ELFa( 4/K4 (   """CCD(D(D/KDkDk / /;0&00Qd;0 2 @00Q8$/ // @ P`D  B00 R թР -L* Dk$rDkmain() returnedr   ),@@(TQ 0/vk4r - L 0 $ 0 $ -0L  T  T p-H$,$HP0`L@ 0p -0L(  -0L( _ "- L0 -4L\ ,00,0 200b104 0 ,00 200b10> p-0LSP P ,  4 ` ,  0P,00,0pp 0 $Pp@0D PT0T0S , , -0P@Lp8`  R   0@ 0 d -0P@Lp8`  R   0 @ 0 d -L_Œ @x`0 P  'H0!@ 0',0 0` 0 0' M-LM0'XX @X0 , %X 0  ( "('$' ,  pPP( 0"(X )%( 0 0 , 0'(h@(K 0-_02@P L0@ 0'0@-0@  0S  4000$ 4 @4@ -4L0S @440S - L0 -LM40S  3 lH0 ,P K 0 Kh?? p-LM@`P3PUOx3e H0 P00 h0 \8y3 @r89n3  : he?? @?,?? Q-L@W0 R@?L? p-0L @P ,00,0 R 0$ 0 00  0 pX,0`0,0 R 0$ 0 00  0 phqo -PL=4p`V$ 4! ,0 J0 ,0 000,  ,  0hlP)@0D PT,0 0,0}@L@d?l?x??? 0-L@P,!@ET ` E0qo -4LSPp `00  08#8<8#8000 08#8@08#803 08#8 08#80  0  J?4S0=0ShMK,4S 08#8 00L$H@0@@000 m31C0 1-L?rcWP`S wV @ 0DPT0`T0d  D0PT0C4Q -LàL0L0Ϡ@blpP30 0S PVd;0P0,0 00P 03Q - @p`R0 0L PP 00 0 0008#808#80\4SX 03g4   -L@pX00S20W6 = 00`- 00P00Zpd3 00X3  #0W  -0pS0L00@`% 000PU00S`U \    8U $Cr? @?? -8@QL0z2>0 p-8P@L@`4 00 00S > S 0 p R  B  h 000 PXp 0 00 ?L?? 0-L@LPl 0( 0( 0h' p-L@`R PUP00SxXP ?lp  000PS p 0U 0 0 0P 0UPp@p -0LSP 0S" 00 @ = p`Z8:Xo`Z6 @ 3S `V a0@ V0TTPPQ @Om@ 800000@TP3038P060 0 308#83 R 00  r @00/h$C p-L@m P`dU  000PY YR`pp 0-LP@P 0@dH@ @0cP' 0H@ 0V 0' -LM0` Pp @20S3  09P.0  0*0,0K0,0 Kh r KhSf0S a08#808#80KhP R 0P00 0S  0P3g4 $Kh, -0`10#LP8p @P@ 00 0000  0 0, |0| 004 P`0  @=0@  00  8  |? -L M0PSp 0S` K@K APS 03K 3[8#808#83K0` P`h3[8#808#83K 3[8#8<8#83K0@0 4 @K?0Kx0  PXgL0@ P0 0 0   $o Cd= p-L@P%04`!Ka@sp -2L M PRl2   ``0KST2`0 0 S<2004 plPRd0S| 3>1 :`@ 000S3033 T] 3dp0p|14 NP=303@To3 `3`V㏏H0"S3R1  K0 ,pK ?3 00,0K,0K3 f @4  0+@K*K( v>#t003 P3,00,0P4Wk CL  $CrX Я -L M`@^   P00 K,0 $` 00@C?qo p-0QLM@`  `uxR P 0P ,Vx p-0QLM@`  `#uxR P P0\Vx p-0QLM@`  `txR P P0XVx p-0QLM@`  `txR P 0P (Vx0@- @@  P @   0 0< 4("4!̃,<,$,W0U VT0-  00  00 0 <4("4!  < $ W0U VT0@- @@P  N      0 00@ 0 0 0< 4("4!̃,<,$,W0U VT0A-P0p K Q,@ 0@0ll 0$ (, <4!4"<0cT$0 0!$` 0@0ll 0$ (<0cT$0 0 0 $@ 10ll 0$ (, <4!4"(00c0c$010ll $0 ( p- L0@P0  00!010!,0?@0p?<0,0 A00 P!0p20A 0?A0S 0' 0! <4("4! < $ +0) *(@! 0 T!0#40 TW(K0!0R0>0U;0U8! P 0 0S0S00@ P"0!B20T1 0U>0G0D!010?0p?<0!0 400000p00Ġ0U0V0, 0TW0020!0100?<0!0 000Sf0Ib0 ! (0 ! t= - L0p @05 $P i 0$ , P0 * 0, 0 (0 $ @ 00 10P@ T`$00  0(0 00 $0` 00c0 " $;#;c 0 $ @ 0(? -LM`0 R @p  t1 0 ! 0W0U V T0PS   0 (0 0 0^W0UT0UQ< 0RP \ S 0S]0A@0!0?30P0200 >0!0?<0040!000P000L! 0 T!0#4 0T!0 T 0|P 0S  P 0H 0 (00h  zd?L?=??? -P0 RLpẀ` @H 0S0800 0300#0! < $ +0) *(0! 0 T@00 @@ ""  0! <4("4! 0 000 # 0S/000 0300P 0! <4("4! < $ +0) *(0! 0 T0800 S0 0 00 0 s 0 0! 0W 0U V T0 000 # 0!000S0 x? 0-0@L $0P0 Td0 T0 p-L@P40B $C $`P U p0R $0N $ PR R @R v ptq 0N TpDe  00N Tp꠆X?7芁 0p llp0@P0 ,< $4.4,$  0   :4PP  K PB?P0`  0 PP! `:PP 1, : !0` , t==l???? -04p@0aA@L000 P0U S` 480@P81080!081Q0C1 -LMP@ 6pP`' @0 0  B0 P` (0K0 0 *,P 1פ`$K0 0 ( 04P 0 P 1 81 0 -LM1! 0SP@# *AT R0001 0  ƤpP 0  a .0 < 4("4!, ! 0A \!0  ! 1/< 4A!4",/0!1 0 101@! 0!080|00 1 !?\=,C -0Lp`Q@4P @T  4 8 1 40! T 1@01P R 0S 000Q0  PU@0i? -p4`0ALT㼠P 1@ R  P 0G < P ; @@0<80P P8 T) 㲣  0Q0 0a??? -LM0 @p`10! P0UQ@,PP G/c$ 0 (? -L M` 㛣P  㕣P NP0  PFP@ 0  00s0 00  0 P@ T0@ # , 0 , 0 0`  40 0P 2  4,3Cp p0 0$ 0"0 0 0! U0V0WT0<80 (44 <0 (  4Z [XY00@! 0?<=0>00 <4("4!  (  4B C@A00! 0GDE0F00 <4("4!   ( 4HJ KI00 <4("4!  (  4R SPQ00! 0ge0f0d0000 < 4("4!̃, ,,4kj_ \ ] ^ i0h0, <4("4! , < $ a bc0`4 <4("4!@0.̠.$.T  0|$0 436("$ 4$#  4  (0 080 8 38("$$# ( 4 0 04 "4 4 "438("$$# ( 4 1!0< "8 < "838("$$#  4 ( ! 10# < 4("4 ! 10...̠ 0" ! 1.< 4!4" 10...̠ 0`" ! 1/< 4!4" 10...̠ 0"< 4("4! 10 ...̠0p! 0Q1R1SP0 ]p0d0 d 0, 0 , d1y,0 S@Qp\10\!\(Koj, <48 ("44 $" < s  d(Ko_(Ko tPT@@GR J0!0 PU@@DZ(ꬰ=pCtCxC|C?p??8?? 0-PL@ $ d10d!@dA0h 0-PL`AT R000d1 0  $ 0 -LM` TA(P0T1000 hQ,0 U  0 10! p0S PU,0SpQ0,0 0 $0S (00 1S X 1SX $0,S 'Z ʊ0(@'Z@P(Z X 00 0 00< 4("4!< 0Z\S0@ 1Y>0 1Y>0 ,$!$#< \10 I LS @ < 4("4!, !10\h @ 0Z? 02|R@ 1 Y>!0@\ T0  @Dh D2@|P".$2@|!.@2|0 S0Z/C1!PZ/B1! R0001 0 嶞Pg?P1pPATP 8壞0P80 XpP0) (\ 00: 1>, \  @0  !< 4("4!,10\ " @LXP @0  !< 4("4!,10\" @L= C==? -L M4 l440%00KR,0 0 :4Q1 10pW# 0`00P0 @T ,00@,@ 0ɒ 0 `PR00SZ0S40% R4 hAT$00 0P0,  @,@ 0園 ^@PU04 l10 0P,00@,@ 0凒I40pAT$00 0P0,  @,@ 0rh4@PU04 t10 0P,00@,@ 0]0@T, (0  0(0P( 0B0 H$ $00CS00$0$00$(  R000,0  0@ bU(K004000!  Z40%e???D?p?? p-@LT`40 <0P(00(0ph7? -L(M0` $PD D0SM 0 ,X\ 0 ,Q::Q\:\ , 8 4 0 p @l3 Z0B (0P $<  Wm 4妑 i(Kb0 T0S 0CTTZ >ΟW@ 0 @@@@;od.`#43p YW  4 0 80 , , 08 10 0@ 0 $<0@  @A , , 1@c , L W5 0) !0 "$#(, <4!4",  @Lg|d Ja B0t033 W  0 $ 0\04 $<0@ R R , @10t03%5 W 0$040 ( 0  0!"4# 8<#L4TB@ 1p0, \, A , 8p 4p 0 W 4墐< e00 ,P@WF $0SS,:T 0CTj 0 T 0CT  E40S 40(0, , 1@c , d ,0 0@P; T`$00;  @_ W 0 <#0! " l$ ,01hu 1p0, \ 0!"4# 8<@Y 04 T@ 1?, \e 1=>, \Wi! 0"4#8,@  ` P> T< Z =0@P, \`,0@, *7T( 0CT  0T>04 $P5 $06 p$10!Rh 10P AT 0G?, \VRSM PH`L0 ,@, , 1 c<06W 0$04 ( jbgJl $4P V>@6T 0T05 $0<04 1p0, \5T |0T0, , !b4Q0(0U~|d R\ 0B< 4("4!̃B,<,$,O0M NL 1=, \U05 $<@)0 $P` #P 4P ܎0h 00 ..ZVd1t!l \|0`apahaXaac`0@`003Tad|@K&00  Dxxa 4a Ch6 -P0 L  80C 8(R2 d #8X$ -P0 L  80C 8(R4 h #8X$ -< <0L00\0  (@ $8;80@-8 0 0@0@0 0@0@ -L MA0P` ` ,0K "[P1RC R $K2[mCX#X`+p@  1 R0C8 p (K"[p0 R2K"[0X00@ 0   00   &0Kt t0 00@0@,[H u=@  0'$t$p$# 0-MLM@P80000& 1 R+ 1 t!0Sd1 KX!0KL1AKA AP(1K R000K003X000 K  0C,K 0AKA AP K00C S񟗼$   000000000000t'D -80(0L 0 '0 0   p-0LM @+P-` x0 00> `P0 R0C  (P01Ł 0PP8 x+r 00a=C4`#hl 0dx0S 40< `*  `0:0'8'p? p-0L P@p0`   000呚2  R` ^P00 S 0RPV@p$$r$ -1@LP H0 `p 1 R 0 0< S\  SN  SL  SPS000H1  R Ė     1 8 0 R 0 0 u0tx 0 R0 R S 0 p0 `0 P0 H0  0 0 00t$' -41` BpL R < D L T \ 0GS꼗 ,  4  0 0AMP,@ P l0l pᲀ\0 R    t -L\M4@KP S"03K/P3#K 8#c[Qr Qn 0S3Q  4"2 3K2#K 2["[`0 2[d h0  !"2 ㌂#K3K0[[3 1C 0"Pr0!2"[0<P"KKK 7 Py Ps r2 ">?DFcà.L !2c N"10,Ϡl`P!PdP0PhPc 0` P@K(K T1   D1`  T!T1QQZ@K&!05K015K P-V0[@S*T0[.S'Q0[-S$N0[S!U0[S[#!BR[ O[3 A 1C "P[05A1!1 00 `p["[2[D'T=$ $<@hQ??v'N$?? 0-LMP%l0  0;H0@@0!0@ 8H=88' -8L@@, 000 000 0-d3 LR@P H3R $<3R Q03R 20RB R3 00CR "2Rg -2Rv 0R- !0h%V0CRt 72RD >0R@2@ 0C 0h70CRI l2Ry 0R @C=@00CR0 0R( 0? R2 0h,0CR> 0R1@@00CR 0R1@@01@@0 1 01@@01@@0x1@@0H@0  3 001@@0 1 0h1@@0 0 0 #0h0@@0 D m 0 0h 0 0R x00 0 $ C$$$ ? -MLM1 0 p 000CSp(KBKII  D |0T `0S` @ T OpP@VP8K +8K '0l"0C4K02K#K t B("(04"43K@QBK0 5[90K 5K *K L @ 0 Bk$[4[Q04KD 0 D B0000 <  L @0 BG,DPt 0 P0! 0C0 0 a0 RB 3Y0 R 5[TK< 35K06KNK pPt w5[3K RD0 <0Ba#$?'Cgfff -LdM∠Kd 80!<(K1 (K>PB `@p10C0P P  Vp W@P0`(,("(8#8 (2S W@` d0008#88K@0 $K 0 0' 6S-LP` 8SB  "p 00Q8  X@#8  00Q`8X@   #8`@@D<t `X0 R0C  (9Tp<$?$ -LMt!0 0 @P  @ 4QPEuD q 0aR0 ` ( U3 0R" D ( R4 h 0X 60aP?`VP\\0 R0C6 l P0XU<'@?$ -0L R |P|`|@0 $<< p0T㖽 0Ti茽$ 0-@LP@;40 00 @0@0h?' p-0L M @RP+ 0`0 P PEUu KpUt 000\01KP01K01K0K 00P$'|? -0LHMp$Kh`KD[0 ZK PX H(@"(D0#K0K"K0 0H00< 0 04P  {' ? -LTMl p _l p@峻h?` B$Q  | B$8/0 d$?P  &XE?n*T  C>T N0CT R>Tv >TA-p, 0lX >Tc 0CT 0T  p0l0RX 4X. X0S x ɋx\ Ë. 0:0V`嬺(K=T !=Tv =T5 =TڑP 4XX l 5@ x xB$h=T` '0CT 0T㸑P0= R   宋p X ,zIP4X 0 S <R  R 0CR P= Xp0X,I t 冋p0X `,RIP l 5@? < R; X,P gjPpaX [^P Zp X X+&IPX0 \U;Q= ;Q 2 Q;  Q K0XPXPl 5 0"0p  * 0*0004K?4K X;$K NK:Q !0Q ;Q :Q :Q |:Q t:Q \:Q\ L:T D:TF <:T0:T# (:T :TݐPpfX 9T:p X 9T 0Tl 5D = S @S 9 l0%9 p!X 8 Rp 010   圊,X X0/ H9 XPX0 8R p 101zl 5 8 RB 4vt8X 0X <08 XPoX 0 Sk !`X0 x Jxp  ! HxJMPr !Ip0!  x HP xX 5 Q;|7 RᏝ@` ]P x @N`K@&@@,7@4KDK hG$K HK l x5 0x P(\6 R l 52 6 R  $l6X 0X0)   6 XPn(6M@ V   Կ6!l%0@a  20C%l 505p0 0S/ 5 p(X 㣏P4 R 㛉(5X 0X0, @5 R 45 XPX 0S >0T0 p X 0T 00bYp 0{SX |0 P\ d0 t UY t0 `:  |@h ' ht tt0 0$30 R0S   05 %<0 S  S  7S  nS  0t B02 R B000 C B0 2 R0x0 hPx00x0p0\ | fGPp0 T0 p0 X 0T 00b Sp 0d | Sd :|0B\0 pMX P p X X!FPrX ڈ(2X 0X0, @2 X@PX p0 \t \1X 0X0, 1 XPX0 p0!㧎Pp 1S 埈?X 0p 1X 0X+P!l 5$1 1 p00@ r?ii i5i i i iiii 81-71$%Ci8i|6i(iii8i i #A#Cp gfff?B# $$'pX 21p0 ! FX %U 0  e 0 Rf 0 4K04K0$K NKY| P 1Rc 0RP 0CRi PB XDfP1  8 0 R9 l1 4K04KAX0 u 2 0T X 0Y1>,0X ꏝ@ x sxP X 00"0X 0S00' XD ~!D2 RlBX0 u >s0X 02X 0000 X 00200X0 T YX +002Q' D0CQx >0QBt3Q. 0Q;(3 R}X H3  jX3 s +l3 n h3 @i `3 d XX0 L3  W 3 R 3 X:1>,01 -L R6 l I R6 l 0X @R6 l 0X 60 `@P R6 l (T0P R6 l ((0P(K$4xV -L0M`P? QC D3P 83QX Fd0CQd  80$P/ @sR8 p 0X R8 p 0X\ RL8 p 0?I2  0lP (K0SD2.`K0K2K02K(2Q: 0Q0SX2K?2K.`K02K00C SK | t  l d \    8 0!02K0"K.`K2K 10S: x10S. S08#[.`KK}H!TK0@20pPK&SW?D  K5KI0 P@T0 R08#P 0H2K.`K0"K2KC      $$'!'#(( $$ p-LM`80@GPP<<0 R0C8 p 0MHxx$ -3LM PR@v"0 0!P$ 80P4 娂 0rR8 p (0`P 0R8 p (0S (K`0\ RL8 p 0G0? SD 1 R 1R 1R 0R d0CR< 0RP P 0AS@, < 4 \   T L       D (1Q% 0Q0S? .PK2K"Kt0\ 0S40 00 000 .PK2K"KV<8# $'$ #'(( -LLME0 P5 0Rx5 RN y`P ; 1 $0 0@0@(KDp0p P <C42 D@F Q000P@ @tP  ㎝T4 RH4Q Dl0KP6[p5[p0 `P ; A1 p0 00pC bp b3 R 6[* RV  RT  RR $[Qy0H# 00. Px$3 P  5[  2 R 2 RlK =P dS zT0 0S Sk S2< @>h<@0 fPc=  )A$[P& >K &8K " *K  0  0D P 0 0@0@4x.갤[>0P 6[Tl" lK0 <0< P 8 R<00 0lK CM@ 09p GP 8 500 @0@C= G(0   K''$ $?d?@?? ?? - 3L  8sc @RR2 d 0X R4 h 2X蜢b r0R2 d X 0R0 ` ( RP4 h 42Xsc 0R" D ( R4 h @0X1 Rd &4  1 R0C4 h :XTT1 R0C2 d D1X2S090 R0C4 h 0X0 R0C4 h 0X{ R4 h 0X R4 h 0X~`$p -L$M8888H}/` `P, 8 $K4K JKpP $, 0R(K3 FK@ ᭯` 70P8$ ! 0|1( !! `  P #DD7D'p0C 0'00(7 ' <07 pp0d '006 &6pp ?$K3K@K0P#[C=C=   6Q Q) Q +>3K ,6$K P3[SP&000  0,b T& 6:@K3K 03K5 P5  [^5ࠃv5  P AM,@%5j 0Jh 0D0 0 070 0h00 0P)0c 08"0Z $0p 0 0g 00^ 0Dr$o'???<@?+  $$ h @?$'(j)'_eNaH=-0 |0"32C0cPP 1S!0S!0SP~H -0L@P` 00p@P 11╵;0 &h= -L@P 1} 0-P@0@@L  00000 -LP\`@0Sp\@0^  00g0   -8(L`P"x lOL @ T0 3^     qhM?  S0-L@ P 0P 101 0 0h8 ᮬ0h? -LHMES, `Ph l0 (ھ0ᲀ0 S0 Nh0 l & l@K`pK!hK 0nPaK hK @0KdP 8\Da [0R 8 8D, 0R(KR0 Bh0 l ͆0a[ Y # Pp @P  Y:<$ @ @ 000CS P 0 :0 0:0<  P2: < : :P;Uq8[\ P 2@@3N0 h0    h0hKⰀh 0h0 岠h0h0 ,2岐h0 0h0 }040K@@(0K {0 0B@(0K t0 0B@(K i0@ 0B4 K0& FR:00:0:0< 0R:00<0ĕ:0< 0R:00<0L8 0(Q ,0S㶃 8  0 R  8   0S 㴓 8 x01h0纳8 H $o#(?? X?@?L=|?$??'? -8(L`P"x GlL @- T0 3^ (   $   qhh?  -PL @`p88 ?!R 8 q'  g !1S3>!Ry듍 YPP 1 8D  Ῡ`1#0 3ᶩ0P8PD "2R:0O  1  0 0@0@@0!0 1Sq@p10q"8  "0% ᚪ`P 0| pP 1<1202 ??2'?ʚ; - LPDp`zP pE 1‚32C0c0QA20`><@ ,=A?0C @300  00S 0 0=0h 0 0P0 00@ " 8 S00 pu~H&$$& !' -SLM` 0 ʼ8b(K0L 0  0A 0  V@K0KPK P0SK 0KPP  VpPQ 3-Q> Qb 8 \ P2  3N    0Y$ 2ᲂ $ ڨ K0 K& .⫩8 ᤩ 02 R@ 8 1  1!Q ʼ89  @p`Wx1 R0S( S Y@PU 0  Q9 A 0R  R1Ḑ0 1 @PU @@Pe7D@T 8^  TyPP@101Ay0@0' ?4??&&?d?? 0-8]L@P 0 R 0t0t P00h0X0 qP  x +>8  0h  I$&$$P!? p-CPID@DL`地0 #DB@@0 00 R 0\00 0   R 0 0 0 @Pxx 00C0p&$& -LM8pş@`h5P, p P5MQ@| 0CQ 0CQ pş, 0R(K4Q :4Qpp4 @T  0{S|㨐K3 000@TI 0|SE:|pH| H Kd  KdC=06KK3 4K3U K#4V0Kf KK:00 e0Kf K:0 f [(0K0=0AfK:0 f [(K 0=0AfK:0 f [(0K0=0AfK | 6pP 긠K  6pP@3 咧@T 0S`؀K@T 0`S:pF K K3p \ 1<[180瑯$ori ?i i|$&&\=' S0-L@ P P 0hM80"0h@? -8L@P0  0 m+k -`L|t2@T_ 1  [ W0 @20  ,1:100 @@X00W00S6 !@ 2 00p5 8PR e1P01 0t10  `1:100 81@@X00W00S0@T 1 * mo 8P) !001 P0 00  1 :1 PgP DPX$$'?? -@:<*0: P0L4884#8 X -0:L  84 0X -0T#LR@ `#D8p 1?0c4X \804H \0:;0:84T ;\tgfff -h0T#LR@ 840X \0:;0:840T \0:;0:t -LM3KP, `Z 804R $1[7804S $$84P 0T`@p804 $Z 0S00000008 `4TV84P 0T$Kl=?4? -L0ML P0P ,0 00  0:0 ""0 0001,0 00 , P <0 2T0  #,4H L PD 0:H( @ 4 7@0aS<(\ H H$0  B H0( R < 8 ՈH<080 *0 ,0Z0 , 00@0"!70C S0A! S"8  <(\ 0 0 0 ^H (0 S W<G( r\`@ 0 00 <@(\ 0 00 TLTZj^02 <"(@T0 Z70D0 <0H$D(KL0*Sl,00@ 40 hd'(,  ,0 , 00 C40S% 0  ),0 ;0 L 70C S+a,0 <(@T 0 0 05^8 <'212<(\ 0 0 0 T L08 #@'ȗ a'P P00/"-0?00b0  D ?x? Q- L Q Q T0TT 00H0Q 8 00 900) 4 6 8 ?* p-PL`@U 8 04< XV V Vph804< XVph Pph4 ? p-`Pe0:@!;L0:⻪51=5q847 0T8@4< 0X84> 0X P jj@k3S <0$03@T@l7S <0$07@Tp -LMⴧP b0Pe 0 0@0@0/"-0?0b b0#RO <0(C\E 0 00 <7(r\ 0 00 W2@7#<07(`V  $0  B< $s03 0 0@0@0 0@0@7rW:';Q:0:š 8,*4@0T 0-@L1Pp@30<# 01p -LM5P+`0:  7p 0 @0  BQr0CW 087,*@04T05 020#R KYP P0@DQ!0S*DpP  э'7R 5;50@DP0S*00 @0@ 10R!!  10C1 10R!!  10C1 0-@L%P1Yp0*  <390:t0hة<3 @30S 02)S0* Pg 0-LM'P"0  @@RC0<(\ ; B$0   7G7GG8 -LMPP ;@P7 0!0 0 y<凁0g 1 P U7(K<(\' $0 <䩕( \,  0 00 < (\ 0 00 Z o90,0 0G,0@,0, ?WA0 @<(\ 0 0 0 ,10<(\ 0 0 0 0/"-0?00b9? -L@9?Sj7P -L M9PP0 S處sd3 0*R1z01*zpz0/"-0?0Qb[<I( b\pO 0 00 <(p\,p  0 00 X=1@w 9<0C9(`V  $0  < $ T#$2 @R``  T 7S  0 0@P0@ h0::pX,p 虅p (K:S0D0 0 t!0Ca% BbQH1 L! 0 Q AC1 01*pz0 D:: 0 0@0@0  0: ,0  202, :S 9S202P   0֡E  2022:S 9S* 00C0 0t  0-@PL YYYZZ0 0-L84@7 0TPPU [8047 $U 0:  84 0T0? 0-8L#88P814` \@@/T 804` ,PT 0h? -PL@p`T#0R  0i=VT\)!)!<)!<)!D)!L)!T)!d 884#8Xi& 0f h j {b t4? Qp-L@ plR 884` \PPǟU 804` ,`PU 㸟 p804$phP? -`LP@သT#@1pR  @ϝH$TUU* f U XU  ?ẝUU Ud 804(@ᦝj 804 $804h (@804b (@@t4? -L\Ðp0 6H804P@T`$00P d/804@PP T`$00P 804@PP T`$0P d Ȁ P 804@PP T`$0P  -LMp,  804@PP T`$00P dڞ804P $ 08#804@PP T`$0P d㾞Xʠ,0尐 -LM8pK@4P0 P T`$<<0P d㛞Z*804@PP T`$00P  * K804@PP T`$0P 0"[0 X 804@PP T`$0P (K -L M80 "Kp@ `4,+ RT# ;R (;Ry }t;R7 &R5 !5CR0: 0 0 0<: F0}0D:D:@*T3+S!0H`3 }0`3 H0:@ e @0PK80 4$@TT#:R :8 :,*O @d:\( T#0S \Q "($ :  < Q*}> 0}n@ 0 `@,0,PP  (KR R R R R0:0 ~0 Q 0 y0\3*K0C"[096@KR0\30 0PK 00[S/0[S.0[S-0[S,0[S+0[S}Zy  +0[ 0+0Kp<7'2 4P D$<0'0 8@ :,*Y<{> 0  0 PJ<7'2 P@L <08804S $0!0@`3 Ss @!0`30:00:Rb |R^ R\ R0  0 [R g RM RS R0 0  0 <0'"8@Td 20* 0t4 4P \ <0 *0}<,>  0 P  <0#8<)3 P@ <0@T7 1~><0 0  0 P@ D@\@Q <0T<0$804 ,B 804,00s Pp0:" 2*12"12P1!0 4B T#0R$1 R R0$1$18"9$1! ? C0:.  0| 0w1!D311^@H#L3!1,Z 0̠Aj4CT/  M.  ᮜ804@Po T`$<<0o T3 S804@P T`$0 0:* "0"|@H|t?|=???)roro?H?h??l??*??? ?0?A!A!!!!8*!x(!!!!T? p-LM8P4D ,:!8#8  * 3S><8#8: 0` 0 `0 0:" 8 <(4"4!<4 \ 8 <(4"4!<4 \840D \Kp84 0 \8@4 0\ K`%P @@u P 00 @  01 0 0 T -LM塙 08 )  @08#(0: 0088#8#84 X0K 84P 0T8@4 ,0\84 00\8@4P 0T ^98p,P`04 \8),04 \'8,0@04$ \'8@,04 \8 047 T:St T#1RC 84@ 1\84 0T8@<4D \:S1 84< 0XH:8@8#84> X8L 04\T#1R 84 1X:S L(K84@ 0\H*&1g804@PR T`$ 0R 05 @0;5$0:90:ㆡ84@ 0\t? -L`P㭘pD00 @0@jShh? -PL@`p厘D1T% 0CT-  0Ph@4T ח0T 0T01.✞@4T5@ @5 @ Bᶗ@508#8@5 0 RPR@@ @@i 5i 6i( -:L@@`804> (1PP P`Pp HQ. W 02S u804> X$%7Pp` !00" 00p -  3`0:  )p`p`  804H \y`8 6 -@QLPppU@RpW?`0OOP$ 2>AB?/UPP``0O?0@@ cAQaQ p- @L`0T 0TP$ U  $8P pp -0L040 T -,0L8l02 0C6k -,0L8l02 0 C6k0 8C0 -1LMpQKP 0K 00`P 0@  T 0@`\ ڔ 0S 00 S R0Ġ T 0$ 04 000Ġ Croukro4bkj!ro -04Pp008@L `T0 T0  00G  0Td̗ $)d×0 T0@@P*P 0T 0T 0T0 T $P 0T0 T -0L`4P 0T 0T 0T 0T 0T 0T0S0'0 Tp0 T}N@T B $  T 0pWd2}~@ $ pW #0@W}~ $0P0P@0T @? 0-@L 04 00P T0h. -0㈠4p0  LT64 Qi  $  0PT  0T  0T  0TdÖ@T T! 0  T0Sq SHR!|P!TR!Q!Q!R! R!`R!R!  $ P7 P%00<<0  T  $@P90  T  $P000  TP00@0S<< 0 T !0 T  $P  0T0  T  $P00  $0`  T  $Z0P  T  $0@  TZTU000c 0} 0 S0 00  0T  $q0@  T@0  T0@ 42P ("(Ÿ0 S[00 SY QT R< N !Plf 1 R0  01bzQs000pmdQ f000D`<]4Z0@000~m  $0 r0$ 0440 0S0 o0 @0 0 00\roH?uk4bkj!4?p`!F![!?p????8?\???r Cro'D? -PL `p@ 0TW@DD0 @T0 T 0T 0T 0T0 T $iA -LMP@pP 0`P  0<<0< 80@` ,0 $ $0pro(Crro C$CroC 0-LMhPd0d@ @0P @0S000,0 0K0hoZro Croro Ch? -8pLW`4@P t0  0@#00C SX!X!X!V!V!V!V!V!V!V!V!V!V!0@2Ÿ 0i9 @0TP 00 T0 TH40 T0 T03 0KSpږ SpGpӌ0Sd p0 TdI $ 0Td< $0S 0 T$ $ 0 T0 T 0T 0T 0T 0T 0T 0Tn $<<0 pTCro -LM@`pᰒ}^PU ̓ $  0 T00 0 }^PU  $  iߑ0 roro -LP `up $  $@ $ố 0 roro -@LQt0  0t0 Q-L@ 0@` 9L0P R K#@ 9!41!/#)D )VP! -#\!X1!#@  ,1! #)D 1V  ~  0!#)D  f -8 <0!  -S==`===H==(= -2LGM2px2` 2B P AC81 , XŸ4!  00 PP`~(2Y P0 P \0CI͇0@40C(1 \  0\@ 0\P B&(p 8p(R B 5RN n   P`0 \0 , ,@ 0\ 0\50;@05(R   Bp?00Dx0 =S 0-05C-0LSP0CS005 0h",孳00 @0@0h?80 -PL@`p嵁1T* 1T2 1T  4P@2 X10SL1T; 0̂@4T@505 0S. 5@ @@ M؀@ 4P@8S 5A0AS@@ #Ṁ0ڂ@0\5A0AS4@Di i i ϖ1i 8@0 -LM0p,0 L! 00@D   D\P 0` L!\Q 4! 4 8S 0<1 V> PʐX 4Q Qڰ8S, S 6&x0CPƟ 2`\1 AC0 0 PP00`U@@TST6PU @P0@418&006 0I͇0640C @1!/!b32Cc@!B=p`0(3@jt1\P 0C  00   048,+ )' 1JpP}(8 0(80 0@0@}70 0@0@q(8 08(h0Q40 R`0CP 0008;8,(Ko.Q(K*? -LIM4 , 0( ,4 4b $`00V< D1   PP ; 1 Bm(\  $0  B 0$0p 0p;P@! P,  -00.  /00D@1 048<#8@!:#:0 0t3 R; Tcds0D ,0@@ ,PP0̈ ,  3# 0 "0 n0m0C 0C@1̈,1 p(3R@e1\ 0C  00  0 $(T10S 1E@ R 0 0@0@, 0R-(K00 @0@0 0 0p;P,00-  .00/  0 0@0@{@8嬮$o 458ش= ? -q0PL ,p` P 0\@0 \8@   @  \0\n -@A 0 L⤢[@Q \00HS X00 0R B0HSQ -`PBM @BL$tx堃ឃZ '!ȷ!!! !8pp8HS 'p8SS1 p(R6 R 8s6 s  08pq8plȃW0 8 0\ g!P  Pqp(}㣃Ҭ7l,?.A 0  0-@Lz8PS 00 ]4zB $}0h꠸! 0-PLz8@S 0hz0x -L@ᜠ4P 5A0AS 4@ HK -LM0S BM(\  $0  B 0$#"B 80 0@T0 0S) p@P0S  B=(`V $0B-0$ pQ B= 0 S@oJ -0(MLp`$0 0(0 B #Pa@ p  0 @P  4@ 4(KB-",0K0 0 *,@P B=0 ,  04@PB  0 P4  0ӫ4@Ϋ0@, A  JPq YT4 8 0 1P ;V ;!U B 0 @ 0< 1@PJ<@@@0 080, 0  S-00.  /00 108 M?C@PB=C 08 P 0 <  @P  l`B=(\_  $0  B Wd[ @NTV @I@QE8M @@L?p?????0@<10@ 2 "8!2"10@!0` ``-lᬗ1!18!1(3!1 #3!J 0 X0Y1  D0C!@<0D BD0\ACC-  NP 80h̢  -p@$P1P DU=0@@ P0P U=0@@ݒ0@ T=0pl??==" ""<l!!!!4!H"/,??= -LXM0h Pd j7(Kh dp0 `K  @e   : @@ ,a,qP 0 ;C*@,0 T0Zd Z p@P0* `, + 0pT Wdp0 R8hP :0h-[0S0#0Q0 00?,?, -LKM00 H! ,0 /0 0@0@ 048<0#,## 0B-(@T hh4 00 #<0<4  ! ?  a B4 `( 0CPC0\p 0C  @0  0 48< @<L1 0PD1 ;L!D1 a(\<   $0 L! 0$D1  L1000 ;P@ <D! , Ÿ -00.  /00H10 048<#8:#:0 0 RH TbTr0*,0",0@*,",PP@AJ͈0 < @!  1!1 .0*0CpJ͈@14$ K(1 1L \p<@àA0 S p b ^ PA X0 %Rj L H   B0 %<j 6 2  -0 %'bp 0SS Z  ^0 mj==0 -pBM @BmL$`tXqqZ *|!\!H!H!!8pDp8HS 'V'p(RRA RC R 1  ^0}q  08p8pqU@P0*,t ,0`*,4< \zp(dp(ld0 -LM Ip, Q0P@L `1 PQ ᭐ P PB 0\E Q8 8 8SP 0\D1 T> `V0X@1 p0  @7Pǟ, 0R(Kqt'8002007\Q8 8 8S47 @ D!  \ `Q`R àlQ p pl6 `0&01 0ƟB=`PB AD0 4 PP00`U@@TS6P z?C@?@81`&K͇0PT67 P08C ADP0 pŸ  04 P`H2P ,z?C0!(2K͇ 0"80240C$ 9C4ch4l4 -DUDE0`L* ,0 %\`0*,0$\x`0*,0$\i`0*,0X$\Z`0*, 0$\K`0*,0#\<`0*, 0#\-`0*,0h#\`0*,0,#\`0*,0"\`0*,", PPZEr唂0*,@A0d"\_0*,0("\_PUZ0*,!0\_Qq0*,0!\_0*,`!,0#28@8*#,!0\H_x0*,0 \x_0*,0 \i_0*,0X \Z_0*, 0\K_ p4 p-L` 4130 4332 4534    E1 Ƞ@!!,Ƞ @j?.0 s 2 8HQHA #800Md0S!<C<0N[0S <C<00S /0#@0C00\S 0P00C0C 48#(R0  0S05@ 46T0PIM@P(0@8sP 40ĕĕ#U@px 82-` L0C 0B L$ dB  d1MM-pp^W AQ0*,*,@P W|813]\/X1p 0@&@AC P(@TG]P P  @DAC@TZG8@ P 0@T  l`x0HD rG!D!D`????(o?-\$0$ 0-\_ -`P0L@p ,0 \W 0p ,8#8:H \00 ,0 \,( -0 d@8`Tp4 P0L<4 \ 04 \ -0 hp@8LX`4 P0<8 \0 84 \  -XP@LPp`D ,`80 00 \ p-0P@ 0PL`` 0/\`8 Ph Ph$0, 0..\pj -NpLP @l0T TH6T8 404 \1`V@>.4 6.02/\>.4 6.02/\>.4 6.02/\`0`  08".\<0< @08.B\ -0L`p @P*,0 1# 0*\H@`@P0AK ,0 \@ P ;";";";";";"<"<"<";"<";" <"XTPLHD@<840,??@@@@ @(@0@8@@@? -9I9)QL 5xI   4130  4332  4453 M@xP8 P 4U0D@8(QH  48#(P8R 0  l8 X8  =$8 (8P 8  -0G  48S7'000S 7' 0 B07 m`pO@@) W 0@ 4@0  4X706p 0 S00ƅ60S060ƅR`m`pO@@<xV S@ 4@0  4(X706p000S00ƅ6000S060ƅ(Q`5 0S  p 48# R m`oU  @ Ȅ 00(=(D(C(F(E(G(H(J(I(K(U(M(L(O(N(P(Q(S(R(T(V(0(/(1(A(7(3(2(8(4(6(5({(UU!"'X"5' Qp-L` @P0 ,0 \0/,;00/\pp@pP0 ,0 \0/,;0/\p -0L@0t ,(3 2 8Q Q Q 0$ 0 \ -LM0P72 8K { `0 S@000 03 K!Q3K93K#K@ptP0 80K4 K7pK0+0 0t 0 ( t H(K8=x -LM0@Sp B](\  $0  B 0$ +80  0Q B= `0BS`  (PU $00 $ @Q B= V -LM0@S B](\  $0  B 0$ +80  0Q B= p`@BT`  (PU $0 0 $姵 00@@Vp -LMp`@TB  (PU $0 0 $ 4  00@ @X`01 11 p-@L0` P 0 ;,0` fa @ p0z0 ;00@PT0  fba @ pP0000 ԗ ԇ bbfa @ p5(6(7(8( -(LMp"h@@VdTw 1!!,dTj AWQ( (40! \`0 0;  0H!\W@1!!,0 S  Z@dmVTP` 0\@ 0\<T x`xp0| ,@\ 0\P08 \14C@Tppp 0Ƞ P ,(("(0f{( -LM5P@`!@@5q=5E 0`a0/\L00!,P 0!\ 0\P0 0; 0 \0@3B$@T]<Z \0 R P@0000''|8@0 -LMEUh&h 0,` \`p ;p U 0\` ;p }U 0\` ;p lU 0\` ;p [U 0\` ;p JU 0\` ;p 9U 0\` ;p (U 0\` ;p U 0\` ;p U 0\` ;p T0 ,0``,0ԢSF r@A0 \ P ; T 0 \ @ ; T`VZ  0\ @ ; TIpQa 0\@;  T0 ,<ʠlj@ Ƞ 0,\ ; pG}Tw 0\@ ; jT 0\@ ; YT 0\@ ; HT 0\@ ; 7T (K -ALP8`-#, 08 10-\@@T}T! Pp0-,0}T ?0?S Y.b0 ("(, 888## ? -LMlalQp+8\L!L@0  *t+0\@0 0; +0\@ 0\ 0\@0 0; @@ST H0H +, T(I<(pp? -LM0Q,Ap !0\`0 0; PPgSU `̀0/,@ U<2PS%0/\Q0 \ QX00 '5';( Q-L !0SQ@@=80͌ p`@             =0 S  S 00SP  S@ 0  t@?   ?  i=\C''9( -LP@@QdT l`lp0d ,PdT  4&#51 \m, ? Q-`Lq 1p0S0= 10RS S0-Q8 = 4O7;`P dT1  @@ d00T O7!0`0S  T0D@@   < -L`,, @N 3##,3 R 0C !R 4LCLS@#\04#, 0#\ S@0 @&T ̂@ r0S) "@D ;90@ >  S wH"/ ;:0 A$ ; 2 !R\AQ0E/,0E/\1 R_ j0SH = R 01 R b 1 5Z .S1 !R0 R 1P00 = 6  4D =0S`0 S@0X00S S;(='59(:('''A( - K4@ L7 bp >P 7 b ? @7 b V W2 RrR KP 2"/, 2 RRR tKP pX2X"/, 020("/\2"2"P \S WF=1P \f Aa0!\1!Q> W$1!Q!!0Շ0՗00.0  B(idMR !KF Rb KF  ;40! 20 =0P  \P$P0/,0  WL :0 0.B\P$ W=(>(''5(p05(VUUU 0-LP0p @P00T0Sh0h QT@TT0hL0'p0 -LMB }2 p Pp  0 `Pb !M,0K @0 0 *,`P p}Q 瞝,,  ;4`PI  @;`PC (\ 0 0; 0,p 0 p 0Z 00p  BADn B=(B=C 0 0 ~  nM@`P H H}K(K,} }p??@$@ -LMB `p 00 @p  0 PP |$K (0K 0 0p  ,PP | (  ;4PP  ;PP (\ 0 0? 0,   ||?p?@$@ -LMß5PA0, ASu 0BSxy"l{"t{"l{"l{"l{"{"l{"l{"l{"l{"l{"l{"l{"{"080 0022< k< iR} H3H# 0 00t00S* 0SS   S .4 <30K2 K4K.x. x ,4,`1K0pK/K.K-0K2"<0!0*040Kt0p( TBTR0*,0 1#8 3*\, 0Rw(K080 8 8 < QA0aK ,8000 \PqP0 00tp8S2 @P 0Pt P0tl0P00 S̀ ,#,430K2K1 K0K4K-K.K/Kw.4 <_  3 K40K2K^@P 0Pt P0t9T$o = -LMp: 0C0S P t {`\*000T: RrHZHj08*\0/,@>/\+9\@0 0; +<\`P93N0 $hIh 0 s@ 88 \49T@@lJdT h0/,0 dT{ /<` { &|8|(.B,tz~>/\@/@8\+8\@P ;P +<\@'0\'0\@ ;P  0t'\lG4W4g @\T<7<'Q00 , @@IdT 弦0 ,,PdTpp&000/,@0}0/\u-B;\ D&0\@ 0&0\ r0I`PF\ 0P+@; )00 0P*@\E 0P+ 0P+@0 *00Bm(`^ЄФ $1\@ @0\ P 0\)U@^0 \ /0\@ /0\ L$L4\@@%IdT Sc0/,0 dT >/\@0!.\]M@'P0A0S @T3 A  QRn\3R 0'H3S 0! C= =CTR0S0#001 0S2 0S  S {=\ L2x"Q` j(2("Q(8p0A 0r밁0",.0 4!\(10P bJ`P',0\@/|1\0  \1 05;@05( 8S   &\00 \00 @21C! c.  @FTp?<(p(H@ 43 #0041 ~U300 < 01 <1 @ d2<   @`0 S8P0 $㮣PH`7@ 0498#,("(#80 :L80཈841 ?H1 R<; 㵣13H:87@N xuH.v"1  0 0<1!0!0 0= K40L$1 H1KK L,1 ( /UH 0HAHB]00 0   0@P 00! #0P 0T! 0( 1|/0  ?P8! 0 $֢7@H N Lu̢$o8=<''''=x?<<=4= -LM5P=@S`0p"  1R0' '  (8(80C0C(8(80 0 P  3/ QPT1  05|1 RW > RS.0@ BT0S*8S.0@ BT&0S* 00S:A BT  1R0! !  11D0C0C11P  . K⮢@P 1R08( <(  x8x80C0Cx8x8 900 @0@5;5' -LMP0 U200"00180 00/3<0 ,8<0,  010G=0,0 Q4 F p01ထ0 @TB ) (`V $0 0 $40! 0G-@0@010 0  G00/"-0?00b , AR 08< 00l 01T 0?Q0 02<0   84;8(Ko'' p-8LS@0` hP8 0# 80p@0S8 0C000C00 RUHD -LJM6 , 0P/,6 @ @ *00T@! D1 9 0|6 R D@D N?K0 4 @DB 0498#,("(#8 0B-(@T 5 ^=C0# 0%@00@Q@ B5(0\H1 ` 5  0  03 0 48< { ;lP B-(\A 4A  $0   B0̤@ $B=4  0p;P< $ p,0H!0-  .00/  @D10 048#8:#:0 0<8  @@  81081  0 4 H3QR 0RࠓࠃQD00 X3 ࠁR?  00t#0h3 0  H3 0C 048#9l  S| 3@D0CͅD0> r00 @0@w0S@"0" "Ȣ"P1   @!0000S~"""""p"`"P"0  0  0  0l  f0`  b0H  ^00  Z0$  Vx0  Rh0  NX0  JPDKHr$o<|'<<<<<<(= ? -L MR0 P >@TL@2A 0g0 [0(S6ڋ,q , , P\0 2S P UZ%0. X0 0@ \@DJ0NS` 2"0 P`0, [0 S, (K20  @80H00!0+0!0t8= -tHLT`p` X$"`"@"@""TBM0Q!,8\!\ <18pp8S Nn'p(RR' R) R 9}8p  78pV8pQT !>p(p(l(2! -A  0Ef -0LM PR `p0 ,8S  0h聐 x 0\@0 0;  @0 0\hȧ"8S S0≕ -pqpa0PL,,p@ P,0\   @" %(+ .   d    @       q 0-LP@Kd4P 0p 0 |" 730 2S Q <0 5A0AS 0?08=  0-0@LPd=@3B$@T]<r)0P0 BB--L` aP|2 2RR8 ,QA`A@PO-U   @P_h1P/UN>0@H1 @!@1(18!810@1!0` `C9@d1!1(3 0#(3 0,# 3 0#3 0#3 a , X0l& 0 D0C @<0D BD0 0hbo@'====Ĉ"ؗ""ld"0"@2"2" 3"7"$9"dT \2\" B,0@s dT$op : 6M `<`< * &꘺Tv+p==="== <<|nO),'===5 =5$TTPPI=aq -@L    ("( ("(,h, p-LPL@ 8`("(  phsQ 0 S0#8R#( Q 0  n>= 0$("(("( -L@h Q0-LP n? 0m/00m?@C Y0d 7"\0R 0S 0m0hRan?p "("(R<P 8#8 0   -`LA0000 ("08#  = P-L75 -LM0,  㰐Რ\Ppp` `0eS0cS@`VP0V ( 8B(C62 ~0P, P0-:@C,S 0C8:0?S?0?0 Q p-LP!h@o("(f("((B(R ("((0B(R (B(@H@Tp 0-<1"LRP 00B- ,0S:0C *0b10 0?A2c>S@>@OH$D@ H$( ,0S| p d {X wH s< o0 k,0hfP gfff  8( c31 0P @PP p-0L` 0B-  XU@0@8#Xp p0UPPdL* (L"(ph)(@[%X XX%X  0- 0LSP X@ @00\T@ @ 0tT0 -Lp_@0P`  0S 84#(#  #("(X 0S3 X " 0S& ("(, ("(0Sw |, ("(\0SH XP T  L$H=08#8T T" =08#8" Hb/=08#8b/< 0S@ AQ4,\0SC/4\封0DS;#HMw- ("(U8X#P`0@ (^  >a 90 P@^ X`(08#8^ $<*("( K~a'+ (-L`"X@p L,R00C4 0@(T"X 0 S R10lAC 0CS? 0 Cm@S@P @ -(0L("(0*(A- BRq0 /h 0bS1b1P# &L#$#&Ġ& 0`@ -pLtP@`T@ @P P,@ hUdU 0-H0L0P@0 ,$0 0 $#20 00!  r 3R0000088##0   -rL@v@0B͠P00,0, Q0C @R000|kN -Lp`!HPV04 4 0P(U"H -H0L0@pPK/\`,0K/ -L0L0P`@K/\p,@0K/ -pL P`@!1 $O\H@0 \0@1 0C\ -L M$  0@  K U -L M@00 @K--- p-8|#8L 0@h 8P#8.BX`8 04 8#8` XVp",P+@P P -@31CLp`PP PP@0A=T  008#`08#L0Ba%,0 R 08#Mbj -0LϠ̠ 0( 0@0l 1 \ -@0L 0( ,  P 0-LP808 @ B,H@@T05@  0`H -0L  -0L MP@ (pK`)3 "K @ 0! Q @ TK p-L@cP12U  80(0PP  @ppdUhU -LpA`@ 0#0PW@ @p P@D  B1 @;10@ .1hUdU p-`L@Ph -1T ' 1@ !(1,7P U hp蠯 -@!XL<p#X`' ("( 0 ("(0 ("(0,0-`Vp 0\0,8#(0L  ("(0--("( -LM0@  *KD0  *K D` 0< 40 Y`@ @I@I``T@V`F*K,K Ɏ080 T0 T@@ D,0[  + [hV)@  ("(H3@K)@  ("((iP@@ -0Lp0@ 0\`Px0x  ,: S:P, U@],0,  0\ U<@0 0$U -LM p, K 00 @Pp p *0,`P {](K 0,  04`P j]  0`` p`P0, 00 0,T] 0 , 0pX@t@@ -PR000L@`p T0 R pPU00p $0 @ ']@ -l1LM @P* P!00C0S$<1  C( KPU% aq0 ,U 3*0 0 \  U 0 \l0l  ,  0S : \p -L@ho 0-PL@|0h -3LM CRp00C"Q& , K@KP "04$2"0t2`"Q( \"000, *@B@R0<",, KP0@P!\`,? 0!! 0@PB/\`, 0B/d10S S 0d!P@B/\`, 0B/ 0 !@P B\`,!20 0 C( P| 0A-B\ 0 A-B, @x0T 0\ X T ,P 0q  Pk hUdUl 0-LM@h0 CC(0 KPP <0< 0l \ rP8 -LMp圁!0P@.B\`,9.0X!@PH!X`(08#8$!1B-1Qo$0 CC(0, K.P0 @Pl \`, 0 0l  ,0 P@@ X`(<8#8 tC -LMp`h Qn B= \1S_t \ ,R00CP1Tc1@S1ų!QT \^@j@P&K0P8U#H2[08SL2[08SG2[08SBp ^R0<08#@0S>0@``1@T  `P@ Z KQ0@11SʴZJ01,R00C41"0R 40`1l@ ?` RLZ`80R4 `!0 ,`tC@@P =@= -2p"LQ? Rb0"X0/(HL"0X0<"(@8.#8ʠ",ʠ"$N 0R10% R. R ZZ!1P\E PZ0@T@ T0@@Rxh10d1P \1PE P2Z81P* 4*Z00 110!S1 !1 1 !111!11010,@0T@000 10!10 S000! 10t0110p 1T0!1| 01!tC@` (@P S \@@'#̊#"0"Xw#8#j# " """"$o#" Y=@ 0-1@L!P.B(,R00#$R *\F PY0R 8Y0\( 0 S 0 S9 0 S8  Y0\ Y010 ^0$ 0 *>R00#600|0 $0t0 1G.0!2X0 $0r01s01t0 2 @x@=0@T@L#rп" p-P1L`P% P ,1,!Q pQC0e01 0   0S  R &Yp  YpYpR 0e01 @x0  0 T0`000 RP 000p8 000pz$C=@@@ -LMp`P  X,K ) K2[ S 2"B 0S 0S>*P X`BR0 ,t2)[h"0`2[ B0 8 #X,2[(" SZ 2U  0 S R X`!1 B PU 0X 1   @t0C!! PX0/0"0)[0P!P1 @@T `P ) K!1[ 1 !PP 1P) [AX)0[S4 #0  3X`Q -XL|0 %X`CC< `<@zx= @pC =0@vX@x@@@ -`@p0PL.,1 010P,00 X |0 R lW,8\0,,0000$@ -@P0Lp.,`43.\.,0S@@&dT @ 5P dTW<@ -p@圀0P`L.\,0. 0J/\0.,J/, o -@pLP>.(0`@.\P,7.0S8Sw1 011 01 -LfP p0@P.\`,0.0., @O&`0@T H0H J/, $0TV< '@ -0LS8S!tpt0P@.\`,7.0., &1 01 -LM8K`P@m  p@#[3[,K0K@P ,@ 0P C[" 1R 8#H2[3K3[CK3K W:(K,P0QTQ,0S0 A0C A@,0 0 ,0 0 @ f8#HT,0 0@,0 0 B=  , 1 B !H, 0 P -LM1p@ Nx1t!QI )PKX PP 0SA p P;)0[( ['[&[ 0  ?0? ??)0K( K'K&KPi"[2[[00[00S 0C1UA% KP[! a00B1Zc?0 b c!B0 F$KZ P`0@0 0H| p-PL$8`S phg#80 S $@~00B ,, -@0L <4,4!Z BpPaRg` 048#8#$0$("!888 S L23,:X^^1!04!48#8PNX0Z`E1 U70 $("(04"48#!888 S-*Q ^PN304 8<̠Č@ Č#<\0Z`EU  tZUdUU 0HMU8HU(CU@@@`@@@ p-L!@`VPP Q !NPPp!Up Up@@ -X"p1L0C #a.B4A\VP"<4!4 <Y/\P 5$V@Qa@L.1,С\Y/9\@.d1\X @P8!<4!4 <Y/\P $X@P`J/0\@.0\@@#T `吀0J/,PU ThT<0J/,  $JP(T@@ p-LMRP`@"iT 0 $(, <4!4"<NS  UTx0S  `@KTx H0DTx0S @ @9TxxX@@,@@ -LM1!pQL (!t1!@P!X`(10! 0S6 1@1 0S< mO(K 0PK⌁ ㈁ 03K02K 02K@101)X1cP`P*Tv* v   K0  !(K0Sڸ"p0Rv ("(v<S1@01|{zP @ -L P`pA 0p eP S@ 0 TP ~S蠀0 @0.,1 S 0`` gS0J/,P 0,$ XSUU4@UUH@\@4=@ -L;A S `#@#@#@#X#@#@#@#@#@#@#@#@#@#@#@#@#@#P#@#@#@#@#@#@#@#@#@#@#@#@#@#H# T@(@B\A?B@ -鴁Q0pL!,@ I`h!8\@;"TB <10&088#8#8ESF0C8#Ƞ  0b8#Ƞ\ 08 #(^"(0S)48U#( U hQp9S:0C8#Ƞ -S.0C0C88#Ƞ #Ƞ U 0U08#pp08#pB=   P98#48U#( U\008#p U 80U=08#p$p=08#p0 @ - 0LSP 0@R`p R0Sp0"R 0@`p iH0S 0`B= @p@0@`pPP @ @ p-`0L`+QL[`@`P0S 40 $}00 @TpU -L!