  `"b` `& &  "*` 4`" " &   ( @`"i D& & @`5K 4`"SM` 2, b`` `֤`2&   ܐ& & 8 2H  (& & & (& & @`р "ڴ  & &  @ ( ,  \  " > "ː `"& Ր"& &  &  @ ( ,  "&  & &       2> c@ 2`` `2`(* @@ #   ?@? @ @@#㿘 `$> <8`E8 X 2@. @,??)@                 2 ?@?ۖ ?   ?@? @㿘 (`2  & `& $@`  П@  (`& (@  (& ("" h (` " h ?< l ((@(@@" h 2``"2` " `#㿘 @6<@8h  <`$88~ Xz  H`%.,   @ ` ` ` ` ` ` ``  @   @` @    (`"   \ 88`Θ 㿘 T $> : X  $ `4$@`@8` + ,    8,` 81   8  @  8) 81ؠ   ?8   㿘 Tܐ Xؐ  7  <$  h`S> h    ! &8 `8+*` 뀡  , `0@` #@#`#`#` #`#`#`#`?` ` @ #@?``@ (@`20@Ϡ@`>  0    (٠㿘 `$ T X A=94    㿘   ` @&   "@@6 & & @"   > I#㿘H` ` `> "  (`  \&   ` & 4`$ߐ & 8& 4  8@4& 8 4ђ "` ?ʒ ? `& 4` @뽐& D 8@`$ 4& @ <: & L& <& $$& & H` 2 & T`$& X`$`(& P @;& \& d W& `> > `& & > > ct& & > > bl$& & > > b<& & Ȁf&  (`c> >  b& ̀b& Āc (}& (Hp@? _ 8  <  @: 8`$<  ?@R&  $& @ꠐ & d@삐@ꙑ*  & ` \  m" 8 $   <  @$@0\  84 < $   \ I"> >  cH& ̀& @` (@ (b& (Hp@   (  ( W& (6#㿘 `@ c   @5     @  #& А ?   @     @ 4ߐ> 5#?> 0 ?  ``> b`" ` > b,> " > " c" Ё> b" > `x" 㿘 `  X  <  ? O`$O l l@P M` P&l`8`( G,> `X(@8`?    (`((@ @@ @80@@@# <  ^ @ (`%@ @ @  h h@ ?  ,(> > cP@88 `S @?"    (`(( @ 8(0 @ ""  -@ (% @-@ @      (`((@ @@ @0@@@# ?є    (`(( @ (0 @ "" ?a@  @ R?@@   @ !! `@u㿘 To Xk  `$0 0 l l1` .`` PS&`8 4`(` 8(>  (`$(@  h hՀ ` (@@`݆ ( Ф㿘 T X  `$3 3 l l4` 1`` P~&`8 7`(`  8( 8( ~Ӓ  (`$0@  h hҀ ` 0@@~`݈  ( ( ~Τ㿘 ` 7 ~~ X~ > < h` `$) > @X(` 8  @ "   ) > c@(> cP@$>(, , ??뀢   @"  ! `@ @ @#@܅8`㿘  $ ~1  X~, $ <` `` > (> `X(  @  @ " cԛ(@@ > (P88???  @" ?@?# ` ` }}}ݐ X}ِ`$@ M,``H >> > > ?Ԉ cP!> ,`X@  (`!,`,  8@`   (@@t` *@"   @:@@ " ֆ > # - >  P @$ `8< m#ԃ>' >@'/ ,`@(`?'*- ''+`''زɀ     @   8@ ` (@ @ ?@`"# 8@ `   @   (@>  @## 6#  `   @#ԃ; ;`/  '?` (`.@- (` (''Ķ@''Р" 'ȲU   ` 8@    (@@`>  $`$@? ` ` 8@ $   (@ ??@@"6@` 8@`  ̂ @ (@@̀},> Ԉ +@@ Ȇ  > `Ԅ  > P ;@@ !@ 8@   @  (@@쀠)` +@@"> `#Ԟ   > cP@;@@ #  *@@+" >  X  ( "> X  (#+@ @(" >  X  +@@)@ @> `X@ (5$@`  ` ` ` `> aL" > c" > b" > a" 㿐 T{Ґ X{ΐ7  `<7 @<`hh `$` // 0` P{&`8`(`    &   `  `  (`$@(@`@2(@ (耤` (`(`@) @@0()?  ʐ 㿘6`6``<<@`kk> n> n ` ./ ./ ./ ( @'@ 㿘+> n`%``%`^> n`"`T`T{'`X{#`` +$( 8`P{%> n`  0``<@ $(``<@ $ `" %``> n(`$ @ `%`  > n $$ `瀌㿘+> n`%``%`> n`"`T``Tzʐ`XzƐ`` 1$( 8`Pz%> n`  0``<@ $(``<@ $ 0``<@ $ `" %``> n(`$ @ ` `%`  > n $$ $ `倌㿘+> n`%``%`> n`"`T`Tzf`Xzb`` 7$( 8"`PzS$> n` `0``<@@$(``<@$ 0``<@$ (``<@$ ` " %``> n(`$ @ ` ` `%`     > n  !#@$」 > n`> Kb   > n` `#`> n`2"@2 `2 `> K?(`(`   :`@  @+`  `  `` ` @ ((㿘Hoo> n`  0-`$ ` &2 ` ` 2` `(2`  2Hp@ Hp@?㿘Hoo> n`     $ ( 2 Hp@㿘H`J?   ` 2 (`0`Hp@> u X㿘H`*? +1` ,@.` `] ( $y 8y  > `x. 2`$ ,``$ 0`` `4` &@(`0`Hp@"`  0@` `$ ("$ 0  $x 8 ݘ `$  ) (   (ǘHp@?Hp@㿘H`  $ (   I > K2 2 b)> n2   b"" ` " 2 % Hp@ Hp@?  I͐ < <u$ $xw (xu  I $ 8 8`8u4@ 0`(`2`(@ @( (`"@? ?"`(`"`(`"`(`"`  "@? "`  "` 0\*@ *@ (`(`> c㿘@*`! @%!  ` tʐ@   `tÐ@ `@`@(@ @t    㿘@,`! @'#  ` t@    `t@ `@`@(@ @ t    > b9   @  `  @8` 4 > ' @ ?> 'a!h!p!d@ `@!d(`@ `@!x@(`!"!x0(  !|@ "|#| !x(` @!x( !x(` ` `   (a|(c|(b|> b$ 㿘@ `! @(` t !` t  `bt㿘@ `! @(` s ` !s `"s㿘cA@<@ B@C@ cE@ ?D@_@@@2? $&  8`"&!|  8` !|  \!0 < "@ 4 "@ 0"` 8"` 8``?("` 㿘> N@da> V!x0>>a@&ad4&ah8&al`?> @ca: > >!p@ca0 @xB&$|> @c֒a @w &!x> @c˒aȔ$& 8> @cŒaؔ#& 0> @ca 8 0& 4v@?v: 2 : v& <& @> !$|& X3& p> 7b`?3> Zݓa㿘> ǒb`?cA@@  cE@?D@ _@@@ "  < " 4 "0"8" "`@`0> b9   @  `  @8` 4 > ' @ ?> 'a!l!x!h@ `@!h(`@ `@> 'a  !t`"( LH` d (d(Hp@ ``(Hp@ ``ˆ@`¨@ˆ@¨@@㿘> ;"P%> '` 0`  L`   @v &!d &!x```e` `!>>> E L`W(`H@S`?F`N@`> "(`> E>>@`?0 &!h4 &!l8&!ph&!t# p$ 0 4> ސ"0> !xb @ @v*& X& p `?3> Z»aP> N@ba`2N@Dz `` L` > &!x   @vxK&`P?"&`P`L`&`L`2rl L㿘`z` ` rY ? `"> '` a􀠠    > b 9   @` @(( @@(@8` 4 > ' @ ?> 'a􀠠 !h!d@ `@!d(`@ `@㼘`!p @> !tb *///?(((2( !@ >  @b!t  ̔* (((`a !' 㿘cA@ @  E@L@" ?@@ D@   "&  4& 0 &&&  㿘`L` &`L 0 @u> '& Pa􀠠  > Ec` H`` `?  ?@u&!p0&!d4 &!h8 v&!l!p   s      $/# @& p!> !  @  *@ug @&!t @  *@u^ & XI 4 0> "@`"3> Z?3> Zma㿘`W`  > 'a􀠠`"  q1 ?  E`?> b9   @  `  @8` 4 > ' @ ?> 'a􀠠 !h!d@ `@!d(`@ `@㿐!p !t r#\㿘cA@"4 4 B@7C@ cE@ ?D@ _@@@? !& !tR !p  0 < & & 0!& 8& &!tg㿘> ِ"X`L0` &`L @t > '&`Pa  > Ec` H`` `?0&!d4 &!h8 z&!l!p   ?   $3#>  @b *@tm 4 0& X& p>  ؐВ> Ԓa`?3> Zza㿘`d`  > 'a􀠠`"  p> ?  @`?㿘> b9 @?`% @@? ?rӐ :  > 'a􀠠!h!d`@怢> 'a!d(``@%@ `@%x(%x(@(%t  %x"%p"%t(%p@8@ "%p @ "%t%x( @ "%t@"%p%*`@ h ap @% @ `*`@(as(ar(aq(ap> b 㿘%x " (``   `%x``` `(%x`(%p%t 㿘@,`! @' # , ` nؐ@   `nѐ@ `,@`@(` @n’     㿘@+`! @&"  ` n@    `n@ `@`@(` @ n     㿘 8@`"% X @ %`%x p(%!(h% @& 8&%t`%x @(> vb& 8&%t q(% A(> 㿘 8`ʒ > H> Ha` 㿘cA@"V 4 cL@"$,cE B@YC@"0%?D@" @\@1_@?%`I < (` &`H%`A  @?0܀@ڲ?  &` !p 0%`‚ @ & & 0&%@?` &%`?(`& %`2ʲ !p! &M 0 I 0㿘> "h8?c  $1> !4`"  1> "1> 3@"x> N@^;aJ`2v>>@ 8@ `? @r> 0"0&%| &%&%&%x&%&%<&%&% 2&%  D :`> O" <&!d @&!h D &!l$ϖ# @ D(``?&%&%  @r < 0 4& X> 0 > c%  &%@o&%& 8ϒ % ) @  p!  N& p> Rb􀦠2 3> Zb@ "> "(>>? > 7> d"X3> Z㿘`` ` @> '4@> 'a􀠠" ``?!x?? h!`   !t`@ c !p @ @> b9   @  `  @8` 4 > ' @ ?> 'a􀠠 !h!d @ `@!d(` @ `@H`!x`hd{{!x hHp@!| @ ? @@! 㿘 Va|`&Z @@P&Q@4  E `$oΒoʐoƐ$$$$$$ ($ *`3$`$ `$ d@$ 4 `$ d@@$ `$ d$ 4 `$ d@@$@@@    㿘 ga|`d @@`&` D@4 &Z@4  O ` odo`o\`$oX% % % % % %   (%  *`3% `%! `%  d%  `@@%   d$%  `%  d%  `@@%   d$@%  @@ @   㿐 `Ta| @@PP D@ F  n $n Ƞ@ $$$$$$ $ *`?c$$(`@`h$ d$ `$  d$@$n `?($@@@  D @ 㿐 `Ya| @@4 B Ȕ@ $`$`$`$`$`$` $` *`?$`c$a(h$a @"' ( n`$ d$i `$i  d`$nw?$i 4 `@$i(`@@`@ `" $i$i $i $i( 㿘   $ nKa| nG $$$$$$$  ($ *`$aU$ d@$ `$  d$@@$  ` @$@@@ 㿘!x 0`0?c߂` !p! !  㿐!p ! #\㿘cA@3@ B@6C@ cE@ ?D@ _@@@? & ! !x(` 0 < & 4 & 0!& 8& &!㿘> '"h0&ad40&!h8 &!l @n &!p  @n &!t *@nސ &!x@nؐ &!|@nҖ &!`g`2 L> N@ZaL`2e> 'a􀠠2Q>> L> E` @? H`?!t @> `D &$$@l&$<   ;  $O#>  @b  *@n 4 0& X& p> #> `  > `"3> ZÒ?3> Zb@`? L> ` & LL` > "(> 'a> &!> a&!&!> > Pc\&! &!$Ӏ`㿘``V $``  > 'a􀠠 > a0?@@n)  j$?"  ``?> .c " > b9   @  `  @8` 4 > ' @ ?> 'a􀠠 !h!d @ `@!d(` @ `@H`` !p``(Hp@(!p(Hp@㿘!p(`` (``!t`(!p !  㿐!p!t#\ 㿘cA@2@ B@5C@ cE@ ?D@ _@@@? & !t !p(0 < & 4 & 0!& 8& &!t㿘``i 2``?>  \#0 "㿘> l"h3> Kc0 {c0J` >>@0@`? @m$ Q&!p0 &!d4&!h8$x&!l> b̔ &$x@k&$| & !p   s     $#>  @b  *@l 4 0& X& p> "0X> \c4`3?3> Zb@0@`? @lӖ &!p!p `` 20> Z c0 ``p@)   20> N@Xa >>J` > ې"(}>>) )  @@ @ ` (`   `` +`x0> b9   @ ?` @(`8` !> 'a@? !h!d @`@〠@ !!d(` @`@㿘 8@d`e!!t@?yn \!t X!p  p!p? T!p X!!|%?@?' #!!t@?yn \!t  X!p p!p T!p X!!|@?  !!t@?{j! \!t % X!p? p!pc T!p X!!?@? !x !x a!x) )  c !2!x& 8!t@?yn \!t X!p  p!p? T!p X!!|?@? !!t@?yn \!t  X!p p!p? T!p ! X!xc !x  a!x !x  c!2!x& 8㿘 8`R > H> Ha` 㿘cA@;@ cL@"8!cE@?D@@\@_@ <(`& `   `@`0@ނ &&  @&  4& 0 &&&   㿘> N@WKa> O А> @WCc@J`'> }0>>a@&!d4@&!h8&!l`?0! ! @k;"&!p !@k5#&!t $@k/&!x$#  4 0 < & 82 : i& <%> & @`?&!a`  ??8 @?  @k*!&!|  0  @j* &!& 8!|& p& XX2 0 4 > #P> @V͒c`J`> #p3> ZcX ? > 7> ]"X 0> #Hr'> 㿘```?> b9   @  `  @8` 4 > ' @ ?> 'a􀠠 !h!d@ `@!d(`@ `@H`` !p`0Hp@0Hp@㿘!p` iu !p`.`0!x0!xb1!x 1!p`0㼐> @c<' ``!x! @* `  F> e ` e `e "p0i) p`,`0  0 0 0p`00z#㼐> @c<' ``O!x! @*!p6 h !p`,`0 @ ( @( @(!p`0e` " `  e `d0 > za#cA@*@ B@C@ cE@?D@ _@ @@ " > `  < "> b,  4" 0!"8 " "㿘> 'a  > Ec` H```?00&!d4 &!h8 $&!l  &!d@i9 &!p ( @i3&&!t  @@i-!t?&!x0    $ۖ#>  @b *@i!d 4 0& X& p> >#x> |`(`S?3> Z"c㿘` `  > 'a􀠠` > a?@ @h0dޒ 8@ ` @`@* 2 `*@"@> b9   @  `  @8` 4 > ' @ ?> 'a􀠠!h!d `@!d(` `@㿘$p#Д $pĒ#ŀ`  ?ߴ $pœ#㿘$p#`.@ .`!p@@$p#ɴ`*` (p (q> c(p㿘 c$t! 2?㿘 c$t? $t~!!   㿘`$@Ր ߒ   8`/` `6< `&$x 0d":$x&eb"1$xc $x@&$x> Âb0$t&!> > Ą4`(&!&! > > Ą,bx&!&!$ 0A $t G= 0&$x"$xf@"$xd@$x@&$x&$x@@&$x@&$x@&$x@&$x㿘   ff `$xf`$ d@@ i$t F $t @fr$t,  P$t@ T $t`$ X*@ ; 㿘 `$ fUfQ dxfK`? *t F t @ `t. P `t,  T 4t X-  㿐  Ȗ $x@ (`@`h'` f  ``$f d $t F{ $t{ `$t @u $t,` Tp@e $t$ X(`e 㿐  Ȗ dx@ (`@`h'dt FF dtF `dt @@  @@ `$e d `dt(` T0@ edt 4*  X &~  (`" dt T   dt X*j 㿘  $e  d  $e$x ` f$t F 3$t @ $t P,`@$t T $t` `$ X*8 㿘@*`! @@%`! ( @@` a   ` a   ` a    㿘@,`! @'# ( @@` aʒ@    ` a@ `@ ` a@     㿘cA@"2 4 B@5C@ cE@ ?D@ _@@@? '& !pw 0 < & & 0!& 8& &!p㿘> N@Qa> O' >>a@  1> ##> a  @e` &$p$@el!&$t* `$62&$t  / $#>  @Qc  @ &= a&!d&!h&!l `?  * @e!d 4 0& X& p> ؐ ؐ #惐!p> c6`$>   HÔB3> Zc?3> Zc 1>  㿘> `h捰  > 懒`x`?> b9   @  `  @8` 4 > ' @ ?> 'a􀠠!h!d `@!d(` `@$x (@@ $x*`@ @ax`(ay$x@ ) az$x(2$x*`@ @(ax(az(ay> Ɓ` 㿘!t `  ֔!!t !t  !p 0c@2?㿘 :> !p> ǂbĄ&!&!> > ǂaPP&! &!> ǂc&!$ &$ !p !p b!p !p  4 0!po(`@ $!p&$ !p a!p  4 0!po(`@ 㿘 ` cq?cm `ch`$cd d !p3`$$ !p@@$$ o(`@ #@ !p$X o@,`o@!!p@$$ (`@ #@ !p$ؤ ,@o!!p d$$㿘 `$c?c d cOp3`$ p @@ $ ` /o(`#@ 4 `p@ X /o(` p @ $ ` oo(`#@  4 `p@o(` ب / p `$㿐   @  'bƒ ` $b dap?c$d ap ap$d / /(`@  ap$b / /, %@ap `$d㿐   @ǐp?c% p  p#% @@% %`$br d ` o(@$ ` 4pbd@ / o, @%p `% (`" #$  po(`@ p `~%㿘  `$b9 d`  $ b3 `mpa$  hp  bp##$ o(`@  p$ @ o,`@#@p `H$㿘H`!t`&$8` !t a8@OHp@㿘 cE@R ( C@R&cL0Y@UZ@"/?cD@: (c@c_@6cA@? 4 & 0!& 8& &@B@?!x鸓@ې? ( &`:`2ѐ?@7 ͐ `  `  < &e!x  !t`&$ ` 0``2? &@&&   &@& &  @  㿘> ~"`h> [`" $x@`"$x`0&dx$x`l `&!dd &!hh0&!l@b8&!tD  @b<>>&!pa@`? "=!>  @b  *@bw!d!t& X& p 0&$ 4> ` !t  &$ > ƂaD &$$@`Z&$ǒ> ˒a `  2 3> [m`H1>  s ?3> [c`H8  "3> [1> ` 㿘>  > 耢 >>@@`?㿘80 @b &`0*`0 (`01> = 㿘> !`?> b 9   @ $Ѐ``# ?` ?!l8` 42> ' ,@ ?@?C & ?!x8` 4!p +@ ??@C ߄  !!|> 'a􀠠  `@π@ !|?> 'a!d (` `@؄?!p!*`"$ !*`! "$!"$*@ @""$(`!"! !"$!"$*`@ @(a(a(a> Ɂc0 ! `(`"$ !2` `"$*`"$ !"$"$2 ! `(`"$ !2` `"$*`"$ !*"$"$ !!"$!"$㿘! `  !! !  ! 0c@2?㿘 H> !> ʂbd&!&!> > ˂`&! &!> ˂c&!$ &$ ! ! b!? !  4 0!o(`@ $!&$  4 0!o(`@ !&$ ! a!  4 0!o(`@ 㿘 ` _?_ `_`$_| d ! $$ ! @@ $$ o(`@ #@ !$ X o@,`o@ ! @ $$ (`@ #@ !$ ؤ ,@o ! W$$㿘 `$_8?_4 d _.B $  /@@ $ `o(`#@  4 `@ / Xo(`  @ $ ` oo(`#@  4 `@o(` ب /  `$㿐   @ (`@`h' )^ے ` $^֐ d "$!"(((@@@#b##$ /(`@  $^ /, %@ `$㿐 Ȓ  @(`@`h'ሂ "&!"ህ(((@@@#bሂ#& @@% %`$^x d ` o(@$ ` 4ሐ^j@ / o, @%ሰ `t& (`" #$  ሄo(`@ ሰ `^&㿘  `$^? d`  $ ^9 `M Z"$!" h(((@@@#"cc$ o(`@  $ @ o,`@!  `#$㿘H`` ϐ  ?$Ԃ`&$ԃHp@  ѐ$Ԃ&$ԃHp@㿘ŀdbd >  Gb- G> ?a-  H`!? &$ ! &$&$ !&$&$@ > (> [bP  p`` `m` `" @ @~  `"!`` `j`  `2ݢ`!+&$ !!!&$!!8!  @]!2ᄂ`}&$ ]Đ+!> b&$!!  !#ᄒ s&$ !  &$!  s -$耠@3 $Ԃ@&$$Ԑ1 `Hp@ `s2 @`c` ` `    >  #bl-P #=$6 9b$Ԑ `@e&$$>  Ga-<< G>  #bD-6 #㿘$Ԁ`$Ѐ`2$ > c 㿘H`!`&$8` ! a8$Ԁ@*Hp@㾰> nc> <@' ` ` @ S> (#\ Ȑ>  ($ ''$' '@K $`` ҄ @80`@8`ʀ !> [!$ $ $@$ (a$ 8㽒    > ⼐! h& l 6  $& l0n~!㿘 cE@S ( C@f-cL0Y@RZ@"6?cD@; (%c@c_@7cA@?$Ԁ`"a$$ؐ &$&$&$``?(& @@B@ڐ?!!@Ԑ?  &`\`2ʐ?@ Ɛ C` $Ԁ`"9 <$$[2 & `J`2? &@&&  !  !`&$ ` 0`&$$Ԁ`2"$> c  &$ &&!&  & $Ԁ`$$w ۔ ސ$Ԁ`" @  j &&$Ԁ`& a @ & [ 㿘> ~"쀦1>    `0&dԐad $Yp&d4 @\ϔ &a@  @\ɐ`<a&a >>a@&d@ `? # u"X`0`4&d耦d&d$$ &$&$܀ h&$$Ԃ`&$> L @( &!@\D$$& X & p> Đ ! &$ > ʂ`&$&$$ @Z ""m> @b |> cJ < ? > 7> ͐"XO3> [`> @E |ʒ > Βc-  3> [u`# $$`0 &$&$܀ &$ 82$> 㿘> N!`?> b9   @  `  @8` 4 > ' @ ?> 'a􀠠 !h!d@ `@!d(`@ `@` $@ @$@` @@` @$@ @$(@$:`("!# @ @ $ (` @$`(` @$`(` 2  (a(c(b> ρb 㿘 ` @[Ɛ!d?c?c?? ```+ @@ `$ @   2`+` @ @ (0`3`+` @ @ (0``3`چ @@ 8݀$0)؀㼐> @c<' ``! @( `  '> Vǒ ` V `V WW@ @ W0l"㿘@ `! @(` V ` !V `"V㿘cA@"2 4 B@5C@ cE@ ?D@ _@@@? )& !{ 0 < & & 0!& 8& &!㿀J@, @2`(```> O `2`> "J@, @(`>>@#> `?@F c n> # ($'7#''0  @Z &d @Z&d0&ad4&ah8&al &`8&`0&`4Y>&`<&`@>  `@> b  *@Z}&`p&`X #aQ > b ^ > [ahʒ# ;a> ʒb? E > [nahc@E > n#H0㿘(`8`, `(`8`,`22>  cXۗ > /ch@ H`!`h(! hHp@> b9   @ ` 8` @(`8` 4 > ' @ ?> 'a ) )  ahad `@8` 4> ' 造@ > 'a ) )  ahad(` `@`.c! ƠD`$̀`  @$Єa @ ?* (` ظ`  @ƠƠ0 $Є $̈ (@  ?(  ĺD) @㿘 `$XXX @#?  d`0 `W@W$& 4``0  ޢ@㿘 &*d   WӒ $ d  ``0WɐWƐWW`0? @㿘/  0$ȸ+ W&@?* 0@?(@ ĺ&@!?  @@퀡   ĺ&@!㿐 Ȓ @  / @`k'` W`W\ ``$` dWS   㿐 Ȑ @  @,`@`k!' `$W.W* d 4 ` r    (`"     㿘  $` W  ``$  dV`  K  2  㿈  @ ((`@k`k'' VԒ `$Vΐ d l @ ? P&@0@8^V&V( (@@ * @  .   @    @   8@  `" +) ĺ*  @غ%`(8@1  @غ2 ĺ)!  @ظD* ĸD߸   0  ?  쀠` 㿘$Ȁ`> $̀` > !&$Ԅ4> &!a &!> ҂c&!&! `> @Bc " h> ӂ`|&!$ h` 8$> ӂ`&!㿘`>  @C6c !&$Ђ &$Ђ !&$Ѐ` ``(`(`  @8(`&`4&$`>  @Cc "!  (@&$`>  @C c ! @` ``(`(` 8(@4&$ȁ㿘!   ?ς  !|! !\ !  h㿐!| ! ~#\㿘!??c !| @  8" & 8!`` > & 8/`2& 8> ԐQa& 8㿘 8`Ւ > H> Ha` 㿘cA@U@ cL@"#+cE B@TC@"/!?D@ @\@/_@?!`D <  &`F!`> @?0݀@ې? # &`  ! !` 0!`Ă @ & 4 & 0& 8&!`?(`& !`2ΐ ! (`&[ Ð W  㿘> |"h>> a@1> "p > N@B+aJ`r0 &!d4 &!h8 &!l<&!p@&!tD@V'&!x&!|@ `?** @V&! $і#>  @b  *@V 0> &!c@Aw 2 !h @(`&!d&!! 4 0@`  `?> #  Ғ !& XK& p> OaH> Ԃa`&$&$$ @S˖ ` 3> [a> "(0? > 7> Ԑ"XxHۖ3> [ړa㿘> ĒcЀ`?> b9   @ `  @(`8` 4 > ' @ ?> 'a􀠠 !h!d@ `@!d(`@ `@1``=`!x `5`!x `!x d dd @ @ @!x ` 2` ` ` > > uc`\ݞ@㿘cA@;@ cL@"8!cE@?D@@\@_@ <(`& ` ˒  `@`0@ނ %&  @&  4& 0 &&&   㿘> N@@a> O" А> @@ݒcJ``?4@ &4&8>>a@ @`?$Ф0@T֐> &!x`@@J`F`g$#$& < & 4& 8St& 0& @>  0 @&!d4!> &!h8!&!l  ( @T @&!p  *@T* &!t !p& X& p> `\"3> [ߒ?3> [a$$π` (> ``@> t> @@L`(> @@F`0d$>  ~$$㿘> `8p  > j`H`?> b9   @  `  @8` 4 > ' @ ?> 'a􀠠!h!d `@!d(` `@%x`*`!xt @  t$%x` *`(a{(ay(az(ax> ׁa0 (ay(a{(az(ax> ׁa0 `"!p!p `  㿘!p``  ! 㿘@`?`! @:   `O* .,`` , O       `O ,`` , O      ۠ ` *`  N` ",㿘@`A`! @<   `N֒ 2 `  , NȐ       `N  `  , N      `  *  N   㿘cA@0@ B@3C@ cE@ ?D@ _@@@?& %x)!x  !p 0 < & 4 & 0!& 8& &%x h!x㿘> ~"1> `  > N@>’aJ`> O >>@@ `?> 7`&%xP  @RH&!pD  @R<&!tT &!dX&!h\%&!l> ׂb  &%@P&%   $V#>  @b  *@RT 4 0& X& p>  ؐ> a3> [bD?3> [bD㿘> Ӄ >  { Ȁ > u Ѐ`?> b9   @  `  @8` 4 > ' @ ?> 'a􀠠 !h!d @ `@!d(` @ `@ *cp*ap*bp$t` ` 㿐   dxdp  PÒ ` $ dPP?P?@@\( $(`@`h. ($ '`@ @'` 㿘  ` dx `dpP`$ dPPPP?P}\? @@ `P%n( &`. @&`,` &`@ 㿐 $ `P#\    㿐 `P#\ s 㿈 @@  D `P #\ a  (`" D  dxdp @ `P&(h(`&   ( &  & 㿐 D#\  e 㿐 #\X 㿀  @((`@h`h''$  Oِ* OՐ , G  PdxdpOɐ&8(@@ `P$.($. (`$.$ ? (@&  $   (`   + 쀠`??$  (`   +  `P#\  쀠`$(` @ `P$.(`$. ?($.$ (@$ 㿘$t$cO?` ` > ѐ 㿘$t$  #p$!p"p @ (`(@@$    !`$  `$ 㿘$t`$  ``"?$$ `$  $ `@㿘$@ `$x$p $n$n ?c$n?$n 0 4(` @$ $ @$  c$n&$  "   0      0$|?` $n?c$n$n 0 4(`@$n$n ?$n `P$n$n  0 4(` @$  $  $ $ @> !p`@"p#p+ +@`) > YaE&$㿘$` > H> Ha` 㿘cA@7@ cL@"+8cE@?D@@\@ _@ <&  @& `@`0䀦@ 2& @  4& 0 &&&  㿘0&ad40&ah8 &al $@O &dp.@Oz &dxP.@Ot &d| @On &dt @Oh> N&da@;RJ``T> O >>@$@ `?& 8> @;"c8#& 0> @;c@ 0& 4* & <& @> m >  @b *@O4 $$4($$<$H $L 8\ ("$T, : $<  ?@M$$$@$d@> ڄ|: $༃0`> ڂ@8`$$`> > لdc$$> > ڄ,`$Ѐ $ఐA > 7> ے "X`B ? &$  3> [b㿘> a`?#> '00a􀠠3f##0`@* 2 #> 'a􀠠"8 %"`@ % #"`#`2 # %㿘``ϵ   `  J 8@ @ 㿘> 'a􀠠"#  8 \@##8?@! # `#`8 1!" Mt㿘 > R`ao> |c8j> |be4 1> Qw x`?`?> ~n"0&# &#  @N7 &#`1" > I`` (@D`" (> 'a􀠠#D #D @{֖ ? * >#H 6#@&#$4&#Ā> <&#D@&#H&#L  Da@9˔ 6#@`\8 > .a, " G">݂c>&#&">݂c&#&"&#> > ܄Ăb&# %> '&#> ބ&#``> > ܂c#$&# > > ܔ`܀`I`>#`:  #  % ~   y  D>b&#􀠠"5##  @K&# > .a,Φ  <"5@  "$ 0 % J ] %0ѐ # A T #0Ȃal&#`> ނc8&#I> 'L  "w$ 0u  @{ F? @̀j$ > C!0㿘#?c  #8@ LM#8@?28㿘# b #8@ L6#8@?28㿘#``8@ #(```> ```> 0!́> +!`> 'a􀠠"#`#,`@@㿘#(`  ```> 'a􀠠$#`  > 'a􀠠#`r  > 'a􀠠 #`|  -㿘#8`> [b ځ?`8`  K 2#́  br t@@0@@(0@ th@0h@ t@ (@@(@ t( "`  @  @?@*0@`@20@* " 2"  " ` *` 0`*@  `2 2@ `  *@*@ ݒ`x#h'4 `` #D@ (`` "#D#D@ܔ> X/`<> 'bВ @* Y(`0``Yǐ  > ߁aT 㿘 t d,J?,㿘 t? d4(@J4(@㿘``  `" `$   G 8@ G 8@ 㿐#l l#h$(`0`0`@44"4 ?4  #\,  ,  @,  ., ,  `, , ?, @ , , , ,  k 2> ` >  !Ё  l $(`0`0`@44!4 4 #L @#( J  ` 24 >  !4%4  l#h$(`0`0`@04  , 2#h` #h@ ` >  k" #h @ `#p#l#P@#p#<@13 d !& !,$ !,&    X ? &h+`T@ && `    (@ ct bd  ,`@`ct@ l* #t @(`0`0`@4 4 dh(`@ct  `1 ` &\& `   ) @ h$   bh  ,`@`h$@ l* ($ @(`0`0`@4 4 h  (`@h$p`0dh &x&&t l&&& `% ? b0 + ($ ` 0 h #@' @($( ( (@ a bhbd l#t P#h&H?D&&L! &) 1 1 2 l($#t @(`0`0`@0  l#t#h@ @6 ԃ(`0`0`@1   #h@ ` #H`@0 @ `   2#h @2#h   ?>   H"h#h>  B"#h?>   9"8#h> "㿘Hof (@g  + x 4"0 \Hp@ \c$#\ \A@h Hp@ \`6 \`  xdВ `@ #0b``7$ ``x y ..`"@ @ `F8 `$ ` ].. "@ @ `  b4 Ԓa{   $#XHp@ \ 6 \㿘Ho& (@g > " Ԕ { x6 ' P `+ >   `" " > k# Ԑ`6 3 Hp@Y"㿘  PbhL*@h$@"  `0($0@@ &($0@  &>  >c(㿘 >  4a!@ #&cT> > ߄b<&cD&c@>(> ߄D`$&cL&cH@> a| &cP  &`p@Hh0`p&`t!?'>Br >=  c,`p ] &`l`p#> a  @d0@ `la @2> `pcP@&`h`l>>`&cd&ch@ >> a  8  ?`l&c`a`p&clac( &cp9 T0> G#> > ނbd&c@&cD> > ߂c&cH&cL> @`H0  (H&cP&`p&cT@G&`t4(@`p? * @G"&`h&`lhD a ?4hD(4@4g`pcP`l@c(`p`l|&cp&cd&cl&c`&ch/ "> 0 `D`> > a$$> ?b "$4\$cT> [(b@> א#`"!> `4 8&`4> b(&`0`0 8 > ȣc耢 ` "$ b(&`4&`0`0@Ey 8> m#X> j#`h#p> e#x  D #h/ t(`0``F  bh L x'' @> > [4`8 4    !(+ 0(3 0 *(20 (0(`) 0`1 +`@3`(`*0`2@@ @+` 3`@ @ @>!55  5  $5> [ c4t@0@t`0 H(t d0 `H@  D H&@` D` & @* *h$@`@ ($((`00` @a 0@#L` #\bicSa @    ?'`'` '` '`  ܨ   $ a @: $`Y> $ $$@` W , `#L@% @ @$0@$ `0@f `P&($ P0@U  P& +> n,@h$` !(`(0`0@a @M0 Ä@`#L@@% @ c@@8$  @$ > na )> n a2M ܔp d@ * t(`0``" `\@"B l  ۟( `hp 0@``#L@@@% ([$ ؐ > 4c(!@>!! t > n !($#t @(`0`0`@0 l#t (005  ` #(瀦 `"   ``  `@ڐ ((  `x@2 2 2 2  @ 2   `q 怈 #(5瀦  `" 0 怠@  #(" -!@e>!#)#*#+#,#- 0v#)̀#*ǀ#+€#,#-] #)f#*a#+\#,W#-RC  @  A@ 㿐 \`@c!  p`_>  Xc  t `7 (@"F` $"X%"X(`@@`  ,4 @eA`  @@ (ٯ4 ;((4 (`@@`0`%0`@` @ % (@2(!  p l l6 \`  x X(`@@ `@`(0* 2*s2?(`@@` P0 (`@@` 0 h(`@@` '(`@@`) ) ) (`@@ `0$(`@@ `0(`@@ `0 l(`@@@ ` (000 l(`@@ `#h (001   %5 ҁA4 ;8X( < "S $"X+%"X`u v x X(`@@ `@`(0* 2*r2?(`@@` P0 (`@@` 0 h(`@@` '(`@@`) ) ) (`@@ `0$(`@@ `0(`@@ `0 l(`@@@ ` (000 l(`@@ `#h (001 k  %5 ҁ ` X ` X㿘 xP ԃ(`@@`6 6 (`0` >   ! aa /@ ` 2$cX> `4 ($cX2a 2a 2a"cXaa@`   ` #h@ `&, @0 ` @  P퀌 Y ꀌ C "#h!@L>!#h@ `ޅ,  hDhDhF *+ 2 3 > А XhD, a4hD#h'''''''''''''''''''''t'h'\'P'D'8',' '''''''''''''''''''''''''''''''''''''''''x'l'''`'T'H'<'''''''''''''''''''''0'$'' '''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''|'p'd'X''L'@'''''''''4'Ƹ'$'$'''''Ĩ'Ĩ` @ `?> [ct ? 2  2 *     (@  )   (@  (  \`" " 0"  " " " $" (" " " " ," 㿘@(&@@@0 ((@&@@((`&@.``.`.` ````(`(&`G`>(@&` ``0  `|`(x@&` $6` ` 6` .` ` .`  ( &`` $@( @?`0` .```@>.`  @ @6.`  @`6`  (L*_`>(@&` ``0  `|`(`&` `.` P.` ?ք .` .` > 'a􀠠 >b .`  ``09 `|.` .` .`  .`  .` "6` .` .`.` `(&`o ``0 `|.` Ղ.``.` .`  Ђ6`  Ԃ.` .` .`̂  * > `> t> `> `> b8> b(> b> a> a> a> a> aP> a > `> `> `> `> `> `p> ``> `H> `0> `> `> c> c> c> c> c> c> cx> ch> cP> c@> c(> c> b> b> b> b> bp> bP> b0> b> b> a> a> a> a> a> ap> a`> aH> a0> a> `㿘  `R`#> |c( 0`> `G `"`|`a@ @@@@@@4|Ԑc(2)  `" 1> |ʑ > |ǐ"1> |đ @> @@P> (b` ` ` *> 2|"h|c("  1> > |"x|  `㿘 > [#t`? 6 2@ #t(` > `a|" 㿘 n Ha;" 0a& 0> }="x ؔ ;ܒ  @ ` ` ` ` ` ` ` (@! ``((@#`  h0(` h0( h0)  h(` h =(  h ) @>  `"   h ` `   > |*" h ( @> `>  h`  ; (  ;{ |ѐ#㿘!~` `H@.!~- -  @@@(`@X@D?`@0`@` `(`@`H<@lR  > {ݐ#@!~ ``.!~(a@@ !~`H &X&\ X &  <@$ 80`@8`  $ ($ $ $ ,$ $ $ $ $ 0$ $ $ 0 @  /BYߐ`0 @  耦$> X\ \\ @D?00(`@`lC,!~ &X&\ X &  & > |@#|>#0㿘 hB a!` !`"+ 0=G?  ` `B  4   @Ә 2! ?$ ?  @² .`.` (@`!~` 耠` ( "!~@6"!`8!Ҳ @y !㿘 h .``.` @@(`6P1 !`@(a_!.!` .!0 > {#h P9>  @> ` C @@` @)  h0`( h0`)  h0`( h =(  h ( ! ` .! ʀ0> {#@> ` C @@`㿘`2!0`  ! @UHa_.!.!x P  !`2 h> {J#㿘`!~ h (` @  #y > y   !@.!(a_}.!Ay!`.! @s' Ao!~!~!!!@@@ 2> (>  > y#> y >  y#1 h@ 㿘` ` `"E`?`R``22` `&` @"` ```&` (&0((@& 0.&`!` !.!.!(a_ ˰ `"Ѐ `q ʀ ` ?`@&`! .!`?Ֆ&`!.!```$(`0` ` `( &`$&` ( @&`(` @ Ւ@  @ ؒ@@4?``&` (&0((@& 0``.6`̂@6 `Ҡ?$@ܐ. `@`. !  !.!@㿘 h `@ ` /c  -/ !~!5$``  ``  ` `(z`$ ` [`0R`0 *4 ``"``@, @!.!00` ʪ $` 2`ڦ4 1`0$ @`, H@hF < <` 0 @ 0 @ Vє !~ ``.!~(a@ !~`ߐ ?`@$`!.! ?`@$`!`@ .! 0 d$ 4$ 0`$( $ @( r/a `` `( ?$` $`($`$`~$`- $`$`@%0(@@%`$$`5 `` @ `5 `` `@@- `  8`0@a @- `( % !"!!@.!(a_.!l M  h> x ( ?~ e> w H> x `?0y㿘` ` @`0"!~   m   !~Ha@ .!~, ,  @@(`@@ .@`l  $\ ( ,      0< !~> > `!~!2 ! @ "!~ `  @ "! !~㿈' ) > t`" 8܂``" ց `2u `2q `2m  `2i  6 `a ]( (`2  `2  f `Ho4`Ȃ(@e` #\#`@  ) * *  @@(`. `. !,!`` !~ ``,!~(a@  !~``h`f Hp@@gu`  `%`!`` 0 @gs ``2` 5 "`@gH"Ѱ `2Ͱ @ Հ 2ǰ  `2ð o(` 2 @ Հ < (`2  `3(Y6 4`8 `2 @ Հ 2  `" ?(`>+!~{>'!j !~㿘֒ !~`  耠` i "!~  >>  >`" >>  >`"x   @9"0& &`h> E*`cd@> ~&`|"vE&` ` &`l&`p&`t&`x@fϐ#&` &`  &L&`   , ``+` `@ (a@`@ ` =(``) ` 4`.a~.a.a.a.a.a&`&`#\&` 0#`     O`* SM* `*  (@` > u a.a``!a~```.a~@(a@ a~`#0> uϐ > u̐ a.a``2a~=gaa~```.a~@(a@ a~`=Xa~> u  *` 2`> u!a.a``a~```@.a~(a@, ,  @@(` a~`y#\#`      a.a``qa~`, ,  @@@(` .a~(@! a~`Z`" &`4`> uZ!H> `&`0`0 `" @eܖ 8 ''`'`"#`' OԖ ``'@e" @#I a> Dcd> 'bА(E@`2'` @#4 '<a~#\<ara~<a~`<aa~> uǐ 㿘`` `"   3 ? . @6Ʋ` `  㿘  !"$`(a6b8 $`8> n  ?(`#`@`* > `|@10 6ab > t!p`H`4> @(`6 Е2t!`46 `H6 `0. `,. `86 ҁa6 a6a$`8a @V $`<4`p㿐 `0 7`&`L`"6`6`&`&` ( l`# Ho(@> `Ƣa`ƀ` =` "`ƃHp@`> Ɣ#tP`Ȃ #\#`6`Ɛ    S d!.!``!~ , ,  @@(` .!~(@! !~``Bр`E> t"`#\#`    # !.!``!~ , ,  @@(` .!~(@! !~``".`O> s"  6``ev> :> sؐ! 6`` ;t`ƃHp@#\#`    ΢ { !* @`.!}!~ , ,  @@(` .!~(@! !~`f`Z 6`6`6`6`.`.`Ն ?00~`#\#`     !.!``!~ , ,  @@(` .!~(@! !~`h`"2> s["p :!!~> sQ!z :!~'`B:!~S`:!<!~> s<"He :ܐ!~`:ؐ!!~`#`#\    7 !.!``!~ , ,  @@(` .!~(@! !~`n`c> s"* :!~`:!!~R.`  `И > r"```Ւ4c4a": #\2> : rҐ"`#\#`    ע !.!``!~ , ,  @@(` .!~(@! !~``"`> r#ʂ :A!~`:=!|!~`Ւ4```Ȓ@44 #\#`    #!.!``2!~:!!~ , ,  @@(` .!~(@! !~``:!~`" > rR#H{ ?c c`ԃ(`0`0``Ղ`@`~``~  (`(`0`@ 0 @ "``̀* `~ > r%#h`2  J `1"@ 6 > # : ` 5 3$ 9!~\`9!E!~㿀 > [#t`? 6 4@:#t(``"6 `ƀ` `' @bv" '''`R@bQ"`ƀ`    `. @`  `$`   (@$`$` ` (@$`$` 㿘> [ct`?0` @1 @ct??(`` ` (@@`, @ࠀ?`<  (2     @@;B   p "`Ұ?  "< ɰ?㿘 > [#t` ?0`@3`#t,  { e`g@`f `n@X0`e@ @ e2  r@  `h@5e@  0!   Sb  ƀ`C @Ӆ4`  `, &   ?(c > * b@,  @&  `&  (& Ho$ (@e "0G ؃Hp@  6 Ɲ(> c<' Ho$!_(@e!_!!!~!0" А!@0 Hp@@@`  #\> p#> '''''''7/p#؀> @" p  ?(> p{# $> >  " ?po ? (@$ > pb >  c  `4 `2   @ , @@@`#\02#` 3 pB  `4Ho$4 (@e   `"4``@" 4   ` " 4L` >  p 0 ?  Hp@> 'bА!(@Ē@  > `>  o#0C P㿀> [ Dct`?@0`@0`@6 ct(`` `ƃ(``"S`ȃ0``"$` G`` & 4& 4 0 <d& @& 0Ho$ (@%Hp@e0`K_?Ho>(@` !~` 耠`;   !~`3`& X X& \ @ Hp@ ' @`" '''`@_"`ƃ(``0` & 4e`Z0'''t''''''t't''t't'x'l't't't'`'T'H'<'0'$'' ''''t'''''t't't''t't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't't'''$'''''''''''''''''''$''''' '''''''$'' ''''` @ `?> [cĄ ? 2  2 *     (@  )   (@  (  \`" " 0"  " " " $" (" " " " ," 㿘 @0@ (`6@@@6@.``6``6` `G``Ȅ`(`6` `?`)`(`6` ` `2`6`.``.` $6`  (  6` 0``6`.`@͐.` @* @Ţ.` @"`6` $6`  ( 6` 6`.``|6``?(6`  * > `> > `> ``> ``> c> a> a> a> ax> ah> aX> `p> `> a@> ch> ap> `> a > a> `> `> `> a> `> cP> cx> `> `p> ` %*  >  `  @ 0㿘  `O`#> mc( 0`> `G `"`m `a@``@``slc(2)  `" 1> l > l"1> l @> ``P> (b``` *> 2lڐ"hMlՐc("  D1> > lː"xlɑ  `㿘 > [#`? 6 2@ #ă(` > `al" 㿘 n Ha," 0a& 0> md!㿘`  `.u   (```  㿀  + 00@0(߂@0 0 @`0 ` `(`1   h@)  h0`( h0`)  h0`( h?( h.& ?"   h(`` `  > l0" h b@ >  + ( + lߐ!㿘&  `` `& @0@ |`h``0F` "E   @ , & ,  (@  ``  ) @ |, ,  (@ ``  ,, @,  @ # @12   `צ` @ `22 " @ 00 㿘`܀>G`` `(`@` H<@\  >  k#@<9 0`@8` $ $ $ ($ , $ $ $ $ $ $ 0$ $ $ 0 @  }B`0I > l/!㿘`" @3 P`l` a8``@ P㿘`n>  h b@  ?   %  |@ 0  `4`  "`4'  `00@0 ` )0*2޲`4 0  4 00d 0 $ 0( `@ 0 ,<@ZH 0 `X 8 |@`0`@0< 0"@I/ J 0' 2 `@'  jؐ# h㿘` `1`9``2!` `&` @"` `&` 606`.&``"ဥ ` ۀ ``` ?`@&` ?M&``ɀ``$ (`0` ` `( &`$&` ( @&`(` @S ْ@O @2!@.@%?` `&`60``6 `.6 `Ђ@6`֠?$@!.`@`.㿘 h` J `@ @(`>  + -/?``3` ", `@"(@`"#0``V$`  ``^  ` ?`(b`$ ` "`0J`%  ͂ (Ĥ > i" ?  > i H> j" ?`@1$`,`0$ @`, H@Y <` X 0 8 <` @ 0 H ,$`ɤ $` "` ?`@$` ` 0 d$ 4$ 0`$( $ @` `( ?$` $`($`$`$`,$`$`4(@4`$$`4 `` @\`4`` `@V@:,` 80` ,`(@4 @0`4s㿘@ #B`a h @`@a``  $   ?    ?   2@ 㿘 h (``P^ I0 > i"VP+>  {b@ T > i"h D h( h0`( h0`)  h0`( h?( " @؀0> i"` > @ 1 @``@`> @ 1Ӗ @`` \P> i"> i"H㿘`\  ` .  `!Ѐ .@`l$  $ $ $ $ $$ ($ $ $ $ $ ,$ 0e *p"@> $  h"ۀ> b `Ԑ 1~ "  㿈'`L`2F  `2B `> `f`6 Hod4Ȃ(@e #\#`    . . / `"<Hp@@X`( `  *  `쀢   @X ` &9 "@Xz &3ð㿘   >>  >`!h >>  >`!hp   @*0& &`h> E*`cd@> ~&`t"g&`x&`&`l&`p H @XS %?' H @t  @XE H H@X' @`H@`> g" N H&`&`  e &`|  ``|#`@ ` 4`h1` d1`|b1``1``@1` `02``|``h0&`&`&`#\ 0#`     ` 0`` `> gG#0` ``.` > g6 > g3#0> g.#X``2e> > g' Ѐ`V`h`=`&`4> b&`0`0 ژ`" @W 8''耢`'`".`'ܠܐ A ܂``'@Wo" @ `> 5c,> 'bА(7@> f#> fސ#> fې#`2'ܒ` @ 'C`> fɐ#fŐ#p> > g# 㿘`` `"   %|? b@ @ 㿘  O!"$`(a6b8 $`8> n  ?(`#`@`* > c@" 6ab > fx!p`H`4> @(`6 ԕ2fn!`46 `H6 `0. `,. `86 ցa6 a'a$`8a @ $`<4`p㿐 `0 `&`L`"6`6`&`&a&a8a8&a< |(( @@(`&`&` ( l`# Ho@(@> `Ƣ``ƀ` / "`ƃHp@`> Ɣ#f `#\#` 6`ƒ   C W "^ "!i> e! 6`` e> -`ƃHp@> eԐ ( 6`6`֢ 6`6`.`.`ل ?00~&`̒``'&``#`#\     2` ` -O` `>  ` -E`  > e! p> e hE6.`  `Ԓ> e ```ْ&&": 2#\: > em" l "``̀"F`` p "``̀"R ``ؠ `&ѐ,2`&͒`Ȓ?&ǐ#\#`     ` ,` "=`> e) ; > e  @2 ق @  `Ԁ ` ؀" p > e  > e̐ @ `Ԁ` ؂ `@" `ْ&s```Ȓ@&m&i#\#`  !  < ` ,x` 4 ?cc`؃(`0`0``ق`@`~``~:  (`0`@ (` @ "``Ѓ(0`@* `~&> d#h`2   > d#H @ > s!  `  $ a#"㿀 > [#`? 6 4@:#ă(``"6 `ƀ` `' @T" '''` @TВ"`ƀ`    `. @`  `$`   (@$`$` ` (@$`$` 㿘> [c`?0` @1 @cİ??(`` ` (@@`, @ࠀ?`<  (2     @@B   p "`Ұ?  "< ɰ?㿘 > [#` ?0`@3`#ă,  { e`g@`f `n@X0`e@ @ e2  r@  `h@5e@  #!  !E  ƀ`C @Ӆ4`  `, &   ?(c > * ah@  @&  `&  (& Ho$ (@e ""ƒ!Hp@  6 Ɲ㿀> [ Dc`?@0`@0`@6 că(`` `ƃ(``"9`ȃ0``"$` G`` & 4& 4 0 <d& @& 0Ho$ (@傐Hp@e0`>?Ho$$(@=`` 0 ' @S" '''`@Sd"`ƃ(``0` & 4eے㿘Hod4 |(@e |  `"4``@" 4   |` " 4`  > b 0 ? c Hp@> 'bа (3a@%0%000 000 0 00 0㿘% `4 % %   㿘% `$ 㿘!`  `c%!$&&$`3``3``,``3`,`` 3`2`3`3` 83` 3`3` 3``"-  (@   ) ` ( (``3`!&!```3``3`2`3`3` 83` 3`3` 3``2  ̂ (  (@ ` ( (``3`!&!> b!㿘!`  `s%!$&&$`)` `$`<@ $` $` `"*  ̀ (@2<   ) ` ( (``$`!&!` ``$`<@ $` $` `2  ̂ ( 2"  @( ` ( (``$`!&! p>  a!0 ܐ rʔ۔>  a~!P > b?!㿘!!`%0cP `(`0`@? #C d&``@?> aV!p`$㿘&`%؀`2 ܐ 4 #%  4 # 4 4 4 4 4 &4 4  @ $ #$ $ $ #   `$  @㿘!!` 4%؄&! $  ,!`   3> !$a @! @&!$&! ` `K`8`.> \8` 8$ $  @(@ ( > `!@  ,!`&!!`0`֐!!`&!$ $  @(@ (0 > \0`+@4 4 > \0+@ 0`+  ?c0+ ,` , > \0+@ 0`+ 0 0> ai!㿘!!` `%؆&! 4  @"!4 4 4 4 4 4  @(@ ( (`0``&$@&`  > *`!`k2`@  ,!&!!0&$  !$J ! @&!$&! ` `` `  ?c@8`)?&!4 4 4 4 4 4  @(@ (0 `` ``@ ? ?8)? )? ?c@8)? )? @8`)?> `А!㿐` `` ``@0&f(  @"ɖ ( > \6`P`< &``6`>  &`&`Ȃ  f(&`&`Ђ   &`&`&`>w>yc&`d&`&`&`  > ``> &`> &``&```k> `"> > > `&a&a &a &a `"&ea`&a&e؂ &a!@&f y &f t f @@2f &e> &e&fb&eJ ``e Q` `a&f`> _"2on!Z a4 `0@X `0"3`0' > #: @   > `8> &` > &``&`> > ` &a&a`e @ ```> &`> &`b z&``2΂`0 @ R ɂ`0> _"8 <8@4" <@㿘&`+%,0` 2@` #!` `(`0`# &!w> ^"p뀤`> ^"Xפ㿘`` > 'a􀠠. 9 `(`" > b  >b   ?> ``b    (8`?> b  >b" 0&㿘!` > !`> `" $`   @NO $$ $` _X"_V"㿘! `5&(`/! #`!`, & `  !@2> _7#  $`&$`$` o &@NӔ $` $ ``> ^Y#@&> _"> _##2` `@Pc ` * 2 2` #`@Pc ` 0#2` `@Pc ` ?(`#0`@`: (`2` #`@Pc `* 2 ?(c :0㿘4`1> Q^ x> ^ > &calc , `"8&c> N&#b@  6#>  @ cp&!|8   <"  > # &#!  "x  &!.!&!z&! 6#6#6#"$6#6#> # c!> \`d &!( &!.!  8{ &!!!6#6#6#6#!6#D< @ j !2!!2!#> bP#H  &#H@X&#L!  &!`?&!Ȃc_&!!x`4&!x"@@Q!`m`_M! ` ^d"# @@*__> 9#Ȁ 2#!А! b@@ @\> *# 2q!n&#@a > !h 2"> X ? id_"@@__ @ ? _H`  0 1> ]#ؒ# 4 > # "- > #&`?!`  00 @Ɣ &c s, p,  , , @  0㿐#V#? @(0(` 8 ?7@(`0`@`8(`7*+ 23  > _x!@?`@77(``(`` (`0`&@6( ##(`8`(`@?(c08`(@6㿐#V#  7 7*+ 23 > _/!@?`@77(``(`` (`0`&@6(  ##(8(6㿘`h>#e* `"> #e#đ* e> '* $@a􀠠" `$`$`(b` #` @Kށ \ 㿘`$"$``G"h)> '!`"b` ` e#đ* `s> `` $ !"h`H#&@(Pe#đ* $`h4 ` 6  &$& 6  @ //  `$ ' / ' / // `$& &$ 6 ..... .,  @0 g`@6 `` #@L%  2 &`, e > [ `!`"`  &`, f`$@KV  \a 8㿘"p`"!  *  * ^ @!&"d (`X !`F&#Ă``A! J  I&"h@K <&"p!`1! 7  D&"l@Kϔ 7&"t!`! & #`0$! 5@K `4$! >  [@!8!@``!! >  [1  >  [*  >  [#  >  [ ȁ >  [!㿐!!@>!@  !@>! A<&!t &!t㿘``Ғ > `  >  a &88@ # "> # "> !` "> # "> # ">  #Ȁ "(:8(:X(:l(90(90(90(90(90(90(90(:(90(90(90(90(90(:(:(;(;L(;(;(90(90(90(90(<((<((90(90(90(90(90(90(90(90(90(90(90(90(90(90(90(90(90(90(90(90(90(9T(:0(9P(9T(=$(=(=(=(=(<̝㿈@`3`> aH@3`& & 8`83` 4` `   + >    @@̖  : > @Hp*@@$` ($`, $@(` $@ ` `  ɒ .`@,$@ $` .`@ .`@ ( @v@~ @n ,@i@ @a ,@\ 0`@& 0 @Q ,@L@ @D ,@?@ @7 ,@2@|   `-@")"p*@$`  @ ,@@`   A @ @ ,@< E $` !P`:```> Y}#H> Z@#X(`>  4! > Zc 4> Y#(' ?  \&`> Y["``'`0 @ ~h#j!> > Z #h``> Z"> Z"`Q> (`> 0'  '`> > b0 ;0/ -~+h9j'  $ "`> YՐ#x`'`(`  ``@$&` @@ܠ @> ''    `> Y"㿘  ,  , K` 0`j @$ `  $`LA`L6$`T`$`T @Z @ $`X$`P @ "J     `c8@ @@2%$`h$`L`?$`P` @$`T$`X 4> `X`0$`P@ @ @`@$`h$`d$``c%$`\ @$  @&  &  @&  @c$`\@ `T`~$`TY #@x0w >` ,92 "H  `) 0`!$5  "8   <  @ $ D ( H` @@$ `?`(`  s" `(& 0ڀ`, "  s"   @(`  s"   s" 㿘 ` , ``2 @`  ,@`,`  0@& y    $ ( <`D @`H@gt``4 @ "` @G@g`&3`  3`` "`  @G@g`   2"`    @G@g`   2"`$   @G@g`   2@"`(@` @"` & & & r @`4 @"`㿘6`c?c@6.`@67 ..@/     #`#`#`#`?#`?`#`#`#` #`@E & & & ?`& &  㿘6`6g?.@(0.    #`#`#`#`?<#`#`#`#` #`@ & & & & &  㿘?6`.@`0( ` ! ! ! ! ??! ! ! ! ! @ & & & & @&  㿘` >`@       @ư 㿘.&` 2`&`&'" > W@#x?"`&@@@&` & ?&@$쀢?耢?2> ဢ?㿘````` 00@1 (6()   `0& &" &`2 ` `2 `2  &`&`&`&` ``2&` @ C&`&`&`&` ``2 &` 0``  ``  `?㿘`@B(`(")&`c H `@d?c, `&`&`& `?c&& &`` $` 7?&& &@[ `&`&`& `?c @H"@J " ``@2`&& & " `  $` && &6  㿘`@9(`#"&` $< = <@ '`"', `&`?(@&`` 9$` -?&@ >`&`?(@@Ւ"@ג " ``2`& " `  $` &6  㿘`@-(` R` 5@ Y`N>  2` , `?(@@" @ [`` $`  6 Z@m"@o " `` 2`"`$``"`Ul#㿘@``# `" ``c$``4` r@4"@ "```$`` :` 2 㿘 > U2#&j&V&2> &㿘 ,   ,@`j`e`2 `` @$            `  S `@   d @ ` .667 @/ .`@6` F@ . ` c@.667 @ / .` @6`` $ @$ $ $ $ $ $ `Z `@$`.667 @/ .`@6` F@   +`   .667 @/ .`@6` F@   +`       .667 @/ .`@6` F@   +Z @㿘   `     $ (8?"@@@5; @@ /`@7`"; `` @ 7  ``@.@@6" 9  ``  @@ 7   g@`.@G@``6"$7  g@G@` ` ; @ a`/`@A7`@@"(" @l@A^8㿘     `G  c#6c82#.  (  @6 6@ .@.@6 .#@@#####  7  @.6@6.@@.@##### "# c  չ6?" P ` L h d  L c \㿘````r> S#`r````@@= "`"`"`"`"`  `_#` `?(`  `""`0 0  @ ((+2 *3   @ "`"`"`"`"`  @  ᔎ`۞ > Rʐ#  `9 ( @  `9(`F`fɀ` 4@"@` @  > na\ a\㿘> nc@㿘> nc`㿘> nc@㿘> nc@8@ 㿘> 'a􀠠> n`x `t㿘> ncl㿘!> n#` @  #`>  Q#㿘> 'a􀠠 >  Qz > nc @ >  Qf H @㿀> c<' Ζ  " > $#㿘!> n! !8` ,㿘`" 4 > Q,# 4 >  0`> Q! p > c㿘> 'a> n`x `d> Qѐ 㿘1> n!` &!`7 2&!`> Q 㿘> Q 㿘?> Pc> ː Ȁ 5 8> )> Pa> > M`Ȩ      ɒ   ݒݐ˰> Qm 㿘```?㿘  > )a  Lp 㿘o> 'a􀠠2 > n `2#& c` &"Y``@K>  : && &   8 9& > \`Р & ?`> PD!:o> c` *> a`> bW@{  .`.` @ > > P!> \`Р & @> Pؐ > PՐ!8PӐ!p㿘> nc ` |@@y |@0> nc> <@' ` `> >  dO&@&Ґ` @`?@ > #j#㿘#@z#@z%> n 0'> OȐ#@|q0 @yȠc Or"@ .,㿘#> \aP`> na<> 'a􀠠> n> n a<( @( $aP. c> n>=c0'> = &> n@yg > n > Or"0 > n( @(< $  < a c<' >  bh> O@y1@y. ؔ `,       > "#> O"`㿘 6 >  `"P 20%> ' $````(,N @` @"` N `s  Ŕ @`   @ $`> ! %> '`s2@0Ѡp#> 'a`  U P> <@'<'> a ''tЀ 3a`D> a`4> M b "9> > M> Q> b``ئА " 5?"Ð   ( Ё> MO8"8'ԒO2"O0"㾐> c<'  !> bՖ!?C @zp E @yɒ &  ,&  &>  a ? : & (>  ch @?7 4%> ' < &!0*`蔂 ``S" @<` #> PQc pc> > " N  l> `"@%> p .   )pe4  /%> '> \> \`     ) @`4 `(`>  MƐ#0” %> ' > > #Mq&  *  * > > #8Ms > #> Mz \> `Ȣ O !4#P-> '`2a>b!>> > !HMNؒ!H> <M#􀠠b6F `G> nc LH@"#H>> a@> `>= B c0>>`<'@L`> a̦L`` 'ђ  'Ζ 2M> )a!>> !H!H> <M #􀠠 !Dɐ> Obp '!> '!̒ !D>>> M`<'''!' !> M> b8'''  `2'> ` (> O> Pbp> a "j  !D{' ''''] O`/> )> Ma> a> P> Obp/> \`  P\@`&`!v 2 Đ ` 3!D> ap''>  '́  Q 7Ԁ` Hpk '& ̀`3  `> Ҫ``H@>>>  ܒc>> a@Ԃ`%> `<> L) L !DՐ> Obp''''>  &> Lؐ > LՐ#㿘> L  @>>H`< `<> > `XP> `hL`>  $ K ` `aKL`2 > K >>aD  ?(@2``0ؔ@ KА 8> )> '!c<@'  !`0!>=!>" l $!ý !!@!C!@<=Z!`B> !``:>Bc=@`?P ?P(@@ >  #4!>> \`> n ($ H,$ L$ T\$ `$ X$ $ P`$ d$ l$! $ $ tऀ> ,Ђb8 !> Mʐ  Yn# # sĀ`m`q` pҀ@` ``[ !?P 'pҀ@` ``P``@UĤ@4@,@~Ҁ` ``O`@C?p  ?p`> @!!> M  %# @> # 1(`@~><>< ] cԠ> 'ԔpJȐ6! > '%! > 'c0 > K!h#> K > K > K!0> K"8> K!> K K"8> c<' !>>  <!x/> n`(@ *J`/2',;>> J`@ `/ `" (( J`@ (J`@5?$ aD ` 'aDJ`/" ,@ 2L-> 'L`-`2 -> '#> c4d`P> (> Hb> Eb `G@ ""   h J`, (8``:aD J$ J`"aD`/aD J`"aD`/@"؈  P`ك(`@ `  `  '> a''>=  `` `!> '!`"'> `x '> #$' !``  Ho@H/` /> 'b̒ " @Hp@> ' b > Vjh-> '#>  L`c"c4`c`d`"Wc4`a c4`$c4L`cc4d$c4`s2 c4`$c4@: L@ -> ''''M `(0 -> '` L`-c4   *  #>   y!}`y> P<c> O^bp "P> J8"`f (8``l"M (8``sM `d `t`r㼐 < > Ra;>>aD$`'aD?$$ >  rcaD$0$4$8'aDL@ r;M> pI >> |[ aD$P$X'aD$T> I"M `e( < > MGb#>>aD$$`$aD?$M M > Hڔp 3 aD$0$8`$aDg$4`d `t`r`>b` <``Δ >b> I"xM `dz > M <;>>b0  aD$`'aD$?$L@ > Hh >> \aD$4$8'aD?$0ML@ > Hp@ aD$P$T$X'aD`eJ( < > RԒa!>>!D$`$!D?$$ >  ǒ`!D$0$4$8$!DM `d'( <> ͔ c >>!D$$$!!DJ`,-> ' yJ`,2-> 'r -> '> M <;>>b8U`y> < > Mb0;>>aD$`'aD?> $$ b~ aD$4$0'aD$8> \`LH`1!`8`MM@ > H p>> a |aD$P$X$T'aD> H# > H"ː `8`> MKb;>>aD$`'aD?> $$ b < > M:b;>>aD$`'aD?> $$ c> ǐG̒ ɒ>>ap` >"  ` "> `8     "("8@ "$   >>p> '`  * * 8`>b(b8 b$  ¢>>p> '` + *`* 8`> `> `8  ¢(8@ $ ¢  ¢0*`* ل>>ap >"  ap ¢"(> 8@ "$ ¢㿘%>`"> aa>>`p`@` 0@r, `,@?  ¦c@ @04`>(%, $ ¦  ¦04``?k>>p >"(" 8@  "$   `>>p> '`  * * 8`>b(b8 b$  ¢@>>p> '`  * *`8`>b(b8 b$   *`*  >>!p>> "(a!!p8 "$ ¢@㿘> aa>>`p`%>` @@@q0@($. $,  c @@0`` ?c@ 0 4 f4 4 `?s  ĠF  ĠF ƠF>b(b8 b$>`> nh` > h o@ @"p`,op h ¢㿘% >> "b>>? ah>>(> d al  €@a {  "$    a>b"d ڠ@ >> b>hb 㿘>bhbTb<@pbP@p*> b>>( ah>> lȀ@"!  Ơ F!#  Ơ  F# Ġ@>̂   Xl` pbĘ@@ĸ@@ >" `!"p!"1> Eב > 'a􀠠 <>> @ al>>> ah  $  @ ˆ@`¨@ >> b>hb x>>  al㿘> $؀@> >>? ah(>>> d al!    Ā"   Ā  > :>b! Ơ@>    `1> Eu %> F6 㿘>bhbTb<@p>bP@p:*> b>>( ah>> lƀ@ F  F Ơ@> `1>  XEB 㿘%>hT<@pP@p *> b?>>( ah>> lƀ@ D  >    >bTb\`  ¡ā"   ¡ā  @  Ơ&€@@ > D! >1> D 㿘>bhbTb<@obP@o*> b>>( ah>> lĀ@Ġ@>b< bD`    @ >bTb\    Ā"   Ā   >1> D > ca2 `@  ? 0`@`  ``> ca2 `@  ? 0`@` `?> ca*  **`     (`@`?~ ?㿐ɒ(" D(b H     0h% 0Ť > b|,`" 0`"  "&& &  & 4H@6!4 6!H6!06!,* 6!@*`&!D2 &! 2`: '%%`` @ ```B@m @m%`%`ު`?b6!> '%`%`@@`  @ "``B`@m y@mx%`@%`ݪ` ࠈ ( ࡀ (ࢆ7  gGc&  ! & 6!  6! 0% % ?(b% 0 0`% <% 0@b7㿘 A X> 3`@a&Xȱ(" DE 0" " ?(b" 0 00`" <" 0@; 24H6ab2p  @`b(``B   0h$0Ğ > b|<  @`@C  #Ŗ 耤& ߀k ؀LѠ^ Ԅ ? ̈́ 0  &XaW&&@&`! `! ` &(! a&,a&0a&4a~a<p&8 @  a: @j &<6p 6ra&@a &Da &H6&> &a , `` M $ 4  $ +`0` @ 4 @`,   , 4   (` 0` `0` ` gG#ꀠb#뀠```856` ``-`.`.``" `1` `2( `?`gGc뀠26 Ȉ - ؀ - 5  6p<6  @ C " ``: ``2(   ( (  02(  ( ``Ȁ @`@2`> a`, `@  $ 4  $+`0` @ 4 @`,   , 4 aӚ @`㿈 / 0 @@ >4 `"'`M`H(`?  Ec傌 &`'4 `?`;R `*` ڀ`H쀢`R @l'而` 4 @<(&@`"4 4 `` `H(`?۔  Ӄ4 (`@ ` (`@`', 8`'(`@`'`H(`@  0'>b  㿀> c<@' `  @ @ 2? 6 *) @%&'''/''7 ` ' `'  `Ȁ> А! ǀ? c `"  @ =& 2 @ *  ?. ? + ??%  $(,048<?@ ?܀    ?   ?  ?  ?  2 @? "  2m *2?c $(*  `? c  `"@  ="@ 3  @`+  @.`?`+`?%  $(,048< @`?܀``  ``  ` ` `` `" 3 `@`" `2o  ?# 3 @(`0`@0+  3 ? @0`@?c`""`0`0`2`0""`0㿘@`0`0@2`0`"@`0 &`0 >  @i!0㿘 @(`>>!@ 㿘> c#P  8`> N" b'Ӑ 1> c#  8`3> & ah'ɑ 㿐!>''"@ !`?p! > > P3 ?e!p!@> > !?]> @ "0㿘   > > "8?Obp> > n!p @`  > nl``  l !!p> n al> ?"㿈r{> 󀢠t`*&` &``'k` H`> nt8@` > nax. @`  > ?͐"  > '> 'b .  >"a @8`> 'a􀠠> '. > c##@Hp@b . >"ah @8`?).@   #`(R> #\#d?#0(R@΂ #`>  ?z"?w" 㿘H` 8`  > '& 8`  </ Hp@ 'a  9  H  G /,$ <$$ $ $ @H`> nt8@`> nax,`@` ,`> ?#h,`>>!@Hp@  Ǥ  Ĥ 㿈> '> 'b `. >>"a @8`)?. '(R''H`)> n!t 8@` Hp@L@  2L!t (@(%!t. > nx Hp@>"ah @Ň8`x> 'b H`#> nat8@` . Hp@ > cc@>>a@> 'a. >"a @8`?).@? #`(R> #\#d>s#>"ah @8`(R@  ' 2 @ q8''. > nax @  N@ 2Nat (@@$atHp@  ǂ㿘Ho8`@>aH. p@`(((((((((((((((((((((((> n a㿘> M> 㿘> >#㿘> M= (㿘> = 㿘 > n!`2 ?x!! `%)> !@8@@ @ @.> 'a􀠠( @`%>B@ !&@ !)> !8@ @ @@!!?ض> = 8ڃ(`> = H㿘> b@> Bcش.q> = `㿘`   G> = x >`p 㿘``? "..  ϋ 0 > "" " " a" $" " " (" ,\ @㿐`  > `?b   k  $$ #`#\@ *?  ; \' ' ''    㿘H`>`0``> 'aL` M$` Hp@b̝㿈>`0``"<> `4>  a``````#\>   (@! <:> a0`(@ 0 <  $ ( ,#\ 4#` 8#d 8<$#h 8 2`1> <!h< > 㿘N@`  > "1> 1> < !`t1> <!<ǐ!;!㿈> ;!> ;!耤 > > b4@4@ 0 <  $ ( ,#\ 4#` 8#d 8;#h 8 2㿘> lb?(2 ((> \ aT`> a ,@)>>!@,,*$@@!Ć$@> c> c c㿘> 'aP;> lb> cc'> c䀢bb ?> "H2;b> \(`(`T @b>  ;v"xb(( @@`8> ;h"@e@J/> `> ;[">>>B Qx`N,8)> n@- `  > > D> ;;"`@  - @!b! >B@#`4 `@D( 8 @@8!> 4`; "! `` ` .`1> ; p-'> cj> + 1> :"1> :"1> :"1> :"1> :"1> :"x-@$ @ !P@` 黒 @@<)#@#`#`#`#`0#`H؀ !<`&!<??b&!&!<>`0`aP`$ H'a<@ (@@23a4  (@'X'T'\'D'H P'` 'd'h 'l 0'p@ ú@$  D X a@$ H$ $ $ a8@$a<0'<'Ht+<0ܐ  a@㿘`   !    ->=`( 0;> cccЀ cЀ`8 > F`ذ> 'a 㿘!Lh!P$ !L @f, 3 ? /  2!T ?`$!T  @%>@%n *&!T } P $@a$=c$`$`$`,$` 4`$`$`$`H&$`$ $㿀#> 'a`[>>a>>B#!> !@>! @ @2?Ha?L` 0'X> 'b> > c9" >>!a > *@#92`> Bcؒ '#\ rr a> c% c?>> a?>>#\ aȔ>  #  $q >>  a  > *@#P9z2`> 6 b?>> aބ0> :.#(㿘> 'bȀ" > 7 "XC2#> > 9P#Fc>  c4> c؀`!>?zH`!"> 7> 790#@B`> #> 9&#> `0 '>  ؀(> i09#p0> 9#  > n! s ( @! d( ! -*!(!b! *!(x(((h(h(h(h(h(h(h(h((x ? 2    (`   ? -㿘? 6  !> n> `""`` ! "`> /%> >Bbȶ- ->>5> '/@'>> 8!> n"`"=$" @ ` (@ @``Ԁ`@ gԒ`԰`а j`˰`` &`` ?Gc@@>BcP@{>B@8` `?(`k ǔ`` @u o`>> , @  `  `@ @ @@ @`?H@@>B@͠ ˠ `n @ @c`!>>!Ђ Q$> B> co I$!> 8 ` &@`K&`> 8  ʹ % dch@@``@  8 6 &`  8 w *`"" " 㿘`>`0at at  & Hp@> >  88oh㿘 H@& @` >"@0t` t@`@> >  P8K㿘 H@& @` >"@0t` t @`@> >  P8'x> 'a` ?  㿘> nc 2   @ @  @   㿘c  ?   &Y,㿐c@>=#> n> nc''0@"280 c@1@| c0& @P@o  "_  ]Y Vk O   H/` / @Hp@ 2İ #p H/` /@Hp@ `   H/` /@Hp@> n b& H/` /H/` /@Hp@@`F 4& ab1>=c0.> nH/` /5Hp@ X$bB&   'H/` / @Hp@L&)) ) p) \) H) 4) (㿘> bԄ?@?? 2`(( @2` a 2` `㿘 0 `>B#z>>a>>"a"@>>c>Bcx  8     㿐> ''D`'H` DH@'H D @?>B cPD>B? chH@>B'?c> '#?7>>1> c;>)> n/>>3> +`= Ĕ@`#4aԠ  #a?#(4`(`(`! ` 4``+` 0؄(؄ @a„@@¤@@@H> '` @`Ȁ@@(> 'H㿘+> 'a` , 0Ho>(@g> U ! 8`!&& a`=` @@ >>> ab, 8 ,#@2@* $@ %( ( @  ?  °`??  ް  ¨`?/!>Hp@Ԃ@@A `C >,` a`@   ,&04!"؟@! (,`8``x"⠀  >bП "Ġ@`Hp@bП{>>??   㿘> a@@ 3>Bc@$  `" >> `  2`(`(`   2`a2` ` > ' a> b?*@ o2  (@">>b :```88>>ah @> 'a`` >Ġ@>> 2c 㿘>>> 'c( `  >>>>a* `> b:㽀7> ' Ϧ  Ĩ@@"c'9> ->>!`*'?'`''  >>b (`@ >> D)> l$0"!> l!   "" D!> l @'!   "" jD @2'`!  ;>B/> lcx` ?`  ?! K 2@ `5@/>>+ ->>+> l`2E @` !†'! *?b" ?D ! `2" İ@`@> lb"−" D "Ġ@4"@`Ĩ@`ဤ@㿘 06` (( @(6`>>a"! @`*` @Q ¬@Ȇ@ @@  > a``@?)(@@&   > 'a6` |6` `@> 'a  İ@`>` `> (Ȁ@ Ĩ@`>` `?>`  ¬@㿘.> >>b  .@`% >Bc>C@ `0(Ho&(@g`+"@ Ġ@<``">  Ġ@`"@ @~@Hp@ `% Hp@bğނ 㿘 >>BcU>B#> '>>aa`T" @@Ho@(@@a6`6`3`? *(8`** ! @ @` @ aHp@a`' @@퀦@ @`  *(`Ѡ@g@#> 'cHa` "@0"@㿘QHo4 D(@g D$!> '!`( @@ @%> # ¬@@ğ@  ! `!`2"Ġ@Ā` @@Hp@"@ڰ @"@Hp@㿈>>b @  $8'@ "@ " D8'D` #\#` ?͚?㿘Ho4 (@g `="@ 8" ->8``7 y@` `"Ġ@ğ Ġ@` `%@ 9 `& | ` `$ " $  2 "@Hp@> 2 > 1 㿘Hof4`(@g``o @``` `` 2 (( @i2 ??`?)>>-3> '/@5>@" `6@8``Ĥ@"<'` ` 2 (( @C2 `?) "`"@`"  `¬@@Ղğ@Ђ¬@a􀠠2  ư@`<` `> („@€@ƨ@`<` `?<` '`  @@Hp@Hp@ > 1r 㿘 L` p @2  㿘i @ L`$ L㿘 L` Z @ 㿘T @ L`$ L㿈Ho4 (@ g `x ‹@ q' ` 2 (( @ 2 ?7>>(/ 8@+> 'E@`h[?`­@>ğ@'쀤 m@ऀ a4 `|4 ` @` ` `$` "@` $` @`+ ``Z> `` 2 (( @ R2 `?(Ia2 `|2 `@@ @`2` Ĩ@@Hp@ (`?(@` ­@a2 İ@`: `> (  < `& Ĩ@`: `?: 0!> 0! > 0!@㿘`G> '&a􀠠&! Č@%>` "@П ¬@>$@ > ¬@>$@ "%>؟@ ""@П@ "Ġ@` Ơ@>$@ > 08!`㿘!ƀ@>`"/̃(€D` 2> >a> 0!p0"> 0!(`c >B+'?)?Ƅ`"=`*/ `> 0"p`"Ӄ(   @ ̃(  @`@*@ @ *@) ) +  @ x@  @2@2 >  Ƅ` (`@Ȃ `" ?*``"/ > /"@`+ x4`$4 ! @`b"՞  (`@ĀD`"%> * `" > /">`"́@ @ `@) ) +  @ x@  @2Ғ`/!` @㿘0ƀ@`#Ā` $Ġ@`0€@``€@``€@``(`@/(`@?(.?(.> /A"㿘 "Ġ@"` @ $Ġ@`!!2  ?Р@ $Ġ@`㿘!>"` 8*`8"'>  `M >>6?((@¤<4?(@¤@/>bğ ¤ Ĥ@,"㿘 8&> >>4@a<?,@@¤>  ¤㿘 @ (`>> %W", L>>c ` ` `  &$$ `?$ (`$ >> `  & & `?&(`@& 倉 >> l@c @ c " `2͢  `#c &   3 > .#㿘 @ `6(>>c `  2!  >> l@.c @*c >> `"!>> $ؐ", %&"" @ " (`" >> (`  & & & & `#c &  !>>> .+# 㿘 `x@M>>c  ``$  A> `; `@2@`@2@$ @>> #", ``" >>l@K `2 0E@B `>2  `$ &   $ > -ؐ#P @>>c  ``$  @& ` ```@ && & & >>#K",  `  `$  & & > -#@㿘 `{@O>>c ` ``$`  C> `= `@2@`@2@$` @>> #", ``" >>l@M `" 0G@D `@2``$` 5$  $` > -U#P @>>c ```$` @& ` ```@ && & & >>"Ȑ",  ` ``$` $ $ > -)#@㿘Ho&#> '(@g#> 'a` `/> ` `)> Hp@  a "a`"`"  $ `"> k $> n"w" & (& $,#`,#㿘  `"  "㿘V> a>Bcp.@@ (2 Ho&4 (@g *`*` @ `"5>  >> 2 `" >>b@.> ' 䈀@`I  ¨@@c@l(@¦@ 䨀@Hp@+#Hp@a 2 `|2 `@-(@!Hp@0@?@¨@> '􀠠) ڨ@`: $`?(Ā@( @@`"Hp@ @@`"> +^#0ڰ@`: ݄`>bğ㿘Ho&4 (@g  L"@ 1 > c;>`"*& ``; ", " Ġ@ Ơ@` `2@ `"@  @2bă<  ?`@|@`2`& "@Hp@+@@   `< Hp@ 㿘 L`  @ 㿘 @ L`$ L㿘 L`  @2  㿘z @ L`$ L㿐>>#\",    > #ښ`(> 'a􀠠$$  !> c> n#" #\> #ʚ`0> n#\"> !`@! # 㿘> 'a􀠠  >C>`+ $ې 2  + #  !ѐ 2   @ !Ȑ 2  $  &!&!㿐> 'b7> &`> 'b8@>> ؀>Ca >B`# ? xѐ>>* ">>#!Ě?* ">B cx !>  0@#!> 'a`f`B>>''>ƀ> /> n?((@ `l%㨀``4>B >> b>B> 8`t D>B> 8 \>>> :a >>> Q >>> 5b >B> 8H >>> 7c >B> Q0 >>> Ib( $>B> E> :a l>>> < p>>> Jbt >B> K H>>9>B a܄#   ?-> c%>> >?>BcD%'$ k!+`#@ ?`?0??>B(`(` $"dme> a`>> bb>> bb  `>B pp'#">>'>$. @@ (@ & ! ;>B D'c>>? a>> a>B$Ԅ`` $ $@!Ԇ@4$@> n> 'c>? > `> `?>B>>a؀  >@`@>Bd-- k?c @@ 0`)> ? 5 @ ` $ &@ @`@&@>Bp&`>B &`c`>>&` ` 0``#`"06`&`6`? 0`? @6`(`0W>>a`(``4 #`4 `,    #`>>`  /> n;>B'>c8 >  41 >>@ >Bx㨂``$ @ > a` 1 4@  ш>b >B>B(`4"4 > `, >>a,@> a  `@"@  ?> ' c ت@8 ư` 8   ƨ`   `" >Bd) )  @ @@>>0` `  >> ,"@ ,">B>Ԁ`2>>> 'b ! @8Ь@    ; ``(    ?ư@` @ ƨ@`@  aԐ @  ƨ@@> '> a` >> @a (@> a;c€@ @+c€@   @  >>䀣;c €@    >>>@`}>B!>  >B> =cd D>B> = \>>> Bb >>> O< >>> 4` >B> =4 >>> =b >B> Op >>> Dax $>B> C> C,` l>>> 5 >>> Ma >B> K H>>$ a9>B #  ` $ (/> n%!>?# k;+>> cDk5+n!($$ @ ? @?>> ->Ԃ(@%, '#$k > Ԡ5>>,&(㨄$(?@RѐђF% #>>$# <$bj$3>>&a j(('>B$㌒ j$> nbc> >B! $ (#>B,;>B$cL$ 8'cx@ % >B ak*` @0``x # *`  `+ ㌄@ 0``x*!a ``>Bc`$z#>> aa `>>? a>> a>>B$Ԅ`  $!Ԇ@4$>? >B㨤> > 'a>B 3`(`(` > '> 3``3` `|3` `#@ 0`;`(@ 8cL@ ( @**@ @: x >B`) 4@ "4!>"`7(>C> 2`0T  #@    )   r) φ#`     #`   #`   #`   #`    #`cL%:"0ǝ㿘 "   < i < " +++$` $` $`> '``$`$` $`0 > nh" k$`$`$$`(  x #> ax   $`0㿘%> n 8``8-> n/> nD+> n!>"`;1> ! ` >b4(  0Ơ`5(``x pƠ@`bx!!> n>bğ" "  pƠ@`> nx@> npƠ@`> n x"!>>!#>B% ﺐc! $c%%b㿘%> n 8`''> n!>"`"""> a4@(``` 0Ơ@`xa> n pƠ@`> n x>>a>B$~#$㿘Hof4> (@g> >b.@ '> '`, ƈ@@ Ĩ@@`>Ą Hp@¤.Ĥ>b `" @@Hp@"@ Ġ@>B2# `׆ 0 Ġ` z . `z"@Hp@㿘 @Ho&#>(@g#>`0` Hp@@`b؟@> '` Ĩ@@0"Ġ@00㿐h>Bc>C@?`0$@"Ā@'Hofp(@>>c +> /> '-<9>V6``?6`[ `) (8`^*) )   `";+` ``"4`" Ġ@$> a`&8@@@$$  pĠ@`@x@a@ŀ6` ` ?@a(`$(뀉2 "ğ@ Hp@"Ġ@`) (`@g>>> % P㿐`⑰ @`2 Ho'`D`"Ā@' `L`H` 2 - -  @ `"> 2 ?-``>>b,9>` 2 - -  @ `"> 2 ?-``~.`@ "`Ġ@"ğ 0Ġ@`@4  l9  `z`4$`4`0>Bc@+@`-`- @ aĠ@`-`@x@@> n"&@ `, @` "Ġ@``$x@1 "> n$"䀤2 `'`D'`L'`@"Ġ@Hp@(@g\`D Hp@> $L $J p> $G 㿐 Hp@ Ĩ@@ ˆ@'Hom(@/>>%> c -> '9>>+)6``?6`A` `) (8`w*) )   `"+` `" "(6` @`= `¯@@@0@̀@ $`& $ (>Ă`& (¦@`) (`ö@`|6` `@@ @g¯@@2 Ȱ@`>` `> @(@€@ Ȩ@`>` `?>` > # P㿘#> 'a`L@ @@Ho&@(@g@>B)>Bca2`2`0`? *(8`**  @ @` #H Hp@a` @@ @` #H@瀤 *(`Ԡ@"@0"@㿀>>b 2b     @?$$  $   @& $ `>>$ c `>B @&` ,p! , 4`! 4` .. @ .0$ 4 4 >>b b `>Bc@>     @$?$  $  >B cp&  ` (`(`   (`'# @@@` ` >M`¬@@  >bȑ* *`2 2`> 'a`  (`(8`@>>a??-> +# ) $,@@@c'ђ?* *  @>*@@`(("ނL> ` L$@` >>a`4`  ((`8`@"İ@`"0 K  @? $ @@$ `.$ `  ` &`. @ .0$ 4 4   0`0! 0)"  (`(8`@ƨ@` ((`>>c `4`0 `4E `0 4> 'a` İ@`j '`   ((`ƨ@` Ĩ@`[ ߏ ¬@@> '> " > !!`> ! > !!0!!㿘 0@?` 6`** @L6``?*F`>>@  †@@@??@Ho&$!(@>>"> 'a􀠠 ®@`>>> a¦@@Hp@ ¶@`>>g>>f"> 'a􀠠 0 㿐> 'a􀠠X @@ Ĩ@@ K  4;c>*b@)> %'9> ?'* *  (`(`@@`@ (  Ц@""Ģ !@ &ې > !N! Ц@2"ğ@! @@ "@ Ġ@ H>B>*c@)</>%> k `A4 [?!* *  (`(`@@`@)     0 `|@"IJ հ ? 0 `|@2ğ@"@  ?>  !> 'a􀠠>>( 0ƀ@`>`>B> cL"@2@> Gcd 㿘>b * 㿘֔ >b2> a֐  㿐>Bcd.` .` @@w> 'a􀠠m-(8`@>>a>*b@+> )#' `"a@@ @2 ~?* *  @@`((< L` L`aD  - @?-$$  d>>b(>Bc10"K >> @>>?c $$ 4! 4$$$  , `! ,-(`@> 'a􀠠+ İ@` & "$ >> @>>?c $$ 0! 0$$$  , `! ,>> b Ĩ@`d >B ct> !㿐`e @`5Ho݂(@ D` ‰@' L ۪ H` 2 ,,  `2 a@`߄;>>.``b/> 'J@`} `­@>ğր˃:`B@  @  0 `|0 `"`4$`4>>","' L` 2 ,,  `2 a@``.`bM4 @т`|4 ΂`>Bc@E>@``6b°`@ "`&@ `,  "$`4`4`,"$`,`0@"$`0`4­@􀠠2  ư@`< `> (ƨ@`< `?< ¨`@@ƒ "&@b, `­@Ĵ``>Be# q, Ĭ`킀g" D ' L' D' @ ƨ@@Hp@Hp@> ِ"> ֐!`> ѐ"(㿐 .. @@ @/   ~  Ĩ@@%> &0@`>`@ +H,@(D,@ 22a>c|ϐ ?"* *  @>*@@`((@< L` LHo&<(@ΔHp@ ¦@ 4& 4@,`> 'a 3/ .8`>>>a  /`¨@ IJ`/`2` - Ī`킀gÒğ@>bȐ ~.ѐ㿐 ..  `/    `> `"   >"`> b&0u E+> ;<a@>6` `@ @2#4  c>| ?* *  @>*@@`((@ < L` L樂` pĠ@` | 4& 4a@ȃ6` *-`./ a @Ġ@` / @x@!> n4"% `- ` "Ġ@` $.xE " %""Ȑ@  ğ@4 > }"`{"x㿐 ..  `6=> /  ,`5>> `   Ĩ@@/> &0@`>`@ @ W- @(S- `@7 `@>{i @?(* *  @>*@@`((@ L<`` LHof(@gbHp@ ¤> '4 `|4 `%@ 4& 4@- -!> '!./ 8``d>>°` "%; `,  "$!`  ,"& , 0@"& 0>bȐ p> 'a6` |6` `@>*@@c/> -@  "! $ 4& 4@- ; "% `, 2 "$¨`z?އ* *  (`(`@@`@"$Hof(@gHp@$/ .l  ¨@> '􀠠 @`>`  `?/> ` (@`>` `ğ@/"`> ,"x㿐 .. @@ @_/  `Y "Ġ@%> &0@`S>` ȟ@D>*'<b@/>@(<, 6` ` `22" 7  24z%?(* *  @@`((@? L` L pĠ@` x 4& 4@8, `@ @̑7 㿐: 6`(`(` Ho&4(@g`K"`S> n6``?,[6` `@6 ,` ``-` 8`& 8  7` 잔/@`" Ġ@ p `@@x@ 4& 4Hp@  ?c<"?2  4& 4 "]  ق"$, $> n ʐ"䀢 2\$Hp@ > n "䀢  $-`  `,  x ,뫠2  |6` `yV?* * !>*b@ ((@ߔ` " 4>bğ 4Hp@h 8 `& 8  x h $@2  |A t& 8㿐=c@{ 6`(`(` 6`aHof((@6` @ - ? `,  7` є/@p Ġ`x@ 4& 4Hp@ g6` @ 2  ?*<"2  4& 4x?* * !>*b@ ((@F " 4 "Ơ@>ğ@ 4Hp@6ϖ 0> R"㿐> `b`?(@?0x}? * * >*!b@ ((@",`x +`>B`#@@N@㿐x.`?<(7>  a>Bc @ (`.>C04@("@ 6@  22>  2  " `$ "@`$ a4@x ?Ƈ* * >*!b@ ((@̀ "㿐? 6`) )  @'L@Ho/> '(@g/> '`4,0#@0@8`@W &$0 "5a@`@ 5>>K`` Ĩ@@ƅ>`@ 6 D` `. 8`$8 @ @  `N Ĩ@@@6` `|6` ` @4`$4Hp@ & $,`(5 `@ 6 `c@ @Z?4$4 Ĩ@@􀠠B ư@`= `> (@ 5 `|@ڢ  Ĩ@@􀠠3 ư@`= `> b* "  fHp@ >>aؒ "(   $@.  `5>>t- ƨ@`= `?ƨ@`= ϐ`?̃= w,?* * !>*b@ ((@`"424>bğ4Hp@LЖ8`$8 $8 ǒ" %- 5>>0`㿐 6`,, 6``?- @Ho4 (@g +>>b" @` `,  @ ڔ@b @"@ 4`& 4Hp@ c@ @@W@1? 4& 4>B#p 4  >`- > 'a  Ķ@`, >>ƨ@@ Į@`>>> a?@  0vI,@?* * !>*b@ ((@R@2 4  ƨ@@>ğ@ 4Hp@6 0㿐(`(`@>  a! @6@ ?>B(@ #@ @> au6@? * * >*!b@ ((ۘ@㿐>>b>``` (` @&>  a`?4(@ @>Bc,Ȗ  > w"@@a`u4?ؘ * * >*!b@ ((ʘ@њ ր @? ? ` P` `P !L`㿘!T`" *!>"@!ذ ֝ $"!T!ΰ !. &!T㿘!P``@@` շ P@aP<,! 㿘!T  >b!ա > d`!ՙ ^!T㿘!P PՍ  㿘!P 0( 4  8` , ,`@?`B  㿘G!L `㿘!L` &$`  `  @ 8 @?  4$` ?㿐>  `@`$ ] | p> '> # > bp> \`%>0``Y> $aP *aL *&  > u "' "' h> dc> > # bp'  Ȇ0t怦 >  "'   { 2;'&^&] @M > > # bpc . > da$@bbȀ"&&<&&X *'  $ > #А'   20 . > Y ?}? `> `"?H#'&&   >b@(&> U '&&   0   0@> !aT$aTb0ђ  @ ِ`> $ ('&&   Ș0> >  bpĐ# b. '   Ƕ0   ǯ0> d c`, ~`,> ncj 0  H ˔ @ "XÅ X` @ r`?q$   {0i ݀ > Ȑ# Ѐ y TY 0PaTP *>=`"'`C'>─@ `ԆaTԬ!L$│`$!L@1&   ;0)   40"`4a> 2#P'H` (!aDaHr$aH  0 !> d` !$aT (ʐ#> ǐ#Ő#p> ` @>@`0`!L> 'ac@̪`0!0$!P3Xƃ4 6`e,Ѓ(( @@ `8"`4 ,`"U `4'' ,"z :&!0`.!0`,``@&`0&`&`&@ą `8"@ ,`k@>b(&@`0`44 &`4,K&`0$@?``(`@`FĢ , U 0``R @`H \*Г,ѕ   `8"!0 ,`2!0U !0А(`5z @> 2bĀb `4`84] @`(&@&`&`#@Z^`4>  0>  8>  P> ݐ h㿐> a>`0`  +q l`` @`ߐ>b(&` `@  k `#`  @`"'L`` _ H`>  > PƘ >  `4 `?6``.``B @ @"B$PZ> 'bȀ2L=c(7 > Bcؒ?o 2L`b @@`0> d@ @ d€@```2`#€@` > ob&&2L$P  ?; x@ 2`b`  T0\Y`0xH`>  x> PG>   㿐> a>`0`  ">>b"%>`` @`2V!L @ 'B  @>b('@ @ @ @.$!P  єB &Ҁ`E` V!L>' b.> 'bȀ=c( > Bcؒ> !L H`>  > P">  '`'`> b>  x@ 2`>w `2w`H`>  > P> S  8"aG6&!\ &(6!P P~!L!T` ;'>b<!o('"aH'#d#h#l '  #\#` З쀢 "#\#`#d#l#h  Є!\ `& T!(k!T㿘!T  #>b@ *EX$b㿘>`0`!LHaL> bL> |" !T 9>b< * Ր!&aT!Tk!% P@&aP d2  & 0&  `& 4& P$ @& H 8 >'a$ $$ $ & &aTH$`Œ * 㿘 0#>  Hb>B@8#$ H> BcؒH L>& L& H` @ < @ > c 㿐 0H/>  , H` & L`> B؂@8$@ @G& H`,>B+>>c1>!>>!' @ @@a@ > "`! @ @@ >  㿘> > 'b.`'.uHoo>>a̒9 > Hp@>`@!0y0۝㿀 > d#`-> !#  8@@@@@H` Q>>#à@ (`#` #\#d ?0Hp@ 6 <@, '>>#> '+>Bc`@  @'@ / a('y @'>`"@a#  @ (`#` #\#d ^0@@0> Z!0> Bc؄  > Xb@ 㿘> a`@.@3><c`6@   㿘> a . 5 ><c> B&@cؗ6 ?  4 > B&@cؗ6 ,  ` *  > e>H`!|@㿘7? > 7cH4 > d(a@> !P> b"> ~!` P#>C`p`H ``P!> e!x `$!xВ  !x$!x`H ` P 㿘> eax> c4@> Ր!?㿘`=> c ( * L   . J  㿐(``?c`?>C`B= <c= 89> > b> Ȫb> > XЮ`  `"$ `  4 ??  < 8ؔ')p)p)p)p)p)l)l)p4)o)o)l)l)l)l)l)l)l)o)o)o)ol)l)l)o0)o)l)l)l)l)l)l)l)n)l)l)l)n)l)l)n)l)n)l)l)l)l)l)l)l)l)l)l)n)n)l)l)l)np)nX)l)n@)n$)n)m)p4)o)m)m)m)oP㿈 j @> ecT``0~0~7c0p 0`` @  `"j> 0` `8`W @2 2 >  #(  (`8` `, j L``,>  #??,(`,@-`,@4 4 `'4 `@?',4`@4' ) - ?/``?Ђ``E(`>  ̐#L`2%> >   Ð Ё0`?`4  >   #ȁ> Z$>  #>  #pۦ !X ˃) >   ">  > > b  `@ @(`8`a`p`"` y` s` o`4> ` h#(>  c# > ec@@>  [#>  U#8>hLF >hL? |>  A#v>  ;#p>  5#j>  /#d> ea@>  '#\>  "#W>  #R>  #M>  #H> eb@>  #@> eb@>  #8>hL 1>  #+> -`  #%> eb@>  #> eb@>  #>  ڐ#x> ea@>  ѐ#XL`82>  ʐ#h> e (`>  #HL`724> ђ `  >  #>  #ߦ > e(`>  #զ> ea@>  #ͦ> ec @>  #Ħ㿘?΂a&.`.` ( @@(` А 2 @7ɐ $&`, `2 @7 `&&   `*  @*@Ho(@f(`h`(Hp@> \bp"  `  `?㿘> jb԰ 6 (` . .  @@`<> 8 l`ȅ(㿘> jb԰ 6 (` . .  @@`<> 8 l`ȅ( > jbԐ 2 (` * *  @@`< Hoe4 (@ f (`hPf "!Hp@  ` `@`(`m`(`lHp@  `l`m@?``@2` 2`  @?``@@ `?(`@Hp@  ` `@` (m` (lHp@  @ऀ2  `@ (`(m2``(lHp@  㿈> j sb`(0(`@ (( @   `$   {Hoe4`((@f`(  =b`(`" `$(v(r`$`(|(x` (` @?@`"2a?b;`2(``@@?`"(  ( ` N(?((`` @@?` ` (` ((!Hp@  ɄDŽ> ^`l"  ` `?> jb 2 (` * * " < 㿘  > 'bЅ. . "@59* 㿘  > 'bے@5-#耢 @5(#㿐& & Ho%`(@f`;a@(`h`"ۖ@(|@(x@ ( @` H(@` (@ (!>  @(`h@(@` (Hp@ &> ! 0㿘& & Ho%`(@f`0> @(`h@ (r@` (@ (!>  ٔ@(`h@(@` (@`?(Hp@ &!Һ 0 " X@ " Q@㿐> jb `6 (` ..''@ `4`@ a  < D$ <` $ <* * A    l ``d``"`<`Y``D``2`<>`G`<`C`H`$#`H% `(f`<`H`$`<! > 6Hp@ ``2`"``<`W$  `<``Hoe4(@f@ <``%Hp@``!f e "`<0א* * م  <`$ <} l <$ <$`@&` @@ݞ@㿘 & `:> ^> ^cЪ  4, `&8 , , @מ @ט l ` P , `, @`4&4&`0> c1> !> 1> c!> &`0 1> cx!㿘> jb԰ 6 (` . .  @@`<> 8 l`ȅ( &@ޘ  (`(` `]@@ y@C (zx@ߐ `@ &u א k@"38"l`j@9\@2ʐ  Đ  `$`@@ {@2 `D`$`D @ m@2 D  @  <  `D`$`D  / & )  㿘 & `<> b> ]b\    &P ` d` 0,`@4&4@ " 3%&8" " &< $ &L $8` 0@`۠ @$0> `c> c1> !&`0>  c㿘> `p``p` Kt @ 2  㿘 0`c   (`4g   t@R0 ) ) @`0  `"`" b(   ) `  [   (( @` ` ," `"  ( !  (```v ؁  (( @`` `b$" `" $)`b)  @ 2" `  $    `" | 0``(`(`  `m @?`@ # `#  +`` ` x@0 ) ) @`0 `C  (`c  ! `! ~   (`c?(c ! " ,`(`c?(c ! @`! ,! (`(`c`(`c ,C` B ( ( `H!  `_$ ` 㿘> jb 6 (`@ . .  0`@, `@`@, Ho%)(@@(h@o&Hp@ c`$   &&  &f& & &  㿘> j pbԈ?1 (`0@Hoe4 t(@f ta Hp@33 H` U H , ,   ` P  \ t, `, & t Hp@ p> jbԈ?1 (`0@Ho%4 t(@f t` a`(`(`  D` DHp@ " t㿘> jb԰ 6 (` . .  @@`<> 8 l`ȅ(Ho4 (@f   t`   (`(` " @ Hp@ 6h> c<@' > aЖ '> `p8``  ( ` > @I# 2`@I 2`@> NbJ `  > '"`> &# 8&``,&`0`4 &`4 `&`t`&`x` &`|`? $- @`0@ ``$@$(@ `?(`0@ @@#(( ( @@(`8`2 : @/!, ~``" ``4`2`?(`K $ ` @Ǧ`4`   8+`@@ `4`    > \Wbp  > ^Q`l> a&``|&``?x` > e!aT&`> !@ >  J(8-`-@Ю@b  J(8-`-@Ю@ U `㿘> jb` ?06 (b) @"0 . . @`4Ho(@ ``Hp@ f  & Hp@$?& & ڐ & &  Ho%4(@f(`h`?( (Hp@ 㿘> j"` ?00`F@"ԃ) @@ `0< (`(` ` t` F$ pdd ' Ho(@`$> # b  !@  t`b/i$ t " Hp@ t}$ t Hp@ l> 8(`@b3i$ t c $ $ c$ ` `` $ ` `` @@$ ` `% @$ % $ $ $ `$`$$` Ho4(@f`(`h`?(-  (?-?(` 2 t``  t`v$ tfq`m$ t㿘   0> 8> `Ƞ> 8b   ;@/  0 <`t` 2B T 0-0) `# P <`"`H` <$ f` `? Hoe4 (@ f  (dC\ "" Hp@  ` `* 0   @(d` (`((Hp@  J 0h(@?`a@2`@ 2` `Hp@  ``* 0  @(d`@ऀ (((Hp@  `"* 0  * 0 @(d` (`((0   @(d`㿘> jcL 6 (` . .  @@(`@`4> 8 l`ȅ(㿘> jcL 6 (` . .  @@(`@`4> 8 l`ȅ( > jcL 2 (` * *  @@(`@`4㿘  Az0``/ / &@(`@`L( x(`D"`@`H@" `@  (h&@&@(`@ `L 2```'``  (h&@&@(`@ `L 㿘  A0``.`.`# @(`@ %`L  `H@"`@" ) hzhx) D  @`H@`@2``&` ( "# @(`@ `L 㿘  (A0``..&@(`@ `  T &@(`@``  (&)((` ߂` `#@ )( 3 & ?(h{ &({@(`@``` ``&@(`@`T`4 P@` T  P `(h{ `(h{T`$P )({ ?(h{ ` ' `   A`@0(( @@(`@``  ``"@ (  (h㿘.`@,J. 2  `?c .0 .> gc Ā`?    @@  @ " "`0> 􀠠c> >hb!> > c>hb!>  "`0> c>hb!㿐  ' @  " w```ђ  @  "  v``  @   u`` V @` e @㿘> jcL 6 (` . .  @@(`@ 4> 8 l`ȅ( 8 &8 `]@ 4@ y@H (zx@  X &U ܐ k@"88'l`j@9\@2ϐ L ɐ  `$ X@"% `{@2  ` <`$ `༐ (d`(0@m@2        <`  &    㿘 & `.> i> kcx &D `@4.d  @ (d*" " &4&<&8$ H &@ $$ 0> `c> c1> i!&`0>  c㿘``CB  > C< p`?㿘 ``0> 8> `ȸ `-@/   4 4`t` 2 H  4$ H` 2`2 `l(`@` H L  D$ H@ @H` ` $ `Hp@Ho4 (@f (hd (Hp@ `@$ \ `l(`@`2  P`0 "`0 P`P`HQh @ `t `l($`t@`0㿘> j scL0(`(( @@(`@`8Ho%4 t(@f ta Hp@+ H` HNr $`T P$`P t`& t`<(hd`(Hp@ p> jcL?1 0(`@Ho%4 t(@f t`a`(( @@(`@ `` ``Hp@ " t㿘> jcL 6 (` . .  @@(`@ 4> 8 l`ȅ( 8Ho4 (@f  t`    4 `(hd`?(Hp@ .㿐4`1>  `1>   8  А0&` &`> `&``>  ` p&`%&``  &`&`k&`(@`ab ? `2[> ?, `@``k@?(p`?(q``(a`?(b`?(c`(@`(hA`(B`(hC``` #\> !  > f?`  > g9c> gc`h?&`h`&`l> h``0?&`0W&`4 > iaP&`&%b&`| ?㿐> j scL`(0(` ,,%@(` `8  `$   Ho%4`((@f`( 4  b`< (hd` @?@`"2ab`2 (h ab  B `2>  B. ` @@?`"( ab  D `2l>  D.   ( ab  H `2T>  H.   (   (  (h   (  (  G(  @( (`(`" `$ (9 (:`$`"   (1 (2 ah  ``2>  .` %(@@(`@ `\Hp@      H  D w Bca㿘> j#L` ?00`M@> j$`G#L) $@A0 `<,,%@(`@`4 t` F$ pdϒ ' Ho%(@`$> % aH  !@  t`b'$ t " Hp@ t}$ t Hp@ l> 8(`@b+$ t c$ c $ $ `X``2c$ `X`` @@$ `X`% @$ % $ $ $ `@$`L$`HHo%4`<(@f`<`(hd`ab % ``2'> %@(`?@,``< (dP&O` P(X2 t\`  t`h$ tfc`_$ t ڂ% @ ( @ ( 㿘 0`I x "6 @ @#` ``,`(  8@`& 8( @( @#` R  @``( 0& 0 `  `(㿐 @'􀈠 `!o`   @   @`'` `>  %!h @㿘8  0 &`@Ȑ`@<@ (" > >  !_> !Z!V㿘> >ޒa`?㿘> jc ?6 . `4`H_$`8 ?$`0 2 ``$8$ 2`4 `0@&`$`0㿘> jc ?6 .  0` d d d 4| , <㿘 > j#`? 6 @(`#  N <`  Đ$ & 4& 0. <  㿘`>  # 㿘 4#> Ma H & @ ? @%& < 4a < ` `8$`4 @   @   @ `  @" `4 @@ ` <@Ԑ 0 1> |2#`P> Na> &!x> a> >a  > !  0 &`D  ܐ< &`H  ֐H &`L  АT &`P  ʐ` &`T  Đl &`X  x &`\   &``   &`d   &`h   &`l   &`p  &`ta4 " '> =a "48'?> ^b`D&`0&`4* @` `0`D(@`8 d &>  Р!D8  ' '> n ,x` ''㿘>  =f! O@  0 d`(> k,`,@`` > k,` ,@``@  㿘> k,` ,@``p ` ` `> k,`,@ ? 0`@`  ` ` ``"܁   `܀` `  ܐ ` > k,`,@ ? 0`@`  `2 `ܐ  ܐ  ܂  <؀2  @2  ?"  ؀` `""  > k,`,@  R` "`<> k`@"`8ؐ "` ؁ 㿘 ܆` > n؆`   ?c@?( *`n@ 㿘a bt" 0 0 `   ( ( 㿘> > bP> > b     0 (    0 ` (  ;  tV |`R x`7"  & t& x `"ؚ  0@"(@ 0  ͚  Ț `&   "P  |`   . & |  |`l t΂  | "  2  I       `& (`& |& x 3   t& & x& |@ (`& | 0(d  & & @?@ & x & |& T ȃ O բ  0. (E _㿘 x`  x`H` t`& t`  & x`$& `& & &  |` & x ` Hp@`$`;, Hp@h > k ,`> <@' R ,@ N  @" @@ @ Y> a@ a@@  -  p`# ..?& p".  .װ E;ϰ  0 ($ ǰ Ű   /̂ ''̐X`? . z /̂ 'ܒ'I(.ʔ 耠`.? .. 0(@ $  0 (@ $ (.e?.h > k ,`> <'   ,@  ?''/ > R h>``!> /Р#<'  >//ς  ''//ΐ > 0!> k,`,@ `(@ࡂ@@ (`(ࡔ@ *> qc?h>  pc<' @ ! `! !?/̂ //΄  '' t` a-"  g$  > ? t//͂  /'܀'0  g  a "ɐ! > k,`,@   @ p`@* @h> c<'  $ /̂ //''J̀` .  > . Ɏ!0> k,`,@   @ > rbh h> c<'  # /̂ //''̀` &  > & X!Hh > k ,`> <@' ? ,@ ;?c @ 76`//͂  /''ߒ$ d.6  0//̄  /ΐ''ΰ @ >  d@ " @ 6   !Xh!> #<'   /̂ ''(`@& p > !hh> c<@'   /̂ ''(`R J>    O> r    "* pf   @ `5 @>  p`8>  #X ` p @ `@ %> > cH> `> c>  # ϐ " y ǹ @ Ր"s!h!> #<'  C ϔ //-/΂  '' > R!㿘 > 5>  ו㿘> 8#p`?㿘4`1> Q x`1> #x8  V0& 0> ">>& t!H> 8`c   & t . c  ( > p 0 `> p`& 8 8?& < ) > sQa| p`A > j> cب> > bX> > `Ю @.@+ P94@ @@6```"6``2@  ` >  В  :   p`@  0 D(& xTޒ 0 # # # # #   #  # #@  > " @"*@"" " ?(0 (0> `a> c㿘> v& $& (c4& ,  㿘 , "& ( & ,& (& $㿘 > `0! H` p (@ " pHp@>0a$ p  h  h 4 aa"p 0 (@ @`" >  ,`~1> )c ,>hb! 0> u`(㿘> v"Ȱ `l> z( > "㿘 ,`4`@"0 !?  @u,@ 0 ?  0`  0  0@"  0h#0  ?"   d(`0``@=@  " `0 )0 0`1> .`6"@㿀> bx' h''''> u ̓ &&   ?(`0`h@?߂@@1  (0 `  0?   @s& 47 & 4 4  0#> MaӐ@,  4  > "a x?@ &`4> va&`0?`W`0> ~" > "> u&`p! y> k`x &`h/ - -  @ `p@``,& 0 &4 & &   -&,`@`` ` &@&0& &[ ` Ԭ<㿘> 6'"`?㿐H` | (`0``'` 0 (`0``'` 0 @, , ` @``t  2@Hp@    `#*`@` @ # # \#@ @ 㿘>  pbH` p "? (@,@& pHp@(( @`t ` 4`݂` 0 =$ 4@s 0ՃHp@  0ɒ `Ƅ 0'$ 4 @6 0㿘 $@ (H` a0Hp@㿘 d`ceZ"@d# 1в@C"@  @X"@ & d  &@N"@& d  &%Z㿐!,Җ( (``" @  +`@(`0@    8(8`@(a0 @@  (?0``@(8`݈@ 0""" ""  0 `#`*`@`4 @ # # \# #@ @  0# <# #  > `a> c㿐> 'b{@vb@> 'bȀ '  >  Ő㿘 , "& (<& ,& (& $㿘> x& $& (cJ& ,  㿘 > ` ! H` < (@ " 0a$ <㿘> x" `8> w( > ^"㿀 & $& (& ,& !&   > bx' 4''''> w | E&   (``0@  ( 0  @ ??c(`0@   `??c(`0@ ?`  c(` 0@  (`` (`0```&   `@&  ?(c08`(@㿘> ?c # > k`& <& 4> w#v $`L$`@ ,  `@ \?(c08`(܂@  @(  @@(`0`0  ($0> wb# ?@(`0``@(8``@@8`(`@0  ($0> wb#㿘   `(& 02"   8(8`~b80$"   8(8`yg0  (`y`  @@0@   @(W  ?c@1"  ?c !@(`0``" ` `?"   @(`  !@(`0``@(8`@`瀈` & I (`0` @Ӡ ; ? ?& &  @ A +`` 0@  &  ?(`0``@(8`@@ @`8(` ?@(`0``@(8`@`@`(`8|@`& & ?(c08`(@?`(@8`@㿘H`?> c0  - `,  (`6` (`0`@#,`` `5`+``0@  ")  ,  ` @` &`+` ` 0@ ̂Hp@ (0(`8Ȃ 逤(8`Ɉ@(0``@(8`ֈ@㿘H`?c  /-+`,`` (`B``(`0`,` ` `(`0@ (`   (2 2 $2 "2 !2 2 `` 2 Hp@`(0(`8 0# < # #@㿘0`&`4&`8&`0 &`4&`8&`&`&`X&`0&`&`@&``K4`1> s#` `̅, ,  @`8  " , ,  " , 0 6 / *@ `p&`p  > z&ab&a?`a> ~B"> z&`܂`&``ؖ?> 4#01> ~- 0 `&`&`\&`  1> "#㿘> 1#`? 0 D@@  2`  8(@@ 0 D@(@ 㿘` @  @`!X` `` (``@  㿘 `0`4  > aX`"7 ``"3  ` "/    P, L @ $ L8$ P   N M  L  L P " |   }$ P $ L㿘 `0(`4㿘!X  0$ " T`"  `"  R "  T@ X `E  ?G  2 T 6  ?8 㿘 (`D>  ``0`0 & `!X" 0``" D @* @`(!d2` 0 4`  H  ,0@4 !d` #!d& `!d`#!d `00`4Ð#㿘 ``> & (츐 㿐 (`>  d`` d ``/ `` aX"`0``" D" @* @`@ (H2``0`4@ ,     d`` d 04 H#\   D 2k   (aX@?@`  ` AC T`2}  (` `?(` q m  aX`" ```8  Oa N]  MY  LU  P L @ O  ``#:& `  `00`4  `0,`4e `,0@ & , @ & 0& @& D& H ``0`4| #㿘 `h` > > b0> aX  !@` `C$A`A> !P?c(`!R@#`2=> >  8!P(`2` > !R@> aX> 2` @!R?c@"> .>  X> ."0`2> > " > @ې h ג ѐ 0!P͐! ɐ! > @> Ð h> b> >  xaX !@ ` ` `> ꦐ 00꣒ `㿘> ꛐ &`0&`4 &ah&a`&al㿘!X  `"   $ "   2 㿘!X !>  `   ` $`"  "$ $ $[  2 㿈 0&!X`, 4@ $ 00@ 4@ V!T`2 > ka/!X"/ d $ ( T X2 !X 7 > }> {aԨ 8!P!R'77'Ĺ$ $ @ 2!P`?@4!X |۔  ?" `"" " "  " !\  !X&!\ > 깐 㿘`"!X`!X  ` $ " E  2   `"   $ "   2  㿘`-``?㿘 aX`\  T` 2 \\  @&  2 \a``"Z> `0`$`4 w ?y & T& X a`@2a``D> Hoe4 `0(@f `0a``$`4  0 4`  > |$!`& X& THp@`0`$`4Ho4& X(@f& X& THp@ !㿘 !Xd` T` 2 \\  @&  3@ !``n> Hoec(@$T$X$\ 0 4` > |$!`Hp@ a` ޒ   ג   ِ$!``=> Hoe4  0(@f  0!``$ 4  0 4` Ho4$T(@f$T$X$\Hp@ f l!(j!X****p*\*H*4* * ***** *************t*`*`**T `"!   @(`   @*@(`  0(  0@(`  0(  @` *@@㿘`"   ``!|`` "  ` ` &` ```ha " a  |  2 `h a `h a a$&`&`l&@ `ڐ `  2   <2  `@ `l  d ` $ `l `  `l  `}@, *$ `l  `  `l  `@g@, *$ `> a۔ \&`d ``l  d "! &`l z &`l@?"`l`&@ `l ``l `l `h`la$ `l`h` $`l `' $  `U `h` $`h `   $`  ?` `@ 6 `h (``h,@ $ 0%`# `h` ` * 4a `h`ِ `Ӡ * 4a` Ȓ``d` @ `?@I `@ \ z  [`d8 \%`X`l`X` `l `%@&`d` z  `@ 5  ` @   "#4@`"  `   ` } 2  ΀`` \&`d2 2) # @ `]@` %` `%` @ `` %`  d%` %`(%` %`$` @t `:@` ~?%``@%`@ ``%``a%` (@5`4` @P q@0 `@ ``%`80``0 2`8`h`0`8` "+% <Bp `@ `@ `ݒ@ `ג@ `, ,` , % < `h`0 ")% @  /  `@ `@ `@ `@ `, ,` , % @`")% D`؀`'`{ `@ `@ `@ `}@ `, ,` , % D`8@y  @ `c@` q %`b%`  `d%` `h%`  %`T `@E` 2 0v`=@ ` @` @ Ȧ@ *``  %``%` @ ``%` ``%`" ``%`  %`i `h`>0 xX &`l@?"`l`&@ `l ``l `l `h`la$ `l`h` $`l [`l `@ ``%` ` 0% m`  `@˦ %  N ) @2   `@ %  `% ` o ` ܀`0 `@ `@  * %  `@ `@ `@ `@ `, ,` * %  `u@ `@n  * %  `c@ `]@ `W@ `@P `, ,` * ~%  `@@ `@9  * 5`4`/@ `)@ `#@ *  `, M, `@ `@ ` @ *  `, , `@ `@ `@ *  `, K,  %`8 `@ `ܒ@ * * %`< `В@ `@ɠ  * * %`DU%`@ `@ F*  `@ *  `@ ܑ*  %`8 `@ `@  %`@* %`D* &%`< `@ `@ * *  `|@ `@u * *  `k@ `@d * * > 䤐!㿐> ' !֒ 8`" <J> <ʐ!> Ɛ"> >  c(X,`a@`" 1> ` 㴐` 1> 㭐 > PR"(㦒aX> > > c> 0> 㕐X`` (`> ㍐#P > ㈐c``> 5> `89> @7> }#`4z#` `2N``8`2f> `T`> lX``2> `2> `2> `2> `2> ` 2> `@2> `2> a2> b2> d2> h> E `X`"@<``> `"> > 2#`4/#` `"`8`> '#` `   `@` @ `8`"`T>   `8`  < @` D`@`8@ `T`>  HX```>  ```~`> ݐ p``z`> ֐ ``v`> ϐ ``r` > Ȑ `` n`@>  ``@j`> ⺐ ``fa> Ⳑ `abb> ⬐ `b^d> ⥐ `dZh> ➐ `hU> ☐!▐ `X`2T2Tb1> > `<⃐!> #`4> > u#8 > p#( > k# > f# > a" > \" > W" > R" > M" > H" > C#` > >" > 9"p 5,`@a@/``4~1> k'!` `2[> > !V> > !Q> 㽐 0 4'H'L$@ ȴ#\ ̐  $@ ̰ '' '''      *@c 'LH@ ̒`' @`2&#\a #\  .`$@̓2`'̀ `? '=  ' @`߬ #\    ȟ@Ą `'''   '  ̐` '̐` C2 ̐` I2 ̐` S2  @`'   @6 / @~(~, * ~, #\$@̂ 2`''   $@  #\$@̂  |' ' M̐` ?`'LH@ 2 `1'̒`-'̃(`> `D@ 8̀̐`̠`|̠ * `7s̢`n̠`iW/@c' (` `@@` '  O@ ' @> !̐'@ Ւ  ̐.` * @`'  `; ''̐`@  `? ̐` @̰`/ ̠`@̢`@ `, ,`*  @ `'B H  ``?ސ̬`ِ̠`Ԑ̢`ϐ `, ,`*  & > ??!0 @   @ > ?-!`(''''''''''''''''''''''''''6!T 8''? a a a a a & 80a `0a!X> a$a,?`0㿘> ?bX>  b  5> k!X a4`@W!P@2`!R`2`LJ2``\!X"&!X "  Xt7  2 Xt0  2&!X&!\ `Z d r}    d $ $  \  rp ` \$X X @$ $ !\  @&!\`@!P2`!@ "`#d` 2`!D "`#[` 2`n ,a@`  2 > > a#( ` > Y !X \ r$  `N \$ X X @$dD!X,@a@> >#(4> ̓, > l aЖ@ 2 `  @+```  +` @@ 㿘a @ 㿘`"  `  `@, `|@@  (` 㿘```"  0  `@6 # 0`"#)##& 0 ## >8  `& 0&/ 㿘"l ##` 0@4## 0 @4㿘# #` R%b 5 =   㿐&c ِ > 8`>  `"> |#ebRc` 04`   > cc&cX&c\`   Bc "c> V @c> P Xz(`0`Q8`  .c d  &c`>8c&`0J`O> .!p $#` hl> c>  2 ` 04`    >  #~ #v8 (`  > גbP    |c>  > > ޢ h$`  ` `  `@*2$$``` #$ #$p$,`  04@ " $,  > ݤ  ` 04##\  > $ܢ ($܇0@(`$, 0 @4$,` 0@4  s $,p`7 $,`  04@ - $,  `0`4 #\ #܆  ( $,` 0 @4$,` 0@4> 2 >  !+ $,㿘```"   `@"6 $0`"$,]$,$,&$0Ͱ $,$,  >є&$0] `F Ȑ $0`6 $,㿘$( W; "$,$$` 0@4$,$( 0 @4$,$ 0 @4㿘> b$?,<`" $ `" $ "  $ " $    $)"?@2"?2 @2 $ " $  u 2 $ @2ڰ $  㿐&d,`  > > a0X> d a @` " m X ">  ``" a X 2 > Z"?&d( `  `  04`  "dB Xd&d&c@&cD`&d=F >  &c   Td( "> #!d,` 0@4?&d(#d,   7d$ 2> d>   X> ?  b  V W`"9 @ "* `  `$ V W!"`@"y!`` `" !`"  ! "  "J  ݢ`$ 2ת ` 2Ҫ  `acD (@cD `Psd`>d, `>sd,!&d0J`pV d,d$` 0@4d,d(` 0@40iۉ!d,h  `@ `"  `Z v W `$"``2`> _!d, 2d,>b>&c>b&c&c>>c4&c&c> &d&c `p2d>>b&c&c>>`t4&c&c> / >`܄&c&c>>a&c&c>>a&cn&c@㿘Ho&4(@g`"> b`  2! 6c& `@(&Hp@㿘`3``  ``" d`  ` & # ` ͢`$  > `ؘ&   >  o@ `@6  ``& -㿘`-!  &`  04 @   00@4僐 㿘#  ` n&@w " > `#``0`4@  @ @ > N"h`@   p @ 2O> ``@@> ;"` @@@b&@! &@ @ &@ഄ&@ &@Ă @&@ @?΂`d0@@ @ ?@?̂`h0@ `>ǖܘڠ &@ :@J> `X> c> "> .9`    @  `0`4`@ ! `  @'@&@  04` `@ > ϐ" 㿘> aD$t "  ` 2  "   `"  # 怤 ?c "2 "2@  @  `  >فb 㿘 `   JL O   JF I d 㿘0!  &@4@" 8" &`4` 1> 8 $ &`1> N!Ȅ  &@>b&@ `?@ > ~?"> `|  &@> `&@ > גa &@  &@&`b㿘> !耠`? @ @  * *@     *@ 2@ @ 2@ : :    : * @   @   @㿘  &@ `" ` ` `` * *@     *@ 2@ @ 2@ 2     2 * @ 㿐  &@``?`  `㿘?c@6 6` )$ $ $@$`ܐ`2 * @4 , @@@- @5 @@4  @,  `㿘 IA 0)  @ $@ & &$@@@`    @ $@֤ Ӓ&` ` `88 `   @  ( 0@ @0  *`(@ 2P > lb`@B  ?    ?0674 4`6`77777777`<.`"$.`0`@, * 0`@* @,* 0` @ ?@* @* 4 @* @4 *  'ĠĄ ` ?`  @(`' (`ڂ@0+`'ȉ0c'Ԅȅ(`'Ȁ` ĒOȐJ+`0'`ć0(`'@?''c''̬ @(`4`ԃ(`0`, @Ԧ@!, ,0` ĦԠĀ  ж@i$$4@@4 #@ (4` @0`5Ā И @@00`? 5ڂ1К``''Ѐ  #ȀĒ   @*`ȃ(@0 @0 *`5@(`(@?(`(@Ӄ6Ȁ (`0` ' '"@ @b   @   @> cp 㿐  `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2* J " ?* /> lh=%/> ∬%/> lt @`E < @   7A2Y    @2 $ a$ 4@  , ,2 @$ $ +> 'a`-?8 -0-?8 - ?$ (` --00 @-a""  Ѐ2 @ , ?$ ( @-a"  Ѐ 2 @`  ,` @$ ( $  h %8+> 'a`+?P `-`0+-?P%/> lh@̀/> l%x/> ∬%/>=(D=(  ,%P %`8+> 'a`+?P `-`0+-?P%  ,% P %`8+> 'a`+?P `-`0+-?P%/> lx@̀'D'H'L'P'T'X@@@ @   (@  +` @ `(`3`@!`@ `v"   *3`"  "`0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"&  @   (@  +` @ `(`3`@!`@ `v"   *3`"  "`0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &" @   (@  +` @ `(`3`@!`@ `v"   *3`"  "`0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  @@ @   (@  +` @ `(`3`@!`@ `v"   *3`"  "`0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   & &  levelchannelphytargetlunslotoffsetconsolemuxvectdrivecontrollersocketfunctionirqpfpflogpfsyncpflowencnmeamstsendrunvndksymssystracebpfilterbridgecarpgifgreloopmpeppppppoepppxslsppptrunktunvethervlanbiohotplugwsmuxOpenBSD5.2GENERIC#87 @(#)OpenBSD 5.2 (GENERIC) #87: Mon Jul 30 17:43:44 MDT 2012 OpenBSD 5.2 (GENERIC) #87: Mon Jul 30 17:43:44 MDT 2012 deraadt@sparc.openbsd.org:/usr/src/sys/arch/sparc/compile/GENERIC Nonparticipating?????Config WaitWaiting for AL_PAWait LoginReadyLoss Of SyncRe-InitNVRAM 0x%08x%08x 0x%08x%08x exchg_cnt %d maxframelen %dNVRAM execthr %d loopid %d fwopt1 0x%x fwopt2 0x%x fwopt3 0x%xNVRAM Port WWN 0x%08x%08xNVRAM Node WWN 0x%08x%08xNVRAM 0x%08x%08x 0x%08x%08x maxalloc %d maxframelen %dexecthrottle %d fwoptions 0x%x hardloop %d tov %dxfwoptions 0x%x zfw options 0x%xinvalid NVRAM header (%x %x %x)invalid NVRAM checksuminvalid NVRAM header%x %x %xversion %d NVRAM not understoodUsing Node WWN 0x%08x%08xbad WWNN- using defaultUsing Port WWN 0x%08x%08xbad WWPN- using defaultDMA error for command on %d.%d.%dtransport error for %d.%d.%dbus reset destroyed command for %d.%d.%dcommand aborted for %d.%d.%dcommand timed out for %d.%d.%ddata overrun for command on %d.%d.%ddata reassembly error for target %dtarget %d sent ABTSmarkednot marked%d.%d.%d data underrun (%d) for command 0x%xunavailablelogoutport %s for target %dport changed for target %df/w resource unavailable for target %dcommand for target %d overlapped task managementUnknown Completion Status 0x%xUnknown Command 0x%xno parameters for 0x%xIN mbox %d = 0x%04xOUT mbox %d = 0x%04xopcode %xHOST INTERFACE ERRORTEST FAILEDCOMMAND ERRORCOMMAND PARAMETER ERRORLOOP ID ALREADY IN USEPORT ID ALREADY IN USEALL LOOP IDS IN USEREGISTERS BUSYerror 0x%xTIMEOUTMailbox Command '%s' failed (%s)skipping target %d bus %d updatebus %d set tgt %d flags 0x%x off 0x%x period 0x%xisp_plogi_old: portid 0x%06x already logged in as %uisp_plogi_old: handle %u in use for port id 0x%02xXXXXisp_plogi_old: error 0x%x in PLOGI to port 0x%06xisp_plogi_old: all IDs used for fabric loginisp_plogi_old: error 0x%x on port login of 0x%06x@0x%0xInitiator ID is %d on Channel %dInitial Settings bus%d tgt%d flags 0x%x off 0x%x per 0x%xfailed to set active negation state (%d,%d), (%d,%d)failed to set tag age limit (%d,%d)Enabled FW features (0x%x)Cannot setup DMA2100220023002312232224221240101601216012801080LVDDifferentialSingle-Endedunknown mode on bus %d (0x%x)Unknown Chip Type 0x%x10201020A10401040A1040B1040CDifferential ModeUltra Mode CapableDMA Failed to Stop on ResetFailed to come out of resetchip reset timed outreset didn't clearMBOX_BUSY never cleared on resetRegister Test Failed (0x%x 0x%x 0x%x 0x%x 0x%x)load 0x%x words of code at load address 0x%xF/W Risc Ram Load FailedF/W download failed at word %dskipping f/w downloadf/w didn't *really* startresidentloadedboard type %s rev 0x%x, %s firmware rev %d.%d.%dFirmware Attributes = 0x%x2K Logins SupportedLast F/W revision was %d.%d.%d%d max I/O command limit setSelection Timeout for %d.%d.%dcommand incomplete for %d.%d.%d, state 0x%xstates=>%s GOT_BUS%s GOT_TGT%s SENT_CDB%s XFRD_DATA%s GOT_STS%s GOT_SNS%s XFR_CMPLT%s status=>%s Disconnect%s Sync_xfr%s Parity%s Bus_Reset%s Device_Reset%s Aborted%s Timeout%s Negotiationtransport error for %d.%d.%d: %scommand overrun for command on %d.%d.%dstatus overrun for command on %d.%d.%dmsg not COMMAND COMPLETE after status %d.%d.%dNo MESSAGE OUT phase after selection on %d.%d.%dEXTENDED IDENTIFY failed %d.%d.%dINITIATOR DETECTED ERROR rejected by %d.%d.%dABORT OPERATION rejected by %d.%d.%dMESSAGE REJECT rejected by %d.%d.%dNOP rejected by %d.%d.%dMESSAGE PARITY ERROR rejected by %d.%d.%dBUS DEVICE RESET rejected by %d.%d.%dIDENTIFY rejected by %d.%d.%d%d.%d.%d had an unexpected bus freeInvalid IOCB entry type detectedinternal queues full for %d.%d.%d status 0x%xAuto Request Sense failed for %d.%d.%dWide Negotiation failed for %d.%d.%dSDTR Message failed for target %d.%d.%dBad LVD condition while talking to %d.%d.%dport busy for target %dCommand for fast post handle 0x%x not foundIgnored Continuation ResponseMarker Responseunstable type in response queueUnhandled Response Type 0x%xAsync Mbox 0x%xRequest Queue Transfer ErrorResponse Queue Transfer Errortimeout initiated SCSI bus reset of bus %ddevice reset on bus %dextended message underrunSCAM interruptstalled SCSI Bus after DATA OverrunSCSI Bus reset after DATA OverrunTransition to LVD modeTransition to Differential modeTransition to Single Ended modeTransition to Unknown Mode 0x%xFast Posting CTIO doneline %d: markportdbLIP destroyed %d active commandsPoint-to-Point -> Loop modeLoop -> Point-to-Point modePoint-to-Point -> Loop mode (BAD LIP)FATAL CONNECTION ERRORLooped Back in Point-to-Point modeUnknown connection mode (0x%x)LS_RJT sentQFULL sentUnknown Async Code 0x%xfast post completion of %umailbox cmd (0x%x) with no waitersinterrupt (ISR=%x SEMA=%x) when not readyisp_intr: hard optr=%x, soft optr %xResponse Queue Out Pointer Unstable (%x, %x)bogus intr- isr %x (%x) iptr %x optr %xResponse Queue EntryRequest Queue Entrycontinuation segmentinternal queues fullbad header flagbad request packetbad request handle %d (type 0x%x)cannot find handle 0x%x (type 0x%x)cannot find handle 0x%x (status 0x%x)%d.%d.%d FCP RESPONSE: 0x%xasked for %ld got raw resid %ld settled for %ldRequest Queue Entry bounced backBounced RequestUnhandled Response TypeAdapter not at RUNSTATEunsupported cdb length (%d, CDB[0]=0x%x)XS_TGT(xs)=%d- hdlidx value %dRequest Queue Overflowout of xflist pointersSTART cmd for %d.%d.%d cmd 0x%x datalen %ldFC scratch area busy (line %d)!IOCB responseCT Passthrough returned 0x%xRegister FC4 Type rejectedRegister FC4 Type acceptedRegister FC4 Type: 0x%xscanning fabric (GID_FT) via CTct IOCBCT HDR + payload after putCT responsescanning fabric (GID_FT) via SNSno loop topology to scanFC scan loop 0..%dgiving up on synchronizing the port databasebad pdb (%1d%1d%1d) @ handle 0x%x[%d] not probational/zombie (0x%x)Loop Port 0x%02x@0x%x Pending ValidLoop Port 0x%02x@0x%x changedout of portdb entriesLoop Port 0x%02x@0x%x is New EntryFC Link Test EntryFirmware State <%s->%s>usec%d: 0x%lx->0x%lx enano 0x%x%08xisp_fclink_test: not at FW_READY stateisp_fclink_test: register fc4 type failed4Gb link speed/s2Gb link speed/sFC Link Test CompleteIOCB LOGXIOCB LOGX responsestatus 0x%x on port login IOCBPLOGX failed- no linkPLOGX failed- no IOCB bufferPLOGX failed- no Exchange Control BlockPLOGX(0x%x) of Port 0x%06x failed: reason 0x%x (last LOGIN state 0x%x)PLOGX failed- no fabricPLOGX failed- f/w not readyPLOGX failed- not logged in (last LOGIN state 0x%x)PLOGX failed: LS_RJT = 0x%xPLOGX failed- no PCB allocatedPLOGX failed: invalid parameter at offset 0x%xportid 0x%x already logged in with N-port handle 0x%xN-port handle 0x%x already used for portid 0x%xPLOGX failed- no handle allocatedPLOGX failed- no FLOGI_ACCstatus %x from %xPLOGI 0x%06x failednew device 0x%06x@0x%x disappearednew device 0x%06x@0x%x changed (0x%06x@0x%0x)FC Scan FabricFC Scan Fabric Done (no fabric)Fabric Nameserver rejected GID_FT (Reason=0x%x Expl=0x%x)fabric too big for scratch area: increase ISP2100_SCRLENgot %d ports back from name serverremoving duplicate PortID 0x%x entry from listskipping null PortID at idx %dskip ourselves @ PortID 0x%06xChecking Fabric Port 0x%06xFabric Port 0x%06x considered deadchanged WWN after reloginFabric Port 0x%06x changedFabric Port 0x%06x Now Pending ValidPortID 0x%06x already at %d handle %d state %dport database too small to login PortID 0x%06x- increase MAX_FC_TARGFabric Port 0x%06x is New EntryPortID 0x%x 0x%08x%08x/0x%08x%08x %ld already at idx %d, state 0x%xZombie Fabric Port 0x%06x Now ChangedZombie Fabric Port 0x%06x Now Pending ValidFC Scan Fabric Doneisp_pdb_sync: bad loopstate %disp_pdb_sync: isp_scan_loop failedisp_pdb_sync: isp_scan_fabric failedSynchronizing PDBsportdb idx %d already validisp_scan_loop: state %d for idx %dUnknown Control Opcode 0x%xRESET BUS NOT IMPLEMENTEDdriver initiated bus reset of bus %dRESET DEV NOT IMPLEMENTEDTarget %d on Bus %d Reset Succeededcannot find handle for command to abortABORT CMD NOT IMPLEMENTEDbad frame length (%d) from NVRAM- using %dbad execution throttle of %d- using 16bad value %x in fwopt2 timer fieldSetting ICB Node 0x%08x%08x Port 0x%08x%08xSetting ICB Port 0x%08x%08xNo valid WWNs to useisp_fibre_init_2400: fwopt1 0x%x fwopt2 0x%x fwopt3 0x%xisp_fibre_init_2400: rqst %04x%04x%04x%04x rsp %04x%04x%04x%04xisp_fibre_init_2400INIT F/W from %04x%04x%04x%04xbad maximum allocation (%d)- using 16isp_fibre_init: fwopt 0x%x xfwopt 0x%x zfwopt 0x%xINIT F/W from %p (%08x%08x)isp_fibre_initisp_reinit cannot reset cardisp_reinit cannot restart cardNO-OPLOAD RAMEXEC FIRMWAREDUMP RAMWRITE RAM WORDREAD RAM WORDMAILBOX REG TESTVERIFY CHECKSUMABOUT FIRMWAREWRITE RAM WORD EXTENDEDREAD RAM WORD EXTENDEDCHECK FIRMWAREINIT REQUEST QUEUEINIT RESULT QUEUEEXECUTE IOCBWAKE UPSTOP FIRMWAREABORTABORT DEVICEABORT TARGETBUS RESETSTOP QUEUESTART QUEUESINGLE STEP QUEUEABORT QUEUEGET DEV QUEUE STATUSGET FIRMWARE STATUSGET LOOP IDGET RETRY COUNTGET FIRMWARE OPTIONSGET PORT QUEUE PARAMSSET RETRY COUNTSET FIRMWARE OPTIONSSET PORT QUEUE PARAMSLOOP PORT BYPASSLOOP PORT ENABLEGET RESOURCE COUNTREQUEST NON PARTICIPATING MODEGET PORT DATABASE ENHANCEDEXECUTE IOCB A64DRIVER HEARTBEATGET/SET DATA RATEINIT FIRMWAREINIT LIPGET FC-AL POSITION MAPGET PORT DATABASECLEAR ACATARGET RESETCLEAR TASK SETABORT TASK SETGET FW STATEGET PORT NAMEGET LINK STATUSINIT LIP RESETSEND SNSFABRIC LOGINSEND CHANGE REQUESTFABRIC LOGOUTINIT LIP LOGINLOGIN LOOP PORTGET PORT/NODE NAME LISTSET VENDOR IDINITIALIZE IP MAILBOXGet ID ListSEND LFALun RESETGET INIT SCSI IDGET SELECT TIMEOUTGET TAG AGE LIMITGET CLOCK RATEGET ACT NEG STATEGET ASYNC DATA SETUP TIMEGET PCI PARAMSGET TARGET PARAMSGET DEV QUEUE PARAMSGET RESET DELAY PARAMSSET INIT SCSI IDSET SELECT TIMEOUTSET TAG AGE LIMITSET CLOCK RATESET ACT NEG STATESET ASYNC DATA SETUP TIMESET PCI CONTROL PARAMSSET TARGET PARAMSSET DEV QUEUE PARAMSSET RESET DELAY PARAMSRETURN BIOS BLOCK ADDRWRITE FOUR RAM WORDSEXEC BIOS IOCBSET SYSTEM PARAMETERGET SYSTEM PARAMETERGET SCAM CONFIGURATIONSET SCAM CONFIGURATIONSET FIRMWARE FEATURESGET FIRMWARE FEATURESLOAD RAM A64DUMP RAM A64INITIALIZE REQUEST QUEUE A64INITIALIZE RESPONSE QUEUE A64ENABLE TARGET MODEGET TARGET MODE STATESET DATA OVERRUN RECOVERY MODEGET DATA OVERRUN RECOVERY MODESET HOST DATAGET NOST DATAPrivate LoopFL PortN-Port to N-PortF PortF Port (no FLOGI_ACC response)????isp_read_nvramisp_mboxcmdisp_parse_statusisp_intrisp_startisp_register_fc4_type_24xxisp_register_fc4_typeisp_gid_ft_ct_passthruisp_gid_ft_snsisp_getpdbisp_scan_loopisp_fclink_testisp_plogxisp_scan_fabricisp_fibre_init_2400isp_fibre_init%s CHAN %d FTHRSH %d IID %d RESETD %d RETRYC %d RETRYD %d ASD 0x%xNVRAM%s RAAN 0x%x DLAN 0x%x DDMAB 0x%x CDMAB 0x%x SELTIME %d MQD %d%s CHAN %d TGT %d FLAGS 0x%x 0x%x/0x%xGeneratedO/!OOOO?????OOOO?*H*P*`*p******P*p*****0*H*X*`*p*x********* *0*@*X*p********8*P*h********** *0*@*P*`*p**********H*P*`*p********0*H*X*`*p*x*********(*@*0*X*p********(*p*@*X*h********0*@*X*p********8*0*H*`***bad underrun for %d.%d (count %d, resid %d, status %s)HBA attempted queued transaction with disconnect not set for %d.%d.%dHBA attempted queued transaction to target routine %d on target %d bus %dHBA attempted queued cmd for %d.%d.%d when queueing disabledSCSI phase skipped for target %d.%d.%dNot RESPONSE in RESPONSE Queue (type 0x%x) @ idx %d (next %d) nlooked %d%d.%d.%d: FIN dl%d resid %d STS 0x%x SKEY %c XS_ERR=0x%xPortDB[%d] changed: current =(0x%x@0x%06x 0x%08x%08x 0x%08x%08x) database=(0x%x@0x%06x 0x%08x%08x 0x%08x%08x)HBA PortID 0x%06x N-Port Handle %d, Connection Topology '%s'HBA WWNN 0x%08x%08x HBA WWPN 0x%08x%08x*****bus %d is in %s ModeDownloaded RISC Code Checksum Failure%s: ispmbx_sleepInterruptingPolled%s Mailbox Command (0x%x) Timeout (%uus)target %d has departedtarget %d has arrived, 16 bit wide, Tagged Queueing Enabled, 16 bit wide, Tagged Queueing EnabledBus %d Target %d at %dMHz Max Offset %d%sBus %d Target %d Async Mode%sSCSI bus %d reset detectedLoop DOWNLoop UPout of target idsarrived atarrivedchanged atchangedstayed atstayedgone zombie atdepartedPort Database ChangedName Server Database ChangedOther Change NotifyInternal Firmware Error on bus %d @ RISC Address 0x%xfinished command on borrowed timerestarting blocked queuerestarted command for %d.%dblocked cmd again%s for %d.%dCMD_RQLATERrequeued %d commandswatchdog found done cmd (handle 0x%x)recursive watchdog (handle 0x%x)watchdog cleanup for handle 0x%xwatchdog timeout on handle %xpossible command timeout on handle %xwatchdog with no commandadded to blocked queueActive Hiwater Mark=%dblocking queueretrying later for %d.%disp(none)TargetTarget/Initiatorisp_wdog*p*x-z*PortID 0x%06x handle 0x%x role %s %s tgt %u WWNN 0x%08x%08x WWPN 0x%08x%08xPortID 0x%06x handle 0x%x role %s %s WWNN 0x%08x%08x WWPN 0x%08x%08x UNK TGT INITINI%3d---%d: hdl 0x%x %s al%d tgt %s %s 0x%06x =>%s 0x%06x; WWNN 0x%08x%08x WWPN 0x%08x%08x%s:%s %02x0x%08x:%s%s index %d=> isp_fc_runstate: linktest failedisp_fc_runstate: f/w not readyisp_fc_runstate: scan loop failsisp_fc_runstate: scan fabric failsisp_fc_runstate: pdb_sync failsisp_fc_runstate: f/w not ready againNIL PROBDEADCHGDNEW PVLDZOMBVLD isp_print_bytesisp_print_qentry***** *(*0*8[wrfifo(%d): %02xregs[intr=%02x,stat=%02x,step=%02x,stat2=%02x] %s: resetting SCSI bus [flushfifo] %s: unknown revision code, assuming ESP100 ncr53c9x_rdfifo: bad flagcont [rdfifo %s (%d):ncr53c9x_dequeue: lun %qx for ecb %p does not existncr53c9x_dequeue: slot %d for lun %qx has %p instead of ecb %p%s: reselect with invalid selid %02x; sending DEVICE RESET %s: reselect from target %d lun %d tag %x:%x with no nexus; sending ABORT ncr53c9x_sched_msgout %x %d [ncr53c9x_select(t%d,l%d,cmd:%x,tag%x,%x)] SELATNS [ncr53c9x_sched] ncr53c9x_sched: not IDLE (state=%d)ncr53c9x_sched: tag alloc failure%d:%d busy requesting sense [ncr53c9x_done(error:%x)] %s: QFULL -- throttling to %d commands resid=%lu sense=0x%02x error=%d [NCR_INIT(%d) %d] ncr53c9x_ecbDMA activetimed out [ecb %p (flags 0x%x, dleft %x, stat %x)], AGAIN sync negotiation disabled out of memory %s: unknown variant %d, devices not attached : %s, %dMHz [ncr53c9x_msgout(priq:%x, prevphase:%x)]%s at line %d: unexpected MESSAGE OUT phase %s at line %d: no nexus [ncr53c9x_msgin(curmsglen:%ld)] %s: msgin: no msg byte available %s: phase change, dropping message, prev %d, state %d gotmsg(%x) state %dcmdcomplete got %ld extra bytes msg reject (msgout=%x) %s: tagged queuing rejected: target %d (rejected sent tag)%s: sync transfer rejected: target %d %s: wide transfer rejected: target %d noop TAG %x:%xdisconnect save datapointer restore datapointer extended(%x) SDTR period %d, offset %d async mode max sync rate %d.%02dMB/s %s: wide mode %d unrecognized MESSAGE EXTENDED; sending REJECT ident unrecognized MESSAGE; sending REJECT %s: TAG reselect without IDENTIFY; MSG %x; sending DEVICE RESET %s: reselect without IDENTIFY; MSG %x; sending DEVICE RESET %s: unexpected MESSAGE IN; sending DEVICE RESET [ncr53c9x_intr: state %d] %s: SCSI bus reset %s: nexus in reset state%s: illegal command: 0x%x (state %d, phase %x, prevphase %x) %s: DMA error; resetting %s: !TC on MSG OUT [intr %x, stat %x, step %d] prevphase %x, resid %lx %s: !TC on DATA XFER [intr %x, stat %x, step %d] prevphase %x, resid %x %s: SCSI bus parity error sync nego not completed! %s: unexpected disconnect; sending REQUEST SENSE %s: waiting for SCSI Bus Reset to happen %s: target didn't identify <>%s: target didn't send tag: %d bytes in fifo [%d] backoff selector %s: RESELECT: %d bytes in FIFO! [intr %x, stat %x, step %d, prevphase %x] selid=%2x %s: identify failed, state %d, intr %02x ncr53c9x: no nexus%s: step 1 & !NEG %s: !MSGOUT (%s:%d:%d): selection failed; %d left in FIFO [intr %x, stat %x, step %d] (%s:%d:%d): select; %lu left in DMA buffer [intr %x, stat %x, step %d] %s: unexpected status after select: [intr %x, stat %x, step %x] %s: ICCS: : [intr %x, stat %x, step %x] %s: can't get status, only %d bytes %s: STATUS_PHASE: msg %d %s: invalid state: %d ncr53c9x no nexusMESSAGE_OUT_PHASE MESSAGE_IN_PHASE %s: MSGIN: unexpected FC bit: [intr %x, stat %x, step %x] %s: MSGIN: weird bits: [intr %x, stat %x, step %x] COMMAND_PHASE 0x%02x (%d) DATA_OUT_PHASE [%ld] DATA_IN_PHASE STATUS_PHASE %s: unexpected bus phase; resetting [ncr53c9x_poll] [ncr53c9x_poll: rescheduling] [ncr53c9x_scsi_cmd] [0x%x, %d]->%d espESP100ESP100AESP200NCR53C94NCR53C96ESP406FAS408FAS216AM53C974FAS366/HME %s: eeprom failed to come ready %s: erase pencil mark, or disable PnP mode! %s: media_status on unknown chipset 0x%x /(unknown/impossible media)/autoselect default %s%s (default %s) ep_get: packet does not fit in MCLBYTES address %s, wrote %x to TX_AVAIL_THRESH, read back %x. Interface disabled warning: unknown chipset, possibly 3c515? %s: device timeout epstart: no header mbufutpauireservedbnc100-TX100-FXmii100-T4*# *%** $*(& *0'@@*8&*@(#%$&'&(epgetwi_do_hostdecryptwi_do_hostencryptwi_attach** *8*X*p***** * *  *8 *8 *8*8*P*P*P*`*`*`*`*********P*P *P!*"*#*$*%*&*'*%s: %u (%d dBm) Unknown PRISM2 chip%s: Firmware %d.%02d variant %d, Symbol %s: %s%s (0x%04x), Firmware %d.%d.%d (primary), %d.%d.