Ȱ`oO* =R?006$ᘠp 99 B1 0t 0Ph0h@ `$o} Q 0lp Q(08;8T @(,(0(U -LP`p0.,@P]/ 0, 008#80$!00 @0@8 0 -0LMp0(`\P $ $0  B 4@T , 20 !i0/"-0?0@bV4`$U -x0x` tP00pL ,J$JA1 \8 0$U -L`0p@Q၂0e0 1 , &00R0S R @? T xN T \!TT0e0 0\@$$0e0 1 ,  @ T N T  0e0 0 0\ 3 $0 01<,0@P0PS `0 $_|000S \o00U@`Td @ @ -QL`0p%3$001<00@P0PS 0 $.|Q.o0 @U XYx0x  QL[X@XP0S @0 $| 0 @TXT -LMp, , ,3$00PPU0 "10 0؁<,00@`0`@  0 P , 0NU <(0@h1 `V@, k (K,  R, ;X00@ 0 P @ M,@@T a 0fQ<`00 P0P 0 P p MT L 0fP 0P U0,   @ @ @`QXT -0L M`,){0(\ $ $0  B 0(@40P0Pp@ p#@U@P0(\  $0    00P K$U -$300 1L@ 0M  0 z0(\ 0 $0  B p0ppp@Ph` 1 1\$OH 0\(,xTpTtT`T -p@Lz00S* S0  ,P` 80UaP@L10F\0\ .B, a00PPP `@`=hU 0- L M0@'PK0C( KPP Kl0l .B,41C  c<00(0 fPp -!L M0p0KC( KOP1!Q |1  0 R'c0CX!@P.B\`,8#87   )00S/ S0 ( 0\(K6$000" c`P@#9 \$l 20a #9 \40, ( ?\t!Cp?BC -0@00L py|yH0 88 0  @R00<<Oy81|1 -L0M`@VK$7j@T@Dǟ?,D@TY((9Q))("(/G ("(&>  ("(d\4T&L 0Szp ("(zz ("(zP; zz   ("(% d ("(LD ("(,0 ("(0 ("(Z-Y.X 0S *("(  ("(ld`$T ` @ ("(z ("(z2@K\x03K0K2KCi  ("(CFZ p  {90SPP@4ß0 @P T @D0 ß,C @D"t[ ("(:R)("(10SU@ᤢPBKp 0 @TPڶ%[%[8(%[(K0"b @BK @TP@DBK@T. /   ,("(xp@ ("(X`@ ("(`,("(qP {e  HPW$HPEpUW  BpP {yK p HpW$HPpUW  (==)="x -8L#8MP@0  *K< w080 40 00 0"p0"烀<8@`J4 R Z  !*K wXaX080 X0080 C)(@2R  +h2@8@008#(z10  !*K 0epW4000S40 0 8(K)h @P *K 9w C41Z 080 @BR  @ C)(0R   @0 @80 *KwZ)(C l08 0088@#()H *K v C08` 8 L=== -2@0L`CqTP p:("<8#8"(0p 21C0`0gSp 0-P@L:0 p-@LP` P P  ph phI0 @ -LM< <  @ D 4, P0p81  0! <041 xvY qI |4 "  7300<X6 L4L$`V 8$@P0@p0U̅p 60 40C C4 00 @ uCp pCklCghCc$ @6#0U\/#U#+#0"p"T#" 5#@U`".#"x""t"""h"""p""` @ @ @ @ -L  -@C  Ly8[@Q \00HS X00 0R B0HSQ.C  f8 -8LS@ 0$ bC }hX_# -pQLP2 8@$1$!!(L@` Q Q  T0W0  Q+ *  `V@0 0 XS $.S <+\0pQ W W Q Q  0 R   0-@B LPB ,U0P0 0-5 @LP% ` 0S 0CS005 0h20(}B00 @0@(Uh? -L M5P=@S`0 (K3 0 p240 4 0"00S0 (AR@q8S  1ASMq B00Sp2p l2   %.0@ BTm0S* 0, 0P  |0@KZT ,0 P ,Qb0 0@0@  0  S p`T 20 40 0A@T:0S* 0 Smt@P gP, 6 DP  4, Ko@Pw , 7 ";@Pc Z ,b0,0  10R''  (80C(8 10R!!  10C1ao5 ;5pd4)0(U0) -lplP0h`@L (L0 0 X 0S <h -PL0@p` ( ^0d X0 0 0 ?/à€0S , 0$ 0m -0QL0@ 0 0@0  `R0 0R^ ^ ^X 10 h4A,0$0otU|= @ p-1LM @R a 0S] ad~<S  B$fK!Ks<S  B$̄K!K PK R00L 0\00L00L  \ 0A0QS 0\Q00L00L Q00L 0S PS  $nS < Kphg0<000 \ L 00?00 10C 0`|j=v=Xe#"tU -0LQp1 "0R ,0S Q00  0@PX`0>@8#8?.\0 0P@X`0>@8#8?. iK@P  @T= -L,Mp "JKT mRK3"胟R0P0  *z"3Rd +#r@ ("(RH@0T`tS@ ("(R:#P#@18#8S!h1P1 T ("(R&`@T<8P#X/ ;0"8#h@18#8 S11T<8"#X, ("(/"H2R $[7(K+," * " $[ $[*#[5$[$[$[0"[C"[zR"[ ("(RT h1T0`!P0/X *K5KKK0KCKzK@TK0P/(RP 00 2KT/h0X3[X  52[  zg P ?? -L0M,0pS ((j'W aG0'(X 0`Pd'X@(98#8<'@07<.0D@T@D 7T<0D@TFV0&(T 0/(P 0SCzp ("(z4K Jl03K0 3K03Kzz 0S$0 ("( 0  ("(z ("(z z8#z 0S ` @ ("(454%@P/X`(:8#8/z ("(z$0S0 ("(0 ("(x k03K03K 03K,0S R{ ` ("(RXCq ("(CNZ-mY.iX eV  X H8C8DQ80 c[0tZǡǡSӜSLbH#< B(Z(# :@2.0D @TRbX0"X@T0"XP0/X@x2<0D @T00$ ("(z)("(0SZ @PLK` 0 @TP(K褑@LK@T.  0SS) S' SS9 `@ ("(`,("(쐟@LK @T0UC {+,("(@ ("(.L  )==0p=x -L$Mp@4].D@T@D>Kt@TCS0#(H 0#(/(D 0Sz2z LS0 0@8#8?.Z 0aP@/X`(00/} 40 R! @0P` 0 P@/X`(;8#8/ >@0P`  -0L  -`PC}pL@U! 8p+P!p8S U%  1U0 U B ,c 0@+ k8褘'|0p0  p(R R 8s} 80B   p(Dk,U< @pU -@L)3+0    hx -L(Mp0"JKP0 e0EdEdU0\%(98#88%X0/(h*Kd5K``K\CK6zK2RK.0K 0 CV0/X. (x 3[$ 52[$z +#*#08@ #[{0@ L$H, ("(| ("(\@H$(88@m1.#0c /#Rb 0/X$[*$[5#[`#[C"["[zB[R@BK008#8 R2Kp 0"X0 #[#[#[}#[y#[u#[qP (K! ("(d/!_|1^#[ ("(DR3[T! 0LpzX ("(z, 0BSSR @FP  !??`aˆh@+ -0LS`p 4$Q 0$Q DP P'LU@5;,,("(5TD2S 00S?ڸ2S $4$$0$X ,("(*("(# ,("(5 d ("(5] ("(]0S &3+0 3# 3/X0Sh  "0SW  PB22S u y }P yP# u2Sd [{ n \jz ("(za  |2 x*!t2S8 1!P@/X`(?008#8/X1X!/:X L!K&,F!,!B" !>#!:$!6l] P Zp 8 # zP ("(zz ("(zQ ("(Q| !P +j"?0>c7~g p-0LS@`  R R` T  R@ B RRwPPPPPp R0Rx ,0S 0S0,0S&3#Q "3R,0S Rn?  ("(Rp0SB= N . #0SN/#00Sm"tB= B 00S:s{ ,0S< 2 2(R@ p00S\\"OPP"KU Da ,("($? y."90S/!20j FN,0S! 1 |1(R0! T(L((ph60*&("(6gE+  a ("( ("(> "("(R3~P uxtC02)> 0-|0@Lp .B,  0S 000PU%   -2pL"`2/X "v& r0 n>,jXBP PcLDU@DR/:X0S A2S u #y P P# 2S;  32 /2SK 5h!(&3+!2SB </X*!2S yB=  i}* P Zp [{ \ z 8\ 2 &,"?0=<P ˆw -LMH 00 /`P@C ,K ^, <(4"4!<S  X R,0 3 PpL@,0S  X RH@& H^H ^ )_PPp@@< (4"40 !<0D <(4"4 !<0(K@ -LLMc0@ 0 q/P双P 21 0RK1S 1S> 1S[ 1S  RR R0B0SwT0H. 0`pKS0#@0"0!dKs?^P d0!u0UP  00 0`pKS00@!z0!dKu?7Pd0!p0.P  RR 0B0S000`pK@ O0!dKw? Pd0!i0Pz i`pK@ 020!dKy?Pd0!i0P` L$o\ @? @X=l @x @ @ @ @ @ -Lp( EP PP4 R0C R h0C#P@ B\`,20#PP 0c吣 .3\PPPPPPPPP00 0,# X$D$0S 0"X@ a.9X0 "X@ "<Xx2h"J/9\@1$PwD4 0 \8"@T?C P7 Tg 0 @P!\`,6! !0 !X 0R@x1PP>@TX1PP:1 81@P50 !P0X!P0q}? l101; b/1\@ c/4\x 00000C x=/ l9/`5/P$@VUUU0U8U@U@@d@@ 0-0LS@3IPP 0qPP 0S- XPPPPPP000l 00d0\ 0X ,0,  B, -(4LMP$100!0$0#?A3c03@ 0CC @@ nB  iB  ,dp`P `Ph3  `Ph`P`P?`Px3 Rp(K31C01C=<0@ $`PL`P (`P2p R`Pl2l"1!d2d"1(  0P`g\<2\0B P A00R"C40Q` / ㄸ0S㠀h 08 xN@pRp1/Wᰀ@3NH 803:\.X1  0D!08<10@(N-B( 3"1!# 1 !3(!U | X00  oD0C @<0D BD01T 03 `  -CMbtUl_#N##p#b#pa#@==?lU",U#^#^#(#/,UU@ p-1L`P+0@@0T0000000` 000T0L 0X \101p0B4P@8S 5A0AS@0@0"s5A0AS80p0(4@Dp /i i i ϖ1i -LM8`@(KSs0J/,p@ 0K/, 2P0@KD0 PU 2唂%A@r@!U 7KwK,07 1  PP+UJ/ 0\@2 0 0@\T @V P@(c@0PY408@OI1 R9 x1 R5 0T0U  ' P1P!0QE|AQ0-,-0XD 1 >+>_SRU V-+Dg@l0@X0PD+VUUU@g0xU @4@XULUD@ 0-L0@PP0 R @@C <0@ R00S0S<SH0H0<<0S<<   <0CS,<00-,000-,000@-,00@0@<0040 -0@DL4 0 l\|0St 040x R|00|0x |- 2! 00202 -0L@3 0< p-L0`P="R p0X 03MD0 @/A#b, lpCMbX# -L@k"P 0h 0-0P L@3 v $0S0$00h"@-P4@pT D`  !00\;0 #;^0 L00dL00 0@u"P# 5 )P  0;-R#;  'Pv Q  Q0 00000v 09040 0-PL@<0L0h Qp-L`P @Vp p-LMlR@`pt2 ` l” 0pXd+lRpt2 ` l” p0Xx -0LP@ ra00B@0U0 0 0"2R0CB200 -0PLD`]0pSS  4@0T0 1* **P\^^!h p-PL`G0 L@0U0 0 D<SLp00< p-| LRPh` x0@S | 0|@Dp ph>p p-0LP` L@0U0 0 <SLp00 p-0LP` L@0U0 0 <SLp00 p-| LR@h`P x0S | 00|0 0S DX0Spp0t phD p-PQL`@pVU 000ESQ 000 0ASQ0pp 0-LMLPT 0< VK0 0K='P  ,0 0  ,  ^ @< p-LML`T F\@0< UKp 0K'PPP0@   ,0 0  ,  ^ <x -L$MP@D H L0 4 @ h0@ '(KH  @"H0@S08#h@ P4pp'0'40 l1l!Q 8 D"8 YE  j0 `P, <0 L0S44 404i0 079 @ 0`V , 00 0,"Jp'PDj@P! <P008 0 V <0 H ðP@Q  @H ᷰP@ D X@ -LM`pDPh@U L0 0P0 p 0(Q | R x0S | 0|KH0 < K$@K @=$ U040 $0p t0 L0 0P  00 0-LLTP H0S<> 0< ThP0e @P -RLMp, &R@@JgP P= T`: U  0"100"P V `^U#`00 `V# iP  V1@`F4V g;,0LDP`, LDP @`, L0@!T x@ -0@Lg ` P p>11$$00WW@D4(D0@T 7PPT1Q@CRJD0PU@DZDgt@PD 0  ^ 0@ 0H0L i 0-PL80@40 <R P P 0X1000P100000S####0, 1r00 0h000PD00000hm000PD PPDP0PTDFP00 H0$P D7P!T08CPCCCChC -0Lp@D0 0 Q50O'P`•D0\ PP 0S0 0 ` VPDgi%i @ -0DPLp`U@L0@T '@L0@T&Lgi -L0MP,+0  Q`%8 <  D 4 H TDPp@@  040<,K < 400@K @1P[00,@ 00 < H0X  L% qH0D 68Ǡ-0 0b @H0L 40S,08 001100 f  0 0 pptl`@  p00  0pS @ #V, p0 FD000 0@T4@ P B6t:P0pH@4 L0,0L0(Kos(Kl– pt2 0  l2p (?<@c@ -LMPpQpl• pt2  B l2p (W0`lB8 #h`pt2  B l•0p X@l• pt2  B l2p (20#0W@ .! T 00W,  $ @@8@H@ 0-LMlBP pt2  B l•p 0X@!dT l• pt2  B l2p (@88hHX@ -LMlpPpt2 P l2p $lB pt2 P l—p 0XlBpt2 P l—p <T ?P|"0lB0x2pt2 P l—p 0XlBpt2 P |2l— ,0p0 \PP  ~@P P00LtPP 0@00 \\h@Pu 0P00 LL\`Pi 000@ Pllx@LP00TQS0$00  0 X000 HBBx"0 Q0 XP>@ 03 < LL/0lbP\ 004 \pt2 P l—0p Xlbpt2 P l—p 0Xmo$C p-LMlP pt2  B l2p (?0@# s# <S %x``` ` `  =2S! 0=2Vx0=2xlB pt2  B l•8#8p X\20\2xx@@@@ -LMl@ pt2  B l2p (?h p-LMP0U`0@PUJVl” pt2  B l2p (? `0S x PP 0Sxh p-L0P`="R 04  RD0 BAt@lPp@<Sx0,x00h03-<| <2Spp p 0-LPP@0#T0 -LMP`0p="R @ K0< $@K0?H0  K @;@P$ 040P$0 l`t0p D0S<@Sx0,x00h03-< | @<2S F L0 0  D0S -L@GP 0h 0-0L P@=2S 0P<2S00 -L@"P 0h -LM@P0`="R  K0 Dp0H ?L0<$K(@K @P( 040$(0plPt0 $0  0 0!2010P0S0SP(0-#206S,0&,000a>000, R000000 !2010P(0S(0S,P0 =2S, 0 ,(4 000 - 0p`L<0@@pGP4 p-PL@8` 8 0 Hph 0-PL@' R 0 0 0 ( H0hw -LMRp`4`R 0K0S@C * TP,@ 5<*U   0010#Q Y@, Z, 10"0 0  3U ,00010# Q#0,0@0S@ pX00090,oh @PJ0h soYr@@$0S0$0 0-L@P|0h> p-LM H`T  X@ 0 8mE040 06$Kp 0KPPP@   ,0 0 ( (@ ^ 8 -LM408 0<0 =P}<0s<0"00<0<04 @0 ,08@\^j4 PL@&j, ;, p0 0, 4R0><ʅ0 S00,0 ,4 0PLCJ 3( 25 < ( 4<0, ^0, P<0@ B00p*0 W!`<apP- ,#(0L",A P p4,<0@ 00 <0@ `'(08 08p090(Kox(K<0$(Ko<  (Ko@ p-LMH`T X@0 8D0$00>OKp 0KPPP@   ,0 0  (0 ^ 80 -`P(0 SL4p8@P 00$1l00< @0, 00 00C 00$P202L@0080004 -LMS<0 <0GF, 0@,08 `,00 Ǡ0F0R4 p8 @84j:#:zc>0PP*3 S R 00 } ```0F  0P"0X$0= @00C 00 市`P2p$<\ (K, 810\0S 00  0B@P4P  0 0B$@Bp -L MP`%8 0+p 0<0 ,8@P, } P $4 0D4 $2 <0 $084 ^080,000   ,K@;,0P , h0440<0@ % 10<@ 0, 0 0 $`0L!,PD10L@0,0,0, ,0 , 02,0, $`04 08lBpt2  B l—0p \0S <2S  (KP@ TP0 H0 ,! ;,8(0$CMb 0-LMHPT 08 B00K0 0K!P  ,0 0  (  ^ @8 -LMP0@= `Z0 p ;80 S9 P2 pW4[ P, Q 8 0 40Q # 800 0S00 00W#$$$$@ +D(KP 100 P1 00000 @ , <00  PP , R  P 8 (" , , D0r00 (Ko$000(KoKdC|CCCCC-0 =\ $ 0 xt0| h $ -LM=BT (KX20X2t084X4H40 0HU)Z P& $`V 0SS P0hj0S 0C0b20000#>80 s2Z P40S`  4P$0U00 W 0SSQ 3N 4 @00b@0 L, 0 倐3. 0 p#> 00Y R00`V,0@ 1@*C6"*0S8# 00V,00,0 3 Y@ 0L0@T ;0 R8S?X20CX2Z$pW@$0S 4 00lB pt2  B l˜p 0\80S 0 000@ <0S800@ R08 -$HLT H0S$8>0(8 Ae @P 0-@|LPP qPPK0 -L4M⨚ , 0p="R =,+ )0*T d<0@ %0& P('$Ry .0:R <R R R 0lB pt2  B l—p <\00!@ w, 0R$(K Rk  R z`9R 0RU80R _(9R 0R 0 R H9R} RV8VUlB t2p  B l—!pP ,0 L#Ġ# XK WKVKU@KX0KV8V!0NPPS񟗆X$$4%$t$t$t$t$t$|$t$t$t$t$t$t$t$D&$&$%$x%$$$7R RmU000zx7Ru 0Rr 0sRn 0o7RWVU8VR!0NPPSL$$#$t$#$t$t$t$"$t$t$t$t$t$t$t$t$t$t$t$t$t$t$t$t$t$t$t$t$t$$^Ǖ= 0=lB pt2  B l—p <\)lB pt2  B l—p 0\@d=^l— pt2   l2p , @TlB pt2  B l—p 0\lB pt2  B l—p 0\lB pt2  B l—p 0\lB pt2  B l—p 6\l— pt2  B l2 p, HlB pt2  B l—p 0\lB pt2  B l—p 7\lB pt2  B l—p 7\lB pt2  B l—p 8\lB pt2  B l—p 8\8l— pt2   l2pH ,T`K@( ᒛ8 R0K$40#  $<@Q KO0KP@Kl— pt2   l2L p,P 0  @P ! 0 0R@1@!  T0K]^ 0N4S= S* SH(U@1@# H8 C4  0?U00U  >U0 0 U 0R0* R# R   U`1 `#@f TP1 P#p@e T@# x P \ .  $o#  #CCD=@CCC@ -L@P 0h2 -LMplBP t2  B l2pP ,Z8 <0 @1pCWp!>W"@T`l• pt2  B l2 p,/.00 b` T!0,!@W 0 0 m 0-=2LSP 0?,@E0h -LMPP "R pWO 0``c00v[ VlB pt2  B l•A0p \4` X2\"0 X2\"|smW@IX2V0CX2 lB pt2  B l•p 0\4 04 l• pt2   l2p ,` "p0=2l• pt2  B l2 p,"`,h@`}lB pt2  B l•p 0\li`X80X8 P`y $X(T`0X8qD@@@@ 0-LMlBP pt2  B l•p ,488h -LM`0Vp0P`VJ=2 SlBt2p l•p ,4 0S 00h -0 L=2S<2S 0-LP1P@0YT0 -LMP40, =Z 40 000 p8@`P) 0 &$ 170<0@ ,0 00C  0"`$PL@0,08`090<2S(K a( -L@P 0h -LM@P ` =2S  $K0 40< ?@0(K8p(P060( 060(202( 0(0 $Lpq(0W   $P(0 S00( 8090lBpt2 l–0p \0S <2S <2S P@~ ($0 0 ,!$CMb -L@LP 0hv 0-0L P@=2S 0P<2S00 -L@'P 0h P =2S<2S  -LMp0  R0 0 R0>0/8 $(8 80 P (Kx2|" ,];[04]P I 090SP < 090IP0 0@9P02>U 0 .P@50E?01P E 0R904 0 @RJ1?P5|@TZv sp8  3 2 \!l—Ppt2 P l2p ,l—@pt2 P l2p4 ,l—pt2 `P l2pH ,0 l—pt2 P l2pL , L, 4@ gdlBpt2 P l— 40p\dlBpt2 P l—p 0\@ l—pt2  l2p ,@ T @P@T ]l—pt2  x2l— |,00 p\lBpt2  l—$0p \lBpt2  l— $0p( \lBpt2  l—p 3\lBpt2  l2p ,lRp t2O  4l—0@0p \lBpt2  l2p8 ,l—Y %Ypt2@a  FN.B Bl— c0#1A80p4 \lBpt2  h"`l—1p@ \lBpt2  0l—:pH \lBpt2  l—P 8p\ lBpt2  l—pH 00\lBpt2  l—,0pL \0@ i Pb l—`pt2 ` l2pH ,@ T0@T 004 PH LHclRpt2 ` l—4p1 \lBpt2 P l—p 40\0C`@@%I$PC4+$ -LMl`ppt2 p l2p , H P81S[ l–pt2 p l2p ,lBpt2P p l–0p \@ l–ppt2 p l2p ,@dTP ,lBpt2p l–p 1\lBpt2 p l–p 1\  D lBpt2 p l–p 1\t@ p-LMP l• pt2  B l2p ,d B`0 @`0P T < 0`2xV0`2x@<@@@@ -LM0A`SE$E$lA$ A$A$P2lB pt2P  B l–p 0\<2l0<2ppt2 p x2l– |,00 p\lBpt2 p l–$0p \lBpt2 p $l–0p( \P8S LHT lRpt2 p l–@@0 p\ lRpt2 p l–@0p \lBpt2 p l2p8 ,l–TH pt2Pp  10CN>C 0Cl–0b "!HQ0p4 \lBpt2 p T8L! l–p1@ \lBpt2 p l2pH ,lBPpt2 p l–p:H \lBpt2 p l–P 8p\h lBpt2 p l–0pH \2V <2 0CL(<2T(P(i31<2l–0<2ppt2 Pp l2p ,LHT lBpt2 p l–0p \2 <20C<2|PP0=2l–Lpt2 p l2p ,l–Ppt2 p l2p4 , TlBpt2 p P(l–`00p \l–pt2 p l2p ,@%I$0U0U 1303 22a0S106SH0H064 010 0-Ql2x"@P@L p,l”x"*0 p:\00 =2S 0 &6D0 0-@LP6S\0&\0`0V`@0hJ 0-PL@640F0h> -`LQPp 4@T0004 L00 R0S R06 0 -L@P 0h p-0L P\` 0S @R60 0 @ 00<php -@LTp`; 0S8 `PU# 0 0l0t\0\0\0S `Pd@TQ d@T Q`d@TQY000x&\01x2 x0]\0S @ -@P0Lp8@0`0C@0 R 0S R06 0 hz -@T`Lp\D 0)\@0P0 ;0C  80 0 , $(\LpC 0\Q 0Ph p-T`@PL\ 0D0 D0T\0HPD@D0 SH@P0\000ph 0- L$0PS0$000@10h -0LSS`3 0 00S8 @T1 Pp4 <D 0 0S P%40S %%88 8pc4@T@p +%20# 0 000i"888S@P @000SO$|O$tO$lO$@T% pPtl 0r40U01#.#8*"*8 #Ƞ00PpP40Sd@T00$@ p-0L`PCT0S@c0D000C! `0(p 0-=2LSP 0@0hc 0-0L @Q 00S P tl 0  1S RP.0h0h'Q0hX@ -0LS8 p 0D<  0$ PW@S4PW D<@ 0D`0 &888 D  0mP0hmmx|@0 00S -`L0Pp="RC0 00 @0!9000Ph{i\  1R11d\X0@6 t 0@00 iD?p@P~hHi@@ -LMP(l2x"p ,!BP x0S QE\P*(0KPk~p`4(0$, 3  h (0Kl0p@t6S\06\ ` ^``pV\ R`0`0`0 \ y3lt 00x0\0`0d0, KP -LMF`T V@4064 V3040K?*$0KPPP@p$0 P,@ 8$0K<0@@DP6*U40@& -LM<`@@,Pp@  S0 2-6-0G4 0 T>\0< 80 ,   {p3, 00<S4 !4 0PP^ Z00< b`>8 00c S@1`301 :J$JJd U@``V00, RP <bP7 8:#: \ &0^ 0004 S804E I 0TP40140 V, R ,` D<4 0 p P(K0<90D04 , 0P -LMp`(0 S0S 0S @R06 0 @0 0<00 K0.S 0!C60,ʠ 804 0080 80Q4  4 M00PU< 0P*@0, R00@`>  0^$0ʌ@ D P 0 $ 040$0D0, 0(,  $::5 0%(0 ,0   <,0, S @}(K1914 0d0 D @0S<l2x" p,2P0C" D0 00C3 R PS0Q<Q&@ R@@F\D 2 @ 0S00h01&0\0&\0xS`0`02Pc <0dTDD @0<0@0@00嘠60&@p$@<2S() @X@ -L@aPh -LMP0`="R @  K0  4p0 < $K(K? P@P @(0$ 0 $0S <2S 00& 6@P@P<2S @P@. }$ -L@P 0h -LMP0`="R @  K0  4p0 < $K(K? P*@P @&(0$ 0 $0S <2S 00& 6@P@<2S P@ &1}$ -L@P 0h 0-0L P@=2S 0P<2S00 -L@P 0h p-PQL`@p_-U 000ESQ 000 0ASQ0pp -LL0M , 0p="R 1,+ )0*T d<0@ %0& ('$RD9Rl 19R Hڣ R 9R 09R00@_FP, 0R9(KL9R R R RTӼF 0A?CR< "8R, RU0008R T`K( j6 R0Kl—p, 007 0P0KQKO KP 0  @0P0 00S@1@!  TK>V ڸ6VUx"l—1@  p,5  A4 XKW0K6 SL4 XK U0KVK  R 85R 0TFǕ 05R 0Rr 6 (< 0t |0x@0e ܙ@P}$ A-LQ$$$$$PPLP0=2<2l˜0<2px"P,lB00px"\@dT l2x" p, @ <20C<2<20<2l2p ,\2l˜x",2 0p\&l˜P0x"0 p\l2pb@xR \p, 08 10l˜x"@ p0\@dT4 /l2x" p, @l˜x"6p \2<20C<2iiPl˜p 0\`\@ @ 0-@LPP qPPn~K0 0-=2LSPX20QX2 @T|2 6S n6SX20CX20 06B -l2Lp $l™xp ,l2p ,b0`2 1PZl2px", Pꐅ$$ $$<2奯 * 0P@0"0R2 2 !Q l™,0x"0 p\e じP  t#j>060 H07 ` @40&@T P? l™p 0\ ;2<2@:!0=C 0Lp@Dp @@@\TD ;0C`@0P1T*pD 0 P@PD PPLp\TT"P@Ue:@TP!0  @P P :0@00 ?0C 000LT\H@D@D 0hFl™P0x"0p \ n m囘l2pb@xR \p, 08 10l™x"0@ p\dZk l2x" p, l™x"6 p\K "P001"P\C @O$ @ p-T0L@`TP @T :S  @Tpso -04 10@LP  >00x*R90  q0@-P( HT X) 0!"4# 8̓ \0S \0S  RJTPP \0SX00 P Pp0: p0C*:p0: _0C*:0p30 P  0 0@-Q 9Sd$H$,$$d$0@9I )Q 0@ 9I) 0@ 9I)0@ 9I)9S < -bLV@pȐ\P RU00S ʜ\PQ 0P'S% 0QX 0! "4#8<V+*9X ",0( 4;2( +>`P %VX ",0( 4;2( +>$0"` %405 6478`:p ?;P L<$+4"2X)540674 8<2X)! 0"#4 8̃ˆX405 6478;P8p 4 ? 4 8\,Q0P , 8K00K0S@P`P`D0 @@ DKB2MP`0 K ?c`XW? X -L^P`p@ P@X) 0!"4# 8<^P@+ $" "202 0-X@ 0 9PL)p $09l#R 0 㤤lp30̊$ 0-LP@@T0@ 0-@LP 0 0 9@)0h -@8LP R000<0 0 8P0,000$0(0 0-PLhIT R0009 0  0 -Lɐ`p0P$ 0 0`0=00000090000p匀@@ 0<@H08@4:8 000,0\  D ` p l00l0r -0.@L 0lP hP%0@ -L M0 4 X, 04 8 P , 0S ,0 S S] SA p0,(Kp0 08< 044 @0 0@, 04``p4 `00p` pX998< =>@ $?:P(; W ,0 04804@V0 :0*:1 0C*:,0 0@ p,H`P0@pDP0` p0@ L#D <P`0@(!(Dp#L440@"@p@\@ 0-L MX@! 0Y"4#8 0 K00SPڀɔ0X R1X R0K! 00P000SU\p 0(ɄK0p 0@@ 0-PL@00P4@T0@ p-@LP`h0S @00 000 < <0P< phE @ 0-@LPh0S 5t<"8 0P80< 0D@ 0-LMP~@# 00  0   p (00(0 ,00,0$00$0K04 | ]@d@ 0 -L4 8<SL@ 0-0LHPT JT XX  !P00P lQp0p0p0:lp0*R *R lQp0p0p0:lp0 *R*R lQp0p0p0:lp0*R P㧒P Q00090)R P㓒 -L@h -@L R 0S0S PP  0S00m R0  00so 0-@PL YU 0)9  @2)>0 9Y   @)2@29 P R0 p-dPL `R@ 0S0S  R  PP00ppso -LXM@ %@,  0D P`p0 %4 8 < @ @0 4P `p$8, (<4@,@0D8,(K@ 0-LP(0U@  ?0hǑ<@ @ @ 0-XILPL @N!08 H 0 48  0@P:TJ 0Sp0 Qi 0Rp0 Q@ p-0 LPsP3@N0`l9L:UH D0 20l#PP0l9ᔿ:pP@C -*ML 0 0SR ! -L@M܀0P$0  `R00p- $ 0R$ K^@K:cW [ 0 Z0KW K[K^pK]pK\KX @VKX HNKX X>K: $o= -1L MP U$ . ,@K1 P$ xW! hiV#`V P0 48<S@@T (T P < $ 0R KzW ro$op= -LMp)(0! *@@"`+P 48#\, @ n 21C0a1 @ ,  P0 48Q Q QD H  0 $ (,   048 <   tPa0 48<@(0) *4+8<SL, 0RM(KO0 0 PP0   㑏0 $ (, BM 048<#,##Ƞ 00 $(,0"̠""N 800PPPW00PPPz $o@@= -LM Xy@W ßd9 "10 0 0 8P $̠$$$H  @ 0 P$ (< L  "\!4!!̠""HP 0@00  !" 4#`800 00 9(KDh 0X08(0Ct@ @D@ 0-L@㯽PP 0p90h@ -L M4 XYUp, m00a 0 0 /0C 0 B0C` 0 B<0C 0 ` ` `4 !L`9' 040'a)(Ƞ 4 b90 0'4c)!000(0C "#567@0`1`2`03` p4``````````040|YU0@ :  p`D PU# 0 (0,@X h -0 8,H 0$ (0W TPU4 |9S  0`4p0S0 @49I)(KV`p(`0@S 0 @(! 0-QP`*!d*  !*!* * @Lpt*lJ\JXJhJxJ|JJJJ! CU cU U 0U U U0-00b!0h,000$$$$,%$$t$$$$$ -`PL: d:pS PX P\ PhIT PPU@1S10 $8S V:*R:::8*: QhÌ -pQL @T `0T`SP w0` t`]㧌U@00r p-@PLPC 9`S*U4(0P:&l9S  p9S 0 3 1Cֹ#PQ T Pjph\090 D 弹9SU A 0p@C@ -L@8 P -|ILT p@T `hP P  0< @pTW m@(0 S-$0@L"l9S L:S h蠸 p- L0410T`Ut@H t9S X)p f:S0(0ph00`00%SI 5S@ +(S *SPp*M00(0 S S SP P"S S SS S SPPPP @@ -@L l9S L:S h -LP`@Vp (0S0(0(0:S P% :S$l0S! Tl Rp0p0p0:l p0 4P (0S 00 0:S h$ L4 0 ṷ8@ -LM$ 00R:T @ 0 K0$ p-L@P咺`ph p-@PLn `0l0*lp PL:ʄ0CL:ph˼ -@PL YU y@ Lz < ,0 W :*Z ZZ `08 80< `WtP p-n `PL᥼JT lQp0p0p0:lp L:0L:ၼp<0S8<0] --LM K00,< 0H- K -L@P , P  X@x@ -HLTp` +^JT X p Ph:S +^ @ -HLTp oJT X p PPX9 t P PP|o @ - 1LM` pP( @`0o/K\@rP ( 0R)$K_K 1 S h b0$0K 0RSJ/K 0``p` @p@`pW`p$Vr$oedA@= -@L`p  PPX v d)R_ |) R 9 Rd9"100PV| P Q0|9  0S00Q| | V#ڀ9PP 0 S0 S RQ  PU | 9PPU|| P 9 P2T!   {P\ (C@@ --LM K00,< 0+ K --LM K00,< 0+ K 0-00LS@P HD0  lPf P P01kp -LMS8# 0 8,K 2]P`XI 0ؐK:0 . 0h0 0, 0 0 P` Lp 00 H D P P P l0 0l00 r &90 + 0 S ?04X@ `p XP1X#\   ?04X@@,PY(K 00P@K00@@rH@ @ -L,Mh$V0,0 . +^jV* X p P4K U4@T@T  pPP (0 @  /P h@+^  P@8T, 0R5(K @ &X)04 8 0S> X)0,0 p h0㸳 Q@ @8 R 0 S@RlQQ 8 R 0 S@RlQT 0 PxY,h f0(Ko腅0S*~4P@ᘅ <&\ $P2"0CR202 0S00Ƀ^ᶲt@@C@@V -LMe\pK 0, ~PP P  d@, 0R(K  8@,O}KW@P @U 0kP TP@ 0 kT.K0@kP 1 S  t02(K (RQ 0 @ 0ikTW/K 4"  @  ! 2  "<K@K  !  ^ \1`02 hK"00B@(,"042 B<K8 H0 i@X@ /m0a 0 0 0 /0C B0 0C B0 <K     = B1#4!2 1",,(##Ƞ0702>? ;90: =!"#0123456![8 1[ <0@=!1H0!X tтXdɀɀL %h  " 2|9gP"O1"R' 0S0202@X PfcZ ^t  Q S@ ‰$o@@8@=T@redA@@(@0@x@8@ @ 0-@1L PR "RE HT P0S J0T0R R R 0 0hY|)R \0S \0S R`w0 pP X)p f00h*@@@ -L8M0pXK@`P 0( dɔ\048 L1 $(T\ 6( 0Rc$K"1   P d X1U8@K `0` P 0 4 8,R* R R 004 80 0 @00 @ @ @Xh 04 8,P00 $ $omarc@C@CRAM0 @ @8@= -LPvM0,0 ! %((0"4#2r 40  $yK{UP l ! Xß, 0R(K@ß@ 0!iP RR.K0iPcŸ 0i@P=R1 S  ,`P  &P !>KdIA 1 1K01 <Qp_ 0S%40$ $yK! UPK 0hP@0 @PH048 1 $(Y |!0 hQX 0hQrDS@1ZL K 0 0P$ 0 hQ{VR vN0B  (▀@ 㑀 U100 $0@$ox @redA marc(=CRAM @!@\@ @ -LM0  80 lpd "10!P040 Q|iV0` + 0㨀00 ,0  0 \ 4P0\X0048 L1 $(T\ `V X0S\`VY 0(K0U \ 0P,\ \ 0\0 4 . 8X 0,0 000 CmarcCRAM -L0M0RX ,0 `S RpT @ T0|900| APt0\@X0, LK 0PKSP4!P0 gP2 hP0 `0 0S @00$@S p TqT  XpW@d, 0TR(KT0P T 40T0 PPT  $orC@!@D= -L0MOp \, P T0 F oPQ8  0 c0h9| 㟹PT r ?Pg/0| #18#hV*@ P@VP# P L@K 0 ,  w`  =P `Q, 0RE(K  "pd 7 " P2 P PPp@ P! X)540647/8 <S /` *` %`  `^? I2Xʘ0\`9 9I @ P0  )9P R0 I0:(+*8``P@( X 0 4 80P 0#,##8  0X" 048 <  " "4"Ƞ 0 @ t9S  (3#x 0@@ T0 TU T *  1A p Ꮑ`P ``TQP`P0S`9V X) p X)0WhIT |:S P @T\ʘ\i  T0 Pa `;#V#`F hN` XI`X `<@  >}X | hpO lP9`SQ 0:X `@ p lQX) p ` |, 4S PX @p0SP&$<$$$301 20@X  p X9p0 J(2P  0X) p ~|Pp PX  X9 p0l X $o h!@!@"@!@p!@!@T=p"@0$d$|#@"@"@4"@!@"@#@d#@#@#@8#@̓$#@ -P4LȌ?; ,H  P ,#LK09=8< >:; $? (H3 L \(@,P, 09=@8<>Č?:;P|H Ȍl0`4p ,H3 8H HLH H0LHO0X0|L"RE 0SH0L202|(XP( s8< 2K 0s0S    P 00h0  CR @#00D3  @0 QPZ2Q80L@K0C80L 0L 0L@a@1 r! 0X @P @DX3 0|Sl : $Z 0@1 r0@嚀P`p@ČDȌ,$Z 80R L#( 1@6K0p 16K   ` 0CSv PL4@C|L< 2K0L9|<# <# XYY8cP@XpT $PPuzrzU@lz`W4P @$PPaz^zU@$CT $PPSzPzU@0Q0C 0#@CzT@3S ;zD\ 5zP, 0<R?(K4Q @   P0h0 $@T   PP X 0SB*KL3Ds @s 83S# `< $?(<L  %P\ X A P , 0RZ(KL@K @X0X #?`@9 8p ᔑ唁ČȌ/0P:̌p ! ; a唡! /T`X 0Ol|O a  .K p 夜q ȁ b?KKAsSO<@  !  ʃ|kK  ഑ 尡 mKcP\  |Q xa X ڀ!LxX Z*|Y{& 0 ATbK~KpWP`P`B2MP`.K ec0`Ap QX ` `p p8a 4q sᩌ( $ 剓0 , \ (|!Q Php@Q Ha DQ Q @h ?$(Yt p [K]KpWP`P`B2MP`]/K Rdc@`(!\|Q0T0R Z  0 PV\A 嘡9S@ N?K0@81 4A ~KP`0PU`@p0q , JK( $ x V<ژX9X) 0!"4# 8̓  0X R_ 1X RY  QPIXQ u$axqVꘁ們X)p 8$|| U(|!Qy$1xASu少 !""4  ",H1 @ < D! kXY@l0  ߣ!ꀡ|W1AX)p @ pQU0$oh%@%@&@ &@0&@%@%@ -LXMd 00K\0 @h#X@ P\P`XI`` ! 0"#48] \<P`^Čp80<@ Ki&@ 0- @0L,(0 :0 9 0\*X:&@ %%%@-X)@ 0!"#48 <9 -,0LS@P` 0(00  X |pDh0S ppPX8p 0 0 (0  &@&@&@ -L$M0K$"`+P=X)0K0P 48<@0 ,  .  8   0XY@y40 !0 "# ,_00@1X R#X y 1X R02I *(KXY 0! "#48Q8 =02A 0O0 K  }P  80Y! 0"4#4 8<S 4 X)p '@('@T&@ 0-L MXI! 0Y"4#8 0 K00SPڀɞ0X RO1X RK0K! 00P000S/ S 0S$0S,0S> U%%%(% %%\0<' \Ɏ$ K0\0<&p 0\0<\0< p 0,L 0  ҭ @@$H'@ -LMP@`()q0X@T) T %% %%% %<%V V l)0X)p 0PV0X`t0p9 0 T 呭 KiN0FSV ViV V@@$ M-L0R TKX9',&&Ƞ&'D'X? 9:;=@>P8`@ XBd K QHQP^@K`pK X9T P lK H0TKXY( fb d K &_| x 0S @d K P 0_d K x R0 S\ X0  |K| x  T@K0 PE06NPU>E DKT p t0##8 K 0 )|0k1 X Rw \  (KL XLKX0S JpP D ]| 0`` pfP\ 0 pZPD00| 0 K`Pp\ 0 `<PL K  R 0L H0  v 0K0 @0 @ D@@D@ p t 0 ##zdK\ X V02* |KMD `\`p| \ 02 Dˠ Pg` `WdVAV  D@|0 @P MP   0 0 0Ex\|R6PU 0 0@ 00l 4匐l*p :P YN'@'@'@'@ 0-L MX@! 0Y"4#8 0 K00SPڀɔ0X RM1X RI0K! 00P00 R$ @R 0S$0SR4U %%%%%%%%&%%%\0<&p 0h\0<' ɄK0\0<%\0<p 0 IG(@@H'@ -LMP@`w9q0X@T( T &%L'%&%'%&%&%'%V V Ở)0X)p 0\PVX`t0p9 0 $  Ki螞V4(@$ -X9@] \L^_  p t&@ M-L0RP KX)0_^0\]XPE] \0^_4 8<40c@ o1v,#\@$,##Ƞ$d$x? 9:;P=`>p80<@Khh(@ Q-L@ t l0 t:09\0  B)\:L L0X*x:D D0*:< <0*p:0 (@$%'%'%%%t%%X&%(@-0 4 8<S, -LM X ?P@ D0HL`P0 0@ /P 0   { (K000 0@H0X)p KT0 0(0T&@ -800 P`p@8`Lʠ`(  (0@(@h讠 p-h0LS` 8@T P@Tph(@ 0-4 (08PS 0L(0,@ႝ0 p-(04`SL8P 0 ( @nphg p-`0LP 0mnTXp3 ^P@0@pPqP\$@T R000(0 0 <PZ0 R 40800[ ?  5"2H0"X j48Xy01`d99  hɆj   |( j @ 8j00!   08   B\h90X)h)(0*+48 <0# #Ġ#+)*(0-PY AjV@ P:j7j@W 1j\L KPZ %j$or$)@edA@@@<)@(@0@)@8@ =@ -LFM@`KO_Kp@1 , @K\} ጃᾃ @!  ĭpm\j, 0R(K呤$o= -LzM@`TpP@K zO K肏K,pPU @ @pU@ -LM ,( h9i)Pj 4k8|WN@ P`?< L#?1SDOpP3400  D0 %`P P0U|r@8@ VB K QFQP)R봐`X9pPKK l h lK KQ t p p(` ̂Y ʁ K NRH K  GR8KX 80K0 @ P Uʳ 0K@  Yʣ 0K@  P l0K EP6NU>E ;|0 x ? X \@0##@ K D0 SDڴ`@   1X R02 X R PU  @D  RN P Q ! `Mp)90 KTt tD^&`@P\ | K ` X t@K00TPˠ PPD@_\ dKt0KQ d `   PK`P`P ` T``T` H0SP  tP tpP} L8@P uTt 0Tt "| K PPtPK```K` @pPW| K tPK`` @psPG`| K ` @`dP8tKT  | K  QP%t0K| K @p@  @>PtPK``| K `` @+PY \f  (KY@ R0S@ PU`V@\5 X%Y#0dQzdKt p uX \P0##@@P P@ P zH^ P`@P ` tK| K T H@TP`@P ` P )  0 0 00X`W^OFKrp@0rpt T%tPK`| K `T`ˠ  @@@`pPiD\`0@X ( P* \- ; 0t0KT@S   @G| K  pPD`D0O\ʗH^X Y PPU \^@K0@ ŸP 0@$ p t Tt@K0| K ```T`0 [ P`p(P Pt@K00| K P `PPD`VL`0@X- ^/ Q2 PU5 tK+T0 !0000 | K P`DP0OUH\XY ^P Q R PU\HPH\H^*㝑븀X 0 0@ 00l 4崐l*p :帠ߐ y(Yr)@D*@@*@L*@wo)@*@'@ -L MXɐP! 0i"4#8L8 K00STڀ 0X RM1X RI0K! 00T08 R- 0DR࠳ 0S,pWT4V _%_%_%`%$`%_%^0>& p 0^0>' K^0> ^0>p 0H@T `9`X T(@@t*@*@*@ -LMP@`9q0X@T( T a%a%(a%Xa%(a%(a%Xa%V V %)0X)p 0\PVX`t0p9 0 $ K KiV4(@$ -X9@] \L^_  &pHwX) 0!"#4 8<0S039t&@ M-L0RP UKX)0_^0\]XPE] \0^_4 8<40c@ o1v,#\@$,##Ƞ$d$x? 9:;P=`>p80<@Kh*@ -L@00 T6P0  H t:09\*808 X:x*000 :*(0( :p**@^%Pb%Tb%J%P%N%N%`%@-X)@ 0!"#48 <29 -LLM` 00K\0 @#X@ P\ X)! 0"#4 8<4  D @  ?< 80 ,00 @@4;T$P0 T a\0P@ 0 dkVTn 0L H0 TKpP0S[W \L0 X 0X$(^ ,K &X y908 :=<;`$>0(?P ČȌ<L "l!4!Ƞ!"D"X Z?`90:;=@>P8< (Ko&@ 0- @0L,(0 :0 9 0\*X:*@(d%$d%g% -LM  0`\&m% -LM) 0`\&m% -eL`Pp< (00p04S80,0d0804p 00 , 0@07< w&((0"4#220&$ 04 O 0iQRC*@*@WEVm% -P L d&@ pP` 1TI t1T) *`ᐛT1T* L1Te/\J`,10S ` 0 `P `P0T$ 0 00" 0`0 e^@ 0be/]\^ 0U %40$ ( Q`krdAhdsd edAk~gdm% -DL!88#!墠P1 弟p" D0020p(P00`4Q!<00@aT@!0   HI<00d@0㝍@ K o0 <+0400 @⌍@ :oH IkCC 8 8-#TLL%pM`P 0@o gĚk 8 8-#L@(/PPp 0`RpP ᩚ0S  0ğp=0 pPk -L@嫤0ݤn%0L00H -p`0L ]P$  ]@P P00 `(Pp 0ᢾP,0X@P00 @8 i屿寿kLkk+@p+@ +@800S SP 0Sk -0L -L@\p``h蕾# 10 0 P 0+W h@+@d+@ 0-PL@0 00h -- LM K00, 0 K -- LM K00, 0 K -- LM K00, 0 K 0-@0L@PT@T P0k 0-`0L PRT  0@ST000@\T 0k 0-PL@ \P 0 @ P00S0 0 0k -LM q 1@T  P0 1T, %0T( 0T% @0T*0CT*0T0`K 0@PP@ 0RKp0T h0TP  @80T @($o'B&B"B!B$BB B(B%B\= 0 0 xklkpktk 88#4 P00lkPკ0 Rxk -@L㎋4 R00 0S00hڊ|k -1Ls@ $080q 00@NJk|k -pL0PS\\\0`@ L 0?V0C0塊xktkpk 0-LMDP00@K0 P  0R0K0N$olkh= A-L 0 R lxk|k -LMp0PS  @ 0RK8`K0HD 弈PP u# $opkl+@x= -ĠLp@W `P L @?V@W00 h͇d3X0 R L垼@ ,0?S?0C00幇xkpkpk|klkt+@tk -LMD@0 ( $K,0  ,K 0RK帕$o= -LMD@0 ( $K,0  ,K 0RK埕$o= -QLMK 0K 0SB$  p-LMPK@` .TCJ |4QZT00V0S 10C x 00(k80 P0S0SP,k@ P P 0S00,,k+@ -H L@T00 ((0 R00@(k$kho+@ p-L`P@P @phP , P @``00p ph+@,k+@r -`@L0S P@T <߻0 ,ٻ@Thһ,k+@ ,@l( @+@ -@L ;hj 0-DPL0S 40@T  )@T0000k,k p-L`zPP @0 0` @0!# p叻+@ 0-XPL0SH0@T  #@T0000k,k0@-\P@ 0R R R  0R RT@@\0@0@0 Hk -LM l(0Q 64 pг@,@ p-`LQ 0R p 0 S0\ P  \ 0S@@PP   \ ph pa0 -LL X -LLH -L L H -I LL -LLI - LK -L P -LhMa0@K 0 Pp˺ 0RMK@p P& @lPK1@0 T0\0X 0 T0P 0 L0H 0 lK@ <K0@ 嚺lPKP@@ n P 卺O vP @a P  TH~@ Tʺ,匓4 r4 $o4,@г@4@D,@=X,@ P-L a# 0P蚟TA|ol(?dl(Q0 W\rl( Fl(C fQU$l( fQ0l( fQ]0l( 0fQ(0pl( * 0fQh4pl(* fQ#l( p-<` @fRPPTL  $@TpX4pl( fQ$l(l(Wl( fQ1l( -LQ @ , Ql,@Hk -LM`r0`@ 0 P# PP P 4Ź 0RpKTH PK DP7 P1  @T; P k !0@ 0K\ 0K0   h1 R`1T1X!P!@10!0~@ $z< @ 00@@J P ) @KKUP00  00@@ 8 P  00 0qxc) P hH K2PL@ yKx $o4@PPg 0@^SD嬵 0H@K 0p SpP  哵G   劵>  0@^SP2p/-t h lrh0`* `l0gP8y$oX/@ @pod/@l/@|/@ @P/@/@t/@l(,/@lo= 0-0LSP@t   0hx Lk -L@P P P P P# P P3 P& 0 0 0  P 0 |0 lP  P D P 0otoho  Z a0@S( K$ \R0S  0S0SQ+0@a$0Lx U TA00 01 偳(KP0SK }1 r` |!0S PPB`aTU Up0K8 0@ A00cP H 0 7,U`&0S@  @ 0a0C0S0@SV P0P000 R  a0B0S(0K +00B R0:S 0:S_0PE$0L000C SP0 ZWꄇoo/@kP% 0-@QLPJ @TZ0 Q-L`ሀp@00fT*P 00fS 0c00f000f0,o0o p-@@@`08PcL0`000p,o0o4o 0-@QLPJr @TZ0 0@-L@~S~t%%%%%T%%%%%`%%%|%%ԧ%%%%ئ%8%%D%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%xx6 Q 0@^S)\V Q0q0 R:@0 00 `P0aU 0R 0 0CR0:E%0S 00C0x5l%0Q*LU@0Q* 0 RE5 Q* 0004$0Qd帄0\ᔔ $0ST t吤T000 0 S\4T00S0  0 0 @04#0S*cC3Q`3 be#C0 0Sn0RR0B B  0S 0S S0R SU K 0RLRr 0Gb 0SQ P000B Q6br00CS0吢% G"8:|R0B0 S C R0!H"010Q? 0$RC 0 0R "p쑟000 0 1R R 1 1`1蠡 G0000R010 0QH L!<000 0 41R R0 0R0 0p Đ P* Q% 0Sp0PQ 0S|0\^0SRL0 @N 0o(o,o4okkkok/@o -P@L@PpP`P0P @D@PPP P  00`4o0o(o,o0 00ḗo8oo4 P00 0 Q4#5k8oo0k0k -L 000kk -Lt T8 !0@]S@00@ SE0P03P0cp0 QR`TWpD@T7pD0u" @/TA DaDU9070S0pDU A D00DR Sa0D_TS0oPOPP tPTP P xPXPP 2P@A @a0@SR2\T( 2@P2@U tA @a0@SR@0@_P Q:P\P00 \Tbp P@8I0F0hSp P@:\P_P 0?SC<%0%0%0%0%0%0%0%0%0%0%0%0%0%0%0%0%0%0%0%0%0%0%0%0%0%0%0%0%0%0%0%0%0%%د%Я%ȯ%%0%0%%%%%%%p%h%0%0%0%0%0%0%0%0%0%0%0%0%T%D% %>P V +@<P*@.P @  k0o/@0-: 3:*fA*Q 0, ::,!,,,\V0 !0!"Y!0` 0Ѝoxo|o|=1s s080 080kk; 0: 0Pკ@-44 0@0 0 @* @@臃ok= -LM   0| hDz%o -LpPL@s 0岃, `0P`P`hskk8o 0-PPLMsK< 㙃40 0@0@s8kk8o P0-LP `X,@TR,00 -LMs00p̠`0@(P \(, 堀0,0 ( @ss,K\s P@P\0 0S@0%050%\[s$K>yk okk8ooo -#LM0pŸ @ 00, :Bp PPJs 00 0bC2S0c0S U 2@8P 8< Ts(K`0D"\B"\ s \p 00,0&:#0 1 1b 8 4 @ P`@P`P`}p=8K !\!P@PD` $@qD$A00SA r 0 0c bo"oFS0c aR bV00S0 "^08PP C4PC2P C1P0PPUhr 0XXfP0@0P 04 0K8qEx ookkk8oo -LlM蠟0P`(0 %UpK8K pK8K*wrH*JU@1@#9K g0dPU`<X( 0R$K {$ok|oT= -pLM0lK @,0 P1 ^_KD0 0# 0Q 6r!0S:  @0ց[KJr@  ᪁  r 0pP`<p@ P`xP`p q @` @, 0R (K^_Kp0Sz$o ok8okd= -LP`p  @PP  P@1J# SZpP  00 RA?P PpX 7?