%d (station), %s: unsupported crypto algorithm %d %s: wi_do_hostdecrypt: iv mismatch: 0x%02x%02x%02x%02x vs. 0x%x %s: wi_start: dropping unassoc dst %s %s: host encrypt not implemented for 802.3 %s: wi_start: xmit failed %s: wi_scan_timeout: %d tries %s: invalid data path: %x %s: failed to allocate %d bytes on NIC %s: init failed %s: wi_mgmt_xmit: xmit failed %s: wi_cmd_io: busy bit won't clear %s: timeout in wi_cmd 0x%04x; event status 0x%04x %s: received packet of unknown type on port 7 %s: received packet on invalid port (wi_status=0x%x) %s: oversized mgmt packet received in hostap mode (wi_dat_len=%d, wi_status=0x%x) wihap: failed to copy header %s: oversized packet received (wi_dat_len=%d, wi_status=0x%x) %s: Error decrypting incoming packet. : unable to read station address address %sWaveLAN/IEEE nodeIBSSwlanwiiocwiscan%s: wi_cmd failed with %d %s: tx buffer allocation failed %s: mgmt. buffer allocation failed wiLucent WaveLAN/IEEESony WaveLAN/IEEELucent Embedded WaveLAN/IEEEPRISM2 HFA3841(EVB2)PRISM2 HWB3763 rev.BPRISM2 HWB3163 rev.APRISM2 HWB3163 rev.BPRISM2 HFA3842(EVB3)PRISM1 HWB1153PRISM2 HWB3163 SST-flashPRISM2 HWB3163(EVB2) SST-flashPRISM2 HFA3842(EVAL)PRISM2.5 ISL3873PRISM2.5 USBPRISM2.5 ISL3874A(Mini-PCI)PRISM2.5 ISL3874A(PCI-bridge)PRISM3 ISL37300PPRISM3 ISL37300P(PCI)PRISM3 (USB)Sending deauth to sta %s wihap_disassoc_req: unknown station: %s wihap_assoc_req: from station %s wihap_assoc_req: bad ssid: '%.*s' != '%.*s' wihap_assoc_req: rates mismatch. wihap_assoc_req: capinfo: not ESS: capinfo=0x%x wihap_assoc_req: WEP flag mismatch: capinfo=0x%x wihap_assoc_req: polling not supported: capinfo=0x%x wihap_assoc_req: already assoc'ed? wihap_assoc_req: returns status=0x%x Sending disassoc to sta %s wihap_auth_req: station %s short request wihap_auth_req: station %s algo=0x%x seq=0x%x wihap_auth_req: new station challenge: 0x%x 0x%x ... wihap_auth_req: algorithm unsupported: 0x%x wihap_auth_req: returns status=0x%x wihap_init: sc=%p whi=%p wihap_deauth_req: unknown station: %s wihap_shutdown: sc=%p whi=%p wihap_shutdown: free(sta=%p) wihap_data_input: no TODS src=%s, fctl=0x%x wihap_data_input: incorrect bss: %s wihap_data_input: dropping unassoc src %s wihap_ioctl: i shouldn't get other ioctls! wihap_mgmt_input: len=%d MGMT: assoc req: assoc resp: reassoc req: reassoc resp: probe req: probe resp: beacon: ann traf ind disassociation: auth: deauth: unknown (stype=0x%x) ftype=0x%x (ctl=0x%x) wihap_timeout: disassoc due to inactivity: %s wihap_timeout: deauth due to inactivity: %s wihap_assoc_reqwihap_ioctl 7n%s: overflow %s: receive buffer error %s: dropping chained buffer missing buffer, no_td = %d, last_td = %d %s: controller failed to initialize %s: transmit buffer error %s: underflow %s: excessive collisions, tdr %d %s: memory error %s: receiver disabled %s: transmitter disabled am7990_config: weird memory size %lu: address %s %s: %d receive buffers, %d transmit buffers ne2000_detectne2000_attach: where did the card go? : setup failed ne2000_write_mbuf: negative lenne2000_write_mbuf: data != lim%s: remote transmit DMA failed to complete  @ @ Xh%s: mii_write timeout %s: mii_read timeout %s: status=%b INTMETXEMPTYTXDONERXDONERXNOBUFRX_TAG_ERRPCSTXMACRXMACMACCONTROLMIFBERRgem: invalid Receive Descriptor ring size %d %s: cannot disable tx dma %s: cannot reset transmitter %s: cannot disable rx dma %s: cannot reset receiver %s: cannot reset device %s: can't load rx DMA map %d, error = %d gem_add_rxbuf %s: unable to allocate control data, error = %d %s: unable to map control data, error = %d %s: unable to create control data DMA map, error = %d %s: unable to load control data DMA map, error = %d %s: unable to create rx DMA map %d, error = %d %s: unable to create tx DMA map %d, error = %d , address %s gem%s: board self-diagnostics failed! %s: unsupported chip revision: %x %s: bios thinks we're in a 64 bit slot, but we aren't%s: unknown hwrev ti_jfree: can't find softc pointer!ti_jfree: asked to free buffer that we don't manage!ti_jfree: buffer already free!ti_jfree: buffer not in use!ti_iff%s: can't alloc rx buffers %s: can't map dma buffers (%d bytes) %s: can't create dma map %s: can't load dma map %s: no memory for jumbo buffer queue %s: can't create recv map %s: overwritten!!!%s: couldn't get mbufnot enough mbufs for rx ring%s: unknown link state code %d %s: invalid command %s: unknown command %s: bad config data %s: unknown event: %d tigon1%s: can't load firmware: unknown hardware rev tigon2%s: firmware revision mismatch; want %d.%d.%d, got %d.%d.%d %s: initialization failure %s: watchdog timeout -- resetting %s: failed to send write command, status: %x %s: failed to send address, status: %x %s: failed to send read command, status: %x %s: chip initialization failed %s: failed to read station address %s: jumbo buffer allocation failed titi_handle_events%s: probed fifo depth: %d bytes : unknown uart : ns8250, no fifo : ns16450, no fifo : ns16550, no working fifo : ns16550a, %d byte fifo : st16650, no working fifo : st16650, %d byte fifo : st16c654, 64 byte fifo : ti16750, 64 byte fifo comattach: bad fifo type%s: can't establish soft interruptcomprm%s: %d silo overflow%s, %d ibuf overflow%s comcomstart|QEB;632*+,%#"""-+2LCBCA;;=43422$1*{*+#+,B.#%$+$#""A"#"3J!2,b2q"4R#z5& *c  # 3   > L!|"3"B2'"R:31,#"bQB;32*,%#"!  C3@DA1U BA` Br!" micspkrhpmonitorsourcemuteinputsoutputsmulawslinearulinearalawvscsiccbdiagnostic ../../../../dev/vscsi.csc->sc_state == VSCSI_S_RUNNINGvscsiref%s: POLL && NOSLEEP for 0x%02x vscsipollvscsiiocvscsiinvalid data offset%s: %s: illegal block count for %s %s: %s: illegal cmdlen for %s %s: %s: %s: invalid chunk state%s: %s: invalid volume state transition %d -> %d unknown optional metadata type%s: unable to start background operation %02x%02x%02x%02x-%02x%02x-%02x%02x-%02x%02x-%02x%02x%02x%02x%02x%02x%s%sOPENBSDSR %s%03d%s: invalid optional metadata checksumunknown old optional metadata type %u %s: no in memory copy of metadata %s: could not allocate metadata scratch area %s: could not write metadata to %s ../../../../dev/softraid.clink->target < SR_MAX_LD && link->lun == 0sc->sc_dis[sd->sd_target] == sdsr_shutdownsr_down%s: roaming device %s -> %s %s: sr_wu_put got active wuvolume %s not found%s has unsupported sector size (%d)could not allocate memory for metadatacould not allocate memory for foreign metadata%s: sr_rw: failed to allocate vnode %s: I/O error %d on dev 0x%x at block %llu failed to get DUID for softraid volumeinsufficient boot storagefailed to write boot blockfailed to write boot loadercould not save metadata to %s%s: sr_meta_rw: invalid metadata pointer cannot clear foreign metadatanot enough memory for metadata buffercould not read native metadatanot part of the same volumenot all chunks are of the native metadata formatsrc_dev_mm == NODEV%s%d%cdiscipline does not support rebuildrebuild already in progressvolume not degradedno offline chunks available to rebuild%s: sr_rebuild_init: can't allocate vnode %s partition not of type RAID (%d)%s partition too small, at least %llu bytes required%s partition too large, wasting %llu bytes%s is already in userebuild of %s started on %s%s: no offline chunk found on %s! %s: %s volume degraded, will attempt to rebuild on hotspare %s sr_hotspare%s: pending I/O failed to complete on failed chunk %s, hotspare rebuild aborted... %s is already a hotsparesr_hotspare: cannot allocate vnodeHOTSPAREcould not save metadata for %sunsupported state request %dchunk not part of arrayinvalid foreign metadatanot valid softraid metadatainvalid metadata checksumcannot read metadata version %u on %s, expected version %u or earliersr_meta_native_bootprobe: cannot allocate vnodenot enough memory for fake disciplinesr_meta_native_bootprobe: cannot allocate vnode for partitionnative bootprobe could not read native metadatasr_meta_probe: cannot allocate vnodesrdiscould not create discipline workqcould not initialize disciplinechunk %s already in useinvalid metadata formatdisk %s is currently in use; cannot force createfailed to clear metadataone of the chunks has corrupt metadata; aborting assemblychunk sizes are not equal; up to %llu blocks wasted per chunkvolume level does not match metadata leveldisk %s already assembledtrying to bring up %s degraded%s was not shutdown properly%s is offline, will not be brought onlineno free target for %sscsi_probe_lun failedvolume %s is roaming, it used to be %s, updating metadata%s volume attached as %sunable to create sensor for %ssdwdfailed to allocate boot volume%s: failed to allocate device array %s: failed to allocate ondisk array %s: failed to allocate hotspare %s: found duplicate chunk %u for volume %u on device %s %s: not all chunks were provided; attempting to bring volume %d online sr_locksr_hs_lock%s: controller registration failed%s: save metadata failed %s: %s: %s: invalid chunk state transition %d -> %d %s: sr_startwu_callbacksr_sync%s: sr_scsi_cmd NULL discipline %s: %s device is being deleted, failing io %s: sr_scsi_cmd got active wu%s: bogus rebuild restart offset, starting from 0 %s: resuming rebuild on %s at %d%% %s: rebuild exhausted wu_r%s: rebuild exhausted wu_w%s: could not create read io %s: could not create write io sr_rebuild%s: could not save metadata to %s sr_yieldsoftraidsr_checksumsr_raid_inquirysr_map_rootsr_meta_opt_loadsr_meta_native_probesr_ioctl_installbootsr_meta_native_attachsr_rebuild_initsr_hotsparesr_meta_validatesr_meta_native_bootprobesr_meta_probesr_ioctl_createraidsr_boot_assemblysr_raid_read_capsr_rebuild_threadsr_check_io_collisionsr_raid_startwuRAID 0 requires two or more chunksRAID 0sr_raid0_rw%s: %s: too many ccbs queued %s: i/o error on block %lld target: %d b_error: %d %s: invalid target on wu: %p%s: wu: %p not on pending queue %s: sr_raid1_recreate_wucould not requeue ioinvalid volume stateRAID 1 requires two or more chunksRAID 1%s: retrying read on block %lld %s: sr_raid1_intr_cb%s: permanently fail write on block %lld sr_raid1_rw%s: is offline, can't read %s: sr_raid1_rw%.2x %c%s: %s: invalid volume state transition %d -> %dRAID 4RAID 5%s: %s: %s: invalid chunk state transition %d -> %dio error: disk %x sr_raidp_rw%s: can't get wu_rDisk %llx offline, regenerating buffer sr_crypto_rw2%s: sr_crypto_rw2%s: sr_crypto_finish_iocannot open key disk %s%s partition not of type RAID (%d) %s is not a key diskKEYDISKunable to allocate work unitsunable to allocate CCBsincorrect key or passphraseCRYPTO requires exactly one chunkCRYPTOsr_crypto_wu_get: out of wus../../../../dev/softraid_crypto.ccrd%s: i/o error on block %lld sr_crypto_intr: no wusr_crypto_read_key_disksr_crypto_create_key_disksr_crypto_calculate_check_hmac_sha1sr_crypto_decrypt_keysr_crypto_alloc_resourcessr_crypto_change_maskkeysr_crypto_ioctlsr_crypto_finish_ioold_state = %d, %d = %d, invalid new_stateRAID 6sr_raid6_rwDisk %llx offline, regenerating Dx+P Disk %llx & %llx offline, regenerating Dx+Dy +Q singleDisk %llx offline, regenerating Dx%s CONCAT requires two or more chunksCONCATsr_concat_rw/dev/ksyms: Symbol table not valid. ELFfailed to allocate memory for /dev/ksyms pf_change_appf_change_a6pf_change_icmppf_rtlabel_matchpf_calc_msspf_routablepf_get_wscalepf_modulate_sackpf_get_msspf_tcp_isspf_send_tcppf_src_connlimitpf_insert_src_nodepf_test_state_icmppf_testpf_route6pf_routepf_free_statepf_unlink_statepf_state_insertinvalid address type: %d FUW%u.%u.%u.%u:%u[%u]IPv4IPv6TCPUDPICMPICMPv6 in wire: (%d) stack: (%d) - [lo=%u high=%u win=%u modulator=%u wscale=%u %u:%u @%dOUTINpf: state key linking mismatch! dir=%s, if=%s, stored af=%u, a0: , a1: , proto=%u, found af=%u, a0: pf: IPv6 short opt typeIPv6 short optIPv6 long optIPv6 multiple jumboIPv6 bad jumbo plenIPv6 short jumboIPv6 short jumbolenIPv6 multiple fragmentIPv6 fragmented jumboIPv6 short fragmentIPv6 multiple rthdrIPv6 short rthdrIPv6 rthdr0IPv6 short exthdrIPv6 missing jumbopf_setup_pdesc called with illegal af %u../../../../net/pf.cstate->timeout != PFTM_UNLINKEDstate->timeout < PFTM_MAXpf_test_via: kif == NULL, @%d via %spf_step_into_anchor: stack overflow cur->timeout == PFTM_UNLINKEDpftmpf: pf_src_connlimit: blocking address , %u states killedpf: loose state match: fwdrev seq=%u (%u) ack=%u len=%u ackskew=%d pkts=%llu:%llu dir=%s,%s pf: BAD state: pf: State failure on: %c %c %c %c | %c %c s->key[idx] == NULLpf: %s key attach failed on %s: wire, existing: stackpf: state insert failed: id: %016llx creatorid: %08xpf: src_tree insert failed: pf: key search, if=%s: pdpd->srcpd->dstpf: state reuse pf: key setup: dropping packet with ip/ipv6 options in pf_test_rule()pf_normalize_tcp_stateful failed on first pktpf: icmp type %d in wrong direction (%d): ICMP error message too short (ip)ICMP error message too short (ip6)ICMP error message too short (tcp)pf: BAD ICMP %d:%d -> state: seq=%u pf: OK ICMP %d:%d ICMP error message too short (udp)ICMP error message too short (icmp)ICMP error message too short (icmp6)pf_test: kif == NULL, if_xname %snon-M_PKTHDR is passed to pf_testdropping IPv6 packet with ICMPv4 payloaddropping IPv4 packet with ICMPv6 payloaddropping packet with ip/ipv6 options in pf_test()pf_route6: invalid parameterspf_route6: m0->m_len < sizeof(struct ip6_hdr)pf_route6: pf_map_addr() failed.pf_route: invalid parameterspf_route: m0->m_len < sizeof(struct ip)pf_route: pf_map_addr() failed.pf_normalize_msspf_normalize_tcp_statefulpf_normalize_tcp_initpf_reassemble6pf_reassemblepf_normalize_tcp_stateful../../../../net/pf_norm.c!TAILQ_EMPTY(&frag->fr_queue)missing fragment at %d, next %d, total %d%d < %d?off == totalsrc->scrub || dst->scrubpf: %s: multiple TS??pf: src idled out of PAWS pf: dst idled out of PAWS Timestamp failed %c%c%c%c tsval: %u tsecr: %u +ticks: %u idle: %lus %lums src->tsval: %u tsecr: %u dst->tsval: %u tsecr: %u tsval0: %upf: did not receive expected RFC1323 timestamppf: broken RFC1323 stack did not timestamp data packet. Disabled PAWS security.src->scrub == NULLtrying to free > %d frentsexpiring %d(%p)pf_refragment6: short mbuf chainrefragment error %dpffrentpffragpfstscrbad fragment: len 0bad fragment: mff and len %dbad fragment: max packet %dreass frag %d @ %d-%dreass frag %#08x @ %d-%dprev != NULL || after != NULLnew frag overlappedfrag head overlap %dfrag tail overlap %dold frag overlappedflush overlapping fragmentsfrent != NULLpf_reassemble6: short mbuf chaindrop: too big: %dcomplete: %p(%d)bad fragment: IP_DF../pf_anchor_copyout: '%s' '%s'/*pf_anchor_remove: broken refcountpf_find_or_create_ruleset: RB_INSERT1 '%s' '%s' collides with '%s' '%s'pf_find_or_create_ruleset: RB_INSERT2 '%s' '%s' collides with '%s' '%s'pf_anchor_setup: .. beyond rootpf_anchor_setup: rulesetpf_setup_pfsync_matchingpf: startedpf: stoppedaltq: startedaltq: stoppedpfpurgepfpurge threadpfruleplpfsrctrplpfsnitemplpfstateplpfstatekeyplpfstateitemplpfruleitemplpfaltqplpfcnslkpfr_mark_addrs: IPv4 walktree failed.pfr_mark_addrs: IPv6 walktree failed.pfr_enqueue_addrs: IPv4 walktree failed.pfr_enqueue_addrs: IPv6 walktree failed.pfr_update_stats: assertion failed._pfpfr_get_astats: corruption detected (%d)pfr_get_addrs: corruption detected (%d)pfr_get_tables: corruption detected (%d).pfr_unroute_kentry: delete failed. pfr_detach_table: refcount = %d.pfr_clr_addrs: corruption detected (%d).pfr_insert_kentries: cannot route entry (code=%d).unknown pfrke_type %dpfr_states_decrease: states-- when states <= 0pfrktablepfrke_plainpfrke_routepfrke_costpfrkcounterspfr_get_tstats: corruption detected (%d).pfr_pool_getpfr_clr_tstatspfr_reset_feedbackpfr_unroute_kentrypfr_set_tflagspfr_del_tablespfr_attach_tablepfr_add_tablespfr_route_kentrypfr_lookup_addrpfr_kentry_byaddrpfr_commit_ktablepfr_ina_definepfr_clr_astatspfr_tst_addrspfr_set_addrspfr_del_addrspfr_add_addrspfr_walktreeFound "%s %s %s" instead of "%s %s %s" Couldn't find "%s %s %s" osfp no match against %xosfp matched %s %s %s %x==%xfingerprint 0x%x didn't match%adding osfp %s %s %s = %s%d:%d:%d:%s%d:0x%llx %d (TS=%s,M=%s%d,W=%s%d) %xpfosfpenpfosfpfingerprinted %s:%d %d:%d:%d:%d:%llx (%d) (TS=%s,M=%s%d,W=%s%d)pf_osfp_fingerprint_hdrpf_osfp_fingerprintpfi_kif_getpfi_update_statuspfi_dynaddr_setuppfi_address_add: address buffer full (%d/%d)pfi_address_add: no memory to grow buffer (%d/%d)pfi_table_update: cannot set %d new addresses into table %s: %dpfi_kif_unref: rules refcount <= 0pfi_kif_unref: state refcount <= 0pfi_kif_unref with unknown typepfi_kif_ref with unknown typepfi_dynaddr_updatepfiaddrplpfi_kif_get for pfi_all failedpfi_kif_get failedpfi_attach_ifnet: cannot allocate '%s' address hookself:network:broadcast:peer:0/%dpf: pf_unlink_state: unable to optain addresspf: pf_unlink_state: selected address . Failed to decrease count! decreased state count to %u pf: pf_map_addr: src tracking (%u) maps to pf: pf_map_addr: weighted RR failurepf: pf_map_addr: selected address . Failed to increase count! with state count %llu with weight %uinetinet6natrdrpf: af-to %s %s, pf_get_transaddr_af: no nat pool for source addresspf: af-to NAT proxy port allocation (%u-%u) failedpf: af-to %s %s done, prefixlen %d, pf: NAT proxy port allocation (%u-%u) failedpf_postprocess_addrpf_map_addrpf_get_sportpf_get_transaddr_afpf_get_transaddrpflog_packetpflog_bpfcopypflogattach: no mbufpflog_bpfcopy got no mbufno second mbufpflog%d../../../../net/if_pfsync.cst->sync_state != PFSYNC_S_NONEpfsync: cancelling bulk updatereceived bulk update startpfsync link state uppfsync bulk donepfsync initreceived valid bulk update endreceived invalid bulk update end: bad timestamppfsync_deferred: unable to find deferred statereceived bulk update requestst->sync_state == PFSYNC_S_NONEpfsync_delete_state: unexpected sync state %dpfsync_update_state_req: nonexistant instancepfsync_update_state_req: unexpected sync state %dpfsync_update_state: unexpected sync state %dpfsync bulk startrequesting bulk updatepfsync link state downpfsync_insert: PFSYNC_ACT_TDB_UPD: invalid valuepfsync_state_import: invalid creator id: %08xpfsync_state_import: unknown interface: %spfsync_input: PFSYNC5_ACT_INS: invalid valuepfsync%dpfsync destroypfsync bulk failfailed to receive bulk updatepfsync_input: PFSYNC_ACT_UPD_C: invalid valuepfsync_input: PFSYNC_ACT_UPD: invalid valuepfsync_clear_statespfsyncioctlpfsync_clear_statespfsync_delete_statepfsync_update_statepfsync_deferredpfsync_undeferpfsync_deferpfsync_insert_statepflow_pack_flow_ipfixexport_pflow_ifpflow%d%s: insufficient message buffers %s: %s bioioctlhotplugclosehotplugreadhotplug_device_detachhotplug_device_attachhtplevhotplug: event lost, queue full %s (%x) state=%d, session=0x%x output -> %s, len=%d pppoe_send_padi in state %d%s: failed to send PADI, error=%d pppoe%d%s: timeout %s: could not establish connection %s: failed to transmit PADI, error=%d %s: failed to send PADR, error=%d %s: disconnecting ../../../../net/if_pppoe.cm->m_flags & M_PKTHDRpppoe: packet too short: %d pppoe: could not get PPPoE header pppoe: unknown version/type packet: 0x%x pppoe: packet content does not fit: data available = %d, packet size = %u %s: parse error %s: tag 0x%x len 0x%x is too long pppoe: alien host unique tag, no session found %s: host unique tag found, but it belongs to a connection in state %d %s: wrong interface, not accepting host unique TAG ACCOOKIE ERRORTAG RELAYSID ERRORTAG MAX_PAYLOAD ERRORSERVICE NAME ERRORAC SYSTEM ERRORpppoe: received PADO but could not find request for it %s: received unexpected PADO %s: No valid PPP-Max-Payload tag received in PADO %s: session 0x%x connected %s: session 0x%x terminated, received PADT %s: unknown code (0x%04x) session = 0x%04x pppoe (data): dropping too short packet: %d bytes pppoe (data): could not get PPPoE header pppoe (data): unknown version/type packet: 0x%x GENERIC ERROR%s: %s: TAG HUNIQUE ERRORpppoe_outputpppoe_timeoutpppoeintrinit_machclkaltq_add: no cpu clockaltq assertion "%s" failed: file "%s", line %d altq assertionoldtbr_set: no cpu clock available! invalid weight value %d for red! use %d cbq_add_queue: no parent class! cbq_add_class: borrow class != parent altq: packet for %s does not have pkthdr rmc_root_overlimit_rmc_wrr_dequeue_next_rmc_prr_dequeue_nextrmc_init: root class not allocated altq_hfsc_dequeue:Not set. All breakpoints used. Already set. Too many breakpoints. No breakpoints set Count Address %5d the kernel did not panic Bad function Too many arguments Argument missing %-12sNo such command Ambiguous Bad modifier Count missing ddb> procscalloutpoolsmountsvnodesbufsnfsreqsnfsnodesbcstatsbreaksbufextentsmallocnfsreqnfsnodeobjectpagepanicpoolregistersuvmexpwatchessynccrashdumphaltrebootpoweroffmachineprintexaminesearchdeletebreakdwatchwatchstepcontinueuntilnexttraceshowboothelphangmandmesgdb_fncalldb_command.strtab[ %s symbol table has bad start address %p ] bad e_machine.symtab[ using %lu bytes of %s ELF symbol table ] bad magicsymtab unalignedsymtab corrupted[ %s ELF symbol table not valid: %s ] ELFAddress missing Value missing : %*lx%*ld%*lu%*lo\%03o= 0x%lx %-*s%-*lx%-*ld%-*lu%-*lodb_print_cmddb_examineSymbol not found Syntax error Divide by 0 Negative shift amount () Score: %lu/%lu 88888 9 7 6 97 5 9 423 9 2 9 1 0 9 9 \/|\/O|/-|^R Bad character in number Bad escape String too long Bad character Faulted in traceback, aborting... Starting stack trace... End of stack trace. -%#*lx-%*lx-%#*lo-%*lo-%#*lu-%*lu--db_more-- %-12s%s %s+%sdb_show_regs [%s:%d]invalid symbol table nameSifting table %s: Unable to find symbol table slot for %s.No slots left for %s symbol table%s%s %s bsd[ no symbol table formats found ] db_printsymAfter %d instructions Breakpoint at Stopped at RUN AT LEAST 'trace' AND 'ps' AND INCLUDE OUTPUT WHEN REPORTING THIS PANIC! DO NOT EVEN BOTHER REPORTING THIS WITHOUT INCLUDING THAT INFORMATION! Unknown variable No value radixmaxoffmaxwidthtabstopslogNo watchpoints set Address Size %8lx %lx All watchpoints used. Too many watchpoints. Unknown size %s = %s Nothing written. db_write_cmdau_get_muteau_get_gainau_get_portaudiogetinfoau_set_portau_set_gainau_set_mutewskbd_set_mixervolumeaudio_silence_copyoutau_portofaudioattachaudiosetinfoaud_qmiaudiooplaudioprint: unknown type %dmpu%s at %saudio_attach_mi: NULL audio: missing method audio: could not allocate play buffer audio: could not allocate record buffer selectauddetaudiodetach: %s didn't detach aud_draud_qwraud_wraud_qrdaud_hraud_rdaudpquiaudrquiaudio_open: 0 precision aud_qioinputdacmasterlinecdcnopen: recursive/etc/firmware/%sncr5380_done: state=idlencr5380_done: current=0ncr5380_done: dma free did notncr5380_done: sense asked for sense %s: target %d, bad status=%d ncr5380_done: bad state%s: SEND_IDENTIFY while not connected; sending NOOP %s: unexpected MESSAGE OUT; sending NOOP %s: weird MESSAGE OUT; sending NOOP ncr5380_reselect: current set%s: reselect, BSY stuck, bus=0x%x %s: selected as target, data=0x%x %s: bad reselect, data=0x%x %s: reselect, SEL stuck, bus=0x%x %s: reselect, phase=%d %s: reselect, not identify, msg=%d %s: phantom reselect: target=%d, LUN=%d %s: reselect, no REQ ncr5380_machine: state=idlencr5380_machine: no current cmdncr5380_machine: unexpected disconnect. %s: no REQ while aborting, reset %s: no REQ for next phase, abort %s: sense phase error %s: aborting, but phase=%s (reset) %s: data phase error %s: too much data padding ncr5380_status: none? %s: unrecognized MESSAGE EXTENDED; sending REJECT %s: unrecognized MESSAGE; sending REJECT ncr5380_machine: Unexpected phase 0x%x %s: parity error! %s: reset SCSI bus for TID=%d LUN=%d %s: %d extra bytes from %d:%d %s: Target %d LUN %d stuck busy, resetting... ncr5380_sched: not idlencr5380_sched: current set%s: reselected while polling (abort) %s: select found SCSI bus busy, resetting... %s: ptr but no data in/out flags? %s: polled request aborting %d/%d ncr5380_scsi_cmd: polled request, abort failedncr5380_scsi_cmd: poll didn't finishncr5380_cmd_timeout: no scsi_xfer %s: cmd timeout, targ=%d, lun=%d DATA_OUTDATA_INCOMMANDSTATUSUNSPEC1UNSPEC2MSG_OUTMSG_IN+#+#+#+#+#+#+#+$%s: device enable failed : failed to clear NIC buffer at offset %x - check configuration dp8390_start: no header mbufdp8390_xmit: desync, next_tx=%d inuse=%d cnt=%d new=%d%s: length does not match next packet pointer %s: len %04x nlen %04x start %02x first %02x curr %02x next %02x stop %02x %s: NIC memory corrupt - invalid packet length %d dp8390_init ##$  !"#$%&'()*+,-./02468:<>AEIMS[g****++++(((())))....////,,,,----""""#### !!!!&&&&''''$$$$%%%%::;;8899>>??<<==2233001166774455   jnbfzrJZ镗 "&*.26:>ACEGIKMOQSUWY[]_abcdefghijklmnoppqDqrDrsDstDtuDuvDvwDwxDxxy$ydyyz$zdzz{${d{{|$|d||||}}4}T}t}}}}~~4~T~t~~~~~~~~ ,<L\l|||||||||||||||||||||||||||||||||<<<<<<<<\܆\܅\܄\܃lL, ̂lL, ́tdTD4$ԀĀxph`XPH@80( jkhinolmbc`afgdeu@ut@tw@wv@vq@qp@ps@sr@r*."&:>26 UWQS]_Y[EGACMOIK~~~~~~~~~(~8~~~h~x~H~X(8hxHXzzz z`{{{ {`xxx x`yyy y`}P}p}}0}}}}|P|p||0||||@@@@@@@@XHxh8(؁ȁ聘XHxh8(؀Ȁ耘` ` ` ` Ђ0pPЃ0pP%s: %u: policy %d %s: %u: %p(%lu) %s: free %d %s: allocating %d -> %lu %s: new, ents %d %s: %d -> pid %d %s: %d: code %d -> policy %d %s: %p: pid %d -> pid %d systrmsg%s: Trying to detach from %d strprocplstrpolplsystrrd../../../../dev/systrace.cstrp->proc == psystrace: pid %u killed on syscall %d systrace_fork%s: attach to %u: %d systrace_msg_policyfreesystrace_msg_childsystrace_newpolicysystrace_detachsystrace_iosystrace_getcwdsystrace_policysystrace_answersystracef_ioctlvndioctl: null vpWARNING: no memory for vnode disks vnd%d%s: sloppy %s from proc %d (%s): blkno %lld bcount %ld vndioctlvndencryptextract_entropyarc4_initrandomread;n vAMaX ֣d° xcd9660_reclaim: pushing activecd9660_inactive: pushing active..RRIP without PX field? SPIEEE_1282IEEE_P1282RRIP_1991ARRIP with incorrect NM flags? RRIP with incorrect flags?isoinodefhtovp: lbn exceed volume space %d fhtovp: crosses block boundary %d fhtovp: bread error %d fhtovp: directory crosses block boundary %d[off=%d/len=%d] CD001%/@%/C%/Ecd9660_mountroot: can't setup bdevvp'scd9660root_device     x  x8 4 8tag VT_ISOFS, isofs vnode cd9660_strategy: specudf_disklabelspoof*UDF Virtual Partition*UDF Sparable Partition*UDF Metadata PartitionCannot read sector %d Invalid file entry! unodeUnrecognized file type (%d) found a vnode alias udftrpludfndpludfdsplCan't read sector %d of VDS Cannot read sector %d for Metadata File Entry Invalid Metadata File FE @ sector %d! (tag.id %d) FSD does not lie within the partition! Cannot read sector %d of FSD Couldn't find the fsd Invalid root file entry! udf_find_partmaps D  Ɯ ( h  Cannot deal with strategy4096 yet! Unknown strategy type %d SFile offset out of bounds (%d > %d) LFile offset out of bounds (%d > %d) Unsupported allocation descriptor %d warning: udf_readlblks returned error %d udf: invalid FID fragment udf: invalid FID tag VT_UDF, hash id %u udf_transname(): name too long udf_transname(): Unicode translation failed udf_allocv: failed to allocate new vnode hash entry is NULL, up->u_ino = %dInvalid FID tag (%d) uiomove returned %d udf_lookup: Invalid tag udf_readdir%s@%dOpenBSDcoredump: offset %lld != notestart %lldcoredump: offset %lld != secstart %lldcoredump: offset %lld != p_offset[%d] %lldexec: a VTEXT vnode has writecount != 0coredump_note_elf32coredump_notes_elf32coredump_elf32elf32_load_file#!exec_script_makecmds: epp already has a fdexec_script: copyinstr couldn't fail/dev/fd/%dexec_process_vmcmds: RELATIVE no basevmcmdset_extend: not necessary../../../../kern/exec_subr.cocnt > 0/dev/consolewarning: /dev/console does not exist warning: /dev/console error %d initexecinit: couldn't allocate argument spaceexec %s: error %d init: not found no initfork initcfpendcannot mount rootcannot find root vnodepagedaemonfork pagedaemonreaperfork reapercleanerfork cleanerfork updateaiodonedfork aiodonedscheduler/sbin/init/sbin/oinit/sbin/init.bakCopyright (c) 1982, 1986, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. Copyright (c) 1995-2012 OpenBSD. All rights reserved. http://www.OpenBSD.org Accounting resumed Accounting suspended acctacct_threadacct_processbqquiesbqqueuebqdestbufq_init: type %i unknownbufq init failbqinit < <@ < ;8 ;p ; kn_status & KN_QUEUED(kn->kn_status & KN_QUEUED) == 0kqreadreltimespeckqueueplknotepl r rexecve: argp == NULLexecve: no vmcmdssys_execve: falloc indx != i../../../../kern/kern_exit.cTAILQ_EMPTY(&pr->ps_threads)init died (signal %d, exit %d)thrdeathcpu_exit returnedwaitprocessppwaittforkunable to allocate kthread_qWARNING: thread `%s' (%d) exits with status %d ../../../../kern/kern_ktrace.cnewvp != NULLnewcred != NULLktrace write failed, errno %d, tracing stopped ktremulktrstartktrstructktrcswktrpsigktrnameiktrsysretktrsyscallktrgenio lock type %s: SHARED (count %d) lock type %s: EXCL (count %d) by pid %d with %d pendinglockmgr: process context requiredlockmgr: using decommissioned locklockmgr: non-release on draining lock: %dlockmgr: make up your mindlockmgr: not holding exclusive locklockmgr: locking against myselflockmgr: non-zero exclusive countlockmgr: pid %d, not exclusive lock holder %d unlockinglockmgr: release of unlocked lock!lockmgr: draining against myselflockmgr: unknown locktype request %dlkmlookupDDB symbols added: %ld bytes lkmopn%15s %5s %6s %7s %6s %9s %8s %8s TypeInUseMemUseHighUseLimitRequestsType LimKern Lim%15s %5ld %6ldK %7ldK %6ldK %9ld %8d %8d malloc - bogus type../../../../kern/kern_malloc.cflags & (M_WAITOK | M_NOWAIT)malloc(): allocation too large, type = %d, size = %lu malloc: allocation too large, type = %d, size = %lu malloc: out of space in kmem_map???%s %d of object %p size 0x%lx %s %s (invalid addr %p) Data modified on freelist: wordprevious type%s %d of object %p size 0x%lx %s %s (0x%x != 0x%x) malloc: wrong bucketmalloc: lost datafree: non-malloced addr %p type %sfree: unaligned addr %p, size %ld, type %s, mask %ldmultiply freed item %p free: duplicated freefree: multiple frees%d,%s,freedevbufdebugpcbroutetblfragtblifaddrsooptssysctlioctlopsiovNFS reqNFS mountnamecacheUFS quotaUFS mountshmVM mapsemdirhashACPIVM pmapfile descsubprocVFS clusterMFS nodeExport HostNFS srvsockNFS daemonip_moptionsin_multiether_multimrtISOFS mountISOFS nodeMSDOSFS mountMSDOSFS fatMSDOSFS nodettysexecmiscfs mountpfkey dataxform_datapagedepnewblkindirdepVM swapUVM amapUVM aobjUSBUSB deviceUSB HCmemdesccrypto dataIPsec credspacket tagsemuldataip6_optionsNDPtempNTFS mountNTFS nodeNTFS fnodeNTFS dirNTFS hashNTFS attrNTFS dataNTFS decompNTFS vrunkqueuebluetoothbwmeterUDF mountUDF file entryUDF file idBluetooth HIDAGP MemoryDRMsysctlklk??%s: lock held%s: lock not shared%s: lock not held%s: lock not held by this processrw_enter: %s locking against myselfrw_enter: %s downgrade of non-write lockrw_enter: %s downgrade, not holderrw_enter: unknown op 0x%x $$todo < 0; minphys brokentodo > MAXPHYS; minphys brokenphysiodone < 0; strategy brokendone > todo; strategy brokenmawnusage: show all procs [/a] [/n] [/w] /a == show process address info /n == show normal process info [default] /w == show process wait/emul info PID %-10s %18s %18s %18s STRUCT PROC *UAREA *VMSPACE/VM_MAP PID %5s %5s %5s S %10s %-12s %-16s PPIDPGRPUIDFLAGSWAIT PID %-16s %-8s %18s %s EMULWAIT-CHANNELWAIT-MSG%c%5d %-10.10s %18p %18p %18p %5d %5d %5d %d %#10x %-12.12s %-16s %-16s %-8s %18p %s PROC (%s) pid=%d stat=%s flags=%b CONTROLTINMEMSIGPAUSEPPWAITPROFILSELECTSINTR SUGID SYSTEM TIMEOUT TRACED WAITEDWEXITEXECPWEUPCISPWAITSSTEPSUGIDEXECSUSPSINGLENOZOMBIEINEXECSYSTRACECONTINUEDSINGLEEXITSINGLEUNWINDTHREADSUSPSIGSOFTDEPSTOPPEDCPUPEG pri=%u, usrpri=%u, nice=%d forw=%p, list=%p,%p process=%p user=%p, vmspace=%p estcpu=%u, cpticks=%d, pctcpu=%u.%u, swtime=%u user=%llu, sys=%llu, intr=%llu enterpgrp: setsid into non-empty pgrpenterpgrp: session leader attempted setpgrpenterpgrp: new pgrp and pid != pgidenterpgrp: mksession but not curprocchgproccnt: procs < 0procinit: mallocprocplprocessplzombieplucredplpgrpplsessionplpcredplidlesleepstopzombiedeadonproc+P*m+P+P+P+P +P(plimitplrlimit../../../../kern/kern_sched.c(self->ci_schedstate.spc_schedflags & SPCF_SHOULDHALT) == 0idle%dfork idlep->p_wchan == NULLp->p_stat == SRUNcpu_switchto returnedci == curcpu()curproc == spc->spc_idleprocsched_chooseprocremrunqueuesetrunqueuesched_idlestunrsensor_task_unregister: unexpected state %dsensordev../../../../kern/kern_sig.cpr->ps_single == ppausesingle_thread_mode = %dsuspendsigactionusersystempid %d (%s): %s write of %lu@%p at %lld failed: %d /var/crash/%s%s.corepostsigpostsig actionProcess (pid %d) got signal %d issignal psignal signal numbersigaplsigwaiterror != 0p->p_sigwait != 0coredump_tradcoredumphashinit: bad cntureadc: zero residureadc: non-positive iovcntuiomove: modeuiomove: proc%02hx%02hx%02hx%02hx%02hx%02hx%02hx%02hx%s:%s,sysctllksysctldlksysctl_diskinitkern_sysctlwakeup: p_stat is %dsleep_finish !SONPROCtsleep: no identtsleep: not SONPROCabstimespecthrsleepsleep_finishabstimevalnanosleepdenied attempt to set clock forward to %ld denied attempt to set clock back %ld seconds %9d %2d/%-4d %8x %s ticks now: %d ticks wheel arg func timeout_add: not initializedtimeout_add: to_ticks (%d) < 0boredunexpected %s wq state %dunable to create workq thread for "%s" wqdestroywqtaskssyswqsmashed stack in %s../../../../kern/sched_bsd.cp->p_stat != SONPROCp->p_cpu == curcpu()phzsetrunnablepreempt: cpu_preempt not yet implementedresetprioritysetrunnablemi_switchupdatepriconfig_activate_children: device %s failed %d failing resume cannot be handled resume %s config_pending_decr: config_pending == 0config_defer: can't defer config of a root deviceconfig_defer: deferred twiceconfig_defer: can't allocate defer structureautoconfconfig_detach: bad device fstateconfig_detach: forced detach of %s failed (%d)config_detach: %s attached at %s config_detach: detached device (%s) has children%s detached config_make_softcconfig_make_softc: allocation for device softc failed%s%dconfig_make_softc: device name too longexpandcreatconfig_make_softc: %sing dev arrayconfig_make_softc: duplicate %s>>> probing for %s* mapply: no match function for '%s' device>>> %s probe returned %d >>> %s probe won >>> no winning probe ../../../../kern/subr_autoconf.ccd->cd_devs != NULLdev->dv_unit < cd->cd_ndevscd->cd_devs[dev->dv_unit] == NULL%s at rootroot device %s not configured not configured unsupported config_detach/dev/%s%s%ccannot obtain vnode for 0x%x/0x%xcannot open disk, 0x%x/0x%x, error %dcannot read disk label, 0x%x/0x%x, error %droot filesystem has size 0filesystem type %d not known.. assuming ffs use one of: exit %s[a-p]disk_unbusy: %s: dk_busy < 0 ../../../../kern/subr_disk.cpart >= 0 && part < MAXPARTITIONSdisk_detach: disk_count < 0dklkdisk_attach: can't allocate storage for disklabelwrit%s%d%c: %s %sing fsbn %lld of %lld-%lld (%s%d bn %lld; cn %lld tn %lld sn %lld)dkopendisklabels not read: (default %sexitswap device (default %s%s)root device (%02hx%02hx%02hx%02hx%02hx%02hx%02hx%02hx) not foundroot device (%s) not foundnetbootroot on %s%ccan't figure root, hope your kernel is right (%02hx%02hx%02hx%02hx%02hx%02hx%02hx%02hx.%c) swap on %s%d%c dump on %s%d%cdisk_mapfindblkmajordk_mountrootdisk_attach_callbacksetroot%s: NULL extentextent `%s' (0x%lx - 0x%lx), flags=%b FLWANTEDWANTEDNOCOALESCEFIXED 0x%lx - 0x%lx extnt%s: extent `%s', start 0x%lx, size 0x%lx %s: extent `%s', region not within extent%s: overflow%s: start 0x%lx, end 0x%lx %s: region not found%s: extent `%s', size 0x%lx %s: bad size%s: EX_CONFLICTOK and EX_WAITSPACE are mutually exclusive%s: extent `%s' (0x%lx - 0x%lx) %s: region lies outside extent%s: can't allocate region descriptor %s: name == NULL%s: extent `%s', start 0x%lx, end 0x%lx %s: end < start%s: fixed extent, bad storagesize 0x%lx%s: storage provided for non-fixedextentpl%s: already registered%s: NULL result pointer%s: extent `%s', ex_start 0x%lx, ex_end 0x%lx %s: substart 0x%lx, subend 0x%lx %s: bad subregion%s: bad alignment%s: extent `%s', size 0x%lx, boundary 0x%lx %s: bad boundary%s: extent `%s' (0x%lx - 0x%lx), alignment 0x%lx %s: overflow after alignmentextent_print1extent_freeextent_alloc_subregionextent_alloc_regionextent_destroyextent_createextent_registerklog page %p, nmissing %d item %p, magic 0x%x POOL %s: size %u, align %u, ioff %u, roflags 0x%08x alloc %p minitems %u, minpages %u, maxpages %u, npages %u itemsperpage %u, nitems %u, nout %u, hardlimit %u nget %lu, nfail %lu, nput %lu npagealloc %lu, npagefree %lu, hiwat %u, nidle %lu empty page list: full page list: partial-page list: no current page curpage %p pool(%p:%s): page inconsistency: page %p; at page head addr %p (p %p) pool(%s): free list modified: page %p; item ordinal %d; addr %p (p %p); offset 0x%x=0x%x pool(%p:%s): page inconsistency: page %p; item ordinal %d; addr %p (p %p) pool(%p:%s): page inconsistency: page %p; %d on list, %d missing, %d items per page pool(%p:%s): page inconsistency: page %p; %d on list, %d missing, %d expected usage: show all pools [/a] %-10s%4s%9s%5s%9s%6s%6s%6s%6s%6s%6s%5s NameSizeFailReleasesPgreqPgrelNpageHiwatMinpgMaxpgIdle%-10s %18s %18s Allocator%-10s %18p %18p inf %*u %*lu %*d %*s %*lu ../../../../kern/subr_pool.c((((vaddr_t)pi) + ioff) & (align - 1)) == 0pool_put of NULLpool %s: putting with none out pool_do_putph->ph_page <= (caddr_t)vph->ph_page + ph->ph_pagesize > (caddr_t)vpool_do_put: %s: page header missingpr_rmpage: nidle inconsistentpr_rmpage: nitems inconsistentph->ph_nmissing == 0pool_destroy: pool busy: still out: %uLIST_EMPTY(&pp->pr_fullpages)LIST_EMPTY(&pp->pr_partpages)flags & (PR_WAITOK | PR_NOWAIT)pool_get: PR_ZERO when ctor setpool_do_get: %s: crossed hard limitpool_do_get: %s: curpage NULL, nitems %u pool_do_get: nitems inconsistentpool_do_get: %s: page emptypool_do_get: %s: items on itemlist, nitems %u pool_do_get(%s): free list modified: page %p; item addr %p; offset 0x%x=0x%xpool_do_get: nidle inconsistentpool_do_get: %s: nmissing inconsistentpool_init: pool item size (%lu) too largepool_init: too much uptimepp->pr_itemsperpage != 0phpooldb_show_all_poolspool_do_putdma%d0123456789abcdef%llo%llx(null)0123456789ABCDEFbug in kprintf: bad basepanic: splassert: %s: want %d have %d spl assertion failure in %skernel %sassertion "%s" failed: file "%s", line %d%s: table is full kprintflogpri*FOUND**UNKNOWN*0%o%3d free slot (for add) %3d %s count %d disable (pseudo device) Unknown devno (max is %d) %3d at root ??? %s flags 0x%x %s [] ? Unknown argument command args description [count] number of lines before moredev add a device8|10|16 base on large numbersdevno|dev change devices enter ddbattr val|devno|dev disable devicesattr val|devno|dev enable devicesdevno|dev find devices this message list configuration leave UKC[attr [val]] show attributes (or devices with an attribute)[mins [dst]] set timezone/dst toggle verbose booting don't know--- more --- Error unknown state already enabled %3d can't enable free slot %3d %s%3d can't disable free slot already Unknown routine /%c/ Value missing for attribute Unknown attribute change (y/n) ?out of memory. flags changed %3d can't change free slot %3d %s changed Unknown pseudo routine /%c/ %s ? Not same device type No more space for new devices. Device not complete number or * is missing No device of this type exists. Clone Device (DevNo, 'q' or '?')Insert before Device (DevNo, 'q' or '?')Unknown command, try help Argument expected Dev expected 8|10|16 expected DevNo or Dev expected Attr, DevNo or Dev expected timezone = %d, dst = %d disautoconf verbose %sabled Unknown command User Kernel Config UKC> Continuing... addchangeddbdisableenablefindlistquittimezoneverboseassertwaitok: non-zero mutex count: %dassertwaitokfdsetreltimevalpollpipeplpipelkpipeclpiperdExpected pipe buffer wraparound disappearedExpected wraparound badPipe buffer overflowpipewr../../../../kern/sys_process.c(p->p_flag & P_SYSTEM) == 0ptrace: impossibleSysV message longer than MSGMAXmsg NULLfreeing message queue with active referencesmsgwaitmsgqrmsysvmsgplsemexit - semid not allocatedsemexit - semnum out of rangesemwaitsemop - can't undo undossemaplsemuplshmplshmseg free count inconsistentttwrite@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ttyunblockttypendttnreadttyfree: tty_count < 0ttckoutqload: %d.%02d not a controlling terminal no foreground process group empty foreground process group runningrunnableiowait cmd: %s %d [%s] %ld.%02ldu %ld.%02lds %d%% %ldk ttyrub: would panic c = %d, val = %d ttrstrtptydevnameptcwriteptcread/dev/XtyXXpqrstuvwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZptmattach: Can't find pty slave in cdevswptarrlkGPSGPS simulatedGPS estimatedGPS autonomousGPS differentialGPS invalidGPS unknownGPRMCnmea%dLatitudeLongitudeMSTSmsts%dEndRunendrun%dputc: required clalloc b_to_q: required clalloc mbuf %p m_type: %hi m_flags: %b M_EXTM_PKTHDRM_EORM_CLUSTERM_PROTO1M_VLANTAGM_LOOPM_FILDROP M_BCAST M_MCAST M_CONF M_AUTH M_TUNNELM_AUTH_AHM_LINK0m_next: %p m_nextpkt: %p m_data: %p m_len: %u m_dat: %p m_pktdat: %p m_pkthdr.len: %i m_ptkhdr.rcvif: %p m_ptkhdr.rdomain: %u m_ptkhdr.tags: %p m_pkthdr.tagsset: %hx m_pkthdr.csum_flags: %hx m_pkthdr.ether_vtag: %hu m_pkthdr.pf.flags: %b GENERATEDFRAGCACHETRANSLATE_LOCALHOSTDIVERTEDDIVERTED_PACKETPF_TAG_REROUTEm_pkthdr.pf.hdr: %p m_pkthdr.pf.statekey: %p m_pkthdr.pf.qid: %u m_pkthdr.pf.tag: %hu m_pkthdr.pf.prio: %u m_pkthdr.pf.tag: %hu m_pkthdr.pf.routed: %hx m_ext.ext_buf: %p m_ext.ext_size: %u m_ext.ext_type: %x m_ext.ext_backend: %i m_ext.ext_ifp: %p m_ext.ext_free: %p m_ext.ext_arg: %p m_ext.ext_nextref: %p m_ext.ext_prevref: %p ../../../../kern/uipc_mbuf.cfrom->m_flags & M_PKTHDRm_zero: M_READONLYm_copydata: off %d < 0m_copydata: len %d < 0m_copydata: short mbuf chainm_copydata: null mbufunknown type of extension bufferm_clget: request for %u byte clusterm_copym0: off %d, len %dm_copym0: short mbuf chainm_copym0: m == NULL and not COPYALLm_copym0 overrunmbuf prepend length too bigmbinit: the largest cluster size != MAXMCLBYTESmbplmcl%dkm_apply: len %d < 0m_apply: off %d < 0m_apply: null mbuf in skipm_apply: null mbufm_defrag: no packet hdr or not a chainWARNING: mclpools limit reached; increase kern.maxclustersm == NULL in m_pulldown()unix../../../../kern/uipc_socket.cso->so_splicelen < so->so_splicemaxso->so_rcv.sb_mb == so->so_rcv.sb_lastrecordsockplreceive 1m == so->so_rcv.sb_mbreceive 1areceive 3so->so_rcv.sb_mb == msoaccept: !NOFDREFnetclssoclose: NOFDREFsomovesounsplicesoabortsofreesbcreatecontrol: message too large %d sbdropsbappendcontrolsoqinsque../../../../kern/uipc_socket2.c(sb->sb_flags & SB_LOCK) == 0sb->sb_cc == 0sb->sb_datacc == 0sb->sb_mb == NULLsb->sb_mbtail == NULLsb->sb_lastrecord == NULLsemi-panic: sbcompresssb->sb_mb == sb->sb_lastrecordnetlcknetiosbappendaddrsonewconnsockaddrnetconacceptnetcon2unp_disconnectunp_connect2unp_attachuipc 1uipc 2uipc 4piusrreqCurrent Buffer Cache status: numbufs %lld busymapped %lld, delwri %lld kvaslots %lld avail kva slots %lld bufpages %lld, dirtypages %lld pendingreads %lld, pendingwrites %lld bremfree: lost tail../../../../kern/vfs_bio.c!(bp->b_flags & B_ASYNC)biowaitTrying to undirty buffer on freelist!Trying to dirty buffer on freelist!bufplbp->b_bufsize > 0buf_put: releasing dirty bufferbuf_put: still on the free listbuf_put: still on the vnode listbuf_put: b_dep is not emptybiodone alreadyneedbufferbuf_get: dup lblk vp %p bp %pgetblkbp->b_lblkno == blkno + 1bp->b_vp == vpClean buffer on BQ_DIRTYbiodonebuf_undirtybuf_dirtybuf_putbremfree../../../../kern/vfs_biomem.cbp->b_data == NULLuobj != NULLpg != NULLpg->wire_count == 1(bp->b_flags & B_BUSY) == 0bp->b_data != NULLbuf_needvabufinit: can't reserve VM for bufferssize == round_page(size)bp->b_pobj == NULLbuf_page_offset > 0bp->b_flags & B_BUSY(bp->b_data != NULL) || (bp->b_flags & B_NOTMAPPED)buf_mapnchplcache_revlookup: found entry for .cache_revlookup: found entry for ..wtf? leak?cache_lookupcluster_wbuild: size %ld != filesize %ldvop_generic_revokevop_generic_revokeallnameilf_findoverlap: defaultlockfplrelookup: null namerelookup: lookup on dot-dotleaf should be emptyrelookup: symlink found.namei: bad cred/procnamei: nameiop contaminated with flagsnamei: flags contaminated with nameiopsflags %b vnodecovered %p syncer %p data %p RDONLYSYNCHRONOUSNOEXECNOSUIDNODEVASYNCEXRDONLY EXPORTED DEFEXPORTED EXPORTANON EXKERB LOCALQUOTAROOTFSvfsconf: ops %p name "%s" num %d ref %d flags 0x%x statvfs cache: bsize %x iosize %x blocks %llu free %llu avail %lld files %llu ffiles %llu favail %lld f_fsidx {0x%x, 0x%x} owner %u ctime 0x%x syncwrites %llu asyncwrites = %llu syncreads %llu asyncreads = %llu fstype "%s" mnton "%s" mntfrom "%s" locked vnodes: %p, %pall vnodes: %p, %p, vp %p lblkno 0x%llx blkno 0x%llx dev 0x%x proc %p error %d flags %b AGENEEDCOMMITASYNCBADBUSYCACHECALLDELWRI DONE EINTR ERROR INVAL NOCACHEPHYSRAWREADWANTEDWRITEINPROGXXX(FORMAT)DEFERREDSCANNEDDAEMONRELEASEDNOTMAPPED bufsize 0x%lx bcount 0x%lx resid 0x%lx sync 0x%x data %p saveaddr %p dep %p iodone %p dirty {off 0x%x end 0x%x} valid {off 0x%x end 0x%x} tag %s(%d) type %s(%d) mount %p typedata %p data %p usecount %d writecount %ld holdcnt %ld numoutput %d clean bufs: bp %p dirty bufs: vfs_register called with vfc_refcount > 0 bgetvp: not freevdrop: zero holdcntbrelvp: NULLvref used where vget requiredvref on a VNON vnodevinvalbufvinvalbuf: dirty bufsvinvalbuf: flush failedvwakeup: neg numoutputsoftdep %p, type %s, use %u, write %u, hold %u,|VROOT|VTEXT|VSYSTEM|VXLOCK|VXWANT|VBIOWAIT|VBIOONFREELIST|VBIOONSYNCLIST|VALIASED flags (%s) Use count is not zero!vnode already on free list: vnode already on free listvput: null vpvput: bad ref countvput: ref cntvput: bad writecountvput: v_writecount != 0vclean: deadlockvclean: cannot reclaimvclean: not cleanvgonemissing aliasvgonel: not cleanmissing bdevvrele: null vpvrele: bad ref countvrele: ref cntvrele: bad writecountvrele: v_writecount != 0vrele: cannot lockfree vnodefree vnode isn'tcleaned vnodecleaned vnode isn'tClean vnode has pending I/O'svfslockunmount of %s failed with error %d WARNING: some file systems would not unmount retrying syncing disks... giving up done kinfo: vp changed vflushbuf: not dirtyvflushbufvflushbuf: dirtyVNONVREGVDIRVBLKVCHRVLNKVSOCKVFIFOVBADNONUFSNFSMFSMSDOSFSPORTALPROCFSAFSISOFSADOSFSEXT2FSVFSNNPFSNTFSUDFvprintreassignbufbuf_replacevnodebrelvpbgetvpvwakeupvwaitforio+++++++++syncer vnode fsync failedmounted on: %s sched_sync: fsync failedsyncermount: lost mountunmount: dangling vnodesys_fhstatfssys_fhstatsys_fhopensys_getfhsys_mountvn_lockgetcwd: oops, forgot to null lvpgetcwd: oops, went back too farspec_badop calledspec_ioctltag VT_NON, dev %d, %d spec_close: not specialspec_read modespec_read procspec_read typespec_write modespec_write procspec_write typespec_fsync: not dirtyspec_fsyncspec_fsync: dirtychkvnlockdead_badop calleddead_write: lockdead_read: locktag VT_NON, dead vnode fifo_badop called, fifo with %ld readers and %ld writerstag VT_NONfifo_write modefifo_read modefiforfifowdos2unixtime(): month value out of range (%ld)   !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~!#$%&'()-0123456789@ABCDEFGHIJKLMNOPQRSTUVWXYZ^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{}~Ͼ󨷵ǎԐѥ噞᷵ǎԐѥ???????????????????????????????? !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?Ѫ?????????????????????????????յݯ????msdosfs_reclaim(): pushing activedetrunc(): can't truncate root directory, clust %ld, offset %ld msdosfs_inactive(): pushing activedeextend: file too largedenodedeget(): pcbmap returned %d fatentry(): function code doesn't specify get or set fatentry(): get function with no place to put result extendfile(): attempt to extend root directory extendfile: pcbmap. .. doscheckpath: source and target on different filesystemsdoscheckpath(): .. not a directory? msdosfs_lookupmsdosfs_sync: rofs modmsdosfs: reducing max cluster to %d from %d due to FAT size RRaArrAaU#D 4| 4$ 4msdosfs_createmsdosfs_mkdirmsdosfs_renamemsdosfs_readdirtag VT_MSDOSFS, startcluster %ld, dircluster %ld, diroffset %ld (LOCKED) dev %d, %d, %s msdosfs_strategy: specmsdosfs_create: no namemsdosfs_mkdir: no namemsdosfs_rename: no namemsdosfs_rename: lost to startdirmsdosfs_rename: lost from startdirrename: lost dir entrymsdosfs_rename: updating .. in root directory?msdosfs_write(): bad file typebpfattachbpf_mcopybpf: ifpromisc failedbpf_detachd: descriptor not in listbpfbpfwriteifpromiscifnewlladdrif_getgroupmembersif_getgroupifconfif_clone_listif_group_egress_buildif_downallifioctlif_upif_downif_start on %s ifa_update_broadaddr does not support dynamic lengthif_attach_common: mallocegresstoo many interfacesifaddritempl%s: trying to send packet on wrong domain. if %d vs. mbuf %d, AF %d %s: can't handle af%d  ;n C&vkkMGP&"/+Ka5 d1͆< 8O     d;n &0vAkkQMaXPq< D֣ad°Ԡ x0123456789abcdefopenedillegalinitialstartingclosedstoppedclosingstoppingreq-sentack-rcvdack-sentnetworkestablishterminateauthenticate%s: pap peer TO %s: ipcp_open(): no IP interface %s: phase %s %d.%d.%d.%dpapchaplcpipcpifidcompressionaddressaddressesproto-compaddr-compmruasync-mapauth-protoqual-protomagicchallengeresponsenakecho-replydiscard-reqconf-reqconf-ackconf-nakconf-rejterm-reqterm-ackcode-rejproto-rejecho-req\x%x-%02x%s: ipv6cp rej opts:%s: ipcp nak opts: [wantaddr %s] [agree] %s: ipcp rej opts: %s: lcp rej opts: [don't insist on auth for callout][access denied] %s: %s output <%s id=0x%x len=%d%s: ipcp parse opts: [invalid] [rej] send conf-rej %s: ipcp parse opt values: %s [ack] [addr requested] %s [not agreed] still need hisaddr send conf-nak send conf-ack %s: lcp parse opts: [invalid chap len] [not configured] %s: lcp parse opt values: 0x%lx [glitch] [empty] [non-empty] %lu [mine %s != his %s] [chap not MD5] max_failure (%d) exceeded, send conf-rej send conf-ack %s: cisco output: <0x%lx 0x%lx 0x%lx 0x%x 0x%x-0x%x> %s: pap tld %s: chap tld %s: %s %s->%s %s: %s close(%s) %s: %s open(%s) %s: ipv6cp_open(): no IPv6 interface %s: %s down(%s) %s: %s up(%s) %s: %s invalid packet length: %d bytes %s: %s input(%s): <%s id=0x%x len=%d%s: %s invalid conf-req length %d %s: %s tlu %s: %s id mismatch 0x%x != 0x%x %s: %s send terminate-ack %s: invalid proto-rej length unknown%s: %s: RXJ%c (%s) for proto 0x%x (%s/%s) %s: lcp echo req but lcp closed %s: invalid lcp echo request packet length: %d bytes %s: loopback %s: got lcp echo req, sending echo rep %s: lcp invalid echo reply packet length: %d bytes %s: lcp got echo rep %s: %s send code-rej for 0x%x %s: %s TO(%s) rst_counter = %d %s: pap invalid packet length: %d bytes %s: pap corrupted input <%s id=0x%x len=%d%s: pap input(%s) <%s id=0x%x len=%d name= passwd=Failed...Welcome!%s: pap success%s: pap failure%s: pap failure %s: pap corrupted input <0x%x id=0x%x len=%d%s: lcp nak opts: magic glitch %s: chap invalid packet length: %d bytes %s: chap corrupted challenge <%s id=0x%x len=%d%s: chap input <%s id=0x%x len=%d name= value-size=%d value=%s: chap success%s: chap failure%s: chap failure %s: chap corrupted response <%s id=0x%x len=%d%s: chap dropping response for old ID (got %d, expected %d) %s: chap response, his name != expected %s: chap input(%s) <%s id=0x%x len=%d name=%s: chap bad hash value length: %d bytes, should be %d %s: chap unknown input(%s) <0x%x id=0x%xh len=%d%s: ipv6cp nak opts: [suggestaddr %s] [random] [agree]%s: ipv6cp parse opts: [invalid] [rej]%s: ipv6cp parse opt values: %s [%s] send %s send %s suggest %s %s: workq_add_task failed, cannot clear addresses %s: workq_add_task failed, cannot set addresses %s: up %s: cisco invalid packet length: %d bytes %s: cisco input: %d bytes <0x%x 0x%x 0x%x 0x%x 0x%x-0x%x> %s: cisco unknown packet type: 0x%x %s: Up event(incoming call) %s: LCP keepalive timeout %s: pap TO(%s) rst_counter = %d reconfirmedtlu%s: chap %s, next re-challenge in %d seconds re-challenging suppressed %s: chap TO(%s) rst_counter = %d %s: no memory for transmit header %s: sppp_clear_ip_addrs: in_ifinit failed, error=%d %s: sppp_set_ip_addrs: in_ifinit failed, error=%d %s: Down event (carrier loss), taking interface down.%s: Down event (carrier loss) %s: input packet is too small, %d bytes %s: Failed to align packet! %s: PPP packet in Cisco mode %s: invalid input protocol %s: Cisco packet in PPP mode %s: invalid input packet %s: protocol queue overflow ipv6cpsppp_get_ip6_addrssppp_suggest_ip6_addrsppp_set_ip6_addrsppp_ipv6cp_scrsppp_ipcp_scrsppp_ipv6cp_opensppp_lcp_scrsppp_chap_inputsppp_ipv6cp_RCN_naksppp_ipv6cp_RCRsppp_clear_ip_addrssppp_set_ip_addrs++T+++!+Rg%#|4,;MX9!+'&%h#d4 $M@hL W+'&$#L3F(D #+! W0Vtl#+!!YhX(H9lo%dlooutput: no header mbuflo_altqstart: can't handle af%d loifmedia_match: multiple match for 0x%x/0x%x, selected instance %d ifmedia_add: can't malloc entryifmedia_set: no match for 0x%x/0x%x ifmedia_set failedslstartslinput%s: af%d not supported sl%d: can't allocate buffer if_ppp/ccp: not enough data in mbuf (%p+%x > %p+%x) %s: got %d bytes %s: decompress failed %d %s: VJ uncompress failed on type comp %s: VJ uncompress failed on type uncomp %s: input queue full mbuf packet without packet header!%s output: %s: comp_alloc failed %s: decomp_alloc failed %s: no compressor for [%x %x %x], %x pppdumpmpppioctlpppintr0123456789abcdefppp_requeuepppdealloccan't establish softnet handler%s input: %s: bad char %x %s: bad fcs %x %s: too short (%d) %s: no input mbufs! %s: garbage received: 0x%x (need 0xFF) %s: missing UI (0x3), got 0x%x %s: bad protocol %x %s: packet too big %s: too few input mbufs! pppdumpbpppwritepppasyncstart0123456789abcdefiiiiiiiiiiiiiiii#2F$We6tHZl~3"VG,ud>ɍ@ۮRdv!0g&vD4UJÎXn|1 wf.TE<ˬBُPftBSap '26L^׈hzRC q`(7&:DV`rcr@Q%"40N\թjxsbPA5$*8FTbp,ӥ>@+R:Nd_mv|ҭ$6 H;*Z^Ol}l~ .<ѵ)B8 Pof~Lt]&н49(J Xnn\M| ׅ(:JD[iVx `/r>֍ 2ZKLyh^ h?.zՕ*8kFzHTY-b<pԝ"0{jNXI\=,jxbsd_decomp%d: bad sequence # %d, expected %d bsd_decomp%d: bad CLEAR bsd_decomp%d: bad code 0x%x oldcode=0x%x max_ent=0x%x explen=%d seqno=%d bsd_decomp%d: ran out of mru bsd_decomp%d: peer should have cleared dictionary 1.2.3z_incomp%d: inflateIncomp returned %d (%s) z_decompress%d: bad seq # %d, expected %d z_decompress%d: inflate returned %d (%s) z_compress: deflate returned %d (%s) tunreadtunopentunstartbridge_rtfindbridge_ipsecbridge_brlconfbridge_ioctlbridge_broadcastbridge_input(): no HDRbstp still activenot implementednot a bstp memberbstp_notify_rtagevlan_ether_purgemultivlan_ether_resetmultivlan_ioctl%s: initialized with non-standard mtu %u (parent %s) svlanvlanattach: hashinit../../../../net/pipex.cmppe->old_session_keys != NULLpipex_sockaddr_compar_addr: unknown address familypipex_sockaddr_hash_key: unknown address familyPPPoEPPTPL2TPUnknownpipex: ppp=%d iface=%s protocol=%s id=%d pipex: (m0) != NULLntohs(l2tp->flagsver) & PIPEX_L2TP_FLAG_SEQUENCEhlen <= MHLENip packet discarded by ingress filter (src %s)rn != NULLPIPEX is ready.rn_inithead0() failed on pipex_init()m0->m_pkthdr.len >= hlen + ppphlen + 1(flags & PIPEX_L2TP_FLAG_TYPE) == 0Received bad data packet: out of sequence: seq=%u(%u-) ack=%u(%u-%u)m0->m_pkthdr.len >= PIPEX_IPGRE_HDRLENout of sequencereceived packet caused window overflow. seq=%u(%u-%u)may lost %d packets.ack for unknown sequenceReceived bad data packet: %s: seq=%u(%u-%u) ack=%u(%u-%u)m0->m_pkthdr.len >= (sizeof(struct ether_header) + sizeof(pppoe))session->protocol == PIPEX_PROTO_PPPOEReceived unexpected MPPE packet.(no ecrypt)Workaround the out-of-sequence PPP framing problem: %d => %d%d packets loss.pipex_session_logGetNewKeyFromSHAmppe_key_changepipex_l2tp_userland_lookup_session_ipv4pipex_l2tp_lookup_sessionpipex_pptp_userland_lookup_session_ipv4pipex_l2tp_userland_lookup_session_ipv6pipex_pptp_userland_lookup_session_ipv6pipex_ppp_outputpipex_lookup_by_ip_addressrn_init: radix functions require max_keylen be set rn_initrn_init 2Mask for route not entered rn_addmask: mask impossibly already in tree rn_delete: inconsistent normal annotation rn_delete: inconsistent dupedkey list rn_delete: inconsistent annotation %s %p at %p rn_delete: Orphaned Maskrn_delete: couldn't find our annotation rn_addroute: t->rn_p is NULLNon-unique normal route on dupedkey, mask not entered Non-unique normal route, mask not entered next == NULLraw_usrreqrt_timer_remove_all: rtq_count reached 0 rt_timer_add: rtq_count reached 0 rtflushclone: called with a non-cloning routertflushclone: no rnh_walktreeifafreertfreertfree 2rtfree: %p not freed (neg refs) rt_timer_init: already initializedrttmrplrtentplroute_init rtable_addrtrequest deletertrequest1 RTM_RESOLVE: wrong ifa (%p) was (%p) rt_timer_timer: rtq_count reached 0 rt_timer_queue_destroy: rtq_count reached 0 rtinit: wrong ifa (%p) was (%p) rtrequest1rtinitrtredirectsysctl_dumpentryroute_outputroute_outputsl_compress_tcpgre_send_keepalivegre_ioctl%s: port %s at index %d %s: capabilities 0x%08x %s: ioctl %lu failed on %s: %d %s: failed to remove multicast address on all ports %s: using proto %u trunk_hashmbuftrunk_ether_cmdmultitrunk_ether_purgemultitrunk_ioctltrunk_media_changetrunk_enqueue4 ../../../../net/trunklacp.clp->lp_timer[i] >= 0la->la_pending > 0la->la_refcnt > 0la->la_refcnt > la->la_nports!LACP_TIMER_ISARMED(lp, LACP_TIMER_WAIT_WHILE)la->la_refcnt == 0lsc->lsc_active_aggregator != lai == p->pm_count(lp->lp_state & LACP_STATE_DISTRIBUTING) != 0TAILQ_EMPTY(&lsc->lsc_aggregators)lsc->lsc_active_aggregator == NULLbest_la == NULL || best_la->la_nports > 0best_la == NULL || !TAILQ_EMPTY(&best_la->la_ports)!TAILQ_EMPTY(&la->la_ports)la->la_refcnt >= la->la_nports%s: unknown statelp->lp_mux_state == LACP_MUX_DETACHED || la != NULLla->la_pending > 0 || !LACP_TIMER_ISARMED(lp, LACP_TIMER_WAIT_WHILE)%s: ADDMULTI failed on %s lacp_port_create<„hlacp_set_muxlacp_sm_muxlacp_port_creatempe%d%s: trying to send packet on wrong domain. if %d vs. mbuf %d vether%dpppx_ifs modified while lock was heldpppx: unable to set addresses for %s, error=%d pppxifpppxreadpppxdevspppxifspppx_add_session la_rt=%p la_hold_head=%p, la_asked=0x%lx [NULL][, ifa_addr= ifa_dsta= ifa_mask= flags=0x%x, refcnt=%d, metric=%d rtentry=%p flags=0x%x refcnt=%d use=%llu expire=%u rtableid %u key= mask= gw= ifp=%p (NULL) ifa=%p genmask= gwroute=%p llinfo=%p Route tree for AF_INET (not initialized) revarparptfreearp: ether address is broadcast for IP address %s! duplicate IP address %s sent from ethernet address %s arp: attempt to overwrite permanent entry for %s by %s on %s arp: attempt to overwrite entry for %s on %s by %s on %s arp info overwritten for %s by %s on %s arp: attempt to add entry for %s on %s by %s on %s arpintrarpresolve: %s: route without link local address arpresolve: %s: can't allocate llinfo arpresolve: unresolved and rt_expire == 0 arp_rtrequest: bad gateway value arp_rtrequest: malloc failed revarprequestarprequestin_arpinputin_delmultiin_addmultiin_ifinitin_controlin_lifaddr_ioctlin_ifinitin_controlinvalid argument to in_lifaddr_ioctlin6_pcblookup_listen: laddr= lport=%d in6_pcbhashlookup: faddr= fport=%d laddr= lport=%d in_pcblookup_listen: laddr=%08x lport=%d in_pcbhashlookup: faddr=%08x fport=%d laddr=%08x lport=%d rdom=%d IPv6 pcb passed into in_pcbconnectinpcbplin_pcbinit: hashinit failedin_pcbinit: hashinit failed for lportin_pcbnotifyallin_pcbdetachinternetdivert_packetdivert_usrreqicmp_do_exthdr: m_getptr failureicmp_redirect_timeout: bad route to timeouticmp_mtudisc_timeout: bad route to timeouticmp_erroricmp lenicmp_mtudisc_timeouticmp_reflect}E#(Dip_savecontrolin_iawithaddrin_ouraddroKgpqrstuvwxyzsave_rte: olen %d ip_srcroute: nhops %d mlen %d hops %x %xforward: src %x dst %x ttl %x redirect (%d) to %x ipqeplipqplip_initaeshmac-sha1deflateipintr no HDRphyint_send on vif %ld err %d unschedule_bw_meter: bw_meter entry not foundbw_upcalls_send: cannot allocate mbuf bw_upcalls_send: ip_mrouter socket queue full wrong if: ifp %p vifi %d vififp %p ip_mforward: ip_mrouter socket queue full ip_mrouter_done ip_mrouter_init: so_type = %d, pr_protocol = %d ip_mrouter_init rmtaddrmaskadd_vif #%d, lcladdr %x, %s %x, thresh %x del_vif %d, numvifs %d add_mfc update o %x g %x p %x add_mfc %s o %x g %x p %x dbx %p multiple kernel entriesadd_mfc o %x g %x p %x dbg %p add_mfc no upcall o %x g %x p %x del_mfc origin %x mcastgrp %x expire_upcalls: expiring (%x %x) ip_mforward: src %x, dst %x, ifp %p ip_mforward: received source-routed packet from %x ip_mforward: no rte s %x g %x bw_upcalls_sendreset_vifip_mrouter_setip_setmoptionsip_outputmalformed IPv4 option passed to ip_optcopyip_output: IPv6 pcb is passedip_output no HDRip_output: tag of length %d (should be %drip_attachrip_detachrip_usrreqsyn_cache_respondtcp_dooptionstcp_inputtcp_pulloutofbandtcp_sack_optionsynplsyn_cache_insert: bucketoverflow: impossiblesyn_cache_insert: cacheoverflow: impossibleinvalid sc_tp in syn_cache_cleanupm_pulldown malfunctiontcp_input: TCPS_LISTENtcp_output REXMTtcp_output: options too longtcphdr too bigtcp_outputtcp_output: template len != hdrlen - optlentcp_outputtcp_signaturetcp_set_iss_tsmtcp6_mtudisc_callbacktcp_ctlinputtcp_respondtcp_respondtcp_respondtcpcbpltcpqeplsackhlpltcp_inittcp_timer_rexmtx$Όttcp_identtcp_usrrequdp6_ctlinputudp_inputIPv6 inpcb to udp_outputudp_usrreqipsp_reffree: illegal reference count %d for object %p (len = %d, malloctype = %d) (unknown address family)no tdb hash table tdb cnt bucket cnt +%d%s %d IPv4 Simple EncapsulationIPsec AHIPsec ESPIPcompTCP MD5 Signature Option, RFC 2385gettdbbysrcdstipsec policyipsec acquireipsp_spd_inpipsp_spd_lookupipe4_input(): should never be called ipip_input: should never reach hereetherip_output: no space for align fixupetherip_getgifudpencap_ctlinputipsec_common_ctlinputipsec_common_input_cbipsec_common_inputipcomp6_input: l went zero or negativeesp6_input: l went zero or negativeah6_input: l went zero or negativeesp_input_cbesp_initah_input_cbah_massage_headersah_initcarp_ether_purgemulticarp_join_multicast6carp_setroutecarp_vhids_ioctlcarp_hmac_generatecarp_send_adcarp_hmac_verifycarp_hmac_prepare_ctxcarp_ioctl+P+X+`carp: carp_update_lsmask: %xstate transition (vhid %d): %s -> %sstate transition: %s -> %sip_output failed: %d> snderrors< snderrorsip6_output failed: %d> snd6errors< snd6errors%s: master_down event in INIT state %s demoted group %s by %d to %d (%s)carpdevdetachinvalid version %d != %dincorrect hashreplay or network loop detectedpacket received on non-carp interface: %sreceived ttl %d != %d on %spacket size %u too smallchecksum failed, on %spacket too short %d on %schecksum failed on %sINITBACKUPMASTERipcomp_initQP~AeS:'^;kEXK 0UvmvL%O*&5DbޱZI%gE]/uLFk_mzRYԾ-Xt!Ii)Du‰jyxX>k'qݾO f}:cJ1Q3`bSEdwk+pHhXElR{s#rKWfU*(/{70(#j\+yNie4bĦ4.SU2u 9@`^qnQ>!=>MFTq]o`P$ֽ闉@CgٞwB[8yۡ| G|B 2+HplZrN8V=6-9' dh\![T$6.: gWOa ZwKi⓺ *<"C ǭ-WuLݻ`&\rDf;[~4C)v#ܶhc1Bc"@ J$}һ=2)m/Kܲ0 Rw+lpHGd"Ġ?V},"3IN8ʢ 6ϥz(ڷ&?,:Px j_̛T~Fbظ.9^ï]iГ|o-%Ȭ;}cn;{&x nY욷One~!Jo6 )|1*?#1ƥ05ftN7ʦа3JAP/vM֍CM̪MTߞѵLj,FeQ^5]ts A.gZRV3mGa7 zY<Ω'a5zG8$4,£@_r% ('qOf }:cJ1`Q3EbSdwk+XpHhElR{#srKW*fU(/š{70(#j\+yNie4bĦ4.SU2u9 @`^qQn>!=>FM潵Tq]o`P$ֽ̉@CwgٞB8[yG| |B H2+pNlZrV8='6-9d !h\ћ[T:$6. gWҴOŢa iZwK ⓺*C<"  ǹ-WLu`&\rDf;4[~vC)#hc1Bc@" }J$һ=2m)K/ܲ0 Rwl+pH"GdĨ?V},"3LJIN8ʢ6 Ϧ(z&ڷ?,: Pxj_bT~Fظ^.9ï]|iГo-%;Ȭ}nc{; &xnY욷Oen~!ٺJo6 )|11*?#0ƥ5f7tNʰ3JAP/vMMCT̪MѵLj,FeQ^]5st. AZgR3VmGaz7 Y<Ω'5ah,8$4_£@r %(kXq'Of :}Jc13`QEbSwdk+hXpHElR{#srKW*fU(/{70(#j\+ϴyNieھb4ĦS4.U2u9 @`^qQn>!=>FM捵T]qo`P$ֽC̉@wgB苈[8y G||B H2+prNlZ8V=9'6-d !h\Tћ[.:$6g WҴO aKiZw *C<"  ǭ򋨹-WLuݻ`&\r;Df~4[)vC#hc1Bc"@ $}J=һ2m)/K0ܲR wl+pHd"GĨ?,V}"3NLJI8 6ԁϦ(z&ڷ?,: Px̛j_FbT~^.9À]|i-o%;Ȭ}cn蜻{;x &nY욚One~!ٺ6Jo |)1#1*?0ƥf57tNʦа3JAP/֍vMMCMT̪䖵шLj,QFe^5]tsA. ZgRV3Gma z7Y<'Ω5ah4,8$@_£r% I(kq'O f:}Jc1Q3`SEbdwk+HhXpEl{Rs#KrWU*f(/{7(0#j\+yiNe4bѦ.S4U2u9 `@q^nQ!>=>FMT]qoP`$@C̉ٞwgB[8y| GB| +H2pZrNl8V=-9'6d \!h[Tћ6.:$ g WҴO awKiZ *"C< ǭ򶨹-WuLݻ`&r\f;D~4[C)v#hc1cB"@ J$}=2)mǞ/K0܆R wl+pHd"GĨ?},V3"INLJ8ʢ 6Ϧz(&ڭ?:,x P_̛j~FbTظ9^.ï]Г|i-o%Ϭ;}cn;{&x YnOne~!ٺo6J |)1?#1*0Ƣf5N7tʦа3JAP/M֍vMCMT̖ѵjL,eQF^5]ts A.gZRV3Gma z7Y<'a5G$4,8@_r% >>>KKKKyyyy xxxxZZZZݨ33331111YYYY''''____````QQQQJJJJ ----zzzzɜ;;;;MMMM****뻻<<<^//qSSh,@ `yȶ[[jjFgr99KJJޘLL԰XXJk*OCCŚMMf33UEEPPx<!KKa pp|>>BqffHHaaj55_WWiX:''8+"3iip3-<" IUUP((xzY  e1BBhhAA)Z--w{˨TTm,:cc||ww{{ kkooTP`00gg}V++bMvvEʝ@ɇ}}YYɎGG Ag_E#Srr[u=jL&&Zl66A~??O\h44Q4qqsSb11?* ReF##^(07 / 6$=&iN''uu tX,,.4-6nnZZ[RRMv;;a}{R))>q^//SSh,`@ y[[jjFgKr99ޔJJԘLLXXJk*OņCCךMMUf33ϊEEPPDx<<%KQQ]@@?!Hp88cwucB!!0 mL 5&/__5̈DD9.WU~~Gz==dd]]+2ss``ўOOfD""~T**; ʌFF)k<(y^^ v;Vd22Nt:: ےII lH$$\\]nCbb917yy2CYn77mmdҜNNIllVV%eezzGoxxoJ%%r\..$8WsQ#|ݜtt!>ݖKKa ppB|>>qffؐHHaa_j55WWiX':'8+3"iipى3-"< IUUxP((zߏY  e1ƄBBhhÂAA)wZ--{TTm:,cc||ww{{ kkooT0P`0gg+}V+b׫MvvEʂ@}}YYGɎG AgԢ_E#Srr[u=&jL&6Zl6?A~?O4\h4Q4qqs1Sb1?* R#eF#^(07 / 6$=&'iN'uu  ,tX,.4-6nnZZ[RR;Mv;aֳ}){R)>/q^/SSh, `@ y[[jjF˾g9Kr9JޔJLԘLXXJk*OCņCMךM3Uf3EϊEPPKݖKa pp>B|>qffHؐHaa5_j5WWiX':'8+3"iipَ3-"< IUU(xP(zߌY  e1BƄBhhAÂA)-wZ-{TTm:,cc||ww{{ kkooT00P`gg++}VbMvvE@}}YYGGɎ Ag_E#Srr[uᓓ=&&jL66Zl??A~O44\hQ4qqs11Sb?* R##eF^(07 / 6$=&''iNuu ,,tX.4-6nnZZ[RR;;Mva})){R>//q^SSh, `@㱱y[[jjFg99KrJJޔLLԘXXJk*ŪOCCņMMך33UfEEϊPP<KKݖa pp>>B|qffHHؐaa55_jWWiX':'8똘+3"iip3-"< IUU((xPzY e1BBƄhhAAÂ)--wZ{TTm:,cccc||||wwww{{{{kkkkoooo0000gggg++++׫vvvvʂ}}}}YYYYGGGG𭭭Ԣrrrr&&&&6666????4444qqqq1111####''''uuuu ,,,,nnnnZZZZRRRR;;;;ֳ))))////SSSS [[[[jjjj˾9999JJJJLLLLXXXX着CCCCMMMM3333EEEEPPPP<<<>>>ffffHHHHaaaa5555WWWWiiiiَUUUU((((ߌ BBBBhhhhAAAA----TTTT @6MD5FinalRMD160FinalSHA1TransformSHA1Final˻]b)*6|YZ0p/Y9g3&g 1JhX . dGHOB/("q7D#e͵M;/ۥۼ9V[H8Y?O^mB[Epo$1N䲌U }r]t{oޱ;%5ti&iJG8O%Ƌյ$ we-,oY+uJtn\ܽAvڃS>QRf߫1m-2'Ș!?YǾ =էG %cQo))g np' F/.!8\&&M,mZ*S8 e sTcvj &aц!}}Onxgro c}ŢȘ? q 5G(w#}2ʫ{@$< ɾCgĜ LLԾ>BY)e~*_o:lDJGXj ggʧ;l٫Ak[~!yB/q7Dۥ9V[Y?^[$1U }r]tޱtiG$ -,oJt\vژ>QR1m'ȿY էGcQ))g' .!8M,mS8 e sTvj .r,表fKKplQђ֙$5jp7l'HwL49 NتJ[Oh.otxcoxPlqxj ggw1K'x/U`\`U%UWHbc@U9j*\4AΡT|r铳co*+]t1\>ֺ3l$\z2S(w;HkKĿf(!a !H|`]2]]u&#e#>ӖmoB9. D iJ^!hBlg aӈjQT/h(Q3n lz;;P~*e9vfY>CEo};^ou؅ s@DVjNӪb6?wrB=7$ HISrɀ{%yPyL;lO@`^\j$cho>lS9;RomQ0,́ED^ 3Jf(.K˨WEt _9Uy`2 ֡@,ryg%̎2"߂\WoV.iB(~ìg2ƌOUsi['X]=!Jl-[SyEeҎIKڤ~3bA 6wL~+MꭎqkՠЎЯ%<[/u+d O^h񑳨//"wu-otΉ♴O|;ҭ_fws!w ewTB5ͯ {>AӮ~I%- q^"hW$d6 UcYߦxCZS }[Ń&vbϩhNsJAG-{JQRS)W?+`vtoWk* ce!4.ŅVdS-]GnjKzp鵳)Du .&#nI}`f쪌qiVdRl±6u L)Y@:>?T[Bek֙?֡Ҝ0M-8%]L p&c^ hk?><kjph5R↷SP7>ޮ\}DW:7P  uA8͙;/2>1NT8OmoB  ,$|yVyrޚwٓ?.Ur.kq$P柄͇zXGtK}z:ۅc CfdG2C;7$ºMC*eQP:q1NUw_5Vףk<;Y$ ,*wN=)eܹ>Rf%.LxjxEⶣlOOBBjeO;A!yMKGj=bPb[&FǶ$itG V [Hbt#XB* U>#?pa3r𒍓~A_l";|7Yt`@w2nPUaٗ5i Z ܞDz.E4gsUg_ygC@4eq>8=(m >!珰=J+ۃ=Zh@L&i)4A vk.Ԣh$q3 jCԷPa9.$EF!Ot@Mpf/E m1˅'U9A%G (Px%S) ,mhbHih'O?臭zֶ|7_x@k*B 59׫;NKmV&f1㗲:nt[C2hAx NE@VH'US:: kЖKUgX̩)c3*JV?1%^~)1|'/p\(,Hm"H?A@Gy]n2_Q՛A5d%{x4`*`cl2fOсk#3>;$ b" r -(xEd}bTIo}HÝ'> GcA.t:on7`Lnk {Umg,7'e;) 9i f{} ^/Q[${yv;79.Yy&.1-hBj+;uLx.jB7QKcPk=%DBY  nի*dgNچ_dW`x{``MF8wE6̃Bk3qA<^_wW$UFBX.aNXt8SfȳtuUFٹz&a߄jy_FnY WpUL ỂbHut f- 2F3Z J%n= ߡ(hiܷڃW9ΛORP^ ''w?A`Laz(`X0}b#8cSݔ4V}Yvo K|9r =||$r_rM[ӞTUx=|MP^alQZ4ח,+Qլ:}}>|}-(%ϭZִrZL)qGč(;Wf)y.(x_u`UD^mԈma%d{Q!dwO2~)=FHSid怢m$i- !fF dEXl Ȯ[X@kݢj~:YE>5 DrΨdf~of,"#W2v#51VbZun6sޖbILPqVǽ2z E{ɪSb%5qi"|v+S>@8`%G8 Fvw u``NzL~H\ji\ޠ? %-柷Na2w[W:r$?j.psD 8")1.NlE(!8wTf4 l)|P?յG ىy~ ,ntfߦ3yjXDݝD1sZ*"8cˬ$:iz IH8@HL_H %AN@$AU erQ略%ח 9Myjch@ VZ qVN)cf-Ĭwq 7*W5"aBt[h!!S<ȭ(=\8ә N $/OOivǕtU圢¦-'jBce fU)Usu2Ǒh RGU< D𪇬6:t&+tId-~۱Ih &B„cg7PGf6nz7}0c߶)A&fVdTЍXHTU0I[.Zjn":f+͞h>Gl ыiWw@~˳PM xQ VA$ VWUnaX $K'{UahwdlkDMfdi~կI/07O,5jsI@v;M(BDHsnL )_}Oao.w+᪐r<}F+YEEYTNmHo |cD_sVjprn] `yE`۩11\"NB\rr,%@N2N/@g#\xnu"xMkXnD O?H{wv#uV_F*+ (=8 6RJf;tQZרխly ueXJh&pSF\l(vk07h)҅6*$gk %huUD,eI40ʸ"W ubIb~U^vSEFmG,lLHg3|hC\2US `ߡWc톹^9283Ia7b^~N#tq܇&3@~C/ ^A (lؑ0~foo䬘s`*4-K6%░#% =HI6oJ8@CzT¼pOWAZ:TUY5|ūZǵޯ:G:S%e=~jT&IQwP[]Dlvȸ!`Xi[)Y;LJ]5UkLD5$bI/T81q(TH9)[u/@3+gf-V*o` ('Md)P,2\K6ޠ_AP! NhÁ\yCMIP8CA<?f϶&`ued$zHܩóf(` ߨ5mw 5k*HiMuN{:_Cg7I3BfΌAT:lG()G%7j+z \D7bB ntgr9X7EXVn0!$Eˆ)^18FXJNFFPx)C_$;,NmdTJOëoxnn<UV6;]޻a<tb3<L(m tyl{nwe\R0+@`>x7T0}ȧm2羾-yy"SuwXkxoZc\]3򎿰€vzҰyBq3j'`CP=Ăm+NvH%6f(NAa =IϺ߶_撮d:枨 +}?pP+ObZjyb.H@@Z,Қ"-E4S֙)nIloIrB~>VofblqTL+*)9ܰX򮞢RVLf.v9Si.Ӡߦi>҅tFL+OuvV]93x2#O=2]K&ǟ/<~~^O?v)f=oEӵ4+4NrgU="Ҩ`g8k0=8}cQXӐTyGawY-WSVXNcF.xe~yU@0ј5?P=@!IXLQ6p΃yǔqoKK0 ڽ5dw$,ϰ/ t*Bv-:7ޚޱ ,p) @$:7ϴNy ]H 1hZfB1?ru3 BQ\}mc@!d SWz13]oCqF8"ΔԸGi[bUfg N[GLoŽĸWrndzx]D`Փl 9_] c~2p PI) *m~SHX~;t.R/G~'ͤ![<z8BOv5`9'5ɯ{6 g{qp-^3TIZd,= p4wB&Ob$ҿF%dN>7`xͥE{_ v"1.{$%r_m LPm=O%#so(%Iy4azn|n6lTAV'JA<șgmB`{u $ž9g;?q0T;2dB̰E}JBp} W[z?Z MΤ(y043w;S7x倳Nhȳ~ 9|*OC/}"6ʢ7ߓ+$W4xgaoHR^^A$e.{@鎠XӐ[HV8Wrs޼[d1~OPa`{ I8,v%ѷ%$K vGX YѤf 0nN&Qd# Ph0@ԟ k/?%z!?/M`@ϟIԯ'@Жuncaf"(h;oY#yw_PC@/V|ҽ-4lHam"T/*2Tk"V:Af@ȧ9/M/-ޗ?JRvD7,QYoZ z{hА."TY5Km/PdfI-3";K4]E@1?.Ueձʭ-Էm P"@ nO8O[rVL/ŜSITFiXcE]WSj9=7*T:x}_bvzB j)r'^Pg8Ƶˌ*ZJ'ѓk*҆Vґ׉C`B\u &ql-sJ5&{M 0n٘&fVH%^V c|cp EP(r#Hp -;MyBA &G LGMj| ^\#Y8r۫Sn/#qFVEn9 q+A|ʉiHCyB}B{ZIݏ\e  [i~9?Caz zUrQyNr5Zc60_ }/{Y6 DDY̳A; *{B [%AzzƩX0ދw?Nyi${[P5%a_b1T UKc]h!fY=cs4~\g+!a9b60W;`/d:͜F5-' zyl0%7^oo; jEt'N:4Oi>M5YdE8Cfr%c3N?( 'ᛥզRTUfpdw M&g!CX`T0orSGUb]hVk-n;ۦк=\w 3L9{^+_Soa Cd^xc"g&рI"{^U-%Rr7yҕ LHϢ 0qc/ S!ET(5c)1BƎI# 0(_qȾ`a輨M/".pN40';yaٸHi?(;CZᗘv/܆7ӱÓnƼ>Q7Bh(Re-jw5'K \n.ے^)XXOTi{&g̅`HK8` #l8~ I` 5sܱGLV>#d8^FB kzOdEA^\#>];Cוr~m|llq`9spvE#@%]=G`6KDʐPQHX_0.r| ],*IPڈ'WyoIR}rY}@EE]t>OuVi#A.`' v䶔etyvwvNHam❄/}4 ȖH0b \8D=`nm`T:IW'H+8 $hE%;` E}(/P4b +md+10ZRXAB휤1\2>F63S57 ާ{sJO{dWQC~(zc _5y Cddc$J(_OC@ " 07O-${MQgqL-_d_ !S>^'Ҹ_Bar%΄q=Ko&;~ԄT~DmLl&I߮63P?~w a8rPP.wWOgF3Ti 1M5=\f][̩o꟒oF"/9F}mCOC!N ? (X&Hn>׊ptw|- %y 껁(;#iޭ8t߇b!@7{ @YVOv/@U{ MV3i5W#'ȰVÑke^anu2Uw?[-;%m;$ cf8( 2T2bZg,uzT1w&16o FjHVZyjLRC~/v t,߷t*M . k|AT嶠5!=B,|&aeR1%i &c1\!^ rIyٍ 1p>d >Ӷ È0lrqn/ބkD؋V9ñ/ʴ1x(o}2X~$ŗ{sa0-!!))*\e0,Ъ?\Ԟ, T ͆_wޠ:xV^V!\uㇳQ#wE)/i߯zpIJ[̘v9F څ8/sgD)k)I/•fgni~/%p^QS$jlD!>Yye)CA9y+WMN҂z) >@@CCEEFFIIJJLLOOQQRRTTWWXX[[]]^^aabbddgghhkkmmnnppssuuvvyyzz||cryptocryptopcryptodesccrydevcryptof_ioctlcuio_copyback: off %d < 0cuio_copyback: len %d < 0cuio_copyback: empty in skipuio_copyback: emptycuio_copydata: off %d < 0cuio_copydata: len %d < 0iov_copydata: empty in skipcuio_copydata: emptycuio_apply: len %d < 0cuio_apply: off %d < 0cuio_apply: ind %d >= uio_iovcnt %d for offcuio_apply: ind %d >= uio_iovcnt %d for lenSoftware crypto device cannot initialize!swcr_combinedswcr_authcomputeswcr_encdec66666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\aes_xts_cryptaes_ctr_cryptDES3DESBlowfishCAST-128Rijndael-128/AESAES-CTRAES-GCMAES-GMACAES-XTSARC4HMAC-MD5HMAC-SHA1HMAC-RIPEMD-160HMAC-SHA2-256HMAC-SHA2-384HMAC-SHA2-512GMAC-AES-128GMAC-AES-192GMAC-AES-256Keyed MD5Keyed SHA1MD5SHA1DeflateLZSHMAC_SHA256_FinalHMAC_SHA256_InitHMAC_SHA1_FinalHMAC_SHA1_InitHMAC_MD5_FinalHMAC_MD5_InitAES_GMAC_Final H!x-ML.RN8D( `hz=Skc|j9{Б/Uڅ?AZX_f ؐ53eiEVmv° GJBnI[#Q")yq~ ruo7ӎbwO$26󦻬^lW%㽨:Y*Fmplsintr no HDRmplsmpls_raw_usrreqbind failed krpc_call: sosend: %d RPC timeout for server %s (0x%x) prog %u rpc denied, error=%d rpc denied, status=%d ;Process killed due to text file modification nfs_doio: type %x unexpectednfs_bufqnfsvinvalnfs_read modenfsbioreadnfsbioread: type %x unexpectednfs_write modenfs_write procnfs_boot: bootparam_getfile: bad reply nfs_boot: bootparam get %s: %d nfs_boot: mountd %s, error=%d nfs_boot: portmap NFS/v2, error=%d nfs_boot: no suitable interfacenfs_boot: using interface %s, with revarp & bootparams nfs_boot: socreate, error=%dnfs_boot: GIFFLAGS, error=%dnfs_boot: SIFFLAGS, error=%dreverse arp not answered by rarpd(8) or dhcpd(8)nfs_boot: client_addr=%s nfs_boot: set if addr, error=%dnfs_boot: bootparam_whoami: bad reply nfs_boot: bootparam whoami, error=%dnfs_boot: server_addr=%s hostname=%s nfs_boot_getfhnfs_boot_initxid 0x%x flags 0x%x rexmit %i procnum %i proc %p mreq %p mrep %p md %p nfsmount %p vnode %p timer %i rtt %i size %llu flag %i vnode %p accstamp %i pushedlo %llu pushedhi %llu pushlo %llu pushhi %llu commitflags %i nfs_reclaim: pushing activeNULL v_data (no nfsnode set up?) in vnode %pnfs_inactive: pushing activenfs_commitlk../../../../nfs/nfs_node.cnp2 == NULLnfshshlknfs_ngetnfskqpollnfskqdetnfskqpwnfskqlks0ps0qnfsrv_pathconfnfsrv_fsinfonfsrv_statfsnfsrv3_accessnfsrv_commitnfsrv_readdirnfsrv_getattrnfsrv_readdirplusnfsrv_rmdirnfsrv_mkdirnfsrv_lookupnfsrv_symlinknfsrv_linknfsrv_renamenfsrv_removenfsrv_mknodnfsrv_createnfsrv_setattrnfsrv_writenfsrv_readlinknfsrv_readnfsrv_read iovnfsd wakeupnfs getstreamnfs server %s: %s nfs_realign_fixup: no memory to pad tonfs rcvunlocknfs sndunlocknfsrcvlknfsndlcknfsconnfscon sotypenfsreconshort receive (%d/%d) from nfs server %s %s (%d) from nfs server %s impossible packet lengthEgad!! receive error %d from nfs server %s nfsreply nilnot respondingis alive againnfsretrynfsrcnfsrv cachebuild > MLENnfs S too bignfsnodeplnfsreqpl../../../../nfs/nfs_subs.cauth_type == RPCAUTH_UNIX111111111121N1j111111101<1F1P ?BEFnfsdnfsionfsidlnfsd initndscplbad nfs svc reply, siz = %infs_args: retrying connect nfsnfs_mount_diskless: vfs_rootmountalloc failednfs_mountroot: mount %s failed: %dnfs_mountroot: rootroot on %s nfs_mountroot: getattr for rootnfs_mountroot: can't setup swap vpswap on device 0x%x swap/swapnfs_mountroot: getattr for swap swap on %s WARNING: no swap nfs_mountnfs_mountroot(ytag VT_NFS, fileid %ld fsid 0x%lxnfs physio/asyncbwrite: buffer is not busy???nfsfsyncnfs_fsync: not dirtynfs_fsyncnfs: sillyrename dir .nfs%08X%08Xnfs readdirrpc bad uioEEK! readdirrpc resid > 0 nfs_rename: no namenfs_remove: no namenfs_remove: bad v_usecountnfs: writerpc iovcnt > 1open eacces vtyp=%d nfs readdirplusrpc bad uioEEK! readdirplusrpc resid > 0 ../../../../nfs/nfs_vnops.ccnp->cn_proc == curprocstart = %d, len = %d, fs = %s ffs_alloccg: map corruptedbno = %lld, fs = %s ffs_alloccg: block not in mapbsize = %d, size = %ld, fs = %s ffs_checkblk: bad sizeffs_checkblk: bad block %lldffs_checkblk: partially free fragmentffs_freefile: range: dev = 0x%x, ino = %d, fs = %sdev = 0x%x, ino = %u, fs = %s ffs_freefile: freeing free inodedev = 0x%x, bsize = %d, size = %ld, fs = %s ffs_blkfree: bad sizebad block %lld, ino %u uid %u on %s: %s bad blockdev = 0x%x, block = %lld, fs = %s ffs_blkfree: freeing free blockffs_blkfree: freeing free fragcg = %d, irotor = %d, fs = %s ffs_nodealloccg: map corruptedffs_nodealloccg: block not in mapffs_clusteralloc: map mismatchffs_clusteralloc: allocated out of groupffs_clusteralloc: lost blockmode = 0%o, inum = %u, fs = %s ffs_valloc: dup allocfree inode %s/%d had %lld blocks out of inodes %s: create/symlink failed, no inodes free ffs1_reallocblks: unallocated block 1ffs1_reallocblks: non-logical clusterffs1_reallocblks: non-physical cluster %dffs1_reallocblk: start == endffs1_reallocblks: unallocated block 2ffs1_reallocblks: alloc mismatchffs1_reallocblks: unallocated block 3 %lld,ffs2_reallocblks: unallocated block 1ffs2_reallocblks: non-logical clusterffs2_reallocblks: non-physical cluster %dffs2_reallocblk: start == endffs2_reallocblks: unallocated block 2ffs2_reallocblks: alloc mismatchffs2_reallocblks: unallocated block 3dev = 0x%x, bsize = %d, osize = %d, nsize = %d, fs = %s ffs_realloccg: bad sizeffs_realloccg: missing credentialdev = 0x%x, bsize = %d, bprev = %lld, fs = %s ffs_realloccg: bad bprevffs_realloccg: bad blocknoffs_realloccg: small bufdev = 0x%x, optim = %d, fs = %s ffs_realloccg: bad optimffs_realloccg: small buf 2file system full %s: write failed, file system is full dev = 0x%x, bsize = %d, size = %d, fs = %s ffs_alloc: bad sizeffs_alloc: missing credentialffs2_balloc: block too bigffs2_balloc: ufs_bmaparray returned indirect blockffs2_balloc: unwind failedffs1_balloc: blk too bigffs1_balloc: ufs_bmaparray returned indirect blockCould not unwind indirect block, error %dffs_indirtrunc: bad buffer sizeffs_truncate: partial truncate of symlinkffs_truncate: newspaceffs_truncate1ffs_truncate2ffs_update: bad link cntDisk overlap start %lld, end %lld overlap start %llu, end %llu Disk buffer overlap?