{V -@0LP ,0R !hApa0 -p0LP \0R /@ <uz00 hu !pa0%o o|% -LRMh@0T`$0 $ 0RM K  ? TpP1Q$  Q@1J#U YK @ Y@P U/?B Y@PQU@ YK@`-{dPKYOK@D@)@ ᙀ@Py$op=C-0 pR 00P`U%  \00 N @ l3)^Q<0PU TX 0> n1 ^2V UF40H0`1@0P 04 O0!tLt H y\@  ;0S9@0U5:0S\ \ 0S 0S 0S0P R @ R 0@4 R(K0S  R P`0OTS/0 0OR 0 C, l5.)0S#Q 00KtP0 H00@PQ -L4M  $0 0<0 @K;   1KB KTk -L4M0@ $ @K <0 3 K$k 0-L M(0@ P b$p'!0S(0 K0S   00 p $ (0!Z(0 @ F p-0L@`P5 Pl^00l pd h00l pt x000pl0P d0P t000pPl(00l pd h0 t4l/Pd)P 0-@LP~ 0h(3@ p-0L4M"`@l1Ph P 01`l1D P <LK( 0P H0 t  Kp3@k 0-L8M @( ,0 xP!0Kp!H 0@ $ K0[S< L@KLK0L@KH0 0H0 kk p-0LS@P p R R`d P0 <0p`8~P0 S tP 3@3@3@0 <#<0@0  p-0L@ S D&`&h&&|&&&&&&&&&&&&&&&&&&&&&&&&&&&&& 忙"P8#`(0  ("( Q&*0(00 $0 e0b$000p` PB8#`Pp`P\`P0PP`8#$ $0V0$0000p3@@oo -LM0 0P0,0 , (0U@$p0`>*V2S/00@0 S\&h&&&&&&&<&&&&&&&&&&&&&&&&&&&&&&&&&h@`T   0P,0pS(0$p@0`0 0S000 (K`@T (000 $00a$0 `ᐐ@`p@`d0\@`0pd `㰐 "@` pd@@4@oo0@- 0P840 Pp,0 HhPl0l0  ãl l ,00  0 ,l 0,0 (o4@4@4@4@c -LM⌒`$, @p, 0R2(KKt kpP$0 `RP KZ 0 pP@0,00C 00K(p 00pP@00S pP  Kplx x 0 #40SpX8P $0= 0SP p r0 09P / Gq@ZB_P Z ZYOKZ ZKZ ~Kt  ,fs 0KPP v$o=uk p-1LxM1`@P0P@P 1Kp K@P 0K$@ @P00 R0 000 ,00a0   B 1ukro(k(o4@5@ 5@X4p -LM@ pQPD@`00@<000 ) ;<00 8 0@  P H@AP 0S S 0P@`UVP00 ;000 $B Q0BP( 8  0^07<@`0@p P:0p0`007\0 (Piᾋp 0 , -r,O P4@WEV D0s 0s0s(0s 00s 0s0s 0P0" 0s 0PE00CS#&#&#&#&#&#&#&#&#&#&#&#&#&#&#&#&#&#&#&#&#& 00 H000 d1S  0%000ʚ;0@/ - L,5@ -LMPp00匀0CS<0S q x ` 0D0,  K0S@0@`P0s<HB@`_@-_`004`;00_@x _冒H5@0@ 5/0 @// -L@zT -L@oI -L MH@Pd1S p K0 C1 0(K pP (Z( H 00S@ L0S0 S%*㛉0" KP 0S0  R*崈(,p((0S0 S*[ 8Jp<埈"[00b0"[000"[00b02p -L Ƞ,Ƞpp0`0@ SP:@#R D3S PD300C@#D3 IP4S8cP 0 00>P0 h> -<1LM4@pK(1pP@!, @DẺ00B`@ d7W, K P , 0R'(KD| K0x t |@ PIK iPd| K0|@ x t Pp P000 e$oh5@`5@= -LpM40Q|,0   PKA⳹`dA$0h 0 @ 1|0 !x 04 t 0 4p 0F l 0 0S0h0 4 h @ 0d 0LK0`0 0\0  0X0 0T 0P  h  K1 P0`P , 0Rn(K01 P0K0 @=10 @ Q0`K PK` ` ؀ Ȁ 0 P `P0S` 0!00  K 0 =`P000 =`P 0!  0=`P 0! 0100 嘀K  P`P@00TP T   P0P@T P`d$oh5@$= -"LPMx |"d0K, d =PP )D, 0R(Kd0 h Kd PP`@K4  \K[KZKK(4K[ 0D K xRKYPKXPKHP @P , 00 0^nP`U TG*AT1 @f0P  00,80 (KT/*. A.0P @@0 0 Y &400 00< 0S0c<0la0 , LB@>@:@b6@y8[&Z&Y& p-L M@P0`   0K`P0SKp -LMBPBp f(` 0@@P/22 V/*@ @T**0S 0 PP: G(P 0@P  R0S  P @''P -L4M 0 , 3SPp%]P!10C8S1< R (KBB (  0@iP 'E01 1\$ @`L 0 Sj*x  0GP_`\ @0SYt SLPL L 1S D  84 41, 0 S  4@@:P 3\0 @,`K0  P\00SP2S@ H `< @ 4@ 8@ R R7 < 2 S< @ `4@ 8@ RY{  4wRL 3R@P Q: 0R_*21C   0 @@DP a@  @@@DQA L V L 0@ c0  00K4K8KP@0 D0 0 80 1sY Q40000b0a1!1H L0SY D X 1sB Q40000b0a 1! 1D@ 0  0H0 1s0 11s* @0DY0$1  &HD 00" 0D00, 8D! &40!1J40! 1F !10>0>0 1!D0 4K 8K00K90 D {2pkh5@kۣe,Y& -LrMuD, LP  ! 1 P 儀 K*`P @0pW `PS&d00 , 0Rg(K0! 0|`PL0$ 0 0^`P P 0 C`@K 40`PP5[S `C[ BC&PD 0@`PC[Ta !a ^  0S0q.(K !p0>00b>0q 1 ! l`z q0G 0gP p@ DqpP( K10   h !t.  . a0 S1Q>2=12>303h0 5T( 0! 1 1 hKNP Z pD@h0Q q.0C 0b 0pp@Dq  ! !@Rʴ#[Rm0ˠ@1 1 1Q8  @ R ]h l Q!lKR 0c!d d hK d0KA PH\3:h0\d% * d b 00b$1#[0d0 Z!0Q$*"!B00  000 1#[0j1 hd ` /R1$oL=ۣe,Y& -LHM@aD1V@$0 p 8Q$K 0wP P $} K$}Z0d0  0\0 ` 0T0 X  0P L0 *0D0 H  0@ 4 8 <0 0<dK7 ( , 00 92p -L@P @1S<@ -L$M (18 @ `@ 0S` GP 0PSU *0 S   0 S  R:p(K00@ T T@ T T TH@ L@ D@  0T0S' T L  0L0  T LL @T TT D H 08#8;00 0 40  8 0 0c   ,%,K.p,%W0<0 w(1, 0(1,0, $,0 , (00(0, 00CS 0  c00P L0 @(1? 0(1 0$?< +$0 0` Ȍ. qΌ@P 00 `vKp -LM pR`$K0.>0 0`. 0 @P`0 R`P0@ `  0`y`P0S   . . 0`` -LM @R`@" 0:#:S%0:#:S z'zW 2<P @  @ Ȍ PqΌ00p @P K0@ 0-LQ@ P21C 0 P  QP P0\0 ?\"00P0 -0LS`@ p2PC@0 0 000 p@P00R00S p-@P00L? @U""`!B 0P?"`p p-1!1!0@ 00>0>0PL 1/*"`!B ` 10a 0`0PP PPP0P:"!B00` 1 0 10a0P PPpY&0er0Cr -0LHM,0 0@ L0 T0$ ( TK BP T0 {P P $ K@V5@5@5@ -L8MA 0R<0 0 !N0S $0` a1(K *0!@0P0 `PX ,0lx0PUM +0@c 00 0`Cp0K 8@ 0p X/@F 8K80 PKD KP0 L@ Hp P& P 市PU 0- ,04 Kj 4K1@K@``ds0 30K2K0@ <` `F<K (K,哂(w$uo5@ k 6@o 6@46@5@ -`6`LO 0R: `  40KK 0 BQ *xhO@7@ p-L` 00 ;4 00L@WKPPp 0-LM@,0P00xN0S h0XX K0SD R00 0S008hNo0kH7@0k -QLME hp0OO$ Bb!R^V )ڀP@pN21C Pp, (P! PN0S 0xx J0Sd X00N RPpPpU ~~0p=o0k|7@0kl7@P7@ p-@LTP00U00S p0Tʄ 41Cc00CPpH0`$Tp 0@@ cCC -LM\0ϠBl3 1C 0Q   00 R(0 0 0  K KMb?B p-\0LM`PP0PHH0@^ ,0K(P $@ ,` 8KpCoC Co -PbPH0 LS@P RH D O $2L00S/ U 0, FD00CSD01 RGU000,0 0@,00@0UD0 P0!0P00S000iVp,0 7D0,0CSD0000 R/0 0@0 @07LL!0H~~D00CSD0ʳU L0S 000$00 @D$0(@Ha~0 0@0@40 0@408@rkouP0  #1 01 00 l0(0 R 0S00 0$ 0 0W  000X$00 00 0 0S0 00 0>@ -QLlM`  k S&  %0S00S,0S 8Kh@800P  R!00K@0 <@ < 40@ cR=9 =`< <0 3@ A@ Q#43C" cb 0P 00 Z0g0@KAP00  0(K0倐Kt0 xP Wx0K0H $0P0  ( 00C0W= @ R 0 0 00  0Y g ( 18 001 C 09 (0 0(0 00C0ZpGP,>  >0S000 zWP儠x Rt0t0 0t00 >Z .80 P(00(0  B 00 0 @(00(0  B =80 h >=0W. _ 2 ! $l0 gb0 0R( 43C" cb 8K?, 400 80P=9@ =C0 , 0 ,0 00 ,0 0 @K= 4 ,0R  3 s00  0#SP =@ Mb7@QC?B -LM0PA8`|ZszJ 3Zu 0S} opP - 00 040P@#(*80AT#@T 0S!0S 0,0 , 80  ,W 00CS 09 p0 T^ 0,0 0 0$0 =80` P'+=  (0 =(00(0=  (0 =(0P R0(0- = O  (00(0M<Pp@ @ .4.0AT@T 0^0S1ASp/gP  4p8`0,0 0  @00P p   ;r0ko p-LM,`2PS S PKp 1:0$@2K1,K , $` @ 2KP( `0 041( [? ( R 0S000(0 -L$Mp@ ZP<  0S 080 8(K 00 0P 4@K dP8 <  00CS 0< @< Q$G$0D0 Q 2 ! D, DP8 ,\%P`2A"@$@@*" P`  0S3 920  0 0 B 0 ,P\  !0l  S Y@ <  00CS 0 0 ,K8 ,0@ 08 <  -LM`p,@$K( KPlU  K$0 $0 $0t  lf@P$0$(004 R4P$ `(00(0$ 00CS 0$(0kDo -<@L{D 00C00k p-0LM `Q #0000Ϡ! KNl# !B A31C01 0 1P 01   @(B]D<@Kp0k0kMbt& -LM( 0 0@ 0(  10T0Ϡ!KNl# !B A31C010  <1DK|Mb 0-L@PP( ,^%00U  0S TP14P 08#8 1 10:  1(00(@0 00  r 0-@ MLHPH 0@P6g0 ,@0P@-gK05k7@Do7@o -LM40@`8 Vc>0p `@a@ @0 @P0` ?P @p (K @>0`0`,K@0 @P0` #P 4,o0, 0Ok -LMp4 8 @P 8K` P*840 @10@0!0P,0 P@8 ,K ,>P8 0,0 B0R,0 P8  P'00K@ (K4K  P`@Z`J,K ,P0 ,0@T0P,0 ` J P'00K  P -L M"0(0, `PP 0pWy W P8 d R(K0  0FPPL0$0! 0@;00 0 #PP1 I 0  0PP @0 Pp0 ,K PP;, 0l0b 0 RP0Tq@ P41<  T T (1#209P0 pS00S 0S T P P @ 0S* P0  0 8`cvPT$1 !SP#P3R0! $0S UbP`D2pkk -LM0X T2 0\" 0 P2 upP (KTJ,`  X"c0? 0 @ lp hp p d | <ʟ8" 0K < 02 ," ">K K Kq 4r q q (r $2 Q0 bP P" 0@ \b(L'n<? `  RLB LBP0S 00S00?  R? 101 0,1 s ,P X2PU Hr , R 0 `HPH 00@`d,K 0` P00KP p?W8pGHr W0S } ! 0H"0 000100L00a0 !0S00 pq 1  !81 P p041 K>0#6`001t0,!0. "&h0d 1>0#6l0(!x $1|0P00H"1cL@KD2 @ H  KL2 $P = `P1 &UQ)bP0 \"bP" 0@"5L'<?  `p ?Ppp B 00 B0 yTFO @ ",aT0S0# X00 T2C 50T"0A@@1T1`T,00 Q0Q `0  P`0 00 0  T",0d0@0@0@0@ #L',\a 0P"@T2( ,0S KPr D"\2 K ( PfT,0   <?01S# L R  S  1 3  1S30D 0R K  101`# Jp  7T2@F*@T000000000000027`80P@50  0 000 0 00, 040 P4  X, K`T",T24) 0Q.0Q+`*< K4K X@@Ph18K@P& 0$ 8 P'h8 <00<040@4 408 40$ 4(00(04  00CS 04 <4 f,W <4 \8lo4 k Wk2p0k;k0ST0  Q 0(0 R 0 0 0 $ R0 0$0 0$o 0-,0L@P=  R 0 0 0 ,   R 0 0 0  0 0P1%`10CS`1LP*gPpY`"0;XQ`LN`H 00C040E`, 00C00 oopo0ko0k -,0LP@`DPL L00$S$0#L0[/00tPi pP ,Dn(Qi3  -LM0pS00  b  $@T 40Q 0 r @Ti P,q! (0S00S1`Vb ,0; S V5   ,400Qj 1(K0  K0,  (00S000S 1X,0,g400\R 0[/0(K400  ',0   ,K400Q/ [? (K$   ^& 00% 3P{ 400Q [? (K  P Q PH P  @ 7@ 0-@L8U84P,0S80 80<0@8@T  0P4@T 8 R<0<0<0 8,0010,   (Q 0 20u0k0k6@ -40LS`@P!$ Oh,p0S U U  R000 0 0 , h0S @02#-30S,0 PX 01,0SU 01L0S8 0R10<00<0<0 Q 0 0 0S0 0 0`,0 $@T Ԣ0720P,0  S ,V0 R^   EU@,0 3T  D"0000g0S 2FF=D=RB= @0SS   Tt,0A@0$  1 10ST,P0[/@,N ,1D X 84 ^P0SPJ  ^PE@ R 0TP 00|0S  B 0P  PR8@ 8@ookq,8@o -L  -LM@Q K00  VP   @-88 @2 1 0!0 c@蘾kQo -L@ R 0 SHPsPP0 R  00S 0S  R 40Soo -`0L RP 0@@<@P @PDok -L@p !^0`0 0P ( 0$pp@`Qxt   ^ 0F0 00000a:h ]:R\ Y:,P00,0 0S `,`poo'8|&,|& 0 ,fr -0L, @ hY -L8MP+@ D0  = S  = S  l8lx` @V@0AS00S @@6P# 0'f#(KQ@0\08 0AS00S1 6P!0#0C0ǟ7'@h0*L@ 00HP0 2@^ 0 0C0Xe,'00C0Q0 '0T  0p0QPƟ 0 B0C#0 3]@010 [? Q[?C`(,00 ,`10`1 @ℒE8 E\8 }9 @H P c< A@;L0 L0 $@ R'01H0S  \5^0 8 D0L  4 <  d0l 000,0  4 R{ğ4 R0 0 4p  `180S!80<00 0a40 @010\<00S0 00$ 0R00 0,0  $ @ $@ 04 QD   4^ LL0L @L 400L 400Q 40(K=9 =0  !P@ R   Y *@Q( 44#<08S000000\000^`<QH R ,0 0S @40"\    "0/,000  0`0 R 40,040:    d0l 0001$ @ @@WE8 E\ P8,0 H ,0  , * AM  !000,,,  d0l 000v D s10@1000`0<0C?2 C0kk0k0-@C0kk4Ok0Oklq@8@op'x5Hooookq@BH8@ -LM 0   K -LM0@H ( $ 0@@K& p-L MP0L S`@Kp0 $K0 $0 0 @P 0$0.@ `l@& p-T`T0@ TL 00PSP0Q@Tp0kho p-d0L@`TP p  oP $ `P@0pcho0kP8@ @P-0, Ã0ɃQ #0@S00*0,.0T0a  㸎88!>0 C6 00 6P@40  04 0P @@@PP  Y0 0cC61p00@4 0ii00S00#00!P0 ,6. @a 4`(ao0ko4Ok0koo8@8@09@ P>0 à 0Rl PR 00S 0000S 0-PL @0h p-0LP`@V0D  Ppphy+00  R 00CS0 r -0L(!(M10 p  `@0   PP0S (KE+@8K" 0P* p38K+  #8Ks+ vp38K+8K9+P r`= -H0L   R@0 00P00r -L @ hgGP -L@ hY A8P -40L   @+Phhr -L@ h\ P<0S8<0 -LMbp<0 P @2Pp8 p (K)0 - @W2`00Dp004P,P,0Sprp4P 4 10S 00<000 00*  4, 0 00S8<0<0<0 T!00T1T!Ro4 -@L 0@ko -LP00,P0!00 @\\0$@\@T1 @ 0-PL@ d^  00@00h0h”T0 R 00aS0 @ 0@0o1k >@0@-@PU P S! ,0  0Q Q U U00 R0\ ,@00S00 0 P ,0  f$ $10$1$ 0 -@$!0Q0""!A0 !!Q0 11k10,0@ -PL00`Sp! P,0 010@)00S W400CS404,0  ,0  -Lp`PP9WV W,@ᏸ㛸@0T400`WH @T T ,0  Y,u100CS /'/'l/'/'/'/'/'40S4@02 40S ,0 W010 (40040W 40 040P0 z,; 10S(400404>@8jo -@`LPph|T`@00 V06p0 0 -LM0HL`A_0! A_U pD|0@@@$KP ,K 9pP (0A0 ,0Qq) p0^H0η0J k1pSH00P @K|H0 0 八pWpG <WpGpqCC<>@ -L ML1P @8p^@ M?(KP 0 0 0 XPT (`K ЪPW  0 <1$0 SM?"(( 3 K -L MP0ES@$`@V U U; T* !1, 0 $ ( 1$  1$00$0 1$00$0 1$0@0$0 U $0,K0$0 0 0 (0 @PV@ ,pK u@P @ K 1$00$0  1$0 0$0 0 ? -L4M4 8  <0 0 , 0K 0 , 1-P( @0Z p1x#@ 0 K @P080` 04@@0@ ``P0OZ<0 00@ 0@(K`4@ T@8@<4F/000@ @0`@ PmML>@D>@T>@ -LXM 0( @F P``@  TKpt{`1h!8@ X@ @0 < `0`@K640 d &0 l Ơ 0, P ( 0R$K 0P 5[ @P0` `d&$o= -LM , ,08 @,0 `,0 d0l D &Q* NpKFφ0"t"L!P p , 0R(K p`0@  0K 0 -cp 0 @ @ |` pP 3@0S꘠^K  0pPV00S  0 7 p1S 16 1S᜵@0P @ P t C000 X@ TP d` ` \ Ჵ  0 pP01dK0p Ἵ7P| ,0 g d0Sc 0Spw D] 0 %$o<@>@1k>@= 0-@P,L⍵C0p 08#801  `Q0S  PP 0h0S1k  @0-rL`1M@ 4 $P`Aj`1!S0 d1h,0 4\!00, 4 S< +,0.10  !1 1 0V1 0!10101 h`!0R000\1`1h1d101,  40 0 0 (K,"X(Kour1k -@010L,` , |0 Vh%-"X0@P p;0S #000 0@@0<oo -,03LP0#,!03PD y 0@CA`̴$ 1, , + >  SD !1R.40S45 , 0 R8#8[/Z0W w@, ,  !03P`R y3K, ,8#8[/0 Z A@S,  [?P  @0`|@V$ 84,m1k>@ -LQ@Q 0,  10 KP,0  B11!< , X1Q1Q 0,  10 %P,0 -L Mp,PQeR0 Gb Y (1$@a,0 $ 1O10,0 1,   0S00ʅ 0 R9 0,0 Aᾳ 4 000 $00Y00S @T T @T,P 10`Sx S S@. T (Kor40S 10S (K W00 00SPA(Koz R1P R ,0 1 P,0 ,  @\,p34P00SV0P00S@H @ A[8#8[/0;(Ko|NHpK, 4 y A3A000 v A;,8oA%,@ d,0K W 40S0PX0S ,0 D0 ,12S201Ņ#iA ,@,P ,0S@ X0S@ 010"RA1k8jo - L N -x0L@T@T ,0 ,ֲ0$ 1  @To -LM@,  P$`0A s  hd\`Q Ki!00000 10! !1 1 0U1 0!10101 K1k Pp-L`P @T U  ,0 `@Tp P-L@uP  h -LS`p) X1@TO @T 404S, T00Q0S 0P W f@TX+ R 7P% PU PU @x 40S,0 R  0P W 100C0S6o -LPp`P P U 0 R Q 00S U U U  hlP @T0P \ 00S U U U @T U  -P0 UL@p #R#0R = B @`P  0S  w`P ,0 0P  U r R 0ig 0i b0i @B$$10CS$10$0?o 0-LP U@$J/@R0$10o 0-$0L$!PR @$@0 -`L$P!R pju0 @ ! 0 !1@ A T101!0R1M 1P 0R 10P01k -L M<< q4@0 ,J 0@tAKoxE'5k>@o p-L`P @T @Tp@T R0000 0  R0000 0 -pL@` P$P W` P 00  00S00@ P0-LPP@@@T:P T 01 R0D00H>@ 0-LM0PS Q@ R  R 0A@S0@ 80SK` P  0 B0 00 0@@ 0 @8S0 -pQLPT\Q 0 0CW .\, @ R W`1`!P$0 70S( ѣ^ 0 f0 0 0pf0@ fW0 @P0S  ) * !r -LM2 K -LDM 0P@, H0 D@ +PP #0S CPU0L0 ` P`P t`P`U`L` pP `#P P3P @1`,3 P3P  "P`Vj p=KB 2R20L g"E@Wt2P Pp5t,  000@8 @0$0(@H,0 P0408@X \0< @0` d0D H0h l0L P0o`TV @ osT @HK [sP A @0 B C  D! EFG@@EW00`C,00, 0PR=(KU 0`V Pp P P@s<,  000@8 @0$0(@H,0 P0408@X \0< @0` d0D H0h l0L P0`TpV($o1kpp1k1kp<@>@>@=-P  0S 34\^ oQ0S :P00 (0r -QQL Mp`1Q1 $0K`P) @$ P$0( $$ $ ,0(0,@$0 400$84$<8$@@<` K(K`P l(0@ (s(T K(0l lh  0w`r -@LPp`sT  0R U T  hܡ  M-PL0 0S R K P  -PLM0  0S R  P  K⫡  -QLM@NQO `PM Z: @0C 100C0SA,0L> 0  0R>,0S2P U;P00 U"@#0 @@0pႭ P( K0E0"@E0`0@P ჵ(K@@,  ` D@@P -QLTM| Q0JS-R@P |P 100C0S,0  ,0S0JS @ l@ P00P0 `=1X 4 @PHK`0 \@ p80K lhK8 TP h0 dP P` L CPZ Z ZD< x x H@0x|p0 p t 10 0!P,0 A eZ,Kt РPfp00KT d  @P80 l80KhKP `@ \P X 4 h0 L PN0 RA :#:jc0T0 d0 0@P8K lhK`@ \P 8p 4` h X` P L0 P2V6 0S@10S @T000Z8, ᄠP ,0 0T ,0 50 0 00 (K Z(K00 t hly@ 0 0RA P<  | D0, ?P ,0x 0^x ,0 tt Zpp U | <0dZZ|0700 -LMp`P&. pY   0@ 0$@ 04 0@80<@$ @D 0@H0L@P X\ 0@(0,@( d ,,0@ 00h00x0000000 00…04…0Z0 -01=L ( 00 5/A#b 40=9 =X2 01A !P Y T00 <0@1A80[1! !1$1$0S1(1$0S1,11001 M?3!C/ 0 0 pF Nzp vp0S`00`00S`00`01 0B0RS) 0S X01 `01 h01 l01L1@0@1 0!x00| 01 111!2!tQ  BpY X0@X1\A0SP0@2DB100C0SP0@1A2!/A#b!0O1A/!0O1A/!0O1A/!0O1A/!0O1A/!0O2B/ "0O2B/"x0|1t P= @ @ $0@H2LB \"04 l 0S04 p 0S04 t ,0 Q p00|0S00CY|0 0@P0T@0|001 0B0SR 0 08 K0K, 40/08?@#bL3c1!(KT X0\ ?A3c 0X"\00@d!l01 A {o7Mb?B<@ -L$MRL0 LH < < Q`V pW&V (K (3A!0 Hp3Q, D  & D 2H @@ 8 4 T2 10S, P R( XVh'h'h'ph'g'Th'S񟗐ꀅ'Ȇ'Ȇ'Ȇ'Ȇ'Ȇ'Ȇ'Ȇ'Ȇ'Ȇ'Ȇ'Ȇ'Ȇ'Ȇ'Ȇ'Ȇ'Ȇ'Ȇ'Ȇ'Ȇ'Ȇ'Ȇ'Ȇ''Ȇ'Ȇ'Ȇ'Ȇ''Ȇ'Ȇ'Ȇ'Ȇ''Ȇ''Ȇ'Ȇ'Ȇ''Ȇ'Ȇ'Ȇ'Ȇ'Ȇ'''''''Ȇ'''Ȇ''Ȇ''Ȇ'Ȇ'Ȇ'Ȇ''0BMSؑ'''''`''d'''p'X'@''('' ' ''''' '<'ؐ'''Č''P',''''''t'X'X'܈'''Ċ'''`'@''܉''''t'P''`'@' ''؋'''''t'X','''p'L'''''''@', 0R(K 0 0~ 0w 0p:\ :R  :_L 0@xJ@ 0VP00CUS< 0 S @_`pd 0!'뮋:*L 0{ɟ 0*  9U` 9L{t@fh  000QD@@T 9@-\L 0@RHNK 08 PF81 CRS0=;L 0x-408^[ 8RW  0" ȟ 0ȟ 0ǟ 0 L 0>Pǟ 0L 0L 0#Dǟ 0{P iL 0L 0L 0yL 0uƟ 0PϠ l6{\Ɵ 06@Ɵ 0.$Ɵ 0&L 0@ş 0ş 0x 5q-o |5h b \ V(E0MK 4 410Hğ0 L@P00W00S7 43ꨤ0 0K P'W% 0S0 S40S 7(ğ 0  3`#3PBnD  Q?K@ C@ 0PP0S >/L 0@\ß 0n<ß 0e30S00<1 <1  O?KŸ 0DŸ 0D͠ 2oŸ 020 S<0V KOKo ٓ Ÿ 0|Ÿ 0s0 L@P00W00Sb 1 ^ 0Ux 0LX 0C ,1< 15 0.0|'$opa0_4C(Wk8Ct1p:kHol2por, k0k0k<C4k|%p(CGkp&p(5pD&p$@A@A@ - 0L 0S h00C0 RKp -pL@`TU@ 0P$ RU00000 U@p 0-$0LS@P  P 80@ P0  00hE $$pLA@A@ -"LM0rP,0 d0S ڈ2xx v0S0CX0? <K Q P0S P ~ A00S0 &, 0 Rl(K R P!0S@ @ @0S V0QI Q0(0BS0A0- R 0$10  0  01' Q0S  Q00000 R<Kf1S R0000 T<#0 R000x  $$$op4kA@Cp4WkA@@=A@ p-d`@ L0P0 P $0S1P0 Ppp -LM0p@/P`` PP_ 0 0( @0S* 000h!"PI$p @RTR pP= T*p 0!R20,00Q0S Q0!R 0S S0 R 0Sʵ!(P'8~#4|#0z#(w#$0T  q#HB@A@PB@B@B@B@xB@B@ -pQL 0 Q0`V) P0S" 0S 0C8S 0J@0J0 5RZ0Z P0S`V>p -0LS@`p3 0S$0S  0PS'0U 0S PPp0S00S0x"0l "0S T"p0 0!i!4kB@B@d@C@B@ -QLM0p0 4 ,0 (  0 Q0$ `0V 0  P0S 0S 0C8S  0J@0 5R 0Z P0S`V`0 R , R $0DS 000!,K4K^!p4k,C@@C@ -L M`p\00 @!0S @200 30S00Wi 0 QP `b @ 0,0 Q0S00a 00 P W[ ` X!00S  `1\ 0S 0S T 8CR0S00 S00 0S\ ᵲ ,00 R 00CS0l< h(K`Pd 8CR00` p4kA@pdC@p4WkXC@ -@PL` pP  0hGV0 4k -LM08`, J|pP4 ( 0 $ 08JE00C8S0NP4Kl08Z,K\ CC p-`@L PP  0ph ppC@@-X@\F @@0Q:XP @ @0R:Q:& XPXX@XP @0@ R* 0R X0S @ Q: X0SXX@ 0R 0R 0RXXX@XX820P#! 00"8Q#(p@-(0 S<3(057<@ @00@09780<S3 ; @@0@008<<7P`@ +7P`@ :00;O0$TP7p"p -LM, 8 p0 RDP] 0T<0 8@ W<Z (@<K4 04@ Ы 00 ;4 00@0(K 4P0,PP`0 @80$"S/ < c080 4K PL 00B0 S??( K Q02\ 0A1@T (0 P @  "LP- @TZ \ 080 ULP0.S a0B0S8 a0B0SW0B$Z$opA<@C@P= -L MPp`Z* ((0"4#220 $04 D,K.P 0 @ (K, 0ؤP ,0FP 0t ` ,0 Ҥ,0<  0,ä, pC@redA D@C@ -LM`00PK  0 &LP 0RK00[S  00C0 S00•0SLpQ @@Q KP10$$o wk\= p-0LM`@K Kd0 ]PP"0 K0 @@0@0  K0\S QT0 QL0 QD@0 0RKp (k$o&x1TD@08D@l= -PQL`. 00S`S%p0@T@T 0S KP00SfP020$ 0440apCWPE@p -L@P TYP0@T @T 0S$K@TFD@pD@ @ -LM0x,0 ` P@T $0s (0t @TU 4@KJx JP RVX HJW+D00<(8(00000S[ 0#4PP0 7@PK$88@#D0a'$B K 0KD@P VPPpT00S 0S V 0Sh 0SO @, 0R(K R 0S(0 @ ?J&P0&0T0U0SuƟ0s0Sh @pPP0೼0  " 40 $@ 020$ 04  6 %ş00a6 0qW 0S" |$ 0#(("#4@!| ,40T,((0 "4#Q r  H0R<5 (p %5 "88 #$0a0""0p 4 "88 #$0a0""PpKV 0Sx |  ,@ vHPv|@IP 0u03V0STU@E( K0^*S@ K0 PP 0S$ 3\#   @udHuD`IP X,0S] S7 @#002TPPp㸀K 0N?PP IIPa 0K*P 0S \ @ X|@T@T $0s (0l@TgAP > ((0"4#220 $ 04ă\ l `@P 0pP@ P`:儬H HP pW (0 P @ HP @VPP|^@ Z`@P 0P@ P`$oppp@ko(k@0E@CD@,k0k E@d'E@E@ @D@D@XZ@|@D@D@<@sBD@ @D@t@E@`E@|=D@E@㒺 0-P@Lc,00S,0 0hH` -LMp PN,00Cs,0P 0K,d 00`Q`=Bl0 B1h @BQ=9A h =C lh l0Z00K`0d@)U /PP`P`80 0@80<@PPT`  (w(K /HP`P`00 0@004@HPL`@0 0@@0D@c?BE@ -鰀L0`S Pp@0@S 0PSp0S P`p@00@S 0PS  0  0܉ukWkuk4bk -|0L0@S㫸 PR 0D00  0 (0 BR ppppF@ p-0LM`@ T P@T $0S U(0 0 (0g  0RKpd0K KkP(0,0 Kw(00(0 p$o= -,@L>:(00(00F@ p-LM(0@P; e mP7 X``00 U@0 000@ 0$0 P }P 020$ 044$0$0s H `9@00S xUppp(p8F@ -LM`D 88#|p 0 @P,  !00! 10  @, a0 ሀ<  R `U 0O  < ?0 R0Q4O0@ @P Q: U:0`)p@0@P@8 P0Ǥ0, 0P 08 0p`,@P 0ᯤ 0 0@d (K< (0R 4 k(TA<@@n(lF@WAtF@F@F@F@F@F@ -LdM\@ <0 r  <( 4"4&, Pf< ,$ !$*,R]04!48#8S T20Y *00!8P#QE 8 040 (@LP@ ,(T 00, <\0 4 l0d 80\<4 l0 < 8,t X <0, L̠H  X0|,P0dT0T\0Dd0l0Čt00$80p40t0D0 (080 ,08X0 008`0 408h0 808p0 <08x0 H08|0 X080 0#dX0#T`0#Dh0#p0#Čx0#|0#0#$80 D #t40$H #$L ( ,0"l0 #\"L408 #"̌<0H # "0X " Rk @0@@T(PKT` 0 T50 A$,0@(@0 00<@9000cP4l $0 @@K0H0 K 0$l 0sH 0S S0S 0 48#8,C(R;;S@TPlP P;`@ G?E?C 1* ZW: R e 00 R0SP,0R0#03P0S<08  , 8 0 0@ 0  i0 0H cH0I 0Y40\@"* Z %0 6:4 S R!*0, q 3P R . D000D0 aP (K 80@< @D <0k@4@< 8 0 , @D@#40 8 , xHG@-00 R0  R 0 Q R0S0S0000 00Spa0 P00p0 pp< 00b 0P 1 Qp-LP4 1Q 0Q  p 1Q 0Q0 p0 00  0  p` 0 @aUT0 @@pP8 4 0000 00p}f~fvtwt@pp -@L 4 R00 0S00h$p -1Ls@ 000 800 <0 00@4kpp -l0L RX@0 D 800000 0ppp p- L@`A@P <0 S p@ppp -1L @Pf`p\ 0+`P  000^  S 0El@Q@1@!T /`P0Q 0Q`#`ppG@ Q0-L@0PA 0R |<x0 0 PR0 R P P0000 0S0SU RUpa0pp0@-P@ R( 0S%\ ) \ ^ \@ 0 0\0 S 0  0S R 0 000@ 0 0  R P,  R/ 0\ 00 S 0  0S0S 0P@ 0S@@0  @0@ 0 0 0S00S0@ 0\@@  @0@- R 0S^ 0Sk0 0R 0SI0SD \  R0 0 \0S0  0S R( ^ 0Sm R 0S 0R 00 S00 S0 0S    R 0 000 0 \0S0  0SR 0S@0T 00 S @0  0 S 0R 00 S00 S0 0S    R R 0SP0U 00 S P0@  0 S@ y -LXp5 PU?P0S`X`V  0S@ W`RP 0WPP 0RPPV 00SZ  `X `V 0S` -@LP' ( 00 S\   R (0c\0 0lS0P 0 \/0 0%-P( 00 S00SP (0c\0 0lS00@-P (@ 00 S00S@ P (0c\0 0lS00 P 0S0SP0SP0S  P 0S0SP0SP0S PQ00SQ00S0S000 Q0-PL <@D᪕৕40HP0L 000x|  0-@LTP ($ @T0G@ -LM0PS`p ppS0pS(`@ $0X@T,L<D H0W 0S0S0SdP (@K0G@G@G@(H@\H@H@H@H@H@ I@H@ -LMpX,  $`,@V P,  P 0U@XPU!  0,@02$` 002 TV 0@ 002T , `F V 0PU -LT0T 0 Mug>0 Gug> p-LM@(@K`PT0K P  0 uKp=g> p-LM8(KP`@ 0  @K ` uKp=g> p-PL@dT0`0 uphg> p-LMX(@K`PK P JT0P ru@Kp=g> p-LP@`  T0PpT0Pp -LMRp0 S`( - S& S ZQP1@T (  ( P0S( P0S @0T M0S (KgZQP0z03Q0SP7P P P X80 R  g Xg4k -L MT0p (@\`X `0 .001 P\@\001@P$<@0S!  0A@k  f (0X 0_ (K `Y X (0T`@R  X  0  0 AD I@?dI@I@J@ p-@LTP` `< @`T@T  @`T@T  }@`Tp -L8M⼢ ( pWaWW "22 2`Vkt0Sd 40s 8Kd" X X P@_e @ @@@Od $ P@P_e  @@@Od  P@P_e  @@@Od  P@P_e8  @@@Od h P@P_e0 H @@@Od , @a W `V aWX T0 `V( 0R"$K L 0 g8K & qx p$oJ@m@8AK@4k0>0S! ! ҎP11"p"l00``0SW\60D D0D0D 0 0 G0Rpph>4kK@5kp p=(=(>(>(K@- \ 0Q|@l0p -L MtptP`@F ` 0 04`V pPKPkpK@8h> 0P \| @l0dp -P1LH1\@1Pp  U00S`@! 1 Q X00S@Pp PVP$1 VV$W 0X0Q0S U    PW \ 0U00U <000 R jigV p pk45kp -RLhM  !l @ |@ , pP@ P t l PT t%PP00mP d0  t h0 ` \0 tp t p 0@ZSQXc(0c(0c(|c(0c(0c(0c(0c(0c(0c(c(H`(0c(4^(_(0c(0`(x_(x_(x_(x_(x_(x_(x_(x_(x_(0c(0c(0c(0c(0c(0c(0c(0c(0c(0c(](0c(0c(0c(0c(0c(0c(0c(0c(0c(0c(](0c(0c(0c(0c(0c([(0c(0c(\a(0c(0c(0c(0c(0c(0c(0c(0c(0c(a(\`(](0c(0c(0c(`(](0c(0c(`(0c(`(](lb(b(0c(`(]([(0c(0c(b(0c(c(t Z t  P@W00 S}  zM, 0Rz(K> mh@@h@ h   `@\@  `0S @`h00P00h ,Kl  Rd , K2l 51:Rg D 2A P`0l@0  dl@ h d 0Rl l000b al  b``P^h 2h0 /h@@, 08#X` h(h  %h0@" 08#X` p 00Bt@!0000L Qt@ p d0 t*P 0@ \0p `0 t0 Pp p@!00D0 0 \?`0 t hthh ^t0+@\@ Y0PCK l XP C0K`\` th @ h Ht0lPh@h @t0 h@ h  &BP l0`cl0  c*,K @ 0 夏0d 0㕏QP` @Dl@ l@00 d0 P0P` 000P0S  Rp @ !  0p h@ h  h@ 0 8#8@L0 H@ 0 L H h h0@ 0 尀n0 i @|Q pL0H@0Z `Pu  P@ l@2A \@QLK<@00`!0@0^S!0@0^S$o@L@$L@,L@L@L@=L@F@^<,Z; PW00 S   !0@0^SP@W00 S   !0@0^SZ l.?PX0 H@L0CK @F`P?X0  oHL0CK4!6^ Zg PW00 S>00  St@0?`0 t -L@MQ  K" 0( K 0 K(0 --0 L M0CQ0  0( K  y K0 K( p0 0-LM@TP 0P^40@ R 8x85k p --LMP 0 ?,0@ R hKX5k p -@L @ -Lг@ --80LM Q0 Kk --LM 0 K --\0LM ,0 0 Q @@ 0  0@Kr p-LM`0@< 3PK0 t0\ >3[P @ hP >a 0RKp$od@= -p-LM `~ 0@PP P00 R0PP Kpp -p-LM@ `[P 0@@ @},0 R0@@ qKpp \L@ --`LM0PSP pAO d P PL0 R SJ'P,@ 0@L ppL@ @(5kҿk -@0 LH@00S S S  Ph]ShOxL@05kL@ -LM  0L@ -LMP`R,020#00S !R b1!#88P$H*0pK@ 5[P1[0 1K[P ᷁ -0L0S  c1 #880S$H:H1D0H1,g0 8jo p- @LTP`Tኁp  @! 01 01堁ppE-鰠0S㨀 p嘀` @00 q0 pP A8Pq 0S2  0S 0N0C@5k<5kCD5k, ,0,0Q0 ÷ X5kP5kT5kP!p-000 \ 0   X5kT5kP!pP5kp@-`-\PP0\ @3 0L0 \S5\3  T! 0L0 \S\ 00La L ^ W0LRA0L0S7 LTp/0 S a ppX\x\@@0 @-paLQP`ࠁ@@@a0L0S*\0 0@0 S008C8!0000@ 8 R#8 P P PP@0 -p0E L`l0Shv(\v(Pv(hv(Pv(4h`,h]$hZhVCTAL@8:@L@d@0S400S S DA >85kM@d@L@ -1@XUL aU_!00UCUڨh#aUʐ!2px@0sJ `0|8s0Sw(w(w(x(x(0!0 Pq0 `@Aqh`@@! 0S0c!00c10 Rڄh|hph0s L<5k@5k CTM@CpM@xM@ @|M@CCM@M@ Ch C$M@@M@M@4M@d6@ 0-LMP@tMhd(1)X0 S S SS8KP008M@M@P%pM@ 0-Lz!0SL Ps* P@@k T 0D0C2S2{({({({({({({({({({({({({({({({({({({({({({({({({({({({({({({({({({(|{({(p{({({({(d{({({({({(X{({(L{(@{({(4{(.,0S0%"|t l d\TLM@\5k@ P@ @O@O@O@hO@@O@O@N@N@N@lN@@N@N@N@M@ -LM0 S S, C SA S?  R R  08 R R#Ā0S*8@㰐pChP08#X(0BHT)Pp0  \*8P#08#X(0BHT 8C8s , 0D5kC 0-xPLq h0 Q 0000DbU0@40~@0QTqT000H5kL5k@P@PP@ p-XP 0P`SL @80b0@SP 00pD5kH5kCг@ -d`dP 0\pr0L0 J@ 0 0S8P@C 00 C@5kH5k 0-0d L(\Tb)PPP0@ P *0Y)4 (R)00d(@(!pT5kX5kP!p 0-t1L @R ` 0S3x((x(Ԁ((4QT(1 T0`!10 0 0c0C1 0S*0h0h0h@Y@Ne0 0 0c0e}<5kC@5k Ch CP@ CxP@@TM@P@pM@`P@ 0-t1L @R ` 0S>D(((((4QT"(1 T0`!10 }0 0c0C1 0S/0cd0P:^0hj0hg0hc0 ]@d8"FpR0 LJ@@E8B<5kC@5k Ch CP@ CP@TM@P@pM@`P@xP@P@ -LM40p,S0 @h, 0' 00 @(r 0 P (r @BVW 0Rp,eQ sQ dQ ,Y h00T 0 SW@@A<5kH5kCCP@ p-LM0P S S` S S S S 0 S S S S S SPx@KP @ |x0 S S xP@M@ -LM R R00P R R P R R  08 R R# R R R R  P R 0S?8@!Cx`0 08#h(0BHT'P0  (8P#800 08#h(0BHT0 8CHt Qs (K,`KDPs 74D5kCM@Q@ -@3LM `R#(SP3 P8CxnTNT R@yTYTYTyT{ (K(Ko8C800 nTNT |R@pyTYTYTyTcH2 Rp @P) p Wp 0S$ QYa P0 sp p0p8s |PZ @ >&,@ x0 8s dPCr08s<iY0 00(KoU(KocjT@aA00c10F0 0c10 q4(Ko]P! ,%P,  ,L(KoZ<5k@5k C,Q@ @`Q@CCCLQ@pM@TQ@TM@ C|Q@h CQ@ `fgfff0  `&pD&pR  Rx0x0'' Q Qx0x088 RA↵ -0@ 2L 0Q p00  (00H >1>1>1t00  |0S0 0 0l0$0(QD&p`&p p-QLM@`@00CS(<(H(T(`(000 P#@Kp-@h0`0X0KH02 0\ @WX&pH&p<&pP&pD&p 0->L@ C~0PT;:h0h0h (h Hh D00 8 P0$0 0PY0`&pD&p( 0-LP 0NnP.8CR0 -@L`^᜵VpH 00RUV hp t0`0t00FH0U 10 XH Ѵ ʹrCT@ 0-@Lgt0P0t00h蹴 p-LM@WP`H0St0t0$ 0  0S H0St t  0  0S 0t0H 0tPP Ⴔxp6k 0-P<Lp 40d#"B @H L00b 0H >R@@b01@9104bk 0-@<Lp 40#T"B P R00 0S000h904bk 0-@<Lp 40#T"B Pʴ R00 0S000h04bk 4 0p-#Lp"B @`!r r p<0P80<`㠴00@p0P804bk6kx6k -LƲpH  P``0O0@d  d >V0 H>{  0@d 0 d  H0 P 0>eHb 08#(08,!#8 Q0A8#(}zA0H\XSNP 0@d \ d H Pj ;^P!P(P'P)X)P0 l 0@d 0 d  LH PH>SB >H&p =$CA p-LP@5t0`   U tၱp0 {p 0-t0L   % P"20#0 P0S  @@T 0h0@T00 P0S P ^T @^? -LMPP ٱ(`$pK @P $ @P` @P $ q @Pt0:t00>0> p-`QL@ Pd aP]Up -LM2@0 SP 50 ^ B?@0CS+1 ? RZ  t0 ! W0N>N2n @ :t0\ 8CRHt0 :t0>%`(pKⰎ > PP ( PP0t 5*0t ၰ.8C8Ac Q.PPQJPUZ =T@ -LM0`P0 ,0 8" p4b t @0  82#34CY  G<\#0 R|  VR8 0H0XDVT V(ڠ0@ "?0@V' 0>H  .` . 0O0@d P d p`l?ʨ0H0X VR  ^NSP)0p`FH0XㆰH0@X#82Tt0!0t01H R`1l#OK dP@4Vpp4b ŚH0CbH0@X\,  |0P| 0y w$0!s1Fp0S7   0@P< T  4QK, 0 R(K ꄯ 4 Q 02R#x #}sL84Kv  o$oX6kr =H&pp6kp`6k= d<6k p-L@P` (Q+Q%t0 >;.t0.}<ph7p0t#40#"Bp0t HQHP ˬ1(Q HP4bk Q-L@ t00t0t0 0t0 0) P P  -Lt@  0R'0 t0! 0)P P 㜖xQ  p0̌#40#"BH0t 0t0h]D&p`&p -| @0S00L>0 Q>|  00CS0 t1tk(o -`pLp=0 㨀廮@  0@D  D 9@P ✠% !,t 00S t PWP|@$  20P= t {RyW  b @h0(PTh ?R](0Sڜ0  P HPt0@t0 0S Pt@tt  p [ t|  0S- 0S  0S 0SI 0SW~ X+ | іt p 0@$  $ h0 t@0   th0@t t    0R40,50t o9 pG0 #Y!   A0GS p0S P 0S 0SM @T T   0t@(0 h0S&  .H0Sqtp  0S 0SWt W W@ p p(0 S|PP%PY T 0S 0S 0S >08#8S>>>t  ^W0SpSn l >(B8CS@1@#Td@DT]0p  x t  (Wt{pp !W|pl 'W`pi W X@0|S W 050;- (0 0S050,| ʕtWtW   ^tɌt z Tx 0>(NxW 0S MtWW9 tl 0W4tW   >Rs kQe0>t>tW  |@ P0 P p p P P 0 @Pp0 P P W 0@0S  tt/C W   t}\WˌtxXop0̌#40#"B0t )W}p ^W~p > R @F0Sa&| zP&pX&p<&p =4bk p-LM4`K@P0t2Ɍ0tXPt09t0Kp -4LM0p40 0P00 < @ 8p ,p 㨠 @Z_0 0S\ @w0$($?Aas P0S Pi8 R , R,0 8 0^t 0  @0#P30#p!8\ 8 0#p  0S00SW#W00n㨠p᮫@ k0 0S, |0P 4 $0!41@0S  ;|"2@pPu =(0S( ֪` @P%0T: 0TT X<pP<0S X` T 0T 0T 0T  T` Nh1@/ b\)ឪ8 R ၳ8{(KT =  S| V  !1opP 0PCʡ#W  ] 0%>0S8\, { 8 壱8_80S, 8V0pO#ppIprCgfffX6kh6kp`6kX( -0L@  (0 P0S0 p-P<Lp 40#"B `㻪@ 0 t0191p 0Sp191p4bk 40 -LàL@`㏪ApP@ .H0SPUWTة ѩPʤ0  P T t0 P4bk -LTMPx0 U`$ G:U |:U J0U h:Uk C\:U P:U ,:U 0U- p(K:0S 0 S , |0^ $01F0S1 Ò )9@UpP 9U'0CU*0CUh9U (0CU L9U% 0Ut @  5,0t .;p8U 8U , < p8UF 8U& 0U 8U0 R  ZP|pPdX8UU 8U v:80Sr㦩$8t 0S$0SXtpb'0Zp\ pZP W0S Z t0(0(SpL  @0h 'D0 @0CpKl0 p H@ @ @pP= \6d 0 \ap \lc\LW([t @tp0,#40àL6t  gQ0CU 0UBt0p;t0嘨d6U 6U40St0t000t0t0IL6U D6Ul0p0,6U 0U_|0 Q$,0! Pp 0Qp| p5@ p`Tp#*l0Sk l0U20x   pP   l0 =p@  1PF   e| けp0 @T0S QQ 00CS0 0, 0p00 00 | 0 Cu  dpo㢨1! pg㚨t0p;t0_pP W pSH0p0O0 0S x0q 0 R,0 l0x#20 p4 p0c@ |ḧp&Yx08x0 @8x0  x07x00@x08x00 x07x0`(0S0S  pP{t  0    00C 0 00003!0 !00l # B,0 000-0S 0x 0 QR BP0R 0P R00c!0R#<0k-H0P R 00c!0R#<0k p-@L`Q@# 0 R00B0C 0 0 0A00P0Q  00b0<^,00\00S0 0@4p 0-@LPЦ0S US 0S\ a aR QPb0bU00S0 00h000 0 -@L`ᡦp^P V  0 PbU0Pb 0 b PP 0eS0 1S00PS0eS0 0PS p-@L^0`SP!  0P0Q  00b0<^,00\00 0S00000CS00 0ᐥp -PL`+V@-Q@)pQ$ 0S`0`Q@@ zt P 0ay0 0S00`dd0Vp@hQ  N -@LP M>OvP 0SBA>Cv000 p-@`LP >jvV`0 0 0P  pUB> Vv -pQLP@p1㫥 Q( Q* `0Q! 0Q a a0RPP `P  0a 0 0S 00pe 0W֤ R 0   p-LP@c `R4 R0S) 0 0 0P \  a 0 10 0 P000  0p0 #0 00  V0ꄤp -LMp0S" 0S 0R mp$K@@KP@K $KmP00  ,0 0 P ]r,0 0 0S ] p-LM`P, @T \Q Q 0 S ,?Kp`]at -Pp L,0` 0 @T  f_ 0s] `^` -Pp L,0` 0 @T  D_ 0@] `|^` p- P,0L` 0 @T  #_0 \ `[^p`p80 P0S0SPh&p -L@PP*0S( BT 4P: P0-LP@0P QT 4Q08C(R0S T0SR\ 0 -h0LPpU` @T * \4@0  ^PUh&p p-`0LP`U @ T*$04@S  RPUphjh&p p-`0LP`U @ T*(04@S  RPU}phMh&p -LMQP@#P P CP U Q4Q0S0\ E 0 $K*A$Km辋 0-0 L 0P0S@ T* 04@S  RPU 0|S00p0 @h0@d@ TҩPP Ω0㊫40h膫h&p0AkCkQk8kX.pH)pkl&pD)p)k`)$ 1S!P@7k.R0>> S9>R0!03Q>  p-PL@`p21C0Nnpp@-T!Ta0P 0cS@*81841 (1 ^  >!("(R 30bS01\> ^21C0Pp0S5@ 21C 0Qҁ0S0 S*0>p, 0 0cS00o0/p=kT.p\.p k"!B >0>\P 1 0 SXQ \0\"!B >0C>X@-@P$ Qࠡ \00 a0 0l 0^Qʲ1 0 a0b0  R( 0 0 R`0 SQ1 a 00a01 a 0S*cPQ- ^0n\  S ^ 0n\S1  `0S   D00ccD 0b1  `0S  0  b D P0 0c 0-@PLtl1!dX H@D 1 DP \ TXHL d `0(0 ""> ,0 8#t@#d\?1U@,U@U@U@U@U@W@W@W@ X@4X@U@4V@`V@V@V@W@0W@\W@W@ -LpP`A @A1 00100 P1D001 D$!PD -QLM`  p$R KPP VU 0 @@cV@1 t`d0 0 VpP  X@X@|X@dX@ p-Lh0`PU @ T*,04@S  RPU 000ph0h&pp&p D0- 00@ 1L0*0@0 -`LQ@ d0d0d `1 01P 1 H0S L DP1 01P \0D@c0UL)pX@ 0-1|00!L B!1@ P 8018U1:11p&p(p 0-@PL bPP@0h负0 0-L@RP@᧟0 0-L@P@0SU 0  00 0PP 1  `0S9 0S P00 p-@L`TPtF@P h 101cD0 001a 0b0@0pRp(pp&p -L@pP`W P1T% 21C 0f1UPPD# W 7 "1D 01 0P L0\`XpH0d@`@P @  @Z = @L)p p-PLP@. w`PC  R'0c00 01  *1! $ DD[1D 01 dP`P1 0@ ,@1 p0 r17pD [W@᭞7p p-@L`FTP\t@P P 101ᑞ0 a 100pᆞp(pp&p -LM@Pp `QP P R*P`bU1f0Z P 0j0!: D@D00`0!`01`` 01dPd>0 0 `0 P  vP&0!0g00,0 pZ 0j0 "0 PPS,00< -LϠMϜp0 Q10 K0 p`P} W0,0 ,@K,nDD0@0 0 0|`0!`01`P `0d`1dP˝00W  pl 000 S0`00 WEVA @ PP> Z& 00 0bW1! & 0S  ;O RW1! 0  00b\! 0 dZ  Pd0Wp00 SZW,(K, ʚ;(Y@ Y@X@ -LM^ -LQӻRQ`pP PP 0 \@ @ 0S*@cTS5X V 0!0 00P0000f0yPP" 1 `000 0X0j 0    0S 0S00P 0PX 4 -LM Q-Lp@`8W 0 0g 0 1000,P% 1 Q PQA @@AQPQ100D00 0g0 `` p`LY@0 0 墥o/p0/p -L@P   -P@P`\LpLP <0@T0hL)p(C7k(p -@ ML 0@00 0@p崐崀崠`0@ @P#5  0@PPHp`VpDD t(KohY@(p8h>,CpY@`.pL)pk7k0CxY@/p$/) -PLMp, Z ,  0Q`%,` P`U0@TpcXP @P0U U1Q  P P@U`0X#@gT@!  0X PU X`p0S P P0gX@cTPP P, 1 0YpP XPp 0 ]1777 -L`RPp/Q+U" 0Q*U 0ScPPV`dVP U 0@`T@! P $  Y@Y@Y@Y@ -RLMp`@0,0 PP V@`C,K⼠,0S PP; 젠 jR&,0S W0 gpZ @1@!S @  `dVP0Z0 c; 1 ,, 1:1,7X.p -1L`Qu 0,0Sp* 0Xcp`!Q@@T P 0D P0 S`:X4 `X  `V00S 0 X@1@!  