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@Pߜx4ј ffsinodino1pldino2plinodeupdate: rofs modffs_statfsWARNING: %s was not properly unmounted WARNING: R/W mount of %s denied. Filesystem is not clean - run fsck ffs_mountfs(): obsolete rotational table format, please use fsck_ffs(8) -c 1 ffs_reload: dirty1ffs_reload: dirty2ffs_mountroot: can't setup bdevvp's ffsffs_write: modeffs_write: nonsync dir writeffs_write: typeffs_read: modeffs_read: short symlinkffs_read: type %dffs_fsync: not dirtyffs_fsyncffs_fsync: dirty%s%s(%p) state %b %sATTACHEDUNDONECOMPLETEDEPCOMPLETEMKDIR_PARENTMKDIR_BODYRMDIRDIRCHG GOINGAWAY IOSTARTED SPACECOUNTED NEWBLOCKUFS1FMTONWORKLISTmount %p ino %u lbn %lld fs %p ino %u nlinkdelta %u dino %p %s bp %p savsz %lld fs %p newblk %lld state %d bmsafemap %p buf %p lbn %lld newlbk %lld oldblk %lld newsize %ld olsize %ld %s bp %p inodedep %p freefrag %p savedata %p savebp %p off %d newblk %lld oldblk %lld freefrag %p %s indirdep %p buf %p vnode %p mp %p blkno %lld fsize %ld ino %u previno %u devvp %p mp %p oldsz %lld newsz %lld %s chkcnt %d uid %d mode %x oldino %u vnode %p mp %p off %d ino %u da_un %p diradd %p bp %p mp %p ino %u dm_un %p pagedep %p deps: %s: got error %d while accessing filesystem softdep_deallocate_dependencies: dangling depssoftdep_deallocate_dependencies: unrecovered I/O errorinitiate_write_filepage: already started %s: dir inum %u != new %uinitiate_write_filepageadd_to_worklist: already on listdrain_outputsdsdtyclear_remove: vgetclear_remove: fsyncinitiate_write_inodeblock_ufs2: already startedinitiate_write_inodeblock_ufs2: I/O underwaysoftdep_write_inodeblock: lbn order%s: direct pointer #%lld mismatch %lld != %lldsoftdep_write_inodeblock%s: indirect pointer #%lld mismatch %lld != %lldsoftdep_write_inodeblock: Unknown state 0x%xsoftdep_write_inodeblock: lost dep2softdep_write_inodeblock: lost dep3initiate_write_inodeblock: already startedinitiate_write_inodeblock: already doing I/O%s: direct pointer #%lld mismatch %d != %d%s: indirect pointer #%lld mismatch %d != %dsoftdep_write_inodeblock: lost dep1newfreefrag: frag sizeindir_trunc: lost indirdepindir_trunc: dangling deppagedepplinodedepplnewblkplbmsafemapplallocdirectplindirdepplallocindirplfreefragplfreeblksplfreefilepldiraddplmkdirpldirremplnewdirblkplsema_release: not heldsoftdep_setup_blkmapdep: found blocksoftdep_move_dependencies: need merge codesoftdep_check_for_rollback: Unexpected type %ssoftdep_fsync_mountdev: vnode not a disksoftdep_fsync_mountdev: not dirtyhandle_allocindir_partdone: dangling dependencysoftdep_disk_io_initiation: readdisk_io_initiation: indirdep gonehandle_disk_io_initiation: Unexpected type %shandle_workitem_freefilehandle_written_mkdir: bad typehandle_workitem_freeblocks: block count handle_workitem_freeblkscheck_inode_unwritten: busy inodehandle_workitem_remove: vgethandle_workitem_remove: lost inodedephandle_workitem_remove: bad file deltahandle_workitem_remove: bad dir deltahandle_workitem_remove: truncate%s_process_worklist: Unknown type %ssoftdeprequest_cleanup: unknown typesoftupdateclear_inodedeps: vgetclear_inodedeps: fsync1clear_inodedeps: fsync2flush_pagedep_deps: MKDIR_PARENTflush_pagedep_deps: MKDIR_BODYflush_pagedep_deps: lost inodeflush_pagedep_deps: flush failedsoftdep_sync_metadata: Unknown type %ssoftdep_fsync: pending opssoftdep_fsync: Unexpected type %ssoftdep_fsync: dirtysoftdep_change_linkcnt: bad deltasoftdep_setup_inomapdep: found inodesoftdep_free: unknown type %dsoftflushfree_diradd: unfound refhandle_written_filepage: not startedhandle_written_filepage: attachednewdirrem: whiteoutnewdirrem: not ATTACHEDnewdirrem: inum %u should be %ufree_allocdirect: extra newdirblkhandle_allocdirect_partdone: dangling dephandle_written_inodeblock: not startedhandle_written_inodeblock: new entry%s: %s #%lld mismatch %d != %lldhandle_written_inodeblockdirect pointer%s: %s #%lld allocated as %dindirect pointer%s: %s #%lld mismatch %lld != %lld%s: %s #%lld allocated as %lldhandle_written_inodeblock: bad sizehandle_written_inodeblock: filefreehandle_written_inodeblock: Unknown type %shandle_written_inodeblock: live inodedepdisk_write_complete: indirdep gonedisk_write_complete: not gonehandle_disk_write_complete: Unknown type %sallocdirect_merge: old %lld != new %lld || lbn %lld >= %dallocdirect_merge: extra newdirblksoftdep_update_inodeblock: bad link countsoftdep_update_inodeblock: bad deltasoftdep_update_inodeblock: bwritesoftdep_update_inodeblock: update failedsoftdep_setup_allocdirect: lost blocksoftdep_setup_allocdirect: Bonk art in the headsoftdep_setup_allocdirect: non-zero indirsoftdep_setup_allocdirect: lost entrysoftdep_setup_directory_add: lost inodedepsoftdep_setup_directory_add: lost entrydeallocate_dependencies: already gonedeallocate_dependencies: not indirdeallocate_dependencies: lost pagedepdeallocate_dependencies: Unexpected type %sdeallocate_dependencies: Unknown type %ssoftdep_setup_freeblocks: non-zero lengthsoftdep_setup_freeblockssoftdep_setup_freeblocks: inode busysetup_allocindir_phase2: not indir blksetup_allocindir: lost blocksetup_allocindir_phase2: blknosoftdep_setup_allocindir_page: Bonk art in the headbmsafemapallocdirectallocindirfreefragdiraddmkdirdirremworklist_printdrain_outputgetdirtybufflush_pagedep_depsflush_inodedep_depssoftdep_fsync_mountdevmerge_inode_listshandle_written_filepagehandle_written_mkdirdiradd_inode_writtenhandle_written_inodeblockhandle_allocindir_partdonehandle_allocdirect_partdonefree_diraddfree_allocindircheck_inode_unwrittenfree_newdirblkfree_allocdirectallocdirect_mergebmsafemap_lookupinodedep_lookuppagedep_lookupsoftdep_freequeue_processmfs_mount: dup devmfsidltߜ$x4ј mfs_badop calledmfs_open not VBLKtag VT_MFS, pid %d, base %p, size %ld mfs_inactive: not inactive (mfs_buflist %p)mfs_strategy: bad devmfs_close: dirty buffers ufs_getlbns: Invalid indirect block %lld specifiedufs_getlbns: indirect block %lld not foundufs_bmaparray: invalid argumentsufs_bmaparray: indirect block not in cache../../../../ufs/ufs/ufs_dirhash.c(dh->dh_hused >= 0)(block < dh->dh_nblk && block < dh->dh_dirblks)((((&ufsdirhash_list)->tqh_first) == ((void *)0)))(dh->dh_hash != ((void *)0))(offset == dh->dh_dirblks * (1 << 9))(offset < dh->dh_dirblks * (1 << 9))(dh->dh_hused < dh->dh_hlen)ufsdirhash_findslot: '%.*s' not found(oldoff < dh->dh_dirblks * (1 << 9) && newoff < dh->dh_dirblks * (1 << 9))ufsdirhash_checkblock: bad offsetufsdirhash_checkblock: bad dirufsdirhash_checkblock: bad dir endufsdirhash_checkblock: bad free countufsdirhash_checkblock: bad first-freeufsdirhash_checkblock: missing first-free entry(offset <= dh->dh_dirblks * (1 << 9))ufsdirhash_dirtrunc: blocks in useufsdirhash_dirtrunc: first free corrupt(dirblock < dh->dh_nblk && dh->dh_blkfree[dirblock] >= (((slotneeded) + ((4) - 1)) / (4)))ufsdirhash_findfree: free mismatch(dh->dh_onlist)ufsdirhash_lookup: bad offset in hash array((((ip)->i_ump->um_fstype == 1) ? (ip)->dinode_u.ffs1_din->di_size : (ip)->dinode_u.ffs2_din->di_size) >= (1 << 9))ufs_reclaim: pushing activeufs_inactive: pushing activecheckpath: .. not a directory First bad Second bad %s: bad dir ino %u at offset %d: %s bad dirufs_makedirentry: missing nameufs_direnter: newblkufs_direnter: compact1ufs_direnter: compact2mangled entryi_ffs_size too smalldqsync: dquotdqsync: filedqsyncfree dquot isn'tsetusesetquotaquotaoff: mount point not busyquotaon: mount point not busyufs_quota_free_blocks2: vnode is not lockedchkiqchkdqchkdquot: vnode is not lockedchkdquot: missing dquotmissing dquot %s: write failed, %s inode limit reached %s: warning, %s %s inode quota exceeded %s: write failed, %s %s inode quota exceeded for too long %s: write failed, %s disk limit reached disk quota exceededdisk quota exceeded for too longgroupundefined+RX,,ufs_makeinodeufs_mkdirufs_linkufs_renameufs_makeinode: no nametag VT_UFS, ino %u, on dev %d, %d flags 0x%x, effnlink %d, nlink %d mode 0%o, owner %d, group %d, size %lldufs_readdir: lost in spaceufs_mkdir: no nameufs_link: no nameufs_rename: no nameufs_rename: lost from startdirufs_rename: lost to startdirrename: EXDEVufs_rename: same fileufs_rename: lost dir entrychown: lost quotaufs_strategy: specifree: range: dev = 0x%x, ino = %d, fs = %sdev = 0x%x, ino = %d, fs = %s ifree: freeing free inodebad block %d, ino %u dev = 0x%x, block = %d, fs = %s blkfree: freeing free blockmode = 0%o, nlinks %u, inum = %u, fs = %s ext2fs_valloc: dup allocext2fs_alloc: missing credentialext2fs_alloccg: map corruptedext2fs_mapsearch: block not in mapext2fs_alloccgblk: cg=%d bno=%d fs=%s ext2fs_alloccg: dup alloccg = %d, ipref = %d, fs = %s ext2fs_nodealloccg: map corruptedext2fs_nodealloccg: block not in mapext2fs_balloc: ufs_getlbns returned indirect blockext2fs_bmaparray: num=%d ext2fs_bmaparray: numext2fs_bmaparry: indirect block not in cacheext2fs_indirtrunc: bad buffer sizeext2fs_truncate: partial truncate of symlinkext2fs_truncate1ext2fs_truncate2ext2fs_truncate3ext2fs_inactive: pushing activecheckpathrec_len is smaller than minimalrec_len % 4 != 0reclen is too small for name_lendirectory entry across blocksinode out of boundsbad directory entry: %s offset=%d, inode=%lu, rec_len=%d, name_len=%d ext2fs_dirbadentryi_size too smalldirenter: missing nameext2fs_direnter: newblkext2fs_direnter: frag sizeext2fs_direnter: compact1ext2fs_direnter: compact2 %u %uext2fs_direnter: compact2ext2fs_readdirext2fs_direnter%s: modeext2fs_write%s: nonsync dir write%s: typeext2fs_read%s: short symlink%s: type %d start %lld, end %lld overlap start %lld, end %lld Ext2 fs: unsupported revision number: %x Ext2 fs: bad block size: %d (expected <=2 for ext2 fs) Ext2 fs: unsupported first inode positionExt2 fs: unsupported optional feature ext2fs_statfsext2fs_reload: dirty1ext2fs_reload: dirty2%s: file system not clean; please fsck(8) ext2fs_mountroot: can't setup bdevvp'sext2fsext2inoplext2dinoplH |P0xext2fs_reclaim: pushing activeext2fs_makeinode: no nameext2fs_mkdir: no nameext2fs_mkdir: blksizeext2fs_link: no nameext2fs_rename: no nameext2fs_rename: lost from startdirext2fs_rename: lost to startdirrename: same filerename: linked directoryext2fs_rename: lost dir entryext2fs_rename: mangled dir- uvm_addr %s: NULL - uvm_addr %s: %p (%s 0x%lx-0x%lx) entry %p: 0x%lx-0x%lx G=0x%lx F=0x%lx free: 0x%lx-0x%lx start=0x%lx, expected at least 0x%lx 0x%lu entries, 0x%lx free bytes pivot 0x%lx, epires in %d, direction %d empty 0x%lx - 0x%lx free (0x%lx bytes) contains pivot %d (0x%lx) %s: entry was not in tree%s: duplicate insertion: state %p interting %p, colliding with %p%s: duplicate insertion: state %p inserting entry %p which collides with %p../../../../uvm/uvm_addr.cp->entry == NULLuaddr == (struct uvm_addr_state*)&uaddr_kbootstrapuaddr_hint_pool.pr_size == sizeof(*ua_hint)offset < align || (align == 0 && offset == 0)(align & (align - 1)) == 0(offset & PAGE_MASK) == 0minaddr < maxaddruaddr_pivot_newpivot: cannot grant random pivot in area less than 2 pages (size = 0x%lx)align >= PAGE_SIZE && (align & (align - 1)) == 0*entry_out != NULLuvm_addr_invoke: address selector %p (%s 0x%lx-0x%lx) returned unavailable address 0x%lxentry_out != NULL && addr_out != NULLdirection == -1 || direction == 1(hint & PAGE_MASK) == 0 && (high & PAGE_MASK) == 0 && (low & PAGE_MASK) == 0 && (before_gap & PAGE_MASK) == 0 && (after_gap & PAGE_MASK) == 0high + sz > highuaddruaddrhintuaddrbestfituaddrpivotuaddrrnd(map->flags & VM_MAP_ISVMSPACE) != 0uaddr_linuaddr_rnduaddr_hintuaddr_kbootstrapuaddr_bestfituaddr_pivotuaddr_stckbrk ,0x ,@ ,P ,` | ,x   l|,< ,uaddr_pivot_removeuaddr_pivot_insertuaddr_bestfit_removeuaddr_bestfit_insert../../../../uvm/uvm_amap.c(((entry->end - entry->start)) & (PAGE_SIZE - 1)) == 0((offset) & (PAGE_SIZE - 1)) == 0amap_unadd: offset out of rangeamap_unadd: nothing thereamap_add: offset out of rangeamap_add: replacing null anonamap_add: slot in useamap_lookup: offset out of rangeamap_lookups: offset out of rangeamap_splitref: split at zero offsetamap_splitref: map size check failedamap_cow_now: non-resident wired page in anon %pcownowcownowpage((sz) & (PAGE_SIZE - 1)) == 0((padsz) & (PAGE_SIZE - 1)) == 0amap->am_ref == 0 && amap->am_nused == 0(amap->am_flags & AMAP_SWAPOFF) == 0amap->am_ref == 0amap_wipeout: corrupt amapLIST_NEXT(&marker_prev, am_list) == &marker_next || LIST_NEXT(LIST_NEXT(&marker_prev, am_list), am_list) == &marker_nextamapplamap_pp_adjref: overshot targetamap_pp_adjref: negative reference count((entry->end - entry->start) & (PAGE_SIZE - 1)) == 0((addsize) & (PAGE_SIZE - 1)) == 0amap->am_maxslot < slotneed(entry)->end + (entry)->fspace > (startva)(entry)->start < (endva)anon_pagein: uvmfault_anonget -> %d../../../../uvm/uvm_anon.cpg->loan_count > 0uvmexp.swpgonly > 0anon->an_page == NULLanon->an_swslot == 0anonpluaoeltplaobjpluao_create: kernel object already allocateduao_create: asked to enable swap on kernel objectuao_create: hashinit swhash faileduao_create: malloc swslots faileduao_set_swslot: uobj = %p uao_set_swslot: attempt to set a slot on a NOSWAP object../../../../uvm/uvm_aobj.cslot == 0uao_flush: strange, got an out of range flush (fixed) uaoflshuao_flush: weird flagsuao_detuao_getpageuao_getudv_fault../../../../uvm/uvm_device.cuobj->uo_npages == 0 && RB_EMPTY(&uobj->memt)udv_detachudv_attach../../../../uvm/uvm_fault.cp != NULL && &p->p_vmspace->vm_map == map(map->flags & VM_MAP_INTRSAFE) == 0start >= vm_map_min(map) && end <= vm_map_max(map)uvm_fault_unwire_locked: address not in mapva >= entry->startnext != NULL && next->start <= entry->endanonget1anonget2flt_noram1result != VM_PAGER_PENDuvm_fault: fault on non-pageable map (%p, 0x%lx)fltamapcopyuvmadvice[ufi.entry->advice].advice == ufi.entry->advice(pages[lcv]->pg_flags & PG_RELEASED) == 0uvm_fault: uvmfault_anonget -> %dflt_noram2uvmexp.swpgonly <= uvmexp.swpagesflt_noram3flt_pmfail1uobjpage != PGO_DONTCAREfltagain2flt_noram4uvm_fault: want to promote data, but no anonflt_noram5flt_pmfail2../../../../uvm/uvm_glue.crvva == sva + szuvm_init: page size not set../../../../uvm/uvm_io.ckm_free: unmanaged page 0x%lx ../../../../uvm/uvm_km.csz == round_page(sz)kp->kp_object!kv->kv_singlepagekp->kp_object == NULLsz == PAGE_SIZEgetpagekm_allocvauvm_km_pgremove_intrsafe: no pagekmallockmthreadvm_map_pmap(map) == pmap_kernel()vallocwaitkm_alloc1wuobj->pgops == &aobj_pagerkm_pgrmuvm_km_suballoc: unable to allocate space in parent mapuvm_km_suballoc: unable to create submapuvm_km_suballoc: submap allocation faileduvm_km_init: could not reserve space for kernel!(flags & UVM_KMF_VALLOC) || !(flags & UVM_KMF_ZERO)TAILQ_EMPTY(&pgl)1 01 1111 8'../../../../uvm/uvm_map.c*start_ptr == uvm_map_entrybyaddr(atree, addr)*end_ptr == uvm_map_entrybyaddr(atree, addr + sz - 1)map->flags & VM_MAP_ISVMSPACE(flags & (PGO_FREE|PGO_DEACTIVATE)) != (PGO_FREE|PGO_DEACTIVATE)pg->uobject == NULLpg->uanon == anonuvm_map_clean: weird flagsOBJECT %p: pgops=%p, npages=%d, refs= refs=%d PAGES : <%p,0x%llx> PAGE %p: flags=%b, vers=%d, wire_count=%d, pa=0x%llx uobject=%p, uanon=%p, offset=0x%llx loan_count=%d [page ownership tracking disabled] vm_page_md %p >>> ANON DOES NOT POINT HERE <<< (%p) anon backpointer is OK checking object list page found on object list >>> PAGE NOT FOUND ON OBJECT LIST! <<< page found in uvm_pmemrange >>> page not found in uvm_pmemrange <<< checking pageq list page found on pageq list >>> PAGE NOT FOUND ON PAGEQ LIST! <<< MAP %p: [0x%lx->0x%lx] brk() allocate range: 0x%lx-0x%lx stack allocate range: 0x%lx-0x%lx sz=%u, ref=%d, version=%u, flags=0x%x pmap=%p(resident=%d) vm_refcnt=%d vm_shm=%p vm_rssize=%u vm_swrss=%u vm_tsize=%u vm_dsize=%u vm_taddr=%p vm_daddr=%p vm_maxsaddr=%p vm_minsaddr=%p - %p: 0x%lx->0x%lx: obj=%p/0x%llx, amap=%p/%d submap=%c, cow=%c, nc=%c, prot(max)=%d/%d, inh=%d, wc=%d, adv=%d hole=%c, free=%c, guard=0x%lx, free=0x%lx-0x%lx fspace_augment=%lu freemapped=%c, uaddr=%p (0x%lx-0x%lx %s) exeany[%d]brk/stackvmspplvmmpeplvmmpekpluvm_map_pageable_wire: stale mapmap->flags & VM_MAP_PAGEABLEuvm_mapent_alloc: cannot allocate map entryuvm_mapent_alloc: out of static map entries sel_min: 0x%lx, but should be at least 0x%lx sel_max: 0x%lx, but should be at most 0x%lx sel_min: 0x%lx, not aligned to 0x%lx sel_max: 0x%lx, not aligned to 0x%lx sel_min: 0x%lx, aligned to 0x%lx, expected 0x%lx sel_max: 0x%lx, aligned to 0x%lx, expected 0x%lx uvm_map_sel_limits(sz = %lu, guardpg = %c, align = 0x%lx, pmap_align = 0x%lx, pmap_off = 0x%lx, bias = %d, FREE_START(sel) = 0x%lx, FREE_END(sel) = 0x%lx)uvm_mapent_addr_removeuvm_mapent_addr_insert: entry still in addr listuvm_mapent_addr_insert: map %p entry %p (0x%lx-0x%lx G=0x%lx F=0x%lx) insert collision with entry %p (0x%lx-0x%lx G=0x%lx F=0x%lx)(entry->etype & UVM_ET_FREEMAPPED) != 0 || uaddr == NULLuvm_map_uaddr_e(map, entry) == uaddr(entry->etype & UVM_ET_FREEMAPPED) == 0entry == NULL || (entry->etype & UVM_ET_FREEMAPPED) == 0uvm_map_vmspace_update: vmspace %p invalid bounds: b=0x%lx-0x%lx s=0x%lx-0x%lx(map->flags & VM_MAP_ISVMSPACE) == 0(min & (vaddr_t)PAGE_MASK) == 0(max & (vaddr_t)PAGE_MASK) == 0 || (max & (vaddr_t)PAGE_MASK) == (vaddr_t)PAGE_MASKvmmaplkuvm_map_setup: rw_enter failed on new mapuvmspace_fork: no space in map for entry in empty mapuvm_map_splitentry: split address 0x%lx not on page boundary!orig->start < split && VMMAP_FREE_END(orig) > splitentry->start < addr && VMMAP_FREE_END(entry) > addr(entry)->end + (entry)->fspace > (start)(entry)->start < (end)last != first(first)->end + (first)->fspace > (start)(last)->start < (end)(iter)->end + (iter)->fspace > (start)(iter)->start < (end)RB_EMPTY(&map->addr)which != NULL(void*)map <= (void*)(which) && (void*)(which) < (void*)(map + 1)fork: encountered a submap during fork (illegal)fork: non-copy_on_write map entry marked needs_copy (illegal)uvm_map_teardown: rw_enter failed on free map(start & (vaddr_t)PAGE_MASK) == 0(end & (vaddr_t)PAGE_MASK) == 0 || (end & (vaddr_t)PAGE_MASK) == (vaddr_t)PAGE_MASK(start & (vaddr_t)PAGE_MASK) == 0 && (end & (vaddr_t)PAGE_MASK) == 0(sz & (vaddr_t)PAGE_MASK) == 0uobj == NULL && (flags & UVM_FLAG_FIXED) && (flags & (UVM_FLAG_OVERLAY | UVM_FLAG_COPYONW)) == 0(*addr & PAGE_MASK) == 0(map->flags & VM_MAP_ISVMSPACE) == VM_MAP_ISVMSPACE || uvm_maxkaddr >= *addr + szUVM_OBJ_IS_KERN_OBJECT(uobj)uvm_map_printitvmmapbsyBUSYWANTEDTABLEDCLEANCLEANCHKRELEASEDFAKERDONLY ZERO PAGER1FREEINACTIVEACTIVEENCRYPTPMAP0PMAP1PMAP2PMAP3uvm_unmap_removeuvm_mapent_freeuvm_mapent_allocuvm_map\../../../../uvm/uvm_mmap.c!UVM_ET_ISSUBMAP(entry)start >= entry->start!UVM_OBJ_IS_KERN_OBJECT(entry->object.uvm_obj)../../../../uvm/uvm_object.c!(pg->pg_flags & PG_RELEASED)pgs[i] != NULL!(pgs[i]->pg_flags & PG_RELEASED)../../../../uvm/uvm_page.c(pg->pg_flags & PG_TABLED) == 0dupe == NULL(pg->pg_flags & PG_DEV) == 0pg->pg_flags & PG_TABLEDsaved_loan_count == 0uvm_page_physget: called _after_ bootstrapuvm_page_physget: out of memory!uvm_setpagesize: page size not a power of two(alignment & (alignment - 1)) == 0(boundary & (boundary - 1)) == 0!(flags & UVM_PLA_WAITOK) ^ !(flags & UVM_PLA_NOWAIT)uvm_pglistalloc: Upper boundary 0x%lx not on pagemask. uvm_page_physdump: physical memory config [segs=%d of %d]: 0x%llx->0x%llx [0x%llx->0x%llx] STRATEGY = BSEARCH uvm_page_physload: page size not set!uvm_page_physload: start >= enduvm_page_physload: unable to load physical memory segment %d segments allocated, ignoring 0x%llx -> 0x%llx increase VM_PHYSSEG_MAX uvm_page_physload: can not malloc vm_page structs for segment ignoring 0x%lx -> 0x%lx uvm_page_physload: tried to add RAM after vm_mem_inituvm_pageboot_alloc: out of virtual spaceuvm_pageboot_alloc: out of memoryuvm_page_bootstrap: no memory pre-allocateduvm_page_init: lost %ld page(s) in initpg->wire_count == 0obj == NULL || anon == NULLoff == trunc_page(off)pg != NULL && TAILQ_NEXT(pg, pageq) == NULLsize 0 uvm_pagerealloc../../../../uvm/uvm_pager.cpseg != &psegs[PSEG_NUMSEGS]id >= 0 && id < MAX_PAGER_SEGSUVM_PSEG_INUSE(pseg, id)pseg->start == 0pseg->use == 0pagersegsize <= MAXBSIZEpppp->pg_flags & PG_BUSYnpages <= MAXPHYS >> PAGE_SHIFTswap || pg->uobject == uobj!write || (pgs[i]->pg_flags & PG_FAKE) == 0uvm_aio_aiodoneuvm_aio_aiodoneuvm_aio_biodonepagedaemon: deadlock detected! ../../../../uvm/uvm_pdaemon.canon != NULLp->loan_count > 0anon->an_swslot != 0uvmexp.swpginuse <= uvmexp.swpagespagedaemon: pageout returned invalid 'unlock' codep->uanon != NULLpgdaemonuvmpd_scan_inactivepmrwaituvm_wait: failed to free %ld pages between 0x%lx-0x%lx Ranges, use queue: * [0x%lx-0x%lx] use=%d nsegs=%ld maxsegsz[%d]=0x%lx free=0x%lx #ranges = %d ../../../../uvm/uvm_pmemrange.cpg_prev != NULL && pg_next != NULLpg_i->pg_flags & PQ_FREEstart == 0 || atop(VM_PAGE_TO_PHYS(found)) + found->fpgsz > start!TAILQ_EMPTY(pgl)pmr != NULL && pg != NULLsz >= 1nw != NULLpmr->high > pagenouvm_pmr_split: lost one pmr drain->nsegs == 0prev == NULL || atop(VM_PAGE_TO_PHYS(prev)) < pagenobefore > 0after > 0sz >= high - lowcount > 0 && (start == 0 || end == 0 || start < end) && align >= 1 && powerof2(align) && maxseg > 0 && (boundary == 0 || powerof2(boundary)) && (boundary == 0 || maxseg * boundary >= count) && TAILQ_EMPTY(result)flags & UVM_PLA_FAILOKpmemrange allocation error: allocated %ld pages in %d segments, but request was %ld pages in %d segmentsatop(VM_PAGE_TO_PHYS(&pg[i])) == atop(VM_PAGE_TO_PHYS(pg)) + iFlags: 0x%x, will panic now. (pg[i].pg_flags & PQ_FREE) == 0 && VALID_FLAGS(pg[i].pg_flags)pmr != NULL(pg->pg_flags & PQ_FREE) == 0 && VALID_FLAGS(pg->pg_flags)Current UVM status: pagesize=%d (0x%x), pagemask=0x%x, pageshift=%d %d VM pages: %d active, %d inactive, %d wired, %d free min %d%% (%d) anon, %d%% (%d) vnode, %d%% (%d) vtext pages %d anon, %d vnode, %d vtext freemin=%d, free-target=%d, inactive-target=%d, wired-max=%d faults=%d, traps=%d, intrs=%d, ctxswitch=%d fpuswitch=%d softint=%d, syscalls=%d, swapins=%d, swapouts=%d, kmapent=%d fault counts: noram=%d, noanon=%d, pgwait=%d, pgrele=%d ok relocks(total)=%d(%d), anget(retries)=%d(%d), amapcopy=%d neighbor anon/obj pg=%d/%d, gets(lock/unlock)=%d/%d cases: anon=%d, anoncow=%d, obj=%d, prcopy=%d, przero=%d daemon and swap counts: woke=%d, revs=%d, scans=%d, obscans=%d, anscans=%d busy=%d, freed=%d, reactivate=%d, deactivate=%d pageouts=%d, pending=%d, nswget=%d nswapdev=%d, nanon=%d, nanonneeded=%d nfreeanon=%d swpages=%d, swpginuse=%d, swpgonly=%d paging=%d kernel pointers: objs(kern)=%p ../../../../uvm/uvm_swap.cuvmexp.nswapdev >= 1sdp != NULLsdp->swd_npginuse >= nslotswarning: resource shortage: %d pages of swap lost swapdrum_addsw_reg_strategy: swap to sparse fileswap_off: swapdev not in listswap0x%04xdisklabel regionswap_on: miniroot larger than swap?swap_on: unable to preserve minirootPreserved %d pages of miniroot leaving %d pages of swap swapmount: no device swapmount: no device 2 /dev/%s%d%cblkdev0x%xminirootswapctl: miniroot copy failedswapctl: copystruvm_swap_init: can't get vnode for swap deviceswapmapuvm_swap_init: extent_create failedswp vnxswp vndvnx->vx_pending == 0flags & PGO_SYNCIOswstrategy: vnode type 0x%xswplksys_swapctluvm_swap_ioswap_decrypt: key not initializeduvm_coredump: user process with submap?sbrk: grow %ld failed, error = %d uvm_deallocate with null mapuvn_iosyncuvn_cluster: offset out of rangeuvn_attachuvnsyncuvn_getpageuvn_get../../../../uvm/uvm_vnode.cuobj->pgops->pgo_mk_pcluster != 0uvn_flshuvn_flush: PGO_SYNCIO return 'try again' error (impossible)uvn_flush: obj=%p, offset=0x%llx. error during pageout. uvn_flush: WARNING: changes to page may be lost! uvn_flushuvn_termuvm_vnp_terminate: io sync wanted bit setuvn_flushgif_output: recursively called too many times NULL pointer passed to ip_ecn_egressNULL pointer passed to ip_ecn_ingressin_gif_outputin6_gif_outputHuh? Thought in6_pcbnotify() never got called with mapped! in6_pcbnotifyin6_pcbconnectin6_prefixlen2maskin6_prefixlen2maskin6_ifpprefixin6_delmultiin6_addmultiin6_ifloop_requestin6_update_ifain6_controlin6_lifaddr_ioctl0123456789abcdefin6_update_ifain6_prefixlen2mask: invalid prefix length(%d) in6_are_prefix_equal: invalid prefix length(%d) in6_ifawithscope: output interface is not specified in6_savemkludge: no kludge spaceCouldn't unlink in6_ifaddr from in6_ifaddr in6_unlink_ifa: autoconf'ed address %p has no prefix ADDDELETEin6_ifloop_request: %s operation failed for %s (errno=%d) in6_purgeaddr: failed to remove a route to the p2p destination: %s on %s, errno=%d in6_update_ifa: a destination can be specified for a p2p or a loopback IF only in6_update_ifa: prefixlen should be 128 when dstaddr is specified in6_update_ifa: valid lifetime is 0 for %s in6_update_ifa: the prefix length of an existing (%s) address should not be changed in6_update_ifa: failed to remove a route to the old destination: %s in6_update_ifa: addmulti failed for %s on %s (errno=%d) prefix ioctls are now invalidated. please use ifconfig. nd6_prelist_add succeeded but no prefix invalid argument to in6_lifaddr_ioctldivert6_packetdivert6_usrreq%s: didn't unlink in6ifaddr from list in6_ifattach_loopback: failed to configure the loopback address on %s (errno=%d) %s: got interface identifier from itself %s: got interface identifier from %s %s: borrow interface identifier from %s %s: interface identifier generated by random number %s: failed to get interface identifier %s: ifid: %02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x %s: no ifid available in6_ifattach_linklocal: failed to configure a link-local address on %s (errno=%d) ia == NULL in in6_ifattach_linklocalin6_ifattach: %s has too small MTU, IPv6 not enabled in6_ifattach: %s is not multicast capable, IPv6 not enabled in6_ifdetachin6_nigroupget_last_resort_ifidin6_ifattach_loopbackin6_ifattach_linklocalin6_ifattachin6_cksum: mbuf len (%d) < off+len (%d+%d)in6_cksum: out of datain6_selectsrcinternet6%s:%d: ip6q lock not held ../../../../netinet6/frag6.cip6q lock check%s:%d: ip6q already locked ip6q_lockfrag6_inputicmp6_redirect_outputicmp6_mtudisc_updateicmp6_redirect_inputicmp6_reflecticmp6_notify_erroricmp6_rip6_inputni6_inputicmp6_redirect_timeout: bad route to timeouticmp6_mtudisc_timeout: bad route to timeout(src=%s dst=%s tgt=%s)ICMP6 redirect sent from %s rejected; must be from linklocal ICMP6 redirect sent from %s rejected; hlim=%d (must be 255) ICMP6 redirect rejected; redirect dst must be unicast: %s ICMP6 redirect rejected; no route with inet6 gateway found for redirect dst: %s ICMP6 redirect rejected; not equal to gw-for-src=%s (must be same): %s ICMP6 redirect rejected; no route found for redirect dst: %s ICMP6 redirect rejected; neither router case nor onlink case: %s icmp6_redirect_input: invalid ND option, rejected: %s icmp6_redirect_input: lladdrlen mismatch for %s (if %d, icmp6 packet %d): %s sanity fail: off=%lx, sizeof(ip6)=%lx in %s:%d ../../../../netinet6/icmp6.cicmp6_reflect: source can't be determined: dst=%s, error=%d icmp6_notify_error: in6_embedscope failed ICMP6 checksum error(%d|%x) %s icmp6_input: unknown type %d(src=%s, dst=%s, ifid=%d) ENOBUFS in icmp6_error %d icmp6_mtudisc_callback_registerOpenBSD-currentip6_nexthdr: m == NULLip6_pullexthdr: invalid nxt=%d ip6_input: packet to an unready address %s->%s ip6_initip6_nexthdrip6_savecontrolip6_inputcannot forward from %s to %s nxt %d received on %s ip6_forward: tag of length %d (should be %dcannot forward src %s, dst %s, nxt %d, rcvif %s, outif %s ip6_forwardadd_m6fc: %s o %s g %s p %x dbx %p register_mifip6_mforward: ip6_mrouter socket queue full del_m6fcdel_m6ifregister_sendip6_mdqadd_m6ifip6_mrouter_doneip6_mforwardip6_setpktopt: impossible case ip6_getpcbopt: unexpected optionip6_output: IPv4 pcb is passedip6_output: tag of length %d (should be %dassumption failed: hdr not splitip6_setmoptionsip6_getpcboptip6_ctloutputip6_outputscope error in prefix list (%s) nd6_storelladdr: something odd happens nd6_storelladdr: sdl_alen == 0, dst=%s, if=%s nd6_init called more than once(ignored) ndopts == NULL in nd6_optionuninitialized ndopts in nd6_optionndopts == NULL in nd6_optionsuninitialized ndopts in nd6_optionsduplicated ND6 option found (type=%d) nd6_options: unsupported option %d - option ignored too many loop in nd opt unspecnd6_lookup: failed to lookup %s (if = %s) nd6_output: can't allocate llinfo for %s (ln=%p, rt=%p) nd6_rtrequest: bad gateway value: %s nd6_rtrequest: malloc failed %s: failed to join %s (errno=%d) ifp == NULL in nd6_cache_lladdrfrom == NULL in nd6_cache_lladdrndp info overwritten for %s by %s on %s nd6_setmtu0: new link MTU on %s (%lu) is too small for IPv6 ln->ln_rt == NULLln->ln_rt->rt_ifp == NULLrt_llinfo(%p) is not equal to ln(%p)dst=0 in nd6_timer(ln=%p)default router list contains a non-linklocal address(%s) a router(%s) advertises a prefix with non-link local address nd6_lookupnd6_rtrequestnd6_freend6_ioctlnd6_dad_duplicated: DAD structure not found %s: DAD detected duplicate IPv6 address %s: NS in/out=%d/%d, NA in=%d %s: DAD complete for %s - duplicate found %s: manual intervention required ifa == NULL in nd6_dad_na_inputifa == NULL in nd6_dad_ns_inputnd6_na_output: max_linkhdr + maxlen >= MCLBYTES (%d + %d > %d) nd6_na_output: insufficient MCLBYTESnd6_na_output: source can't be determined: dst=%s, error=%d nd6_ns_output: max_linkhdr + maxlen >= MCLBYTES (%d + %d > %d) nd6_ns_output: insufficient MCLBYTESnd6_ns_output: source can't be determined: dst=%s, error=%d nd6_dad_start: called with non-tentative address %s(%s) nd6_dad_start: ifa->ifa_ifp == NULLnd6_dad_start: memory allocation failed for %s(%s) %s: starting DAD for %s nd6_ns_input: invalid hlim (%d) from %s to %s on %s nd6_ns_input: bad DAD packet (wrong ip6 dst) nd6_ns_input: NS packet from non-neighbor nd6_ns_input: bad NS target (multicast) nd6_ns_input: invalid ND option, ignored nd6_ns_input: bad DAD packet (link-layer address option) nd6_ns_input: lladdrlen mismatch for %s (if %d, NS packet %d) nd6_ns_input: duplicate IP6 address %s nd6_ns_input: src=%s nd6_ns_input: dst=%s nd6_ns_input: tgt=%s nd6_na_input: invalid hlim (%d) from %s to %s on %s nd6_na_input: invalid target address %s nd6_na_input: a solicited adv is multicasted nd6_na_input: invalid ND option, ignored nd6_na_input: multicast adv without TLLA nd6_na_input: duplicate IP6 address %s nd6_na_input: ND packet from non-neighbor nd6_na_input: lladdrlen mismatch for %s (if %d, NA packet %d) nd6_dad_timer: called with null parameter nd6_dad_timer: DAD structure not found nd6_dad_timer: called with duplicated address %s(%s) nd6_dad_timer: called with non-tentative address %s(%s) %s: could not run DAD, driver problem? %s: DAD complete for %s - no duplicates found nd6_na_outputnd6_ns_outputnd6_ns_inputnd6_na_inputin6_init_prefix_ltimes: preferred lifetime(%d) is greater than valid lifetime(%d) in6_ifadd: wrong prefixlen for %s (prefix=%d ifid=%d) in6_ifadd: failed to make ifaddr %s on %s (errno=%d) nd6_prefix_onlink: %s/%d is already on-link nd6_prefix_onlink: failed to find any ifaddr to add route for a prefix(%s/%d) on %s nd6_prefix_onlink: failed to add route for a prefix (%s/%d) on %s, gw=%s, mask=%s, flags=%lx errno = %d nd6_prefix_offlink: %s/%d is already off-link nd6_prefix_offlink: failed to recover a prefix %s/%d from %s to %s (errno = %d) nd6_prefix_offlink: failed to delete route: %s/%d on %s (errno = %d) pfxlist_onlink_check: failed to make %s/%d offlink, errno=%d prelist_remove: failed to make %s/%d offlink on %s, errno=%d prelist_remove: negative count on %s nd6_prelist_add: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_update: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_update: nd6_prelist_add failed for %s/%d on %s errno=%d, returnpr=%p dr == NULL in defrouter_delreqdefrouter_select: called unexpectedly (forwarding=%d, accept_rtadv=%d) defrouter_select: more than one router is installed defrtrlist_del: negative count on %s nd6_ra_input: invalid hlim (%d) from %s to %s on %s nd6_ra_input: src %s is not link-local nd6_ra_input: invalid ND option, ignored nd6_ra_input: invalid option len %d for prefix information option, ignored nd6_ra_input: invalid prefix len %d for prefix information option, ignored nd6_ra_input: invalid prefix %s, ignored nd6_ra_input: invalid prefixlen %d for rfc2374 prefix %s, ignored nd6_ra_input: bogus mtu option mtu=%lu sent from %s, ignoring nd6_ra_input: bogus mtu mtu=%lu sent from %s; exceeds maxmtu %lu, ignoring nd6_ra_input: lladdrlen mismatch for %s (if %d, RA packet %d) nd6_rs_input: invalid hlim (%d) from %s to %s on %s nd6_rs_input: invalid ND option, ignored nd6_rs_input: lladdrlen mismatch for %s (if %d, RS packet %d) in6_ifaddnd6_prefix_onlinknd6_prefix_offlinkdefrouter_delreqdefrouter_addreqnd6_ra_inputnd6_rs_inputrip6_outputrip6_inputrip6_usrreqrip6_attachrip6_detachrip6_usrrequdp6_outputPF_KEYpfkeyv2_policypfkeyv2_send @@@@@(@(   aesctr3desdesblowfishcast128lzshmac-ripemd160hmac-md5hmac-sha2-256hmac-sha2-384hmac-sha2-512pfkeyv2_parsemessagegetflags: %x CLGET: returning %x ttcompatK%  `   X,nK22Kn,X `%K w0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-invalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far back     A@!  @a`10  @`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O incorrect header checkunknown compression methodinvalid window sizeunknown header flags setheader crc mismatchincorrect data checkincorrect length check     A@!  @a`10  @`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O @@ !1Aa  0@` #+3;CScs##h#h #h# ## # # #need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible version-)-)(/-)8-)H-)X-)h-)-)/   L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c            (08@P`p   0@`  0@`_bus_dmamem_mmap: not implemented_bus_dmamap_load_uio: not implementediommu_dmamem_unmapiommu_dmamem_map: nsegs = %diommu_dmamem_map: size botchwarning: %ld of DVMA space lost iommu_dmamap_load_raw: size botchcache-coherence?page-sizeiommu_attach: can't allocate memory for pagetablesbad iommu range: %d: version 0x%x/0x%x, page-size %d, range %dMB iommu addr %p vec 0x%xvmebus: no rangesrangesvme: PROM ranges too large: %d: version 0x%x vmevmesvmelvmelattach: can't allocate intrhandvmesattach: can't allocate intrhandobioobio: PROM ranges too large: %deepromcould not find %s amongst obio devices zsvmeintr_establish: interrupt vector not allocatedvmeintr_establish: uninitialized vecvme_addirqvme: spurious interruptvme: spurious interrupt counterinterrupt-6-7/-7auxiliary-ioauxioauxio2Tadpoleno aux registerauxregWARNING: preposterous time in file system WARNING: bad date in battery clocklostgainedWARNING: clock %s %d days -- CHECK AND RESET THE DATE! oldclk statintroclock0: cannot get %d Hz clock; using 100 Hz clock0: cannot get %d Hz clock; using 100 Hz clock0: cannot get %d Hz statclock; using 100 Hz delay calibration delay constant %d [TOO SMALL?] delay constant %d%s oclock: calibration failing; clamped at %d counter-timermk48t02model: %s (eeprom) mk48t08oclockclockpowerleds߿version 0x%xpsr-implementationpsr-versionimplementationversionclock-frequencymmu-npmgmmu-nctx[viking: turn on PCR_TC][viking: PCR_TC is off]physical %s%dK instruction (%d b/l)%s%dK data (%d b/l)physical %dK combined cache (%d bytes/line)throughback%dK byte write-%s, %d bytes/line, %cw flush%s%dK external (%d b/l)vac-sizevac_hwflushvac-hwflushvac-linesizebad cache line size %dbuserr-typeUnknown CPU type: cpu: impl %d, vers %d; mmu: impl %d, vers %dcache chip bug - trap page uncachedmidsun4csun4esun4m%s @ %s MHz, %s FPU: %s%s, %s; %scache-physical?ncachesicache-nlinesdcache-nlinesicache-line-sizebad icache line size %dicache-associativitydcache-line-sizebad dcache line size %ddcache-associativitycache-nlinescache-line-sizecache-associativityecache-nlinesecache-line-sizebad ecache line size %decache-associativitywarning: couldn't identify cache sun4cpuMB86900/1A or L64801L64811CY7C601W8601/8701 or MB86903MB86904MB86907CY7C601/604CY7C601/605 (v.b)CY7C601/605 (v.c)CY7C601/605 (v.f)CY7C611RT620/625TMS390Z50 v0 or TMS390Z55TMS390Z50 v1TMS390S10TI_MS2TI_4_3TI_4_4MB86910 or WTL1164/5MB86911 or WTL1164/5L64802 or ACT8847WTL3170/2on-chipL64804L64812 or ACT8847L64814TMS390C602ART602 or WTL3171B5010 or B5110/20 or B5210cpu_attachmemory error:sfsr=%b sfva=0x%xCSERRPARITYSYSERR UNCORR TIMEOUT BUSERRFAVOWafsr=%b afva=0x%xSYSERR UNCORR TIMEOUT BUSERRAFOhard memory errorstore buffer copy-back failure at 0x%x. Retrying... warning: got data fault with no faulting address. Ignoring. HyperSPARC async cache memory failure at phys 0x%x%x %ssync mem err: ser=%b sva=0x%x WRITEINVALPROTTIMEOUTSBUSERRMEMERRSZERRWATCHDOGaer=%b ava=0x%x WBINVALTIMEOUTDVMAERRparity error register = %b ERRMULTITESTENABLEBYTE0BYTE1BYTE2BYTE3memory errormemregattachmemory-errormemreg channel %dzs_set_speedstdin-pathconsinit: increase buffer size and recompile consinit: bogus stdin path %s. keyboarddevice_typeserialstdout-pathconsinit: bogus stdout path %s. displaycninit: mismatched PROM output selector cninit: invalid inSource=%d console is %s cninit: zs not mapped. slavezsattach: expected 1 interrupt, got %d pri %d, softpri %d mousebroken zs interrupt schemepwr-on-auxio2keyboard/displayttyattybttycttydconsinitfdc%s: %s: state %d (st0 %b cyl %d) invldabnrmlseek_cmpltequ_chckdrive_notrdytop_head (st0 %b st1 %b st2 %b cyl %d head %d sec %d) end_of_cylbad_crcdata_overrunsec_not_fndwrite_protectno_amctrl_mrkbad_crcwrong_cylscn_eqscn_not_fndbad_cylno_dam fdcstatus: weird size: %d drive %dfdcresult: overrun fdcresult: timeout %s: read-only medium %s: no medium? hard errorcontroller statusfdcintr: block %d != blkno %lld timeoutsoft errorstray interruptfdcstart: not idle fdstrategy: controller inactive : %s %d cyl, %d head, %d sec : density unknown pri %d, softpri %d: unable to register fast trap handler %s: no drives attached CFGLOCK: unexpected responsechip 8207%c SUNW,fdtwofdc: ierror status: state %d fdc: spurious interrupt: state %d %s: timeout but no I/O pending: statu %d, istatus=%d 1.44MB720KB360KB/x1.2MB/NECslave-only%s: dma card found in non-dma sbus slot %d: not supported relative sbus addressing not supported"%s" at %s class %s slot %d offset 0x%x: %s MHz burst-sizessbussbus: PROM ranges too large: %dvm-I%s: reset: invalid keyboard type 0x%02x sunkbd_input;X?@ABC8jgFˋ )v7SrGHIJ !"#$%&'(+KLMRɒE*,-./0123456OPQ:s9tN '&     1!2@ 3#!4$"5%#6^$7&%8*&9('0)(-_)=+*`~+,-=.//*12.345 6q7w8e9r:t;y<u=i>o?p@[{A]}BC D7E8F9G-HIJLM aNsOdPfQgRhSjTkUlV;:W'"X\|Y Z [4\5]6^0_`ab cdzexfcgvhbinjmk,m/?no p1q2r3vwxy z{}+ ]}&12 "3!'4"(5#6$7%!8&9\'0()~)-_#**|6a7z@A`$@M qVmMW%X[{dwj,?k;.l:/m=+w |<> &12~ "3#!'4{"(5[#-6|$7`%_8\&9^'0@()])=+}*6a7z@A$M qVmW%X*dwj,?k;.l:/m!|<> ~^2"@ 3#!4$#6&$7/{%8([&9)]'0=}(+?)|*'*`@AC LVWXk,;l.:m-_w|<>\ 2"@ 3#!4$"5%~#6&^$7/{%8([&9)]'0=}(+?)|**`@AVWX\*`k,;l.:m-_|<>\ ]} 2" 3#6&$7/%8(`&9)''0=|(?\)*#^@;z@A+~LVWX[{dyjmMk,;l.:m-_w|<> 2" 3#6&$7/{%8([&9)]'0=}(?\)*^6qQ@;z@A+~VWX#'`dyjmMk,;l.:m-_|<>| ]}2" 3#6&$7/%8(&9)\'0=|('?`)^*@A+*~LV@W#X[{k,;l.:m-_w|<> 2" 3#6&$7/%8({&9)}'0=('?`)^*\|@[A+*]V@W#X~k,;l.:m-_|<> \|1!2" 3#!4$"5%#6&$7_%8({&9)}'0'`(/?) *<>@A*~NsSV+WX@dzZexXfcCjmMk,;l.:m-=w }][ 1!2" 3#!4$"5%#6&$7_%8({&9)}'0'`(/?\) *@@A*|~NsSV+WX<>^dzZexXfcCjmMk,;l.:m-=}][ ~^2"@ 3#!4$#6&$7/{%8([&9)]'0=}(+?)\*'*`@ALVWX|k,;l.:m-_w}<> 2"@ 3#!4$"5%~#6&^$7/{%8([&9)]'0=}(+?)\*|@AVWX'*`k,;l.:m-_}<> ]}2"@ 3#!4$#6&$7/%8(&9)\'0=|('?`)*^@*+A~LVWX[{k,;l.:m-_w}<> 2"@ 3#!4$"5%~#6&^$7/{%8([&9)]'0=}('?`)*\|@+*AVWXk,;l.:m-_}<> ]}2"@ 3#"5%#6&$7/%8(&9)\'0=|('?`)*>oO@^A+*~LMaAVWX[{k,;l.:m-_w}<> 1!|2"@ 3#!4$^"5%~#6&$7/%8(&9)'0=('?`)*\@[A+*]VW{X}k,;l.:m-_}<> ~^2"@ 3#!4$#6&$7/{%8([&9)]'0=}(+?\)*'*`@AC LVWXk,;l.:m-_w|<>|)'`A^~ ~^2"@ 3#!4$#6&$7/{%8([&9)]'0=}(+?\)*@AC LVWX'*`k,;l.:m-_w|<>| >}1+!2"@ 3*#!4"5%~#6&$7/|%8(&9)\'0=^('?`)*$;z@AC LVWX<{dyjmMk,;l.:m-_w|][\ 1+|2"@ 3*#!4^"5%~#6&$7/%8(&9)'0=`('?)*$;z@[A!]VW{X$}dyk,;l.:m-_|<>\ >}1+!2"@ 3*#!4"5%~#6&$7/|%8(&9)\'0=^('?`)*$;z@AC LVWX<{dyjmMk,;l.:m-_w|][\ 1+|2"@ 3*#!4^"5%~#6&$7/%8(&9)'0=`('?)*$;z@[A!]VW{X$}dyk,;l.:m-_|<>\1!|!3#(-_C 2" 3*`W'@X#~|\|2"#6&$7'%8(&9)'0(-=)^~*|@@`A[{V;+W:*X]}|\_-J `-LT-OO-Nj V-V `-LM-Pj-R L-SP-Tb-Xb-Z O-WV  -W-[|-JN-PHL-O O-VZ-MC-Q~,-[i-R J-TBK-UvU-YdU-Z O-X  -W-[       %s: input overrun zsms#p###T#(zs_shutdown: not enabled?zstty%s: %d silo overflow%s, %d ibuf flood%s flags 0x%x input output: console%szstty_attachzsopen: failed to set baudrate : failed to set modes : no keyboard , flags 0x%xkeyboard-click?true: keyboard, type 5, layout 0x%x: keyboard, type %d, layout 0x%xzskbdzskbd_rxsoftOUI 0x%06x model 0x%04x rev %d at %s phy %dmii_detach: phyloc and offloc specifiedmii_attach: phyloc and offloc specifiedmiiautmii_phy_setmediamii_phy_setmedia: MASTER on wrong media!A  !@@@@: %s, rev. %d nsphyDP83840 10/100 PHY$6$38$5-bnsphyterDP83815 10/100 PHYDP83843 10/100 PHYDP83847 10/100 PHY$9$8X$+-b-c-c(: Generic ten-bit interface, rev. %d gentbi$=$cookie != NULL in scsi_xs_syncxs->done != NULL in scsi_xs_syncsyncxsscsi_link_shutdown: scsi_xshandler on linkscsi_link_shutdown: scsi_xshandler on poolpendxsscsiiomvscsi_xfer pool exhausted! scxsplscsiplugscsi_cmd_rw_decode: bad opcode 0x%02xNo Additional SenseSoft ErrorNot ReadyMedia ErrorHardware ErrorIllegal RequestUnit AttentionWrite ProtectedBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare ErrorReservedNo Additional Sense InformationFilemark DetectedEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnCleaning RequestedErase Operation In ProgressLocate Operation In ProgressRewind Operation In ProgressSet Capacity Operation In ProgressVerify Operation In ProgressNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Not Ready, Rebuild In ProgressLogical Unit Not Ready, Recalculation In ProgressLogical Unit Not Ready, Operation In ProgressLogical Unit Not Ready, Long Write In ProgressLogical Unit Not Ready, Self-Test In ProgressLogical Unit Not Accessible, Asymmetric Access State TransitionLogical Unit Not Accessible, Target Port In Standby StateLogical Unit Not Accessible, Target Port In Unavailable StateLogical Unit Not Ready, Structure Check RequiredLogical Unit Not Ready, Auxiliary Memory Not AccessibleLogical Unit Not Ready, Notify (Enable Spinup) RequiredLogical Unit Not Ready, OfflineLogical Unit Not Ready, SA Creation In ProgressLogical Unit Not Ready, Space Allocation In ProgressLogical Unit Not Ready, Robotics DisabledLogical Unit Not Ready, Configuration RequiredLogical Unit Not Ready, Calibration RequiredLogical Unit Not Ready, A Door Is OpenLogical Unit Not Ready, Operating In Sequential ModeLogical Unit Not Ready, Start Stop Unit Command In ProgressLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorLogical Unit Communication CRC Error (ULTRA-DMA/32)Unreachable Copy TargetTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureHead Select FaultError Log OverflowWarningWarning - Specified Temperature ExceededWarning - Enclosure DegradedWarning - Background Self-Test FailedWarning - Background Pre-Scan Detected Medium ErrorWarning - Background Medium Scan Detected Medium ErrorWarning - Non-Volatile Cache Now VolatileWarning - Degraded Power To Non-Volatile CacheWarning - Power Loss ExpectedWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedWrite Error - Recommend ReassignmentCompression Check Miscompare ErrorData Expansion Occurred During CompressionBlock Not CompressibleWrite Error - Recovery NeededWrite Error - Recovery FailedWrite Error - Loss Of StreamingWrite Error - Padding Blocks AddedAuxiliary Memory Write ErrorWrite Error - Unexpected Unsolicited DataWrite Error - Not Enough Unsolicited DataDefects In Error WindowError Detected By Third Party Temporary InitiatorThird Party Device FailureCopy Target Device Not ReachableIncorrect Copy Target Device TypeCopy Target Device Data UnderrunCopy Target Device Data OverrunInvalid Information UnitInformation Unit Too ShortInformation Unit Too LongID CRC Or ECC ErrorLogical Block Guard Check FailedLogical Block Application Tag Check FailedLogical Block Reference Tag Check FailedLogical Block Protection Error On Recover Buffered DataLogical Block Protection Method ErrorUnrecovered Read ErrorRead Retries ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block ReadNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite The DataDe-Compression CRC ErrorCannot Decompress Using Declared AlgorithmError Reading UPC/EAN NumberError Reading ISRC NumberRead Error - Loss Of StreamingAuxiliary Memory Read ErrorRead Error - Failed Retransmission RequestRead Error - LBA Marked Bad By Application ClientAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRecord Not Found - Recommend ReassignmentRecord Not Found - Data Auto-ReallocatedLocate Operation FailureRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorData Sync Error - Data RewrittenData Sync Error - Recommend RewriteData Sync Error - Data Auto-ReallocatedData Sync Error - Recommend ReassignmentRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data Without ECC - Data RewrittenRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With L-ECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteRecovered Data With ECC - Data RewrittenRecovered Data With LinkingDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationMiscompare Verify Of Unmapped LbaRecovered ID with ECCPartial Defect List TransferInvalid Command Operation CodeAccess Denied - Initiator Pending-EnrolledAccess Denied - No Access rightsAccess Denied - Invalid Mgmt ID KeyIllegal Command While In Write Capable StateObsoleteIllegal Command While In Explicit Address ModeIllegal Command While In Implicit Address ModeAccess Denied - Enrollment ConflictAccess Denied - Invalid LU IdentifierAccess Denied - Invalid Proxy TokenAccess Denied - ACL LUN ConflictIllegal Command When Not In Append-Only ModeLogical Block Address Out of RangeInvalid Element AddressInvalid Address For WriteInvalid Write Crossing Layer JumpIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBCDB Decryption ErrorSecurity Audit Value FrozenSecurity Working Key FrozenNonce Not UniqueNonce Timestamp Out Of RangeInvalid XCDBLogical Unit Not SupportedInvalid Field In Parameter ListParameter Not SupportedParameter Value InvalidThreshold Parameters Not SupportedInvalid Release Of Persistent ReservationData Decryption ErrorToo Many Target DescriptorsUnsupported Target Descriptor Type CodeToo Many Segment DescriptorsUnsupported Segment Descriptor Type CodeUnexpected Inexact SegmentInline Data Length ExceededInvalid Operation For Copy Source Or DestinationCopy Segment Granularity ViolationInvalid Parameter While Port Is EnabledInvalid Data-Out Buffer Integrity Check ValueData Decryption Key Fail Limit ReachedIncomplete Key-Associated Data SetVendor Specific Key Reference Not FoundHardware Write ProtectedLogical Unit Software Write ProtectedAssociated Write ProtectPersistent Write ProtectPermanent Write ProtectConditional Write ProtectSpace Allocation Failed Write ProtectNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedFormat-Layer May Have ChangedImport/Export Element Accessed, Medium ChangedPower On, Reset, or Bus Device Reset OccurredPower On OccurredSCSI Bus Reset OccurredBus Device Reset Function OccurredDevice Internal ResetTransceiver Mode Changed to Single EndedTransceiver Mode Changed to LVDI_T Nexus Loss OccurredParameters ChangedMode Parameters ChangedLog Parameters ChangedReservations PreemptedReservations ReleasedRegistrations PreemptedAsymmetric Access State ChangedImplicit Asymmetric Access State Transition FailedPriority ChangedCapacity Data Has ChangedError History I_T Nexus ClearedError History Snapshot ReleasedError Recovery Attributes Have ChangedData Encryption Capabilities ChangedTimestamp ChangedData Encryption Parameters Changed By Another I_T NexusData Encryption Parameters Changed By Vendor Specific EventData Encryption Key Instance Counter Has ChangedSA Creation Capabilities Data Has ChangedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedCurrent Program Area Is Not EmptyCurrent Program Area Is EmptyIllegal Power Condition RequestPersistent Prevent ConflictPrevious Busy StatusPrevious Task Set Full StatusPrevious Reservation Conflict StatusPartition Or Collection Contains User ObjectsNot ReservedORWrite Generation Does Not MatchOverwrite Error On Update In PlaceInsufficient Time For OperationCommands Cleared By Another InitiatorCommands Cleared By Power Loss NotificationCommands Cleared By Device ServerIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledCannot Write Medium - Unknown FormatCannot Write Medium - Incompatible FormatCannot Format Medium - Incompatible MediumCleaning FailureCannot Write - Application Code MismatchCurrent Session Not Fixated For AppendCleaning Request RejectedMedium Not FormattedIncompatible Volume TypeIncompatible Volume QualifierCleaning Volume ExpiredMedium Format CorruptedFormat Command FailedZoned Formatting Failed Due To Spare LinkingNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorEnclosure FailureEnclosure Services FailureUnsupported Enclosure FunctionEnclosure Services UnavailableEnclosure Services Transfer FailureEnclosure Services Transfer RefusedRibbon, Ink, or Toner FailureRounded ParameterEvent Status NotificationESN - Power Management Class EventESN - Media Class EventESN - Device Busy Class EventSaving Parameters Not SupportedMedium Not PresentMedium Not Present - Tray ClosedMedium Not Present - Tray OpenMedium Not Present - LoadableMedium Not Present - Medium Auxiliary Memory AccessibleSequential Positioning ErrorTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyEnd Of Medium ReachedMedium Magazine Not AccessibleMedium Magazine RemovedMedium Magazine InsertedMedium Magazine LockedMedium Magazine UnlockedMechanical Positioning Or Changer ErrorRead Past End Of User ObjectElement DisabledElement EnabledData Transfer Device RemovedData Transfer Device InsertedInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetLogical Unit FailureTimeout On Logical UnitLogical Unit Failed Self-TestLogical Unit Unable To Update Self-Test LogTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has Changedcomponent Device AttachedDevice Identifier ChangedRedundancy Group Created Or ModifiedRedundancy Group DeletedSpare Created Or ModifiedSpare DeletedVolume Set Created Or ModifiedVolume Set DeletedVolume Set DeassignedVolume Set ReassignedReported LUNs Data Has ChangedEcho Buffer OverwrittenMedium LoadableMedium Auxiliary Memory AccessibleiSCSI IP Address AddediSCSI IP Address RemovediSCSI IP Address ChangedRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureATA Device Failed Set FeaturesSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorData Phase CRC Error DetectedSCSI Parity Error Detected During ST Data PhaseInformation Unit iuCRC Error DetectedAsynchronous Information Protection Error DetectedProtocol Service CRC ErrorPHY Test Function In ProgressSome Commands Cleared By iSCSI Protocol EventInitiator Detected Error Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorInvalid Target Port Transfer Tag ReceivedToo Much Write DataACK/NAK TimeoutNAK ReceivedData Offset ErrorInitiator Response TimeoutConnection LostLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureErase Failure - Incomplete Erase Operation DetectedCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedMedium Removal Prevented By Data Transfer ElementMedium Thread Or Unthread FailureVolume Identifier InvalidVolume Identifier MissingDuplicate Volume IdentifierElement Status UnknownSCSI To Host System Interface FailureSystem Resource FailureSystem Buffer FullInsufficient Reservation ResourcesInsufficient ResourcesInsufficient Registration ResourcesInsufficient Access Control ResourcesAuxiliary Memory Out Of SpaceQuota ErrorMaximum Number Of Supplemental Decryption Keys ExceededMedium Auxiliary Memory Not AccessibleData Currently UnavailableInsufficient Power For OperationUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change InputOperator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedFailure Prediction Threshold ExceededMedia Failure Prediction Threshold ExceededLogical Unit Failure Prediction Threshold ExceededSpare Area Exhaustion Prediction Threshold ExceededHardware Impending Failure General Hard Drive FailureHardware Impending Failure Drive Error Rate Too HighHardware Impending Failure Data Error Rate Too HighHardware Impending Failure Seek Error Rate Too HighHardware Impending Failure Too Many Block ReassignsHardware Impending Failure Access Times Too HighHardware Impending Failure Start Unit Times Too HighHardware Impending Failure Channel ParametricsHardware Impending Failure Controller DetectedHardware Impending Failure Throughput PerformanceHardware Impending Failure Seek Time PerformanceHardware Impending Failure Spin-Up Retry CountHardware Impending Failure Drive Calibration Retry CountController Impending Failure General Hard Drive FailureController Impending Failure Drive Error Rate Too HighController Impending Failure Data Error Rate Too HighController Impending Failure Seek Error Rate Too HighController Impending Failure Too Many Block ReassignsController Impending Failure Access Times Too HighController Impending Failure Start Unit Times Too HighController Impending Failure Channel ParametricsController Impending Failure Controller DetectedController Impending Failure Throughput PerformanceController Impending Failure Seek Time PerformanceController Impending Failure Spin-Up Retry CountController Impending Failure Drive Calibration Retry CountData Channel Impending Failure General Hard Drive FailureData Channel Impending Failure Drive Error Rate Too HighData Channel Impending Failure Data Error Rate Too HighData Channel Impending Failure Seek Error Rate Too HighData Channel Impending Failure Too Many Block ReassignsData Channel Impending Failure Access Times Too HighData Channel Impending Failure Start Unit Times Too HighData Channel Impending Failure Channel ParametricsData Channel Impending Failure Controller DetectedData Channel Impending Failure Throughput PerformanceData Channel Impending Failure Seek Time PerformanceData Channel Impending Failure Spin-Up Retry CountData Channel Impending Failure Drive Calibration Retry CountServo Impending Failure General Hard Drive FailureServo Impending Failure Drive Error Rate Too HighServo Impending Failure Data Error Rate Too HighServo Impending Failure Seek Error Rate Too HighServo Impending Failure Too Many Block ReassignsServo Impending Failure Access Times Too HighServo Impending Failure Start Unit Times Too HighServo Impending Failure Channel ParametricsServo Impending Failure Controller DetectedServo Impending Failure Throughput PerformanceServo Impending Failure Seek Time PerformanceServo Impending Failure Spin-Up Retry CountServo Impending Failure Drive Calibration Retry CountSpindle Impending Failure General Hard Drive FailureSpindle Impending Failure Drive Error Rate Too HighSpindle Impending Failure Data Error Rate Too HighSpindle Impending Failure Seek Error Rate Too HighSpindle Impending Failure Too Many Block ReassignsSpindle Impending Failure Access Times Too HighSpindle Impending Failure Start Unit Times Too HighSpindle Impending Failure Channel ParametricsSpindle Impending Failure Controller DetectedSpindle Impending Failure Throughput PerformanceSpindle Impending Failure Seek Time PerformanceSpindle Impending Failure Spin-Up Retry CountSpindle Impending Failure Drive Calibration Retry CountFirmware Impending Failure General Hard Drive FailureFirmware Impending Failure Drive Error Rate Too HighFirmware Impending Failure Data Error Rate Too HighFirmware Impending Failure Seek Error Rate Too HighFirmware Impending Failure Too Many Block ReassignsFirmware Impending Failure Access Times Too HighFirmware Impending Failure Start Unit Times Too HighFirmware Impending Failure Channel ParametricsFirmware Impending Failure Controller DetectedFirmware Impending Failure Throughput PerformanceFirmware Impending Failure Seek Time PerformanceFirmware Impending Failure Spin-Up Retry CountFirmware Impending Failure Drive Calibration Retry CountFailure Prediction Threshold Exceeded (false)Low Power Condition OnIdle Condition Activated By TimerStandby Condition Activated By TimerIdle Condition Activated By CommandStandby Condition Activated By CommandIDLE_B Condition Activated By TimerIDLE_B Condition Activated By CommandIDLE_C Condition Activated By TimerIDLE_C Condition Activated By CommandSTANDBY_Y Condition Activated By TimerSTANDBY_Y Condition Activated By CommandPower State Change To ActivePower State Change To IdlePower State Change To StandbyPower State Change To SleepPower State Change To Device ControlLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackPacket Does Not Fit In Available SpaceIllegal Mode For This TrackInvalid Packet SizeVoltage FaultAutomatic Document Feeder Cover UpAutomatic Document Feeder Lift UpDocument Jam In Automatic Document FeederDocument Miss Feed Automatic In Document FeederConfiguration FailureConfiguration Of Incapable Logical Units FailedAdd Logical Unit FailedModification Of Logical Unit FailedExchange Of Logical Unit FailedRemove Of Logical Unit FailedAttachment Of Logical Unit FailedCreation Of Logical Unit FailedAssign Failure OccurredMultiply Assigned Logical UnitSet Target Port Groups Command FailedATA Device Feature Not EnabledLogical Unit Not ConfiguredData Loss On Logical UnitMultiple Logical Unit FailuresParity/Data MismatchInformational, Refer To LogState Change Has OccurredRedundancy Level Got BetterRedundancy Level Got WorseRebuild Failure OccurredRecalculate Failure OccurredCommand To Logical Unit FailedCopy Protection Key Exchange Failure - Authentication FailureCopy Protection Key Exchange Failure - Key Not PresentCopy Protection Key Exchange Failure - Key Not EstablishedRead Of Scrambled Sector Without AuthenticationMedia Region Code Is Mismatched To Logical Unit RegionDrive Region Must Be Permanent/Region Reset Count ErrorDecompression Exception Long Algorithm IDSession Fixation ErrorSession Fixation Error Writing Lead-InSession Fixation Error Writing Lead-OutSession Fixation Error - Incomplete Track In SessionEmpty Or Partially Written Reserved TrackNo More Track Reservations AllowedRMZ Extension Is Not AllowedNo More Test Zone Extensions Are AllowedCD Control ErrorPower Calibration Area ErrorProgram Memory Area Update FailureProgram Memory Area Is FullRMA/PMA Is Almost FullCurrent Power Calibration Area Almost FullCurrent Power Calibration Area Is FullRDZ Is FullSecurity ErrorUnable To Decrypt DataUnencrypted Data Encountered While DecryptingIncorrect Data Encryption KeyCryptographic Integrity Validation FailedError Decrypting DataUnknown Signature Verification KeyEncryption Parameters Not UseableDigital Signature Validation FailureEncryption Mode Mismatch On ReadEncrypted Block Not Raw Read EnabledIncorrect Encryption ParametersUnable To Decrypt Parameter ListEncryption Algorithm DisabledSA Creation Parameter Value InvalidSA Creation Parameter Value RejectedInvalid SA UsageData Encryption Configuration PreventedSA Creation Parameter Not SupportedAuthentication FailedExternal Data Encryption Key Manager Access ErrorExternal Data Encryption Key Manager ErrorExternal Data Encryption Key Not FoundExternal Data Encryption Request Not AuthorizedExternal Data Encryption Control TimeoutExternal Data Encryption Control ErrorLogical Unit Access Not AuthorizedSecurity Conflict In Translated Device-k-k-k-k-k-k-k-k-l-l-l(-l8-lH-lX-lh-l-l-l-l-l-m-m0-mH-m`-m-m-m-n-p-n0-nH-nh-n-n-n-n-o-o -o@-oX-op-o-o-p-p@-pp-p-p-q -q8 -qh -q -q -r(-r`-r-r-r-s -sX-s-s-s-t-tH-t-t-t-u-u(-uP-ux-u -u -u -u -v -v( -v@ -vX -v` -v -v -v -w -wH -wx -w -w -w -x -x0 -xX -x -x -x -x -y -y( -yP -yp -y -y -y -z -z@ -zh -z -z-z-z-{-{8-{P-{x-{-{-|-|8-|P-|h-|-|-|-|-}-}( -}@ -}P -}h -} -}-}-~ -~@-~`-~-~-~--0-X-x------@-`------@-h-----H-x--- -@-p---- -@-h------@-`-------0-H -h - - - - -8 -H -x - - - - -H!-x!-!-!-"-$-8$-P$-8$-8$-h$-$-$-$-%-&-&-0&-H&-`&-&-&-&-&-& -8& -h& -& -& -&-&-0&-`&-&-'-k'-'-'- '-@'-`'-x'-(-(-(- (-@)-p)-)-)-)-)-)-@)-`*-x*-*-*-*-*-*-*-(*-`* -x* -* -* -* -*-(*-@*-x*-*-+- ,-X,-p,-,-,-,-,-(,-H,-`, -, -, -, ---.-8/-X/-/-0-0-0- 0-P0-p0-0-0-0-0 -@0 -h0-0-0-0-1-1-1-(2-X2-3-4-5-5-5-5-05-X6-7-8-8-8-8-9-8:-X:-p:-:-:-;-;-0;-`;-;-;-;-;-;- ; -8; -P; -p; -; -;-;-;-;-0;-H;-h;-;-;-;-;-;-;-0=-P>-x>->->->-?-(?-X?-p?-?-?-?-?-?-8? -X? -h? -? -? -?-?-?-?-?-@?-X?-x@-A-B-C-D-Dq-0E-PF-pG-G-G-G-G-G-PG-pG-H-I-J-K- K-8K-hK-K-K-K-K-L-N-P-0P-HP-hQ-Q-R-S-S-S- S-@S-xS-S-S-S-T-U-@U-XU-pU-U-U-U-U- U-0U -hU -U -W-X-Y- Z-8Z-`Z-Z-[-[-[-[-\-(\-@\-X]-x]-]-]-]-@]-x]-]-]- ]-X]-]-]-]-(]-`]-]-] -]!-@]"-x]#-]$-]%- ]&-X]'-](-])-]*-8]+-p],-]0-]1-(]2-h]3-]4-]5-]6-H]7-]8-]9-]:-0];-h]<-]@-]A-]B-P]C-]D-]E-]F-(]G-`]H-]I-]J-]K- ]L-P]P-]Q-]R-]S-0]T-h]U-]V-]W-]X-8]Y-h]Z-][-]\-]`-8]a-p]b-]c-]d-]e-P]f-]g-]h-]i- ]j-X]k-]l-]-^-0^-H^-p^-^-^-^-^-8^-`^ -^ -^A-^B-^C- ^E-@^G-``-a-a-a-b-c-c-(d-Pd-pe-f-f-f-f-g-Hg-`g-g-g-g-g-g-8g-Xg -pg -g -h-i-i-i-8j-Pk-pk-k-l-m-n-o-0o-po-¨o-o-o-Pq-Èr-ør-r-r- r-Xr-Ĉr-İr-s-s-Šs-s-s-8s-`s-ŀs-Řs-s-t-t-t-(t-Xt-xt-ƨt-t-t-t -8t -`t -Ljt -Ǩt -t-t-t-@t!-Xt0-Ȁt@-Ȩta-tb-tc-(td-Ptn-ɀto-ɰtq-ty-XS_SHORTSENSE scsi_do_ioctl: impossible cmd (%#lx)scsibus at %sscsibusprint: qualifier == SID_QUAL_RSVDscsibusprint: qualifier == SID_QUAL_BAD_LUdirectsequentialprinterprocessorcdromwormscanneropticalchangercommunicationenclosure servicessimplified directscsibusprint: device type T_NODEVICEvendor-unique targ %d lun %d: <%s, %s, %s> ATAPISCSI%dremovablefixed %d/%s %s%s naa. eui. t10. serial._~ offline../../../../scsi/scsiconf.cSLIST_EMPTY(&sb->sc_link): %d targets, initiator %d, WWPN %016llx, WWNN %016llx%s: unable to register bio scsibusPLEXTORCD-ROM PX-40TS1.01MICROP 1588-15MBSUN0669DEC RZ55 (C) DECEMULEX MD21/S2 ESDIA00IBMRAID 0662SIBM 0663HIBM0664H3171-S2KZ-CDFRSS2FQUANTUM ELS85S iomegajaz 1GBMICROP4421-07SEAGATEST150176LW0002HPC3725SDCASSONY SDT-5000 3.WangDAT Model 1300 02.4Model 2600 01.7Model 3200 02.2CR-2801TE1.07CREATIVECD3630EAC101FX320Sq01GCD-R580B1.00MATSHITA CR-5741.021.06Memorex CRW-26421.0gSANYO CRD-256PSANYO CRD-254PSANYO CRD-S54P1.08CD-ROM CDR-S11.70CD-ROM CDR-N161.25UJDCD87301.14scsibus_printlink-----/-0-@/-X-h---/--/--/--/--//-/--/--/- -(/-0-8-H-P-X/--`/-h-x-----------/-- /-0-8/-@-H/-X-`/-p-`/-x-/--/-p-/-p-/--/--/--/- ////////////-//NEC CD-ROM DRIVE:260SPECTRA90000200///sd_read_cap_16sdgetdisklabel//////////////////%s %s(unknown)%s: %lldMB, %lu bytes/sector, %lld sectors, thinsdattach: unknown result (%#x) from get_parms%s: WARNING: unable to establish shutdown hook %s: bad residual %d out of %d %s: block wrong size, %d blocks residual %s: cannot set selected mode %s: bad request, must be multiple of %d %s: bad request, must be between %d and %d TANDBERG TDC 3600 TDC 3800 ARCHIVE VIPER 2525 25462SANKYO CP525 ANRITSU DMT780 VIPER 150 21247VIPER 150 21531WANGTEK 5099ES SCSI5150ES SCSI5525ES SCSI REV7EXABYTE EXB-8200 263HHP T4000s TEAC MT-2ST/N50 5150ES SCSI FA1501 A-8-0-H-P-`/-P-x/--/--/--/--/-- /-8-H/-8-X/-8-h/--/-----/E-8-*--////ukFan%dPSU%ddoorlockalarm%s: unable to read enclosure configuration %s: unable to register update task %s: unable to register ioctl with bio SAF-TEsafteses_attach%s: error in sensor data FanPSUDell%s: unable to register ioctl ses%s: error: csr=%b INTERRDR1DR2IENSLVERRRST WRITE ENDMAENCNTTCDSBL_CSR_DRNDSBL_SCSI_DRNTWOCYCLEFASTERTCIDISENNXTDMAONALOADEDNALOADED%s: line %d: CSR = 0x%lx ../../../../arch/sparc/dev/dma.cR_PEND%s: intr: addr %p, csr %b dmaintr: DMA wasn't activeDRAININGdmaintr: discarded %d bytes (tcl=%d, tcm=%d) dmaintr: empty esp FIFO of %d dmaintr: tcl=%d, tcm=%d, tch=%d; trans=%d, resid=%d %s: start %d@%p,%d dma_setup: dmasize = %d dma: cannot allocate DVMA addressledmacable-selectiontpe: rev esc1+fasunknown (0x%x)espdmadma: %dK memory lebuffer%s: reset failed. %s: PROM ranges too large: %d #channels: no channels : invalid number of channels: %d : %dK memory %d channel%sqec%s: invalid tcvr type %s: bmcr reset failed %s: bmcr unisolate failed %s: rev %d PAL not supported. %s: no internal or external transceiver found. %s: invalid packet size %d; dropping unexpected%s:%s stat=%b RXRCNTACNTCCNTLCNTRFIFOCVCNT TX TFIFO TMAXPKT NCNT ECNTLCCNTECNTDTIME%s: resetting %s:%s qstat=%b RXSRXPRXLRXSMALLRXDROPRXTXSTXPTXLTXDTX BEboard-versionchannel# pri %d: rev %x address %s %s: excessive tx defers. %s: excessive tx retries %s: late tx transmission %s: tx fifo underflow %s: jabber seen %s: babble seen %s: tx descriptor is bad %s: tx late error %s: tx dma parity error %s: tx dma sbus error ack %s: rx fifo overflow %s: rx late collision %s: rx packet dropped %s: rx buffer too small %s: rx late error %s: rx dma parity error %s: rx dma sbus error ack %s: unexpected interrupt error: %08x %s: resetting... : no interrupt found on parent mace-versionqe: no interrupt : only %d register sets local-mac-address: can't map registers SUNW,vge%s: mii_read failed %s: mii_write failed %s: link status changed %s: reset rx failed %s: reset tx failed %s: stop failed %s: burst size unknown %s: setting rxreg->cfg failed. %s: stat=%b, resetting. RXRCNTACNTCCNTLCNTRFIFOCVCNTSTST TX TFIFO MAXPKT NCNT ECNTLCCNTFCNTDTIMERXHOSTNORXDRXEEXLATERXPRXTEOPMIFTXHOSTTXALLTXETXLTXPTXTSLV SLVP: expected 5 registers, got %d hm-rev pri %d: address %s rev %d qfeSUNW,hmeSUNW,qfehme pri %dinitiator-idSUNW,fas: expected 2 register spaces, found %d : could not allocate dma softc : can't map DMA registers : can't map SCSI core registers espattach: no dma foundptscIIaudioamd%%@%+>IV"k}3 3 D %s: trigger_input: already running %s: trigger_input: bad addr: %p cs4231_trigger_output: already running cs4231_trigger_output: bad addr: %p %s: error interrupt %s: attempt to free rogue pointer slinear_leslinear_beulinear_leulinear_beadpcm%s: timeout committing fspb %s: timeout committing cdf %s: timeout waiting for !mce %s: timeout waiting for autocalibration %s: timeout waiting for reset : expected 1 register set, got %d pri %d SUNW,CS4231audiocs' char-height >body >user %lx ! ' char-width >body >user %lx !stdout @ is my-self addr char-height %lx ! addr char-width %lx !stdout @ is my-self addr window-top %lx ! addr window-left %lx !screen-#rowsscreen-#columnsstddepthwidthheightlinebytesfb_get_console_metrics%s: couldn't allocate copy buffer wsdisplay at %s%s: screen %d-%d added (%s, %s emulation) wsmoused_sleepwswaitwswait2wsdisplay_switch2: not switching wsdisplay_switch2: invalid screen %dwsdisplay_switch2: screen %d disappeared wsdisplay_switch2: giving up wsdisplay_switch1: not switching wsdisplay_switch1: invalid screen %dwsdisplay_switch1: screen %d disappeared wsrestorewsdisplaytty() on ctl device../../../../dev/wscons/wsdisplay.c!wsdisplay_console_inittedtype->nrows > 0type->ncols > 0crow < type->nrowsccol < type->ncolswsdisplay_forceclose: bad screenscrdata->nscreens > 0%s: screen %d deleted dmuxwsdisplay_common_attach: no memory mux %dwsdisplay_console_inittedwsdisplay_console_device == NULL: console (%s, %s emulation), using %swsdisplay   !"#$%&'()*+,-./0000000000:;<=>?@00000000000000000000000000[\]^0`00000000000000000000000000{|}~00000000000000000000000000000000000000000000000000000000000000wsevent_fini: already invoked wsevent_init: already initialized wsevent_read%s: connecting to %s %s: disconnecting from %s wskbd at %swskbdread: evp == NULL %s: can't attach mux (error=%d) wskbd_input: evar->q=NULL %s: event queue overflow ../../../../dev/wscons/wskbd.cwskbd_console_initted!wskbd_console_inittedcannot load keymapwskbd_console_device == NULL: console keyboard%s: attach error=%d wskbd_console_device == scwskdetwskbd_detach: %s didn't detach wskbdABCDEFGHIJKLMNOPQRSTUVWXYZwskbd_get_mapentry: %d(%d): bad entrywskbd_load_keymap: %d: recursion too deepwskbd_load_keymap: %d(%d): bad entrywsmouse at %swsmouseread: evp == NULL attach error=%dwsmouse_input: evar->q=NULL ../../../../dev/wscons/wsmouse.cev->value >= 0wsmdetwsmouse_detach: %s didn't detach wsmousewsmux_set_display: bad child parent %p wsmux_displayioctl: bad child %p wsmux_detach_sc: %s has no parent wsmux_attach_sc: busy wsmuxclose: bad child=%p wsmuxopen: dev already in use wsmux_do_open: bad child=%p wsmux_mux_open: busy wsmux_mux_open: no parent wsmuxpoll: not open wsmuxread: not open wsmux_getmux: no memory for mux %d wsmux: attach out of memory wsmux_do_ioctl: bad child %p sun&~&\&&&(&........ .(.0.8.@.H.P.X.`.h.p.x...wsemul_sun_output_lowchars: ESC in kernel output ignored ../../../../dev/wscons/wsemul_sun.cedp->console == 1wsemul_sun_output: kernel output, not consolewsemul_sun: invalid state %drasops_mapchar: no font selectedrasops_init: fontwidth assumptions botched!rasops_init: font table is empty rasops_init: couldn't lock font 888????@`px|~ 08<>????????????????????????? @`px|~ 08<>????????????????? @`px|~ 08<>????????? @`px|~ 08<>? wsfont_unlock: font not locked@ `P0pH(hX8xD$dT4t L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}C#cS3s K+k[;{G'gW7wO/o_?: model %si128_fb_physaddri128_fb_sizep9100_reg_physaddrffb_depthffb_widthffb_height, %dx%d, depth %d PFU,agaagtenp4%s, %dx%d bwtwo: p4, %dx%dcgeight: p4cgfour pri %d: expected %x bytes of control registers, got %x expected %d registers, got %d expected 1 interrupt, got %d %dMB, rev %d.%dcgfourteen%dx%d, rev %d SUNW,cgsixcgsixcgRDIcgthreedev_id (%s)%s: %dx%ducoderev, microcode rev. %scgtwelvecgtwo_putcmapcgtwo_getcmap: %dx%d cgtwo %s: expected %d registers, got %d fb_size %s: expected at least %d bytes of vram, but card only provides %d %s: unexpected engine id %04x SMSI,mgxmgx: expected %d registers, got only %d : bt445 did not attach previously : rev %x, %dx%d p9000pninek: id 0x%x, revision 0x%x bt445btchamstdout @ is my-self addr char-height %lx ! addr char-width %lx ! addr font-base %lx ! addr fontbytes %lx !p9100_romfontp9100pnozzp9100_pick_romfont"%###Sqn|uqn/C"c ]"pqrs   $(,0rfx_putcmap %s: no SBus registers! configuration, unknown %d bytes conf. structure, revision %dRasterFLEXRasterFLEX-TVrfxstip-ropblit-widthstipple-aligntcx-8-bit%dx%dx%d SUNW,tcxtcx'W 'Trevision, revision %sfreqcodehresvresPGI,tvtwoPGI,tvthreetvtwo %s: expected %d registers, got %dVIGRA,vs11vs10vs11vs12vigra%s: zx_cross_wait: timed out SUNW,leozxbusmaster-regvalif_le: Lance buffer crosses 16MB boundary%s: lost carrier on UTP port, switching to AUI port %s: lost carrier on AUI port, switching to UTP port %s: configure command failed %s: individual address setup command failed %s: TDR command failed %s: TDR detected an open %d clocks away %s: TDR detected a short %d clocks away %s: TDR returned unknown status 0x%x ie: bogus buffer calc%s: reset %s: abort commands timed out %s: disable commands timed out %s: receive descriptors out of sync at %d ie_mapie kmem_allocunaligned dvmamalloc breaksie pmap_extractunknown : RAM CONFIG FAILED! pri %d address %s, type %s ie%s: tbuf overflow ietint: command still busy! %s: multicast address setup command failed %s: parity error (ctrl 0x%x @ 0x%02x%04x) %s: receiver not ready multibus/vmeonboard3e/vmeACFAIL assertedUnknown errorSoftware fatal errorSuccessful completionIllegal cylinder addressIllegal head addressIllgal sector addressCount zeroUnimplemented commandIllegal field length 1Illegal field length 2Illegal field length 3Illegal field length 4Illegal field length 5Illegal field length 6Illegal field length 7Illegal scatter/gather lengthNot enough sectors per trackNext IOPB address alignment errorScatter/gather address alignment errorScatter/gather with auto-ECCSoft ECC correctedECC ignoredAuto-seek retry recoveredSoft retry recoveredHard data ECCHeader not foundDrive not readyOperation timeoutVMEDMA timeoutDisk sequencer errorHeader ECC errorRead verifyFatal VMEDMA errorVMEbus errorDrive faultedHeader error/cylinderHeader error/headDrive not on-cylinderSeek errorIllegal sector sizeSoft ECCWrite-protect errorIRAM self test failureMaintenance test 3 failure (DSKCEL RAM)Maintenance test 4 failure (header shift reg)Maintenance test 5 failure (VMEDMA regs)Maintenance test 6 failure (REGCEL chip)Maintenance test 7 failure (buffer parity)Maintenance test 8 failure (disk FIFO)IOPB checksum miscompareIOPB DMA fatalIOPB address alignment errorFirmware errorIllegal maintenance mode test number%c: %s %d/%d/%d: [still trying, new error=%s] [recovered in %d tries]%s%c: crash dump not supported (yet) xddummystrat%s: off-line: %s xdc_resetxdc_startbuf freexdc_startbuf bp%s: warning: out of DVMA space xdiorqxdc_submit_iorq addingxdc_submit_iorq wrap upxdc_start%s: soft reset %s: diag: xdc_reset miscount (%d should be %d)! %s: diag: lots of done jobs (%d) RESET DONE %s: fatal error 0x%02x: %s %s: soft reset failed! xdc_remove_iorq: controller DEADxdnfreexdsubwaitxdcmd nfreexdc malloc: couldn't read controller params : %s: : doesn't identify as a 753/7053 : Xylogics 753/7053, PROM=0x%x.%02x.%02x %s: controller config error: %s %s: WARNING: no `pcyl' in disk label. %s: WARNING: guessing pcyl=%d (ncyl+acyl) xdattach drive %d: off-line : ERROR 0x%02x (%s) drive %d: ready %s: write format parameters failed: %s %s: read drive parameters failed: %s %s: write drive parameters failed: %s %s: reading disk label failed: %s %s: <%s>, pcyl %d, hw_spt %d %s: %dMB, %d cyl, %d head, %d sec, %d bytes/sec %s: write real drive parameters failed: %s %s: reading bad144 failed: %s %s: warning: invalid bad144 sector! xd%s: diag: IOPB miscount (got w/f/r/d %d/%d/%d/%d, wanted %d) FREE: WAIT: MARK: running %d: mode %d done %d errs %d errno 0x%x ttl %d buf %p %s: watchdog timeout xdcxdc_tickDOUBLE ERRORInterrupt pendingBusy conflictHard ECC errorIllegal sector addressLast sector too smallSlave ACK error (non-existent memory)Cylinder and head/header errorAuto-seek retry successfulSector count zeroSelf test ASelf test BSelf test CSoft ECC errorSoft ECC error recoveredIllegal headxydummystratxyc_resetxyc_startbuf null buf%s: DOUBLE ERROR! xyc_remove_iorq: controller DEADxyiorqxyc_submit_iorq: stuck xyc%s: stole controller xyc_submit_iorq addingxyc_submit_iorq: xyc_chain failed!xyc_submit_iorq wrap upxyc_cmd%s: stole control iopb %s: can't alloc IOPB mem in 64K xyc malloc: doesn't identify as a 450/451 : Xylogics 450/451 [OLS disabled]%s: error: %s %s: 24 bit addressing turned off please set hardware jumpers JM1-JM2=in, JM3-JM4=out to enable 24 bit mode and this driver xyattach drive %d: ready %s: reading disk label failed: %s (drive type %d) %s: <%s>, pcyl %d %s: %s and %s must be the same size! xy drive size mismatch%s: write drive size failed: %s xyxycsi_dma_start: bad pa=0x%lx%s: bad outgoing adj, %d != %d %s: bad incoming adj, %d != %d %s: DMA timeout (while polling) sw: DMA error, csr=0x%x, reset sw: short transfer si_dma_stop: excess transfersi: DMA error, csr=0x%x, reset si_attach: impossible bus type 0x%xsi: dma handle malloc failedsi_intr: DMA conflict si_intr: DMA bus error siswsi_dma_free: no DMA handlesi_dma_free: free while in progresssi_dma_alloc: already have DMA handlesi_dma_alloc: xlen=0x%xsi: no free DMA handles.si_dma_alloc: can't remap %p/0x%x, doing PIO scsi-initiator-idQLGC,ispPTI,ispptispPTI,ptispSUNW,qlcQLGC,qla%s: no mem for sdparam table ISR 0x%x SEMA 0x%x%s: kdma handle not already allocated%s: kdma handle already allocated%s: Request Queue Overflow++ %s: cannot allocate request queue %s: can't mapin request queue %s: cannot allocate result queue %s: can't mapin result queue %s: cannot allocate FC scratch area %s: can't mapin FC scratch area SUNW,isp(0X()`()(44(2 (1X.ExA'W COPYRIGHT 1991,1992,1993,1994 QLOGIC CORPORATION ISP1000 Firmware Version 01.37 Customer No. 15 Product No. 00 $   qp \ pISpP p p?p 10 y8xc/   @B bxx xxO 85 xxx i8@h< !xh(hh hhhh#hh' i:  h hhhj-  i;  h? h2h7 h @hhdpx xdx1xGx62 ppxxxxx4xMx22xxxxp  p  z zp@xxVxU 8h!Ux'xx 8o!e@C 8j!!! `xOx> 8o 8i! @S @xx| a`@^|ppppp 8yn.. HW2 &cl{z 8yetrq @xsrq @p a` P @|qxp@x A A Sxppzxxxx ppISpP p p?p yx 10 Y )W Qp ar P @xUqrsp 10@psr Q I] ApO Ik Awpp qWpp@kp   B J &Sxp @kHk&Sxp &Sxqp! rxp%ppxprstprstҠ@xr@xx @xzz{~|vxxxxxxprstprst֠@܀x@xx @xz{|xxxxxx 8Y! rx 8A! x 8B! x a8@a bx 8E! x 8F! x 8G! x 8H! xyz xqā:jh@#kx$k xwxX kj 'x xHF a; `<F<xN   xS{zyx xwxX ijk xqġxxqġ 8A"~!xxq  "@pxxآ~ 8B"!