d 00dS 0000 X  V00SR`` pP T)1 Q PQA @@AQPQAD00X@@X 0Xpc`0 100 2022RP0S0SP00 -LQ@ 009Q02`.p - LR0@0 0S008  R0 0 R8#82`.p 0-@QLP (T R(P P@00_`.pZ@ 0-@ LPP 0 -@Lp`@T PU00002 P02@T P7 -LMPp, 00 , K6@P P P `0PTP0 ,RX \ 0`h 0%`hW00S Z,00 0(KW#VgXg0PUSUY  0 `Q ,0 0P@, R  0 R0W8\fEW3PP00W00SU& `0, N 0 0f 0 00 00 0f00P0@,0 0 1m Z@PP  _P0 XU( ,0S 00S VU 0S:0f 00,  00f 0@,P V0 1e 00 U 00 0 ? @8@Z@ -40ML @   0Kr0S R$  0S$ 40$  0  191# 3S,0 00Q0Q40$# P 0-40@L$P" R00 0S000S?0?0hj 0-40@L$P R00 0S000S;0;0hO 0-!40r@L$ r 0P0P80,  3,@03600P008080 9k9k9k 0-LM@ǘ0P9@ %@ 80  0@ K0r p-LMP@ᦘ@0` 0 @Kpr -LM0@P`-@ Kㄘ0p 0  8@ԗP,0P   0@r -LM0@P`-P KW0 P0p PP 0S000VH 0V`< 0V003ᑗ᎗ `r09k49k -LM`P@# p0 @qK -@L<@ D0Dhr -LM^@P` 0S \ ` 0 *0 Up 0\ UY 5UV QUS *D2U0CU70"0_[ 0@R0R1 p1U\ U0U= 0U 0 RZ S- U O@U U 0 0000CU 0U 0U 0 U U0 00 0 0 0  0S  R  R} \z `0 3 003 0  U  Uw09 CC -LMXP`$0 p" 0S \ $0K0 0 @ K$3RO Rr R  R  R *@W  R8  R R U@R R RWT 0S%0 R00 0000 0S \ $0K0 0 @S5 0S00S S0@1om@PAR`1R 0S  R  R \ $0K 00 @R R R@W 0S0*B BQ@@R񟗦LJ)$J)J)I)0T@00T@00 xP 7@n0nP"P@ 7@^P@x 7@VW 0SMJP!@L00Vh V e@Ar! -@L 0S   -L,0@ STh 4 0b S<1H00H0 HX & P4 L<S< QUX80Q 0 R ;P%8#8 +@bDP D(K p a 1SS 00b00,C 1P00c0LQ PLP 00PL X00U WpPT RJ*0R:H@D 0QA0S>80:3S U 1S/ 1  *1S' 1$ R 0 T0SP  H;#8#8 +D @D R T0S @3 80PQ 0P P000 0;qc  D 2P H 0  8PD 4 UJ GH00H0 DUX 80 0S 2  H0UH D0 S1WpppM0;"T T Q! ~D T PD0P0\0S UPUo0SJ0D0 ; 8#8 +)@KHYWppp 0SpPw,0DS 0QD0 0H 000@000;̏/0;Ǐ90D0 #D H'r p-LM@`ᰒ0P8#( p00 0 0 5@ L0  0@Kp PrdZ@ -LQ@ 0 0S P <2hϻ4/p p-LMPh0`BP- 0K @S 0 0("8B?BS 0( ,1 6F!@P 0S 1  0T@0,00ᄑKp@T @T  @TH0  06@P CxZ@rZ@ -LMSh1p0 @ `VO 0SL 8CT)@ (K`ܑ , P0 0$ 尀 ih P000   0@ @A @A@ 4p `@P 000,,00P+@r4/p -@ ML  F0@7KZ@4/p-40$ 0a0bP  191# 3S 0 ,0 00P0P -L(M ,0 S R0 H D 00`p`W0S   ,P R (K0' 00,0#40 !H R  R0000S 0 R XQ@?0?   #4 iP0:08  K3SK  0 , ; 0X07 0Pb0c UP00 [S@  W0@8*(?8 #8*  0?   0 Q P:0O0@/Tʨ 8hH0S, K<  ,@T Q젠PW0c0 X00Se ; 1] 00S ,0S  V@KdH r{H P @<0P, 000`pVV4 R000eW@ 3@ 0P ,  0D0 ᪏4 R0000Z,0 0 00 X00SR =gjV X00S0X@@ T @Pd ,0 s 3Z R 0d000X00S ,@L06`h -0@080L06Qh -L ML H32C0bC^ (K#0 0Rx ^P 0A0 <C_,0 A@@0@@D0@D0@0C C< Qaq0 @P(0 0??;PXP ;  a0  @ 0PX 6000 08 Z 0L)pQ4/pr 0-0P; 00UL@0 CP6⼈f0ha ]60hY -pRLP` 10^ V@ @@ 0R 0 `0aR \^1P 0 0 T`pV`0   0 1SS 0001P00S 0 00!RR 0001P000$0S $ [@00 -LM @S 1 !@ PK  0-0@0LSP S TۛP 0@000aP -L@OAP  0S 0& 0  0S -P;0SpL`p3*V@ ; 1y7p ` ;pP U@0S0#S0`a -LMp`$ K@P$0$P 0S  00CS 0$>A9@ K(K @P $  00CS 0 !C  @p0@P(0@@$A -LMp`$ KaPP  K(K PP $  00CS 0 X $0$@  Pp0PP(0P$@ p-L M0`@ K 0 !PP* 0S* $K PP0$ 0K PP Q $ R 0S R $ PP   00CS 0 PKp$P @$K P -LMp@ KPP%0 SP 0S` 0`SV  8PP!0 0 0 $0|P  00CS 0  Q@7P; 1V 7P7  00CS 0 p-LM`@ KPP x0$ P 00CS 0@x -L@M\ `, K4 0 lPp 0@ P0 L@ \0\X T D @ <0 H  0SH0 ~Q{H00SH0 v\  ,0R@$ @4K00KX KHPP@cpPH0r 0c0Qp 0Pp8  08 R !pPJ80X0 8K pP@Q& X" 4PU  0X05! 0305  P0U @@X00P0Sp U0 cW,,0 0@,00@0,D0/0@D0H@p,  00CS 0 0Pe4Pb(K\,f?H0S wW #W -L(M0`Sp @K P02(K `D < D K8 (@ $P 4 ,`  K@0 -L`MDKPp @P8 P(@P`K0P,0  0,K0 PP$0,$L K(0<`PP<  < R uU #U U   o0$ b 40 0@408@0$L0/0@PL0P@, -L`MDKPp )@P8 P(@P`KP0 , <` R@Y X(K!<@P .X`8儐KP -L(MP 0@ @ $K@ K1Y,= 6k -LM@`4K p#PP (K8K PP 4P , 00 0 0000008 $ <048@0 -PP$0S DK PP, (00(0, 00CS 0& 0 (00(00 00CS 0 X84PP @=0=080 D =,=040 0A=,== 6k -LM0pP K$0 @P $`0A?AS  00CS 0 =%@K $K0@P 000  00CS 0 $Pt@$@P0A?AS  00CS 0 $$@ < <HP06F4  0\@P ᔅC03[@ -LM0pS`@   0KPP,K PP (K,,08 $@ .  7 3S PL0, X 4 KLCP,WUH< 3SE, X4I<,<,W0P89 00CS 0v<3SP0 0F6!剃PP 8 00CS 05 5#03P8 00CS 06[  -PB eE,0 , ,0  ,0<$PP  R 00<TPP ,W4;,<,|W< #P5P, (00(0, 00CS 0 40@ 0,<$[@ 6k$[@ p-LM`@ KPPP x0$ P 00CS 0;x p-LM`@ K2PP Kp K0:PP   00CS 0;0 $ P  -@PL' Q 1S 0 Sl0 R0S0 0C#qW P`Z0 ` 0WP@TP )P( 0S0 0  (0(/pP 0  0C0 00C0;/p -L Rg r R@0T0  (0 ( @T@T ( e  ( 00C0( 0 S( I @T@T1 &,U `R3 P  Q 0Q(0  00 0P pLW@P@T J P0S$P @TZ@WPe;@TPZ&T00$Q d0 R0 D)@ Q 0Q@/p@o/p0AS00|1P&O0d P>XqP0?H! 008a&0@S(1(00 R 5 .0@1,0 @@0y@0@@D$Q  B!Ϡ@l0 0 l@ Kp 00?2c, dS0d00ŷ(Wkkqvk4C8Ct1p0p0p0pfffP\@0p0pgfff/pp1p0p0pQ 0-LQ0D0 P 0@ P 0 0h臧0p0p -pL ~00 00;0000 L 0S 20S0000000P `H0 S 80吂C6OŸ0@0@P   0 0$0 0P2p$000:000&0"0SS$Ÿ0S " 0/SVR 00I m%}00$ 80弁C6O0@`P` P`0@`Pd`00x0 0S 0  0$0 0d!0p$00(080(C6O0@0@000 00!$0 p0K?(000z00800z0S*t0S0 0vzt0Sr00 ( m|p0S00800`zP `0p0p0p 0p0p|1p0p1k 0-00L PL00p<P00v/0S 10S00 *   00  00  00 # 0 0@ 0$@00@ 00 0h008000hz00@000000800l(0 0@(0,@弯0p0pX\@ -2LM 2p x2 0PoPV@= Q |00 H0S 00  "0S  P=8K}, 400bS8 00Pc<0PE0<0 |U!pW!0SR0t p!Iz0<0 Ut0S< R00S1p RGl|00700e|`P`80C6O0@P `0@`Pd` 0$0 0pd 0sUot0Sk40p Rg8 0S 008yr0p0p/p0pp1p0p|1px1p6@ 0-00LP D0#4 R21C 0Q 0  0 00<000h00000|@]{$ 0000hukWkr - LRpe 00Sx0L0 P00S $0@PQ XC x0 0@x0|@,P `00 0@004@ $ 0@00<000{P0  0l  l {00800;6pP.X@ v@uah0 0@h0l@a@000pr -LpL0PS` 8@<@ R @00 00;00` RK00 h800800h\x -1LM tP@@M{`1@D\, ! ?@1cR c@1@ ,0pW@ $/P`V20S` >pW' 0P`OV 00U@/R  x,oizUQt0SP0p RUP` P`0p0pgfff8C0p0p0p/px1p -SL M40 0 Bz , 0`P $D$4 @ PK/0( D0P40p<00\d  P匠倐儠00 `P@ PR00 3`4 \v,y(Kz@38 , Po00P@V$t0S4 Ÿ>0#6` @P?U# t0S2 ?UEڰB"00x,yp` jw00@;00000T@2L" ^7<"0OQPM "@0P ?UT1!0Q 1 Q ;wA!0) ND倣,zypzt1 \ 0n !@0P ?UʌTUvT "PQ@T P `}0OQʗPyT0p RRt<0p R],1yp10 P唬0p!Ce1k\9k0p/p0p8C0pt\@x1pt1p0pr05p0p|1ph\@0p0p\@ -L@ 0P  -LMp` 00 & x 0PPyK` Tp P PP 00 00 8000l Fw@xT P(KD@0 0@@0D@0 0 fx\@0p -LMp00  Z00Sx0LP Z p0 0@p0t@$K0 0@0@00\9 000P(` 800@(, 80<@3 0000pr -LMP @Pp, Z `@P` P U (Ko, 1 -LM@h -L(M@PH `v>0~pW (K4K 0H ,@K@2 PD,04 @r,@ T3P<  PIPD < PR.JD 1`PU&J0O U 00HP`F<@T D1P @00;00a< TDH0 <D0\ 1@ > D8 1P(`80 p0@80<@(,  /00xP`900040K  0t8p X. WFʁ qp tq U<9 Xt0   0 0Su0000rtuXYTU0SVt0 TY t6 q: R Q W t0 00sR XY V qrruuXuVzrQ]@ p-L M0PK0%@ `K0S 0S  0`%PKp  -LpP01 0101 P`u 0P@`PU`P `400v0@0 @ -@L0B00C0h莖3p 0-L@PBUT004S0P0T$0 0   R03p:k -0SL 0R& 08 p1) P` 0S@ 0@ 0p $0( 0S 0 0@ 0R0 @  -L M0P@T$pK `K$0   0`x@P ]0DS L) )))) 0 0 @K 0 @ 0@ 0$0 @ 0$  0@R  0S v 0 0$  @ 0R 0 0@ -L M0SPIJ@PN d @ 0@ 3 cXQ t0S\  0@  0S @ K  `V $ (0@(, P$0#0i0@S (Q,0, ,0, $ 00T 00F` pK'`@(K 0P ( `P ))) )))#@@T $0@P(  0S^ 00@T$0P( 0 0@(z@0SL P ( R,0,0,0,0$0 $0 ,0( P((0 $0PT& $ 0P( $0  q@ 0R:  0R& `P(0 @ 0@ ($ 7@(0$ (0S *(0S # 0R$0P( 0 0@.@' :k:k -LM40 1\00 ,0 080 G\C`VB p pppV4X 0 P; ,Y0 = @PMP$ ` p4  00 08 0@$0  8 0 ,0 40Y40' Y Y P\ P(K`P`(KoY0P1, 0 'P PUr -L M((@ $8 0@僖K(]@5k3p -LM 80@ `%0 R\ 0 [  "P|0P0C,P SP%0 ,0S 0 $xP G 00WL0$  P WL0$  0  R  0  ,0S L0$ r p$ '%0]@D]@ -LM,( 0 080 R0 0`(40 S P< 00  , %<@0/S D 0S/S 0S/S0dS@0 c0/S ,,0SɌ,80SɌ,,Ɍ,@0S , ! 0U D0U 40,P L0P  $0Sy 0Sv 40 ,  00,P #"@PD R,Z, 0 jb, D@0,SɌ,P00 Sx@T$  "}P, #,K0 plW^ ,P,P00 S SJT30 S ( @<@ <@ D 0S/SY0c@ 0/S^0/S ,`jnj ,WPP{,  (00CSP  z40S,r @Q p!0.SM0.Sʌ,HIS,hR 8 @0! RN d T+ 00(K0/S 0 db<00@S@ p0S4 0p03R0S@,PɌ,p@4 ?@p #pt,@0 R1L0$ ,  0p " , 00S L0$ 4 Rs L0$ o p@0 0 jȌp,0 @p3p@  -L(M0,0  p0(40P 0S 8+0`V/ R+ ,0 80CQ 0S/S0/S{L Q0$0 R3  0/S dq P8 ``8ۑ00(K Px8L0S < P `Pu,0n 0`"\ RU $0S0$0o0S8$㇒0`0K4 PP 0PK@4` H0 D@ 8 `8lE  00d R88 `?`00PS8Z3p2p0@-P@ R( 0S%\ ) \ ^ \@ 0 0\0 S 0  0S R 0 000@ 0 0  R P,  R/ 0\ 00 S 0  0S0S 0P@ 0S@@0  @0@ 0 0 0S00S0@ 0\@@  @0@- R 0S^ 0Sk0 0R 0SI0SD \  R0 0 \0S0  0S R( ^ 0Sm R 0S 0R 00 S00 S0 0S    R 0 000 0 \0S0  0SR 0S@0T 00 S @0  0 S 0R 00 S00 S0 0S    R R 0SP0U 00 S P0@  0 S@ y -`LV@3 ^=0S`PVPU p` 0S`` TPR 0T 0RU 00SW `PV p PU` 0S``P p P 0S0SP0SP0S  P 0S0SP0SP0S PQ00SQ00S0-@0 S0 UTR p-@LTP `P`@@T@p 0-@LPT P@@T0 p-@LT`P@P  R0T 0 PPP@p0@ 0@@P0 T- P  P 0S 0R PX4p -LM 0 0p00 `R 0|040@4 Q0$0 $PK @$00$0 08P#8@$00KukPkX4p 0LP  \ @0D0<0804000,0(0H0$0000 00L0S X R\0\0\0 QL0SX0 X0\0\80080@0D  D R80SPPPT0T D0T0 PT 0P0 PT 0D 0D0`4p 5pD0@ 0CD0S80SPDPT0T 80T0 PT 0P0 PT 0 5p`4p -L@p`\ L0S XPPU L0S \ -L M0   K0 P K 0*-2L?0\ \ x 0S00S85px0S 40  0 R  R x 0\0 00R0S R 0-L$@ P R 0100S P 0$   00$0@- P@P -0A0@0@P -LMD0P,4@ ` @P@0d0(HL@Pp8<P@ Pp K]@`]@L^@^@ -L M`0P1p ^0Lx@10P @Dl@8 <0@WKd@T  @T\h@T < @T:k^@:k^@_@T_@d_@l_@ - pLt ,0S+ 0 ,\`0h h0dx<0@@pP`0LP T0X@DPH`Z BZ YNZ  el i -L M$`R @0"( Px  0PXP 8@0H @`0 ,0 ,04 00`KP `p PX``@000p @0 00 x@0h0P @0p0P| YϊB?0 \ T @TP P01Ps #X 10CR c. \P X@T (^$K @T 0Xe\"!10C c RP X@T\ \ L _@|_@`@P`@`@`@`@a@4a@ha@xa@a@ @a@a@a@܏@ -pL@T P` 0 `@S BPQ 00 R 0 QR0x9kt9k p-0L@`T  P @T P pH0@Q @`0(0S ppx9kt9k 0- @RL R000 00@ dP h0S& 0S0 00@P0@0hP00S S t0d 0?x0 R <0< Cp0Q@0t0t0t0!Ce:kVUUU -LP  p R R000 @  h0S 00hp0\@0t0t0t0刔!Cea@ 0-0LSP@@000CSx00 D0D d0S0d 00dP@0ia@ -@LaD@ 0tt0P \@ 0P0 PT 0@h`0SP0 P0P0T00@T 5p`4p -L@p`Pll\ 0 @@(_P  -L`p[ah@PT! 00  R 00@00$ =`0WS]9ah@PTW 08 h0S `/h}`a@a@ -LM`, 00 Y a0@!h0S a`, 00/@PC`l0@S\h0SYO``d PR U@%Up007r00;00@Wd RhP UP @Up 0SP 0SP `@(KP 0SUR Ho008000( 0d^@ _T ^a@b@a@ P-L l00Csl0 @  S 0@0lh]D,b@ p-`LV@P00   R000   pl00l0!Ce@-Q @P -\ 00 R 0@~Vo:k -1 RL PpU. `PU 0 00S00` "`@v_;W`pGZ`V Z ,a'P0@X PU`(ڑ בr\9kpo'5 Pb@Db@ p-LP`\@0^0$C! I p\ ^6P @0  0S p@0@  0S pp$3 0S p p-LP`@`T0   000%VPp%* - L@0 1/ -LM\@PT`o T^dP[TYPW1 0p`X\ PH\ 0S d RE@$T@7 0\ 000   P00V@@T@!0400P x0400 R R 0S 0S $1 0\7@1/@@\` @Pd 0S ǭ$0 @0400P < 4 $0<$0h&p p-0L@P`    eP$0<$0p7$0<$00 -L MQp@@ @+ R t1\ \ 0R@@@A 0,P K0S S S -P0 KiKP0x  KiKQ0PU 0S0S PU-P $,/@$ 0 00$ 0JP.x9kt9k0p -QLMp`0T@$KW00 P@ $xW -80T 0CSL@80  hQ"80S@0 hr -LM8P@U08040`pI<40#G`9U2 V$P7U 800CS80 0,0@40, 04  KD0SX 0|<40 KiZ  0奐壐 塐D 4000 |P@/ R, ( L0S30X@`Y6:P,K,pP T,@  L0S YX@$:` pP P N(K0` @G0T04 b80ph0 R \X0` 0 40a8  p0,,0p " 8- X4p:khc@(5p -0LP@U3 PU0 `pP *@p P 0$0 p0 00$0$(0$0 d/0B0Z 05YZ 00@x9k 0-p0 ML@d@P@XX 0PP嶅<<0< P0 P K0hIC,5p,@5kh4p`4p 5pX4p - LЋ d@ -0 P0@L`pY@  p Rt0t0t0 @  @ 0EL X000 Rp p0t0 @tiY:k;k45p`k 0-@L80Q 0L0PPYpQt0t0t @00@0X{SLP H $ L! l-PhPP10 P OPPJP  L``P`PPP8$$P$P!$"2 0P1 $P 0p0K PP"P0O0@P!$0H P1$$PU$L$<P!0Sc P0Px_U|H! 000P10P0 R0P! P10 KP$0 PP!P,0 P 0PP IP1PP000<K 7PPC$10SH1 LH1 0SH1 G H!<KPΧPxPT  PP P HP1  P0$ 48P$P! P10PT!$L! 0 P1 8;k$od=^1kX4px9k -LM,0 0S K- -L M,0   <0S-K K -LM,   0 $0S-K K -LM,   0 @0S-K K -LM,   0 D0S-K K -LM,   0 0S-K K -LM,   0 0S-K K -LM,   0 ,0S-K K -LM,   0 |0S-K K -LM,   0 T0S-K K -LM,   0 0S-K K -LM, 0  0$  0  40S-$K K -L M,0   L0S-K K -LM,0  0S-K K -LM,0  p0S-K K -LM,   0 (0S-K K -L M,0   h0S-K K -L M,0   80S-K K -LM, 0  0$  0  l0S-$K K -LM,   0 t0S-K K -L M,0   x0S-K K -LM,0 0   0 0S- K K -LM, 0  0$  0  X0S-$K K -L M,0   \0S-K K -LM,0  0S-K K -LM,0  00S-K K -LM,0  d0S-K K -L M,0   0S-K K -L M,0   0S-K K -LM    ,0 0$ 0  0S-$K K -LM,0 P0S K- -L M0AS****************,0   H0S- K00 K<0;0 -LM,0 0   0 0S- K K -LM,0  `0S-K K -LM  ,00S K- -LM  ,00S K-40040 -@ ML̠ 0 @PK$G p-@PL@` P4< B 4  0Ppdd@$ -LtM0 @ K P ;t x0 000 0CS4ꀐ*D*L*T*\*d*l*@0K4;D@0D@pK8<  TLp |D@hPH`Pd`0\X  @$0 , (4HP0L`Pp(K  $ -LlM$`@0p\*  0 PP00W00S 0 @`T   ` Q X00S PP$K K PP l00b0at f@ -$pP0 LR3 ``L0S $0 0 @ 0 @" 0 H `00c@  9  0S` ` -L M$p0 40 R0 0,0 !P`Q VP! , 0 @0 RP 40  P000c@ , (KUP -L(M`0 p0K@0 ,0 P L H0 D@ < P8p 4 @( W0 PKX@ Y@00 (K0 PKX@ Y@00@0 S T R@ d -@<0L0C<0P`p U0  @. -LM(0`$p @PK 80K0@ ,P 8@ 4P K 0 K -`0L00Q00\0S  0@0U ppW 0S  +TR0` 0c0  b -L0L$  0 R02& 40,P -LdM0`0p@a 20 S] ,< D00( ,0,PP100S-PK S>PH K ` 00SP< PP8 0mPP1  00Sb  0?PP%40 H<00<0(K  0,0@0,0(PP0S (|0P# S 00l PJPSPPKn 00 000 @ 0( PPk  0PP@;40  00 |@KAP 0@p@ lP PP -LMPp, @P t 000(K`H0 00 F y@P00H00\ 00 @P C00, @ r -SLM 0 `  0K0 @Pt0 P4 @P 4O ,4 W000Q4PA(K08 0@P*4 =80 404K,K 0 K0p@ T0Q0A/ 00  A0,0CUS4 0,@  PUh0P,,@ 0 K0`@,@0Q 0A/ 00  A,3p -LM0P SJpS"P@?À Y@$ K0D0"D0`0P=PP $K( ` P - L00S 0Ex0(  40àL4bk -0Lx 4 40#"B ,0S -4bk 0-@L0DPS <00S%40"!B 00pWk00CS#ꠣ*x*x******x************* 00 00 $00 00 0-@Lx 0 .$ àhL*PPx "88 #$x00004bk - L -LM`px@P= Q R1@P000 x$ 0#40 (K@P  x ( 0x #40CBD * 0 @xT x00   @( 40940:00(  (0x `40;404bk -LMrld@ 0-LM0x 0 PQ%4@ Q Xh@`T 00  R 00@00 j=Ꮏj>h@`T0S = 0qd@d@ -LMP`L x0R  $010 (4Rp R@% 1 W#*1 R 0s 0 2!1C0QX @PBAD 0*T @D1 W:@0s 0 1P3!2C0$Q1 P{p , KwP ,80S$'P3ᘐBC $0S40040(0 @  0* @@d@P ukoWkuk4bk -LDMX @`P 00S S up 0SP;X@00 x2  $ R21C"0 @T `@ K0PL 0C"(40 0΁Y000Q 0 010!La000 Ѝ8C86pųE.@6pD6pnmp==<6pk_k0@-P\0  U0 @  R 0U 0  Q0a R.00  \@ R (0U 0 P 000==E-@Mp 00 Q.\R00S .0Wࠃࠓ0ЍQR J \.\ 0 S.SQZ0.SR.0Wࠃࠓ00P^ J0 S .SU \ ^ZX \0d `h`cV 0 S  ^Q 0 0LV \00SQH\ᠡ'P0@ S  ^R 00A\  Q00SRQ 0S0C0^ Wࠃ~\_00W @0'!000c00 Q 0l T0#02SpRs  B0 S 00l bS0a  ~0 R0M 0 Q0F0 s R .R =0@-@0 S0C R .RN21CP 0 0 R 0e0@ 0  @@  ^@%J 0p 0 ^ BJ0r0 ^J0 BR0000@000  E- @@  0S ~? 21C0 CPbUP U`p@PEupG8 0`P0@Sw@pPUpG&J 0`Pᐠ0@SwPU@J 0P0SU@ J 0P0S 0S =p@-@?0|03\0SP`@ 2 1C 0 0q  ? >1C0 0C 0S0 00n 0C0p 0S p/SN 0S~0S0 00n0C000Bp/SN V:0S~0S0 00b0C0/S 0S0S0  /S 0S 00L 03 0A0qQ P@ R .RQ4 0?AcQ 0?AcON -PPLpPP!0S|0 <@Ph@d1 T!T10Q@0!81>@ Q  0P@ 00C0$#Bb2 0a༐ 0> 'b! 1  b0àD~ pLAD RlPEd31C 0 !000(iL6pH6p=nmp=QC\e@0@- P$@ 2 001^   R 0\$0T0U00S 00T6pP6p R0S  0 -S0L@ h 0-PL@ P 0 0=.0 -LM@pL $0P PK,`K6   4 00     S0  00S K$ KY PPH$ $P S $0 $0 T $0 $ 5$ #40$ 5$ #40$ 5$ #40$ 5$ #40$ 5$ #40`$ `0$ #40S$0d   S0$ d00#400S0$ d00#800S0$ g0004 $x0s`00#8004 $x0scW .Pm z V XT0 s0^\ S0 0S0e U Z -LM@0 4pSP4` x0s $ h hP(K d0WlW;`0 00 , `pdX01^Y0dp$00W 0, r 00KPPX0 G2#,p t0Q= x0000s7 PdX0A1A ,0K.PPdX0A1\0080 Y `X ,0H `0Cd04K 函PP 4P JPPX0` 70bd0F 40dH80c• 4b4+e@ -LM@H0S` 00S` IH0S L $00  %0`H0 -LM0P4@4 x0s` S0p`d R#*d0X  B2!0C03r T0Q` 0`P0$0dP0i/d 0phe@ -L MxppPQP@ D0 "@@P< `<0#0 0AT@T 0S$0W0V00S  PD0@`(KT#00K`P'= =0@,#<`100@0 ` `8`00 P$p@ 0Ml`P 0(V2D 004 0U 00a x0s[ ,K 40KP,H ǔ,P ”,0 S ,0 T ,0 4 %,0 4 %,0 4 %,0 4 %,0 4 %,0 4`, 040 0 0d04 x0s? 4S0' 0 000`Q% D @c@0Sw0 40040S x0s``1D @0`0d0!55T000 0 p80K~PP X 802d0,0 $ (` $f`&rT6pP6p=ke@e@ -,0 L;P0R0CT6pP6p -@LplP`0p8< U##00V 0` S 0!40X l@-P`@p h\00|0S 1Ph 0\ RP00  h0Q0h0p0Q0p0x0S0#x0% -L MßD D@ `0 <` 04P p `\0 o ^d0( K0`"00K,nQ4 |P#000W{x00 00 s@0Z8K4 K@0Kr4Q <P 4 c @SPQ0 `P20s H<ɎZ0@0P10sb,t 40u@Pp0, Pg p@ X,0K@P4 Op W0@0@4 , 4@ Bf@6pDf@X6p -LMP p 02@$p  0 !P  0P:0RT0S$pH0 X1$^D   !T00T01 01$pP0S5:0lP`P00W0S W( K,0K($K ,0ܵPP$px~H 04 0 0, $pᑰP K$勰 -LM4p`P4K(K 07@P$,K(04K壵P,(0H R:S 0S Q0S\$KXPU,O -LMQ@`PdX 032`DnP6"\050@0 0 PcpPX 0\ H `X H0N a 0PLpP 00 -LM$@ 40   -LM04`<0  <0_PD p,K8 K0PP40K,08KPP.0, H0P*0@SH0 @0S0S 0 DP 0, H0 @0Sữpᷯ(KUP0寯<\PP0姯<00<0 -LM4p8K,K 0Q@P80K,08K彴P30P,H0P *@,0PH0 @0S\ 0` \ P d P 0d`p\(KT0SXf@df@ -LM00( 0C4Pp00 @4K,KX @D4 0`P1(K,04Kc`P-(\0H0 R (0S  @000 A @D\0 0S (D`P 0\ 00T00S$K( -L M, ( S0 S0 p^(0S$K``0\p \H 4`x0sA ,K`X H `0Ld0 pP@,H0 @ 3  AP,0x 4qP0 40X`0S( U$ q@0S (0y,姮 (0K,p pP(S0 `@0\p,p\ W,,ppf@df@ -L(M(PdL ^p4:dX0  a<à  0, `PX0d ,(#d X4K>< K,0K`P( ,0H S\00K H 40<K|`P00(\ H @H ͋P ɋS0 0 T0 0% 5#40% 5#40% 5#40% 5#40% 5#40`  `0#40S dS0d00#400S0d00#800S0g00040x r`00#80040x rc000,0SK[D  @  D 0 @ %P: ,0 @D0CS,03(0\ C(0`P< K0 (4K A(X>}`P0K40<K`P00\ (H @d 0(K0墭0ϯ`PL R S0 `, x0s P0H0  H L0,`@0P,` H -4LhM0,0  H x @00 T |  d 00 4| ` dS0t , 0tR/(K@ 0Pt | ĸPt @40p@ * 7K0P Pb P0t0 \ X  `\0 0R   S R\ q T `m 0Y 0R S .SY B0l0 D0 h0 p@KdhP K<0KPB`HK@0PK)@P4@PHHPH 0@ s 3S00S9 \0S`lp R PP pجhh N \ X ʬV\ `lp R0flŃ2l Q 0\0"'t V |  m0t0 N\`\ 0\`S  P X0S@H` 0 0  (H@7K Pd(pd0,0`0x 4r` <0SPZ V<` PRHl v 3`x0s00 @`Rw T 00R00SS  Q u  0 Pt d`0S  Z Rt ` <D0KyPt p D0R |0 0;0x tZq5\ X d\(p\ 0B,00.S  R R0.St`R <` T d`0S  Z R= ! | 0  |  ᦸT0  u  0Pt |d`0S  Z Rr  | m0 40@hQ`K0t0 aH徫t@ ]P t Y` <D0KPhp0S T x 060D0| T   d00S  0PPt 1\d 0A,0l0(0p0\;0t #x t0 6t 0x 0`60 <D0K@P!pQ T  &D0 |0 m` <D0KPt p0|SD0 x t}060x 3P0t@ 6t@ 0x (P060 D0t $o= 00  $00 0-L`P @P004  0 0 -LM0K@`FP00 0  -LM"0K@`5P0   -LM`B`0$0 ,` (  h0PSp 0S\, KRU   0%P$  $K[+f@ p-00LSP@0 0< 0S  `P  0P ph0S 0S p-``Pd0,0d Q L0L@ 0@T  T0@0 @0@ ,00@$( Z BZ  e|  t 㿈p -L  p`P`R x0`@>0Q `<;$0 :$0`" -L8Mx0Pp @P (KPڈ7 U@  0` 0``@ =T$0040  0@P(K@ H H :'@P x0, P 4 0R   V P<h;e`, ;00k000,0 H@ 0 4 !0 4 !0 4 "0 4 "0 4080 0$02 0$`08  24 \ 8#8R$402@SQP  0 400 0,0 0 @400 0002SL0 $PP80S 0 40S0 x0 0 40,0080 0$ 00020^t 8 0Bp \n:0L k0Qh 8^e 4@,0!< 80x D 0,<0r8<00 L< 2!?04 H @D000H0`T Z80D 4t0LP QT 3R 0D 0 D x 2tQ0 08l0l0;0P S@CXP@l0 4p0r0@4 C`\ d0id @0RX O@@0 40,0P 0 R,¨0,0 |QKP00B P< vP P@P$00104P0010h0 0`b删 x0g"0#4X0 <0! .X@ $ 0@,00@0H&0%40| e0  x0x40+H#13 嚭@Pr,0H@ ޅP 0|0,00 +0 ,V0,0 yX ͅPD DžP, P (of@f@f@= -LMDKh p | , P`P$ # `0S    `P$ -` 0S`P W/K-`, 0R(K`KZ 0=`PKKZ 0 9ps @0,00C 00K(` 00A`PP00S` !x  0 #40S` P $0 lm0 0 z` V$0P 0S`V`R0 0  00 0 0JHx0s00C KP3  &`x HP 010o00KKZ 0 d1 `0 0 d'` dV [ 0%`0吀P 밀B_ZׄPhZ jZτKZ Y_bZDŽKZ [ | „+$ouk=E0  B40R++++++++++++++++++++++ 000    00 005w-|`| @!0@`$dP#r"XX 0' @(?0# O $ Y `@&0#@8^nCCX좙N 1s s s (080<00 080=k=k< R00 0S00@Q 0S!0?A01,0000@Q 0 S 1 91 0-L M Pd @0 80/K0 p-0L@`` $0DhVP4%(P%(P 0 0"$YVpg@Dg@<@Pg@ -LM0 pR 040`V  PR00` X0@0b4` c SPQ 0P -LMp 00匀0CSD0P`S u*  x 0D0,  0S40@` X0b5 ` PVQ @P 0@0@H<zP`0@0v $@Ầb# 0s0sVdg@0<0< k0 <e -L@- -L@- -00 LR@`Pp Np0V a_Y -LMPPpWIpP 0@ BpT;R6KpPᅰ( 0 rpy p-LM80@SPP Kp `K"0 00 4 0 00 000^\ S0 0S0T0XV 00Z0 -0@,LL0 2p -LM0 ,0 @P`0pS( d0R`# :nL, 0Rb(K謐K gd K`P 0 !0 04帀KY0K00 x L` H` )"0 00 ,x0 "0.00  K0%`P0  0 n 0TKV KX0K90PL0NKP K.Y0[ 0Y0K0 RK%0-$o2p= -LM0 ,0 ``0S4p( d0R# :K0, 0R(K@K 0@PK@KՁ00 xp !0 00 x0  000 `X 0H `0Cd0 PPP埨d@H封H@ 寁 H 0#40%[ 5[#40%[ 5[#40X [ [5[#40$[ 4[#40%[ 5[#40x `r= !4 0 0 %[ 5[#40%[ 5[#40X [ [5[#40$[ 4[#40%[ 5[#40x r P d KP)  b0#80 [ `0#80c  @0S 002y TKV KX0KRr0NKP KLY0[ 0Y0Ke@ PK K 0H YKL @ P P0  0 tX 0"8,0 RK!0J$o2pLƟ, 0 R(KP L0^\ | !PL x S0` T  0S x0Q 0 0 x0@x @0` 0T 0Hp0 Ppt (0 d p,L | L) ``0P 6TQ   \  Zt0SHpxPf0 R HK *P]HPp Tt t   \ t R S0oT\atpiP\H0 Ht 7 KPJ00 0 0 \QZ  LKLPX x X \l (0h0 Z T\QpL kL|  Gx 0@00L) | +0 .R=| tQ H(00 \0 0 PB `0S p | qT R0S8{x H@w BK7K p0 ,0d 0( xp pP BK 0SLxl00h 0( 00lxpP 0S | 1L}|  +L"`\Xd x2p 0@P Q | Lp^x  0S\0d 0$0XQK |  RE X0`@T9 `X H `0Dd0PK pP'P $4H0@x0ps` 40  0x0s $,$8  0PͣpP L@0S 0P吡L $wR uRsRqR$or=g@g@ @|g@ 0-P@QL8Q0h -LM@p0`SP40s0s 0s$0sH0sL0s (KP0s@0sDq L0$  0R  PD!88S(-S0 0S00 00 y L0$ y0  ,0 s 0,0 0S P0 S 0, Sp 00S~ S  0P(0s L0$  0R P \0  0P00S 0  (0s 0(00Z0p00s 0000^\ 0eS0 0 S0 0s L0$ d 0S P]00S 0 S0S000S0S0S0 0S0 0(KoS0 0S0dYx 0, S 0PsnL0$  -qvJP'DA0sMg00sz -LM0(@KP4p`0 004 0 0y 0000S `I Pj S0\X240 S0 0L004 @ 0 0400H@ d 40 Q0 408 <0,0( DS0@ 8D04 d0$04d \0 00@L0P@ 000 Kd0S 0S`X H a0C$0"@(2"(@1<@00 !!   x0s@0! T0XV t0y (0`T 80[\ 0^bS04 0S00 0a0ZU0m -LM@ 0S4p00 0 <@00 !!  0 0@@彽Km -LXML T 0 SP 4 @0UP PS00X0 Pd0 0S P(KRX0L4c cb SUaQUs8` 4p L0P h d0 \@X`@ dPQ\P H dD u` X0@P0b# c8! S Q3P< @0   0V: X`d0 ` `6, P0K.QTRPP80K0@0Ud @0jh@HD0cS0! d`PS0!\ lHS@1@!L P0UCL0ST> @0Wd0X@Pp@ lP L l8B \AQU<&`d0 ` `6, P@K.QdT0@K @ڣP,KP8 K0PP`0K,08KPpPUX^OTL0$  JP 000E꩞C -xLZM0 ,0 p!  pAl! S04  KK|l `0S! T1 Z 0@0TTlAPd h  T!20 d1 7Ah 0 d1p2` 8#8Rx1 Wg@ P L! @@tA l!P pt!d0b0a1 KV Sd00X\ 1 եPa8< l2| \Y1Q 0`! \1 0UP!X1 pR/KO?KNOK@P K81RKUP @儁@08!H| cX!X! 0S 0PSY Q U0x p40 40Ȍ \p@04 .1K`XP KK -K-[0008l%#(@Kl0S/:MKl!P %hAT d 0L\d 0 @` \! @ hA X! H| 0 ` P @pR0S S@0`1 \A @XA @娝`q\!rKV 1 R0dA0d0l` p0T!00b0p1d P Qڌ0 0C, 0R(Kx0s{ 0@t! P1 LA 0X!MKeX 0@@@`a \q 04 00,0S<1xSX `H a0C"0n2O@ T04 .1KXPM-[(0K 01BN@0@`1 \A @XA k @(KV "l\{ pt!d0b0a1 KV SX\ d0pPa80 `2| PY1Q U P!PyA0 0x@0RW RU,ڒ0KK,-1K{-1[!0008#(@Kl0SC:MKl!P % 0h!`@pR d10CSd1 `hA@hA PUfx0s@0041 41 0U.1K U0KK,-1Kz?@嬜KV K>KXnK?VQD @PTA 0CL0P@P\ ] PXPV X8 UA D8 0L$T40l@Q  ,0T0\0(KY  LP\ *L T0d D 01 HDd0X0C03>\ 0C` @ < X8 9^ 0nSZn< ^ZRQVp l0 T 0\0 4 ^d0 ` RLDd0S*d0\ R X0P H` \0b@ 0l5 \ Qh0 |tTl0pP` P `5>VNP1V0hR3Q ʧ Ld0 0SXU H d0Pppp0 <Hx00@p00P`Sm 0s] HT\ dP`0iZ! /L d0Rp:LdP @PF00 HT R8\ Q,H0d 0S* 0(L\0P00T \d H0XPRH 0Kd0 PDP\ 0 T0MQ040J@U];0s\0STT\ 20SH `0X c51 a0 QVP t P $h@0Sl0 l0p0p6p0  0- LP X0$ 0X00H0=k -@L T  O000 -QLMP P- K@K00, P0S0H@K00, PQ0 Q=k=k -1L@T6 W@1 0pS0pQ*ڴ 0SP#00S PU R |`0S l0S Sh 0ɸ RW@0D0P6puk4bkE+6p -pL@` PP <@p ` 0 0 0e0I6ph@ -pRL PP` U @W@1 avpWP`I h@0 Vv0  0- L@p6PP@ A`@0S @-:0S 0S 0s $0S0 $ \Wo -0R,(SLpP ` VA G P @TZ,@(PY EP Z,(@Y 0-80LS@P0S  R00Q0 0008m P PP II,h@Dh@ p- L 0`S t0 PUPU 0S 0S2@gqpp6p -0L@pTP) `0S0 uPV 0R`@TV 0S 0@S S1;M.6p0  0- L@`1;0PS,6Tw 5T <5T, 5T 5T 5T p5T <5T b5T 0T 5TL0p0GP d5T :0CT .H5T @5T 85T p(5T o5T ;T 5T0S i54T0p;0 /4T 0T0p00 0CT0p04TQ4T $4TP gpH4T 0T 0CT@0p00CT 0T~0S{ ?80@Sp r0CT 0T 3Th pL 0 P0 0T0\0CT 0T 0CTR0p:0O0CT6*2T3 2T0 pDi0S< i0S52 0R 0R 00 p (H0p0$Q0pp 0 P 0p00@S0p@,@ 0pD00p0=00p0S0<0@p0 p 4001 @p 1  i=0p0<0p0P1<1  P 0S0p 0p i0p0S0@0 QpH0T :00Sp0T 91T p0rpP080kB @~fwBfB{BlB sB@f@nB@wt@|B@vB fB@hB yB}BzBjB@oB@pBxB@vt=kCCqB@mB -@L9D0S HQ\T0\0L b\T0\0 -LMS00 Sp p@`0\P, 00  R400404 0@0 @ @`0 h0 封 ,00:0`S$P d 00S* P 0 0 $  (Ko(Ko -LMQ`/  P 0 PR@T% @T 00= 0 000 (pP Z0K P0 v<0S101@T(K0K (H+ -LL̠Č.Č@!̌K M0(K.0 01K (@ 1[!0 !K -LM@ 0  $K1K$@ 1[!0 !K -LM@TPp4@ ' 040 @T 00= 000  0(r`P X0K T0   <0S40040 @T4(K0K M!50  00- Lh@0PSb00  0- LpN0PS`  0R` X0 0rX0> $0S;1 $ ^!\C :0S \K | 0(X$@L\":@T* 0  0@   `0 @ 0  y0$0epP` #P0Se`Q\`V0 0 0 0 ohh@ Q-Lp`V Q CiQ Q `QE ?*00@ T2r 0iTP0 ;Tr17`q @P .`P 0iT& 0Y#Y#  uwP ` pw Q0 0Q Q000000` lq 0 0i 0 -LCMq0  0 $ `B @R` P52` P`$ 0R& K,IK J/K0_`P(h 0S`q(`81(0@ R0#1K0@ (`$o<=0@-00 \ PllP \@0 SP 000< 80P 000nS0 n00Q Q 00 84 004 <0-00 \ PllP \0 S P 00 000 048#0A S@-2*Qf 1@ 0S'`+`+@`+@`+_+P`+_+_+0@S 2S K S 0S0S Q0A0@S. )ڀS S) `S 0S0 S 0S @S00Q00Q`S pS SS SS S0S:00:PSS 10 S R=k -LDM@dKP@p#pT@D` @0S񟗾hh+`h+Hh+0h+$h+h+ h+h+d+d+d+d+g+d+d+d+d+d+d+d+g+g+d+d+d+d+d+d+g+g+d+d+g+d+d+d+|g+dg+d+d+8g+d+d+d+0g+g+d+d+f+d+d+d+f+f+d+d+d+d+d+d+f+xf+d+d+Pd+d+d+d+lf+Pf+d+d+f+d+d+d+ f+e+d+d+e+d+d+d+e+d+d+d+d+d+d+d+|e+d+d+d+de+Le+d+d+@e+d+d+d+d+d+d+d+8e+d+d+d+d+d+d+d+,e+d+d+d+d+d+d+d+$e+d+d+d+e+e+d+d+ e+d+d+e+d+d+d+d+d+d+d+d+d+d+d+d+d+d+d+d+d+d+d+d+d+d+d+d+d+d+d+d+d+d+d+d+d+d+d+d+d+d+d+d+d+d+0 W*W$ KF$0S; K W0܇0a2W 0\ :0S b0 bS \* 00a``000 0 0 K10D`0 K10D00WW 0P :0S b0lS P*0 01@0 WG*W$ K$0S 001@0P:01V{ 0P:01WgWj 0P:0Sc b0lS] \P010W:0 $("0P010z0S2 0< 8mP 01ff0S 010c][`Y01@S0P0 K10D`J0 K10DD`B@>0@-P@ R( 0S%\ ) \ ^ \@ 0 0\0 S 0  0S R 0 000@ 0 0  R P,  R/ 0\ 00 S 0  0S0S 0P@ 0S@@0  @0@ 0 0 0S00S0@ 0\@@  @0@- R 0S^ 0Sk0 0R 0SI0SD \  R0 0 \0S0  0S R( ^ 0Sm R 0S 0R 00 S00 S0 0S    R 0 000 0 \0S0  0SR 0S@0T 00 S @0  0 S 0R 00 S00 S0 0S    R R 0SP0U 00 S P0@  0 S@ y -`LV@3 ^=0S`PVPU p` 0S`` TPR 0T 0RU 00SW `PV p PU` 0S``P p P 0S0SP0SP0S  P 0S0SP0SP0S PQ00SQ00S,, 00S0000=k6p R000  B 6p0 R0 >k=k -L$M@0Q0  %2 @00S@0<5  0RK@00CS@0ʼ5@ 8#8 % 5 2K4 K $oi H= -L$M⠡0P(0 p8#(`HK908#83K5X @T@T 0S 0Sᎅ@T`00@T! V 5 8#8 #K%  ( 0R"$K0HK03Kx5 P *P P *Sg$oi RkT= 0-L9 `@PQ \0000  `00`0Q0hz =k -L` pykH0PU ,0S @A@PUh[ h&p 0-L ,0P@T @T0hH =k 0P c *k p-@LTP `P`@@T@p 0-@LPT P@@T0 p-@LT`P@P  R0T 0 PPP@p0@ 0@@P -L M<@KP`p j81,` 0 P 0S@ 0S  @TKT00 ,4Q =k6p 0- PR0000 0@ L 5 P  0h0 -LpP@h58!`0hP 0pq@P 0S@0S`x@h]6p=k 0- L0@SP 00  0@ 5 P  0h00S0 000000 p-`@P LP 0R@j ph=lh@-Q 0P P P-@0 H0 D  p-0L@`T$@T gjP 0 RP U 81 SPUppp=ki$ 0-H0L@PT $@T ;jP0000=k 0-<0L@PT@T 0$jP0=k -pL#W`P,PU) PU7 0SXQ 50@^)*0 0# 0 0#^ tiP Q  liP PUP^ -1LM@ T$ P$@T iP0SP 00P$ 0R! K@`T SP4pK`9i 0i 㺘P@T PEU=k$o`= -LMЀ 0R$0 Q   Q$ 0R  K@`T RP4pK`h i }P@T PEU$ot= -L(MP R0P,0 1Q  R P 0 0S0CPR PQP P, 0R](KP0@l1ZS RLKO0  hpW60cPU   *P@$ 0X@p PEW U`0S <K[ X @ Z UP0 0eP 0@ <Knh  P PEZ @P $o=k= -LMЀ0` V$ ! P0@T PPPU4pK@T PU `3h h 㵗P $ 0R K $o6p=k= p-@LT`P@@T= mhP R000 0 0 PP 0S R000 0 0 00CS00$ R( (080(0 0$( pp=kL 0L0 0- LP, P@ @ Qh 40$    0$ (0@ 0=k -0LSPp @T @T gP  `P"  P /h@E0/S)h09S@Ppm 0@T$@T gP000@p 00   00 ` =k 0-81L0M0Q@ T $@T gPP @ T(@K g0 (0K'K@P <Pi@PD@K l g @P <P@U@P 0RK0=k$oh@j>= 0-0P@L0P $P$00 (P(00 ,P,000 - L@ R! !  110C0C11f 10P RZ -LP`p@QT 0@SpW@0@Sp@0 0C@0 fH0T0H0P U -L`0pPUPU 81W5 @T@T 0 R0S MfP@=k p-L M8`KP@ If(P  PKp=k P-L`Pp @Q Q P k@P 00 0@@@\ 0\   + p-L`l0P@T %0B8R#8 S51S@T0ph=kC -@L%(h -5@05Lo%`0 hZc 0-5P0L5@T bb@T  R! !  110C0C11e 10P RZ:%0h p-L$M`00 40P@T@T 5 5l8!#8R KH< K@Tm 0RKp.$o=ki = -LMX, > 1`V@ `V; 81, R@T@T 0SPU 0 pR*0 0# 0 0# WY  P P P㜑 =k -L0LS@  DPL  $< 0L0ah 괂+CQ -0LSp 00C0 SP@ 00BR0 SQP@T`U 0S U0S; 0`V`V weP {eP0gS"\ 00L0 S0gP ^0P@@00L\0 SL0!l/@!b00RPXP0S =kgfff p-L@`P PP  R 5p@f p-ppp p-LMK`e@PP PP xPPyP  -xL@\P dd P 1S D1 RQD P %0S 0R*0P 0Pr0A!R<10 Rm"pW00R:R*  5PH`P !c P$0000D7=k>k>k,@h&ph@ -L@000  0@Wah=k -L@00S0 0000@ho=k p-1!S0#RL:5 `0 P0 00   `00`0p`0  p0`0 0 @0 l@?\0@P `0S php000 0@@0=k7p7p p-QLU` @ 02phMp -LM2pS0 ce00S P, h0C00 0(,0  q,0(@`(000 00cPe0 05U0d00@0a0 p@B  @0PU0do+ -L M<@< 04 PI/  7 Khdkh@6p+ -LtM␫PU, `p@ p;U h;Ua \;0S`P <;U} F``, 0Rt(K:UK 0UP :UI P` :引U G:U nP0CU0CU*0CUX 0U 0CU \ @ 0 `5 0# W`05 "@ex`Pd````9U N0CUD t0CU 0U{ 0CU`㰑`@ <9U3 <0CU 0Ua 0CU~1`08U 60CU6 0U 0CUi`P`P~ȕ`Z8U[ 0U 70CU~U`PL1Sd  `{D8U 88Uh41`0p 8U; 0CU]4`P+N`P& Y7U v70SE`PLPK 0Kⓒ`PC_Ov$oi$ii$zi i$xi Jii i =i i i i$i i$~i ?qi }p6i(KiFi@i i p-PL5(";5!2"1!`,%" R 010  0 `  R0 10  0 @T" 0 R 1S 0 0S@T 0 R0 R404 140 0 40 sQ1@ @2A$(,0@T 0 R 010Q@TY@0 !phTĆ+p+p+t9p~pr=k=k}ph&p=k -0LS@ S 0SQ 0S 0Sh< *_PT 0S  _P Lj> 0-LPP) @S& S 10 01@T 0SX~10P 0y1@T@PP@0j1=kTAش@HH-0#" A0: 0 A  AQ0A0AkT=0@-PR@ 0 0!\!""0"!0=@-pR` @P@@ 0 ,>#!^ """!1# ==   -"LR@ \0700"R p-@LT`P5 T T ^ ^p/p0S 0S0S @T l^ h^p3000 00   00V^p@Tt N^l J^p@0^  0@ 0000 06^p>k >k>k>k -L M@*PK0pK `P5BT+@T(  ^P ]P00CS0 R07004` 20C2 ]P2 0C2 `$K  -L M@pv*K0K` DPP*0[P$K00[ BT@T  ]P  ]P0007 @P"  ] ]00 p2 S0"00/B 2 02{]P202y4Pu7P -\ \:5S0d0\-P41P0h040\0\ (p2i 1i i i -0@2l D0C"2X 00/0020SL \ @42h@42|k4Wk 0-2L@41pSl0 P4e 1d hfP0e ]020D 0hu+ -PpL` [81W(0 58#(k 0.   R P 0S  RP 0 \PP  \P11<<88#8#8110 0@0@00@0@0@t04 !48#H) 1# 5 > $3TT # Td 3T00S 0Sj \i z\P i\'81 2T& 2Th+p2@P pu0Si ]HB@ D0RW@ 1 00Sa@`10`@  @ 5y51@P pH0SV 0At|1@P p80S7  \A0S H1R0T4DZ _`P  ߸ kp4ZH00H04\L0Spm000 0@@0000 0@@0cZ000 0@@0>k7p5݆7prt9p~p -LMp@AAP`2@ V[(KT 4 P:  dP 4  P \Q p3 QUA@@@P R+ +8+H+8+8+8+8+8+8+8+8+8+8+8+8+8+8+8+8+8+8+8+8+8++8+8+8+8+8+8+L+( PPo 804 0C@800-/@4K g[@.K  `[뼀 ]^PP @ ἀ ZE 4K 㲁@!1`R?p[10107@z0.K ;P㘁@k.K 0juP 1  5  ?@T= P08!Pd 4 P\ ԷA@@@0!0 1SQ@P10Q!00@  !0@ 0 0@0@&@@ 0]Ps  0@k1kh@ʚ;Q0X0ᨁ0 Qp-LP` 0CQ :R  R R /pt0Q p%0CQ<5@@05V (00p0h0pp2i i ܶ+ -Lp`P DP 5AUp 4 20S00 0@0@0O   R R 0,Z/Q`@ D0RH00H0yZ <7LQ`pZ40 3A0 D@ 1 00S၁@10@  @ ؕ0P` @"0S  |P`0@ | 0 OP`P`000 PPQ-h@r~p7p7ph@ -00L @P |7p p- L`@ PP(  00,0 h0%0 1!0 Td0f e ^D 0p4@P pi@+ķ+|7p -@Lh(>k- 0  \  \ 00SP \`0S S S 0S 21C 0@>k p-` LPP0#U T @u T0000 0  @Tp -P`QppW@L qTo 1R& 1RP  0Sc0PS000000P 0S 0S PP P oP>   R0; Pp`PP`p XP1P!  p @P@U00S 01 @P@U00S $LPP00SP P0PP5i 6i( -L@`p  PP 0` pP0  0+ i@ 0-L @PP 0  T*0P P 0 P+,i@Ti@ -pRL` @PPU@ -L  c0P ++7phi@ 0-dPL@XT   @ T03` u7p 0  0S-0S  0 00Sp@- 0@PcUe\5*0   0`Q  ^ T 0SQ 0S p?R00S eQ 0SP 0S pr3p p@- `P0Q!U 0Q 1 !@ T0 0# 0 0 0#\pp0 Pk -LMp, ` 0  ``0S@ T00 R *0Q 0Q  R 0@0S`0#0S0SATg@1@0T 02 0Z@T`PU"0Z,PU 0 @P  @T 0SY 1 !]PPU,0S@ OP@@0\à@-0@    @ @0 -L` P@@Qp >* 0 RQ 3  \0R 000Q ^f 2 @@@ 0  PP0S:  0   @ 0 p pPP00 -pL0S`0S 0@T  0 0S@0SP U 0Pl P 0 -L@p`oV0 XpP0@@ 0 0 @P<0 40\ 0, ,0 0$ $0p 0kk+ ++ +D+ 0-0LS@P 0p o0P 00h0 0-0L R (0Q0 R0PS0hJ) I@P 0V 0X0X Q*00Q8P 0$P) N)h&p7pi@kkk7pi@i@ p- L@PT0`0 U00 00 0P0`@p P@(7pi@ -0 LR* UP -LMⰒ`0PPP@R@T%T〢xx2 DU dUQk*0PSh 0RS BQ:`aT"0S`1 pqQMP!