~xxd2K a8@a bp`p`x a8@ap`xq  (@  2@  < a8@`~a#xx6xqġ 8G"!~xxqġ 8H"~!xxqrȡע!yx "z xxqā: rh~&@@@"" j @)@/@@@@@<xx@xx@r̂@rh@r a8@a(@Y2@_<@edHoxiPHoxiCHoqqrxj hhk qxwxX jk phph'x 85" p xqrs̡xxwxX jj 'xwxX jj h@xI 'xwxX jj h@xI 'xw A I Q xe 'jxwrswrsxh@'x x |  @x xww A! I Q xe a8@`g`xxI |wwwwƧ a8@``gxxI  A! I Q xeph>8< |xl 9 A! I QxX h i 8U?8?U ih0@@hK hH@pxyhK hH@px px y8x a8@```xxhh hF |xxx0qqyJ|tsrtsr y8 @x5@x@x>x` x 8h  # " $   , .%0~x1eeff``xI |p@xqpyxqq!hx ii -h p@x!p@pxqrs!!y/F[]_p@qrsxBp@pppwqx 1a&$0$"F3H 1aHx:x:x:UUwxX h0  'xwxX j4 'xw~ rȂxX l0j2 8''$xw~ rxX l4j6 8'$xy`qqġybxy`qxyTqqyVyXqqyZy\qqy^xyTqyXqy\qxp @pppqrs 0` Sx ppqp q p|p @pp pqrs 0x ppp  p 2q 2,Sp|xPe@=,xR c|~ y8xP b,xR| ]zR r@U/  xL | ;|xX)h**h.h i 8O! h@ ``h~ x ~he@`hxxx+'hhx+'ii |e@`` x>!x|`  @h(`h,`|~ q8@p@ʠ8- pB|~ q8@ 8r@!H!Ӂ!tB|xX hxe@/x,x`e@/` `,( 8O @/h` `hhxdx `d,h%`x`` xx+'hh | 9 A! I Q xe8:?8?: |h\ a`\xx]|@cxyeuw}uuuuuuuuxx0 x x xx0 x  8," x  xx0  xp a` @|,`, cxdxfxhyj@,xyn| ~ a8h- k`d`f`haj@-xanx+A |x@ ~`e@x `x>|xle@ xdxf,xnxj |xMytprТ"x@MxhM @xMx5@Mz|{x@! x$ @x@Dx>xxM xxxx xMxx`yN|VeVVVV 9xx``x`xx|x@lxVx`x`@x@xxxx|xxVxx|x@xVxg  `@  @ 9  @xxX- h+h/hh - h pxĂ@ xx>|xm,xx`x,h`x-`x`xxxxx `|.%0a`a@~x1eeff``gxX h@4 x x xxx` ;`"jh HJ@J 9xx, he@RaiVi!``hhxx h@@v@h x~~i0!h2i4i: xI xx|`` x xe@`x`xxx|ypxt xvpx@xh @|h )xle@x@~xą(x@ @| {yrpԢ"# |H | | q p?pr?? q@ x z{ `$@ @x@1xx? xxxx x?xxyx <xp֠ q | 8h ~ y 8@!b 8!bx0bbxD|~ # q8@ y 0^ +#@|x##S3xox xx pxpxpbxxxCxSx pG8pC | " x|  px" |  px¢! |  pxӡ" | "ϡ | ~ a`bc |" ~ a``` |" ~ a`` ` | ~ a``b `c  | ~~h@e a\xm@S a[ ~xm@? `p=x2xe[ q8@p``q` pxDxa q8@``q` pxD xg   |,@ `` ``x`xn| 8A"  ;"@ !!"|~h䠌 @堄`:p q@塌q~aap  @! x x pppp~aa!p |h~ qp. qpppÀ qp @ px~~~ #<~X|0}8?@@|0"x礜P"xy'!"Q"w$''((()bM7 'f7x  |pp?p0@Kp3 p\pyV^l^xx Fx&jpx9x/px~xxx x`xx[ x& ppp38px9x/qx~xxyxx`xx[ x& ppp38px9x/qx~xxyx qyx x`xx[ x& ppp38px9xx/9p hxox/,Phxn A xAx/9xp\ hox/,P`` hx 1 Ax0K x, t@@28 0qD*H) 8!de?!#qFpp?x9v@8qD&x.qF%h%Xu>,P`<p2~ / p"x"hhhh#x-ڠ-y"#"###--#--$$---$x禄@# x:xx9h@#hx/xii#3h#;h#+h@#xXx9@#;xXx9`@#@##Ix#c~Znxtzyx#V?k!hk"h@@#k~Znp#xx1x3exgx9x4jilk"@#""!|{##@~Znxgx9xg"#x3vx9x3x9xjx9xXx9xx$ i@#ši ~pH ````` x#@#i ~pH ````` ,H @#x/ x,X@#x`(x~X~Z#xUx9xix9~X$xXx9xjx9x-x- y@$xx$-#| @$%H$%x$'x#$z$'x$ $#@$=H$=x$#@$hh~X 0~Z`` ~pH `` ,H @$ax/ x-=x$p ~pH `` ,H @#x/ x,X@#x`(x~Z$xUx9xix9zx$#@$H$x$-x-x-x-xx@$xzx-y$-+-,آ$xx-xix9$xx. xix9P$x#y$$%%@$x p:py$$$$''L&$$x禄$x1M@%xh@%W%`` x*@%Wx+x1Mx%>(%Wx1M`` x+4`@%>`@%4@%4`x%>h(hx%`0@%.`` h@AhhpT ~ `h` `h-%T``xA~x&hh'o@%%%t`@%txzh.j*:"%x%" @%h%x&xA@%@Aih@%p8hix+ x+%`` h%x+x%pT `h`xxAH%x"y%%%%%xp@%x-xixjx9xxy@%x-xjx9hh&x-x& @&xx. xix9x/x0&&y||`&&h/h+x&&5hH5&5x1M| @&_xЀ&Cx4xx4y@@&Mh/h+x&2hH5@&Gp8&Yyzi.j*x&2@@&ih/h+x&2hH5@&cp8&uyzxЀ&|?i.j*!&x&2x4|@&`` hj(i,j:i>h+h/h3 hh py&&&&&&&&&xh&x+x&pT,P `h`*` !8W$@& x&-" k|wx.x/`@& ~ \ h  !\  x!j@&~ ![~  x!j@& p&x&8&xAx+ x+h'xox4J~!G@'x'/ ~h:`` x/kh@'9i ih@'@h !8Wh "j8ip2"y)-)))-xp)x+x1Mp4` x)p@)p \ hp>p2"y))))))xx. xix9p)x+x1Mp4` x)p@)pzx| i\--qV h@)h@* hx)p \ hp>p2~ / p*x)jhhh#n~Zh @*mx.x*mp*$x+x1Mp4` x*)p@*pzx|yy[--qV h@*Hh@*ahx*;p \ hp>p2~ / p*Yx*Rjhhh#n~Zh @*mx-~Xx*m~: `pJ`pN`pR`@*klih*{{||ަ~Zx3vx*h!#$@*{{||h~Zx3x/ j@* i ~Zy-p>: Hx9` @*̀`"`` p`&|x1Mhhh@hpy****+****xx+ x+xxAppy*********y pxAhx'h+ ``|x+'`@++x``` |x+4`@+&`|~~ 8.!@+1 |~~ 8/!@+> |~~ 80! |~~ 8/! |~~~ 8.! 8/#  80|x/hx+x/hx+x/hx+wx/q[-- h+xAhr@+hx+h hpx+ h+x+x+hh xxA-}~ii@, i@+H+@+ 1++x.@+x,x+x.O ~)```x, ii~X~Z+xUx9xix9 ~)```x, ~X,xXx9xjx9 ~pH `a@,KbH,@, &,$"0bp(,4,: x,: ,:  ",?"(x.S++x.@,Kx,x,Ox.Ox,xXxZ xix9 ~)``,r@,l,la | 2 x,bp(,, x, ,  cH,@, xxxz{hh | ~qH!` 5~`x~fxx`x7``` | ~pH ``xxx`xx |-zii@-i-x-cx,ȩ x/ x,X@-x`(x~X~Z- xUx9xix9~X-xXx9xjx9-%@-/qH! -/ x.Ax-cx,xXxZxix9 ~~)``  -S-Qax-` xxxzhh | ~pH `@-k @`xxx`x`` |~p@-x-x-֦ @-x@@-x@-{?-@--@-Ҡx4xx4yx-֦@@-x-?-Ҧ~Zyz -Ƣyyzzx4xgx2x9xgx9xjx9x. xix9x-xix9h#x.i ih@-hxix9 x.  x. x.  x.  x. xx~Z|~?;;: y@./x```88y@@.?x```|xxxxzx`x| 1 )2xxxx}~x`x|~ xy 8F (@.} !.  x. !/  d$@. #p.x.|~ 8F"2H.@. !.   2x.(@. !.  x. !/  d"@.H.̄ #p.x.|d.xpx x전@.$. !x.$|02BDTVfhxz  2BRbrfvxz|~"2BRTdtvxz|~xF| ;|yzxЀ/%?|~ y 8@ !y/5/g/?/?/?/?/?/=/=xxKxH/AxKxH/Hh@hxX@xZx0/g/gh /exx/gx | ~h:` /a@/`/`~ii  @/! x/ x/ ````~ii!` ` ` |xjx9xix9xXx9xUx9xx9xx9xx9xx9xx9xx9pxFx9~x0/xx x전!@/xx |xx |x0@00 x|xx x전!@00x~xx |p@0. ~-`/hx-x,h hxX?hh/h+xKx!̠ @!x전@!!x- ~h: ` HpJ`pN`pR | b G  0 8~*89(œèd;0(â0 (GajV:(✠d)0 0(ᜠ( dgo;p#vwxn> (+dgo;p#vw> i( D! ܢr<no00 Ht.?a22!ℨhe*#`B`*!0 ׈"(H0(0(= 0 &:  ~*8~ " I1Mprr p@1_x1dp |p1q1qx2.x1ip @1p1p1p@11ipx1@1x31@1ix1p |d$@1,p 91'hh 0h)!@18'1pu@1 91x1| ~ " y8 qp pp q p pp Ix | I1p2pqp1䡄0@101p2p 2q 21x2hppp2 pqH2xp I|~~~~ "qx2. |r!qp 2p 2p y2H2R2b2p2b222p2xp2[ Ix2_x32[x|p2ix2mx32ix|px1x/+h@2}h|xxx2rqp (x@2xx2x2',X`c ""c!$@22 +`x2+`1=,holkpx1|8'2`@2 ` 91Q@2p| Q|P9'2 91`d2-`|~ ~ " h `hklW1~ h@@2~ yxX@@33pp3p@3x$3!x3^,X'``~p`p !3N@3N3Nppvpx`p`pb $pb#pvp+`x2x3`x33^ |~ ~ " pp3lp |~ ~ "  I3vpp3~ h@@3h$@3 P 91-`x33 |~~~ ~ " ~ h@@3 I3h$U@3-p.` 91'hh "hH3ՊQ3x8'3pu `@3 91x3" i $"i#3x q x3 |p@4'!p!p!p!p~ yxX@@44vpx2|~~ ~ " I4 q4*h$@4:x1dx4:q42x2.x4pq44x2.p4p4p I |~~~~ ~ "  I4J 1p h&ppp@4hSpp4j Ip |~~ ~ "  I4yh `hklW1~pp4,X'``p`pppvp 1 4qp 4 H4x2pklp Ip | 4Ѣ4̀|~ @44H444x4#4~2 |~2x45c `x x"5[x$x" 84!5  ~?x/ `d5 i8@h@58@58h0 @58!@58 @6@ a;  `<@5N`>5N`@5N~xIp5Tx5> @5[ x5>x5xx5fx5x7 |x<x>5wx@x>xH@5wxJ5wxI|x4x65x8x6 xD5 xF[ @ e@5` @5`"@5`,@x5|x(x*5x,x*x05 x2;#@5ˢ "@5À 5# xI| i8@h@5h<@6@goxXh 6= 8+!@5`#x6=h!``?````` BgoxXh@6hhh h6xh`/`+,hx i8@gh xD A! I Q0xe 85"j>86" 8+  8, i8@h | 8O!d ix`hX?``H``/`+h0@@6|hK hH@6ip6ix6`hK hH@6vp6vx6m p6|x6xhh hF 8h xLxJ | y8x6x6x6x6x6 83 84 x3xGxK|  8F"<@6 {*{.| 0 8F"2@6 9"<@6 '{6{:|  8F"<@6  "2@6  {>{B| / 8F"2@6 9q"<@6 &&{"{&|  8F"<@6 ~ 81# 82# | 81! 7U 82! 81 83!7  ;"#@7U"@7@@7@@7@@7@ 7U #  !~ xI|np COPYRIGHT 2001 QLOGIC CORPORATION ISP2200 Firmware Version 02.02.06 $    ɫ Y+xx# ( Q*p ) 1 9 !h Ϡ 1A4ubvfw^tjtn qd   !A4qd4  A8Ќ   !A 4  A  2    K? |  . \z R5 fu $ h bs #H $\ 0 x#x Px#@x P @*pp*ppX >I .A \ S f  & p  YP Y yx(x* Xpp( a  yx'z(/z* X gC X g X gC J gC 0 p  C yxD J gC X gC   xx@xB s > r<„r>  ! {  - QI YX K(@pp El Q z ´z`ps pМ(p Kppr Yx  (O !pSpWpw yRxЬ•r YH  -ppp yx'x(x* *  } o YH a (Oa. ppp yx'x(x*  } o YH a (Oa. Y   Y  ~ ,psptpvp& pp0 * opЬМ@Є0  ! !Ќpؠ +m opД   + opܠppФд  Q S ЬV   N`8h^(^  ! !q   @   @ppqt @    @p0p2pp  '' > y YP Yx(x*    }  } o o.F& y 4! ({  Jy@yBy$Ѵx'@ќx'6VyTѬK YX Y(  p Y     XX Y@  JxCxC x М8 Y8x$Ь*px$ YЬ p  ''xPxRx/ FS gSxPxRx/ YX Y(  p Y     X  J xPxR Y xCxC !x `x МX Yx$Ь YF !!N!x'H  gx$h    p g` 4!   ({ Y@d( Ypx'x$ YЬX p(  ''H 4 x'Hx(x*xPxR^> X.N*p a c`` `  p !pSpSp[pspw a` `` ````` a``` ````` a`QL`OG` IC` (  pH 1 9 ! )衆    X  (U 8 M    a,#b,"b    a,#b, a, a"b   a ,#b,"b,#b, a, a"b  i8 7  Nx`( P"  yxЄy.x*x&9x:x#x P&VF  @  "@  $@  &@  (@N^. yx @   y$/ zX z y&/ zp y&/|(   @          @x   @     i  a ,V&! `.^ qq`q. !00@pd(" "# 8ЌHpd(pg  H tt& qphpp, h-p. kh.n q& p`pp, h-p. kh.n & qp, j-p.pp.8hh I  qp  qppp qpp& "pp qp" pp( y. qp( yprpqp֡ p hqx&h$x2h(x6h,x:h0x>hph phЄ p)p&q @@!prx"x xA.&6FVp x&q @@!p"Sx"x 3px^N>.6FV  Sx & xApppp .^N>6FV ) x& * S +  Sx & xpppp &.^N> q yyx p#l6d5 (6FVp x@p S4p^N>p px0x2x4x6 p p lp  Pp x0x2x4x6 p p lp hx0h&x4h*x8h.xp ]_ l  > H ( p l  > & " y0 q"pp.p.xx.i4,FhLм h`h.h\h*hXȡphLм Xh`h.h\h*hh "c h2hX@hLЬ hh "c h2h.h*hXhLЬ h.h*hX"c! i2-ih&hLhNh i|iiihLЬ h3"`-ihXh&hLhNh h.h*i|iii   袀 lhL   8ޢ  hh &F6& ".>Npq " # $ I .qp  8 .r "`&&6 "N>.$`a!hjbk^  h @pp qHpH  ЌhF N$``  @   МHx` ` xhxhxpp `aH H hpp qpP  Ќ`F N$``  (  МP  ЌPx``xhxhxpa H .&6FV q"p p y0p x ` 2   x@ &VxxЬxx pp^. ]  Y8f 1 ZEnX `% 8"  TV .! ^^N>.p q !p `!!$I .qp ( (O 8!`` h-Xh(Xh,@hL(hhhP0xhxhxh$ Ph `h0 @`4  -X   ` t д hh "@ p >'0hP((h)pTTpphpTpYYppp`YxhRkljpml ٜP(hon 0hRkljphkj mlkjmlon h4@ "% {"z&}2|6:~>srut"w&v*yqqh(h*h,h. -` "%(hhh "%(hh`hHh0h  "%!h  p `` hp  'phh i|iiih+h/hPhR W & "+hh `yxx XpxМ pѼќ}x }     xpѼg&6| }$~04xhxh  @x(x p k(j,$hn%hrk*j.>.no"%( ";hPhR*h&,h(h2hh HhL0p ` H p p V} ռ g^ h+h/hh i|yiyxhzjќ`Pp hLhNx phh p `` V .! ^p ` H  xhxhxyA   ?xxxx xxxpp ` H  8pєxМ8xМ   աH   xhzj xpѼlh4)ќ&6| }$~04xhxh  @x(x p  k(j, ";(h`4М(hh  hhє 5*h&,h(h2hh k*j.>.V}  g^ h+h/hh i|yiyxМ | x$xh|l xut w$v(p(p!x0Px48x8 x< xxpp Phh 0p ` H  xpp `` hhh l(k, .p q wp!  w!l- uh uh hhP!k,u!j(uhPhRhlx"phpx&phx2ph x6p"h ``4Мhh0 ֬hhx:p&h x>p*ox:x>p&p*o!uk,u!j(hPhRh0 i` М`x"phn` x&phr`x2p`x6p"x:x>p&p*`x"phn`x&phr`x2p`x6p"`x:p&` x>p*hxhxx  <"  x Ф ٠ & "p`p q@ ( (p.p.. Y `  8  f 1 ZEn  ( (p q!0 `` ``` I .qp @ (O! ]  `% 8" ( ( ]  q"p q!0 `` ``` I .q P 8   ` ,  YH !# `! ! A h  H8  !p qx i  0 I H& H +  )   0 I x 2 6 !    ps$t p(p(t&p7q.p/p7s&t" `% 8"& ] y   @ `  p p `   X x0y(y Ѥ ` .x dxЬ   !   ! q yp8xx x0x4x8x<x y0xЬ  yx>x:x6x2x"x0xЬ  o qIp֢ liLi4;;;;oN= hLд  h`h.hh\h*hh|h hhiXh48hLд  h`h.hh\h*hh|h hhhh "c h2iXPHhLд  hh "c h2iXh.h*hLд iXh.h*-hh4"c h2i&hLhN y x qIp r \p hxh hhlxh @ yx yx+hh$ Ph `h0 @`4iyqh xppppi,h i(hX6Fkl "N> Πx& y Y 9.ΠvfVF6&  ~p r:pr  }  }>'0hP(h) ` E E ` ` Y ` E ` J J ` ` ` Q JhRkljpml ٜ((hon kj mlkjmlon h48 "%  {"z&}2|6:~>ypph(h*h,h.p ppp "%.>N^n~ &   @xpp `` h 'hPhR` ab `Ȣ`hj`hfp ` W  P @ ~  } o.!& $ y qI+hh `yx p! !U!pќp  !  !xєHhPhRhLhN&6k(j,x hnx$hrx0hx4h"k*j.>. ";hPhR*h&,h(h2p!&xx yzx6  x м>yyxxʢx.xphpєhx ќ  &6k(j, ";(h`4М(hh  hh!! . qIp y  ! є  ! h 3   @  ! ! !  @x  pxxЬ @xp& qI y p@p `` h 'XhPhRh z hz   @xpp ` W @ ~  }.hjhLhN, '   @xp ih3h?@(p`hh ``4"c E Q PPA(, `- `h`4"s E !%)!'"X"T"b"X"_"\"b"_"Z"Z"b"Z"`"`"b"`k.l*hXU #-``4"c0 `\"``(E@#`e # (hٜ(h"h  h"h #PQ #@ @`e #0Q #@(X`e #`4"c( @+hhPhRX" +hlnkrٜhi$"i # h h`i$"i# h h+hlk"hPhR,h(h2*h&(  #(#)#,#/#4#7#<#A            & & y q i $> $. yx '\x ᐀ @ x/#d ᐀x; .& &xФ $+######## b|x b` b| b8A(1!.& y0  p 3    d W @0j Yx     Z X J_ $.h6FV q" ^N>( y2. qq( ! ! Y С I p! @   yyx '\y8 & q r p(p  . x7x/x/x/x/x7 x0м$Nx7x7 & ( a q`$`&`S0 '`P`R a2a6 '`a``K`C`/`/```  `+/. 2  1 & (&a$,*$$$$$$$$ i  i i i xh i yH iY( i i )..a$`(Мќ& Yxp`$x Y YH`' `C  X Y`$       X&Ѭ`$p0p( [R&  H    Z& [&Ѭ & Y`' &6 Yp     X>.>. YFdL8 adJ`C`CtΤp4Єx`p<ЄHp>6$  > >pTq0ь S"q2`b@ %bH%p4Ќ@  Ѭ%!6s  > >q0q2 S" Ѥ   h  - '  ѬH  +pV   N KK%^N  }  } {6  |w>`  (ќb(b*  # `'  Y@  X gє &b Ҵ &{ g z2`' #}px2P i@abx`x``C `Chhab n% ox pp7/`  i@h@ hh a`(8`* z%& #e ' &Ҽ & g```' i@h@ hh a`D`F`<Π@  g 8aaaa6  |w> #e O ќ '#p4Ь`V`'`/ & `&`/aP`R f& `` М0^aR`' (k&^aR`'`(`*  }  } {6  |w>`   Z  `' a&&& qqpơ(  >  > r 6 ' { a (  +>..& a'o"` '|"`.@@@ HX@ (!0 d8- -  i@   hRhV'& i@ ! hS( hV'. a`0`2V& i@i0" " h'h.^ S PФ@F . N& y@xH  # # h 0"Lx ! " 8  Y .x & (& p ..  h p L(   V y xTЌ(r^ a`0`H```P``` ``(``/`/`/@`/``*`````R```J`2`6  ' q!@ p! )^)b)f)l)r)x)~)))))))))****************))))))))))))))))****************))))))))))))))******************))))))))))))))))****************))))))))))))))))** $* $* #* #* $ #* $ #* #p* #p* $ #p* $ #p* # #p* # #p* $ # #p* $ # #p*  (:* (: $ (: # (: $ #` (: #p( (: $ #p (: # #p (: $ # #p@    &F ! Q*r  ҜH҄8Ҽ* *** Y p*Ҕ p*   ' Nq`  +@( ,3 +38sp>*- =? A~p (H  p'VpĄ N  Nqxą`rҌ`Ԅ N( ,p ,X ,3 +3p( ,@^*p^qN.p ~ Nq8 ,3ppv,h W hB -` `  N  N!& pp.  ~v,h W hB 8-`h~@h + `  N  N!& pp.  ~&  Nq 1p.v,h -` `  N  N!&  +p܀p.  ~&  Nq,h p-`c`b   " .f6& k k9 $!0( ~   N  P KK+܆ .>n6&b"pr& ) kv 9 j, ~.` Pbc KKbc.>`( P qpp qpܠ p ``6&V!x  S PФ@F - N &~ , ,࢈5! H   !`  R ) kv 9 j&!`b`( b., ~!` P.,W^.>F& S HФ8" ' ) .N&6r S"Ҭ! ' ,ӄ 8 h>.& &6!& ) *. >.5 eX aa + N. 5 ~}|{܀zـրՀԀӀҀyx̀̀ˀʀɀǀwvÀutsrqponmlkjihgfedcba|`zy_vutsrqn^ml]k\j[igZfYeXcW\VZUYVUTTSSRRQQPNOMLKNJMIGLFEC<:96K54J3I2H1.G-F,E+D*C)B'&%A#@?>=<;:9876543210/.-,+*)('&%$#"!   qpppp:p>p3p7p a`.@.@ q+xxЄ@*`x i/%. qp.I.J.S.d.R.R+xxЄ+x a`( /p h*`pp hh4*`+xp*`x @aB!?/a.//+/3/7/?/E/I/U/X/b/e////h//w//00$0M000111101Q1Z11/1/////11////////1/////11//////22r22/37KAs/////////b/e7M/7ZB BgB/C.CXCwC///7^899.999:2:A:P:S:v:;8;E>>>?////@@8@A\q< !@ =& / xЄ. |"y&z*{.x @p P. !@  !@ !@ !@ !@.% {(z,x$y0=x#x$.% {(z,x$y0=y$x(! /y$!/ Sy$z({,/x$ `   x;/}8|<@}8|< a ,`   //" iRx$y0/( /(hJiBx,hRx(hVhZh^ \/ iRx$y4/( /(hNiFx,hbx(hfhjhn R/.% /%y${(z,  A = /%  =p/h4 8 /% /%qp (p = /% ab$c(d,e0@ =p/h4 /%p hh8h: Mm(pp0 S&  S ! .=ax$`/ x#@x'ISx+P x/ !x2?x6 ab a`<x: !x>x P @ q '/%y$ N/(~8?@/(|(}, PmҌ P PF a& `H`m0h<h@P.  /% 0 W. /%/  S&   R.//% = /( Ok /% Py /%//% = /( P /% y$ P /%x(/(  gO/&  P )dP$% N P( b%  P xx$p  gO)././%./( = /( O Pm//% = /( O Pm//% = /( PH /% M P Pm/ = /( Ok /%b  P a kv 9 j  ~ Pm/ = /( Pm"/V ihi  h   ~ i5-u0pLqpYh1n#^/}@ / !x  iib//%aP-"cpbtgל 1׬ 1hפ 1@ Y 1 1~:>/a@bD #/& a4 c8./ = /(bDc8/a@bDx$`B{(cF iRhx, i- j/& x$`6x,`:./x8x(% /(x,- /( N bDc8dFe:  = /(x( /(x, /(bDaFc8`:/  /% ay$0  x-!  P&  `` ` =h7ph3h8h:p2-` 2 ../%/(  /% ay$0  x-!  P&  `` ` =h7ph3h8h:p2-` 2 ../%/( h0 /%/ as& `Єxab*``hx:`x>` r cH./! /% Y /%& bH`hH ' El././(  p aR` r  hr& x$3*333:3'3'3'3'3'./( !  4p   48(. !@ / 3 !  8  z 4 { , H P X 6 6T>' -` qI y ih$д@ } x> | x:  6 6 5K 6( 5 5  5; yx$Д0xx y@ 40x yx'x2x 4x$м x'&|x$Ь0X 44M 4PH z& {% 4@  398 " 3 3 1)% 4Mx$м()4M`3 0 x$ЬH "  0  @`' u `&,` @-hh3 x$Фh'  a `  4"@h' t h& y a x' r ` s `xx3e a`'aax$ (`P`R`/`,`.`K`C`C)*++./. !@ /4 ` d   0    "  I  & y  y2y6 'xP 0xR  xRx,x. F4 `4xPxR  x,x.xKxCxC 4xPxR axTЌx'HxPxRxC@  @ x' xC x'Hx$Ь q" y0  `p@Qм8pxx px z& {% дPЬHФX yxЄ@     q  p ! qnpcqfqpkps pwpxpzpppppp~pp6pp'p2p 6( 4!(p$м p' q" y0 ih$д hh8x:  6  6p q" y0y 5x&ќ5p5555ѼPPp xx y$xx"y&   5' x yp8x@ `0  `` %b2pxp`$ `&`a0@(x2@(x6@(x"@(x&@zpp`)8` `  `2 qI y yx-`&p6P6;6Gpќ  6` 6Hpx0  6 a  ` a  ``` t  8 v $ w  =h3 o&-h !8 '>h -h =h3 ph'-h v  r w p a y  ` @ r p ` s p`xxʠ`:`> q p&t2s6p:p> ! q"pAp pp@St0s4-` =` p-p`Π u  8 x $ y  =-`h3 o&-h !8 '>h  6-h =-``3 p`',` x  r y p r p s p 0 x$Ьx  !`' "  0  /&  @ @./}8|</ = /% Y K0 z,{(|<}8 =p7r h /(hЬФ /(Д aa8b aЌ aaa ! hЄXj(/(-! aZ0h(/(`Rh /(A/(/(h  /(h /(hHi@ /( /(hLiD /( /(h = /% z,{(|<}88 =p7 - in-Sp t ЬXx$  2?0 - iR-ShaB`F \ R` R`8h`* #  h p 6k (>hij k$`abc"lHh0i4j8k<`a bc  @ hi kpӄ 5  bhx`ht ` ```8z iR j0p @  (O !! a`/@`/ Y( @ '`Ƞ` 8 Yx X gC X g   X@ J_(` 8/  X p L 0 0` /% iRx0hBx4hFh 0 -z,{(|<}8= 'ˁ/% Yx     Z X  K0 J_//% Y/%ap?  @z,{(|<}8&  =p..p? i @ CeP-! !j ! N`8 8#$  -  j @  J9; = /( = /% S дPx$~ `Ќ`h7h8h:  /%pp9 = /( +,-S    J   J- +z,{(|<}8=/% = /( P//%x(/( = /( P /%  Py$z(/q` )~ adP$%) N8"  gO/% = /( Ok /% P//% = /( Ok /% Py/a/ = /(  /%֬ y$фh x>hx:kja/x$д`/%bPP @ z,{(|<}8=/% = /(`/% = /%h7h8h: P /%pp:h0 /% z,{(|<}8= 'x$/% Y K0x(/(y$8/(! '&& a`` Yx     Z X  }  } {6  |w> a  `J`C`C - J gy$ Y z( :../y$ Nq,/(/ /%`Ь0М /% = /%y$z,{(|<}8 =p;e  N0` !@ /֭ ijk lmnh  ;ܠ ;ܠ ;ܠ ;ܠ ;ܠ ;ܠ ;ܠ!1qȠs h0h2@(h h8h:࠾/(  <"  <"H  <0P <0  <" =hh8h:h7hShO h[ i~hjklmihh7h8h:h#h h l /%pp< /%h / /%  D L) ( <$  D L T \+ * ) (  /%`Ь0М /%y$!@`Ь /(/(z,{(`p@`tN /( /( =,h@X-` QF@$`@'&0@  @ /-p",p -` .X =+pP  /%h7h;-`h3h8،h:&  +.`  N  N!   /%pp<h0p `8 b/% h8/ QF/֠. 5 Ь0& q50 !  q.0!p$(X ho'n&$`-`؄h`8 @( @$hn8 5 Ь @ p=0 @ H 0 Nqcb/% = /%h7h8h:x$ /( /( - + /%pp=h0 /%/y$`Ь /(/(&  T5"e` KK 5 Ь`././% hp -pp0ph `-`p y$ N0~(?@f~$ N(@fq(!hi  qq 1 1 afa`b&c*d.e2, Cpp/& y  h>%xЄ@z"{&|*x @ qq8p0 `xp0 a,p2p6q:"bcd . qp8p& >| yxЄp4 `,x"`x&`x*x @p8p:0p3p7H p6.& S   > ./%& `0`2 Yx     Z X J_./x$ (a a//(/%`/% S Ь/% = /(` x( / = /%h7h3h8h: 1 /%pp>h0 /%/  /%$z,{(|<}8 = /% 1p#p/p&  N?d`0?d S Ь( QFלהׄX 4 S <0הH 4 S <0!הج S  4 S <"& Sה  5 Ь@׌ p~Pה (P?  q /p/qp p"w* a`fp$`b&c*d.e2, Cpp?p,pqp$ w( 1 ab$c(d,e0? q / )~y$z({,|8 /( /( /( /( /( /( /( /( /( /( /( /( /( /( /( /( aabc d/ S  r мahz$cy&//( /( `l /(y&bj/  /%|(}$~8, = /% p#p/p& 5,d`0`X` `  *H q /p/qp p" a`cp$`d&e*f.g2, Cpp@p,hqp$  ad$e(f,g0@Sq //%`ЬМ /% = /%y$z,{(|<}8 =p@֭ h(pHq0r/(h i$ ' Nqq"fen = =h7h8h:h#h h /%pp@/%q  ,h  /%-ph *  J jk lm a`no(pq@ /( =r/(T /(``*b&c*d.e2, CppABp hh  *  J * ab$c(d,e0=/%y, ! = /( Ok /%&  P./x$ЌЄ 9 = /( = /%`(x$Ќ ``0 S д 9x$~ 9ˠ 9ˠ 9`Ќ9h7h8h:  /%ppA = /(9 1!  /%   /% S Ь /%`ФЬ9h7h3h8h: 1 /%ppAh0 /% = /(A /%` /% S Ь /% = /(` /% =  /%h7h3h8h:y((iRy,iVH/(hShWh>   /%ppB^h0  /%/ /%` /% = /(` /% =  /% z,{(|<}8 =pB֭h@h(h/(h7h3h8h: =/( e  /%ppBh0  /%/ /%` /%~$ N/(P` /% = /%h7h8h: h   /%ppCh /%hh6h hz,{(|<}8= = /%y$/( z,{(|<}8 =pCJ *   S/ = /%y$/( S z,{(|<}8=x$/(&   aaB./ Y     Z X 8 a`0`2 J_& ay$aRaN`W`K x8`jx<`fx(`bx,`^ a `````7./& a q`DФЄ EFhЌ Dg@Д D8Мa.a(ќa* bLP`H0bJ`C`Cxq4Ѥ`b@bB(  J`@@`B`Cp{ppp pp J gV t ЌpSp| J gC`@ `B `DЌhDObBp`@`BbB0bBpp^p# DsDEEp  # ᐀ @ y {"xx xx8xxxx#x'x+x/ y {x   S y {x  S` ` JFp`C`Cpp% E-` дE+q E E&  " #D`C```Cpp  J g ii08h4 ih   " #0Ehp ᐀ @  S`C`C`@`B` д`  p ᐀`V`u z) 0p# EyEEEEFF9FjFFFGG1GGGgGzGGGGH"HSHHHII:ISIT a` a`````Cp  J gp`C` д yz0x4z8(pp J gCp G J_p`C J gC J  E` JFp J gC yz0xx4`z8(ppp) J_p J  40  K(`pxHqP( I K "&S ` JFp J gC yz0xx4`z8(ppp) J_p J  40  K(pxqXp-  I( @ ' "&S ` JFp J gC yz0xx4`z8(ppp) J_p  J  40 K(Ppx8 IUp '  &S ` JF Elp J gC@ yz0x4 `z8(ppp xz8(pppp Gg J_p " @ C  A J   K(  pT " BS` JFp J gCh yz08x4 p ) J_p  J  @S ` JFp J gC yz0Xx4@p Jp) J_pp```C`C  J g7p J gCp K(qp pt '~8  I ᐀ @  t S` JFp J gC yz0xx4`z8(ppp) J_p J  40  K(`pxHqP( I K "&S ` JFp J gC yz0xx4`z8(ppp) J_p J  40  K(pxqXp-  I( @ ' "&S ` JFp J gCp yz0@x4 Hz8(pp`z8(pppz88 t Фpp) J_ ᐀ @  S40 p K(Ppx8 IUp '  &S ` JF Elp J gCh yz08x4 p) J_p J  40 9' @S K('(%  *pT#$""'& @S ` JFp J gC yz0Xx4@p Jp) J_p ᐀ @  t S` JF )S%,  A( S   ( HIjI؂` ? ? Iء   ! #$@I# !&%I#()X 9":'IuR-)-uve2e6% '`e # p{&( S ( ! !   ! ! !#8', :qR-$-uve2e6% '`ep{ qp y q@ z2p@ pp& q# sx@&  JxBzB..&  p. ᐀`V`u z)  J g&&  }  } {6  |w>  J a`` a` a`C`C - J g7..& q z2 q@p@ pp Y Y   (O !   X0  '' J_. @ 3 J ᐀ @  S ᐀ @  S a 1 8  `JF S ФX *   ! *  +N J_pp  М&  !.V 5 KE^6V6F iR``` ``-#c #@  #@`>`B`N`R`V`Z`^`b`f`j`n`r`v`z`~````````a`m ``m `ޠ`Jh`:h `Fh`BN>^>& iDnH?@LBLG  L*5!e L`L`  P`  QpiL NH MiL  OiLx@ O( O( Mp`P 0- h`R(-`R`Nh j?.   (  5 Ь``мHa K )  ( ! ь hф @ )a ` H ) ) .& hD L5!e`,p .`-`` `  ` (@ 5 ЬX`м@a )  ( ! ь Pф ( ) ). , &  yiDMh N`phdoP 5 ЬMQ`мMQhdo Mih!@xЬjpklxp`xtN"#@"# =,p0 @@.` QF@$`@'&0@  @hfijjn 0P 8 @   .` -``h8،h:&  +.  N  N!  . ( ! ь 8ф  ) ) iDnH?@ࡈ5!e`hL  O10!hL O P ( @a ) H ) ) & `P 8- h`R.-`R`Nh & `Lp qph`Lh-`N.-`R`Nh p`L pph-p.& `Lm0h`R`N.`Lm0h`R`Nh`  - `-`` && b"`b…„b..& b"`b`Ьh S Ф@ b(b .& b"`bx`Ф` S Ь8 b.&5"e -` , `` KK.& &֡5"m -``m `m  ޠ..05!e V6F` ``` YX`~ i0 5 Ь- i ah bh`h` h`ލi- i@ h ih ih`^h`ba8 `:h`f ! S ! S ih`ji anh`rh`v`~ ii an Y С I p! @  aN>^& q.h qphph.& `mi@jH !(O} & j -`h  Ohn. & ` !hh` Ph hh  `.&  Q. M PH P.& `miP@jTp !(O & jV -`hS  OhWnb Nࠅ. &  j?. & `L h`p hHX0h<h@ -h h p }j`LbN"aR. ` h hHX0h<h@ -h h pj`b"a P  Q QF  QF i QF  QF  QF & `mhh7kJhG `  R P``.` !pph !0P٠& `m( -`hh  P. & `m0` .` !ppP` !(Q$&  ` hhThV  `.`Ф Yqqќ ~5 }Hxxx yRxФV   Nh```Qn^ Q  8 yRxФ0  Q g Q gC Q   ! S Ф0  Q g qpspw *V   N0`Fb' ) ```` ) kv 9 j  ~NQ^` ```  }x&& b5" bb.. 5"8  R+ g R+ gC 5"  qppppppp pKpOp[ p_@p q}ppp p]p p@p7 q5qqp S P S МqR r  s! RnRRRRRnRnRnRRnRnRnRnRnRnRnp6FV v S^N>(pp" 0pp! ppp"  p! ppppp qhL0p(p*(j`r6kds:hhp>pvhlpBpzhLp.hDp2 p ?!rnsrp(p*pV&h8SUh  qp,!hi j-p.pp qpSe 2ScS q5ri4SsiHhD@ "ScS:SSSc q 2ScpЄq"h q}pppp . C qp UBpUBh< q q VUBpUBh< h@ q q VUB& T qpЄq"h8 @i"h @p.p  (p V ࠎppmX V@p VpPpPp0p Vep VV q5qp q! r&V: r*V: r.V: r:V: r>0p"^V q5qؠp q! r& r*V\ r: r>   Bp"^p,q00p4pnp8prHpl@pn ppprq2p p& V  ! @ p .  p .pmp& pp-pp.   ## 0## `s,q0# -p& pVpS& ! . _p) 3 `'WWKWcWWWX WcWVWV ihhp( i-p Z`(`*p( i-p`(`*6FV q" ^N> ihhp( i-p [R`(`*p( i-p`(`*6FV q" ^N>ha$ Xx`8Pp  Xx(ppha$h@`` ` Y $.Vh hW}H hh0W Z^x^p(Xp@p(p p`` ` Y $.ha$X0Xp(@p(ppha$88 pp Xa$ Xx (8p p Xxha$`P(@p(pp! Xa$P(@p(ppha$xP(Xp@p(p p& a i@ q  Y  Ѵ!`'`$Xh    (`(`* YP Y8  '' Y Xx  ''p p"p%p!.& X g.& d X g. z2 q X$&6& z2 a i@ q `(`*  }  } { g6  |w>`   `'   ''.>.  @    ` Мh`hV -X `X^ a i@ q  XXXXYp"@p!(p# p$`C`h  '&  }  } {6  |w>.p`+(`+ V& `$Ь .^Yhhi0hYK Z.^ Y`Dh`P `R Z`R(h Z& X g.   V YHh0   a i@ q    p`h  'h`C`C`'`+/   r 0 r 00 r 0 r 0   Фp '6 ( +>  q . r`P``` ``(`/`/`/@`/`*`````h  'hhh`R`PV&6 a i@ q` 8  !Z  !`(`*`'h `$Zl `Zl  }  } {  |wh    h   $.`   '`h `' `$ 8Z `Z `(`*phh>.^V&6 a q i@`  h[h`h  ' ihh`(`*`' ip jp&p Z `Z[J i@ `' `$  [ `[  }  } {  |wh     $.h i@`phh   '`>.^V&6 a q`   }  } {  |w i@h    [  Ѵ`! X~ i@ $.h` ihh`(`*`' ip jp'p [ `[[`' `$ Ƞ[ f qp& X gC X g. i@`phh   '`  !>.^V&6F a qq0ь` S"q2 p0Ќ \Xq0q2 S" Ѥ0  V  ~ Np'     h\#^ѬH  +pV   N KK\O^   }  } {6  |w>`   XN>.^ qpppp+pOpSp_ pc@pppp qhH0p(p*(jPr6kTs:hXp>pzh\pBp~hHp.h@p2 ?!rrsvp(p*pp+x qpCp \\\\\]*]+]]]^](]]]]]]^^^^^^p \](](])])x0y0 x0y0p0 q,  -pZpc@ pW& ! p. _  -pZ  -ppc p ]2]5]C]\]\ \&ppX a  \H&p apX hppZhhh4:.. ^ qp ]i]i]i]k]npp^^^ ^_^^^^^^ _`$`m`^^^<^ ^^^`a^^<^^^^^a^^^^^^^^^^P^^^^^^^^^b^^^^^^ep h p ]]]]] \&ppX a  \H&p apX hppZhhh4;..^^ _^^ ^^ ^ ^^ _^ ^ ^ ^ ^ ^^ _^^^ ^^^^ ph8h:&  R.ph8h:&  R.ph8h:&  R.ph8h:&  R.h4  p_Ipp-pppK_Ih4 ^ p_hpp-pppK_hh4^p 1! h8h:hS L& h79hJiR R. ( hL pa.-pp $ ShXp^.j^.8hi __ pp ^ p-p"p `,h6p "q  q q" Cpppp h p h^.p hphh- hiq^p hph(hih4 a.__  vfonh `!' p xpxpxpx~ ( x`e0n~ 1! h8h:hS K S&   R. ( 1! hXh8h:hS LN& hJiR R. (  xph- hiqppp0p hppHpiDhH  xiD NfnP OnF  "$Ą$N N Q_hLЄ &  R.& p S Ф asaфxhXP`Є `8`` h` `hXx`hXH` hXb.a.a.a.a& p S Ф as`ЄbcЌ0lHpiX ! (! iX !0h!Ph``bc .a.a.a& p ascӌ c c .a.a& phLЬH as``HhXh\e 1  h``'iLѤiPa& A iX @&  h.hLH as`Ќ `` .a.aiT. @- (*0  !ࡆ p)0iD Nx``Xh\e `$  ` as`ЄЌa& b b.a.hSahSah4 ^x 0 pQ@pp-pppKa.& > 1! a ! єahH p a  aqp a a asa0hSh-pXqhLa.` h. hhi!hhLa..hSaф iD N`qhShShShhSPhS58 r hH p`\qpp мX 9pa9pa9hS(hS).hS* .` ` 2. >X @ (  hThV&  R. p,q00p4prp8pvXpp@pr0ptpvy2q2 h 6&pjDbd҄pjL5"e`,  bhDbCbHbKbQ  ` DH iP [iP D hW&  R..>hW hW phW XhW @hW ( "  = =p =`Ѽ>`pXh\@ G z҄ ^ V6F 0= >(v8p c 0x(x( c7N>^ ! o ऄpH cp դxVF  $. `% 8"N^Hh ? 0x(x(N>^90ph ? 0x(x(V f^ @  Ќx  H&6 H% > >.h` .  S .  S pd Hi C 9  e hj dq #d#p f dq$a p0Pp4d  d0  ddp4d  d"dp0hФ(hqirphv yyx  'y2y6 'iRp< q@p qpp4d dWXp4dhh 0dW@p4d dW  dW! dWR@p4d dWP@p4d dW@p4d $dW$ -ȠS * XSȠa " !!$ > d< #p` ?@x E  ""  ' NqfeXhpht``FPhp8hth ha`q a      (!0 d ~襖   5#Ӭ8 ! q50 ! ~ q.($#ho!k F$x X pd͂" eeeeeeeeqѼq !``Hh\0q$a F Ƥ eiqѼei ""  'ei Nqfe`bHbb 0a`q a q0a" D  a`q a ``` jh o   I >   a`q a q0a"```A j" oqѼxp `P8h\ E  -hq0 eeeeeeqѼp q ' Nqhfeb a `q a   Xa `q a  qѼ@0q$a  qѼ@A0q$a  p `X@   1i 1I 1) 1 p fF ""  ' Nqhfe,N`  -`&hh7l: /.Snf`>`` jh o n N qppappvpppp&p+zIp2p7zp;p?pBpGCpJp[g    :pn qg2 `p ppap& p@ ( qBpD a`4:rlPpn C  > & p$ p p"hp# q&p(p(p0 p,p.`p/ q2( zp4p8p:p<p>pL hpHpJHpK qN qPqNpXp pt Xpppr8ps qvpxpp 8p qp.pgXgYgq qp qrp  qppp q`aq NX`@`0&  o.pqp `& ``a` hhTphV  a . q  pp qp'p#    qq2p/    qqrp &pTpV a`Xph`2pd`.p``*p\`&, C. f qqvrzps  qpxpvpz ass `hT P as`Π8   ahLд8м  h0 t!Є8 B  C 0 B `H A a  C   ` hiRh`iLX asbҌ bb R`mv 9 h~V as``^hЌ8h h  h̀V ( h(#h2 ^2 & ( y. ih i- j`'xii;ii i;iii  g ob J gCx((x* JV  Jxx'x+ @ g<  @" xb`x+x$e   9 x$e x ix('0x* z% a qpЌP a q J_  8  b`x+x$e   U9 x$ xm hhy$!` i<  i>hTzyyxx' oa(igx ig n% jh oiU`'b`Ģxy<0 I    9 y< yDu0yFy<! 8````xHxJ& `, a` `"`H!a.aa i`hh h",hho`hX`V`[,hhZ i `V`Z,hh& `, a` `"`H!a .aa `, a`40!a6a:a6 vfV6&&. qv8&`&x k`( k  ` k p<6  |wp3p?pCpGpK> )p86f v:p46@,6/p6p7f f,~&x` '` h`h7kJhG6v   R~>  j,x` `j 6 o>..>^n~`X6v  ~>` jjf 1& yx8eh` `x<6  |wx3x?xCxGxK> 'x` h`h7kJhG R  ~:~6.n` `` & A lX.& y  l mW.f& qv&`&x l.`( l) ` l)p$8 ih g z2h ~p'6 i@k hh ih$Єh'> ` c p6f vp6@,6/ppf f,~&x`` h '`@h7kJhG6   R>   }k,x` `k.n`X6  >`(` `x` P& 5 e lf qfTpvp0ppv`X}~V/hZ`W`[`` M lv$覀  ihH g z2h ~p'6 i@k hh ih$Єh'>`<`>&` H&`` c lXh7kJhG   R }ln.f 1xe m7` `x$@ ih g z2h ~x'6 i@k hh ih$Єh'>(` c ,0` h 'h`h7kJhG R   }l~~n` X`(` `` `fxe m`T`W`[`` M m~$覀  ihH g z2h ~x'6 i@k hh ih$Єh'>`<`>&` H&`` c mi8h7kJhG R }mim\xxnf``LmhHp qp$5H  ``!n yx8&`` c  z2x ~p'6 y@{ xx yx$Єx' ~> M`<`>&` h7kJhG  R } qpn7n:nPninn7n5n5 p$eHp p"` Pr`pp'rr ` ` M``p p" `T@rpp'rr p$ep ` }`  r`Hrr 0p` }`  r`rr`` ` M`` }pe8`Trrrp'p$e@ }` Pr` ~p'rr ih0nnnn h@ha.b  c>,xq 5 ЬѼPq q@ (-, aa ussh/k&h+xxx@> h e8hh&h+ o ih0  Ѽ`h8}h3h>hGhK& $. 0. x.hCxx @j:xh3h? `h:h6 !f 1 ZEnX` p ptuptup p n% oV6F` a!xy 5"ҬѼPy y@ (-/ ,x aa@p3N>^q3q~qrhrrrrrrrrsHrsisqrsqspppppppppppp{={R{u{rprrpqrhprprprq,pppppppppp{%p !3N>^ppppppppp    sx h $  h< hP hT ` zx hh ijҬм   s  xh h h h h h ` zVF   s x x ` zN^VF   t!   4  S  S 3 q `L zN^  ` z   s R iRhЄPh(  '!(  S  S 5 Ь8x( 8   @   ` z   s  5 Ь8x( 8   @    S` z   sx `  Rx( ~0 b ´b  x( ~r* 5 Ф 3 3 3 ' 33 333 Y7? 3  S  S  r  r 3  r%h 5 Ф@  ` '` S  S  S  rH  rN S  rY r_`t z   s     yRyѬ Ѥ ` z   s Pq   s !  ` z   t!  ` z   t!   *` z   t! q   t!  x(  x ` z   t!   x hhi0i@ !X @ ( p yRyѬ Ѥ t! ф ` z   t!    ` z   t! q9   t!   *` z ᐀ @   t!  ` z& ᐀ @x( ~ " "   ""Т0 " 5 ЬҼȢ( " H5-lh" h i-h-֢5-lh" h "" )  z" / .& ᐀ @  " i-h- )    & ᐀ @x(  5"Ҭ~֠5-lh# h h@h( ( i-h-֠5-lh# h ""   z" z"/ . z" z"x .`  a!xy 5"ҬѼPy y@ (-/ ,x aattttttt F  ` zNF   u( x x `  zNF   ub   ` zN& ᐀ @x(  5"Ҭ~֠5-lh h i-h-֠5-lh h "" s& ᐀ @x(  5"Ҭ~֠5-lh h i-h-֠5-lh h ""  tq& ᐀ @x(  5"Ҭ~֠5-lh h i-h-֠5-lh h ""  tq,xx@ S y!`a 5"ҬѼPa a@ (-, aa@uvv~x:uuuuuuu}j}z}}uuu}Y VF   v5y!hiHy"!"""iL @ф  Ѭ HѴ  "0jn| 6! S>  "&` ᐀` `      N^ ᐀ @z# "x(  5#Ӭм֠5-lh h i-h-֠5-lh h ! ! ) " / V6F  x hh` h\ h h|  `  zN>^& ᐀ @x(  5"Ҭм֠5-lh h i-h-֠5-lh h ""   z" z"/ .V6F   wx h"""""x0xC+N>^w wwwwwww  6iLPkx#hh hd >wá kx#hh hd "ht "h|  wh|htV #wB^"""  ᐀ @x(  5"Ҭм֠5-lh h i-h-֠5-lh h ""   z" a> z    (( """ " """" p " "" %"""""`2 z (""""""` z """"" "x$ ""`  z 6{x"> " >h& ᐀ @x(  5"Ҭм֠5-lh h i-h-֠5-lh h ""   z" z"/ .V6F6x;>N>^xTxTxVxTxTxTxxxT yy   iRhм0h,  ?"""` z    & ᐀ @x(  5"Ҭм֠5-lh h i-h-֠5-lh h "" ! z" z"/ .VF6 a qqTx hh (v֬0м ijtT ijspttx y{ 衅`bbfcjdn`s )`whh`z`/`x`x pp`p`p `p`hl```` v `Ġ X g>N^pЬռ8`bbfcjdn8`bbf`kdn`s `whh`z`/`x`x pp`p`p `p`hl```Hj j b v `Ġ X g>N^x ppL y 5 Ьռ8`bbfcjdn8`bbf`kdn`s`whh`z`/`x`p``p\`p`p|`hl```Hj j b syi 5 Ьռ8`bbfcjdn8`bbf`kdn`s`whh`z`/`x`p`p`p `p`hl```Hj j b syiz# " ihC ᐀`V`u g` ` aa```a& a i@ Y  f 1 ZEn gh ai@P1hh aa(Xa*a$΁ g z)pa$@  g  .   aa(a* g J_ 8& g qq< a i@ Y6  |w>qqp6f vp6@,6/ppf f,~&x`` h '   }},x` `}Ԡ.n~`Ψ f&& qv8&`&x ~`~ɇ('~H`~Ʌ` p<6  |wp3p?pCpGpK>p86f v:p46@,6/p6p7f f,~&x`` h '  ~v,x` `~v..n`Χ q  ppf&& q,v8&`&x"p86f v:p46@,6/p6p7f ,~&x` ,x` `..nf& qv &`&x `( p$ ih  z2h ~p'6 i@k hh ih$Єh'>p 6f vp6@,6/p p f f,~&x` X ,   ~  ` h 'h`h7kJhG R    }8,x` `8.n`0 6V6F9 "* Ƞ8 !""SN>^>   t!  ` S  xx  z   t!   x x x( ` z  yy! ` ᐀`u z) gV66 ᐀ @x$ hrrrrqsqr pr pr .S`5j8p0`7>>^  `6a a*pphpJpO& q uHpL ``H p\ a `)uJ p\0uN.pO  quHpL ``H p\ a `)uJ p\(uNpO Ƞ Ȭ    `` ```````"`& a`H`J&  o. `:U*Ep( n% oG ^f` n8~ 8888888888 f` nSSSSSSSȏȁS i iS f` nn㊞܁nnnx{nnnn f` n  `a` hhO@h|h hhhhhT b, ' j&  o.GÁÁŁށÁÁÁÁ  n o`a!hhO h\hZhth~hxhhh na!h ' hK R  o n +a!h ' hK) R  oG! ` hhLhN => , ^a!hhKhS R  .` S 34 34(".#&< '0` ppp7 6s00` hhh`0 hhh7k2 > * ` S *`  S`  pp7  p0@p8 p<! `  J '@` ppp4pp7  .` SX` hV6&    .>^V6&   .>^Pp8h p.&6! ( kv 9 j`e P, ~>. N   o    n% +  ,`(  框~( 5 !  `2X q y /%`! P" 砲@ vwz}tttttttttttttttttttttttttttttttttttttttttttttttt        p N! n%`  ` o N! n%`6 ]#  @c> o  n%   o q y /% n%  o8 n%`  ` o& ЄЄ & '` pp49H 0 @ p8xp`!`=Hp7p3. .tp pp7p#f&hhޠ  fC  uf3 0f( Nf) ehf .0f f" Vf= pfD PS(1  م? !H@ => , ^.tp pp7  qpt p` h  N! , x   N! ,`` jh hЄh  N iRhФ  NN !"t` hj~  WG M` h( hh`8 hhh7h3  N! ,  q5.М qqr 8` ppмqr` hh8xh49X  @ @  N!`` jhh\  Y 5"    yx 'x 5"     N!  N yyy2y6 ' yyv!  'yR Nq,`  N!``` jh  N!    NN , & qpp(` >` h OZ  P` hhޠ  N!`up49H  @ 0pp7p3 ,   . !"X  N!`` jh  !"8  N!   J~ ?,f   <x  N  N!`` jh ! `` hh@phB` X ! &  J i-h` hh~8 i- jx  N  N!`` jh` h 'j4 !4  ! h p  N! (``K .֢9`` h 'Hh49h8 P` hh@@hB` `h~8 q K +` JX  N!`` jh   iX  N!`` jh X   N!`` jh  !8 !*!d N6` h q5. r ` 5! S ФX *   ! *  + q *V  ,^ Mhh q y. i jxp. i jxx2x6  ( "  ' Yp i qh rhphp hp @  N! , >&6V (# q.p   H   ^>. qppp `8p$ФЬvVF&& )%, !$$ a qrHph Bgh%P$8` LH 0  ` h '`h7kJhG R  ά p\9..N^~ 0 " #0#  `    h( , 8 n%  o @ՉՉՉՉՉՉՉՉՉՉՉ׉׉׉׉ՉՉՉ `a j"&  o.(`@o' n% +a!h 'hh7hK)hGiLiN R   o `@(F8E G   Є& (& i ..` MKKKKKKKKKKhhhhKKKh  n%a!h 'hh7hKhGhPhR R   o n%  o  n%` o`!  n%  `` o@Y  qa!hv =  skbsk^(( hKhKhLЬpij!Hppibj^8hKhKh7nF@  s(s,kVp  6#  G>q$iZp!` q# G h8 iZ h-x   7hKh7nFhLЬ0hi  Rb"hj<j> ` y|{~ }` xxLЬ8`!0"(X$y| #z&%|{~ }, ' j o`a => , ^@ 7  pxbpx^ 7  -xJLNh7x8h:xx@hBnF  skbsk^(hK`hK8hKhKoNxPhRxThVs(s,kVp  6#  G>q$iZ!P q# GPx8 iZ x-x ~` y|{~ }` x|{~ }, ' z` n oa!hiL @iHh8hLhP V!# r^hRhN!h   7h7iD(hK`hK8hKhK R   |w` n o n +a!h 'Ph7hK)hG R   ohK8hK ibh^@򍟍 v qa!xv~FLNb"hj<j>   pxbpx^ @  ~F (  -xJLNh7x8h:xx@hBnF  skbsk^(hK`hK8hKhKoNxPhRxThVs(s,kVp  6#  G>q$iZ!P q# GPx8 iZ x-x 0  qrs ~ => , ^`a!hiL v IiHh8  hLhP!xyDࠆ((hKxKXhKxK yDyF(hKxKHhLЬ0hi hHxJh`xbh\x^ V!# ^hRhN !h t!xyDࠆ((hKxKXhKxK yDyF(hKxKHhLЬ0hi h`xbh\x^hLxN   7Xh7iD(hKHhK iDiFhKXhKhLЬ0hi  R  n% n 'a!hh7 ! ьфaiJ) hG R  o ohK hK p@  & ^.ԎҎҎҎҎҎ ` a j"&  o.``  r'   n%  o  n%  o(` ' n% +` h 'Ph7hGhK) R   o  ࡆ n%` h ' `h7hGhKhPhRSQQQQQ^  n%  ``  o n%  `` o  zzzz|z  ' ` hhL h7hPд(hKhRHмhK hK hG R ` h 'h7hPд(hRhKHмhK hK hG R  ` h '@h7hK(hG RH0' 0 n%  oVf ) !0 i#  G xm  (h7h;- |=(&Y< <-x (/}6(/}6n^Xh}0h R/h  RV !# N^& `.}}xkxmxxkx 6  2``>` h 'h49(hKhS(  S  R ڠ `  ϐސ̐x}}xxxxxxx ` h ' `` ` j" o L 8 qp$ { { x6 qp<8  |w>P ~>( x` z ( z    n% o ` ' `,`  68Xjw6 jj6666t ` ppPpR qp$ {`` `  ` j" o` ` hhPhR`` ` j" o`` hhPhR  L`   ` hhޠ   aᑮᑮᑬ `P8 K ]`  z! ~" z= ~P` hhޠ +  a N 5 Ќ Y     Z X` h 5 Ьhмh@hB``` (-``P``( ~p 5! q K   +&  ,.   N!`` jh o  ,a 8` hh@ $hB` jh o    +&  ,```.`    ``  j" o  ' + 'h` hh7hKhGhPhR R,h Ph` -` -````` jh o `     ~ a!hhK R X@   &b.6& a qsHph`H   ά p\ P.>5! ( aa +V&  ^fe ` K .^ V& b ^P`e `%` P kv 9 j, ~ф( ڠ0 L .^ F ,x~,xx ! /` M NF ,xx~,xx !/` N NF ,x~,xx !   /` (/` R Nv&  PH ( PX %$ S R$ mb A 9& k j/&H a< lX o.~&  f a `-`  . &  f a `-` ! . &  f a `-` = . &  a `-`  . &  f a `-` D . &b"hj<j>.`p``  Q`f 1S&4(f&`nH On`@(`mHh498h8&  a `-` + ( . ءx !"tH M``) jh   (  N!衆 !"` h OZ p` hhޠ8  N! H   hH hPhR& q uHpL ``H p\ a `)uJ p\0uN.pO  &6   2 h  "   qqr d h  " R>.  (   qpp`$m &  xa `-` 3 . qp` hj<`,x pppjP`ptjT@b("  ,7 H   pTjT H &  a `-` C . qp`,x pppj0ptj  + H   pTj  x &hLЬxij!Ph`h\ ibj^.6c#hhJiR@c#` h8  QFjfijjf9#hkkrc#``hn R`>iDp! (hi  of` n(>(((((`(((((( f` nC͗CCCCCCCYYC f` n^Ğ@^Ǡez^^^^^  !@u| gb(;󗪗S  QP 5 ( @` `+ `p Q6&b"pr& ) kv 9 j, ~.` P.>f&` NΦ&4x a  `p` p (  xa`  -a j`p`p  -f&hn  N7pn@( nP&b("  ,7. OZ` p` p +`p  -f&hnަ P&b("  ,7.` p Q@ 5   Qf&48&  NN.P7 a { `pFd($$'F +N S! ѤX ) ` hhhN`p  NV&6    >.^h7 a a`` p Q@ 5   Qf&47 a 8  `pFd($$'F +N S! ѤX ) ` hhhN` @7 Pa`` p -  a`` jh`` jh `   - a` ` jh -`#` jh  - a& ", "` "``"p ",  "!``&` "`%h`p`$ !``%` jh.  NV&6    >.^ `1p  Y&6 YX     X Y>. - aa `+p`,p  - aa  `.p`/p& QX Q  qpp yrprx梄rtpvxp S Ф  Ь( * . t &  h -P8`E` jh +`` jhff&hn7pXn(nIh h bh$`* `hi h$ '0!  ,7 ih(`` ih@h` 0 @'    NN n%  oxzxxxzܜ  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx  n%  `` o  N yRxЬ  N` @ yxx` ``@`( >  8 yxx  N! n%``` jh oa!`  gOf&hnަ7P8    > f&hnަ7p H 0   NN n%  o&#####%###  n%  oa!hiф@ N!  N ,f&hhޠ  ;( km yRxЬ`}xx  N  N!``` jh o ""  ' N  h`` KK``  J8`` jh `  n%  o@ݜݜݜݜߜݜݜݜݜݜݜݜݜݜݜݜݜݜ VF&a qtD 9 0   h  `-h7 hh;lZ,h^`h` xxq0iJhFhOhShW6 R 0  0  [ D  isj҄ h -x`  xЌxx`hh7h;`h,hJ` xxq0ihFy(iy,iy0iy4ihS=rDhO@@hOhO  ! i i~ R.N^  Є  N```A j" o ( i- ihla a``C j" o@```A j" o   I > ````A j" o` ``p`@ S @ G`A  Є& (& i ..`pġ'  `@  NPPtNNNNNNNNNNNNNNN  n% o6`m`` мx  ``  ``> n% o ' ` h   `!  n%` д8` C ` o n% h  o n% A@ڞܞڞڞڞڞڞݞڞڞڞڞڞڞڞڞڞڞ `a => , ^@%%   n o` hhLPh A`` h h 6 n o` h  `(  ```>P`B  n% o'`B   NN n%  o@yyyyyyy{yyyyyyyyyy 6F => , ^N>` hhj xhL A0`` h ! ќ``! h@  jjhf@ ԟ֟ԟԟԟԟԟԟԟԟԟԟԟԟԟ `a j"&  o.`a j"&  o.`a, '&  j o. ^& 6֡@#>.1La ` hhL`a j" o` hhLh@`a j" o``  ` hhL  h`a, ' j o ^ n%aX!h 6 ) >  o naX!h 6 ) >  o ` a j"&  o.&  qr$br  `@`r$`` j" o o.``  '0 P  NN n%  o  n%  o   H0' 0 n%  o6  1``>&6 ,@ }Xv,8 ~g~(```@`  ` L` h ' ``  `>.6V yy8x< ' Nx.& ) * kv 9 j~v 9 ~ P&bb ,. KKfe^> !!t ii i  `` ppp`ii iii ixii```p`X` @` (``-&6Vb"hkxH0-` N      8Fj' S! Ѥ8 ) hh ) kv 9 j, ~  NNN^>. ih`&6V yy0x4 ' N   @   ^>.&6V ""  ' N   @   ^>.vfVF&& '@ )%, !$$ a qvHphP(M M! D B Dg h h%$ R` x`  LH 0  ` h '(h7kJhG   R   ..N^n~P(   hP Rȁ  0 -X`8 0  8 ,   D,!p  `Fp( $',  N6  2>  NV&6    >.^vf&& '@ a y 7 qvHph7(( y Bx$`g@(@`` `@`  ` L` h ' F N   ..n~ vV A ), b } 9 ~g ^~&FVvV, !(  6 N,V A% ) } 9 ~g ^>g^~^N.vVb A ) H } 9 ~g,  ^~&FVvV,  6 Np, A(( } 9 ~g >^~^N.8Ќ00hh}8hkR R/h kR RF6 a8 qtHph!h`H`0`$$@   @>N  h7 h^&    " .hJiVlFhO  hRhhh:hZ RgX@ ( ` pp(` ¡'x n%6` h  > o p   n%`  o     ` pp&6V (" #46؃#4"6 `  P `  ^>. q K *` pphPhRvfVF&& )%, !$$ a qvHphxg%$ B R`  L  ,    X..N^n~& q@դp4p6մp0p2լx%H0 qJ.& q@դp4p6մp0p2լx%H0 qJ.& qB!.. r p. r q@  qD i& q@pDpF. @ @2fpu_cleanup 1 fpu ieee trap, but no exceptionfpu_cleanup 2fpu sequence errorfpu hardware error (%s[%d]) %s[%d]: fpu hardware error fsr=0x%x fpu errorbogus fpu queuefpu_cleanup 3fpu_addfpu_explodefpu_ftosfpu_implodefpu_rightshift 1fpu_rightshift 2WARNING: opennode not valid on sun4! %s WARNING: getprop not valid on sun4! %s node 0x%x property %s length %d > %d %saddr 0x%xPROM boot failedno PROM root devicePROM sync commandhierarchicalsearch_prom: null nodemakememarrmakememarr: hope version %d PROM is like version 2 makememarr: cannot find "memory" nodeavailablemakememarr: cannot get propertymakememarr: no memory found' line# >body >user %lx ! ' column# >body >user %lx !stdout @ is my-self addr line# %lx ! addr column# %lx !sd-targetsWARNING: %s map is bogus, using default config_attach: device name too longfindzs: unknown zs device %dfindzs: no obio nodefindzs: cannot find zs%d%s "reg" %s = %d (need multiple of %d) warning: %s "reg" %s %d > %d, excess ignored %s "address" %s = %d (need multiple of 4) intrinterrupts%s "intr" %s = %d (need multiple of 8) WARNING: %s interrupt %d has nonzero vector SUN-4/%d seriesobio missingfboptionsno options in OPENPROMcould not find %s in OPENPROM bootpath: /%s%x/%s@%x,%x:%cpagesize %x l!