``08Vp9WX00S0 Pp \10P0NU MUH1, K0E,0pS: ^!Q Q\ 0e 100 0  UPpeU 0 00`0 R 0e1000<8(0N S7pkk@k7ph=i@ -LM `PpP @  RX@U TU @Tp R P 05 0S PU 0ES 0 Y Rp T 000S` 0 P 0SPP0 PP 0p0 00R '  00CS 00 ^ڿ0S  \ R0S P P  0S'  p P @ 0St @Tz  d>TPf p \0SP 0S:0S   0SPX `  0`V  `| Q R 0S  C'p50S  Q0A 0 >\ P \00S Q  00CS 00R 0hd 'T 'p0D0   ( 00pj@j@Hj@j@j@j@7p -LMP < @ 0`Q40 8` 0` 0<, K,0SB Pp- p@Q V Q 8CRPP0pS @2PQ (K T00S p0 S <0 00 0 V 8 ` 0 0 8000, @R@ V 0 0@S@ @R4 00T00Sp@T" 0H(8CR0P ,0 SPO 0UM P^Pp@T -P0UP08#x0S5 R 0AS0AS R0 040 BP8 k ` 08#800 4QS 0 00pSo0 S 00 0@RU| Q 0 S R 8CRQ; 0 Sf PR 0S 00 0 P@SP PEUp@Z@ r@Q R#3p0pS 0$%P% k@j@ Q0-L@P0h0  P  @ P00T00S00T  RhP 0R Qr r0R@QPr0SQ * 0Sr0S Q1 \  -L@@PA- 2\ \@pQŸ2 00l0a6# a c$"cb!0b0a!6# a c("cb!0b0`# ` a` P%"^0a@0b@7#0lc! c a$"0a0b6#bc#! c a("0a0b#b`! ` a%"^0a@0b@7#0lc! c a$"0a0b6#bc#! c a("0a0b2#bc! c a"^0a 0` 7#0bc! c a$"0a0b6#bc#! c a("0a0b2#bc! c a%"0a0b'#Q0 |0x00b0l6# bc! c a&"0a0b"6#bc! c a""0a0b1#bc! c a'"ky7 p-L@L0`SPP P0  hpk - LRp` <0S 40 P 40 0 R 0S 0 R 0S P@0H$H`UT0D@`fPUV00S@ PU P80080pDk(Rk -@L `P pP 0 0 R PPPU 0 S 0:: S cPP0 Q 0S R 0 S PUX r0rS f@P@P T 000 RPPr r0R Sr -Lp`@r00S *@P @V PW 0P 0 RNPP @PP PP -rXLPpr@`F PZ 0SJ Vn 0@S``@@ 0S T  0R0S @T r`Q; WX00S 00P 0PPP R 0 0S/ 0S Q 0`0P0SPV``@00PP0 0RXp`P pGW0T@2#8k@ -@00L] R000 h0  p-@LTP` X0X bP P 0< a!0S00@@p7p@k@k7p0 7p - QLp@`0P& S 0S-` XOU` T.++++++++l+$+h+++l+++|++U-` PG @ XO` @ G0 ` `r`"-` 0S* ykc`cc`W @T8`0 0 0` @^.]Nc``P`9` 0S  0`Hk@ --`1LM@0 T, ` 00 A p@T3  0 P!0R!R 0SP 0 NP P  NPW  0QP 0 cP Np@TW 0 cP N(KXXp7pʚ;0 R0%3 %'@k7pP (0 P0 Q@k7p 0-L@PP P0 A07p - L,-00 R310 P0 @k7p@9p 0-L@P0P  00<0 R  R 2S@k -\L`pP@P 4 #P P%U0pS*@k, -< LR@ g00C0S 5 40 40 r040r040 -0L pR㐀` PP%U q@P P P #P4 #P 0`S*7p@k+ Ȱ-P2 S R 2 S,00CS,0 R0000 0 䟾@kp@-@` 0 PU1! \ *0 00\: Up lp@vM 0-L@0#PP "gM"0  0 M0 -0LSP' @T=@T MP,00,0@Tp, "0R8@#xT0W0 j`P M,0T0r,0  @ 0``@00 ``p@kP -`pL =PP# 0@T \ x0$ @TP0S 0Pl 0S 7ph&p@9p 0-l@LTP#l@T  R 0 0 0 R 000 0 0  0S0C0 +l@T07pTk@ -`p44!L l@ T\ P@T 0S R 0 0 0 R 000 0 0  0S0C0! r DP7 pP `l R0 0l ` 00  0001k1k7pk@ P-L 0S 0C 0 hIk@ -@PL) 80CQ840Q 0 x Q00C0M@P` #<h 0 hom7px8pk@k@k@ 0-L MdP@TX0T$ @?@0@@ 8+,O00K0I@kl@7p7pk,k@ -p0L @R  P 0@ 00@ R 00@k7p P-LPP:0A `P0  @P㭼 ̀Pp  p !K  !K㒼㏼`@P0P  80P($0 0o_7p@k7p -LTM0P,0 pKt D \K@lP 0P @P 0 @TT!` 0p0`p 0 0S D:K  0lP @ t',(K,@ 40 800800 S 8 ,0K`P ,@ 80p080,@T 40  p D K 0l0  d 00h0 <0S 0 \ @0 X <04  7p -LM,0 Q0A00S0C0`00`SP 0S0C000S9*  p@P9  @0 JW  J»dP 80S0C80$0d040, ;Pd T00X R XRX  0JM -Lp`P-@T 0 R P@@P@@P P 804 0C80 0 R @@T 0-80LS@P 4P 8 R 0800P 0SP 080P P4P 8Q `44P30Q  R 004PPP 00 q4 -LHM`ǟPp, d @`P/`  000 0WQ W W, 0`0 dƟ, 0`R(KZ Q 40  @0 R4 @040  < 8 40 <0000D R0 00NK;,4X0`0 - , x@P7`  00Y40 ~100l0r0Pr 7`   @PP 4P  PF @0  @P= 40 = 0dP 80S0C80Ń0d0h R800C80 h  P)40@ 0R40 0S  $Z000 ` @g80Sb080` ^` [` X  `P P40740 0RX0 f P4,P  0 W0 0@ 0<0: r0 X0 0 PT d PG0S  Z@8008040 L  y007 P dP ٹ` l @ 0Sh0 k l LLl80l0r 80r hX H  P iP P4040774040TX (P\ =40 hPHdPE ㉹{ ` /P` 4`40 r0 X0 0 T \ 80S\0C80;TQ]@0S h @0@ 0<0 0 S l w h l o g00C0S540040r04 < <4 r0 $ox8p7pt=l@$l@ -<1LHM$1pW- PU' 0 0X" R 0 0 0 R000 0 0 `V 0S0C0]PUpW  8(Kl@KDG0 0h  r 1k7p7pXl@ -LHMpPU$  R 0 0 0 R000 0 0X  `V 0S0C0|PU R000 呸 Kd@KDG0 0`  r |7pl@ -2LxMP 0T0 , 080 ppQ` ` @KD]G0X0h0 p dP  0_/NKl  T0K IX`o , 0R(K _? NKl  T0K .`PT@T 80@ 0CR80 @0S  @@P 0<0 0 S    T0Q%0S" DHP7` @ Vp }P800C80 @0S PZ G0S3`A`PT@T 0 80S080Z| Gy|$ol@= -LPM`PKpDd Fd@ d0K\ T 0 X 40 r <`p@0 0WTd 80SK080dJ -<0LS 4@P  # -40L h0S  - LR@ <0S 40  - LR@ <0S 40  -LXM p x `@Pt@ 3@& 0 t0 &30#P00S, 5 00 R' @PP 0t03 R00SI TU000!000pKDFxpK t0l hp d T (K EP,,@0T P,A@,P 0S 0S40 0A@P   040,  0P, `@pKDE(0K#x`pK8 <@ l hp d @` @,PP 4`P0t037p7p7p -L M@ 0tj%El0l Q  0S0 QPKl@@9px8ph&p7pl@ 0 000 p-@PL,`eET*^1 @0 CS  @ Q00T0#Sp p-P`0LCE00 p -L Mp 4  , 4  RJX 0 Z0 PP 0`@PD 0 10 0BR0U ` PE@ TXU00  S@2 ,0S/ 00S 0*0S' 0T P (P @0 S,  4  R R000 ղR000 Z0 P P00PUP U 000004 @ (K 0D -LHMlKP DD1pWX5R pWR  R@T 0 X P_0S `V 0S?0X0 @T/ X6 0ST 0`0 0 L P?0`S P 0S  00$l0 0sP 000@TT@ L@ `@ pW(K 5d081 0l0 0 sP0 00=k -L(MP@P`0AS`(KHK `!D 0`T<0 H D 4 @ T pxP H0L 0CPS |,|,,P,,D@ePAL``L0P<0@ X < : 400hS `300  `L@`U @%T e0P U`P  ``0 pBK K ,0K21C0b ?A1c07pX,rgfff -LpMⰁ0`S( @2 PKDC< 00 D\0   @0|0 x 50p0 7S0 `;0pS PU 0S( 0R1$K 40JpK"\C"0J0KP  HKCdp 4 L r0(0 080<0< 0帠 0rP00000$o= -L M 0@0 S,,`,,XP,P @CP00S?X/ , @@  C,Pp @Z `Q 0 70 0BR0`0 FPP+p W@00P0, 0 0(KP,P YC@P00S ; {C1@CP@,P P@,P B 0-40L@0PP X 0WP B8000a0h400400hL@kCgfff -L`R@pP TU B@@TS S *@C0 0 80@0T@S# S U *@BC0 0 000U 0S @0`v P@ @8`U 0S @000 -LM`@pTPQ T< T  0p $K <QhQ@` H0S p@ MpP;0 Q080? Q 0001 0  V0@004 0 a `R \0p40 pU P Pd`00C0 00C 0Ͳ (00C0000r,09p@k --LM0 pR,0 Wd2@TS P@T. 0 !0R1S R SP  |AP P  tAP0`Q , 0BSX,,,,,,U 0 `0aR  R  40040A(K 0 FVP KA 02 8p.40`U  09DP0  0 `0aR  R0 0 VP 40040`0QAPz8 r 0Rtq0PoZKPj7pʚ; -p0L PRp`P @0U P A$$ $0 ph409p@k@k@k -L@PM t x \` P(KpPpp ZlKD@t ZR00S pTp 0 X  lKX ` L Pp > 5Z0$00  l0 08! t R00 S V&  p00tlK` d0 hp ^Pp  504 000r x0  0 l0 08! W4 0 0p0p 0Z09p@k@k@k p-0L PRp,`P @5d081 0`0,P0$ $0 ph09p@k@k@k -LP ^@P @00 `p0Z 0帥,嶠T 0 @0 0md09p@k@k@k --LM8P @ 0U, X0 T@ @  0SDPP 1 0S p'@, 0R(K `V0S+pWV V(p P7p  0F?H 0\堠 0X4 X00 V e\W  㵯@  K0@k04 (0,@ r0L0 0(O0 0N@K">"0N0KGP  LK"?p@ 0S K T0KpP]T RZ L ($T `800C80T0DT r00 0T <050T 400 P80080Qo 0 0s03R0#SQw QKpPQ 0P 1>Q   0DPEpPh @P@ e 0S0 a Ph d@T @P P 0S  K@@@ 00 00 <0(20S 4 00 040L $(<050r   400@0S 0S K0SD0p@T |$0T 00T00 $r 0T0  @P m@P P R 4 0"@Pk@T` r00T 80p080P Q  `V2pQ 0SS0S$or@k09p@k@k=l@ 0P 0CP>@t 0C!` @#2 40P 0CP$0PN=@ 0C! ̇ P P10"104 P PP10N  0\30S?000S \ -8LS@ 0CS8 05 8S05p@-@P`0#U@T$b0#PU0t0# ^# 0S0R  ^P0,0,P#pX=P0L0Q00P0S>S  j-RH/,/,/,H/,/,D\ 1 R|= p-0 0 t8LS@`) p8PS 0,0, 0,0, 0, 0,0, 0,0,:0 00CSd0,T0,D0,40,0:0p080p080p080pp8S 000;08X 0\<0<0`8 8|"R j-41 \ Q= Q-L QQ20@S1,1,1,2,2,2,1,1,7P"  P P nP P,$`0 lH J m@ Q-L QQZ$P> 6P? P? PG 0@*S3,2,3,2,2,2,2,2,2,3,2,2,2,2,2,2,2,2,2,2,3,2,2,2,2,2,2,2,2,2,2,2,2,2,2,2,2,2,2,2,2,2,3,HP 0P   `P lP`@ 7n m@ -LHMDğ0"}@Pp`,0 . 0<K ;p h h0S]h  h #0S: 3 0d8 Z ?0 "0Ql0 @l @0Sl0 P P 0 |d8 p<[\v;0[Sq< K0 R  P(K 0C< K0pQp <0[S%@<0[@S0Q0bC4m@\m@ -!L0pS1`o Qo1_AP 00S   R` V0 00Sw T: 00S v7 1v7 ^ V 00S  ^Q 1vGT@# P 1v'R! 1?0Q w1vGrT@k8/ k),0`iK# hD=xm@j m@ 0-8L P& 08#QQ B0S108# Q t 0S1 0P0Q@@O0,)00 @ C0jh -X@LQS QN Q` Q`  V`!0S6  %pP VK  )z  P<, P PP@1 R P48 Sp8嬨4S UpX %00S`8<`8 J4``V0 Q2 RP`8<`8P 0S8X p ``PhjJ -@LJQ+"" R222 h; -LMp ⦕2i 10:u 8!P0`00` VP O0S IP? 0 `0`  V P`AP1 R!  0@!0@)0XL1 Rd  d 10b 00 R"  =2pI,I0~1V7 1V7 = Sd 000 0SH 000 0S, 000 >S 000(-hVm@jhAk?0 0000  0@-1 @T^* T(0T^  T00S 0 000008S  0S00 000S8 0C8 @0 R 00 0S0 :[0(0CR 0 8080 0̫d8>-  0?/ 0 ? 0/? 0/? 0 2"R,Q,@P&4C,DC,:0 "#A10a%= 0 00CS/P,P,P,P,P,P,P,P,P,P,P,P,P,P,P,P,P,P,P,P,P,P,P,P,P,P,P,P,P,P,P,0 0  0)S0 SCLR0S 4p1S]/phph phph  048# @(R"!B10b%= 0 0 0C-LSQ,Q,Q,Q,Q,Q,Q,Q,Q,Q,Q,Q,Q,Q,Q,Q,Q,Q,Q,Q,Q,Q,Q,Q,Q,Q,Q,Q,Q,Q,Q,94h6hIhz h -0L0C@S R,R,R,R,R,R,R,R,R,R,R,R,R,R,R,R,R,R,R,R,R,R,R,R,R,R,R,R,R,R,R,h_3 Q 00CSxS,dS,tS,dS,dS,dS,pS,dS,dS,dS,dS,dS,dS,dS,xS,dS,dS,dS,dS,dS,dS,dS,dS,dS,dS,dS,dS,dS,dS,dS,lS,g0 -OLT` @ RD0D0D0?@ D0H 3㋤OT^p 3W 21C! c%- QpP@  2W h2 -LHM(0` ,0  00C  0@p$@`P 0h d0 hPK`0@p0 l@ ,p@#$0@`P H#H$8!,pp`\ \` : \  >0>N3l080S* @4PK  D3 X K0 80VKW0Kԏ  PKЏ JK̏vXK   BD@Kt y2P  1`p唀@@, 0 R (K\@ >0>3$o|= -L(M0p,0 @0 @00P K080 PNKO0K兏  HK⁏ BK} ' PK  B N1P 3PH 0 0 L0P 0 0 B0  `!4 0<@K040 "880 "4<0   2   3 0 0  00 0@0@<, 0 R(Kx> 0x>y2$o= -LP@?00 0-LP i@P @0 0 -LXMBP h d0 ^, 0 WK` W0Kl p 0 SV K UK @Վ OKю IK͎0 0S 0C KB0KApK{ 0 S 0 0S00000p 09K 8K90Kd h"$d@0x WKlt0 |0 *|*X*4x[@ <2K.0K倠[h0[ lLXtYKXK1K/PK-0K$$h0pK9@K1Y0 0  J40` ᡪYPK 0 0# 0Q`  ᔪ 0 0# 0Q  `冪l00 Vl000h@p `lw, 0R(KAK C;pK}0 SG0V0K`^^%$o= -LMF 0 ,0 P  0Rc0@0 @a  0SPP  0@0 @ 0@ $H,, #H8P`0@pL#D< P0 `0@D p4R  *0Z2@P@ (  G0P0Lj\ 0T@K 0P S  b K @DKd@K @ 嶍DK @0@00t K6PK5@Kԩ0 0lS | 0 oڨx@ 儀@ | 0\ |  X< Pa 0| 0aUP!0Up`$@@U ( K L0Q 0#0, QY0#,0AڠTKT K⒩x08#̠DK#8t K@x0 6K50K兩U|eP |  @1Py 0jR 07 0R@ @ Y TKT KXPT0Ed@E 0TEP0#U 04@K|0 /TK /PU0Kr0A, 0Ra(K; 01P0 0. >0>Z0 $ 0S0 10PP ;01P0 000S 000010PP 0S: h>0h>'0%000 >0>00 0@ h>0h> 0$o= -LP@Ҡ00 0-zLP @P  @0 0 -LtM 0  ,0 00 0P   .P 0 R 0 @ 0S p-0 VP`0P`P`@P "4 <00 `3 00 "8 80 040PP "40  jLK0x>.. x>0x>.;$o=G-p#00`400$M400 !0 0 0  Q0 @  "$""40  0 4,4 ! 0 0$ ""40  0 4,4!  0$ ""40  04 4! Ƞ,Ƞ0 0$ ""40  04 4! .0 $ ""40  0 4,4! X$Ѝ=8G-#p0 Q0 B ("( 0!0##4 "0 "  0 4,4 !0 $ ""40  0 4,4! 0 $ ""40  04 4! Ƞ,Ƞ0 $ ""40  0 4,4!  0 $ ""40  04 4! Ƞ,Ƞ 0 $ ""40  04 4!. 040# 0'  040# 0'!h0 08#X 87 ("H0('08# )Ġ87_   `P@0 4#0#00= -LM`8`p 0 6|P 0 031C0SpY Y`85`8  0儏|? 0儏|?>M0,0P:0,: 0  m@Con, 0-LM8@SP 88 R 1S00 08hh -L(M@p`Qp,p,p,hp,8K00S0,0K00S00,0KPPK0+0K)0K*0K  0  g@ @T (K8K  ,2K (8K  "2K 8K  2K  8K -L\M8Ft 0x p ,0 h l tT  0RkhT 0 @j h@00S  P` | |0@$$,0@H p#H80@ L#D<P`x0|@ 0@|D p4Rd ` *t05-@PX@ 1 t "+P 0 BjR 0 X 0S X hT 埈X00@00l@!!R x@d0 `,X!8X8U.h"H l0x@El0⠐!1 0 /dP@K8#8  l.X T@0pdXGtTP@\  0@a0g T@! l09\ dX\ p.P@ 0W 0pU` ,P`v jX RPP B;+1P  t\ @PK 0 * 0l \ e80P[l04@K!T0X *P^xdK0 l0 !!tQ+, 0XRd(KE pt>0>B+| $X h00Sh000d`,XX.hE ;X+1XP0 0pth>0h>+X+X V+lxE⠐2pp>t0>+X+ X 0S:t*X*p@>0>dKX *X t*X@ rp@th>0h>*$o= -LP@00 0- LP@IЛP p8S0 0 1!1!0 0 -L,MP T p L +0PH0  T )PH0 0 gR H 0S TH < < *00 @0@H#4<<_  0 03 00 "880 040 @ 40L !R^ \ P`0@0LPCoS 8@K9 ? LT< 0bY[H@0`pD @0 D@b 00gT@! @)D @   dL0Y@`p @D 0WpD  0VP/+Pg PgY P P U`` P   P L0CoP"88 IL0 1; c*1PP P0H@0 `( P*P3 0 0 0PLP!0<T @ @0LH 0@P 0$$$$ P @  L06H 0 0 0 T)H(KP Tx>0x>)H)0H0  ;H *H1HH P0 0PTx>0x>) -L,MT pPP 0P,0 L T0` 0R<@K   9K  LT z*0PD0 T g(PD0 0 BjR vD 0S D  D0 @  fZTPITD@PH  0@a0h T@! L0H  dZH +P@ 0X 0Up `(*Pp? jZ RPP`` B;k)1P  H P@@K 0 '(0L f@0S"T(, 0DR,(K ;DG)D1D P0 0zPTh>0h>(D(D PTl>0l>T(D P Th>0h>(7$o= -LP@s00 - @LB㝙P  -L(MP `0P L ,0 0H0 )PD P 'PDD 0 iR 0 D 0S P@D P H0\ 3\H01D0, ,400<@K30  9K  HP0eZHD@`P @  0@a0fT@! @@   dH0Z/P`@ 0V 0`Up ')PpN iZ RPP  B;j(1P   Dp@ g&P%@@ 0 ##Ƞ#\0PH0[D 0 0 0 P', 0DR3(K00 Ši(P 0p 0LPx>0x>'D'D ;D(D1D P0 01V@L Px>0x>' !$o= 0 S00RSS   -0.0RL >@0#200   N000N "" N04\0N`8 2S0S 0> 00>0S 0> 00> -LMp8@S P0  0S00 =$   0 p-LpȐ@\P pd8  8S 0S=0=p` '&P =0=p> Q 00S:` BV  1R0x 0| 0 0  C B  R  0 00@0!0 8Sh@`10 hH( H(> 0-LM@KP M ]&P P P K0@K \6 F&P00CS0,8,$,$,,,@=== 0-LM@KP  %&P 0S꜉,,,,,|,K0@K | &P0S꜉,,,,,|,, F=C= -LM@pAP,0 P0 Y 0 0帡t:P)0 Yl:0 $("10Y_:`A8!#8S,0 P `A @~8# P, 1 PI0SF  Y@: 048#8! Y03:`C8 #X00 P `C@8#8P 1Y: 04Y1:0 $ 20Y :R0Y:/0{(00*0s0\ 0>(00> LW0\ 0>(00> J 0-\PL0@  0S0 -00Q 0 0;00 - 0L S`0 $"!@21C0d!P2Sp 2S? t022S  Q oB02 - 0LSp00 $("8k". bSf@5S 21C0bAP2S2Sbi2SVㄅd5S @d5@P$0f T0@f@d•0d5 -@L,h贕TA - 0LSP@ `>pȐ 0\p``> \  8S 5hQ!48 #80n@ - 0LSP@ \>pȐ 0\p`\> \  8S 5h#!m48 #808n@ -L,MPpP >0>(Kt8S ^ 0$P 0  L } 8 p0Y40 `: 0Y:0D < H @ 0 S@`  S| `pY: 0Y*0>00>H0S 0SD0H  X>0X>PL 804$@0<0> @0Q>q @Pl"0002 R 3 `87`8 `87`81Q3#5Y51 R\ `86`8 !000 o5 \1\TA@08 #8808 S808H>0H>UH` 2SD` | SyR0>00>s+@K W g#PhPf0Sc0< S < ]< R [P @ 000t0`86`80D < H @ LjuB<@ln@4= -LM@pPP t8S p 0 `P:0P:0S` 1:2S P*V 0SX 0 SS : R @>0@>0>00>;"P0S`88S 0 0  000P  pwPPxPP p-`LQP@ P   p 0@S ʓ p -LXMpȐp\x |0  (Kt8S @P0"0S '"PL>0L> t 0QX0 PP "P 00`\ \0 VT  0X5:l d p h ` SpP  SlP 0P`X-: 0X%:00SdP  2ShP  SR0>00>+@K . >"P0` S ` l d p h ` 0>00>l0S 0SpP 0 S: R @>0@>|;"PPx(0BS @P# P 0P>0P>aR8 tX 48#hT> 0T>00x0\ xHPl h0xp`86x0= d0S ?` R ?E(Bx 0 :G P 0xdL KbPx0d04[SC +x0J ~x R ~D"x0<0| P0T x 0|0 c 8xp p \ 'L K#Px00`0\ 0xx0 x7X>0X>nȗH0  4[S *d@0 <0Q)[<0@#[ #[  0@S  ^ H 80S`8 ^( Q& x aP7H @0xRR0 00#[< 20[0P0C0S20K}  x@PPg20[.7= -LM `QpP@! D>p(0RD> KČ Ƞ,Ƞ508 B#8  8  -LlM #R0 (K8 p !0&`0 " $PT #0P0 mX :% 0X\ %p:\0x0 t0 ` |0 p0 l0 h0 d0 X0 0 S pP  S xP  5|P 5:S P`X: p0X*0>00>xQ 0S| R 0p S`1v'R!4>04> t8S `\ Q8>08>`010 / @ |0PP `P TPp(48R# 3  p0S  00>G+@K D| P<0S dP 8 R5S30lSl -d8 WO x t ` | p l h d X 'p8S `8 hQ ?Ud R ?600`t8SP8SMt0XS ,1 R `86`88X t 30( ; 0 Q(5*13lP:  6 7`P P`86`8 L K P00dPH00@  <008 < [ L KPh@ :=j -LMpW( F`(K(0S(  Q 0  0@`W1(PU  @P,  PfjU; 1P (0S 000C `b 0@P  UP ?(;(95B/ -LMP`, ` |2S  @2R >0>op(|00 @R|0@ pVZ D0P0W0SJ`8 1RG  o 1R 0@? @P 8SV4 p`!1R8@0!0 1Sq@p10q!V ! 0 0@0@/00@0@κ R, oK*t 0!pP 1<100 @0@00 @0@ꈎʚ; -@L{ 04"48#hV1ھ 0R p PP # 9g\@ 0S&#@P>0>0S0S z@`F>0>m>ꪪ -LM` 0PSp :@00S ̪,,,(,"PP>0>#2K 01R0S= 0F0f8#8 $#$"K  z00 nPP  $K2K  z,K  z2K2K  z,K z2K  |z,K xz0SFKꪪ 0-@L2P000h腽 -LM`p!28#8N8 ,0 @P0M(K2>0Q 0, S PU @0 0@0@`00 S0 00#  1P00  *P4 U 8h 000 @4` `@T 0S00R0@PRo,?=Ÿv ` -LMP p@@T0 T*   <P 0 $a8Pp@* 00|  `P@% X 0P(K(Kot8Sp8S =L=n@, -LMphpV80  PU=0= X P  ㇩(Ko@=0= < 0R40  DU=5, %02=5:0S@@TP0P  40 S00P 0 <0S t8S! 1T0#28#0"=00 40.  0S=0= t8S 80 0 08 phVa < 40R  <\l \KR>0>Fp8Sp>0p> t8 S@ 6  TT T 5P  1}@ 80(KoZt8S `' P:8 SF >0SU0  0>0>0 0@X0@F(Kd8  8S0 u0S u 000p8S+괲,x,,,,,`,R >0>Rt8S ' P =0=Rt8S `' P8 00# `0`S `8 ( 3 "0@. >0 > >0 > P P  `8O 0@K0@>0>v  P>0>m P  F2 "% ,0 (Ko[TPT>0>00@  POu0S@u0.0C0 0S 0 BQ.0S*@0!0 8S@10 H( H(0S 80 5 X 0U  P>0>O K 1 0Rx |   00C00 3 2C 0%R &80  0 P) ,0 (Ko P 8 000 @Y P 00 0QP>k -  jLMp 8#800  b1*"*RX,  P`M @d20\`, 0 d%020/,000bV0 j = 000d 0R 0, j dő "0h00 0 0dő*2 0R j  $0 00C:0(K -`rCLM gŞ8\P# &80 00  <   - 00c:#: Sʲ00h:#: S>0>@gV@I< 00h:#: S  0$KmE -0` L p' ^$ 048#N  10^:0BPU @ 04 #2$8#8"&0EPU@ 04#28 #8hy -LM܂@` p2 0 S/0  9 280  $"" c("(P54  S0  n `8  <   %80  040 2(K!0S:1  &8 480 c1 Q051Հ5Z8  C PbV>00V.H$H x,0 0D8PS`!0@ 004 0C0- :0,40 0 |Pd @@2S  P(8  0b0 %,d0V]0 <   | 04 0b:#: S40 (KoRD0Q5Šd %8dEu ''0d> \ 0\ @\p\ \\ \0f20W -LM, 28 40 cV>0@p,  Ƞ,0 - 0 0cʠ,ʠ \Pʲ 0j:#: S< 0bP":#:SXP`M @d20\`  0 d%020/,000bV0804P!e00c08#8:#: c ʠ B0Რ,ʠ840a@ 0d00" R 0 0@0@,(KoW, "00  d50P00 d5" Q 0  ?84 b dő "0t0 00 0dő* 2  Q804P, e  0 00C:0(K 0-P@L !t 't0:0; B0 [0C\%#53c0t0d >u & 60 0&(0 l (p08t (780bd -`PpL! @st' ot:0 0;p.p0 0\4[BCR8-S0T 3535t0c0u >d 0l 6 d0&06(l 8p0(0t ȗ x0TPx00x08Sx00x0bd -LM⠟?\, p #?\ =t?\ h?\/ \?\%`85`0& 008/f@P 00 ]`?\ .>\ ]>\( >\ >\  0ᐹ`, 0R(K>\y x>\ 0\I >\d8@ l>`㳀ᴁ\>\0 EP>\ H>\ @>\>`P>P@  P1v'R!{ 1?008@9t8Sp8SJ 8p R 4`=\ 0\ =\D=`P80 \P=\{ H=\D @=\<ҍ`P = RV d89 `8 ;4``8{<\ <\ <\l+F`k<\ <\ <\\M@K! t8S"9 LKM0K2s! E`NH< @R`hG`E;凍`P?`Ș  0S774`4``8`83t;u`P-@ P`8;`8p8S t8Sj`8  % ' P4`:S`P d8 0S`8 <4``8`8^<000=@00Pp0S h:2`P0SS0`021Cc  rE`PpW@P``8 :0 0?00? 000?00?000?000?000?S S S S00 0?00?000?0`0` %E`t8S' ar``8`900{`8`#500(00rt8S4p8S@`f@8娌`P`p8S] 5A0AS2`XX( t8 X( SX(  <8 20C$(媳`=7`P7MK! MD`P1M0[ SN nM [)LKr4`""- 0`7\`Pd8@ 208S74``6J`Pp8!S `84`20`8|67`P0S `85`8 q4`06$`Pd8 W 0S`864``85`P^@P 8T` 8S SX S` 0d5`Ph+`p8`S >`15ދ`Pp8SK @& P@ PX x0 `p(R  `8KU % Rq`r=4\) 0\dP# P @P 0{S`̠K|P 000Q@PT 0|PSP:|`E  | C`P CP  `:8pLK:0; M0Kq`-`85`8 j4`# d`00CSN@` P R4 0S1 R b0a ! c%- Q @0S0000+0ac00  C`P `P P R @ `8 B<4``8-o00?0o??0?S0?0 /0// /0 /0 /R0? 0S S S S ?0?0?0?00?0?0?00??S 0?`84`6`8 Zp`z`8% ;`8 PpMLp`l@0Qh 8p Q4`c0` 8$oii 6i(i8i4ri i8i$i4i i5i iiiiii|i0p0 -%L @ 0S 00 P= 0-3L P@.00C8#8S0 l0 ` 00C8#8S0`8d(6 `87`80d8 p8S ! 0-3PL@.008#8S0 P`(0R00`86`83 `87`80$ 0000d8 i! - 0`00 0C00 Lp  | 00C8#8S0 X@P0PA?0⓸⑸000|RP]/s!x 0-8LSP@B wu> )Rxȕ10# 1 $80C8 R  Rx |   000C0C00 10xP RZ•\ >  0n@ p-LP`d%R @0@S xd% TF0d50`V0Pp 0-p8LSP@h> RR u0SV 0S 4`8Dp1 RR d1  C2S Π0 9S x "101000 Rx |   000C0C00# 10xP RZ•\ >  `8 080~80  B u $jn@ -pLP@ 0p1 -L@h -0P00p00 0`@ X1\A00x|L B =0SS0 h\J Mk0<0hP -LM>Qp +X1`V>xX!^7 9 S02 @")("( > Pxȗ1 2 10S'  2S 00 08`(0C1|200 0mmh  |j -PL@ p[`9 \[ jV @[0S  j[00[0 m( $> a0$>[@ -@L`Pup# @P @Ph辭 -LMhP08pX# @PJ 8S9S7 ᢭00 0=d>J0>X@, W(8R/0V 0S`pQ  q30 t8S 5Q !₮0 p%0W0"! 8 S 0 oQW 8S S 8;SR 8S S P 8S S 8S 8;So@(o@ -(8LR@`(8R p-PL㸭#M` @t8PQ phHp -LQ@ 08xP}00P} ε ˵hȵ -LPp`k@P yp0S  0S 3 #0S R@Ƭ:0S  -LpP^`[@@D@岬T8S h説 0-LPs@P <0p0@000嗬 0d 20H00lo@ p-@LP! \i02 8  PD廳 <ⷳ`#  808phhTg-pz- p-L@`2PP<>0<>   '',i8p p p p-L@`PP<>0<>  p 0-@PL~$ i0p1pP 0hM0 h} p-08@!@1L<(84!41(8 $1Q( 1@(0 1Q0`0 >BB}PPx" d8 p0`B 1}0P0P2  $ p h phXXWPLDRP$,,|,T,dAk , |-P-$-o@=o@ 0-H/0L000000/0P  `8 00000S /000000001d(  < ` 00000000 P  RQh 0<0 p-L`pP p1vGT@@)1@$R@ p0R@p8SFF `(t10S: :  )@R :0RE @` 7$ /0/0@@ @@)@@0SS S S@@/0< @@ 0 S@@d8   P@@p @@@@@ 0% ' P`` @; P@ -LM\0p-4K , 80 g4PK`Y @'0' <0 P/ T \P , 0Ra(KX@8KyP*`80`8  [@TN 8KjP/08 48K\P T1@!P@T P00P<媫0@    0`!❫ '╫0 <叫!⊫xXh @ P\+8KP <w0 4$o<@o@o@p@U@ ]8PSPV 0RU`@V(  Hp2`8 0108p(R9 ~  1p8S`8  9S(gPX(0S  ⺦0X8 0CX8Ⲧ\80\8b$ 0RV K X8  DK/ `P p 0KQp$@U0@$@E`P\  v7 S1 0K $0RS1\ t{7\ 1v' R! P:q$op@p@p@j|= -8u^p`LpP`Vo`51G0T@ `8 0  8p RhQG8 p` -L@ hƱ p-LP`# @P E0S8;S08P@B ph覱 -X(L@'p8 S`8>00X(.`8>5 . `8XX  P0(0(00 (00\8hkp@p@p@j -0p( @RppTLP`> T3 T 00SX 㓨 p@|PU. ㇨000ާ0PS S R  'PHRK 00S--p-p-W 0S00p8SX FPPX X '}d[[ xd2S  R RR 'up34 nP'fp3~=>k -p8LS`p 0 X 000a@PVUp8SSPP [[ d2S  Q0p8SP 0.RP P PP 0.R 0.R 0.Rl= R% 0S 0 $(, <4!4"<#Q#:Q@Q`Q Q0 0@S QQQp8S S ` p0  08#Ƞ;8#Ƞ,40`00S 000C0@- 0000t 0l 2@ 0 0220 0 " 0\#40@j=*00 40 ` R 0   .0 0.0C 0@-800p30C0"\"h"D@P` 0-d8L P@+  0 0S$0 R 0  0S%@0!0 |0SxP@P10|P @0u0S 0 0S0 R>  000E0 p--0P` 0 @ 0 #4L0 % b\\  0#40 ", 0#80 "$ 0 000p "$ 0-20P0 @P@D@L b0 p-$1L R> 0C0S0S2Q` R 0S0qS R0Pf  00 0 00@0@0SX0 R00H0@ Zbp`0`  0-0P0@PT@#@L >b0 0-0@0@ LP1b0 p-8L`#X@P   ;0 B 0P bp -(Lp"hPP @  K0 B  0`a  a -(L"HP  0 0 K -(L"HP  0 0 K -LhHvPP&$x 0 $L&  p@帀 -LMSPp" +@Kp a0 0  a00CS0-- ------------$-.@K a00P@ `6?J&40`P0`T]Z&40`|&40`  04"#400<00Pad8 R(K00P @`  ?a00@`  4a00 (@"h  'a08#h&4  0`@0P`  a00`P   a08  #hP00P00P{ `? S0C0P ~0 0R  `P `08  #hPw `00 (P"hi==p@q@ -"0L@M+pK0`P 8` `00  0d0C0= 0-00@0PL00C0d0C00 p-@ TL`>PP T000p; ]1ph q@ p-0L` P@P 00 P  0#40 b p -L hP @P&x 0 .0"(0CT0;8#("4@& 0p 00b0 0 -L h@ PP&x 0!0 &W(0C0"hpp 8# #80   00b0 0< A 038# #80% 5C40 -0L `KpP( @Q" e0 f0!0C0 03008##80’2 C40  0#40 b -R0 R S * S )SNȠN4 Ƞ,Ƞ0 ;NȠN4 Ƞ,Ƞ0 [ -L[ R`8p p\L@`:Y 0<U $2 PP^L 0 H ;0\ 1 #      pP4 `8P Ud8;8# 40 Z 0 #40N : ;[P[0S@`8%1 -`8 0  00c0 00  T0   50  cd0  p0  08#L '^  -LppPM?0Ā` 9QA0+ Q00 0 7@P )~0 S0  00c0 00     0- @=00 8PLpm0  0 -("x![@0T``DLW ;40T 1 #   P `P(  W'40p 0 0#4[@000[0 S@W003 00c0 0p@  W003 /   O{  -0@L0p0 -P`L:0[2` pRppQ@@\L&# 0< 7R 0  440\ 1 #       IpP pP @00 岀] ]' ] 㶁(#" 3#4!0 `8-  u[@b p8S0 R5 [0S*`( 0 00`0c0 0;: G `( `(`(j>k -x2夈 PpRL[``pP: `@@\LT 0<P 7PI 0 E 4 40\      `P1 @ 8#  ȕ 3[#4 0s: ;  p8SA 01 RD [0S5`!* 0 0c0 0(0 )`  7(0 7` W` &C 0 R oj -LMQp`x PX P @ @PP`0!P21   \ \' \d8  VV?0B 0@005p8S> @0!0 7S㸧@10༧'0 5'$Kp8S  PR 0"A稠p`*pPt0 00d V 5 @0 @   P b=L=Lq@@q@ -LM@ P 0iSS2 0 SP@Px>0x>! 6K  \ pP|>0|> `8! |2S3"[R>0> TcW b00@(K00Stl'-D'-l'-D'-08`(I0@0 P=0`U  ```"[  @Px>0x> @0PS00`7 < "!0< S2 08# < 21C0b10"R`08#< 0<<0021  ,2  "[2R P < @ 1 "!p8S},(-'-%-,(-%-%-t'-ptP(pPM 08puP00  h[' d[0K `[`8  1  0@00p8S pT00' I[0K  E[  A[00  :[0K  6[' 1[ P0@0p+x000EW]0 |>0|> ꈎbxq@ -PLAAP@`p Qa2 P& 0iSS"`V0 pd8  0S 㲁ᯞ!1R>1 010~7 0m-@p10!RA@@10A!00@  !0@ 0 0@0@5  ɝq@ -LMpQ@P `000川@UG ڰUJ PU| Ug >P0>U  U 0U("(`P U9 UH( 0`Px> P0x>U `P 0 PPX舄S`PH((8"(#8e`P p8S ("(G`P 5 !h0 0x("("`P 5 !U0 00`P q@q@@q@ -LMp8SS, 2l1S5  0@,Hp` 0@P DP`  0@  #Dp0>$K, d1S* 048#8 (0 >0>,0 8 P8  0@,Hp` 0@  PD`p 0@P #D p<P`0@!(#Lp4,0 (@dh! ,@0l1 8 R 1S>P0>F E0@$@Ap`D0@#D <P`C B0@!(#Lp4  $Kki -LMp8SS0S (K  0@pH,` P0@00 ,@ 0PK` 0@  D` 0@ P #D p< P`0@!(#LpX!4pR >0>\1StP>0>0   00C8#8S0 \ 00005 ! ,00 ~ xXr@$r@ -L,Mp8S8 $K  0@,Hp` 0@P D0P`  p 0@ L#D(0>8 X1S*80 H P>H0>8@ H P4 H(  04Sa b04S 044.J@"!Bb%= 00.D 00 , D LI8 ,@0P9T@H0T9F E0@$@4`D0@Ap#DPC 4 p0> 048#8 H0 L0 kPa b0cP4epX:d d`0X8 %< % *0PpX`*: 0X&:0SR+@K ,W <P0S0>xX1S:<Qq L c<04  0Rh0>ۡ1 S p ]O )x U P' 000p8Sx200Sx2 5 0S00Khj0|2!֙ L00@5p 0Khudr@$r@ -LMhJ p8S, DJ, 0R(K`1S8  0@,Hp` 0@PD0P`p  0@ L#D <P`0@(!(D#L\!p4Rp: >0>X1S*<9   @B 7P0΃! lPKJ< P p@P  @>0>@ U48#8Z0 P a b0cP4epX:d d`0X: S 0PpX+: `0X&:00S0S^ PP Ro@K T P0SP  S7 P x妣QD R 0S>  Q 1S `@2 pQ  0R  00 0    P^  KHP 0S  0S8[S ? !  0@p,H`P 0@pDP0  `p 0@ L#D <P`0@(!(D#Lp4 0X\!`1% t \ş0T 0 PPk y  04S#  | ,P r@K  T P0S0SP @@T@T@ PP K0Sp F E0@$@Ap`D0@ P #D<P`C B0@!(#Lp4p]O 31q刁x1PQ S  Px3#  `VX  0R@@"!Bb%= 00 0  LI0T)P900T9F E0@$@`D0@ApPL #D<P`C B0@(!(pD#L4 \`)  X)0@ `S  P@PU\ `0S90 $("H0D8S021Cqpc%= 00 0 LI0T P9  0@`$P`P ` @P`0KP 0@L#D<P`  0@(!(D #L4P`  X)`~ pS  P@h 000  L0  pQx200Sx2r0|2l$o==dr@$r@= -LPMtPpPP, `@p00CS, 0R2(K!00 0BτlK,JPp `P>0>Ⲟ00`@ RpQ 0 R 00 0`w P5s ἖$0 0$o=dr@$r@ -LM P` 0@lHP 0@p PD0p ` 0@ P`80 4@ 4`L8!D<`P0@ H#H$8p!,X1S  >0>(K\1Sa b0cP4epY;:d d`0Y40%0>Ox t0Jo QZt L00 <xx X1S>:$o=dr@$r@= -P0o0@0@pL0P 0 0@0@WM iA80bS 0bSB0S>0>0SA SC  048#80\a0b $("(c Q00\0S 048#H 0B8S0SS#R 0Q' 4'  4 8  cpPh>0h>0S0S1S 0SRpP   0S   f~  z v r n -"0LM'`K0p?0P0@ BP >P 00 0C 0 "40040 "880 "4<0 !D  P= -"0LM@'pK070P0 `0P P00  O= -"0pLM0 0'PK00`@ \O O00 @  1S0000 O = p-@ TL`sPP T0 00p; 1ph'Alr@ -L` pP @g @|2 0O! OP0  00S00 00$(SS"(08#( 1Sy 0S08#(s "40 0@ C Cq0CB#4Ac B a0b + AP,D!1RG@0!0 1Sq@p10q/00@[0@@2 b0S00#$ @ ◻0S  0 48#800 0  DP d㌛!1Rq17@01@08#(ꈎ M-LM0, 8 #X40 0@ P( Z c @ M;8#(@#< 0 ,k1 0h!"8 0h!"4 0h hg14 0d!h"880d!h"4<0d! Y? 0@d1hA,@%,( ?$Kk400$D<@ #\#pT l#4<[@<8@ FEpDPCB040[A0!ؒ0 ; $Kr@ -LM` pPL Pc _1 0\!"8 0\!"4 0\ \[14 0X!\"880X!\"4<0X!!D 0S0 c 0 5 ?$Km!⌒ \00P 0#40  002<8#(#< $KXr@r@ -L M0 0S` 02="!Bbo0% Sp 0 00  0 8P,  ,0Pc fV?0 @X1\A$< 0\!c@"8 0\!"4 0\ \[14 0X!\"880X!\"4<0X! 0S\  10, "4F0E04D0 "88C0 "4 `c _1 0\!"8 0\!"4 0\ \[14 0X!\"880X!\"4<0X!!D 0S c0  0 0% ? Kin!` @004 Kj@40dr@r@ -LM0 0S` 0pu0S^ S0 0S0    P l Pc K1BS brLV?0 @X1\A$< 0\!"8 0\!"4 0\ \[14 0X!\"880X!\"4<0X!!D  < 00cS3 (0e)$ 0 0%  ?(Ko"!B10b%= 0!ѐ0 00@ 0@s(K( x "4F0E0 4D0 "88C0 "4@ 08 0"f0 0C(8 0"2 * *-\n-l,Q`8`888`8`82 S-L - `86t `800Q> L@  Q P0 R d8  `87`8`87`8p8Sd83j 0-=LS  21C! c%-  @PPd8P]  =S  21C! c%-  PPP]0p8S S S g0Sgg0S - L@ R' '  770C0C77 10P RZ 10P  R(  (  H8H80C0CH8H8 RZ -LM8  8s8p 4 8 ? 00 [`p, ZVr Vo P\X00@  X0T @ V 80( 0, 0T , F \X 0P;  0T5 \08 p8S= 00 S0 0F0Z[0[`٥ Y00[` 0 V0A 0Z\04 0R00 R0S, 0r0300 (K\ Q 0S\P0P  P\@ 5S40040 0 p- Q` `VLP0 0C0^S@0 0C0^S@Tt~T`PP\vUDphqV 8mV@@$fTp@r@ @r@@ -LMtX`U@pt夈 TCo-o-o-tp-n-U U:([0Rh5+ p(5R'E@Ѝ 00|2:;8p0\@GPUP5@0 <`844% 50`8 080ES4q-4q-r-p-0ES r-r-r-q-`80`8 !HI 'DIp᥯ [:I >  Us-r-Dr-Dr-0r-U U 0w! p8S S w S SތP# a@P 00 0@P$p8S 0 8 R' '  770C0C77J 10P RZ 10P+  R(  (  H8H80C0CH8H8.W^ Wf00 0]5[!oP808M RZ0 0<W:00 01p8u`8, 00@ $p8S@|1Q Y℔y000 p8m000 0t8'⟌0 !@# PiP > R >C0 0ap8000 p888廾kr@s@`= -LMpX ȠU@p.h, :U t8VS/ t>0t>t8VS`8(Z4 5D8S808H>0H>t8VS8S< 000 508  Ȑ000(|8`]/  !ȗ \000W 00tO P[pP  ''G0 0  8p p hpP`\@s@s@t@ -LM@480 0PpX 2S  21C0d1 0"ir2S  cR@eV@ad5S @d5@P0e T0@e@du[0d5 -LMP@`V>4 @c4p  ' 0hIꫪ -LMP@` 0pS0C 0 S h4*>( 0c  ' 0y꣋. -p21C0g1@LM _*>h t0P &h 2XJ0/:0O00 `fp  85x- 0-LMT0@+;:0 ="  7P 8h& p-@LPs2`0S2,0,  * ph迉 -=pS  21CA@c% PL` Li8 T)P ұN @X d8  =S  21CA@c% PP LY8N @0P T9X0   hxH|- 0-LP @c0hȒ p-8LS@` p0S8P000P 000p 000px -LMt8@S`8 p8S `P XU0S 2P 㝱pP 0 p JER E 0<0hp@-P \S`0/ S0, S(p$ 00S 100 0P@J0Q@0SA PLZpV \0R*@p0 0- @0 0000 PL 0PPT LvDH0P0 80B9a$!B30b03@L0H0耖C5010   [0 R!0S S01000 % !!00 p-0`00@L@HP<P 0S S 0 [0Q *0 QR 20a0#20p -RL pP@pPT @t&  P E` -LM4@ ,Kt 0@ @ PKh-t= -L M0@ (KJ 0 @PK\-0=D  tQ 0 S"0!B t=-<JQ !0 S00=0@-@ !X 0lS  1\0}>EN-E8 BS(00"S: 2 1C00 2 1C00=GD  tQ 0 S"0!B t= P0 @x@ p-`PL @H7TP41@T(ph, *Pph%x@d@1@@x@ -@PL D8,$0 h x@x@x@x@ -L Mp`L@0\48 0`P 0<<Q 0l۹@dع@XԹDdH DιHK,ǹy@ y@Xy@`y@hy@py@|y@y@y@y@y@ -L㠘@0岹T   X娹y@-y@ -LM0,0 jP2 p0@ 00@:K =2K00<0<Po:004K P  0 < K;0K1<1< K 0, 0R(Kq$o>k= -LM @ , D P5 p 81@(0@:K 0P2K`00 4K P`  @ }D y0 < K;0K1<1< K 0, 0R(K $o>k= -@< ?L0 <0 L- -LRHM `p00 p@ΚPP 408 0B S800 RH TKQ `@KD 0\0 0 X 0T r `k p-PL 0`P t0@T@T 81S1 00  Pppp=k 0-LHM@T# 80S0Q 0S XPKD 0T0  L <0r S80ěK0   40040y@ -p!LP`[ 8QE H@T UTM \ 0Rq Ÿ0Rm5BbcPNʠ2 R? BPG Q 0 SA 00C00Sp0 pp0004 ^00 000  00 81@PP_" ㊸ O 00C0u P000m\Q 40040 R 0Q0S R 0$0 \00S0040 040\00\0 0P0  00C04 P000@0  ?D!( "E1kh9p(C(z@>kxAktAky@ -L@M0,0 0p\0 04"48#88#( BR`0 ş, 0R(K 0DK X T0 T@K d5\ D 0 R kPz@=z@1kpAkh9pz@8{@0 $!$("( BR`t- ^ 04"48S d0 000^: 04"48#8 S  S p-4aL㵃 1@T0 R*ph\.  @00C@0 0SP 04"48S )0 000Q: 04"48#8 S  S@P@00C@0̂@Pt9p 0-L@cl0P"\0PT 0@\Q ,0 QT0h衂lAkl9p1k -LßP0@S0H`d2 0pST3TD 0 00p<Ɖ,4 T T T T0 r4  0S. i裵< d0Sh0 S000 0S04S @@21 @U +U((0 0 R 0YuhQ  Q 0S 0000S6 :S00(0 0 R 0YrhQ  0S 0R QW zWw 000 R02& 00"0 R9pgfff}p9p 0-PL@Q 0 R0S Q 8PP  0 0 000S  0k p-PLM0 4S`  0 0S 5@ 0 0ph~p  @@2 0 @9p0S S  P0 0 BQ0S 0`000 RP0S1 Q -L$Mp0@ 0 ~0`0CS0 =~ 0RK R000  PU 0, /0K$@ K6-O$o2i = -L$M0p,0 P~ȡP0P 0Sh@T @T 0S000}> 6 0O`PK 0 0@Q60Q3 0S 0h 0 0R h 00h`0 \< K;K80  L K P  @R000 m6N}, 0R (K6N}@g}@$o}p1i = -L@L0Q 0Q 08!P,0( 0S}p -0PLC 5p<0\`L0`@T- 80@T( 5<0\L81 S^V0W  ە0 00%  ЕP 000W  ĕ000}p 0-<0\PL  0@LP 080P 81^5 L0R0 0\<00 R U 0P ㌕P0000}p -LMP , @p}TS 8@<`K1S  PPG |,0S 0,0 0 Sd14,0,0,0\0 0(0XJl0$05 ,4$R( 000L0L05PS*U , 0R,(KP I0S !rq |HT5PSl0S(0@K@0 [l9$o i = 0-@LPnT00!R00P    a -LM@p P@0`<\00 3 R 3SA80S>? 40 ^E 0PS5岐0S P 0 l Y0801 0 4)4 S*[KPq1S@40 |P @0 00 080ᾓ9(K04  00#0l0H  *KP@xBϠt, ;`PUPE.10C8#8S1}, Sz: 0AhP04$484# 80.P P0S P10  t1t!08#8,0 ,!XJ,@^9PUPE108#8X1,, R): 0AP04$484# 80Pm@ 0RPO @0!QJ 0a긁긁(Ko`000 @Xk f}pypAkAkAkAk -L M@0P 0` RG l0 J 0S&0S/"\! `1Q 0S<00 s 0%,80S/  p80@0@+P0 K180S Q0 1P 0800(0`c)`L0S0hL@@ 0 KH@opP 80S 0 P1 }pr|@ -LM$C^  㔝P7  2 @ 0Os,  0Z3 $#$("ȁ  10S!0 0 0 #@D"DH$H00 1 (Pcp $<&$ 4(!4"H%<@ @@1S0 (@cSpǃ04%4, $&8,$#8!8$,000!(@cSp嫃04%4,& $8,$#8$,!8000(@sS`吃04%4, $'8,$#8$,!80001``,r 0 Q<l0(K40 L00:Akypr4|@ 0-@LP 0]P  0]P  010B@<|@X|@ -LPQp `V +@U l0 (0V @X@0S 0@S  -LMP`! \\ \ (K0S p04"48#8g00S03#!4@K,0   08#8,#0@ 4KK.K-K@HP 7, 0 @:P( K20P ,@ 0 @ ("(04"40娤|@ p-LHMPP` 400S Kp\@KD7 0 X0  P 00T0 4 0, r )儤|@ -L\M0`Pp(0 4 400S T00X0( 0R+$K|@KD  8Kx  Pp 00t0 4 L r 0PT 21C0D 10\  0 B|$ozpAk|@= -0L qtp3Ck Dkk -LLM `XPP$K40ppWPl@KDh 08 (0Kd < `媆P(LL\(P<0 0P QPM P Dk\- -0LP 0CkDk -QL MP@`pP $Kq0S S *P% Yp` `.g븀PP# `Vᎈ`0SP| [O@ZfPЁ0 4pqgPPKCkDk{pCk -LMKop  0C`$#Bb20aD c @ Cn<(4"4 KE.Mb -LM0@ p !P@`04!48#8b. 0@@K -L(M0p,0 PP  FP   0S A<, 0R(KU` <p 10CH0 S0 0QP QL P- P L0`S " HPS PdU`0S S@ U@UT# DSS    ' H04"40`8#8 $ #$ ! 0`0 0`0H LLf1P <R1P0PQ 0 0 Q L1PU0PU 0(8A圀T<Q} 0% L0S SsDK/0 ;0K< K 0( <K80 布PD  T00T0MAOP  0 0bL0 0@L0P@D @P80S0C80<@Ể<< z$o}p}p= -PUX#0`000L0Sp  AR00U0S1 ! @ 0R:0SS S S S S S S S S |"000  P 04"48#8SWQ    0\QP1! 1 R @P 0S!ԑa(0 (0 0b0(U]! 0U0 0P0 U00 UX5 00 01D 0NS<: 0 0N 000Q 000A ("(04"400  0>0>00>0d0S 0("(04"40 ;!NEy w{p }@}@ -LM@P  $P h 0-PL@,P9 04$48# X04"48# Q\00AQ\<0 h0 0QST JQ :<0h QX0Q:SX0h腁0T0T0Ck= --LM` 0(0 @04"48#XdUx%000$K 0$U$Q  0pP %000`P$0000(SEԤ1 0  @AQ9p--------T-,-H---- -T@uʲ1#U0 0UR 0Sd 0)S   21C0#10\ 0(  3 R UU0s S#0# 00Q xdcP 00\  0S 05 LP0  010000K 0 0 0PZ0V2 R1 | 000T@Ӊڰ0002 R |2 R1 Up000T@p1_42 R& (2 R" T#U  10UR  00 ,0K, 0(0e,P 1 Ra\@cT񟗮---------------- @&@$@"@ 1 (0,P00000b'$!\00> SCU00UV`P000  001 L0 08{pCkzpAkCkDkCkCkCkhDk$DkCkDk- p- LM@T`@PK0`0P@{ 0T PPd@PK9![0(( b!("( 0P0 xkk4Dk -L0MȡP@( ` p;l0- @TT P<  0Pl0l0`@  LK# 0L ( 0RB$K0 Pl0l0`0 Pl0l0`T@Kk 0tP`HpK 0 H0KG K 0 KAKBKCK]HpK 0 H0KG KMw$o0= -L MQ` 0SP  K ŸA0`>aP 0BS -------------------- -4-L----------P$R 0 P`~bPUP 1 RLP  0P Kia d 0TA 0 @a`PV8 ,A0S 12 q 0 pa쀟P0S k@|j  0U  0P Kia x 0 KiaHp0Sa yk@`jW~pDkop~p~pDkDkDk}p}pxDk -LM1 l, @P.P #(00(0, 0R(K0Sxs(`V  0R 80S0C80Dß00 0 00$0 Ly#`V KK350h:30 p-PL`@x U  U# U -p0V 0p0V 0 Q p0 R0 R 0Q<00p V0p00p0}p -0p01`CVL!PQ`dVPQ Q@0 0S@@0  `d0VpPh 00 -L$M(`V, P@p 0ES.....-@0S , 0R(KT 0S @0S 4R 525200T 0S @00T 0S00S0SD0  0; K<0K0 <K80 uPD  .L=.t=.=.=.=.8=.=.=.>.D=.>.>.=.=.p>.>.=.0c [T{ mp i 0`S1 R 0SN 1p-p 0S1 R 0S/p0p(0,pTU0 p V+pY81@4 SpPpP9 XVpp20 V8p( ip9p|0 Pp8sV 0 xP P 0X0y`[=kEkEkpx}@l}@`}@p --LMLr, P 82U r PUF @0 l0li@(iTy R 0S8 RR( R 0RZ#  !0Z@P l 10S@0  ,K 0F@< ,07PFt,Pq0,0 PUZ$ l 00S@0   ,K 0#@ ,0P Q,P M@c(K0R 0S 0 @004  B4 0 0@FpEkʚ;}p -L<`@41à PddUp !@0P0@AW 素ᶐp' tf/|Q Q V# 01V 4 #tf㫷4<㧷 (㣷Lqp@-@1M    QP> (19C8# ("(8S 0 Ӵ (B(R bA9C08#8(R00Ӱ0Ѡ =0 0S01AS0#!8#(B8 CP&8!̱P ü&,0 0 20MqBN|1S(  S < t0b? S Q Q c|0@ P1Ph0P |20Sh P(0h S1*(0P!Ek -L,MY0@S5 S Q/ 7/(K(0 40 H <0 <0*0S`` P PP#jpP7 PDP D T08 # R; ㄷ1  7 (4 H < 0 0 (0 Y0S S  @ ` P0 , 8  <(4"4!<0D  <4("4!<,0 0 0 D ("(04"4000 ,:8#40* 00S <# <4!4"<0: 3 #0T0 <(4"4!<0P <4("4!<0Y Rx R4@0a8#8#!<< !8#800bmTY 0S|RK R4 @0b8#8 $#$(0"0"(`0!0 Y Rf R/H Q<U@0 H  0 `@  @ |@ 005(P0<@@0 `= >0?@0 , 80 =^400q  x0 0 Y Y 40 c("(04"40Y `\0P0x 0 05()* 0@ 0 , 8 7+,1 < 0S;0H PX.p Ek|DkDk -@Q`RLMQp % 02K R RP VPU00U0SRF R R @00`eV00S RU 0BP U 00 g<( 4"4!<0 [ <(4"4!<0 0 6S-t0 0P0"!U00: UD 101x;x tPPc ` Mh`h``h` 0   (0 r!0 00! 0O0@0@e"h``e h` 0S T10cS`!0bS8ڈP  `1R 0R 0R6 S&02 ' = #P 00 0s R |0@  @|1S_ SP9A h@@ 0R0%p :W PPE UP  @@ / 0S PP * 9R  $    <(4"4!< 0  <4("4!<|0 00 0 0PU' R 0S:DQ * \   P1 0#0  @@@ 040\41ʴ0S 0K0( 0 PoP |Q @WX!0 b0b S0| |0 \ P@P a1 n0dPR ?S0 0,1(1\ \ \} Q 0T!R 00bSt0c^0ڼP !R 0B" “ N1ǁ h0^ 0O0@0@00 0h `nh` 1^0n Σ 1DZǡ0h` h`6VSʨ@ 00c0a0PU0U00D0O0@0@ RP 0R P UᲫt0 0t0 P  00cSP10cSL U =? @ 0(prPHKd`KSP\ \ 1P0P 1$ h0@s,$0 ?0 8+T70S @0PP0S*Q  T10bS00dSڨ@I1990l0 lK  Q101P 00cS10cSV  t0K$Pj t@ 0R0%p G*|@~0 @Pt0PP th0O0@0@ t0;0@ @KGKH@K0d@K@\K 4Kc@K}K0 P  P ( 垪 X嚪 0/  RC02,A@T9 P 1@TB 0RI #3Rʴ@PHKK 0 @Ppn0H0KGK D d0KKcK0`0 &K  `0AMq$oEkxMqEk =}@MqPPTRkL_q89kMqEkMqEkEkdMqH_qH?PMqEkCEkP T!00bS0 @PR00U0S$ Q0SP `10cS 0\1Հ T!h`V$P 00cS0nS 1S:6S P (PwPU tPQ U 00lS0R00[(@6S7 1Ũt0 U@At@ 0 0bS000~"04"? 08R@t0`0`SS1R!P1Q!681S 1'0 1h0@S4@0L0  ZB  P 6 Sʤ@,#00S]PQh` VgPdᒩPZ 8C(RT R ʤ~t 000t8C80CSB~.}.~.}.}.X~.}.T 0bS R 0bSQ0Qh0S 0 0R@P0U000H0^0 Hጅ t0Ńt4P3CQ0 |1S S  @hA 45@5t 0S t@ PVzL5P3CQ 06 0 ( 0+ v 0 006 SLP -0 00cS@h` h`@6S  " S ʨ0lS{ڨ|&6S$! 1S !10cS000`l/0 P  |0S)08\ @ <10cS$l 1S 40\'@0?0KQ A$1T 'P1#0Q  !S |P l0  HP  @ V(0b@? 0t 0p!0bStŨh1Vha 0 0bS 60CS񟗁꜍.P.|.{.(.68C( R0@S0S h0K @t0tD d ߧ@0CHK 0hHK 0PP { p 0DPu | &*@t0t00006@Cb  a f00 cR 0LJTT10P\1000d 06*@0*?08Pt0`0`SS1R!P1Q!P1 00C0[\!00bSTŁh/0  0@hA |;\c@ddy _@P`@Ph`  P 7P 0@ 0S0 S@ P101ch`V  0R H1 0c0cS000S 00cS 00C0b0SH00@00傯L10L1h`8#P 0 0 Xh`~4 cALP 0R^  P0n aS0V0000 @@h0|OP0@U0@| |P l0  HP  ct(> R  X: 17 0S4 51 t@0 @0S |0S P,!S0b.S:h (10(1 ࡤ =@t0ăt嶰t ?0Sto lRntP? R  X] 1Z 0SW 5T th0P@@h|/0 U @ | |P l0  HP  0  Ut0ătg t0t t0ătY0tt Q f @0fP 0S|5t N0@,sw ,A(Af0 0R0 |0S}8\   <10cStl( 0Pc/00 S |P l0  HP  c@▷t 0p!0bStŨh1UhQĥ0 1R& P40h#0?0yNF ? 0  t0ăt弯t0t0S t0q@BN2t RNŸc {&h"c  Nt0Ńt 0S9 @T*Pf 2P3CNT P  1P3CNI T 0  @t!t0 ?0 PM0 @F 0<00 f  @!608#868C8S ڨ  1'0 1o#P0 GP!P$1PM8a0'0 !<\0 0@\0`@<J$!0, 0cS P4_qEkC<_qMqEk -L -0-0L@08C8A9Q/h1 !S0 Q xQx<0 / tM&8 S0Һ6 wBEkC}@ -LdMt |0`U@t tPeUtPc -400`S:70 10 h Jt0VtPr 0\ P1P!R$-nx Ux0xSP"P3 ! 13^hhX0W0U1!X x0d d @ 0\b0c3QX` + X hPt0 \:0 |1S Sd S .0t0 t(K1Sh r0SH1X:S0!0bS`Q Q; 0b` R0a0aSTt 00aS  0Q ^ 040@ t Lx ^hhXU|L40 @ Vrm p aX pʃd XXp I r0 S X Ro0!0bS>0ODH0@)H0L@DߣpP IX00S; 1  0X0 0X0X0x ᴢ 00 0x 0S0 (p% (t00t0ᦣpP HX00S 0X0 0X 0P0Px0S x0 0 |0 @B t0 1R B X40 <(4"4!<0p <4("4!<\0O 0`#P7P` 1Q!0\ ap7`2 S 0S0S"("(\0 04"48#800 cQ0ՠ0 ' 0Q 1("(" 0 0|1S S S2p0 2 8#8 $#$("8S Z|< U|1S' |8 M|( HK0 :0X! 0RKphXPT -00|, %| KLPq$oOq0_qMq= p-LD@P`P00T00S 40php -D@LPpT Pg 40 T0 00h0W0ktP 7S -L0Mp0<`K@ 0 24KPL_q= -L,M4pQ, @` , 0R(K0S PPQ 0@SŸ5P: PŸ0 P- U V) 001L0 @ L 0t Pn @0@S D^ < ,$ !$0,0cS10cS 01 RV @ 0@PH DY <,$!$0$L0cS10cS`F0l $#$("(RD }* 5h1DQ2*t05t0 p10dSmpA0^/t10 00b$K0 R\ 3PAP @PV<@KW P$$o@Ek-ԟ.L_qp.Dk=Lq@. -L$M @RP` (K0S0SK UU 0ES៕MU UH 1 R VB 0S pa  0R:L_qLq -LD@@68C8S S\06-<רhҨ6S,0 R3QAQ @QN 0-@LTP R0000 0 嘞^h@T00x^q 0-L@>PLhF> 0000PqMq p-|P@L@`t0axPzt06t0 @(GD@aup0t0G p-6| SL@P@`h 000<U8#L00S8C88#ph06 00 0MqN - LPhPPpN @p81@P0.@7 Ea@@ ET  E 0-S00t00| " 0C18#8(BQQ/6ڀQ0ü6p0 $1 1h!l!l  00|1|1 @0@0  w x DPPqEk.0=|.EkEkB?0Rk|Dk -L4MşPP,  @L0 P T X  |!|0D @ H0H0 0`0lQ@ PN $0D\ \K TP0\  PT0\ 00@ 0P@ 0P 0 0LP0 ,<4P $!$P 4!,.

;0_qEk8_q<_q 0-@L;t0P6 S `0P T 400aS0h;, ,0 ?0PD<_qEkC8_q p-L M@;t0`V% 40040&(BP1 R|0@  0 ?08CKph:<00<<0Kph:Pʄ0^x0l 40`0Q*80 080x0LPP0 0Mq@_qCH_q<_qEk8_q -@LR;t0p0 h:,00,0&= R P0` 0r0)0r0p04h0a P * 8(C89H C1S01P:000<00WMqBEkD_q0Fk 0-@L ;t0P0t00h[: 0-LP@@@8CT0 -L4Md0`,0 :t# |^ p!0 RJ70cS608#8(R62 &$  $ 0S8<C:, 0R(Kr(0-0(00 x1C1 S01("(8C8S&ƱS0ü60"0?0B2 R- |PU* 6S'ں6Q%@0 R! P 40 T0|Y<@K֙0;K<0K( 8 @P T0K M6Qʰ0 G P!P 8QxPV$1 A@10@1:|-0100P [ ^/t 5t0KPK$K( x@XK |0|0` (0Tv9Z@ 0S 0S$0S(0S$ 8Pl0  0S  0S$0S(0S9P (4l0@<4,80w30P00z4@J!Pi3Uo>l(0S4@PX3 PҽPTၾPO 0mq?3l0 (0(0  w x =FkFk_q~@Lj>0Rk|Dk -QLM 0S K0S0S P0@ SAP T \  0 0HP$0P @0S   0@Ek-_qh. -LlM( @Qp,  PU , 0R(K`VP0@Sp jPf P 2 R X 0| S 0x0 t { H0KHK0 GPKH`K@K | N# 0 0HK2P2p0 Zh |x 0R:l@K㟒d`K0 |x @\PK┒0 c0KdK\| !# L 0y2PWI [&[tHKp0@p 8(p HKH K@0K0  @KHK0V2P| t o @KHK0F2P a >HK@ Kp  pp tHKp \0Pp I[@K&[0(kP=$o-LSkh._qL=j> -@0@L@c@h^ --L⨪tM00p0 ` 0, l0 h 0@#2S S5 +hP(@, 0R(K0 G0K 0 S *:X] 0S000 0V $#$("(8#X 0 dR' U00U0S 0000` G0K 0 S` * p0KP- p 0R0% * ebԏK0^0 0S 0S0s 0S Q  0 0R 0 000" "(00(0G[Yp YPH@Kq0HPKGK d@KK'1ddPKcK0 6K1\ 0S V 0S ( 嬷P\  |0}PU| 0S0h0 l H70S@0   h KMV l 70S@0   hK 0\ l0  h0Sh@K @0S@ )0ȢV l0  h0Sh@K @0S! 0㵢@HK h0ڥP% 00 00SN 0sK   (0 0(0 0S R00d00dSP'U$ꀕP U l0  B@(BT P Ur @0 Ql0 #0R R ,0S00S40S80S0S 0S$0S(0S^? $0|@P8 Q 0l P40S@0   h K7MV 4l 0S@0   hK 0S傎 @h0HK@P}hPz 00 00h0 @0 P P 0S^ \ L3l 0S@0   h KLV 3l 0S@0    hK0A HK@h0 P$ 0@T;@HKH@KGKdKK 0D0 d@KcKK0`0 V$  0-0Sl 0000, яP(H000 ŏP#0RD0S  0-@ > $00"!Q$008 @p_PUq000! 000^+ 0 H(@  0@婷PO8 R 0R( R 0R @ș6( TPK00  0 0Rnh_q$o}@_qʚ;\= -LA0QFk_q-Q@P P*R 000PN% 0&_qFk -LMP)0Kp @ᔎ)0[ !#R)K R K (0/0(0(K%aVT 5,  , 9001S %1S T5,  , )0701S1S1S ,1S Q ( Pk$700001S41S81S 0SN S 0SD S00S S000(1S 1S  ᴑP @ @ 0 000 ("(04"4#0庐(1 0 ! V04 40)[Z Z Ḏx#(0/0(0l00S 00S0 0 0``000I(0C8#8 $#$("<8"( #8"000 0M.B 0H.)@[T T` {"(0/0(0/ 00S St) +0K⧍@0+ K*K*0K 0*[48( <"4!<#,## 0000 1S S0 R0 0(0C@0@0@0 R00C@  00C@0@0@ 1 00K(V00,<$"*)0+ K00(0C@   00K>00,<$"*)0+ K 0嶐0+ K*K*0K5*0[0 +0K' 0 ! 04"48#89C40_q|Dk -LMl4 8  +0K`+ ["2S S (00(0廍(K( 0P "2S S ` 0Pq`P + ["2S0 4* K唋0S000咍 04 8<,<$"*4* K{0SY )Y( 0S:Y )Y p 0S 553 R1 (>30 PU)PU& 810 R@T@T W 0S 0R Z 0S P$00$04w040`O0@Y0@ )YuPB8 R DP  0-@ D0pR@ 1 00Sa@`10`@  @ 842@P `/0Su /,4 t 04 8<̠<Č,ʠ*K) K)KP>  048<!$!0!̠ 0)0[p:("#! !4!(0 Kp*K 0)0K P  )0[R 0 0Q3l`P)000 00 0喌ᄲPt@gH00H0兌 00 0E,000 @@a,_q ~@Fk=kr7p7p~p -\0LP1  0 ($ 00 0V Fk_q --\0LM R1   00 0 d K 00 04Fk_qG-@0 0P8< 0#40   0 ! 0 8<0# RM` ' s`BP0 .0.. " A1 "4 " "  " "0,`0 (V 0 Ѝ08 <0#40 (0, "V-00r`F0 0! #0 P0 .0.. "1 A "4 " " "0" 0 `# V  08 <0#40 (0, " V$$q001 !4 0# 0#(0# 0# # , 0 00 P.( 0. .A 1 ! 4 ( 0  .,00!80!$S!L`  [h>h> -LdM`AT0 2P 0P0 0000 0@DU 0 N0Q 4, 0@P.,4P l $( 4 #l!<` 8 < p !Lp @ L ,!T P T `!a$|,.X |` l ap#Xh P ` qp !8 #4P!01@P@,Ġ Q H0 .P0DP !XPd 1hQx !|$D@1\P `Qa@ 0#pq "t  D@\0  H0@dP!x0At0 Qt`p "`!0',p !0p  "0# W,p  0v0(Kh>h=h=h=h=G-Mhp`@ h@$ P` L$`\,` , .\ p &`PX  ,$,X. .  lH$p th $d0i ̠x|P la !Q`#<`<4P, x0 ` *L#Ƞ0`!|@$0p $x@0P(@%P @,P0|`P#Tx0&D#d<0*!40 "0 #T4,  (8! pq "0. *@P 0p qS`A8` 0#!( !0  "0# l"p0tt唃l l@匓 la"< P !Q`p`T LDPp0`p!L##t0$`!t@0$X$d@ 0@l0@#D0*̠0 0T0l L0!D0, "0*Ƞ #夒  HP QP!$x`@P0Pp Lb@ "*0%PQ @@ a H儀 0# "X !  "0#x!| 0쁟쑟'x h@|P.<b0*( p `FA %40!!x!!,!P*h>h>h>h> -@LP00 -L@P`pP W0G-Ml@l0p`Q @A 0\0.` P̌pd`0% @l``@ P XP`d$` ., .\$@P ``<#,ɐXD,l  8#d #.@`倀h ph ̠ x laP!Q`#<`<4P, tx0 `*Lp #Ƞ0`!t@$0$@ 0|P(@%xP@,Pt0x`P#T|0&D#d<0*!40 "0 #\4,  (8! pq "0.*@P 0p qS`A8` 0#!( !0  "0# "0!L.l ℓ!瀀 0 0@-@$ 0@0 0 0 #EgvT2ܺ -L@M@ hK ph( 0 @ 00# d ,0*0 0#`a0"00# \@dȟ0! 00#X@Dlŀ0 0 0#T@$(0, 00# P@ b* 0.0 0#L@0"00# H@ǟ`0! 00#D@̀0 0 0#@0n)+C0,0O B0#  <`G' 0.@0 0#@8@@dE0"00# 4 0$00#0`ǟ` 0! 00#, ǀ0 0 0#nd@& 0. 0 0#  -P@0" 00#<@|0!00# ` h@\Ɵ0 00#lƀT@<0,00#@@& 0. 0 0#  +,@0" 00#aX@0!00# `D@ş0 00#̀0,00#\@% 0. 0 0#  b)H`E0"@ 00#@@dF4@0$00# ` ş0! 00#ˁL0,00#n$ P.0 0#  T0b&P"H@`0"0# ğ<0 0 0#lȁ0! 0#d@d$0, 0#  HX0b. 0.0#L@, 0"0# ğ@0a 0 0#4@ā0! 0##h0n 0,0#\@  * 0.0#P0`0"0#D@ ß0 0#ll΁0! 0#P#,0 0,0#`@ 4 b( 0.0#h@000# L@Ÿa0 00#lˁ000#T@"0 0 0#  % 000#\@|` 000# @@\Ÿa0 00#d@<ȁ000#H@"0 0 0#  ,Ab- 0@00#@@PQdK0P00# PP4aX0`00#``Xe000#<|` 0 00#` \lˀ000#D@? A10N@b@P, P0@ R?W@pG 0 ^?W@P0 W(K (Ko@@, ; G,0!pc?WP -L,MT  1>?0@0c80 X1"0 @ D <0 08#8H L0 T^!\8 0!pT..l<@ #48 <, D[2K30KT80-KL[ C1PK4KP .KP /K0pKP4K  {U'DP  0#<0 "( 0#40  Q Xa, 0R(K/$oFk>< 0@-@0@ $0$ 0 0 0 #EgÉܺvT2 -LRM@ ` hKx```aD  h! \ DAhp\ 0"hQToD0#@ d0 `e[@̏J " 0%`0# ` flL i``  & 0$0#p苎dKp\ȅ0 0#X h 4D0`  n (T1 0,X0#pl1 fk{T1P  l1 'lˠPꪉ] 0. Th0#l1  `0 @  *g{ l1  @0<` !Pa n`PdL0%h` j0# 8nP 0 `ae[ #`L 0$` 0# X䝟0 hc;4p|0 Lq |Hp &ˎ }LdK0 p靊 0# pT PlP )fk` p|0, ,0# lˠ 'H |@PY 0.茊0#H@@|0nidIP0%0# l1  H0 g{ ( l1 a  !0`j` 8`|d`e[h0$ 0# АdKLa al͎ )0 0#  @0lc;`0 j0`p *` P X{` 0,pfi0#pH Plˠj[ &8@p 0 .gz "00'@  L0Z48y<0b-d1 LP0dLx n x0fk 0 ̀l1 d1l0g{P x雊0,0  X0 e[ 0  x lˠt a@ t艆X dʟ 00 @!@a@*L1idK 0L jȇ  ` 0 0t``al@qd n 0  h hYt  0P 0P P|g;@p <1  L1Xylˠ eZ @p  0 p T 0*fk jp g|ภ @P0 ਟ0 0 < e[꫎@   00 H1g{ 0 pmvmznܼNS @L❀fm 00@0#@D@H0g{  0  Pl PM舂0na0 P0#    P T0` 0fk00#̎00i$ 8Pl1 X0  P$0 PĐlq dK 0'b,p hQdp` P} 0P `p h 00lˠT1P $Z g{0q 隁 0ppfKXa0 $!@ 0 @@Pa018Ba  n @ 0@ a0g{ e[lp @  0@p`dI 00 0 nb)h0Hr `la p `0 01lip 0  la dKa pPcH0gy  `0`h P 0`l 0` P80hh  e[ 0P 0T P 0 g{XT˄  0 aP 0PP0a8@  0  hDL1fk e\ ᜐ@ 0@ 0h@ lˠ K Xp! `0 l! !0p l0e[p  ab*  pL0<` ༐  0` 0L!`dK 0}  Hࠕ00! b+ ! T1` ` 0e0i  0 `, 0``L0lʀg{Pp a  T P\vfl0   0p0p, pP0ig} @,1lA l1@Pn 1 @  Pfk @P@0H` 0Wl1 0P荁Pl1  00lˠP g{ 0 eZX0 pP `  %8Pj0$ 0#Wh0 PdKPHahnਐ0*0#  gT0 !P`Xj`@pì 0. 0#  (xT1 %`pmnpX` a0,0# @ @lL0 &pe[zlˠ dK 0  0# fk '88 h0  (` T j0$ 0#a`0g{dKHP0* 0# h )@Y@0 P i `LP !lɀ` Y0jfj 0. P 0# &PnPP ` 0,a0#@@ d0yflˠ ``dLp 0 0#]jX1 %pp`gz` `L꩎0$  'e[ 0#` H0d g{p dK0pin0* &0# P1h fk (  ሀ hpPj ̀ 0. 0# !0hq 0`[\b,0b;(! 0`Xq n0,lˠ@ a{  0#T@I`!  0P!` ꪎP$0 P% 0: HQ 0 (夀,`L;] 0p0Da % 0dc (K -0Q^q?`p@PfUpLpV@@Z* Q :@ @0Z* Q* ao!@  @@Z`* -L,M01>?0@0c80 \1T 08<0 0!D @0 ^.L H0 T0#\pT<!!l##4<30K, 80D[@0-KL[80 .K2K8T N1PK4KP /K0pKP P4K  U'DP  0#<0 "( 0#40  Q\ v{, 0R(K'$oGk>< 0@-@0@ $0$ 0 0 0 #EgÉܺvT2 -/LaM0 @ lK,0 {1Ahp PaA ad`lnDi4 i80|/0%1  d0 ac 00#l1 p `0(p0 nd-c Hc1@l ` 0(T` 0\,@1 P\0P Q\clD0%X0H@aqbacT\Οc< Ȑ X0' &@0 P,1 T0Q T "aDc, 0% P0H͌@`lcTc< 0* (0X A1 L0 PLx  "d Qc,lDnad<͟H0% &@ H0  "aq@cTcP hAcq͌ 0ᜀ0*L  #@(|O`0 x @ \-&l@`0 ! b @Q? `P0`?SpP`0L`@  goKu@@pb Eu y?0YP@p q?0Y@P 0 -L M0`P(0 p0K  !62 b1 R<0Q0^ ~?@ Q R W 1  !1Pt( 0R$K $o0~@>>G-G-M TXLP@D PAhp!(1,AaP`0Q4ap8q<@D1 HL( P!T1Qq0@0XA\Q8``adqf8<(,0!41HLPQTaXq\p0@$H',#H8P`0@ L#D<P` 0@ D4LP`(HQHa.9.WiQa0@,aLQHL4,,'P&Π`Q a(La(g Lqp(1)HHy ਄ aqGo#Π0@Lq,Qt萍%ࠍp(A䀍C(J_`N p'   ણ^`0ܐؠ@RP` P%`& P`P'`(Vp  ,!Rp~ p #p N0p 䐍@)*P`P%`&! "0!p) *@f圑ph pf]` P`!QaGoZVN`qdR_`~@DJ/ Jx|!. !1N?1ARO0AQ^`QaVoaqplqxq|們儡j!堁夑1AtQalllh !t P _!i!wPQ堁WPaQ^iP#tQp(y`ifWq倫$`at(ᠡil ` kh PY ≑ Vᜁ p$P夡Qጔ(媤Rᄠ .PPpP`蔐P%`&p)*  tx3ᘑ}1Ab_`>q弁^fAa0@408@f^P`P`,P0`- $( p!j?p(P`Pb?`0  . 818<4!,00 @$! p$(P,`0Q004@ݍ> -pRLP`& @D1>0A W@;@ RpG`@D  Q*H0 0@WH0L@W耀cW.:P p@1@ T@D 9 `phP p@1 0S@DRH0 0@H0L@Pp@1 0S@DRH0 0@H0L@SH0 0@H0L@x -RL`p. @D1>?0A @c X2:PP p@1@ @D  pj?X@<@H@ ?X@D @pXP hp@1@ @D P[p@1@ @D 0-PPL 0@ IpPCp@0@0D@H0L@0> -0L@$M80 4@ < @L H <HH8 4 @ p ` P8K 衟 80K @ 0!D#L"$4%T'\1t0 , &dp xAP H 0KL0` ੡@ 1L N@D@ 00K @ 0!H#HD8%X"('X<x&h0@ @DH0L@" 0 pPP0P<0PP <~o<H00@<@P`P`(KoPPp`o<@pPPo0P0< `PPo -PLM, 0 . U00@P0` 0 @ $#4!,<p,0$Dh@d0dP`` 0@(#8!(8$HP`0^``0(Kon -PLM, 0 . 00@P0` 0 @ $#4!,<p,0$Dh@d0dP`` 0@(#8!(8$HP`@^``0(Kon 0-PPL 0@ oP o@0@0D@H0L@0> -PLM`( M 1A@pt1 lA0@$#4!,<$DH1@A <1 4A 0 @q(#8!(~8$H? ⨁@D( 0 8PP0)?PP@+8n@00@0c8( 4<"$$ (  Qo8nP@8n0P0P@8`nP@@`n 0-PPL ( nP@n@0@0D@0>G-: @M;0@$P$8$0$$ Q|4q aP,. .`.8.\0.$ a04p Q,@$ @$`$8$\0$$ a3p Q,. .`.8.\0.$ a3p Q,@$ @$`$8$\0$$ ad3p Q,. .`.8.\0.$ a 3p Q,@$ @$`$8$\0$$ a2p Q,. .`.8.\0.$ a2p Q,@$ @$`$8$\0$$ aT2p Q,. .`.8.\0.$ a2p Q,@$ @$`$8$\0$$ a1p Q,. .`.8.\0.$ a1p Q,@$ @$`$8$\0$$ aD1p Q,. .`.8.\0.$ a1p Q,@$ @$`$8$\0$$ a0p Q,. .`.8.\0.$ a0ql A=P0,@$ @$.@Ѝ  $(,048<DG-4@ M;0@$P$8$0$$ QqA= aP,. .`.8.\0.$ a04p Q,@$ @$`$8$\0$$ a3p Q,. .`.8.\0.$ a3p Q,@$ @$`$8$\0$$ ad3p Q,. .`.8.\0.$ a 3p Q,@$ @$`$8$\0$$ a2p Q,. .`.8.\0.$ a2p Q,@$ @$`$8$\0$$ aT2p Q,. .`.8.\0.$ a2p Q,@$ @$`$8$\0$$ a1p Q,. .`.8.\0.$ a1p Q,@$ @$`$8$\0$$ aD1p Q,. .`.8.\0.$ a1p Q,@$ @$`$8$\0$$ a0p Q,. .`.80.\0.$a p0qP*0,@$ @$.@ЍD<840,($   - L >H0@-@P!0 Q8 #Ƞ 0 ^D0 -L M((K0`"x0i@P 0 8#X "U 0AM00 2K40 @4pK70 40 0X5@P)4 0 8#X00 U0@X(K -LM((Kj"x  <0 @  j@P <@0 8#X "U 0A]@2K40 00 P }@ 4@ 0@v4K0 00 4@00@0`V 8 8 `5P4@ ^ @ 4@ 0@W4K0 00 4 0 8#h00 V0P800S80 4@(K p-LH`P0$H phJ (-"xL` @P08#XU@ (-"xL` @P08#XU@ -LMR`* p0K 0(8,< 0$4 00 , a00, p###Ġ""H"TZ0@P `(K -LMR`* p0K 0(8,< 0$4 00 , n00, p###Ġ""H"TZ0@P `(K -LMS`4 p0K0 0#0P 0(8,< 0$4 00 , 00, p###Ġ""H"TZ0@P `(K -L0CMS `B0K4 pb`B0K 0  (8,< 0$4 00 , 00, ###Ġ""H"T 0 @P 0 0#0Q0S`F0 8<, 0(4$ 0 ,0 00, ###Ġ""H"T0@P 0 0#0Q(KG-P0X\P@0T 0c|àE,80a5, ,E娕0q  A `&0`g`0D`&0& as1LE#8##0A5 nP%0H P%0e as1#A#̠ #ğ0@@$@a 0L@$0 as1#a#̠ #|ğ0`&```0P`&0& as1#4##0Q4 n@$0T @$0d as1#Q#̠ #ß0PP%Pa0XP%0 as1#a#̠ #xß0`&```0\`&0& as1#0##0A3 nP% 0` P%0e as1#A#̠ #Ÿ0@@$@a$0d@$0 as1#a#̠ #tŸ0`&```(0h`&0& as1#,##0Q2@$ n,l0 p$ 0cgqA!Q!1!ĠA 00#0` \`#U0 p0 0cr#xA" "lQ"40  .`40t .0. bs2##̠#(0Q1 A aP&8 x0P% 0c er#@"1"̠ A" 0 0#0a|< p# ` r x@"1l"̠"d@ 0#0l0`#&<&(&' 'Ƞ'p0 `0C>0?>0G>0K>G-0Pp8` <@ W0 tTᰕW< |0 0cr#E"805" "Ep1  .c80x .0n bs2<ş#A0# #$$ 0! @@$@b40t @$ b0$s2##̠#(0 Q4 .l0 p0p. 0c r#T"1"̠"|T 0#0l0P#, l0 e 0cr#8ğ"0A" "4$0  @@$@a(0h @$0$ bs2##̠#(0a3 a`%$0d `& b0s2S#|# #$tS 0! .a 0` .0n bs20ß#Q$# C#$ 0! PP%Pb0\ P%0% bs2##̠#(0 A2 l.0X .0 bs2Ÿ#Ax# #$l 0! @$@a@0T @$0d bs2,Ÿ#Q # #$ 0! PP%Pb0P P%0% bs2##̠#(0 1 l@$ 0L @$0 bs2#t# #$h 0!, a0H ,0l bs2(#Q# #$ 0!PP%Pb0D P%0% bs2###(0A0 n,0@, a0s1|@#( p #A#d 0! n < ( ,,H,T0 @P0K>0C>0?>0G> - RLxM0 00@X0Lp ^ p0XL< 0^P`X L 0 XL8 0^X L 0 XPL4 0^X`L 0XL0 0\@\p \0L,(8( 0X0PP(($.8  .%<!...Gg0.,A.40 %.( %4,G0!,,, ,4l0a,( !q, %8!HgA0!!!!0$P!!4A0QT0 " "! "VA!< " ", H 8 D 4 @ 0 < \` ``` Vd갊/l/l/l/ /l/l/l/ /l/l/l//840P(\F($ 8 P, 0 l% (Ƞ $6$& *|aq !40` 0`0 5ap %D q%ȠPQ` P U*d*  0儀 P0!P "0%P@ pUqhE`QX APe " ` !0# ! "0#  ` Xw/\/\/\/܌/\/\/\//\/\/\//0,4t(,X*̠*(48t ğ0 (4P !Q*D40d t@x lP !Pq#@4(h8@`| ,p q`Q8` hP 40&\l`p  "#`d0ß!$D0&x`@ q aQhp@0#| ! " ! "T[3|#LX[ Q!M[al#d3A0  0# "! 0  \\ 0  0 0  \ ^\ 8KdXKdHKd(KL2"!M[X[T[aQ|2|" AHD\2T"! @aA<2<",Ƞ9P[ 0 0# "!@9[HD1!!aQ1! ,Ġ A 0  0# "! 0  SDpa(8l 0@0XHP(($.H1  .%<!... Aa0.,A.40 %.( %4,@0!,,, ,40a,( !q, %8!`A0!!!!0hP!!4A0Q<0 " "! "@PA!< " ", X 8 T 4 P 0 L O03>0/>07>0;>G-M 0dğ 0@R$2.  B$,,$ ,8 1, ..4 4<.ğ0#. 0#,? H0죟  ܣ))a.4??0.Ƞ1 0.L? R!?! ?@q !8A?d @?0! 1?Ð 0 7  0@ 0#@##a0$4??0$Ƞ1 0$? !R?@! ?q !8?d ?0!  F1?Ð 0   7   X) "0  , "",$" !!1"! 8!8#8 !0##  2# " 0Ѝx|))a.4??0.Ƞ1 0.L? R!?! ?@q !8A?d @?0! 1?Ð 0 7  0p@t0#@##a0$4??0$Ƞ1 0$? !R?@! ?q !8?d ?0!  F1?Ð 0   7  H X)t3333UUUU0O> -LMP`@p TDXHL\0K 0P ,@ 00 0p, P`#@#"#8"Ġ"0 (KG-M R? H0|t l))a.4??0.Ƞ1 0.L? R!?! ?@q !8A?d @?0! 1?Ð 0 7  0@ 0#@##a0$4??0$Ƞ1 0$? !R?@! ?q !8?d ?0!  F1?Ð 0   7  X)00 0 Ѝx|))a.4??0.Ƞ1 0.L? R!?! ?@q !8A?d @?0! 1?Ð 0 7  0p@t0#@##a0$4??0$Ƞ1 0$? !R?@! ?q !8?d ?0!  F1?Ð 0   7 H X)0O>0 Qp_> 0-<@LP -bP@ 0T00PGkGk -2LM @Rp`0  @P0ČȌ̌!2,2! ) !0 #,# ,!T"0  ! ""4!4<$"00#"0#  ,8#0 , ,!0)!S0 -ቝ4 4 40( ር)# 38 0(ˠ <0 80S)v0 p, @^ 0 (KT 0SQ0PM LGkUUUU0W>pW>p_>7 -L MP@`pP DHL.$ . . Ƞ,Ƞ  D,, ,4..D, @.$ @$.`0PK p@$,4  0 ,@  v 3 0,40!0 0##$ 4# ""# !"!!" ! 2!26:0#`p4 P!@!4 ! $ 0 (K3333UUUUp@-0` R" 0@Tڌ0 P 0 U 0S 00\P ppGkGkGkGk -00ML@ d0 @ KXaq -LM,00,0 < K <0  Pp Xaq -L M T P0@L 0D<@,0 ,80@,K?XaqT~@_q\~@`q -PPLD d0SA 1p\ a 10 ^ 0S 010  \00= P à L ` 0 0@0@ P!eGkGkGk -H0LM0S  0 KXaq / -@QL^ ppW`%P0S! 32C0f0 !   \P0@0଀ 0 000ഠ  @GkGk -0`QL\PPU@pp0S Q32C0d0 !   \ 0  ฀GkGk -LM⸡00 SP@ +1p`^1 @0S% 0"0 V U 010 R010 R Qt 32C0d10 R @ ^t`VX Gp(KV ^32C0d(K @ pP ,P0@`@00 000 GkGk p-@LP0` RpQ 0ES32C0dA1 R U 00  Q 0 S Q pP^U( 00  PGkGk 0-@PL r8PQ 40,80(8Q(0h0`q_q -LpX)`P D^W P^80U408@ Pv)@PP8  _q`q -0L&q0SI RXڌPPU 0S00S  0 0ਐ_)U=32Cel `P4 0@#"B c!W^0@cL^10 㨐  lF `40 /l0pX0P 0Ac+^P P PGkGk -pP0LS`P @VP#:32C0f A 0S0C0000SP P0  0S t]GkGk -LMpP_ <0S\ r8QW ^S 1P `U:4 R 0004 R8,K P,0K0@#0(0 $K32C0e 00C0 0,0S  0@/00@0 @  P p(W80(0 jQ8GkGk 0-LMP0| 0@Q *#d0"B a! 000G@0P  (0 K0_GkGkXaqd/-0PGkP0S0SP0S SQ 0S R0000 0 00 000 0-@LP$PL<PLL0 0-$@PLP R0000 0 PL$0 -L M4 0 , L PP ($ 1>< @040K0 @@P@  00$@ @,(K| p-0LMQ`P KpL 0@00 ,6K Kb0P,U0  000\ $@  (00(0  00CS 0哳LYdcGk -LM 0S0,0 0S/Ȳ////QR 0,0 ,QRL hh00  0 p101$2d0 0(00S {Q0S$@PP0S@p(00a L 8$ Uء P, P0S@pP,  X 0@0$0@S (g[$LTL,QR QR 0 P, 0S,0 A0T1 (0P` 0SP`0@0! *P, 0,0 ꘳/h~@ -L/ -8 4(0L0(#Q !0,0hx -LMpH4Q P, 0S Q Pm` `[3#@0CX@@ 0C@R[ 00@(0 3PR{P 0,0 N RZ 8Q4H3  9P, ;Z  ,0 00<  @010Y 0 S 0 000 0 00 000$  (0100"00`< 00@4PP Y 0 S 0,@ P,   ,2 P', , ,0,0 0S 80 Z 0, 0 00S Z D0@0 0!,00S *32C0bt!10 @ 0S P,  (@0,0;?,0@0!, ,0 ,0S00S,0 ( R, Q 0  P, Q 0@ , 0 S Y 00 0 00 0ct \ h X /GkGkh~@x -LxMds\, ^@$2 @3^ 83^ , 0 R(K3^ 1C^ @P 6P  *0S/////ܸ/ܸ/ܸ/ܸ/ܸ/ܸ//غ/ܸ/ܸ/ܸ/к/ܸ/ܸ/ܸ/ܸ/Ⱥ//b0StPK$P@KY$YVJ  0t0 p 0R0R+*hP p0QhYhLDP L0Q\YDLLaHaDa@aQ@-@ \0Q  P 0 SQZP00Q0S @10  -LQ`.R.\V&  \* V  R b\`FPXVp`V @@lT@!d YXpl,j,h, e,~@~@p~@~@ -LQp`-R-\V% 0\* V 0 S c\`FPWV`V @@lT@!pd XW-,+,), &,0@@~@~@ -L`RAQ=8 Rp.0^p.W& 0Sc^pV$ WQ `dV pRP 0 @nT@!  P 0+(+p+ +x@@`@H@ 0-LxMPP&@KtcX 0 | x p l h d ` T P \ 4 0 ,  L H @ < 8 ( $ <K0+HkT/D//@ -$2L Pr0S Q@0Tz P:  00CS+////////////D/D//////////D/D/D//`P WlP Wll0@0T0P sWll0@0T0P aWlP YWll0@0T0 S l0@0THkHk -pP00@Q0SL-fQ X0S X!00 lPP& 否P  !WlP 1S  RTs 1`l PP> 0BS>////x//0/(/ / //x////t/x/l/d/8/0/(// ///|/,/u R0 ! P0pP @T3 `l `PP7tl M0P  0R !("( 0p P @T\tXtTtPtLtl "P0S l 0S 0S 01S 060#0 R0 P 0R !("(  0!S0!B("(P 0S 01S 0j0#0 R0 P0 0R !("(  0!S0!B("( 0S 01S 0\0#0 R0 P0pP 1,rs(rq$r 20P &r rfrrr 10P ql }0P 0pP qqql hP0S l0P [0S 0 S01 0 R0 ! V0 0R !("(  0$0pP ppp0 00X0 S077P0HkHkHkJkJkJk,IkHk`Jk`>0a>8JkJktIkIk HkIkxHkTHk0HkKkxKkPKkHk(KkKkIkIk -LM@`l PpP^ X^ 0 0J( KlPUJ P 0 0U2XH  (0QU(*XH e@A0?P00S 1\1C20A\,0@D0 0l/P  0CR0(li$K( K lP]U0T(0 Y 0`0`mS -LoM8@T0,0 0  pUq q q q ` 0!R 0S 0S  R`, 0R(K0CS/////P K Up 4@TWP ,0   <K T! 01S !<0K 0S ("(K<K 0 `K  P  0 T  `R1P 8#81  0!dfT!K  1 PR`@e0fT@Q 0S0! 1 `A  0S !<K1 RTP! ("(K  P9   0 1 PU6@e T @\P 1  0I 0( "(K 1  8T! 0 S!  0W00CS T <(4"4!<1 1(< 4!4 <1 "(K |@KK$\ @ S\ 1 <0K 0W<K1<K  S!<0K @S 0:S <0KW$oHk`> -LM@ \,  `G PK  SYA 0 pW  0 =0SY( 1lK@ SP, 0RM(K #,10S. 0S lK$ |SlK  lK$Y  l0K -L\M,ɟ| |@, `x pPPxW 0l W x0 -LMPP] 8`V 00S 1 QQ*0AT ,0pp0 S0S @T0(0 0(00CS$/$/$/$///////$//////////$/$//////0 0P(0 04`V 0@T<(00 pP( 0 03P( HkHk0 0  (-"(L+ (-"(L (-"(L (-"(L (-"(L (-"(L ->@LOl$00 -A@LOl00 -z@LOl 00 -@LOl00 -$@L}Ol00H -@LoOl00 -@LbOl00 R@R-L`p l >Q @z p-L`@Pl z!Ppp -LM 0pP@$0 4`K3 0#0P\)  u0#0#0QA#0P0 Q3@R 3x 0#3N$ 0R K  $oa>   0-LMP K@O !4<"D\0 @  ,O=z "K0 -@L !OO00 -@L Oh O R-L@p`l A8! BPP @ N p-LM`0P0 000S0A Q B,@K 00 0#0QWN 0RKp$oa> p-L@P`l  p E p-L@`Pl ڿX%(dpH  0- LP@ lſWP QPKP00 0- LP@l㤿6P00 -@ML0,K - ML̀@0@K 0 0 -LMhK@P@Kp.N 0  0S2"Wh@ @0 < 8 dP @l TP A "0@ xŸX  @ P TP ajP.@K`#YP(d0ST0T0SEVSl `(P @ 0X 0 PTP WcAl P 0 S  @lо0 @SWa(K(W(1!@0 X T@ @ VP0l 0 P W-  W0S$ `pK0@ M000l㖾`e0 pS 0PU :@M000lま``ꤖ55Kk@Kk -pLP 0   R`@0 0` 00@ T000@-pS`P @0 000   000 000  " @Tp@-`RP @0 000   00 0000  @Tp0@-PQ @  0 000 0@0PU0@-pR`% P 13 RP@0   "  80#440# ># b1#  @ 0@^ 0-@P LX 0#40 "( 00  0#40 "( 000a> -(0 $ , 08 40< 00L -@Lz L02 -LMT4PK0` p$0 L `4[  Z 0R300%0[0%0K–\@ 4[  X 0R300%0[0%0K 0Q1 0Q11 0#P1@1!@0#T1 zK$ 0R2 K1 0#P1  0R300%0[x 000#%0K  0R300%0[x 000#%0K$oa> -pLP`@~Vz_1 0#P1`F V@  ረb0`R1!~ ~20VS  21!0#P1z_ `h@ -LDM⬀0dPK`$0 p@K!K@0\0#0@@T eJ$ 0R K$oa> -LDM܀0@R@$0 P`(p C 01dPK@CK!BK@060#0@@T J$ 0R Kp(KA$oa> -LDM⬀0dPK`$0 p@K\ K@0\0#0@@T(  J$ 0R K$ob> -LDM܀0@R@$0 P`(\p s00dPK@J J@060#0@@T YKJ$ 0R K\pJ@m$o b> -LDM⬀0dPK`$0 pr@JX J@0\0#0@@T  WJ$ 0R K:$o0b> -LDM܀0@R@$0 P`(kXp 400dPK@]J \J@060#0@@TP I$ 0R KXpBJ@$o@b>G- 0M0|l L\ ̠<Čh4x HX $'4%Č&'\(l * p$́  00Q >I?("(I -""LM 0`, 00 P" 000 @Pp 00#00  "  0p0#0 0  ,G,0@W0 (KoyI -(LM|"X0`Kp U@T Kd _I  dT `b> -H$H0p!`L BPB@0D @I0 0h -@L1I.I +Ih'I -LDMBl0 l`0Q@h ` 4K,0  l@D0E@L H P@ T l R L0Kd0 `@ P@X \@ 4K \DKɥdKdP[$0@L`Xd0K@0Lp#D <P`d0K@0D#L4p d0K0@#4<$D,d0K0@#<4($LP`d0K@$4$@pd0K@$<@P`DK<K0!@"\ D0 @@ xhDKD KDK 4Kp<K \ld0K0 @\Pd0 `@ X@PE@TX@ \P l`0F@LPK`PU`P`LP H` T``FvT` tDK H 4K0H$, 0PR(K*$ob>pb> -L4MX \0  X0H T !H+< \'H@P L <@ D @ D@XT @H 0Q@ < D0 8KG(K\ 8K< 0KT8K8 K)PKP[\0@$L`XP0K@0Lp#D <P`P0K@0D#L4p P0K0@#4<$D,P0K0@#<4($LP`P0K@$4$@pP0K@$<@P`8K\0!@"8K 80 4@ 孤0K <婤PK0@ D0P L < 0 < D0 |b>!!p@-(0`"dP  0". . @0   0 .0.   pb> -0 1 0L@v  v 0?,01k -LM Y ,0S 001#((8, "X#H`p $  H   %`V Xp  $8,  8 1k -0L@EGzvh -L,M H D L0 `@ LPH  Rr \PLP 0: SP  @0 @0 0 (KL@1 0P80 0: SPt0D@ 0 ?Sʧ LQ  10P ?HK"@0,P២ ?`UL20 R02 0 P\V L#0S0 P| VD0S0X0S<0 @0 , , 0O00p'T P @<0O ȟ P T K /<@0@Y80 4@ WQ @,0O0 p"XI8WF80< Z @0 L@@0 0t Mt0D 0 ? SEHRB0T R800  0$5@ 0p RT001Tx?>   cp i  0S0X d @JTb001^ pQ?>   cpG C  0`0CW^ Bb   R 01Q 0110l1X100`1$ő\ 1 0R 02S\0 P3Ѝ 1 >0   r  R 10 01 -L$MH L  p ?w0OO^P`1`>PL 0  BSLaeH L08`0?>   cpH 02ᠢ0!DPL0` p2RLH `08?>   c 02L!0DPP| 00`1ɯ D @ QL,0S PQH 08 bS180 1, !1!40 L00 0,<0 h1< PoQLL `0Oς  1>0PO>p@P` Q 804 \0 0S. 04  0 S ^,@ 0O QD  RH  0| ?(KLH,0p S0QJ 0H 0 U Kkc>c>\@t@ @@@ -LM ,  @_ 0L8  0F4  ?n40 0:`, p ὞@ ,8P804@0\ BQLT4 ABQ0 CBĘ,0UPT@!4 V< ᰤx<0PQ`004P`1`#Z ,嗞V`!@V`YL#20T 0U00 RH3 VHY@0SJL#20T 0U 00 RH3 Vt\AZ@0YL20 8@T@!@`02 08\Y YPL20 80S@@2 08` BVPZ,(K004`+~q,@T, PL#2, P\08`V04`V PT PL#^08@T04`V P P  -L\MH< 5 Qp< @ <`000 00 0<@@P(0PpǏpP @p8@ ?@d_y8 4 @ 8@`4!4P a, QU.QU10%P1@ 80<Q8 4 < @0@P @ ?  b<@. _@Pp@ȟP =4 Q 8 <( @@8`04Q SPQ C` 0᩟<0 \3R 2<0@, 0PD0 Z= 0ߟd ` @娀ȟ 0ן`@PdK ? |0 | <,,l0 h@  @ 0h@ v@ ` 0 F.lKP೟ ȟ0),@@ ?\D 00C0<0, 2R0S@3CL# 20C 2 0F1kU ȁ@@@ -LHM\ 8 0pSPo0@0T8Z8Po0LO P` 0OVʲ 8@<4 S?0 @8\00 P4 7H 0O0@ 8 ?8`00p S 08'8S`0`0`QωX 0 !00`D  @0 @@40R<0 8 0v8PT0ZPp$P`p6^`0/ 1> R,6@^`0?0 0,p0P`W $ 0 $ 8 b4 D0@4 DL# 00 068Q`0 80/0cQD0@@< P08%8P`0%X3Q@_`08 0NP+8@004(KoxcUJ\ 80 0LvDZ} \P 0,m 08 şR\p00p  0(K8p$8 `$80@_ P L×8 n     ? 0@3CL# 000\@4Q d0@Sယ 4R 820PuWX8`@S80e8 0P H80\000 `3RT0T !000l84S}`06C cB SWAQWS3 P`080YP 2 8R`0 0 0 8   8P ?0@3C0L" 000\`2Q- d0@_X@ TP S c6Q SPQCX K c 1R] 208p, 0PP0 Z8X K ᛜd ` 8娀 ?L H0 咜8@P0`OdKs&,L K lp h h 6L K 8` F.lKPs `0', @?P000 0,RT0T!000\p8 0E)8X P , 0 P 8X Pu 0\8 0 ,(( 1kU @<@T@@l@T@Ђ@@ -L,M D `DL@ pP(K D P4 H 0S 04/ GP00a0 S0X$Q\q\0/ Q n>P  4pR\0/ b>PP 3 ^\0`ω1/p0@00 ,@ f 0p@WXlhP ?᭛0 , 83,@^\00 N1/0L@ 00 R!H \%2R> p2^ 0L1/0 H010  B ; 0@4D@@L#0 0 Q0C0p 4YaW^0D 00KLO_H0NL@ H 0x00K<0 x ? 0 SʲRt0\pD 0(080 冘 P  oPOP`_<u`0d/ , l1 \00.Q`8``}c0pH<x H0R PkPx `R\x00x0j   ?> 0@3CL#@000}0\ L10  ZD0 01kU @0@T@@ -L$M@ D DPAP(K@D P, H P0 $h0U 0 S 0S P@Q0N 0R P3,^02SQ0 @_ 0 <@ 8P 8D @_P 80 UAO>@P `L H  Q Pp 0PS04@T  @ p  pW00 P0O0@ `0D eZp 0@_@, 0_T PQ800cO  vU80pZ,_ %1kT@ -L0M L `LLH PPT P0 00S  L PD H^U #0O0@00S T08U ZO 04 R40 p F0SFp W^ T K D@ < 8 Z?ᚙ `0 , 0 K 1>0 108\` 2Rψ0O0K` 0@1 >00S_] 0@ <0 T Z p T K pQ8 4 }Z8PK` 1ψR` 1> 0 #0P @` ^$  j$ 4 D0S@4 DH0L# 00j 040Z0C40  j! 400400L8@K0AD_@@ 0 0 R#A4g\ 0@ <0 S 0@ <0 @K(K80,@dYn \^ 1/X`0 0O0@1>0 AR!0 \ `! 400C40 i! 40040T0 RY3 1> 020$  B$ 4 D 0@4 D80L# 0 ^0C 0  0Rυ0O0` @1 >004]0@ d! 400C4000 c! 400C401kU -LM080 00 @P4!P @ß 0~ x  (Kj  V ,0P* 00 ,0  V H#0S0C0ß0 K "0P`p40 8 L0 Pl0p 0 R RPn 0   R P 0P`04 H`o 0 Rl 0  P  00d0X0 0 QN 0P R R QK 0P  P  Q9 0P  r 3R QM @gP 0 Q P0S su0P0r 00 ,0 |H#0S00~k _ l0S sY0l0V0h R 0l  r 30l R 0l  l  0 Bh  0h Po}@gl 0 0 (0 4mc>Ѓ@l@@d+0@t@@ -LM $5S. @pd`  02 f V@ SQS K @0@ P q  10Pp7 K X\\a\ (K^4KKx0K|!P0K Po0@@ 8K0Kk!P4Q@K00(00 0K80`S 2 K Ze㼠 ᷓŸ ?p^ Z 1P` OP`@0R P R80P0(0 Sn A0S] ,)\ P0S[ 0!\Z&`pQ d0 c> @SPQP#00d0  c6 0SQd " 80O`p X_000K n $_P' 0 S@P0(0SK ,YH K@00,K _P,0 H0@_0 ^,[0Y0[00H00 f4@000Q 000Kk -LM $5S. @pd`  02 f V@ SQS K @0@ P N  10Pp7 K X\\>\ (K^4KKx0KY P0K Po0@@ 8K0KH P4Q@K00@ P p00 80S 2 K Zo㼠  @K0@ P?@Ÿ0 Pp_ Z1P` OP`0R` R80@P0p0Sp A0S_ ,[ ^0S] 0ZZ&`pQ d0 c> @SPQP#00d0 c6 0SQd " 80O`p X[000K n ]P)  R @P0p0SG ,XD K@00,K]P,0 H00  Z,Z0X0Z00H00 Z,@000Q 000Kk00 R 0  0S Kk M-L4M00P S@0,0 0P0 SH  `3Qt 0a0S QARQ< D?@Ğ@c.d 0P0@0S@TP 0 Ry P1 0ppe @T HP00,K  b]P@ ,P 'X0,0 P@(K,0 < b4ɯT L0 P  0(P@ H@ ?ȓ @P 0PPD@ .