/obio/interruptbootstrap: could not get interrupt node from prombootstrap: could not get interrupt propertiesbootstrap: less than 2 interrupt regs. availablebootstrap: cannot support capability of > 4 CPUsbootstrap: PROM has invalid mapping for processor interrupt register %dbootstrap: PROM has invalid mapping for system interrupt register/obio/counterbootstrap: could not find counter in OPENPROMbootstrap: could not find counter propertiesx%cc%c%cbootpath_fake: unknown system type %dcpu_configure: no memreg found!cpu_configure: ROM hasn't mapped memreg!PROM root device type = %s (need CPU)mainbusmainbus not configuredraidSUNW,sxeccmemctlvirtual-memoryaliasesopenprompackagesinterrupt-enablep2busgetpropintromgetcursoraddrgetdevunitrompropbootstrapcpu_configure-6//@/H/X/h/`/p//ˀ-B-6-9-7//ː//˨-B-6-9-7//h/ː/`/p//ˀ/X-68-60/pproperty lengthcache enabled cache_enable: can't handle 4M with hw-flush cacheDVMA coherent in4_cksumih_remove: intrhand %p (fn %p arg %p) not found from %pprofAsync registers (mid %d): afsr=%b; afva=0x%x%x NMI: system interrupts: %b VME0VME1VME2VME3VME4VME5VME6SBUS0 SBUS1 SBUS2 SBUS3 SBUS4 SBUS5SBUS6KSEASCTVI5MIFVMIME MAnmistray interrupt ipl 0x%x pc=0x%x npc=0x%x psr=%b EC EFSPSETcrazy interruptsintr_establish: level (%d) > block (%d)intr_establish: strange block level: %dintr_establish: level %d interrupt tied to unremovable fast vectorintr_establish(%d, %p) 0x%x 0x%x 0x%x != 0x%x 0x%x 0x%xsoftintr_establish: level %d interrupt tied to unremovable fast vectorintr_fasttrap(%d, %p) 0x%x 0x%x 0x%x != 0x%x 0x%x 0x%x_bus_dmamap_load_raw: not implemented_bus_dmamap_load_mbuf: not implementedmapiodevmapdev: zero size_bus_dmamem_unmapbus_dmamem_free: nsegs = %dcurproc = %p, pid %d no curproc uvm: swtch %d, trap %d, sys %d, intr %d, soft %d, faults %d stack trace with sp = 0x%lx stop at 0x%lx 0x%x(0x%x, 0x%x, 0x%x, 0x%x, 0x%x, 0x%x, 0x%x) fp %p end of stack trace g0 panicw: case 4 w: unknown case %ld w: arg not allowed Frame pointer is at %p Call traceback: pc = 0x%x args = (0x%x, 0x%x, 0x%x, 0x%x, 0x%x, 0x%x, 0x%x) fp = %p dumping to dev(%d,%d), at offset %ld blocks dump area unavailable mmu memory @0x%x:device bad device not ready area improper i/o error succeeded real mem = %u (%uMB) dvmamapunable to allocate extent for dvmaavail mem = %lu (%luMB) WARNING: not updating battery clock attempting to power down... power-offWARNING: powerdown failed! halted rebooting mmrwmmrw: out of space in kernel_mapmutex %p not held in %smutex %p held in %smtx_leavemtx_enter_trymtx_enterpv_changepte4m: pmap == NULLpv_changepte: invalid PTE for 0x%lxpv_syncflags: no segmentspv_changepte: pm == NULLpv_changepte: no segmentspv_changepte: pte == NULLctx_freemmu_reservemon4m: no existing L0 mapping! (How are we running?mmu_reservemon4m: can't handle ROM 4G page sizemmu_setup4m_L3: PTD found in L3 page tablemmu_setup4m_L3: unknown pagetable entry typemmu_setup4m_L2: unknown pagetable entry typemmu_setup4m_L1: unknown pagetable entry typemmu_reservemon4m: unknown pagetable entry typeVA2PA: Asked to translate unmapped VA %ppv_link4m: allocation failedpv_link_4_4c: allocation failedpv_unlink0pv_unlinkpmap_release: segment list not emptypmap_release: releasing kernelpmap_changeprot: no segments in %d pmap_changeprot: no segments in %d! pv_syncflags4m: no pte pmap: %p, va: 0x%x pvplL1 pagetableL2/L3 pagetablepmap_protect: last segmentpmap_page_protect4m: empty vregpmap_page_protect4m: empty vsegpmap_page_protect4m: !TEPTEme_alloc: all pmegs goneme_alloc: LRU entry has no pmapme_alloc: stealing from kernelme_alloc: LRU entry's pmap has no segmentsme_alloc: LRU entry's pmap has no pteskvm_uncache: table entry not ptekvm_uncache !pg_vme_free: no segments in pmappmap_remove_all: empty vregpmap_remove_all: empty vsegpmap_page_protect !PG_V: ctx %d, va 0x%x, pte 0x%xpmap_rmu: no segmentspmap_rmu: no pagespmap_enk4m: can't enter va 0x%lx below VM_MIN_KERNEL_ADDRESSpmap_enter4m: can't fail, but didpmap_enter4_4c: can't fail, but didtrap type 0x%x: pc=0x%x npc=0x%x psr=%b %s[%d]: unimplemented software trap 0x%x trap T_RWRET 1trap T_RWRET 2trap T_WINUFfpe without being the FP usercoprocessor instruction T_CLEANWIN T_RANGECHECK T_FIXALIGN T_INTOF syscallsyscall cpcb/ppcbsyscall trapframesyscall nargstext fault: pc=0x%x sfsr=%b sfva=0x%x kernel faultdata fault: pc=0x%x sfva=0x%x sfsr=%b text fault: pc=0x%x ser=%b data fault: pc=0x%x addr=0x%x ser=%b asttext faultillegal instructionprivileged instructionfp disabledwindow overflowwindow underflowalignment faultfp exceptiondata faulttag overflowwatchpointlevel 1 intlevel 2 intlevel 3 intlevel 4 intlevel 5 intlevel 6 intlevel 7 intlevel 8 intlevel 9 intlevel 10 intlevel 11 intlevel 12 intlevel 13 intlevel 14 intlevel 15 intv8 r-reg errorv8 text errorv8 cp disabledv8 unimp flushv8 cp exceptionv8 data errorv8 idiv by zerov8 store errorv8 data access MMU missv8 insn access MMU missbreakpointzero divideflush windowsclean windowsrange checkfix aligninteger overflowsvr4 syscall4.4 syscallkgdb execsvr4 getccsvr4 setccsvr4 getpsrsvr4 setpsrsvr4 gethrtimesvr4 gethrvtimesvr4 gethrestimetrapcpu_fork: curprocvunmapbufvmapbufvmapbuf: null page framedvma_mapout: extent_free failed dvma_mapin: null page framekernel: %s trapFaulted in DDB; continuing... kernel: keyboard interrupt pcnpcwimg0g1g2g3g4g5g6g7o0o1o2o3o4o5o6o7l0l1l2l3l4l5l6l7i0i1i2i3i4i5i6i7prom%s(0x%x, 0x%x) at nop ,a,pt,pn %%%s%%f%ld0x%lx%%asi0x%-2.2lx%%fcc%ld[%%%s + %%%s][%%%s + 0x%lx] %%asi%%fsr0x%lxl#%s%%hi(0x%lx)%%psr%%tbr%%wim%%y(UNKNOWN)undefined spfptpctnpctstatettticktbapstatepilcwpcansavecanrestorecleanwinotherwinwstatefqccrasifprsasrfcc0fcc1fcc2fcc3iccxccn_readsone_readn_writesone_writeilltrapsethiCdbaa,mbnbnebgbgeblbgubleubccbcsbposbnegbvcbvsap,ubrzap,1lbrlexbrlzbrnzbrgzbrgezfbaap,mfbnfbufbgfbugfblfbulfblgfbnefbefbuefbgefbugefblefbulefbo12d1idaddcctaddccwr12Y1iYandcctsubcc12P1iPorcctaddcctv12W1iWxorxorcctsubcctv12T1iTsubsubccmulsccFPop1andnandnccsll1Ddsllx1EdFPop2ornornccsrlsrlximpdep1xornxornccsrasraximpdep2addcaddcccYdjmplqdmulxUNDEFINEDPdreturnumulumulccWd12F0FtntnetgtletgetgutleutcctcstpostnegtvctvssmulsmulccTdflushsubcsubcccmova0jdmovnmovnemovemovgmovlemovgemovlmovgumovleumovccmovcsmovposmovnegmovvcmovvsojdmovumovugmovulmovlgmovuemovugemovulemovosaveudivxsdivxrestoreudivudivccpopc2ddoneretrysdivsdivccmovrz1jdmovrlezmovrlzmovrnzmovrgzmovrgezlda7d8dldfldfa7e8eldubldubap5q5ldxp6q6lduhlduhaldqldqalddlddadpdqstad7d8e7e8stbstba5p5qstx6p6qsthsthastqstqastdaldswldswaldsbldsbaldshldshaldxacasas2dt2dldstubldstubaprefetchprqrprefetcha7r8rstwacasxaswapafmovs4efmovdfmovqfnegsfnegdfnegqfabssfabsdfabsqfsqrtsfsqrtdfsqrtqfadds34efadddfaddqfsubsfsubdfsubqfmulsfmuldfmulqfdivsfdivdfdivqfsmuldfdmulqfstoxfdtoxfqtoxfxtosfxtodfxtoqfitosfdtosfqtosfitodfstodfqtodfitoqfstoqfdtoqfstoifdtoifqtoimbpp_recvmbpp_sendmbppdelay: %d port%s : %d tty%s magma_prom %s (unsupported) pri %d softpri %d:mttydcd%s%x: fifo overflow %s%x: ring buffer overflow magmamttymbppMAGMA_SpMAGMA,4_SpMagma 4 SpMAGMA,8_SpMagma 8 SpMAGMA,_8HS_SpMagma Fast 8 SpMAGMA,_8SP_422Magma 8 Sp - 422MAGMA,12_SpMagma 12 SpMAGMA,16_SpMagma 16 SpMAGMA,16_Sp_2MAGMA,16HS_SpMagma Fast 16 SpMAGMA,21_SpMagma LC 2+1 SpMAGMA,21HS_SpMagma 2+1 SpMAGMA,41_SpMagma 4+1 SpMAGMA,82_SpMagma 8+2 SpMAGMA,P1_SpMagma P1 SpMAGMA,P2_SpMagma P2 SpMAGMA 2+1HS SpMagma 2+1HS Spmagma_attach/p///p//@`/p// @`/p// @`/p//  @`/p/(/8/p/H/8 @`/p/X/h @`/p///p//@`/p//@`/p///p///p/ /0@/@//P@SUNW,spif%s-%x: ring overflow : expected 2 interrupts, got %d : expected %d registers, got %d revlevveroscCCR: timeout : rev %x chiprev %x osc %sMHz stcpri %d ppcpri %d softpri %d sttycdspifsttysbpp%s: draining still active (0x%08x) : Zebra : DMA2 : Unknown type SUNW,bppbppchild-presentfalse: no devices SUNW,xboxwrite0-keyxbox%s: (op=0x%02x): unexpected data (0x%02x) %s: (op=0x%02x): unexpected return value (0x%02x) %s: command %x failed %s: (op=0x%02x): unexpected data (0x%02x) in state %d %s: SHUTDOWN REQUEST! %s: LOW POWER WARNING! restoredremoved%s: main power %s attacheddetached%s: external vga %s uctrl: expected 1 register, got %d Tadpole_S3000XTmain power availableinternal battery attachedexternal battery attachedexternal VGA attachedexternal keyboard attachedexternal mouse attachedlid downinternal battery chargingexternal battery charginginternal battery dischargingexternal battery dischargingtctrlapmioctltadpole_powerdowntctrl_lcdtctrl_tfttctrl_brightnesstctrl_belltadpole_belltctrl_read_ext_statustctrl_read_event_statustctrl_set_glyphcouldn't establish interrupt socket %d%s: spurious interrupt on slot %d isr %x %s: unable to create event kthread%s: slot %d still busy after 3 seconds, status 0x%x pcmcia: expected %d memory ranges, got %d : %d slots ts102tslot_eventtslotstp4020_delay%s: unable to create event threadstp4020_ev: rev %x stp4020[%d]: spurious interrupt? stp: expect 2 interrupt SBus levels; got %d and %d: attach: cannot map registers SUNW,pcmciapcmcia_function_enable: function not initializedpcmcia_function_init: function is enabled"(manufacturer 0x%x%sproduct 0x%x function %d "%s: error %d detaching %s (function %d) pcmcia_card_attachdisestablishing last function, but card has no ihchanging ih ipl, but card has no ihcard has intr handler, but no function doesfunctions have ih, but the card does notpcmcia_parse_cis_tuple%s: CIS version PCMCIA 1.0 PCMCIA 2.0 or 2.1 PC Card Standard %d.%d unknown (major=%d, minor=%d) %s: CIS info: %s: Manufacturer code 0x%x, product 0x%x %s: function %d: unspecifiedmulti-functionserial portparallel portfixed diskvideo adapternetwork adapterauto incrementing mass storageSCSI bridgeSecurity servicesInstrumentSerial I/O Bus Adapterunknown (%d), ccr addr %lx mask %lx %s: function %d, config table entry %d: memory cardI/O cardcard type unknown; irq mask %x; iomask %lx, iospace %lx%s%lx; memspace@ %lx%s%lx%s%lx; maxtwins %d; mwait_required rdybsy_active wp_active bvd_active io8 io16 irqshare irqpulse irqlevel powerdown readonly audio%s: %d errors found while parsing CIS %s: can't alloc memory to read attributes %s: can't map memory to read attributes %s: CIS checksum failed %s: using CIS quirks for SVECFD605 PCMCIA EtherNet CardV1-151<1511 =1<1=11 (11`(1|1P1<1U1<11<11<10(000P11`: function enable failed : unexpected number of memory spaces %d should be 0 : unexpected number of I/O spaces %d should be 1 : can't allocate i/o space : can't map i/o space port 0x%lx/%dep_pcmcia_attach: impossible, %s%s: can't alloc mem for LAN iobase %s: can't map mem for LAN iobase %s: can't alloc mem for enet addr %s: can't map mem for enet addr : unexpected I/O space configuration : unexpected number of i/o spaces %d should be 1 or 2 : can't allocate I/O space : can't map NIC I/O space : can't map ASIC I/O space : can't match ethernet vendor code : no suitable config entry AmbiCom IncAMB8002TPMX PE-200DIGITALDEPCM-XXPCMCIAUE2212D-LinkDE-660DE-660+RPTI LTD.EP400CISV100RPTIEP401 Ethernet NE2000 CompatibleACCTONEN2212ETHERNETW89C926EthernetAdapterSeiko Epson Corp.P/N: EEN10B Rev. 00CNetCN40BC EthernetNE2000FastEthernetV1.0LNT-10TNNDC004743118001TAMARACKGVCNIC-2000pR01Ethernet CardiPort10/100 Ethernet CardFast-EthernetETHER-C16Fast EthernetPCMCIA LANCF10Base-EthernetLinksysEtherFast 10/100 Integrated PC Card (PCM100)Ver 1.0DE-650I-O DATAPCET/TX-RDFE-670TXDLINKSYSE-CARDPCLAcorega K.K.corega Ether PCC-Tcorega Ether PCC-TDcorega EtherII PCC-Tcorega EtherII PCC-TDcorega FastEther PCC-TXcoregaFEther PCC-TXFcorega FEther PCC-TXDSMC8041TX-10/100-PC-Card-V2XircomCompactCard EthernetCFE-10080Hz0X0` 0h0p000000000@00@00000@30 000(000Pl080 0PH00 0h0p000000`0000 *00 *0HT00 GC000000 00000HT0@0@0P@0`0 *0 0p0x`CGCZ)IeI000ZIZIIIIII0I0PI000I000IE000]IE000PIE000 IE000@I I0 0 00@"00 0-/0 0 (0 0 @0 0 X0 0 p0 0 0 0 0 0  ")A0 0 u EE0 0 0 -X@&o@o @o @  @& 3BIE0@IE0HTIE000@IE000IE000 I@#(0wipwr: can't alloc i/o space port 0x%lx/%lu%s: can't establish interrupt %s%s Wireless LAN PCC-11Wireless LAN PCCA-11corega_K.K.Wireless_LAN_PCCB-11WL PCCL-11ISL37300PWLCFL-11INTERSILHFA384x/IEEEVersion 01.02SMC2632WNANOSPEEDNECWireless Card CMZ-RT-WPVersion 01.01NTT-ME11Mbps Wireless LAN PC CardAddtronAWP-100 Wireless PCMCIACabletronRoamAbout 802.11 DSIntersilPRISM 2_5 PCMCIA ADAPTEREval-RevASymbol TechnologiesLA4111 Spectrum24 Wireless LAN PC CardPLANEXGW-NS11H Wireless LAN PC CardD-Link CorporationD-Link DWL-650H 11Mbps WLAN AdapterAllied Telesis K.K.WR211PCMVw0 00 0000 00(0 080H0X0hPttt3V0 0x0hV00X0h8V000V00000hV00 0s080H0(0hoo PM0x0k&h= = s qPs&! qh00l C00 0 08apwr-on-auxio: can't map modem registers modem0}sun4c compatiblecr .( OpenBSD/sparc: this kernel does not support the sun4d) cr0}d'(^ <<d d@ +8*X0*X8*X@*XH*XP*XX*X`*Xh*Xp*Xx*X*X*X*X*X                          vTUVWa_Y\]^XgZ[`jicehSbfGHIJKFEDwxyzLMNO#$%:;<#$|} !:;=>?@A(2&=?0t0È000000^0000^1p1p00^1100110011001100110011001$18001$18001$180011001L1`001L1`001L1`00110011001100110011001 x1 001 x1 001 x1 001 1 001 1 001 1 001 1 001 1 001 1 001 1 0 01!1!001!1!001"1"001"1"001"1"001"1"00-_1#0 0v1#D1#X0 0v1#1#|0 0v1#1#0 01#1$0 01$1$00 01$D1$X0 01$l1$0 01$1$0 01$1$0 01$1$0 01% 1% 0 01%41%H00`1%`1%t001%1%001%1%001%1&001&1&,001&@1&T001&h1&|001&1&0(01&1&001&1&001&1&001&1&001&1&001&1&001'1'001'D1'000'1'l1'X00'1'0x001'0001'1'001'0P001'0P001'0P00'1'0P001'0P00'-1(H00-1(H00-1(H001)1)001)1)000(1*D1*000m1-1-000p1i(1i<001ix1i001ix1i001ix1i001ix1i001i1i001j1j,001jh1j|001jh1j|001j1j001j1j001j1j001k1k001k1k001k1k0t0r1l 1l4001lp1l001l1l001l1l001m1m00.+1m001n1n0001nl1n001n1n001n0(00 u1n0(00u1n0(001n0(001n0(00u1n0(00u1n0(001o 1o 001o 1o 0\0r1o 1o 0 0r1o 1o 00r1o 1o 0P0r1o81oL0D0v1o81oL080v1o81oL0,0v1o81oL00v1o`1ot0 0z1o1o00r1o1o00r1o1o0 01o1o0h0r1p1p001pP080011001100110011$00181L001`1t001100110011,001P1d0011001(10010001$0@00180001L000*X*X*X*X*X-*X*X*X*X*Y*Y*Y*Y(*Y0*Y8*Y@*YH*YP*YX*Y`*Yh*Yp*Yx*Y*Y*Y*Y*Y*Y*Y=PCD~HH Vp 9ZRPL`qD`,XD&l|HIG1vFED-|u @@5w@H0 **h********** *0*# *%* $,*@ <HCDG4,LFt-,THIS is A memory TEST pattern*X**%edq*8o$fHjeer@(8*$t,`54''5''5L5X5  @ @*00*Xh`/h ,  NlT+d .p-x   l   @Td+44  PT p Ah Ah*XACX*Xz|~*Y`5 +h T+p l+x s+ &t+ &+ %+al+a8/ 0+ $+ + &P+ %$+ ', '+ &+F &+ %X+ %4+ %+ %+ !+ % + $+ Z+ $+P %|+ oH+( "p+0 "\+8 "H+@ "4+H " +P " +`+h 5p+p :* :+x 3- m, q+z q+ ,, ,+ + o+ p+ \`+ \`+ ],* ],+ \+ \* \+ / ", T+p l+0+0`+ '+ A+ !D+ /$ . + .` , , -xx55P09 +0 l+0 l+0 l+0| l-=0 l+0L l086`2@ | \ p +  | $*`*X*`+*`++*X++*h+*h+*`+*h+*h*H*H*H*0++*8*@+-Pa :h # G G( # # F66 \ \ \ \ER CE ST |SL RR hCE ST |NM 8CL 0PL 0RE |@RR hCE ST |PX hTF PN RR hCE ST |  H  4 h 4 < vt \ j 4 H u 4 4 4 4 4 4   lp vt D u l  0 p0 < vtƜ00 00 u0000 008   8   <  p D ,0d4 0dnative(K0 (<  native(K0 x(< Z4+9+:+: m `  |   p  vt0 mh  ye  c\ P m (0 ! l  y$ }<x  o prfpe@ sD m 8 m i m   X W  N  ( 9 O m  4Uu o 0QiH m m m m m m m m m m@   m m  `  "@ T 8 H m m m m m j m b \ m]` / ~p @ m 1@ m m( 8s m m m m Q m m m m , )q m    _cH m  ]@ m m R x~t8Zsn< m  m m m m m m tV m m m m m m m m m m m m m m)J m m m m m m mTS( m m m m m m # " 4 m m m m m m mo [4 t + .X$ X mXg^, d ml  m P P P P P P P P P P m 28 m m mP! D E mK, m ռ  m m m m m x m m m m m m m m m L m   `l $  m m m m m m,{ m mTR\   m m m m m m m m T d   m  p VT E` 7qd \q z1 I %   x h  v< $ ynPmXlrdbq@v Z wylo] ut tmlx H   r r r z qp u y q q  r  qP | rt0ڠ0ڠ0ڠ0ڐ0<0ڰ 0+D+D+D+E+E+E+E +E(+E0+E8+EH+F+EP+EX++Eh+Ex+E+E+E+E+E+E+E,+E++E+E+E+F+F+F +F0+F@+FP+F`+Fh+Fx+F+F+F+F+F+F+F*m+F+F,p+G+G+G+G +G0+G@+GH+GX+G`+Gh+Gx+G+G+G+G+G+G+G+G+G+H+H+H(+H8+HH+HX+H`+Hp+Hx+H+H+H+H+H+H 0  O O P(0P0X0`d+T +T0B@+Vh/+[+[00 ] X0 n4 m  +u(-(*s/H+u0*+u80+u@,+uH+Zx+^0*װ+uP/+++uX,q-=,`+u`*װ+++uh*+ux+ip-`+// L  L l d 4  DhHxt4`tDttyclsttyopnttybgttyinttyoutvutt`Dd~yPeL`c    P  bDd~yPeL`c    P  b  ~D ~tbƄTP¸c    P  bŬ~yPL`cҐ$~yPL`cT~yPPL`c +z0x $0@+8000000#d!|!!p+0`00X, X, @Wd6lP0,wffs,mfs,ext2fs+0cd9660+msdos,hnfs+3\udf 2lockf@` ++++++++++++++++++++ +(+0+8+@  <LPN<L4 <xthlp D <$l44 < < <4 <$4,T44 <4$0p <0 <Ɯ00d00Ĕ0000008˜Lô. .. ---HF*+\/10@ Cd( . 0((<((*G<J(4L.H73.@`,-St)\)* )*@ n[p0h00^^3333+pLp#$%&'()*+;,-.;/;0;1B@2T 3T 4T 56T 7T cdeB@B@LK@O[T@n6%Ql7Jpp@@@@ j j j@*Yp0x00*YXH,$D$<D0X`00X`0<\*YH*Y(Rlb*Y(+( 00| ]c!|Yph!pZ+h20H0|*X$*Y@|$*Y|*YP|*Y+(+888, 0D`80T|hX0ln<,01-+.0-+.(0 $-+.J0ab-+.W0) $-.0b-.01-+..9t;.03-g+.l@02-gl+.l0l`-+.k0/-+  X07-+. 0p(-+.ـ00-+. 0|,+p~0{01-+.4+x00 dd00dX00000<8Q @X,0000000000p00t0x0|0000000006|(@AAA==(A*E@ dd%(i @@@@@@@@@@00T8T8D0x0X0000$0P0X0T00+JJJKKD+p,+4+|+DhLT0$0X000\0`*Y0X,EX p,Yt,ZT0dt,Z8TD H,Z ,Z( x0,Z@$l,ZH$D,ZP$,Z` @ ,Zh +|,Zp X@0`>,Z `@c<,Z `@?<bl,Z @x|,Z00,Z@@ 4,Z4%%\$$#h,Z4%%\$$#h,Z$4%%\$$#h ,[X0`> ,[`c< ,[ X0`>,[(`c<,[0Z,[8Z0(49X099X099X!,\(400  0000,b@,b @@     F'' EF''' ?F''F'' F''' F'' EF'' ?EF''' ?EF''' ?EF''' ?EF'''' ?F'' ?BF''' ?BEF''' ?EF''' F'''' F'''''F''FF''FF''F''x( p 0l´Ԝ0`~PyPxHp0$k| $\ 8xDj|$4SHqHlp$k|jlp0p@0$k|Ɯ0000(000000\,u,u,u,vaHl̨2t2P28H\@%$D+ 6%B$5`03\2z48XDh##->p##l#p#$(D((((<(###$(D((((<(# ##|(@0((## #(X((D((X((## ##(0((D((X((`(##(###((40( ####(x((D((X((`(p##(0x((D((X((`(##d##(0((D((X((`(#->x1`->1`->1`->x1->1->1 ->1->x1->1->1->1t ->1t ->1t-?1t-? 1t-?(1(-?(1(-?81-?X1-?h1-?x1D-?1-?1+1((D*MD\*P\*U*S -?-?-?-?-?-?-?-?-?-?-@-@-@(-@@-?-?-? -?0##-BޭޭK %%%%Fh P##-6#p##@##@#H#t### װ1!`-D-E-E-E-E#<#H#T#`#x#P-E0$TP @-H *PP-H *P(-I5tM-I##T+7@##(-I#T#ܨ#-\-]-_#####\#-`#8#$#h#l-a@$$d$$ $$$ t$$7x$7$&p$$@-b$;$;,$&p$$@-b$;$>$&p$$@-c$Cl$C$&p$$@-c$G@$Gh$&p$$@-c$Il$I$&p$$@-dh$L$M$&p$$@-d$M$O$&p$$@-eP$S$T$&p$$@-eh<$l$d$,$L-8$$$T$$+h$($ +---KP%%%$$*P% %"%!% p+4%(%*%* -p%64%4%4-(%7%C%B-x%Vx%R<- x%Q%R<-H%X%W`-8\%`%]--%w|%s-%%((P%h%S%% %% -%%P$%H%\%%%%% %(%D%p%%%%%% %(%D-x%0%%%\%%t[[dP[]8]@%%__(%P_X`Da_Pam7930xaudioamd%%% %$%L% %X%%%$%%%X%%%|%%8%(-0SUNW,CS4231aonboard1.%x&'&%%t%. &0&NX&Q|&1d2d&3&3p&H&A&@++#aa@(([//\))](-{/-|)-}!!c/l-y-soxoco<<>>?? ' ` ~ ^ "' ,AAA AA'CEEEEIIIINOOOOOUUUUYaaaa aa'ceeeeiiiinooooouuuuyy"A"E"I"O"U"a"e"i"o"u"yA^A`A*A~ACE^E`EI^I`I~NO^O`O~OU^U`UYa^a`a*a~ace^e`ei^i`i~no^o`o~ou^u`uy. x&^&b&j&^&_&`&`&r&qT&u&m&mt. @Boldface.iso1 1.Gallant 1<1cp&1d!1.1.Dwfllllllll||| 0 `F8ll8vv0 000000 0 0f<0p000x6 0>p00p>p|`08l 8llF`0| 0|``f`?8`DDE9  2 2 a>wc`aaa?`  0  0f`vvf`    ` 00`000000006??a@ 0  @````@``@? !? ?1```@```0 00`gop``````p@??`@@000  000 ``````p?```<     `xx``88`9  ?0```g ollg`0? ? @@`@`````a``````````` `````` 0 @a``````````````````@a0@0@000?00000 0 0@0@000?000000x` ````a`` `0````````````````````````80acflxx|ngca`px00000000000 0 p`pppY`Y`Y`M`N`N`D`D`p` p x X L F G C A@@@`0 ````````````` @0@00`0`0`07000000x `````````````0@8@#a````|ngca`p0`` ` p<@`@``F p` ` ` ` ` ` ` ` ` ` p@?`@000 f f f v w@3@7@;;p` 0@8   @`p` 0@ ?   ?``00 || ||1`0009 ```gop````````p`xO1 ````p@0`````1 ````````p9`p0``````0`   1```1?`? `@ @ ?0p00790000000y 08````acf|x|ngcnf`f`f`f`f`f`f`p'y0000000y ````````p@8q``````````@p````  ````````p`8````s48000000x00@8 0?  @y00000009`p` 0@0@ pf f f 7@;@;@p@8  ` 0@0@  xp`A8 p`8    8 >`6gC0000~|V`s@ o`?0000?o`@ ``00`0?a00`0`00/@)@(@(@)@/@0``0`0`?` 6ll6 `??0/@)@/@*@*@+@0 33 ???<f0`~<ff< y00000009>`0000x?```?````````` 8<0`0`0`?l6 `` 6l08@@@@08 8D8D8@@@@ 000@9  ? @@` ? @@` ? @@`  ? @@` ? @@` ? @@`   # ##CCC` `````` 0 @  0@0@00?000 0 0@0@00?000 0 0@0@00?000 0 0@0@00?000 0  100`0`0``0`0`0`0`0@1 p` p X L F C A@@`0  ``````` @0@ ``````` @0@ ``````` @0@  ``````` @0@ ``````` @0@ 0`  0` `!!c`c`f`f`l`l`8@8@8o p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` 0@ ``````````8```acc````````ac 000900090009 0009000900096@&``?fff v@;1 ````p@0  0``````0`0``````0`0``````0`0``````0` Dl88lF ````p@8 'y0000000y  ````````p@8 ````````p@8 ````````p@8  ````````p@8 ````````p@8``#c`f`f`l`|@8?`` y00000009`y00000009`y00000009`y00000009`` 0@0@  xp````aaaaa`` 0@0@  xp1d1d1d1d1d1d1d1d1e 1e1e01f021f8)1fpa1f1g1g 1go1h1h  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ͳɿپ̴ް  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~&&ɀ&&.&&$&&Ќ|&4&ќ.&8&x&%٤x&&,.&P&&8%٤t&܌&(.&`&<&&&&,.&&&&\&&.'(&`&&4&t&.'81+$A'* + + &$&''T.''''|' '.''' ' H|''.(x' '$' '% '".(4'%'%`.) '70'%'5'<':,.)p9100_romfontE!c'AL'='='D'B\.+x'R'F'E.+'X'W0'W|'\T'Y.,X'a0'\']'d 'b@.,'n'dl'e('rp'o.-'sD'tP.0.0.0+*p'~'./'Μ'<.*=.symtab.strtab.shstrtab.text.rodata.data.bss@*,!*X0*Hž)0//11sZx1s41u4L` 3@*X001 HXH-<H>pI E8TDj g4u 'D10\HP,'."8 XH '(\!82)f;L R)L_&j 0lv&3#1<dp$Lp {, 6#ip1&NL:)J(G%8S(a$rp(^4#h1$00 T (d(F %1-aX6s(E|R0a#ܨ`p Լ~Y!d00ި&41&|1h)l, 4] %6 @F0LM]@d)|z(p041\8΀d1##<%(0 pTX{T8.PTB#OCD] /(na~;PD tT(T01@ L'Q0*>THtP'%$&1!>0UP`7k1Ht zH<"g(0< JdT8 $d0$( x:CJ:\e|y6xH6Ȑ. $880< Ȭ ((Č $X&Mx\ n4#88 (h:$;pFؘVtm#dD} HH <)Dq@$4&  H  pD8 80 %u` 8 I%ؐ Y0 j|@ s$,d 8( 0 dh4 5  6 $` P 60  6ǘ 0  H|  &l| *!d 7 Q r  ^$Y<@ l& z&4 9D  | | (( - C )L $l h `  H ,0 ;'H4 H, ` !4d y${ 0$ Pl $֨  \ x T  0   1*0 &(4 &p, :pH UXlH g"L l( p !ՠh 6? wt  H, X 4H <\ $ (P &| ' 08 ?t F$0 Ul  dl8 m( z'h| &  ~4 Ŭl ( 1 $ t    0  &$8ô|!78B(`$P#D[*U`1(Lr"l8|$$ED6p<\%`|6|&>pH <")&7!HTT6x^ .<dkDwL1qT6@ p6 t b,<M<*Jpd 6g m+ 44&jC8T0`0q!τo`(H d81 "|,4DDX' $)p-pH65>((`K([((V6nX} ,$ rX h*?$x&{40ވ `g*04|B0@KJ|Y tDc <`wD BDpL%TL%@ %ed $# N0`+[:DKxT0Xb j8w'\~l0 T8`p5ڬ'%8$$nAh#. %|$A4Q0 Z1k(j +wYhx`564#  tLp86t\1) LX20|4> ,J"lZ (h4r d 470< *!% , *(P!?d4y D0JpUc&t| $ 8 $oh<)lH0|o@<(#40|A Tt<g$r 8} D L\ '$Y*>(|P@D  )# 80 <Td J'(Y (@8jX{6  t1!$860tD'|L40l`l<.H () V0,7 |4HR%+b7n1% xg\&thH |'H e" "|,X)0< ,KX8 cK,mxz%#$Hst(  &38"&#d#H  T \ &0h*#6 R| J/Q1i<Z%٤8j'DspL \( x)&%*(6h  {00 &"828АHZHk0ݨDx8 !| <( XH!$( <\$h(h!` 050xBlKw` pk /{l8@ t(0$d4 !@ 6? =4"|06(>$$HmDLQ Xh] f8pq!pI ]8&l,0o-V  `_X0# pl1Ɯ<P@TM8Y0he ^\m$`\H|61&,(Wl,|\D$(`$=$8" td Ќ (4 3D @ ?D N` a' i#w t |6_ _p 7D  0dP <$ t(  ; 8`!&!#!&ˬ!5T !B)|!Z%xX!h@l!y0ݠ! \!\!&ohx!&~!&T4!8'$!t " c" Et\")|"81l"A#tH"M8"["k6"w%H"1"6`|" 8<"84"#8""6D"$"tx#ِ\## 6`#/ #< 4#PD#_#o (X#|8## j##O8#1# L#z#0# d8# #h|#Q$ ̘x$0$, $;)H $O HP$Y%k`$`$$m(X$w0$8$ϔ4$1 $#L$ $P$8$7%64P%#(%1)l%*6X%3 dp%D0%N$a%_1%o0% #08%'T%0%0`% #hP%08%%c%1 p%g&6`&kD&$#p&6&L &V &b1&&i%a$D&v$&I&#x&&H&&0T&( &X0& ,H&f&l' ( ' '&1'00$'=6π'H(( 'U(P'a8'n8'zF' \'$'-S'#ft'w,'('' \( &,4(6D ("8à x(*C(3(B0(V#(d#Vl(u/(6X( (($*<( x(M (() )4d)Ԍ),1t)9T)C#JT)W8P0)`6h$)l0L)w&8,)0p) c,X))(tH) 4)#T$)1l)&AdH)6D)* l*H*(0<*51#l*?ʈ*Gl*Rh`4*f@p*1* \|H*0* ¼*ؤ0*.* `* x* x* ]X4*sX+ + +% x+4 Ɛ+; @ +G'+S1+]8 l+o)6+zw(t+d$++-x+)++`+1n+%5> 0x>#B>.'\>9\X>Ll>]>p F8>y>0 >1$l>%>$<> 8>1(> T4\>0>@H>?T? &<??.?@?R6?\'Dh?h%R<<?r(`(\?{8P?p? ,?0xL?0? F4X?1?6@5̀@"d<@-L@C,<@[#@b G@@pπ@yPT@4@#@P@CH@Wt @'_\@0`@L@ !@HALPA#gA! A10ACk@AN D`A]!?8dAl1Az DA%[AeA?lA0A&KhA1tA>0PA`A1$0A% BB V<B#$B2 B:"8BD#hBS 5<Be By%xBdBDBHDhB0HB#bdB(LB1otB0TB'P@ BTBC 0hCHlC'C2tC: CF tCN#C]lCz)|@C!8(C$ CC PC8C%ltC$CHD 0XD^D" % D4D@H8DSiDh0DswXTD} H LD1!D$tD8 D,D6 D D%PD8D60D#|DE 'dE$0E! E/#}pE9 3DTECEV0EcEl!Ew $EoDE,hE#k|\EE1tHE E"E"XEe PE FF#%F2,F:FK$FT lFf0@Fq#gXF}*lF F p`F%)lF1 FF u4F%LF#(XG1 \G!6\G-xGAGN|GV,dGi@H!%\H5xH@ `HWX0HncDHyDH8,H0HHlH5H H`|H"%0H |I 1o`I)DI&$i4I9(xIJHIUIZ8If)Iw6(IhI%|I\pIl,ITIdILI1n(J8TJ 'HJ7!̰J!'J0)JA%]JKOJ]iJg7Jr(XJ0J{XJ0J#hJ"`TJJ tJ "J J xDKZXK PK'rp$K(0K7KAtKJx0KZ Kg 4(Kv8 KhdK0K KK KUK۠KK \ L'@L0L6xL2TL;= tLE /DLX),LcLm <Lv0L$ LL5LL]xL#@L:Ll|L"|dLcP8M7HM"M1%HM$ o,M6 M>ؼME0MV@Me)F0Mx&S0M|M`Me`M qLM8M)(M QlMHlM<M&sN 0NkN'6N1 0N>r$NLJ4NS(NedNpm$@NzlN6pN`lN(TNtN N&\N)DN\NpNnP|O O0O!xO>hODx`OWȨOm\OL`O!g DO,O((O1 OaOPO-d O$Pa|P*Z P#XP!)l\P38P9#`PE(|PV<|Pj Pt60P dP(P2XPpP P0|tPNTPxP5P6$PpQ6x(Q"',xQ0@Q=OQEqX0QV4lQ^ dQp,Q{(Q|QQ0QQ1#DQQ'(Q0`QdR ppR)R. ^(@R<tTRM*YARRR`1$Ri1p0RwـR%|R0R5̈́R9R1R|R1)RR@DR1`\S US6?4S ]PS-b S(8@S90S@!ESRSa0Sw lS1S:8S`SC8S S4SS0SilLST0İT%PT01 T;(TB0TX%Tp?"T TcHT1o TPT 8XT&-,HTT5TT0U l0UU"0U2$d<U9#L`UDR\UP%U] { Ui28UtTUU`LUUҤU08UHUdPU-8xV _8V$tV!*DV1$VEhVO) VY0Va dVo0tV{0HV5 LV9PVmdV l(VPV1# V(͌VV1$V*PV8W M W84W!'+<W40 WC tWV0xWa6Wk+W0xW#\W2t W8pWBdWr W$38TWlWD W $W=``X p|XhX X4XC'  XO&_(X`Xs00X4DHX'$ X%(X1# X#xX)(xXѐX)x$X+X HY'Y p8Y! xY-18Y6Y@(d8YLY]4Yi!HY{DYTY1PY phY |Y*Y YdYY!<lZ!UZ8Z! BpZ(1Z460Z? gZOZ[ Zed(Zq*0tZ~e Z IZ08ZZ@ZڐZDZ6Z&[1\[H [1-[("[-\[: h@[I![a8[p [| |[ &@[ K[5[ %4$[%8[0 [ ,[[6H\St\ Q$\'%`\"#x\*0\0"(\@ \M1'l\Sd\a(\lҸ$\ !D\8\D|\ad\ Mh\6@\%h\h]0$]]2T]>0]JL]U]Z x]c6d]qPP])H]$]5l]%]8@ ]]w]*>$]&܌x^6`^^%0^58^Gd^d^s$p^z. ^`^(^&^0^ o`^^h^p^I^ w0_)e,_ H_,_< @T_G&t`_T H_j$_ypd_%yP_h_ӈ__T0d_P_&rh_l` `Nl`&H`*&`<1* `K04`V&`b`o`v(40` xP`$tX`1m<`#}88`D` 8`%,``0|a.a\a(0a:"=`aJ aSa^ x|aj8haqda0a0a0aAa PDau0aB\a`(a$|b8 b5b#| Tb#!X`b3 Tb9#bD!FPbRbbRlbv0bPbbhdb#P b`b6h,b8c \c'X0cDdc(1xc4!"THcG $ c[x0Pcbcqcw Ztc c dc',(cptc /$tcw(c Xhc$8d Pd$)Pd4ZT0dC!ưDdP <d\]Hdi8d-Pd d`d Tdd,d6e<e$e%e65heG'f0eSs0Tebhepe}6`e!KTLe0ڠeWe1&e1%e<el8e&Րe7(e f%~f $dfxf+(f80fF*?HfP!f_8fh(@f"Xfh\f$\f7f0f'sDlf@f1#Xf)`g,g$P g! g3PLgJagZ,8gtgHghg%FXg!t`g <$g1"g)|g&g!7Lh1&@h 1 h xh+8h;1%\hIH4hS0ɬThZ`Dhjhy&8h \h$h%(h1$h%P$h)dP,h%Bh &h F \i8i+i# ü|i8 QiG iV%Ǥ4ib68is$ili ndi$ pii0i,i \`Li8iLHj ptxj% jtj1 C`j@ )X|jH-Q~j[jfjxjjxj$t`Tj)@Hj8jDj0j1 kDk1ok$<k& , k+8P8k480k?kJ `kdT,k|k7k Dk1k1%`kgkk8 k kX@k)s `k&l 8ll21olC6όlJxl[8hll!lzTl zl$l6DlDlDll LPl(sdl :lhm<m#6`m.'@m:!8mC!mO m[(<pme!my4m&mm ,xm %4mm mxlm\mTn1n"#dn6 h0lnJtnU<ni$,nz8nStdnۤn ,Dn1n Ln 8n6n <\n*, o $o( <ho2άo?_PoPRldoXЄoi-ot)0o)|$oto%o!8oo6<oΰHo0p'lp"p,p.1k0'p<&^pJ%<pR$tpZ6pf lpt p8|p"ϜpOpp#p6dp LpSp'ȘTp% qlq ̰8q1`qA$L(qL0LqZ2qe8qs6\hqqpL Lqqq8q pq" q0Hq8 rFr !r(r!vr4JtrBXrKdr^rftrr80rrִ rW0r|r ;(rXs `s*Ps8s(ns6@sA#|<sM sT'sc1sl0H(s*& 0s8 s`seds Ts#(,s s spTs0h t ut#Ht!\(t/ht: 0tN1tX,h4tcŸ,tst,tTt#|t =pt6Hxt}Tt1p$t f$ty$0t%@Pu u du$u-puC<4uL1duluw;u~(u1 u8 uumu -`uܼu6Du.(v0$vYtv 0ޠv, v; @0vFjtDvS48v\Yvu)Yv&Mv v8v%Q@v 4vv0,v,v1w(ww" .`Lw7DwE1kwPtwXwf =4wp  lwv1'w}|w'<$w&-tw0`$w6Xww8w(8w k<wLw Hx xE\x+P(x9&DdxG]$xT&xxf+:(xp'\x{%x @ xΌxLxZh xTx!$xxTxyy $,y T y$ 8y21y;)_yE8yO<yec yr0Xy} y vPy0py0y0DyVy'?y#KLz0z#8lz1z+@z6)0z@,LzH zV hXz`'zl& z(z`z<z Mlz1n0z@zlz0z( {p,{{%yph{61{<'t{F{Z${i6={x${2p{ <{{ @t{ L{ L{0{%| `T|6ǐ|# q@|)8P|2#H|D"|Q\|b$P|t8|P|!(X| v,|#L|4t|#|'kx|}6|} 1o} Y|}1p}!gT}0'F}9 }F %$}Z!H}d t}l F}~ T}|,}L}d}5H}1p} } l}k~+~1 0~? M~J ~V ~b~p$ $~{L~~"~&z~d~~!,p~ ~6aH~0`04D|6BKHdQ$gy6(\$d$\ 0 @H& 8\P5h!d\H- x@H\\L[<`j1ks H{d1!` 1L@45Xj#Ic,hh)"lVd hp2&0>8K'LWTtb5m5t1tLs 9XM`'yd~ P$(01  EDT:,)0:8C6h0MY!(Dfh@r& Lx0(6\.+U4Ldl8(1 'e $T  #1\1PJcAtpt` VT~P1 ´ |0Xxi0 $08(1 :@0B \R)<\er7|6t|,1&h$ `KP k<alx1! Vl/(;)dTMh\c e60q1*(#8(6FIT@ 5dX)6` *M1j&%\T6 T,G|VwrH*<(ѠT1,\ jH,8w0 9d*01|,C(V `leMDn8 0 hv( sD'*dH#HP  0hUp'&X|5lKOP,Ym y% TxH Xxy@0 N(8} `-@  6\" 61 T=HRKD^ h d45lP`(#XP-_T ((d#Y$(38D0B P`a#ixo80|0ݰ|4A0d1&~0߀8,Gx4p0 1%Id0(24(A \K0^% f8s{&<0@$1' ,5\%64\(](h8s8d6YX64!04,< 1@L%`b1mi%<q1| L LfX8 6x3($` GT)X0$sx@0L,4a8j)`tv(i(0T +xh8\T|&43d!4 #& .76 5 XC glW >lc) o({iL |(t( 6ϐa|h6',4(`l:K-4b6j5`z&߸8@h1j(0 (t xD #&,- T8DԜS$]@d~)q (0L$O0<$ 3d)@| %5DRːbtq&rxh~X vT(!ph66h80È0 .&XDA1(Va)j#Lrt~$x'D8%T0d$ =$d'%`L%` D t8 p (01 ]`;%XCS 8,g%<|$MD$A0# Xx0X ~4*%d 00t-6T 66|B D$P]1|k~1ش('r00P`4,4#l #$@3p4=8'PlA!N8hY0De0o6i8w4\p$$x| Mh<1 $pH 1#/{h=' K$lW$kyPv<$@"1H` [45$&rX)al0l,SHt 6G ٨),$r TA#TJW#$b0k1p |05T xh*&PpP):`8%GT`0)$.|;6 S1i^&lpf HT8$0tm<P'O%@( m`1x,'(<p?@XTjH\0e dXoo06 {8&$+\4H(@h6(8x$<%80P?L)]DPjx}W X$Ӱ880' p|l1T 1 6e'z`'%d01 FS%lD[dv^,'JbL]`t$ (000Ĥ `1$$0.=0|O G,,\xn %\8} $#gt DD$d@#\1t 0,,Q%(X"%r<)%+ 7H`tR5D \p1<d'0()   0 Dp1x T)P(#-L<51%;1%A8@hJ$0U1^m}t~6)gXtblH06| Oh5(e  \)L(!Xh7 lLxXU6?8^1Pe!V q06x*I@("5`4(1'T16e"\ \1$C*Ul_0o _h8}0j10d < '{88\   D-1iP(=PhE Q(Pc%\x<lTE0 !@$X1l0  66 .x&tL6)fB%|(Xb@i*'xXz%0("=";,$X0(1 G4  1#1&2&ќ>&aP0KRW  c'Hj5q zPx qp@ D1x8 Xl"ll'!4D88 <8J$W $b&$0q8`~1 x"|0ڰ6?< ;$7`1#!%4(7ՀB6,J%(X8en|y g(T1d1 @*+0`P4$6E<8|+ n4D;00EaPR|@e llt J *I|# 6Dx d+ 7L4"  Hv1~=0N$Y6Hoz /8l4H6h,P0&D-Uv\H*I0 8'dx#150A)J X|$X 6 0j#lv1'AL64(b#$P$dTxH4 'rhl4ŬHO,`^,<gt8xD+' 90P v< P( u$,HD7X# (|1*X4-`F1`N',^-Ydq!`d|<4 @d>418)&<x&0@6`6D h&p#(P ," :h<1 v,H %$Zlmu(<8u L( t=,x$8L&ch8% =42lC!XM#XtZ8b$Hp-Z $5$%s iLl%\8"tk\\#Id 0)!7 (M[lptH8&%|0"|D$L.`P  ,h1#"0 $*$T7 nE,TO1[͘Hlp x p5h  x0  88 bx( ~H4 x(x04FDM!`X)\hi)r$D:N@%qp |1|6H\T[, H$tdC!P h|]%Hitv0|"ڔDVx5(@)<$0%%d60\ec%s ( E`.87xK#yHWiu\q D%G8(^tHÔ(<|( \0q@H40"1T/0ސ6 J „V8cn8 *8P#$ r6$6$g $r4 @"P5FERt Y-f8 fe|#6lq4t 0v, 6d t8 ''l4 \FP@W(Ts,u~0`6xb0ĸ%[TP `p ,{Lˈ7hM@*r5yL>1%4I8Z d4a Xh <v',X;@P p* (4+0ll P i@$ >#|I#{S$d08v 4&0t) '=8T \ x Xtd,'%7#GPO D^ xf5s% $  41'1##Hd L8T-PH) (0'M|7 D@@d_1oe6LXP'>|0HC@D&NXPm1pP  '8 5D$@ 4Jp|Y"Pa Jn18\ p8%`D0`l(4\ < KpL*Jt2);"XGlV0`(dp(q"H@p[,D0$8@ 0L6\  p&3X#1 t3 T8D^lR%P^6hk)4|d$  `p<08%h&`$, $t D8"~L$0@1i(RDc1l'\TDw0P0<  x0850d~t ' , *hDtX(eH)1 ,$6 $K0S$g%it(P4=h8h1lp'a0#L1!@ 16HX %h$.$\C"7(0T-^ctu(`HǨ15$Gh2!L|L  #?, !H ?) x3B)H|0QXh]!t1\6 ` x`6l< # #(T0 !$:l#7A)K)"0Y(`^w<k`P'B\̨X X|), #P(#( y,+   J(#pK0V(HXfx0 8| 8L'8<Ǭ ( x 0!<,H4DSQ`\Hj~ tŒ6I•",Ÿ8¯ (¸)0 +=)p8 N ')Hx7I,B}P %h|Z dh%w0Ì0$ßbé ò Wü5X'J1#^t`8 <4${ P-;xHްZ1j,d0wP\ătP$ďĢ%GĭX@Ļ,uX$  "@h%  DD1'%n,3" 4TD)O ]j@j 0p(88 ō6mPŗ xh@š 2|Ŭ0|Ŵ&`H Ռ$  $ 0Pb,))541p,B&O@^0ޔ lNP|ƈz|Hƛ#0Ƥ DƱ(,ƺјHL)q8$d0s,0"&Q|d/lx9 jPM%`^Ljk(|($njǘ_Xǣ$Ǵ" ('|Hd$$t8<%g $.L%0#$6P<AoM& T^ ( j(w6DȂ lȏȘ00ȣj8TȺ  \5(%a0X T ~|'-8hD6P_ XtɁZɏLɟ(0ɶ1  @@o$)ـ$DX@%&X\5[B,0O6Ȁ]6>XiPʆ |4ʑ6Dʚ=T@ʫ h<ʱ0\(rdK@1(0x'd0$%6,088@ GS \dDl1t <<ˇl˓,t˩˸[Tl ,$$,!<(s 1('#N|>0Mbr"\~ԐD̋8 ̕0T̝]`̧^x̶zx td%l|@#d< Ԥp |`878C%(Sp^(o$7{xX͇&'͝"O4ͬ&24|͸X(J11k(Lp|t 5X1ARLZ( h@`x4΂ \Ύ `Σθ4  m  4 4'ڜd zT4' ^ld> \tJ6?\Q(l1tw,Ϗ)Pϥ ϳ0d }Tx ,(^1oL@p@<#d$6$<?0\K-T =4a/m0}6LPЇ (PЍ Л У8 дX%!R(0p1(l<l$ `9(GP'xdY\f 4w0~8lяN@џlѩDѰ(&P#!xh0 < 1($Ll0( >1 L0] f9$8҈.Xҕ$dx0Ҥҿ1h4dx@ $8 $5(4?&Gh,Q0[0PfttuDӅ<ӗ<dө |ӴӺ$D "ph-`p0-67((>%LN6|W&ɀblTq|(8Ԉ  ԓ3@ԣ `ԯ(׌XP)d8$| sd1'&8`7@J%YX%8p(g V y 8Մ.`Ց0՚0|մhջtHx&xpx4 ) %L%0ݘ-0<81Ghe,4pSz&PևSH֑0d$֘1 (ֱØH*?H([8#@l6,  ($, 4<xH0<WtTe'q1\~T׈0XחxTמ$Lת$Tp׶0D0  h @d8 $l xD%*06%X@ALj S>T@a#dk uz1m(؈ ]ؘ ا=ذ! ؽ0 lPq  D  `al4)P)x ; vtxK1 XXf.t6Hف@ @ُ+40ٝ0`٤#%0ٱ%wX0X)!  X) .x7#hh?#n H]ph"@TpHx6}4Lڍ0ڙ0ް$ڥ ڴ#T8 @0ڀ Y XӘ4*"LX` lu u6 |~D0ۅcې5۞5۪e8xۺ0 #1#6P < x$׼l'$5D(D6O)`c p6x#T܅ܒ#&Pܙidܨܱ0 Op&|6)'k`0C(,<Լ`K Z@X'Rx4a0tr6{CXPݐ3ݠ'(Hݯ%ݽ  4l% 6L%( 3$\ >lP dX0h6?`0qLHz$dށދ %ޛ<ޱ8޺&^X1o1 l8`1p4! < #(/6i<6\=G4F1TU0`&n y}4߆#ݤXߒCߛ߬%z|x߳8$t00(, 4lT!46?(=@X|Nxp P}08*Jh& 81lt'],6ϔP6iPa 0d( 'L850?nQ}Xe1u?PX&qT1 0#bD v8 ,H  9%@H)dU$Il(` #@n0~8D8%\$M[)װ@D<4D0=hpEv T `8u0,L~4d 0\0Ly0  uP,l-6496@D DXQ b&s&\([ p  TD06F " l9 #x`|1$I<4 6)6$4D((L%blt88}0H'd `1`8(E,*7,$yl$]\p1@%(=,D`DR1&T[&k(L z)hL&$,11p Z48 v@,TaH&x,&?%G0R$8Xhb8lz68>DXFt8 0\)Tl~$$3 pCU&4xf-Ry'' 0!ld0݄-Mh#0M@0%I-[|<&T,.)9&\`IP(RфXg$lt"Lx0  l`0 X)H dl 1>L'&458>K rdV c1$l ːtv0tb|\)l708*+GD/':,;(0E8,L<DYi (wH@`0 X&`8tX0D' 88 D |%6/$@1PI88R o`fdr y`~8 bD&$VD0(t w %p6b   # \ ,5$E$btR8D`Hp'5$(1 l0 |d D\<%81"  h#ۄ)(=Q0L<f7u%}`8(h`5p%a*Jh06e41L4 @s(%w<6 *PD @L wH\0dHp'Et{%H($Ψ<8c,3Dȴ8 2ld0D$"3 tJ|h+ p<5kxF7P D]l!6|`| %r8nd8H $@t%"t#(`)yD)H|2q <xR[bƄj XuK,_L"tHx)@t1HtP T0ހ6f1a#P)X 8'`Q8\V,m|" װ'=`'% @' \Ԩ X$ xX1(ڄ$?, I GY1p, y'0p 0 Lh0$1&8 1i(;T %X$1 Z\@(DJ&]0j z6@% ,$(,$VlڬQ0(&a \0,*X,'),8 #DT!"8($@ 5 HdL0Z Hli:t}$U, H\dh(Y4\#\6b "P< Zp4٬0 4d3 @0G$0$W"ll\z%!c  D@8` jI\6L V\<4 & `-o :DF*>HP$bT}#&4&p"d\1"R01$4d/H@0 tX00H& d? JPY(bxlp?x&$hTl zhH \"H'Tx$( ;p,%DX; I Ulp&u~\)h00 s'h4X 0 %W$<#Hl6E$&87DGrxR `axlzl6h P | # ){ f*0ݴ)`,@ W 46((0@2)z<'Q`PE$XTDXi b8z)#`18^48L7!Dlul " T0 /ǘ=HOLd1-k#hx~%0|)1DL L$  \0! P2%4<@qHNY$H<b6mTl5,~` b41L$gl,$`] 70t4 T08t4#@"E $ 6 P,$8\C&LR$P @Zt4hTlt >$ 1|@} X86D-d, r@)$= X@(`$H'¨p7lh|LQxZ'0k|~$$0:X)$58X*Ih h$ \x$;2<hF Z!T`8i``v ,p j t"Th6`0@,8< RP1 *43 ,:'y\CNt4Z)t`g t8s04xP 8`hpR(}0lf,(*#|2v @h P1m(`0hj<|*H@U 0d(t-40!8l_((6b. @(((4|JhS d n8, 8&$0xh ׸@8\@1<$ 8V($&87'l@B(ÈtL1S P(D_ t\8k)ޤlyP0 0&`#pX-P(Xxݤ 5t H(6f5(p=-OOahZ0]d%4vDd l%HX AlX8H<'4 5,@&[ #@0QZ` |o+\|50+P1|)@ *X0$0 H 0 r# -1<0O(YX,hAX| np8 @"d('p`h 0(!01DA&M\#<f5Xt41% 8l% X#| XH$(4 x p  !z@ 21i ;t K  U T p$RD p <T 'PX yLD &1L h E %ר % "l #1  55߈ E, M @ Y14 d v8 7 P ((  Vl X4 0 *? %Vx )Ә< $;( 0 30T A d O X| [ $ d&d   1j( +d, 6fD uX 0D # "G,D =\4 tH H,    " 4X 7B D T  p  y,( 4 p )> %L4 $P y,T l *% :  F<T NH@ e"@ r. ,  XT q 1 D4 + 0( 5 $Cl( !ɬ( #,"4|  6 `8I8THc uDq)$~0T\<05 o054"d*<|4tFD nP%L8;.px=',E1 <PZ4_ grnx#00040l#jt0HP'h($d480 &4 ?|d!%$/7h9"t?e<<P%X6Xg)u0D(^,H0d 0H ؤPtx6|0< x()L&l$d5%-L9G PT)/<a6l it 400$ dXZ )"8h6ged|6h 64)r&t'# 3PD Q( (h| h-  8~ 8Ő8$hP1p$X -  T -"8 <1  E  Ni Yx gtP p t z l ( d$t 0  #@ t h 6! !0!(!# >4$!4) <!B6p!X  $!gT!}x@! x(!0! $!&nt!) !8!e!:!"0"(DX"A"1!Q|"<נ`"Gt"S|"_8"tt"6f"")L"'|"d"ۤ" _"o`"4#;p#% CTP#2>\#>&L#N" #RRH#b8<#i_8#u1##$Hh#)&(L#Ȑ4##G<# %$#w($1,$$$$Sx$,#l$:-R$L0p($h~$sD$y&b8$0ެ$0|$D$ wPh$ $$f4$$%?d%0%8%&<$%5tD%@ ɜ%J" %[ y\%j%t%'"$%!ȔX%T%(P`%%I% 8<%,%%0&&H& &/&@"&M<|&c"H&j&W&|`H&Ѱ&  &8&''\&*S &10X& &0t' |'E\''1'1%h'Al'P 7'[ `'m0'z W8'0' `'!E'`D'8'5'ʌd'(70(Yd( "T<(5d(E;,(N){([8(t0( D(0t((h(d( H(6\(U()(8) l,) 40)H)21 L)BDP)Q|)d6@)l )#|d) )-)))^h) )`) @)|)Dp*h*6 *Ul*/ *Ent@*PN*f0*s0$*#!p*$*z,0*X*'X$8*1L*"*)0* up+5+1*D+"$DDl+01$+91+Fl +Sm+_+`d+m'X\8+|H+ <+*'+*<+)x8+%l<+#x+#z+ 6+6d,,t,# Mx(,+4,4(,<,FF,S ,j6,t0,0P,,h, |, !,,8,( ,l, ) -1jh--(zT-/4P-A-XT-c,p<-o-| <0-@--0Ĵ-q-'0|-&-(. ..d.+(L.494|.C.O%L.d%\.n x..8X.8.'P.$6x.([P$.)=<.p$.1`.$/H/ 8|/'0/,0\/< ;\/D/Q)VDL/d(H/l$pt/y 4/t/)sl4/%e<//;P/64/)-/#< / 5X/*P0 0X0v0,0$ h0/ Q05)H 0> (@0IIx|0Ql0c0x0s +0 0Z0 (0\0%D0 34000x 00Ġ00<1 41 /<1%l4101CT\1X1e81yg4l1 d1Z1ބ1( d1m1ix1$10`2 $DD2#T,2*!t24#OH2Fl(2S02b02l2y402l2|2 D2 ],P22Ȭ2԰2 p3)p303(\ 3<03D)I4`3W 3cL$3m 3z3,43Kp3'e(033#31!3083A360X@>>1p>& $>:)L>I6Ȉ>V `>b$>rgD>&L>6 >6p>&^<>#xl>>܈T>d>`l? T?8P?'?2(?@8?Iͼ?U ?c?om0?x6DŽ? |,(?Y H??X(@?1n?'I ?8?8H?|(@>@1nl@)$@&$U\@3q@<1n@Ep@V  @`d@v@@-WV@@ h@5x@ `@)@n@1)@#Gt@ DA%pA <A xA;AFA]Aot`A} i$A1(HAft<AhA j@A)A(H,A-NjA#p4B BpB+<B7jBB6DBL*YBS8B_6HXBg+By 8BBXpB!dHB %XB7PB8lBB$B8C`CC!1x8C1$ ,C?CK(d(C_(Cp8CCpC CBC1C6̀CC) DC%sC(PC8DpD$lD"6(D,8 D9xDM|,DZ5XDl`D-eX DDDD&~,D&I DfD ATD1%D)(EDE"PE7e|8EE/E\ Y$Eg&bEvh4E"\EEXExE XEEE9 DE E1\F1F% wDF4 &4FG a8F^1)Fi'pFs$<F$&\F 4hFdPF4F\F1jF%F\G`G ,G$ "@G2 +G7#$0GF9 HGQ-d8 GayHGn!Gy XG)HhG)GӼXG|GTG @|G HHG&G|H%H$4H90HL XHUu4Hh[,H{%`HH!(HlH0HdH $H&HH6XTI IL\I%1I/#HI61!I? ADIJ@PIU1-I_,IpX@I|0dI (ILI($I$I ;4I%I&I 'IlI)0I&|J$$J$UTJ"J+ /4J;LJKXJQ `4JbJn!@xJ J J (J!J6[HJjJ\,JPJ6hK h$K.|K" @H|K-)b@K>\xKI6f KW0|Kg KzӤKpXK L8K%$KtKDK(K*@HK5PLL, L b(L(1L0(XL9LF(LO#TL]E8LgLu1#(L~L8LL#u4L mDL LVLhM %dM t0 M0M' '<DM3IM>(,MGLMM xMV0MftMxM8 M٠0MRxMd,M (M+M-M yM&)dMl$Nx4NyN,"tN40xN@ XNO N[ 0NmTN @NN<N(NNP|N#mPN(NxtO$O%,O9 LO. pO<6BpOBŸOWD Ob`HOp)$O|8|OԤOXOdO`(xOh,O%POz\O`|PPPstP$58P/TP?TdPP|PV0]P]$PdFDPk0d(P$JHdP$ @PP\PP,PP0PQ0Q \DQ, t Q9QHHQTdQ[ ռQmXQu1Q XQ 9hQQ# Q QQ)QlQdRR |R,6lR7*HR@`pRO)0pR_&dXRoR*JpR(ʼLR WR(0<R <R+R " R&S$lS $TSS"S2ut S@$LSMS`"7X`So HSw%S, S ^LS'PS u|,S8 S~<S6bS!S~S5(S1'0TPT4,T1lT%0pT.\XT>1@TO'gT\%X<To 0T Q TlT'$TZ T*T6ET8TT&KD$U 1<Up4U )<U&%ahU8UG$~UX X0Uf) pUw0xU&UU pU 4U&0UXtU'oU#tU0hUj`U+4V DV&RXV3VF(XVY $Vy m4V*.V(V6VhV%tV z HVTWPTWmW. _lW;1!WB `WS<`Wc ,Wn0@ W~'lpW NDTWW'<WtWrTW\W <W v 4X6X QXdX28XBXN,X]lPXn0X{( (X8 XHX pX;08X1X'YhX#UX!tXxY a`YDY+ r,Y<XYQ CYVh|Yk#Yt8YY)rp<YDxY Y ˬYXY Y$YYZ,TZ!' pZ.(4dZ<$r`HZI$$@ZZ-TBZmZ|l<Z pZ#HZ<Zv,Z G(\Z(`Z">\xZ!aHZ[P([$@[0[: J[E ;88[['DL[e%$([w d[0`[$5t[#$[@[,v[1L$[ d/[8H[)[x\T\&x\!8\6'\D\Rx8\j~h\x6Lj\"|x\ O8\1-\4\)0\' \#4 \\6]0]3$]"]- ]:(8]C4d]S x]bt]yt8`] ֨0]DT]%(]tP]Šd],]9 P]# ^6^ L^ 4^)-X^<8^D#<^Pc^] 4L^n#$^y#X^h^ l^D^ \^)K8l^9 T^&a^ ^6X^ @^^L^#X_t_%<_)%_@0_Mod__1o_e1'_pm_d_[ _T _00_0_$_$_B`_(QHD_&zt0` %9`^$`5`@(``Xi`gd`r'^ P`}0` R $` ` T`BT`0`(?`0X` `&T$a a&a$$lxa/ aC. aP6a]%Pat"O<taua |a8aO@aa(ۨaݸ a axa!4b "\b%txb? DbMbc0(birbs b0h b(b&Ќb&xb8@bb( b)8bXHc5,c1c&@`8c5+cV4c`(,cj)ބ cxc$c¸c FpcU(Pc)(Tc cOc)|c1 d &$dRd&*(d78dCdO K0dYdb}<dn#d}0d_hdzp|d"(LdLd<dVpd*Hd0dtee le%`\e:"Xe@a84eU'4ef Leu6,e|)x$e /P|e1$eeLe ye)hfeXf(8f!pf-g\,f>6fL'@|fX)gXfmxf' HDff&`f&(dfxhf8%8fDg$gdg&l|g5{<gI $gU%\gg :@gv0g-c g͠g Pgp0g ;pg]gKPHg Dg+g|h$dh,h*Th@8hR Lh`8hw%h$#hUlh68h Th6ph$h'dh^hCDhiPii)8!`i91l4i@&DiPiZpie0iu8ii(i9ii(hi"<iר0i`,i!di xj&ެHj-8\j<6ljB-)(jK7jVjfT`jw'j!Xjx|jjjXj jelj8k kXk-0Pk8 TkA \kVpkgtkx8k k1Lk1 kk$kkR`kƐDktl %l%pHl 6,l0)G \l?& l\6$lh)\lztllB$l 6lxll#&d$l $lPm"$m m9Xm3*,mJ8mV :ma .4mp*hm~$m"m\mfpm "<m)Hm%km gm u`4m "<n\nn$Xn!8n+ @n=n\$Tnj9 pns n| 4Xn$V$n5n9 \n@4nhndn^8n%0,oho0|o%'Lo8$oB8loW\Lo]poiouTo"$oo $o $hTo"t o$&0,oo!p o5o wp u0p'b@p"1Lp40pB0PpK\<p`K\pj0pt9 `p{p0Tp8p*pH4p0p "p8qq)(@q"Lq0) $q<$,\qJ<q\ !44qh .Dxqyz\\q&Aq!Ilq0\q5|q'p ,qLq\q4DqȬxr `r|rMPr(dr:rDrO-b xr_`rrהr xDDr0r'rOr 8r6Drr%J4r + rPr0s#s$"y$ls9 oXpsN;xsU%Lsk,syPps <0sLss%O<s\s0<sststt't $t0(t1)J t=|tQtc,`t~Lt.t6tt5t) t&@t$&t* 4t%\@u_8uu$0<u,͠u=8uF8uV8uo&uz,w4u @uhxu(Pu Du8ut8u'|u5u08uv3pv tv. <@vD&`vQ"0 v_8 vk(pvt'g,8v$D,v8v)y\Dv"v5Hv)sDv$Lv#v!Pv0vw)w$B(Dw 6,0w00w<'eXwH*>@wQ-Xdw]1#<wn8w{=w$w$gPtwPHw 4Lw pw$eLwx t<x 'x x%W`|x& Xx<6i@xJ1l xQȐPxn)q x0x)@x$pDx!1dx5xx ^`lx'Kx6x xxy<yPy&my((\ y0$_Ly>1yI )(yW)\yh%yu"yy %`y%ttyCy%7yϐy&0y!tz N<z@z#6z0*S z6#wzA |zO(z\1zldzxzd0z OHz0z rz']\z zdz7Pzd,{ {1*h {8 S`{?8{S{lJL{u$bl{X4X{ `{8{({&${T{ DP|X| ] L|& |4$D|=1|KCd|a|l|!Hh| E| j|! P||)\T|gt|0t}}*;h}#o}-*U}2$}?0d}K!Ld}XYh0}e&`\}t }}H0}\}6,} }0}d}60}6F}0}X4}~8~8H~ ~- |,4~<'l~H #8~U~d~tq0~ެL~ x~Ә<~ 5H~,~1kX(~~ L8%x%8H3 FA @4I*<PY8 m+|Pl\,|Dp!@@6<90@ D8!Q0t XCXS'(L^ 8o||`,[<0P&4T,h &AD o"1t*-V=p[&|q"d m11(\$$VL<5pH@$ #-c 0$xF |VTadryL$,4%0pD5, i0D,P sH 4`-(Hd9(PElS'W0^fjz"*Xct|t˜h *1L% Y,"  6E$/2%d; pG tTh`Lo;h| F@!pt!5%,(^6 % 6d5.D84W {\0s~2P$*&\Դp6E$0X=8X }d%),:TED,T) `,`p(P!L"8X< f6D -&h&HH< p80&3p(@+xN5@b1'Xh'gd8u X #G\0fHH$ d&T& 8W|4pP()C58GmP L]ql8$y X H]1$)"6@ܘg&,, x+,5 P\=J!V1Te%Ht$ |\J(cP0 $H`8xBhh '~H$'r0,7d9 -GpV.Pc0 s!PD' $p$  Dp &P$0 m 6b8  1tL$`zt -@8DC)@<_vmp K| 1.D<pܬX)*t&I06[L#p"X# H/ 6XI(<[0ll hue@06Ø%*MX |x (G`%P$ME`t405 PB1 H0Of u  WT#L#00„@Lh/$/<@ +N,Yd6`k6iDr rd{ I<0'0L  \0x  tP%P(3\,<1qPDWpHV.,`_)dq %!x0N<D19 d8DNtP 0-J1QxC0 Q18^1 k"<d|"l ^h8P%0X&%Xx@&0/o|pCS (`Tp bzd`%(\8,X .| OpL ` T xX(0:TE9xS w(<k <Xze8<<D<)u1 00 1 "! | $)#< 6À0l|<+ 9 ڈD( S#qb&H0m$ Dv'1,PH6E((,`H$|%i "D 3|l t%hP,03)e <]I] xXk8|`, # $0(6E,"' D'@#\0# 0X$'v8rBqdK&](q$h0)\l`$Q +0xK 6ʜp0P "H(0$4>`N)<i)z$$$2 8"B#(50`1nɜh| ;-0<$?{M1l(] XhhUPpt|$8yP l@HD1p #]t "(T-d 68 !X K&H]<hT{1#@X Hh1ix),#|t6p6H| &10` $X.0dG ,Y% cxLo9 hyL4 yD1& r'dl81j|( @%dTʨh%Ԝ 820\Byde1 q0~$G@(|00,8P,D(8&185  D&\6!@HW<i64r =d8T\8 (PD ,D58Ґ@ h1k#h(XP;0(X,`'xrz}1TD%bR%! & 1  05 LH@3? "hLGPH8Z1%t`&z h&\ (<lT*-$kT' T0 8@, 4T@&$K$CW#l(e`o0ބyb%#e.Lx'xD1 ']0h&8d,4l8#kB9 lQ3\t] R @g)P(t1wi00ed1k)x8. (٘D([404xIPT0 !6$*: C)JpP0]N<s pt0%- (Ҙ||p&,%XPP,P$0 &B(8P \6E0h֨@u (=h8Xgd%8,u|$:D %x,0 ?$H,<K&D\Lo 45(( HX06@(|01)@)r`% t8 %X0Dw`O1mV)L`1i%$ s<%$8 Dt$ rt,L"6f0& GT:8I $44Z d4k'5x d ,&($ptj 64(61t7l( xApx)DL;6f@KP4c rDt(~(4x Xl lxPT9 (\0\X 9l8&X0(L@'/T#`0\#4j6ty oHa6d3H0p dL^hIh6E4)8l$8L@%dNa'Ghj&U,}  Mx|[@h1l(E%$Hl5#\F 4T5|]*JpcDu-X ސ6[X` r8 4 x( H&Y@|.8,5#P?L1Z(X8e8 pn uxTt4 <(`1D)٤6$#'lGcU0^0cDq*Y{,ć\0Ĕ$LĦ# ĸ@!_}PL &mt<$!x02%;8xF6D$L$bTwxŅ3ŔtŢ Ų(]<0H4D&}, <,X%$8)5*G < Y%gpz|tƃ8ƐHƜ1"ƢhƮ8 `Ƹ |pVPp7,"<ּK`%^ pgs0\ǃr,Ǚ'\ǫ\ǽP `41 P T$ ,8D 00H;HM( Tf6m'x&Ȋ$Ȕȥ0Pȳ1kȾ T{<<$tx6\ <t {0,7G{`\p! TɈ" Hɗ -<ɧcHɲ)\ɽ(t(@1*tt8 Č.>((dK@Q8 ]Jj z6ʆ%ʔ)ʣ% XʵjTHd<$ \\#  $ '(&$<96bB,`Hj [|r-˄˕L˟ `˯8<˷6nj1|1#8(DL1$ؼ1`3 HA 8L1\Vcr<z X̆$$̙ ̢$̴ `̾#80l nH  H հp\$8/h: LB !4T`#m!p$z ͎0@ͦ<ͳ 4\&^ g@ ", ,l((0-7 n L&Yb''0{!#Ό<Οkά0X ζ0L0`gl@ c&}<28x0-ߜ\9 GU1^k|iS(t6<%(@ϊѰ`ϖϨcϷ(`<#x$T#H u zL`$'`25C1pKY0tl0Ā{=lЍiН)$XЩв (T/ 75ּ1'$L4D# $+. ,LA,LK*@@tT6_Ln$x$ ,ш{ѕ npѩ (ѷ$S( 6 lx\ 3<@8$U@'$EL4 G,|T%$\$pho~ҋZҙ&D\Ҥ#ү¼ҹ6ly#hT -JXx|To"^,<; yHP ƜlY]l6<x dPӂ1!Ӊ$ӕXӥmT\Ӯ0ӹ ),8X1lH(&\"0 (>TUݸa @n1!8x%Cԃ1ԍ6,ԘslԯԵ,X$!ATd4H'` nxd4'R> 8\L+wVa<k1u0LՄ8ՑX՚ Dhէ0կ"dվ $p 1t {8 & 8p(2pd;WdJ!4S1`7r )$4zmllֆ0H֗$֥6Pֽ֮Hrx Z|XX'?(Owlat6\~z׌#8ט0 ש |׹*C 8X$H w%4l T+9$&p0H&?tV#XHak*ADt1j},؈0أ0ض \l,,1L % 1(0H1-@E0lT8 d]6D@d4r'~1ّfT٥tٵl5)X"!P1n) ,900$D ,R3 pf"tm6bwfڊ$\ږ'Qڠgdڽ6c#b$0TD0 d0x$2 h>hX fi 7Tv*=ۆۖlۤ \Pۭ(h*JL)e D`% &$<5PHV^ 80m&P\y%p ܈ m$ܗ%Pܡ&dX,ܯDܹ|B6f8[(Nl00ޤ',0)H>6iLHˌ\\i  {`h݈D ݞhݧ1ݯ&ȸݺs   8 x8+04 6 @ _X0h? xH8HVɤd$do\އm@ޔޠ#T ޭ 4(޸ 9 '$ \)l | wd<4@1M8V `6ho yH߄0Hߎ%0ߙ`0ߪ߳1#|߼1#)0)0#\ hx׼%U4:8DO<Z6mXgqd pv@PV 0@-(u (&,X| d  |\08 h' n01 bh0?#(`Kl`,_ v,$l6hw4#L P0 $( L(0%x@!HX %!8.61`\[)h|n"16N,10`6|8\ (, <5" xd,(AO^g o d8 (%p7@,0l ,l%G`(Dll+'5)PDSWD|a8 j6s(Xp4([t$P~dt)<&1X51( (46dl' 3TC1p8Q"HX-Tj <($uD88!$hPl8pd GX %x80#0(:0@E hV04b6rĀ0iH9 "@1ID0$X)4 ]H %`0>I(U1 l$`$o%8v$} #0 t!( 7L<% %L6ǔ|8m-8Ā`MpLV˴Xb0o%(|{ y0$%j8 9\#\D0 \<$8(`."l9Kt_"txT &/  $ltY\t ET1) bp4# Sl5J|DZ0hl z200UH%8k|1$'4T6`r8,H48&(81A1I1Q ~ta&n1$w'yl%G(( !c0F1@454mL!1*'4<F3LV'^ |k v8H,H| "<0x| <@+3\4,1o'H4@p Z$$ebr)H0x ,%h0&n$  8 L%Y/ PdI#`$X 9pd'pD0z >XPqH<0l@x)|0`GX x@0((8l5!@N#\7 eMt'n`4| 8<$a,1$$%pxdL86@T%<@$>11H p- }x=$ی<H#~xQ#t\<_ Qv5( X;6xP&{P n8x%4x7&* "-X|1(8TB1-QZ8Xa0$r6E8z18 x80060P 4'tL0`p+ z\:%zD8I#hU0Te+HDnhdx ư Q P\%PHH0h$\H%(7!#|* *`<րO)T<` l@q$a6P 10%w|$b #ft8"@z<8 h$6p" ,.!9*P<SH_(l&s8Xv,5׈&3  $$L6Ð MP($a0 &B|.P:2\I4W(gz1'(<-l|6d ph0H 0}#h (#p 8t 8tAH(B'(&d#xl! hd,(870G1j@(\f!$u iH~ H#!Lb@k|6!(= Ԥ&89"lHH~b li)d|ds%nz17 .@&`xW`|n-Tp` D(lX &P,:">I1U[(c4Hj1t0Ü\!&H!@P0x#/Tx $  j0)82d;6ElS9 `g#pn$Dy0P0t hx0 X$;,!h"L hpp5X( U0 <8 E%9lU$ _ krHv1~'G x$pX6e0 9l ØPJ<|zp"X  GX'L|x%$`7 XDF6T9a6(q p`$(L8"%z% 5H 1" f,4 0@O|CdD/ DB8P1d8hn6m`(TPHt%:&*9 <D)0' eP% NX4 E%Q'tP\Z$7x(e s |`J40(1)xl< 40Ȍ(53( HAxKxTD]8tf|6H\ "*L'n,0|.6`2\,\ 6<%Z H" , }@;1nD(K WZ0c&2hs%"PH0xD1 `/h ^$D'd!,)ht80 >hTx`0q, }$Up,#