< 8 N P 0 R P0 0 0 @0@P@0\00 H8@d0<s c>rc, SqQP 0P  0s(0 ! (pǏSvP0@0  @H @ß0o@ {H@<4 Sʯ H R|Hd <@D4@D_@Ĝ0e.H@O 40`S H00ßD P@Q4 0 P倿 P 0 VP@ 0 R P 0 0 @0@P0Q00 H 0@d04# cX@@l@Ȅ@X40t@@ @<@ M-LM`  0 00SS p0S `3Q 0a0S QARQ< D?@Ěc.d t@0d PR0@0S@TTD`  0%'PP"<4 S<7 0 忏@ Q> 0 R5 00@0@000 (K#3 P 0@ 0P84S 0 ?S h00h0P  0&X40Dmc>@l@Ȅ@ -LEM P 8%@  L?00R 0  P4 UR00 0a QUQY00 @PP Pb0b1re R1nQW@Y0f00Y{,K 0KP P,00C!,0  0PP Ԡ  \Kؠ  pK 000@K@ZP `0 H,1 0Q0 0@0 ,P P+ @0Pr@ @5R Q7   @4K00 YW@P>40 0&d ̠00 V4 d0# c4! 0S#Q d0304 <H/40@ 0 0P@TK00\@Kܠ 0S @8Q40<Hv/40 @ {4Q@ \ -LM P8%@  =00 0 R P"4 UR00 0a QUQY00 @P @ Pb@ 0b1re R1nQW@jY0N00YfڜpK4K 0P  04  B4 X`V) 0  LK0  @@ `00,KVP ,0H @4!\@_M R   L`H` B \ X pLP| \p00;00Lnl0T@d \ l8^ `\ ?VQL݈`dKF0,Kt PkHpL,0PpHp L E@10>r0pp@ -RLMM@ c>-8Pp) P P 0 R030P @0A#O1 g00S0P'1? 0@  `HAR-8Pp# P P 00 030 @0A#O1 g0000P'1? 0@ ` HA -8Pp P P 00 1>0 !A `gPP@0A#O 1"1?0P HA`p-8PP`# P P 0 r3p1>0 R! "A@e0 0@A0#O 1#"1?0P01 FA` -L$M p4 P<0 7\ lQRl \@ R^Q V0 #4000400,K0 XKPP<,0Q<4 ,85H 0 <0, (K,F( 0 0S80 & 0H D 00@@,@^3*.D RH0Q84 Q0085@0L 0 U0H D  -Lą@\5XX SS 0 R@0Rh0 S8P0!RTTcKkC-0 LS03Q% 5p00P5,5MS ڬ4S9Ӭ4հ4S@0Ӱ4Ѝ0t0/Oq,,REQ `PNo,P`PLH0` 0`O/0U4e85X< 8P 0` 4 @( X0<0 8P 0` 4 < K4\<@$0#= ,K ,0P@S { 0y 0P@zO@ =S P@(K y됡0@@ p-00LS@P0 0h0S  c`P p0  yP zcp -LM, `2 !\5SS0 74d 00  8@_d t,`p`p<@D_@,}`Vp` p, ,0C@$0(@[`4P8`,P0`\0(KTT @ -$0L Pp`  [@P`@0 S@`V [@P  z0 0?y @z -LM$0`bp PUMT500#0&PP00U00S@ $KPHG0@x @ z 0@@^ 0Q KxPlaL*'$$0`B:$0 -L@MRx0\ X 0\L0 0  < < :[P (KObPT7 X\ Wz@\0< @@h^\ yZX $0 0@0 \0wPƟ(0K8 #H`0 0PsPR8@t8 I Y` 00:00,0A, T`/:VFP ,6H@ \%R  VWP x0@@,P A\ y@ \0R< w\ -yP0S ㇏PㄏX`Bw P 5-0RP5 @0SX$0! L5@s00!T  O P  Y㎏P h ㉏P0\%4RPP00 0 0P ,0Hh @h0 S, 00;00,@P0, 0P40  04<4= S54@ 4@ @y4D $5S,0 1@MH DH 4PL#480 ,0H ,y@4,@ 80D Q&D04 \40 i0p40 PodLDH4P`, l5. 0\`#Q0EH@P0 H0 4Lގ84 $Q,0HSP 4$H04 ,0SPX`L  40S 0S0X 0 X004$ (5*(0$ LP@X  t0$0P0d 4( 80P@,0@x0XV@ R40HCL 4 X@!00K,N0ua4P0S^`\Q`a004 S:O/ 04@ P  TQd 4 +4 0040 X$00445P%PL05S404%@P 4, v4HX<0@P440L14H-(of>T@@@@ -L,M$0PH ,P L  (K`20D0 lxL0H DPP~\L DwZu`2D0OO[/ P`$:,@K@DP],PHpPR?L3P#L3P#h h0 S, 00;00,??(5`(0/ ,L  40@xP@ L080p ` ,0H ,?80@`\ p@0\4 0f0PH4LD/d  `1, 0P#Q,@K0D@0DP ,>r5$%R ,0PS$% ,0SL0K 8< K80 4@ < 0 RXRD  H0؆@x0 -L$M8@pT_$K (`P@ 0 [PZ, @ @w 04 0 4O  4$"0@<0 8@ @_@P< K @@Pwxw`0d  , l1. @\$Q00 (KC@P,0xw,(0 H x, , 0 R,,00000(\>*^B@ -LM X `SKl , pJP0$U5%0S' S ` PT! 0S\@P <]KKZ ; Tu00 Ts@ T.uTT @P@ZB_wPZ X ZoYOZ KZgKZ  D@P 5H00#0Z$o@@@uke>@@ -L1LMDA@!00p_PP$1$a_PP P ] Kd`PP.  PP 0 0 R  0 0 `2Y @0J  , ^_0C 0   B T_ ]ukor(k(o,@T@ 5@X4p p-PL@`P Q 0 R <400p 00bqbq\aq -L00pSr 0SUh `RI 00600 Rh@T ?f;BhP`U@6 0 1P0S00I X 0S0S 0S 00 X10S  P00700:D00600kY0S>P Xh 0S" 0 XTPh `R YIpx00S $0 6 0S00 0pp@X@ -LHM\ \T \ X  P@ 匐P X00S S S sT0@0 UP  45 S:05S*P(KXT@ 00K2vPP 0T R4 q 0d ` @  8  PD + 0H0 > 7Z 0jSXj ZXXRQUVP 0,0T @H @a<L0T@WPPu8PoPL0 0Sf85 R , 0S 0 $H0t03U0S000T P PT850 p0L0 0cS0!S<0 PDD\D D 0D 0,0K  <0PP<0 T 0R) 00QRY 0 0 RN 0XաH |@ T @0D,<,<,0LHJ00 Uk 0 \ 0pP00P @@b b3a R`QVRUUS\0P0  85@0L 0H0pP600 @ 0 R 00T 0 @ 0 \t 08"X  R R \T@0{ 0 TE P,96T40P*\ 0S 0S 0;0T4 R U @*T000T0X0 H\x0 T4Q8 R 0  T0PU P\ @80dK@ T04 0`@Q T0  0d d  R T0d ` 00o0 뜇@pW@$P(`,4@00cZS[ 0 H < 娢pPu,9<0,p ^p @ 0 @T? @0P`<0ppWX6885004 00 P41P `Y c PR\QZ!R` ?ST@0pW@$0  S(0S,KD 40~>p0P` ,pP69DL0$   @0` @ 00\RkW@@ 000O8 05RNpH,p -LMLD @ `œP0< 0@ DPK`?O# $Q R<` @$0@PPQ0@ ,P ʅ 0@K0`0@TPpW0@ ,P ZP8P @\D K X8P0O0 K 80 S0c0 jD@Xd 4 <0$@P 0xt`p 0K0qt 8@0@8@ t00T0O4PP4P $" 0@XDP@  R\ 4  $ 0@K0@TP7"0@ ,P 0pW`P8P  (K Qp0@VPwP`p8P V{@PY`4` D0Ky -LM L0 p @ `T`P @  0004~q@ Vl`KU,PK 0PP vPUP ,P t @ 0 R 0 10АAQ, S x` ?U P8x00 40 n< 00   0 R x ,0H0 1@ɯT   00 R 0$ 0pǏ0S#  x0@S,0 x x@ 0P` 6P R 7@(0c c9b SaQSP``(K@ 0 R* 1 0pP`( B b5A R@Q2  Q   00St p0  R 0@ T |  PK | \ t@ 0 R @0 0ppp ,0P`P`WX tK0t p | @Q00( lß2 b91 R2Q0@( "0 P(`80 0@(, 80<@o"0006PP 7P dV RPQx0@H, 1 0R00 @  ( R% 0$ 0pǏ0SR @^ ,0!P` P`Q 0S00 0@0$ p@0SR^ 0@H ,0P` P`Q0SR @PP 0 0,0 S00R U 0@H, 0 0Q @PP0$ p@0Sʬ0@0! (Po010X ɯW1 !0 ((pǏ0pr -L M P0  000S P K-\0\ 00P P 0 S0Scqcq R0S  0 -hpP L`@崃 0 01P  R 0S0S 㚃P0Pcqcq -0儐倠L`@p0 0PP 0S0SP 4WPPrcqcq - 0L0 r 0Ccqcq 0-PL@@ 0PVZ0 -LM@PQ 0Sp mQ 0SV0S00S L $0@ p0  0P! 0 00 0p R0(@ 0@p0t@0 000   -L@M 0H QL I 0YIDpKP`(1@L,K 0 @`eoP+,0S(\% P 0L (Q  R0.SR 0.SH0P 0@P`Y X0P(K0YXr -L8M0P( @= P@: (p0\@ K07@`P0 `po@P(L0( R-0[.0[S"[0R4 0R R zT(04L( K 0@P ( T (QhT$K@(@r..@ -L0L(\;; -LMPp@0 0"&!R0 :R4, 0 R00(p N`P 0 00, 0`NMP`0$KS40040Q\$ \` 2 1C0 00 \` PKR-:k;k p-L M0 0S 0P`@P dP@?Kp0P` -LM0p,KD0 R 000  0 * 00 0S00p00 0 0 R00t000 0 R00(0p0H0 0 R 0  0 0 R000 0(0 0 R000D0,0 0 R000(000 0 R000@040 0 R00 00080 0 R00$0H0<0 0 R00d0X0D0 0 R00l0P0@000S;$0 SL084 $0$  0 Rb 0 dkTLPP`0 \0T0X@$K00 0 R^ ,0 O 0$@0 0 RN ,0 O(0,@\0 0@\0`@0 0 R4 !0O004@000B0? 00,0 00 ,  \0 0@\0`@0 t 0 0 h0OdkT0 @0 0 0 ,00 ,001k 0-LM08 PR9K;0 R6 00 00 0 RU 0 O 0$@0 0 RE 0 O(0,@\0 0@\0`@0 0 R+ 0O004@000K00 000 00   \0 0@\0`@0 H 0 00 0 0 00 001k p-LM0`8 PR9 KŨ0 R7 00 00 0 RV 0 O 0$@0 0 RF 0 O(0,@\0 0@\0`@0 0 R, 0O004@0003jKp0 00 0 00  \0 0@\0`@0 H 0 00 0 0 00 001k0   !l0   -LEM@0p,0 0 PR` L L0R ^F, 0R(K^V  _PH!0  QQ8PD 0l!X  R R70 000000@00 8  0P8. 0 0C000C0000cd`dV  ^`^[^W^0X d  R MOK   0P8 $oDf>2p -LNMp `0,0 8 < L L0RP @!^81V E8PE ^fG<dG , 0R(KP L0R 0 R 0,X R 0 R 0,X R\  ^@P<@T 0 \ T!0H,QQ\ T!0,X R 0 R 0+X R\+ T 0: S00SH1 D1 c8 PL! P T0 00 RT  000000T!000T 0@P < ]P!R P1bEL_EFH!RT 000<r^PTT!0 0C0 RT1T  000C0C00T0000<8EHF;0(*d RW @+0P@' I]#E8!E<F00 0 0_ 00OK 8@P"F <\@ 傮Tt)0d RV ^]@0H)d R) @ Q]@0)Q20(d R@0 <[@ <7]LD0Qt H! R S@1 00S\! X1  T[PP8D>TL @P0  NK 48@PO#F8PL P P!R P1L 0RT0RP  0[ P800P00S;R30S T!T 0 0 0@T0DA 0H T1 0: S000 .R <\@^<EmH1 0S0X! \1 @! <\ @M 07[ T!P0S^ L 0 PL1  004400S* 0Q PL!L00p00S P! 0 RPP00p00S@R P1 0: S00SV P0S(B@P 0 L1T 0RdXQ L! 0S  L8%0QQ@L!000 RL1L  000000LL!000L 0@P L0 0C0 RL  000C0C00L!000VT\Q@MT!H 0 RTT00  X"6"6@!PL P@P5\Q7 @!RL1  B P00C0 R L 00C0L000P! 0 RP1P  000C0C00PP0 0081 P@0 P@Pwa[C80 oa8SC00 0 0 OK 6@PD<\o PT!`Uo \1Sj QaV4CU<1CD?P 0: S00P 0 DMOK T 0@P X1S L0 0C0 RL  000C0C00L!000L 0 aB$0!QL! P H1S@q 0.T\Q XP 0T@!0@.0T T@000<xL1 00C0(P00C0'$oPf>@@Ԉ@@@tMk -LMq@`P 0 vy \00 p00R] wP 0 \w 0, 4 0 ,Tpp VpDP (K 04Kp=  =D 0 R00t`` 0 R00p@@#PO 0 0 R00t 0 R,00,p P4KJ 0@  \00p00S\00t00S  vP\00t`` 0 \00p@@u0h tp0,0 4 0 4K 0pP  P 4K 0pP,  VT0000Q 0S 0;0Pb 0S_ 0;0Z8@ -@P 0` R00p00LQp vP+Q 00S  ( 0 R00t|vP  0:0*0000004  040#0SỉO -L MPp0 S`0s0s0s $0sH0sL0s@0s @(KD0sW L0$ % 0 Q00p00R Gv@P 0 RQ 0X 00S 3 R@L0$ \ @Q 0X D 8#8RQ  d0X0#8#888d0X0 0 R$d0$X000d0X00#00D0 R@ 0 R 0"X  R R q L0$  0F@Pp 0 R 000 ,@ 00S@v S S  0@Ph 0,@Se:` (0sv L0$   0S00p00Q u@P \0J  0W@PC00s000(0s L0$  0 0 00(0 0@P(q@ L0$ P 0@ ^0d J @0d 00.Q D0 D0d0X0W00 S*0X d  R ] 000 ,@ tqi0sV`00so -LM`@ 0 P00tp  00>K0 R 0 P 0p X  R R 02& L0$ P 0 d  R  0-L^ P 00S \ R 1S1  01S  RZ(@YY@ 0@@"00000 -L` pPQ @PQ @T@a 0PP QYP@6S@S  0PP@ -L M @p0S Q#0 HPA(X,6倢 0& 0,K6 $P2(X,0aHPQ8 8000 ,  00* 0 R0,& 10C1,{!(K ;<|,0S$[,n ;Sx@@L@ -LM;  l@ -LM @`0PQ $0: O KbX,6r& 0 K6 g$P$`nX 0H \1 100 1 , 000 ! ; 봉@@̉@@ -L`M` @P Pp, !J`(K: S1 (@4X (0P  0P ,  L0 `P30PQ !R/R0 0S00505 0d0 XY ,&0Qp0 0^  \   0˄ |Ѓ@@51cq1k@@ -LM @p ` RP  Q 0R 0W p!:(@Wl6 `Pڜ6 $ 000W $`W괄@Ȅ@21 -LM @偂,Ɣ 0PQ(K 6 6,K _#PW,60 RR 4 $0`a00 ,0HpiWY P b 00ab P 0S =  0S7  \P 0S P3 0S'  RU 400c-WQ`e PM 00` PR 0\TP,1 !P!000 , B 0 0C0&,$0"zU 0V1S101P!P P 4a0V ` *PP ;40t\ 02 P!E@X@ @8@ -LM P,剢@P40 (K6 6,K "P0 Y,0@TH% (V!\1@0! 0,0C040* 0C R0,& 101,5( 0(0T0 0d qa P 00`A@ 0Thdp P0`  ;4 0,10@@|@@ -LMRP`0 0 0V0 8K 0KP 8 0 B18 0XpW/ HK  㘐K  ,K6!P ,80H QAB T  0{4K  0P  4pp40 06!0 63O0@0 <H00 @ 0P  2Q(K 0 h  q< ,T0 94K 0 P x4@ @80( K20h4  PA0 ,z6 PPP 0 6 3O0@000(K,+h UGA0( R 6,K O!P w,00(0 4K 0 P  4 P(0006 l 0, &402O0@ ,0<Hr,0@,H0K S`# *@` |6Q` R0 `0P80SK 2@6/ , 00P;00,80@SVv 04C0 00 0m,j  0n4K  0P [40K0H0 6, &402O0@, <H,0 @ ,P 3 D0K0 H0Kp "(K@6pD,K PM, h0H  ,P  0K6 w @P100 0 ,9q4 X 0 0 0D0K 0 a 6 0 63O0@,00<H00@P0@ ,D@ -LdM \0  00 R x X 00 L Zt 錐`P|  00t044T@| ,K/l0KPx :,\:! (0( 1S@ Z* @ T'P|0S#ڜ10$ ,( P0p`e | ^ ,(0 ( 0P 0e 0@ Rx(Kd0 L10\X, Z L0Kxpp0 p Y@[ TN Wp 00t 40/00p M p0H`,\00Y0S( Z& $0PU"*@| R0 ,0 S1 |0T H, 0 0Q@@$0PS,p 0L S,0 p W9(0 30@O/OP(00 3)O0@0 R`0`  (0 0@(0,@@P  x@ j0@fr0p@-0 : Sl0@@0@- : S R Q0 0Q@l L0S d  0 6d 0p0p -L4MH L HP T0 D PF D F0$!0 S T^T RHL0/ 00D}8@ $2ŸP0`00(80 0@80<@(, 00<8 9Q00P0O0@'R k@PT0HS࠳@ 0 < D $hD0< &@SD@&0"!h! B |0 <@ DL6 #`@ Xࠣpc4 *1@@4 PU  RD0&L0,K"Hc0P,040 4 H48 4 `FX p@DT 0?^00S <^( g40@(K@1S D F D7R 0B,KH %00P0400 <,0^4 00 ;00  pr0p@ -LM@LP$  @(K4`K 0 00 T@ 0 0O!0 000 00P(` 0PEpQ$Q@Q,6 6@C,K6 @P30,00L HPR$@e`Q0)P 9 10#870!RY ,@UP \0 0@\0`@0,I,B1k -LMpRP }00 0BRSvRv &  W(   X 40 6` 6PP7 c SXQ,K/ 0PPN 0 F~,0fH,0<@2 ,!V W0``1 aN0 ` PRQ0G0/,K0 `P  ~ ,000  0(K  L0( 0OT R~0Sz(.   f0O0 @030@ `2 PT1Q&  PCl n(K< d4 -LRMl! #lA0  ,0 4! .KL0S㌀ `0<0l-1K KK Llt 0R 00h1 Z@pIl!_Ÿ 0\A XQ (@K⼐h`@ QKd hYK MOK DA Pa H T `a La HL0@`"00YP tŸ, 0R(K 0#68#80C S񟗹g1g1d1g1d1g1d1h1d1h1d1g1[0O Po 0O5!,@ [@P000NK/O?K@P0<0:0806(4gPe$olf>@,@ -L@ -x1LMl1l`+P\1\A+P H姹DD K},pP7  spP' 0 0 R  0 00 000`2PK' 0 L0S  , o+0T 0   B d+ W)@@ ? 0ukro(k(o<@d@ 5@X4p p-@ MLTPT` 0DP(8 40P@Kph85kl@cqx@Hdq0  0 0 0S 0-PL@ Y 0Pp)Q婯0Hdqcq -@QL$ 0S00 h< -LM @`0P0Y (0KpPK(0@ 000,1P!( 00 ! 0 & 0 pP Z' 000( 0(' pP0  '(00 `\P \P 0;0$-u'&:k2p- 0\:k p-L M0@P`P dP`?Kp0S  00ʚ; p-PL@`fL0(0S S0S  phL> (phrp -LM 0P@  0?`P  KL0p( P@ (/>`P000&0@0 0,0 @ 0`@]A`r -@L00PS` 0 0 pU &&0  upP0! B!3(& -LMP`V#(&p0!R BpT&& P 0 0 0 p 5pP10C1   |&@10C1 0\p -L8M"P0 Qp 0 ;;I,0K{pP H N&(K,0 `0 0 0@,00 0  @ 101 0pPNDpK0 D0 0> K4K L0S `0=@K.0<0K8 62K 0C3K L0S `01K0@ 0 0. 00 K/ K@  ,0@a@pP L0 ` 00Q!/pP 0! B! 01000,%z000  *pP ,00m ڶ2pr@ -`@00LSP=p%L L0R =%pU  >pP.0!R# 00 =pU  = !0 00 0pP 0! B!H"=p=  pP 2p -LhMP @, 0 L L0pR` g=,0T >%,P;%\=&0& (K\ L0R0 0 &0   P\  7>P08h t !R| 00tt 0 o0: S\ X  r&,0P`0 hd 0h! !h h0 0IPP Y 0 A=Pd0S d@$`$\ Rh@ 0000=Ph0! B!h 0$00S$ <$,$(&0&&00 0 0P 000K ' 06<i0 .Rf 0<M  <H  <C0 0r;P 0<`X 0R` \QS  Rp T0 l  Zd0S,j$`h *P0 = ,K P,P` d d R d `0Rh0R@ ` 0.; P,00P00S+R#0S t0hS 0 0 0t h 0X  0\ 0%\P0Ql0 p T0  0o< 0: d0h 0R ` 0   0 R `0R d0Rd0 0: S p0S`h ;Pp0TQ00S ` 0! B!`0#d@p Q10C1 10C8#8S1k d 0d 000,#00 0 0N 0K '0PI h@0YL0 e p R`L R#Y0#%Y`0h 0R@l R `02!R !`` 000` 0Ph PH l0S `@0! B! 0rpQ$pi` d `P d0!R\ Ra VTBZtPl0SP 010C100000(<#oL@HK! B!00 00 0 0 @0 0@u=P60[S#[0R  N  0T  0X 0C0< @ 0 0@S=9@@@@@@r..@ -LM@ 0PS, `p0s0s0s $0sH0sL0s@0s (KD0s! L0$  0R WP 000 0D0   0000 00l#00D0 R0 0 x L0$ x唀 0 y㘐SX qWP0 S R 0000R㔀 0S 0;0Q 0S 0;0p 00S Sq So  0p)P(0s L0$ d 0R 2WP \0y ,0 9Pr00s000(0s L0$  0 0 00(0 0nPY`v0 L0$ 2@ 0R VPI R 00S  O@VP 8  0:0000   40 0L #L0$  jq{0 S VPRMꔀ0j0s6f00sz -LMp0`$KPM0 00$0 00T|!0 000  00 0:#:0 10 00 (0H0 0 ,( 0 40 0 <8 0  D  0000D0 d0@000S;$0 SL084 $0$  0@+P L0  \0T0X@K$  \0 0@\0`@01k -LM 000 K p- Px0 @L0 6`P 000Hq0(!00`"`p\:kP  ,0S !5%PA-RpP `$(@#00 bR:  Q3a0 R R0d0e S:0e0d  S: R:  aS* 0P-L0 0a00P00a00P0a0 p-LM@P`P  0H 00S  Kp P@8@ -LM @T`p5 pP Q*Z  $0( ,@ TP ,Zp Px($0,  \( $0 , 4  $K贎@t@@܎@0@-P@ R( 0S%\ ) \ ^ \@ 00\0 S 0  0S R 0000@00 R P,  R/ 0\00 S 0  0S0S 0P@ 0S@@0  @0@000S00S0@ 0\@@  @0@- R 0S^ 0Sk0 0R 0SI0SD \   R00 \0S0  0S R( ^ 0Sm R 0S 0R00S00 S0 0S    R 00000 \0S0  0SR 0S@0T00 S @0  0 S 0R00S00 S0 0S    R R 0SP0U00 S P0@  0 S@ y -LXp5 PU?P0S`X`V 0S@ W`RP 0WPP 0RPPV 00SZ  `X `V 0S` -@LP+ ,,0S "\" R ,0S 0R:\ R0P 0  \/ 00!-P,P ,0 S 0SP 0 S00:S P 0S0SP0SP0S  -L$M`  PZ 4 80  @P,K0pK $ 0@P P @P (K40@$0(0,0l, 00f0eaQ80  P 0S0SP0SP0S PQ00SQ00S -L`p@PPU@V4 0S2 `P, $0(,  0a@PPU@ Q 0( S$0 AP:,00P* DPU@:`P@4@X@,@ 0-@PL @ P0gqPg> 0-@PLإ0 0 0000|fq g> p-P`L@ǥ @` p4gqf> 0-@PL 帥 000 00 0eqf> 0-@PL妥 @ P0gqf> -L(M`eP@H8 <0  6 vG @PTS `0K$  0X ! W01,K P@ 0 4 `,@P `@PTV* 40 S 4 j  0L <0`8 `  8000 D08 0(K80   0800  -L @ @@DT@d@ -L(M8 `P (K p@4 P* 2P@T% 0S" 0S0$ ,(00 S ! 140,K0K mP ,  @0 0C"0" 8 4 0+$  04S0!0K,K >P0  @0"0C0 p-LP`0㦤(0@ `0 peq8g> 0- LP@$P .P 0Q0 0P0x@hg> 0-LM @PVP(0$ ΄, P R 0S B^R P5 P8 0딏@|g> - L@P׬x@g> 0-LM @PP8 0ì@g>YeqU|fqQ4gqMeqIgq -LM Pp P  t$0(,@ \`,K 0` `P P  (Klq -L$M@  p `nQ4 80  ":RE 0i^ ! \ʠ3hQ1!0l 0PP1Q: Q@P `0S:`0V @T (K@ R 0S@(0$ ,00U: R `0V@@0ST PP!@ {P$( ,0  0 R 1S0!,K0KP, 40U@:00U8P80 -LMPQ`p4 0^ 0^,:0^)* 00000 0000@P  K@ 0AP 0@@峫 @$@ -L$Mp4 W80 `PSXppx a@P3 $ (0 U.:,00V,K0K 'b@T# ( $0 U:,00VR 1 S0!  $e P X@T (K,40W@:00W8pX080WxpW*Xp -LHMpH L0 D 00",P(@4 0dP4`K004`K@K@KࠁS0%5R 0 UP0T@%5 P@ `0f S* P0KU (K@j  DH L0`@ @P -L4MPpU@80 { 0$%Q01Sr:0a bU,0 50 R 10 >0 ``  0, 80P` P(Kf4   40 ,80 PP   0 ,80`P P  4800P, P -L$M` p@ PZf ^ 3: @g `@ PpK 0-@ MLP  0P 0P 0P xx 0P` 0TP@DD0*0<0 K05k@gq@4gq@|fq@eq@eqpfqg>P,,0 S 0 SP 0 S00:S -L !Q 1S 01 0AS 10 ! 10A0© @@@ -L !Q0屩\@ p-@L !ƌ\`"S  QP P 0 - `p Q0S  0  0 00`p偩 }뀑@@@ -@`$0 L0b#6<@ SpTQ&0@ P P[-TP\P<@0!PR00R0S0 !P A-\ -LP@!ƌ0C  0S0 !h2,ؑ@ -`LVP`PV@p$4 0SPP 00 0A S 10  ! 1 A 00CS0 UX01SZP `FPU -@Lb FP  0R000 00 0 p-"fL@P  00b0fS 0S 000  p寨孨@ @ -LM@p, ,P0, a@T; 0S"4PU(0 ( 0s,P ,P(K 60A0C0 ( Q 6,00,0 PP  0:PC, Y|@@H@R -PL@ởPP) $F%6@F0p0!a @ ppf bFPP@ 0 0!< R$0(0$ (崞Phq\iq -b@LE 0@sbEh蟞hq 0-0L@1$ R(0(0(0  R 0 P 0S P 0PS0!P 0S 0CS0=0PS0000hʧ0萒@ -P1LXM@`TPpF pTK0K‐K( 0@ , (0$Q\ $ \0K((0$0^X0 $ ^0 !0SU000 0Rp0 P ^0\Q,0@(0,0\QX0(00P0W0X S(Km\iq 0-

(@@@rX@L@4@p@@@PK`P@@Y00SVH4(0 c4'4( @<L 0<cP T  PK0c}'(0  !(0 Q-L`pP#*@JV  0P T   @- 6@004@ 5@80<@ 3@ 0$@ 1@(0,@ 06@P0T@kq -LM KLH0#&R*0R*0a"!B10brq -0L@TP" Pp` :S0| Q *Q@T ,0" 10Sx0SP@pTV T0 RZ 0 0md 0`_U 0oHOkkq 0-@L P0 PL*,LQ00Ok -RLP@ F L/ 0m 0 0.  . Q! 7 -L΂n^P`Up*S N@ PeV0,0 h  h r0Ok.  . Q : -L(M@ .  ^P U< p#: (K  P e!fV8  @,K , 0S0R*@VX 0 PP  @TF (18P  14@K0@ 4 0@ `'P)4 R @Q00000 0J8 4 R|< e<@ P 8080$8 E 00(Wk0Okr -@dPN`@ RL @pp .0  @ 0Ok -0LM R' 0+ KK\) M 5w/4DX0@$ )H 80@$ H K剗kqq0Ok0kd@ -L$MD @ Xa 0H#Y*qZp1H`00X80 N J$J>00>0Sp1x# Z00 W0~Sp8  Wz3X@3 8 ,0K @P 0d,S0!D <0 mO`  ,4PK@ 04@ 0P @a m ?Z<0cX@ (K0Ok -L M0`SpP6 0SA0SR4KP40 0 $*@,Kd P P,!&R*<0R*0`"!B1 b 0 00  000 JU  &0 ^0S(K0a@nf 0`S00Of ` , $0 60S rq@Hmq>00  % -L(M@  pDL 4KT4 0 < 0 SRS@ 0 S: 0R  48 \= \: ea`,K < 80,  00y0P!4@,pT 8 `&,:,0 @T @ `\ 0 8X,:,0 @Th54K&(KHAe0S 001@ a0S 0Se4K%0C! S, 0 0 0Q @ T00 6`e@ 0@ `S  @0RV< "f @0 4K` %PS ꠕ@rHmq\mqp@r -LPp눀` 0t@je 0R 10 P Le(Fe*9(0OkHmq -LPM rGe 0RZf 1   &e Pq2e 0R1   ehK@h`Kt!p *\0@P0 pP`1X eP1 Q 0 hK!PR U_dZ _dU1h K@U@PQ x0*1(K0@p  P0 `00 @` P@dVHmq0Ok# \mq@ 012hq@ -̡LM d Q 1 R R AR   Q;* 0 1 S0P1* p X00W0S1 $1 hWp 0`$K0!&0@P0 `P?pX(10 0 Q *0h6 0(0  X00W0S X H 10  0 R0 0, S0, 0$KHmqvk0Ok# 2 -LMP$ Nl@T`p(KT,K, Lh0   P, 0 d_ lq'@ 0 p-LMP h`K! ̃.' 0@P0 gPKplq 6 0 -LM\ ~h(K!p@ 00  0@P0 CP4 1W , 0( 0cP`8 0:P@zG`W h 0 &@P(p0x D0pS !/W00S,(K, `,,  aplq'0Okr̕@ -LMp@ `.` $PK @ 0$@ P @] K -.L M  8  0(Ǩ0!Y# 0@P(0 P0 ,(KZ1P ,0 `0ap`p T1ph  a(RP4K@  0 4@ ?#P7,P0U/88 4,0Z0S$ :@`p4@ P00000 0 %(Z0 8T,0Z0S$3,8 0Okkqr -P`pWL @P( (0 h0 ^|0@P`:P@`XW%&* +@&% $ Pp00Cp0ؕ@kq -LM>0`~0^p@0P 0` `P @P 000 T 0 00 0GP  K0 @P姒奒壒''@@D@ p-LM1P0 @ |`|0 h0  `0R0 P b 0K@P0 P 0`Kpqmlqr'0Okp@ p-PLMP*@`Kp IP \0#&R*HT0R*0a"!B10b %JUxrq@ 0Q-L@ 00SD00D0p@-x|0\ @!@1Q% \ 1 !R`#`3P Q#3Q030 "SaP^ Q0#02SQ#3T0#0 2S%ppP 0 S(0$ ,00\1P -L`$@0@PS:b V@cp V:E8 f@U>0e S 0SR F@(U0P@0F\2 lU" R!0e S9A U R0ST0l0U 0SS1:Q0P@U 00b S9R R0e SYD0S0e SI9@0S,  `0R 1P `0R 1 -@PL`@T `0P 0Q-L@ 00SD00D0h0@-D0DQ 0$@ 0TT0ST0SH H0RL L0RP P0RX X0R 0 00R 040c@P4@PP80S@Q 0S@ R 0S00 0- L@PP D0 0U:$0U#300 0 0 P00P0 Q-&:0@2 8P 0Q:0Q4(0Q*00Q:40Q:<P 0 R 0Q:0Q4^,0Q*LP0Q:0Q4 0 Q:lq$0(0@-P Q0#03 P 0S @@1 Q#3PQ8Q 0T # 3P R0T # 3S RLQ T0#03P0S T0#03R0S<Q 0T # 3P R0T # 3S R\004T # 3P R0T#3S(P T # 3 Q R,T0#03\0S 0 0lq-$ (,(0 R:,0\3400R:40\34000 -LpPU/ 0S,`@T1 T R& @TP @0 Q 0` {0S0@  0S@@@`mP iPU 0 00p 0 0  R P; X> P@0T 0` @H0S0P  0SPPP`:P 60SP0/0S0p  0SppP@!P0Pp0p 0 0 z0S@00S0p  0TppPP@p -Lp` R 0SPU 0SY0 0`R 0S0S @TP R0 0@ T`@0S0P  0SPP`PP@@ PRi Q 0S R 0S 0R 00  S`00S0@  0S@@@`9R 0S0Q 0@ ~0S0P  0SPPP@pPm@ 0R 00  S`0_0S0@  0S@@@`QPN R 0 00 0@ T`@?0S0P  0SPP`P1P.@y R 0S0P 0@ P0S0P  0SPPP@ P @ ` -pLWP8 @TD@0Sp`W`V p 0Spp U`P@ 0U@@ 0R@@V @@TX  p`W `Vp 0Spp` 0-PLP@" #3Q R  0 S R0P 0  Q@@000 0@0P  SP 0S0#03 P P 0S0SP0SP0S  0- LP@P'$ Q00R03SQ PD0$ T(0, 00\ H00SP 0T00 -PL@p` 0!S8@ T- P $ (0,0 0S*:@@P` $ 0S X:W WP 80P L0P sV@ 6P@ A-P @lq P 0S0SP0SP0S PQ00SQ00S p- P$` UZ3@L<pLp000&W0-, -0L @#,h/,0+ -0@L  A+p3P 0000c+0, M-LM4 040` P @xh 10 Sp!z3S0CD  , , K00K0 PPFY`+,PU (0$ 0TI*,Q $ (0g (0R,T:00R4T*P* 0@P@T :,P,  ` h(K0g00T0@ , K00K0 PP  P40`@y z`, ,P `$0T* , r 0-0L@P!*P 0! 000 W00000h> -QL M8 <0 4  0Q:$0R, ,(K /4 8 0PZD0 D0$Z(0, 00Q 0ZU Z , D0@000 00 Xk < h P2 Rd $08`Z p1p!Q`!V< @ ( l@@P PU < 00CSDA2DA2pA2pA28A2DA20S]40S0QO jW |$0 Z p1p!0 R <0 L0 D08pl ^0l 0l04P`@p0< 0A, P , P Z 4 _[$0Z p1p!4 U, O4 N0,0 H(0 *00S @a=00CS00,0 00 p-@`LP$ 0 q= UpPP+  @PP@ 0/B000cStiPPP@H0/B000cS 0p$갗@@@@VUUU@ @ԗ@ -p ML`8@0P(,0!0 @04 0P@V (0 H.P) \ K& Q QA ,(01 !0B@@0S!0S W@T PP W|p \@XL@h>$@T@@@p@Ę@lq@ԙ@@ @$@@lqD@@ -L M䒟p`$0 , (, 04 0 |$0@"Z78X 0@P4K08"<P< 0U@ 0L, 0Rq(KP`d pt x| Z $PP 0 $04@ <@X@H0D0L  P0FT0T  XF T F0T0j(0$D ,FT@PF T `D0FT T  0lPPnL;a$o@4@X@|@@A8@@@@@ @(@H@x@@@@$@h> 0- L M0 \0\0\ 0d R@P 0xP啁h 0`dP@匁L 0Dd@儁(E{K0hRlqm5kL@(qT@pq\@q -Z%ZULp`e   ; < @$0X+*@0(PS$@d,P  << D05 0P004 48 ,0S      o(P$$ bP!  b `h0@,408@0 dPtu00LeT$0 -\0L@  Dh }8h}S((\ P1\@0CP1h Sqpqlqkq p-0L1PU S`P\@T P10P1\R0\0T0000p0 P }@P \P 0 @Pd0. d0d0S0h>g>So@OkԜ@q@ -LMPQ`p,P  k, V3 0@U@2 $(0, 00Q[ TO ,0S(0 S$ :(0` Q , R00S 0@$1 V ,000f,0 `YU , vT , nO@ P f0,408@@ `$`( 0 D L H P T X < ,   0Q 0f S :j(0(0lq 0-LM@P yP $ ,0PgP8 -L@P`i (P,`0p4m -L Mt@|0(x`Pp!p1PP1P!\  0`K,0 S00S40S -PL@pᤀ40 0JS`!`1 .P_P ,0T$0( $ R 11S63bS$" ilq -LM$0  p-L*"*R@` 00 P 0 080<0@0D0H0L00,0(04000 $`lx#@d0H00A#P 0 pph|# Ȅ@pfq @ -L`p PP"` 0@ -@QLP`p @0S@0A0 0P0@ -LMp ,@P{ 0`0 K(q -L MPpU0@`0 U (0$ ,0 0S @PP / $(000 ,,  @  00\ 0@0 U  0 , 0 0 %(K $ X00R0S@ -LP`p < @  G  0ix p-PL`@ 0phj S-LpQ 0$ Q`!`1\ P1P!V: @P $0V* 0V  0  X@P 0U$0U* S-LpQ 0$ Q`!`1\ P1P!V: } $0@V$* 0VTP@P 0U $0U* xP@P  E@ -LM$P\@`p:\: 0Q:R*@ 6 KUP@   0T$0V :Q 0S @  /   $0S00S@0SD0 0D0 @0p  48 000 -. ^NP@LMU`P@O 0U@3K:$0TG0P $pU@*D0=P 0T C 0TAD0;$T,0( 00S1 P$0T'Z, T0S 0UHT0S $0T<: 0@O@@$K@  @ yT0S 0U T0S $0T : 0q@ } x O J -QLM` 0$ Q!1\ P1P!Z#:  < V$0@ZlTv 0U  U$0R D0[L00S^nP 0U Y10SX Z:U?:0SH   L`H H`R D0T0ST0 $ 0 T p00V00S49@P) U&$R D00HpSW Z $U* @ % L0S $ 0P  -L M`$ Rp1 p!Q@!@1T00 :(K $0PS  Y RO 0TO0U,0 : 0W7y3'D0 0S,P  0@ 00S$ D0$0  0a c , K00X 0PW $ R 00S W* alD0 $ h@*@`h@P ' -LM<0 $`8 ( 4 ,0\p 00 ^ <0P 0,0 @0408@ DPTPP\0X 0 0_S{\y! 4?2cT0`Kp-P@Ks0 0Q4 1I4 0KA4UϠ @194< 04AKX00, =P\0` 00_S2\0 4?2cL0X@K\00, =PX0` 00_S\X 4?2cP0\D 04 :4kqQq0kHOk -1LM/0 b10PP x1x |/QfD K H1\ @E 100CSP2@2(2d2d2d2@21S |0S0L R 0S@ @ \ ePp0 #50a,#50 ^T l!T31C0a 1 0a&1 %T  @ `1kgfffHOkpoo\qxi>r -LMRP4 0 `P p 0@00 S P(K@ :#:S (, d  Q 00S Pt00@T Uf,&nj,  0, 0 4 0 PPCX 0 V00W P2 H40#&Rz\ 004 4 60Rn:40 0?PP 400 4  RT#00,0@7`p ,0 40 Ƞ, T 0,@Ȍ, `p0& 0 c0@0 9000 [c 0Px4 0  ?@P0r Ux40   .0@_ 00SP P> 01400 v P30,@ >0>009kq -LM ʠ,ʠ\ 0R lR >0. R 0^  0P  0-LM@ʠ,ʠ\ 0^* @l^ >0^ 0T.Ơ0 H R P 4d 6R0  0iP 88`0S*#8kq -L # -LQ 00 ` P00 P00S#@-@ʠ,ʠ\  0R lR >0. R 0^ TȎ2Ȏ2Ȏ22222  0@+  0@(  0@-0 " 0S  ʠS,ʠ\ 0R lR >0. R 0Q  0 0@-@ʠ,ʠ\  0R lR >0. R 0^  0@ -LM ^0 ʠ,ʠ\ 0R lR >0. R 0Q  03 -LM@ ʠ,ʠ\ 0R @lR >0. R 0T`V0TK p a 0P $PK0@ $@ P @ { -LM00  0 0 , SpP 0 ed`Va0`0S0 Z > SW UU )YN>0^PUK  i:#:SD0QA0S>x3Q;,  C r  p0 h0 6@ Q 0@T; p@@0 `,K0,@P,000 R  JZ  0U@(K 0@pW P bP @  0S  @S @$ 00SS@@ S R1S``/ 0 5  @ S S x0 P:00 z 0u  S0`  XʽW@ k 0K0 J@P 0L 0S 0 @ kj 0CZ p@ &똠 p0 S -L,MH T H P :#:S0D >0 Z< *2 P08 40 \8 P L 4 S TD8 0P4 H4 PTP , K Pq ,P. 0< R*L-0,<$ QS` 0R]:D0<Y!0000 ( 0 0 0 R" Y0 Y0, P,  0<Q PH T8 LD8 Lg4(K@ Y@  Y@ 0R0 , < aP 0S0000S 0S,00 @4` @dP bP00 PH T8  040 4  -LM`@00 SpP (K 00Q, KPP00@0S 0 0K PP000, R 00CS 0,&0,0 00@SP 0 0 00 M-LM0Z,  (KYzpP` ,:p@ Q P`ZY M-LlM00S@#vzD0 | x0 p XKl`Kt p 0]0@ ,0 ġ0  0 0 0, K0 tK0 Px F,Q *@@R (0 (2 , @RRP@ZP  000000  ,@Q, 0OpW0 6OtK Xt p 0ʡWp@t0 K@Qx(K0@-P@ R( 0S%\ ) \ ^ \@ 00\0 S 0  0S  R 0000@00 R P, R/ 0\00 S 0  0S   0S 0P@ 0S@ @0  @0@000S 00S0@ 0\@ @  @0@- R 0S ^ 0Sk0 0R 0SI0SD \   R00  \0S0  0S    R( ^ 0Sm R 0S 0R00S 00 S0 0S    R 00000 \0 S0  0S  R 0S@0T00 S @0  0 S  0R0 0S00 S0 0S    R R 0S P0U00 S P0@  0 S  @ y -LXp5 PU?P0S `X`V 0S @ W`RP 0WP P 0RPPV 00SZ   `X `V 0S ` P 0S0SP0SP 0S  P 0S 0SP 0SP0S PQ0 0SQ0 0S0- @0 S0 UTR p-@LTP `P`@ @T@p 0-@LPT P@ @T0 p-@LT`P@P  R0T 0@ PP P@p0@0@ @P -LTM@ < `K Kp@-d0 P0U#F"``@ 0T !P01Rb`0^pLOkq 0-00LS@(0P PR0 00 0  ([00C0(0 00 0000000  R 000( B00C0 R 0  0 kqlq 0-@PL('0h -@L(h/ -(0L@ & R4 000(  00C000S(0 R0000 0| 00  0@@ RH0 0 ($ $00000 kqlq -00L0CS00@008@0 (000 00C 0lqkq -@LPP`p  (00C0, 0 0, U ,00,0 `$pP(~ 000 0-(0L@ R 000  0( t 00C0(0&0   @@(PQ`0   (0 D0 0hP00  @ @lqkq - rL\R2$ RP@L0R P U3 @0Q  Q*60 0 0R0 4 R0B60  B0CR0 \4 `LV`@DPV 0 SAP!@P@ 0R:P U|p\ `LV`@DPVʹ|ip60 0 R \ `LU`@DPVLOklqq@@@ -LhP \0*0  0P 0@ 0P *pkqd@l -LM0  4 0  P, 80 < @  (2(b$ȟ. 0PQ<0 @_TO T"vM6:(00\Q D0R A0R @0 U D0R 0R d (0 0R0HA :#:S 8 n40Z C$1P*VR, 4B  ,F@<00@ 8!"&0@(Kow 0@ ?SʭRD0@0@T P0U ?@P 0QʙP(KS0pkq0pmqrlq05p@@ - LM n 0S0|,0 @ `0 PpT0 `pxn0 0,  S, nn(KojnLOkܞ@q@<@H@ -LMD`4 V80 Pl V 0S  0SQ21C  48  000(K 4 pi21C! c0 0 @P3 W,@ R ` VZ%&0RP08P@0D0H0L0 :80RZ@ (N000`VT@Z( 0,21C0 T B 4 80 0m4  (Komm4 0@Pl0m`(Kom i21C,8 c h6 nLOkq0Okܟ@@P@@@8@ -LM,a0PS  A* pW$ >0n`0gV@P0U,>0 N@ U $`KP% $J U}snhh@I0>0>0 0jU ZnXnTOkSoSolqrp@@̠@ -錒LM™0 @0 ,  0 @@=^^ p80 0b\0 "6!v21C!@cw `0SG 0PcW@"#<:21CcT F0 U` ` T 0P08@0D0H0L0 R 0S0!% 0%0" 0%^0 c21C cl^0S 0pePcUgm 0, >0>00 00 >00V=0h 0 P00C $ (0 0, `\0T(XL(K,mlqLOkq5qkq@So,mqSoPOk@ 0-L@\ $0X(P 0hQ(PA (P$ A000A -L$MŸ`@0@VPU8 4 <0 /<0@PPOTF` 1@ ?S,) Z 0s ,0 S(0 SH1H!D0Q>P`0@K  0 @0 ,@ PP @(KR0D0Q Po0RO 0@VUO70@< 8 K hV (l@0 Q(TS0pkq0prlqmq05p -LM0.`p,@K 0@(@  , ,@T P000(H& R000(0  0  0 ,@PT$K(Wk p-P(L`4@ T` (@l00C0, 0 0, pT?(`A AQ0 x10  Ǡ00C0( BQG 000Ȍ00C000S 0  00C 0 R0ƌ00 $0S0 (p0S (0``p(`00C0, ( @, Q 0  0 kqlqy`POk -QL&P`  pW& (0\`VP @0Ds(0 @6(0 (`eVP !'(WQ -LMP0KS4 0P , :  .0 P0@T( 6P` P ` 4000pH( R000,0  0  040@T(KkD@ 0-L0LP@L0@;0 0P Ed0 $0dE@d50h;2,mq -L`\p/@P(0$!  R (c!P\@P P W (0 5 (0 R(0P@\+5((0   0p  ! %  -LM00 `pP@, 0 \     0 ,0  , 00 U~ 0 A,0`0 0W3 0, x 3X00S100v03 R0S ̠@w@3PVP, 00Q (0X 0) X0TU(K0 , x 3X00S R   00 0v03R0S , 00 0$# X T 0  ,0`0 0 00  -L(MH L0 80K@0L0p 00K@ ,0 PS0 , 40 Sʔ 0K80K 0S @PoD#Q {x L 0 0S @#6:1Y<   *0D @0 L@DK P`P`Y ,0S<Y< 1@D0 @@ 40SE < R p(K5 H @P (    Q (p_( (pX 0S Y0@*A0DKP0`0D0 (pN00S 780SPL`0`0j00`Sf*a80@SfP`8P 4` a -`LPp@T6U#:0`V @@dW9$H04$ 00 F$030S |h59@l019TX0&h<990d#8 # 3Vqqq0Ok 0-,P& L@v0hr -LDM008 ;pBf 40S0l0 00V70#4@hKH0@THl P0)R@(0@l  R00 S &(@(PU@ Z0 ( HhKY 00 P_(K0p -0@L0Ok -LMp 8aP U 0P 0S U@ P4# @TPU@$  04`P0S U@`0` D0@Q@P404$0Z8 8T8qq\@rlq -LM`@P V 0p @ZUJ 08 L0prP  ,$  r 0-PLqD8@0` 8Pd `@0@0S T0qqlqXOk0@-dd ,\O 0C2dS03S<0<<0!R?CQ@00@0,0dH00kqVUUU - LM p 4 X W00S7 R= 6& 0PQ0 P`@ R 00R0SE 10 1D `(0 R  01001 X W00S(KW  X_ 4 0S0S0K,0 000 \褟`p4@, K00KP @P4p@T X* (06(P5(0 #T`^ TV (00`8!00 0X8!0 (0 ```@@ @`104 S0K,0 000 c#40(0C40(0s$1 0$1(@00  p00p0k1Y0100^GQ,10,1O0@ 0SRH+ h p0Si l0RO (00 ;000Y| PlW0@Y Y1( K0 00' @ 0(10(1({0004AtK@P`, , K00K4A0 P``@.00  0$#0 @  0P:)(00 F0F0T0  , 4K4 pP  @7b00 0$#(@ 0$#~N0  (@0p0pkq -LM肟0rPo!0PU` V0P!@ 0eSB101s1Q d0Sop:P1L2d R@D0^`@ ",0 lh0Qr 2PU> 0O Q ,R0jaZ``X@@0 *W( Z``X@@P ( p0S; T  0P( V ,<1W0J<1 0$# P (HPP 00(q( H40(0C40Y( p0Q  \ Rno0pkq0plqlqlq -0LMp ԀL `5``V  01``V 0I`0da5008 0B6C0 P2@O2U`<_5,04@Z0/(DD5rlqkq,mq$mq6@lqmqkq -3LM D J2 P*. 0KƺWi @55 ,0R0S/W 0T00000 0R0T000<0 0 /444P(5"8p@Wm 0 00, 0 4 AQ4 0!@?CSD00D0W0 #0/Q R 0O0S@PoV0l0a0K\W,!,0 ȟ00X@T@0@PoPU`Q- D0Po0Q RO 0@Vm@mUi@iU`0l0a@\0 p018p0W1800 ,@ PNrlqkqlqVUUU0p0ph@4Ok 0-d0LM\ D0@QP Dp4@/00/0P08$c 0 Qrlqlqmqkqt@C( 0@-P@ R( 0S%\ ) \ ^ \@ 00\0 S 0  0S  R 0000@00 R P, R/ 0\00 S 0  0S   0S 0P@ 0S@ @0  @0@000S 00S0@ 0\@ @  @0@- R 0S ^ 0Sk0 0R 0SI0SD \   R00  \0S0  0S    R( ^ 0Sm R 0S 0R00S 00 S0 0S    R 00000 \0 S0  0S  R 0S@0T00 S @0  0 S  0R0 0S00 S0 0S    R R 0S P0U00 S P0@  0 S  @ y -LXp5 PU?P0S `X`V 0S @ W`RP 0WP P 0RPPV 00SZ   `X `V 0S ` P 0S0SP0SP 0S  P 0S 0SP 0SP0S PQ0 0SQ0 0S0@-P@ R( 0S%\ ) \ ^ \@ 00\0 S 0  0S  R 0000@00 R P, R/ 0\00 S 0  0S   0S 0P@ 0S@ @0  @0@000S 00S0@ 0\@ @  @0@- R 0S ^ 0Sk0 0R 0SI0SD \   R00  \0S0  0S    R( ^ 0Sm R 0S 0R00S 00 S0 0S    R 00000 \0 S0  0S  R 0S@0T00 S @0  0 S  0R0 0S00 S0 0S    R R 0S P0U00 S P0@  0 S  @ y -LXp5 PU?P0S `X`V 0S @ W`RP 0WP P 0RPPV 00SZ   `X `V 0S ` P 0S0SP0SP 0S  P 0S 0SP 0SP0S PQ0 0SQ0 0S0@-P@< R( @0S%<4\ ) \ @^ 4\@ 804@0\<<0 S@ 8<0 < 40S48<< 4R 0@000@@0@0@8 R @P, 8 R/ 80\<@0<0 S@ 4<0 < 40S48<880S< <40P<@ <40S4@8@0<8  @0@@0@0@40S<80<0S<0@ <40\4@8@4<  @40@-4 R @0S8^ @0Sk<0 @0R @0SI0SD 4\  @ R0@08@ \<<04S<0 < 40S484<88@ R( 4^ @0Sm8 R @0S @0R@040@@S<80<0 S<0 <40S4 8 < 4 R 0@000@04@ \<<08S<0 < 40S488<4R @0S4@0T<@0<0 S@ 8@<0 < 40 S484<44 @0R@080@@S<40<0 S<0 <40S4 8 < 8 R8 R @0S8P0U<@0<0 S@ 4P<0@ < 40 S488<@88 y -4LXp5 8PU?P40S8<`X<`V@ 40S4844<@< W`RP 40W4P8P8 40RTP! @TV p80 #R 0Q:p '88 880 a0lS`1@P11TV@808 V0b#6P  Q00,000Q Sx @P0O0@i i00 ;4 00` @i@ 0-0($@,0LP0"P 0000(,<P $$4R@00S# T0@ P 00 t$h00bh0@P L0(,$0>0?\~0V@ R(okqq@ -h"LtM@d0Vp 0 0iPP0@TT T P"0V 00 g(K*40"!B 0S p@ @0OD0 K4#R0 A0  ZPHQCN@ 0p ,!OQ\0@ Ipp@k?00S(  0>P" _R0K 0;PPL0 ,pKPPL0E4 0P44;L$@ ~ 04 000h0P0h0(oWklOk4@@@kq p-x1L M@t: \ \\P 0`[0\ @KP$$2 P6 $88#Č@ a@0,  @PF0@4 70P Kp\\\@\v\s0 P0kT@r`@ -EMLPM0|$ ,0 `p 0SG S @PF , 0R(K3Y , ` PU# W0Gpp0+@PDTAnU` pW: 4OF#J64; 0"坭@P Y|@2@d |4 B~KpGB>KpG0C0C+㱮@P+01D0GKL4  0C@PD p$ t4 xt Hd 巵@P0d0CS,+3+3*3*3*3*3*3@00Sx0! @\ `PPV  hJP@ 0B@@P\ @\P 00@00Sx00 0000S1  ;0\ $0+P@P 00SW \x\u@P()\k@8P0 R$odOkqkq,ki>l@ p-`QLP@@Tp -LMp`I 0@,P@f0 TK0$@K0@ $ @ `]PV@P$(ոP R000 0  U @lqkq(Wk -70#L0dM)x0 000p  t P| E W0p$80 S,:S &0 80 S!:SQ x lt`Q% GPU% R |lKh@ lK otQ  PS|@(K@d3d#D0Qx0S@#t0  0OF*p#J 6|^0 3#`,0 Hp``̂@`呼j6Z<080 tPO x2x"D0|2\@0t"000 @ Pp |5 @0` l00l0;x R0 0 i |Pp@`*`(VZJ| (0Kp# p倠| HFኝ00x;@@Q00 80| SpW$`Yj ^ *|0`SZ P`E5P p|lK|Q (Wk0prlqpo!Ceo@ 2 -Lp@Mt0q0 t0 pP09LK pP00P00Sp00p0kq00  -L M0 S0d @\0!@@@;0P  0x@Gh d0@GKhD0P 0N,Noqkq@qܧ@q@quk@@0@- x0Sl061cQ*0!a"400@_#& U l0T -LM pP `~@P; @1R @P3 <` H0 ,0 ( D0-H0 0 R 0R 8 $0r40 $000 S100 x0R :l061cR80 58 00R*0(0  < KP $KJN Ok@ -LHMH T0 D L P 㴀p(`)@P00pH @1R @@T Y@ D0H0 0 R 02R `$vD P@1A#x0V3:Dl061cV`1TT @f0,$"(+"+(R/ ̠Č!Č"̌4 ,@ P@HL4 K0`  @7P00Y00S@T,0@0@p<0 8@ 0OpH10}'<@K0Z `h@P0  0 P@H L0@P fZ,00D p1<KTp000@@Tm (K M Ok@ -LM0 p>0nt`Q70 a@P$0S, d060>0. V  b 0 K@P0 }P  ahL K f 0d 0f#&Bd 0S* 0d 0c#&d @ P-0L R.  . h(M@@ 00 0 -L,M0P ` Zj @<0"00S_ P@@ GP  Z00ST K0R00} 0@0@TT0 C@ @ء0 < L  @00KP0 H` Dp ,@ 8 @@ 4 W 0S/0 PK0 0`@/ V @ T00T00S`' T 50 0C0 S/ V(K" S@f0 PK0 0`@  X00R0S T0 `Xy0Sx Bw`P T {`@r -LM< -L M@H \?pP` 0 \p:@P`0s P,  (0  X 0  0\00 p0\P P(K(u,000P0\`p \:@`pPUY   U  R(,  (0 @0!,PU (/,PP 0 PO R, PPU ,K 0PPP ,@(,,000, (0 , ( ,x@l@ -0LS0S\KxpD0 0@`,PXWꀨ@ M-LM 0  0 0U@` | x t 0 |t\7zx0KpP` P(㭳:@p Q P`|@T 0x@K0`@ P P,0 P ` KP a ( a  D0(@n( { @V 0Ql :PK`@P|`\P ` \ Q 0S @0000$0S0 =0(KS`p00 @P`@P |` VPK`P`0xP t` ڀ0 |@ 0q|tP  (  0 S0@0   ( 0"PK`2@P`P ` Ps{ 0 S0pK p`K, K0 ,` 0 xPK``PK` P`LP   ٲ`Vm 0^\ ,0Pq (0S(@ò㱲G @ 0Q# 000^0 =ڐ,0Pq0 S@ 0R01 R0/0 (( $0(@㋲ \0Ux QQ`VBL0!E TIPI@   R0pKj x@R, @@@@ -LM0`p @0U `p KT0 Z 0-LM0@. 00H00 0 PE0S P0000| 0S 0 Sj00    Q$0$0$000 K0K0hI,@8@ 0-LM 0@C^ 940 0P405  0   0 S 0 " P0  0 _0S    R$0$0$0  0 0K0h襹K00 K0h蘹z,@ p-LMP8414a@0TH=L0S @T U0 0S3 0 0 R(0( 0@ @T@T|(@T 01 P 0S0  Q$0$0$ 0<0`(@TKph%( 0hqxqpq -0LpWP  `0V0  04@0 0  6 r -LpMp 00@"00\{  0SQ 0 0 0  0S 0  0$0p0$<0@60\0< !0K  eP"pPK`| <000P`@P0 @0S 0  0$0p0$<0ᤰ  0 0@0 Kᑰ 0x0  40  L( K0 P$0P0( @(`0 @Qd&x 8 0#40"!B 0S@vd@xqrpOkWkhd0 xqhqp@Q00R0 S-LP P00S00S0P00Gx@Q00R0 S-LP00 P00S00G렩@ p-`PL@ Pat00P30@ p p-`PL@ PHt00P30,@ p -L0MPU, `X 0S 0S0S s P HK0EUS  8T (D#x"h dŸ@KX2XUpX `@2@0 ZP0 L 0 l0P ) T0S ,0S00S40SX 00Y00S @0S p0:0 S<  sP@0S V 3S @ZP, 0LRM(K@0S<0S80S6 ,@K sPWL X QL PX0@0S}L ,@K sP 3S @80SH0S 40X rsP 40S 0HK @Z.$oLj>-LSkj>i> -LM@`? 0 9, l0; v P iAq喏ᛢ`PUPE]10C8#8S1YSW:A 0əP04$48,#H `,0@君P CT: 0,0 l0 1!08!x#W6@X+PUPE"108#8W1X*qA 0ፙP04$48,#H p,0@TP UPE1(Kq0,0, @W |qAkAkAkAk -LM@`d2P< P,0 E 3SD,0SA00S>40S;80S89 0 Qy 0@S.0S/+p 0P" R㲀 0S0s 0S! R 0SI  0 ) P 0 1(K 0 000  0, X,  (Ko04(4 S:0 0A嵚P @0 ,00 ,较p0S0S jP ,Pr|q -L4M⠢ 0 ( L H S@"0S/0Sr 0S 0S0si ,0,`Sg DKDPKrQ- 0`SࠑQ R0  R 0SQ0S0 P0S0 P Q 0S 0S Q1@-0\\ 0S Q @ 0 0R 0 0^@0 0`Uo\ \ R 0S0S 00S0 \ A-000`00#"B@Pp0W60S3V:00:00p`V@ W 0TS 0T#"` 0T0  0TV#"P 0T@0 :0 000E0TSpV:0000  :POkSok>0  2  0 2P0 0  5A0AS-0Q|"R 5Ph  h P01:0S S*S P P1:0S RࠁQ^$00Q=kOk -@LJ E B h> 0-|PL @R 0S0S R 6]0 0@0 S00 00`Uo 0- LPG @ B  =O00 00 p-L M`0@P$K 0 T  0R& KphCoT00  \a00 PQ K0 S  0RKp}$oj>ȩ@i>i> R-L@p`pBR00Q oP /.00 S 0bS1 RS@ -0LS@ 0P P S T loPP P0P P P\j> -@L@Pԑ 0-@LTP@T Q 0S 8oP0 -L M0@PK8a@p$0 4o8K0 @0K?K#P 4 00S 80S0C80$ 0R K<0S80S0C80""$oi> -LIMp0P 0  0`0CS 0  0R!KE R000 P"Kn@0 JK01K/!K-K$6$o2i i> -@LP6 -h0L@T@T 0S P R0600 h`Uo -LJMp00,0 (0P 0P 0S 0S+ P,6 Pk 0 0@PT 0S `V% @T6gPV100PT, 0RH(KPUPU  p-P`L@ 6 30PP700  PUP@ p6P - L@T 0S 0S! @T0PU/PU, 0R@T p`o!00 R 0@V @p@PU p`[! 00 0@0S00PVPpP@`Uo,@ p-PL@/` R 000  0 RQ 0@00\  BR\  00 !phf ]00S 00S40S80S P OmP 0a8 @100S<0SPrj>P@ -1LM 0HK, h0 Q9mAdK5m@K\K⬐K`p DG`KHpKc`KdpK%m D1X  |0 0dK 8  h0K#PP 1X0@@ 0P=@X h0S  ,X h 800C80, 0R(Kh0S @ Q  0h 0 0@h 80S080h  +$oj>\j>@@@j> p-0L@`T P0 lPPUʘ@TU p B!P 40 <0% 800C80phVPr p-LM@ PP0 `0S R Q000 Rxh %`P000 0z 00`?̪@ 0- 0LP8! @P 40800C800<0% 800C8000h -@LP  pR 0S 0S RQd0S `! l0$0P X5S1S  `P  `005Sa0S $`P000 i L4 -LpPMp00`Q0S0, 0 Pz5`0H0SqUSm HPZPgH@K,I-0S p t0SVRm8 RUN H0S |0SM|HG0[S hq8(00000q(00000 EP 4d00d 7 0 @Z@dG0[S@0[S?0[0S[P %04"48#P , 0R|(KP (7 Rs00 Z U  000(0( 6)  5 0`000|00 p0P0 P jSGHP005S3P d0 R-0S" S / 0>>@Kh jPK 000`?`0T >Kj<9K00K圀K%@K04"49K$0 0 $0C K 0KP 0S0 0000 D0KjxK0dK0K倀Kjxğ\K0c0KdK%0L0 04"45KdK8!+@P   ujP 80S0C80@KDj3( 0 d0K0 0K 0 8 0w P w  KkP 00S 0000h3 d0KP YjDß0 d0Kc K04 45KL dK8!@P   %jPa 80S0C80Ť@KD6jd0K0 0K0 2( 0 8 0' P ' K PG 0S0 0000Y1 R @=1 R   001=Z z"P0 t1 R 0 =80S0C80li80S0C80Ŵ1 R  00<  KP 0S0 0000ZX 0 RG <ChX0 RH  l00<>%04"43KQW$olTk1kPr@j>@j>|j>oolj> @@8@p@ -LlM`S, p@ } 7#QP/ 7Q .70S&7T/0CT*7T 0T)<-P7Q t7Q 0Q EP, 0R^(KUP 7Q0CQ7T 6T8 1CT7 1CT2 6TC0CTI*U1CTF 6TB ,0T? 6T 6TJ0CTX:Z x6T l6T P6T 1S  P-PU  0P|P5T0CT*"0CTQ 0S0S 00S% jl5T )$0CT5T :50SM1CT 5T 5TPa5T 0TZl !4R/PTUPP4T 0TUQ ZY p 4  R:p p4  R:q@$00000q $00P0P004T . 0CTI 0TY r 10aR001#050%p= 10bP001#P3P#050%T3Tb 0T_ 0CT[1P83T~ 0T*@&h|2.P2T 0T5`,P0P0 m$P(d0lW@ PUP K`Pg ` oP4K` Kd@K|KK0P 00 P@0[d0@0K@ [!tp0 K@ KT0 P FUP + 0S00 \00\0W$h@g|2 uP]P %04"48#P R 5R00K KwXP0S:P=$X9%04"40$oMi Ji(>iildiH@Ni0WiHKieiHi"i ix i %i i ,j>Ii i i Qi 1kRi Si !i @ -LRMMğ  ST1  0R,0 P X 4X 1CX 1CX -d, 0R(K0  0So0Sl1SSh1SSd Ra3X` 1CX] 1CX0I TP P@QL@0`SG0SDpKxg  g Kf@T00   1FSK00KPp X T1a p\`K f\P<0X@P80T@40P00  \P X@ T P fP <@Kf0)X2X  \K fTpWIpWF 0SY L`K fLP<0H@P80D@40@00 \K LP H@ D @ yfP1X4 S_Kx~f  }f(OK( yfT5 NK`` pf|| lfP X T11!K]fT00   aNKNf( (LfT!5 `F` Df00`9F4fpKx`.f  -fK )f.$oiixii 8j>$@ -LM@@0T0 @T 0 R0 KM@T -LM`peV 83PU,P  0 , PUE 81Sz@vT@T@T 0S<,0S 0iSl PJk `2 R ,  P00^00Sd V0 0,@ ,0S3 ,  0S9  0@hl*P hl* Z 0@hl+P hl+, 0 0@+P +,(K 0@*P *1@P ) 0@)P ) PZ,07,` ^RlʗRV 0 0bSPRXWVU P y=kTRkrL@ -LhM40`$0 xDP T @0SlTN@PKeDe5@8KD#D8!0@0K?KCKPP k> -LQMq@R  R$ ` $ 0R` K\a0S^ .S\ T 0  QO .QM Q0  0 n?R0n 0tPK0KYe0[ K T At [R A0B0S 00 R@KXwdu K [4PK:fd00 <0 %04"4  0 Xd0 n0$o$k> -LlMp@K0`X 0 >d -LM 0夐K0 x,0 d dT@KpPK`K@p0   pK哀K\pK[KxpKwK40 00 @ PL, 0R (K<0 R 0  7$o\j>j>lTk@Hk> -L@\\ 0SQ  R dPGPp P %P P P UP#P P GPUU` cP  cP U U00 0  00  0 00  00#0  uc  _cPOkOk -LM@pPPa0S4$KT P X1@T T tP08@TP;`0S 0 f6`0S 000 [60 U60S 0 @ P `p tP@ P`p@68`0S 0004 460$s5lTk=kX@@ح@@,@@ -"LM0PAK @0x,0 b  c5%#00KH2 >K4 KK 0 _ r`K 0 0K K唀 吀 V@  ZX @P 5d0S 0 000匀K`bP d@KKK4K0 0Q0@0[A0@0K@ [ @ KP T OP , 0 R&(K KP 0 R t5 AS/Z80 R 0 $~5$oj>lTk@@`k> p-LM4ad 0R@0 P *h0 S*1 R 0 [5 0R&Kp0BSh0 S:d0S 58J0 R 0 @5|0 R P L H,KPP $olTkX@@Okxk>\j> -@L0000#0 -LM`\@pb:,Ka<,$!$P(,, %pK0Sp> SH 0p 000 00 00Rp$ R, 1p"[2[[0[0!0000 0!00VTP 0T* 0S @T`00V00S 0 0dS1!Q00Spa @Q"J 000 00 0000!0000! 000 @TP Z J0 000\PZ0` W V00S \ p p W 1 1Q00Spb 8#8%P @ @0TA @Q"J 000 00 0000!0000! 000 @TP Z J0 000\PZ0 8#8%XU\EPEJ0PPZX 8#8%8S @  i]P R <0SL @&$ok> -LM`@ 0R0% ::PH 0 0QR0%p A:W= PEU@ R0 U00UR   bp% 0PcU@0@P  P] (0KOcP ( 0R:0PD (0K=cP ( 0R0%p *Z0r}@0 q -PLU%@⸹ ⴹ0 PU `\0 00 pW \PUPQ0 D00  0 00b0 00C0qqq 0- 0RL@ * ^PP Z\070 a 0 0C 0 0 -|pL0Sd`00rP LP 0 0@ 0$@{P00h\dUoqr -LT0DqS00JPU 90P0C0S90a(0 0@(0,@IUԀP 0R*0S`0 R 00 0@004@ 0, 0R:\P00 P 80S0C8000 odUoqrS@ALaPL 0RS00L0 S0SA Na0N 0RS00N0 ST`, ALaPL00 LQS  P`0 R-\QPNN0`@TY0.S 40S X*,` 000 04 0RfQ 0000 S 0C`00c 0Z VV -L@Md0 `PT,0 H6 R UVppVnV, 0R,(K40 <Y H@KT T )V0 @KG0KHK 0 3P T0S  @PV PP  ;VP0 @@PTe0 P # 0000P\ : P 0P 40 0S X P0@00L0 L `00L0:  L 00@@@ UL0 ULv0(p(0@@@@@40 X R L00 UTL @ UX 0P(P e0L 0@ a\0 S:4 30 S L\ aP0R :0`@0DS:/.00Sx@UL00a  P 0P 000PUP0 0S 0S 0S| 0Sr P@ L( B("(04"48#,("(#80 @@0 P$("(04"48:#8( o <8#8 0P 0@@@&P |" 00@0@|2P`00@0@|"00@0@F `d$a9S`P9UV 4UT0L 00 X0 TL0X@ T@00S0C00 00S0C 0 0{00S0C00q 00S0C 0 0g`ARI 00SX 00S)P' 0S$ 1 0( 0*e TP$or Rkqk> -QLM@PpU UTP0 SRL00SSHDXE,p LYA@> ;` ?T4?R2T0HP4 R0I\/ T& R$ T"0X0Y`P \TP,0pcXj Y X`Y@   @TP X0j S -L M0(  @ $(,L<4,4"| W@P( 0Ri$K1T+ 10SPD@KT0 C0KD K<`K0S7 (QP 4080S0C80?1@T @T00ST0X0W*< |20Sh  h S*S0@P Xp00S0 $!$#KS0S S:0wu$oRkRkRkRkPrk> -LM@P`p$@0 p%KhUo|@ -&LM0`,0 0Č@@P@@,@@RklRk3p@x( -LtMş/R 0 , pX 00 S0% :Pg   ` P 3V ,+Vm ,V V( 0R0% :PP 3V000011`PP 0@S0% :P= 0$48#8 R`P<V 0Z0#X( dKsQ0 S0d0Kc K \@K L dK0UP 4 RQ 0 l0KWPp3@P $(ß, 0R(K 0R0%@ ,:T 0 0Ra`Pz0S 0S0% :P 0 @2  0 l0KJWP l 00R6:0Q l0K;WP l 0R':0@ l0K,WP l 0R:0] l0KWP l 0R :0;l 00R0% \*2$@@KHKP0 H0KGK嗭] 0 HK 0@P_ 048<:Q0  D0 0HKS㈠ P x  p 匀 p`K 4 21C0$!10\ R dK( 0K J#1\@K  BU0 $(, <4!4" -L@M0'T,0  9 RmPh, 0RT(K(Tu 0/Sr :0 000 (0(0 0@ -0#L0M0,0 P0T0 0L0 R0% :Zy HKMT0 H0KG KbX HK t@T p@TH l0  v0:S,0S00S_ T , MP0S 0Sk X MPQ 0"0 # Wd !0yPP] l 10Sf K@HK L0\bPI MLPF MDWF l h10S L K$ K@HK L0?bP|MLPyM, 0R8(K40S80S @W P0KiSP P 0R0% d* $0S(0S @hW0L0 pjIMT0@PP PT  L K $orʚ;}@rl> -LMR8 <0  0848#800 P 4 p`U @T@T 0 R0&0   @WpTYM 0&W00S] P`S00S0 @ +P@> P8 P0  0 0  < R2Q0,0  81 bP0,0 p,<$!$ ,, ,  ,K L  L00S <040C<0 4 P00  0   8 04<8#,("(#8 04(K100S  0 $("(0 0 Ph4 1k=k -L M4 !000 0SJPH 0 ,1`VC @T= p,p @T 0 RZ0P P& P' P  0   @pT,0S`V p(K000P BKP0,0 mP    pp40`=k -L,Mlş 0  S0, L0 @P` K:X/ @T@ HK@@KK0 TG0KHKKHK(wP 0 $("(04"48#88f#pAZ `3`3 3 3 R* Rp K@l, 0R(K RWp`ZO Z* Z y333D3 P0KQP P 0R:0S W0  J@0[S S T eKPH`Kp |3  0L K28` VkK@Py  JPVD V:K~K@2  <`@0[S?0[0Ss2 @P 0S 0S 0R0%0"` :V  0pP OKp~p<`8` ;K1 ` `( K0(` KZ 333x300 00880!000 P 0S0 00s00K18 00 I0L 8 0000PK4 P0 J0000W`p 4u?0[0S:17 0S%04"43K/?0[0S S)  P0KPP P 0R0%` h*J>$oRkoo(l>}@ -L M@ ,  `0Rpf |" 0@,W$-P>`0@ 8$H0S |2  ,J (K 0 S8`  K:XY @,: 0<@ pPP. x̟! !=0@@8DH@T JTe T2 TL,P |2@0  <@T^ 3333,3; R+P(8,H`0@(8,H,0S 00K7PP 0 0R0% *P T, 8;@P $(T5 Ty <:TX T : R, 0 Px@0,Ks,00S |2@08 8< <@T X 8H 0@8H<\W >0@*084HTR T,P |2@0( (, <@TW :T,,,0SK |2 00@0@, ,, @r 0PT),00S |2@0  W}T a:0DSiv,00S |" @00@@0D@<P{dT:WT ,0S |2@0x x| ,(0L@P / F,00S |2@0H HL <@TK,'0LP  B?*,0S |2@00 04 ,,70S W5 W5,'0KP PP 6 8X``ß0@48 4$D8X 0@ 8$H#qlTk @s}@ 0-PL @R 0S0S R  =P @0$ S00 00SRk(@ -L5$00 0tRkRkRkRk -QLM# @P`p, ( ꍦ@P 5", K  pf`0, K $K -`Lt4t0@!0c48t0!0c4<t0P 0c4Dt0 0c4C@@D0@ 00Q0 00Q DtP@10 R d0H, 00 S0 L 0C # 0 pPP P@ꫪ1k -, 0LRP"* L0Szt, 0S*4@pD`@` @X4<0,0 H8@K00 s[t, 0S:j,1k -LRk(Q0( ,S  3S001 001 R0P 0-L MQ090L+S+4,4,44444444444444444P4444444444444444444444444p41\0 0K0-0 K0h:t0 K0hhX0 K0h`T,,0 PK0hdSkH@k>qrx -L8Mlr@PP$ ` 1$ 0R KQ<R444444444444444444444444444444444444444444444444444<44444444440Q:N0K CVN0[0M0[ 01PڢQ: V0KC%[00SVV0[0(Q:L0K( oCVF0[00Q:N0K bCVN0[0M0[ 01Prp B$o4l>X@ p-PSLMPK0C`@0%T  @0FPx@x -LMp0 @$("(04"48#8(``V`!3T (P  1T +T (KZP*0V':.0K C,0[S! -0[.@[01PY3T0V:*0K B3T)0[)0[1001*@[PP<T000 -LM"0K@ pB3T!0[!0[00QQD@P00U00S ; C1` T ` `AU* 0B PxC@ -L(M0@,0  Ply /  DK)0D TPll 0 R 0 0( P @3T 0T6 P PP p3T0000aa 0V 3T T#P00P0 @CC2@P  t, 0R(K<T<T B+T+Tl0 3  l0 2  )0rTP0P0P0 @B@@K B@0[S` SS ZZ 0SV l0.  )00 OTPllfL@KM ,1ATPW 048< ̠<Č,ʠDK= )0D +TPllT (@P  00Qwl0 1  )0T0S|Bl??0[0S SK?0[0S $or@l> 0-0L0@SP ڀS S TB0S00 0@0@ 0S 1  SM: 0V R*KA"[04"48#8 00@P  A+00h a`*0p@0@P0h @PP,0T0h `@0p@P@P?,00h r -LM@` 0)S0p(P 0 0Q( Q0%(":P*0@P  (K( ,0KZGP , 0R:0( ,0KKGP , 0R0% *8h0 EP00@r}@ -0LM40 < ! 0S /9I 0@d/9I0S @ D? 4? #=0@8H<0S |" 0@<.P`0@ ~'RP00`S1 .P0`0@0@0S |2  < @(K (EP< 00@X0@ |2  0-10`p  -Pd Q0SW Pl 0Si0Sf0Sc0%d,-P0`0@0@0S |2  $ <0P ,10@#P (b,#= 0@x,8HWh,'= 0@L,9IL<,8H 0@ ,8HA 0S$0S00@0@0Sd |2  $ <ZQ0Sa 0SV P 0S` Q0S 0s ,K P' @+P0`0@0@<0S |28 8< <0S |2  <  ,00S 0S0S0S<0@p0@0 0 $("(04"48#8( 00 , P`Y <0 (0BSb:(R 0S  00< (00<0S T }< 0S 0S0s 0S0S 0s `)P00 @WP0T@ |2@ @D 9V Y@@0V00S8 <K21C010  8`P 0S @S<,0 Rt(P0`0@0 @0S |20 04 <v0S0S 0S$0S^ Q~ Q ^ ^ <Q Q ^ ^ p5 ^ >00@@0 D^ g0S 40OL'> 0@0'p0 0 哛00zQ 400S? 6 R@p@@  &P@0`0@@0D@<0S |28 8< <00S1@9 0S$0S-0s- 00S~ 04z <0%z%0 0@%0@00S Sh 04d 00Sh 04!48#,("(#80 <Z 00SR 04!48#,("(#8 0 <D00S;0K4K< K 0P<P 0400Sp$P0`0@0@0S |28 8< <0S |2  < 0f 00S{ Sx 00S S00S S00S P:0< BW |" 00@0@<0P 0S 0Sd P"00@0@ R{ @00@@0D@0S |" 800@80<@< 0)S(RPf 40`s P2 R@T  ~=P#0S !hP000S000 00S0 0 000S S 00S Sʚ; -@PLQ000m R5h0 p-PL`@n: U  U U -p0V 0 00p0V 0  Q 50p0V 0 00p00p 0 p4Rk -pL@80h00d0 p-q``.Q00SLP@ P{ة00/U00S00=U00S0d00U00S P 80S0C80@0 0P{001U00S 0P{000#U00S 4P{0403U00S 8P{<0P80 80S0C80 0<02U00S `P{0`0p64 -L@ `Ppi \0NS?T\00S #0NS/0N+S1(B4C4C4D4B4C4XA4XA4XA4XA4XA4XA4XA4XA4XA4XA4B4XA4XA4XA4XA4XA4XA4D4XA4XA4XA4(B4C4C4D4B4C4XA4XA4XA4XA4XA4XA4XA4XA4XA4D4A4 # 50S *0S 0S 0S0S0S @T' 0S P 0S0S0S 0S U0S 0S l00l0U.^ P P Q{ P  7P U U00AU#^ 2^ ^P { P  7U U 0U0SR @0S3{ ըP8n  7PG U U U0S? //^PXU{0 Sw0S+ Ul Un00Uj1{ 㞨P07  `7UX0QSQhUM0 SIdRB0S, 0S< S@ 0S70P{ kP  -77l00l080S `PW4PU30 0S0S0S0!1 00SP  <4("4!<0 -LM@0pSP` @  @VK{ p0 -@PL {h輧 -`0LdlSpdl {ާPP" @ 000S { ̧P  600S 0{0A ủPX07 0w640S 0{0A ᤧPX4  4e6`0S 0{0A ᒧPX`  `S68P 0{0A ဧPXPP8 8 ?6 -PPpQLMP@  K8T<0S @` T P RT:00S000@TP" T `0 R0RS0)S B 0 }P000@TP .P -LM@0TpP+ `U` 0S{ΦPX P  00 zPP@ {㱦p{ @r -PL@p` Pk 40P280S0C80d00$50 0 \(W A |20Qh  Q Q: 0X h Q* P M5P\ W -L$MВ0,0 #A0D L0 Q@S4$S4$S4$S4$S4$S4$S4S4$S4$S4$S4T4$S4U4 U4XT4T4$S4$S4$S4$S4$S4$S4$S4$S4$S4T4T4*, 0R(KPH 4PE 0P0a V(p4W@V   3PpphPLPK``4W@ ;4P PpP`@@Kj3pP`P `P`PpP 8PP d0SpdP`pDPK`P l0p0HPK`H0 P PP`P 0Pp0HPK`H0 $o`l> 0-L@)R P\ V3@0@0S*@ P00\0S D3P 0 :RPPD4 0@ 0PP@\ 0S @0@ 0 :RP@ -L4M⬬`P( LP p@ )R@ 0 P P( 0R$KX 2PP@ D<R!Z4[4[4[4[4Z4Z4Z4Z4Z4Z4[4[4[4[4tZ4tZ4[4tZ4tZ4tZ4TZ4[4Z4[4[4[4[4[4[4[4l0F\77P Pl0l03Tzl0P0 0l0+l0P 00l0%P\,P$ok>pl>  R-L@p`0PP T V @  /P; /01/77 (R-LPp( B(0p2P @@0S1` 0P  0 0 7.P 000 0 0 0 -LMP`U0P1 @0 0P <(4"4!< $K= 0 (/ 000-P @ Za0pP ; /1:/77 0 @0 0 000  .0@/Pp -LM @4 8 4<,$@a8#$@D  X00(@0 |R@y4`D/PP@q P  .@Pl1 (@pp ᆋ @ 4 ,0K0@PZ400("Ƞ0l08#8 $#$(",0^!"( f , 04<8#,("(#8 0 0L08#8 $#$("<8#8"(0  0u1P!  R4 000,0) , )<)00`,08^.@PP7@(KX.p -LMϟ " Bk-  L,0S) 0S&0S#0S  P0@ |0K-`0  '|P- 80S0C80(&U  p`P 0SU $ X00@ ˟R|KX0\@   W 80S<  " d \ 0 $(:0S    R *8#4"<# #$# 00s 0X@KP,0 PKW0K嶉0X0K K0K ( 0 `PPC L0 0@L0P@  0S |" P00@P0T@ R 0S W 0S00  1<1 KR<0K @K@`P0 S 0  W h0S Q 5   R R Q Q Rf R QZ Qx R 1@0100 K ! B0KqPP`D1 @01 [W l0 0S-|20Sh  h S:0Sf RdS: 0  P`|PꨀP `P``d  \`PPHAV &0Ɵ0 @0@0SB |2PX0 0@X0\@000 0SQ+ 0 00S Sk0 48#8# ᅿPt  [00@ |K-`P  P0S1<<1P |" 00@0@5S$ş0 0 @P0@P3` |2P 3`X0 0 @X0\@y400  P|@K$+@ @ `t0SQ7 Pe: 04a 84P0 0S  ,00 0( s`P0S |" `00@`0d@P00|+U `x0p0@Px0|@ |2p pt   0 `XPu 0V0 R+P(`00S000 00S0 0 00S |2Ph0 0@(`h0l@00S S 00S SuP 0S 0S@ P0S 50S,00S(+P 00SH 0 1  00SB 00S S6W h0S&  #V,p0 0@p0t@P@T@T  *P0S 0S  (V `0 0@`0d@/0S, |" h00@h0l@!0S0S,00 $orl>@4Rk p-LM@P 0`R :P" 0S* 0 @0@P0f @P!x 0Km0P  0R0% *TD0@P0  x0 01 xr}@ -LMP8 `P} 0}*pPu J+P 8!( @@0( 0@0 0`0Y0 0* B⯆V{  㩆`0 0@80P0PPPPPPP 㗆0S; ( :0 <8#8 4K0  )80Pp1`00@ X0@0 K4  |2  80S S) S Y00 :(K 00S P PX |2 !X |2  X |2B  !` ,  'v)qxYoLj> -pL0S0 @` T& `@V P`P( R  BR0( 0 UT` `@VTVi0$0VPYoPr 0-0@%x04"40 dPL04!40$ R 0 (P 00S 0h,TkCS0`Vh@0$E D U0( #5#3 04r=kTkMb P-L \  R @T 0 S *01 0 S00@ 0(% 됵@@ 0-@PL` 0S[ 0SQ P d1 RMX1P U 0SCP0 Q -d6L MT6, \H @a <6\- '06\ (6\ P, 0R{(K5\3 C5\( 0\|2H@P0C\댅pPU 0`S l5P 0@@ 0S TPVP 0@S00S fTP0C\H 8#|20Sh  h S:0S0HP0|0 H0 |2 H |2 H0 |2 H  |2 H0$|2 H (|2 H0,tH~#43D ZQ H@  ]L0 0X $ 80(0< , 053@ 0 TPU0- @`1"0H r 0@880S900S03 H 8f P`U VP`U8#830%0Z @ Ȁ R@ D6PꞶL00S=IHJ4#T2pPUH@`M  0S00S H @  J0 0120$0 %"PU* ` V@%P1P @{TP|2H P$ H0 -0LS. 0\"\ 0SP0 0 ( "0 , "0 0 " 0 4 " P 00S0 $#$("QTk -LP`VpP0H0@~0 0$4h00 00$C1k -LMp0SP@ P` 0@  0@TF 40`0 YV?  = H@VT? "0 00@0@% 18SS C8Ss 01P"0 S `VN @( e`P 80< 0CR80= A@X !`'P@|2 ⻰0 `@0 P   `P@:PdP 40 `40@00|"0 0Ba&0 `@Z0`0( Pd40 `c01h \00  18o8C0,04 0 18cpTkD@CMb`TkPTk -LP@) 4 00 S H^ 00S 0S1ST0p 00S0 S! <0D | 0hQ  APhTkC -1L\M℡P P( 8@KpH`, < P; \ 1S  W R !0\00 a`<) 017|@KD` 0 <x0 p 8r 0( 0R$K1S < (0 Rc Rk$o1kC`Tkl> p-DaPLP $0@S 0SA TP $0@S 0S3 T0P S& T0 R0 R$@0S0Q S P 0 R 0S 5RK0Qp0\0WrTk Rk8RkpTk -d0@Sh0L0 l0Q QX0 R :00 @`00 R*h袯h 0R 0Ok@v|2 0-|LP 8H00T0@  0@001 1Ba^0 %i蟿P 000010!$10 B1 Q `V p p<00 0j P pq0S 0S f00l0 d0Ba  040( TTkCMb`TkXTkԷ@@@@ -P!Ll@p dP P iT 00S ]3000  00  00@T 0 4B0  4@\@ -LMpP@ Q 0S0S  !`PL 4 ;00 20 SHX 0PU 0S `(K0S 0S`0Z0S0 ,0 80 4 <@Y00S&,0!H $2$"0 ] @T P P 0 `t 0T]   `P 4 0 Z0 100CS(ꤨ444\4@40 e tP ᆭ@ ፿ 00 @4 R T 0S 0Q01R 1S 0 R0 R| cz00S 00S8  01u Pe0 0 e <uY 0 C`Tkи@ Rk8Rk@@ -L,MⰕ0P,0 P`0HTk@YoYo 4pTk`Rk\Tk|7pl>lTkD@$@d0GS S S S S 5SS 80 P0S0SPZo \ -L Mp`P8 0P @z00@ 0000 @e0@0  0 p R 0X00  0| J4 00C0K Khn꘹@@ @Zoqh@ -@PL P000h0@ -@PL P 0Sh000mP@ 0-t0L PR0q@P  R 0800  0|  00C00TkZoq 0- @P L0h괽4 -LM$  PK$,  e@BP d 00 @00S81(0 R @00 0 pp    0: 0`000 0HKd`K\PKPHKGKdKcKQR S ,04!45K4%KT P0 X @ JxK y@0K0@( 0KP @K  2x(`w0(0@0 *x0Sp S 0S ^ 0S ˠ,48@#8* *$*00 :( @@] <8#8 0K K0@@Y |"P`00@0@|"00@0@2@X\$P PX\$ 80S0C80 , 0Ri(K; 1311 <1 KK嘐 / 00S0 0 0D1 R;P 80S0C80A 00S Sq e0Rv 000 Ro e@ 0 @@ 0P 01 0 e @("(04"48#ȠSᢩ@ 0 MK$oX.pqlTkp@l> -LMHPK$0 , x0S e@P e 00 @00S008!U( 0S @00 0 pp    0: 0`0@0d`K HK@FC0 UG0KH Kc0Kd K \@K wQ R R 0 (SK &0K ( 0K唻P @@K v(` x0(0     0 v0S S 0Sq +"48@#80 0( :@@ <8#8 0K0^0 K@@Z |"P`00@0@|"00@0@d2@EP PPT$ 80S0C80{, 0R(K1 <10 K0K嘠 G; I17Pr ;Pm @@K `vy@@Kt P e@ 0 @@ 0P 0y1 0 e t@("(04"48#(l 00Sc0 0 0_% 04"4P ,5KP@K4\@K%KXP T0  00S SJp0 R P 80S0C80l>( 0g$oX.pqlTk@l> -LM0 005  @0000 0 -PL㣹UpS q`PS *? 0S2 0RK0 0S0R0SS0x!00SP R 0T10  0| ߉0!00C0 0٧ P001h輸0 R 0 0§ P000~ 0 |0 p0Ba0 @囧0@0 0lTkZoqH@D@@@@@CMb@ -LŸ`PQ 2  0   00q0S 0S\ 5 0f P100mP8| ㈉P9 IP T 0L!00Q0P 0V0 0  ( @T0yGm90oG0 @!0@0 I0 Ph000m=ld 0H |0 @0Bam TkZoLRk@D@qlTkC@t@P@Mb -LM@0 s 3X R7 Hd0S LyLKH< r4 R \K> hy7@40 0Z0Si <K' Q_c0S[ IL [ \K 屧Pp`P`6 lK@+X e0 00S b0S8 \K Ae0<K P P <0S 80S40S00S !@KK( 00KKS@P 40  00 Rs sa0S [0[0S%04"45K7`1 R H0SD0S@0[S <0RPP@S@ !80S40S00ST0%% P00 Ġ"Č0 <K\ KK@ 0<K @U0%  `@R000 <K\ Kov<KP zo *PP 0p` `0$o RklTk`r}@q@@l@@ļ@T@,@@X@l>@|j>,@ -LM@0`,0 0 <K p0 rLK rPU" 7 R7@P .hǟ, 0R(K @ 00, 0R0%P U:Uc \pK r0 \[48\l- \^ &300  L0[S^ @KH <PhL0[SZ PP@ 0PAT0Pb 09ᱤ(  [0[0S\%04"45K5 R ᘤ   `0KP ` 0R0%P *|5@P $(s=[0[0S S5 R]  YP4 RR N4 R  <KP4 R; u7U e0 00S P4 R+ 8 e0DT^  SP z HP v 0Xr 1# S <0e @R@U@Td 0e P  0@S! 8#8S140040P @PT@ P 0  0T4  P/U^ 0SR  U  1S012"0 e0,U&P ᶣ@ή00 LU e0 00e \2  0S A!0!R00S 4000e hP  @0@P<yP$ X0U00S 0!10 40  Z |2  00 R < <0| 03T0T 0 ($olTkhr@@Ծ@}@q@\@0@l>@ܿ@C`Tkи@ RkTP0S0SPp4 0000 0p 000001k p-P0L@`TP @T 0S Ppr -LHM0P\p 0S K P40 d@KD`4 0P0@ 4 ` \P X` p -L@P3p70`S h茳00S 04!40 4 -L<8 Q l0 R  0Tq@ 00D00D0|$ 00 0@0@0lTk@1k -LM\#X@0p<K,0 U 7PP` ϡTW00Kx0 A  K0K 0K00K60 <80 4`0X@  @ 堀 >0 0000 4 0000 8 0000 < 0000 0 |0K<K0tK{0K<08 P0 T `0@0`0 嗳K@ PUW Kⓣ1 R], 0R`(K`0L@K0 `0  <L08H 4P0`D0P@ P`0`@00 0@tK |0K<K0{0K@ <08 P0 RT 0P T RA #310" cb ` P `0 R K✡0 PP`0 0,@$olTk: QN@p@m> 0-\0L@PT@T 0SX X0R⨢P 0Tk -T@LT  P HP 1S@T|\000B -0L@pT&@V HS0S P0T0SPU P0S0@ 0Su00STk p-LLM\`K@DP< 00 \X0 T P   @0H0 D 4 0Kp -LM┢P0 , L Pp p2 R ܠX0 T, 0RS(K,2@T@T T P0 X0X RP 㖠`PS HK@K(0H0K @PL@ L@ @KD 00 0`0 0儀 0 8 L0KPLQ rLP00P0Q800C8020 RL t@XPo` l0 0` L`V 0 R `V80 R NX0 0$un$olTk@Tk m>h@@ -LMLP0 0, h0 (2 R *X0 SP, 0R(KҼ0HK0 @ ` @KdpKG`KH@KPK (\Kc`Kd@KDH0K0 p 8 h0KPP#P0h0QP0(1@T T P0X0X R @Th R 80S080h0 R @KʟX0 0P`P pP D0 R ᱟ0X0 0$p$olTk@ m>TkX@@ p-LMS@T @T L0 'P @@2 R T5L0 P0J PP00P0@T 0S00S@T@TL0 P0PUG L01@T 0S00S@TQ@T 0@ 0S P2@T R 0@00 RxPP0P00P0 3PP 01 R X0 PD`P 0 RP0@T 0@ 0S P000000@TxX0 t`P0T L0 P00P0@Tv 0S00STkrPrlTk@ -PL_ `0@#10#T`p7 p@T 0 R0@ /X0P 0P 00Sp`0WV`\00C\0i肯*PP\0`0\0 PP\0p0\0 -LMP0 |bP< 8 \0SK.@P 0 R eX0 0@ pR000 TP @|IT 00CS 00|<Kh 0 elTk@ @ 0- L@P |\P PT0S0T0T@0h0 -LMhQ0pS@|b ?R70S2`| 7PP, ` kTP@XT@(0( @0T0は0S0 00PҮL0X  00 0 K @P @0 R ǝX0 0@dRkTklTkH@ -L4MP@pBT1;@@ @0 %`P L0L00L0L0L00L0L0 80< D@H80< D@HL0 P0 W mP L0k @Tp\ pDp @TN 0 R0X0P 0⡞P 0@p < KL L0 84 Q*<00^*r `200`RP0 H2% 30%`  ` 82QR:R40 @ R 4 <K0 H $LH!00D0S `00 80S `0#10#0W0S@ (K\0@0\00\!@/P\00C\0 @Pp 01 Rl X0 0@`80,` S L0 , K@P 0 R ֜,X0 0E,P L0`>8@,0<@,-,`68<4 8<4 0D0 c1k 4lTk@@ -$LM0ȠK DHpK,0 d`K℀  PK  x@K0  @H0KG K0Kd0K Kc Kh p P ` @ 8  0KmQ [ 80S04$0, 0R(K080$o4m> -$0L@T @Tr -,LM0pHKdK,0 `Kp 4 1 ȠK- D* x@KP0H KHKGPK0 KdKPKcPKhp ` 开 尭 0 8P8 0K @Q  800C80T0$0, 0R(K峸$oHm> -L∭1pQD1 R@ @T: `P@T V? $00S0U  RPU00S @TV7 U  P HP 1S@TV Ubi虬0 R  h0l P HP 1S``ӱU `V` Rk8Rkrx@lTk0@ -0  LRP|b0 R)$0Sp! R 000  0 @T LP@TW_00CS0 |hN}p 0 s Rk8RkrTk@ - 0PL|rʬ@ <`PL ATd $0 S A5  @T6 R0000 0p @T P@T P @ 0``00000  0``@Tӫ1S 0 R0R(| }P `LAᳫ`00 R$0 R  rhRk Rk8Rk -LMP0P,0 |™<0K 0 @p<K eh7 R 0 Ɵ, 0R(K`V 6 R 6@P  z@w0 0p<0[S L6 R <Ke@ ;0[0S 0R0%P :Uz @KG P 0 4 d`K8( L8 u\K0L0K0 T$("(04"48#8H 4KD  <(4"4@%$LT0T @H:0$%#5$  %#3 000 0 4 8  <,$!$ , P`P% @ P 01@\:0SQE 44 R  < 0吶,4@P $(:Q 0S \; 0 A9 e0 00T4 3 R2 <Kⷙe0 D( 0KP  0R0%P J*TPU3 R  ,2 R   @ 0<K@ @r0Sz St 0 S PK`j 0 K0KK2g x0[ 03x0K x0["# 00x0KlK0 $(, <4!4"<0 0 $(, <4!4"<| 0 PF y@0 $(, <4!4"\ U *(1 RT  0DEL Rh0 h0R@1*T:0PU> ~<@00S0 R  $p0 R&  0@@Un 40 R ߘ 0\$o8RklTkxr@@1k6MbTkd@\m>q@}@@8@l@@@(@ -LHMP`@0p,0 <K zfX2 RL2 R ,, 0R(KX 2 R 2@P  ᎘@⋘0 0<0S80S* 0R0% =:P1 h@KJ P d\? 0 A= e0 00T8 1 R <KYe0 D40S00S 0 R q0@P $( @0KbP @ 0R0% *X @ 0@ <K@r(Ҵ$o8Rk RklTkpr8@@p@q}@lm>-Q P-R 8P r p-)RLP@` :R P!P % @p@phvS S @phP   0 0 0@P @@phP 0S0 S [@ @P @" --dLM0p,0 0 0 0 0 Y P`0U @K3 0 JP @ < 0 :R) ( ~ pP: @ Ae @0K  `P4 00 Y @Kx Dȟ, 0R(K 0S0  0(0 L pPW: pP700 0 :R,0K@ H00 堩PY  dH R 40<00 p0  0#$#̠`#8 0v00妧 0 :R0 q 0\:( 0K*P P@0(  l0( 20 K` 0 :R ,6@0P 04 f0S100 _傳0S |2A0 0@0@\ 񟗥L55\5$555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555|5D5 555d5,550S |" 00@0@ R 0S |" 00@0@0 #0 0@0@0S |" 00@0@0S |" 00@0@0S |" 00@0@0S |" 00@0@0S |" 00@0@0S |" B?0@1 A0S |" <0@1A0S |" 00@0@0S |" 00@0@t0Sq |" 00@0@f0Sc |" 00@0@X0SU |" 00@0@J0SG |" 00@0@<$or|m>q -LM PR`@ $K0SP0@S'P% P 0 R Tp  0R0V0Sp  t0Q-P vP ZDZ0p@, 0PđLSkj>r-3r -L0Mğ0堔,0 Pp`0@`L 0P ST  0S 0S0S HK0 X H0KG KHKX 入PU TS PUC @0 l0  v0S,0S00ST , P0S 0S$0S X P0s\ 00@0 @P0 T0b ᫣P"I 00@0@Zm l 20S4P0@HK L0UPLP(0 0@(0,@40S80S @, 0R(K 0smp0sa L KZ& !0+@P l 10S[P N@HK L0 PIJLPG(0 0@(0,@0L0 L(0Sq jP0`0@0@!  00@ 0$@T;\" Pۿ0S |2( (, 0 0c l0@PP PT @ L K僰$orrʚ;rm> -L0Mx Q, L @P`0 8#8^[555555 5455<555L555T5d55-0L0 XL, 0R(KV P u00/ 0@S| 0L0 o90L0 QT 0SHK @G0[SQ /0L0 0@S2 R 0Sq 10L0 V 0L0  T+0L0 ֤2p PL l[1PL o Џ᳏0 嗚T80L0 HK 0@K G0KHK  0\L r000g1 R 0SL0K,p 0pH0aP@ J$噯0S 0S 0s S0S,50 mPr 0oᯣP0 v@0 tP  00 PPL0S10L0  8. 0L0 $o=k@xRk|RkrLj>m>@@ -LMßPp, S0@0 3@0 `K3 07P `  X K8, 0R(K T 0S 00 0S/00 0S 0S 0S$0S(@T| 800 0S 0Sb ,  0 0pP700  Z0 (1"(1(`0241"4101 #0 !0p0@  0# #$#8`00 0HQ 40<ᚢ _ _ 0(  PH, l0 , 2(0H P e$0S(0S900 [ 0SW100 T倮HKH`K[0@K 媢P[@ ,KH0@ P 3S@ K n 1P@0K 0 f &$orh_qm>@-@\   0 S  0 \T 0As0 -LWMP  s0`0S0@+  @0S00f+cYU ,0K3pW0/Sp Hs(K\2 ,00 SPC/R 0u/S @0 tKL H0  0Cp0 l D t` 9P/00%Y0`, ,0 0@fP?p  1P 0p@0H0 0CtKLp l p0 t` D 9P p,0K2pr`E\E@ 0LKP 0 p 匠 9PP0`K 0[PP 0 aK[PP !p1R!l1RPzE`xEpu -LM  4 0 , 0 P  0$00 00S (K ŸK0ZP0UX# R 1  rp2  \Py0LŸ0 @ P< P< KH0 8 \ X0 DP L T P  tr0P 04K \K0K,0K[PpL0 pcW]0PP`\ 4Q0 0 S+ 40 0C40 phW*`U 40SG XDE0S U0 0-  P1U0O 0ApbW40 `P0,0S X Pr|0 [ rb R ? 00 ` Q000r -L`p?- P@ P! P9 T00PU0S+ N,- P@H00P P P<00W l4`FpGW@ L,@T0gG F`p(!p@ @0@ @@ @0tr@-@ tϠ0Cl$ !B l10b1 0!0c"0 0cb# a10` bP@tr_ No@-@R 0 0#\P0S SS0S0S  S 0SQQQQQ!Q1Q!Q1R 0S  R@R  0R\ P0Qc-R 0R^ 3! !\8#8S    2  0m>P P  0S  P P  0S  -R0 0c BSR48 R p-@P`x BRpR0 BRRR P0 P 0Qc R-L" 0S 0S \ @`R 0S  ^00NSa00@R  R 0S0  R000Sa@R P0SbR 0PP  R0QcR0S0  RR B0 0Q0 0QQ 0S0S QbQ- * 0 0 QaR *0\ 0 S Rb` `!  0@-RP@# A0La L\0   S00`P0S 0zP R00@P0S ZP\\ ^0 `0ȠR@-,Ƞp` Q R2RHV}GR0pG@00 0 0  0 0 0  0 0 0 0 0  0  0 0 0 PU @"Vm> 7("B 1@W b`0`WK W300 0 0  0 0 0  0 0 0 0 0 0  0 0 pG0 W `W 0 R 0,8(2C"B0 cbR  0 R p0\d0LL'82C00c08 P @@ R,B B[q p-@PL 0V\("( 0$H,8L2C! @\` 0%H c@`R,B BR,B B,0QA>A0AQAApqm>0@-Q@; R,P0 0,0,! ! 1!4##!#$" " 1"4##!#$""1"4# # !@D#$""1T"#T (P0@T0,0!," 00m>Q  0 " p-L`P@@Tp -PLM0@`. 0IK$1  0K0R0pK Pd@0 Pd@0  Pd@0` `&$K` S-L@P`0 @R1SVPQ00QppW(,0\h0p(S\0 p,00L  P  %9$0( 4`,p$P0p@褖550% -@PL$Q ,0S 00$0 -L@MPX \ `0 (K$pW 0 0,  P, P`4`< (0  0AS_05,15T05,15/5,15,15T15,15,15,15,15,15,15,15<15415 U, `F0P U, V\,KX0`P@,` ,0H0PU8s, `F0PU, kV\,KX0`P0S0 8P U, `F0PU, V\,KX `P( 0P1:=0VPT0 # BL !0@UᲠ:,0`F,0 T 020CL01 @PT粠V\,KX `P `4`0P =("((8#R  = 0 K0̃"(<  \`d \(PERQh U, `F0PU, V\,KX `PH @< 0 h,̟0 \ 0 Q7h威PEP 0 000Php0P0 S.l0TL T l L T0H H/D DP L0 Pv  \; 0 < 0  ,0H,0(8S0b0`@@br>q>@@@|@@@G-0l0 $0 #4TR4$p@0,0% -$PL4p^@F (\ 0@c T#*0 ``T*:d .R@T*00(0S, 00000R00#3,05$ 02,0(00@c T: lR (0,00 d R`4d Q(0,00@$`0 (P4 -pPL`@$PU 0S0 S P#( T b4Q(0,00 04d Q,@0 S 8 50P 00 -LDMPT  8 8(K$X PH QL  \ 0 @D@ P0P 8p<`<@ 8 S0^5O5R5R5(_5_5^5]5Xb5P5P5Q5V5 ]5HZ5P5\5Z5`5W5W5Y5X54_5h_5]5$^5^5 ^5V_ L`F0zL Z0Sp8 ? 0 0VK L `F0zL  Z0\"'`?P  Ud 'w\`Pd JRh? 0 0V# L`F0zL Z'4,<'<$00 0 p80 0Sx  8T\aH  D00L@P(08pS<0S `@@@BT@@@@{>z>h@ @@|@@VK L`F0zL Z<D b 0@  0\ 00 0S^ H0 l80S'4<,'<$0 0 R DP1 l@L0T l0 T/^p0P(P8 7 0 07 0 0`l0pPX0Xd 0P P8 < 8 0 0G-|M00\`0 S\ 0 |0  2R0 Q2B@P0 RPU0@ @@@ |ЍU p0 RpW@0 00SJQS03<X 000Q\ 0|0 Q@ 4T $D@0 ^U010!W0!P808 0200@(0@L @$0, 840p  0@ , `Tp$(ń0@p@`p0 4 01# 1 l!c0  ll 0S@BpB @0 D4  4Q40A0 0440|0 2R0C8#(@Tw 000|08"C^B4 0@ T< P`0U |0S (aR  00 cRU  0( 0 [S 3 "R< 080 0  0bC1 @000000d0U0P0S PZ $(,80>P00[P030"S @  7 4^)  P0 4 @0S80 0  04L0#04 0 @!@00 4P @0 !0084 0@00400@̠$0(@,H>>ā>>P$ R 0SP-$^ 01 0C$ 0 B0P- $P | 0  !400  0-@PL0$Q P*UEU IU[U(0S 0,$D0S 0,$@0S 0,$80S 0,$0,qU0$00gUqU 0UG-p,l A?@0CR0Mx8|P0A?00`0`0, \0 00@ R 40 0 0t%Q!\!  00 RY*PUW  0 ^@ 0@ST@ 0R 0R`  0R' 0R" 0R 0R 0R 0R 0R  0R ` R 0l#PD 0@H08XT0 H4."D H @ H0D 0@@U*0*S -PPL@$`Q00V0SQ0Sn 0Sh  :TRpp Wb0S *R(0P(@ ES_ IS [S gS. Q TRZ:Q Rt0ST 9QN )21C00@S90PPpp,P~0(0,0Sq00 0S {8 0 80 #4 0 8q000S 8 P T  0] T XP ZB0SlS@ 8080 #4 080 #8 0; 0  0  "4< 0 "88 0 04 0BL0S0c00s3Y) 00 S&0B2l 0ĀRX'  c0#2c aq00aQl0S 8!JG H800SS@SP ?R 6 0S   0p W p  0 S,0S ^* n88 0 \p,0S ^:W0[0 p0$0S   0$ p0 0W p  0 S,0S ^b:u 0 \p,0S ^|:W0g000Se 1 R !"* 0   1S 0 S,0S \#= 0 \ ,0S ^* n880 R I00 0\U n88 n8|88!if 0SC{[00hg00kI00+ n8[8R n8S8z J8 000C 0 }0 0^a , 0R  S $0QPS 000 0 0  0#4 0 0#8 0 0   R  0S[   0 0S  0  0#4 0,0S6 E0 0  0   0   0  R 0 0S!0 00 q00L0D 00pCL   BD8 8RʟR0>|>B -LP@P$`V q@0 T00?Uʄp吐"!B 0h 0 P  0 T h 0 @ |P p> -`tL\EPPUl8 H 0XT 1#D04 H00 @ H0D 0`p0Xd0x` 0\*,0lpA?C0ChQ 0BSU``0Sxlp\`0 SdTTT4aLD4A  !t@(4, 0! 0A9!0P933;ӗӅ@! 0@D00tx0l#3LPlptxpTlp:8 H 0XT 1#D04 H00 @ H0D 0lpxLQx0NUp0`0hlp= tBPPX_tPUZB UPh0S 28l  @RP 0C!@ 909hP\l P80 `Z00` l0\00 RtZ\ R80 b0L l0\00 Rh0S( ||18  0@R0`1  @9H!0900CQ lptp@ lpt0Slpt0 @hl0t \l P80 `0 l0\0R0 R S xp00c Sx0`0 lpQ`Z>>  -LPptDQQl8 H 0XT 1#D04 H00 @ H0D 0pWl` ,0l`A?C0CgQ 0BSl```\spDCD3a83L  !3, 0! 0A9!P0922;ӗӅ! 0002 t`0 BQl\t\PZ0L`0l08 `l` 0HX T2#D04 H00@  H0&D0 ` p BR` l``l`^j \ R80 b03 l0\00 RYxx1 8 0@0`1  @9H!090tl` 0CA`Rtl`l`8 `0`0l` H0XT 1#0H0tQX Q!\l P80 `X00l0\00 R XR5Q3l``-X>>  p- 0!PCUQL@`tP7l0\0 Stl0 P0`Qt08000 al0l0\0B0 R l \,0 aA?C0CR:Q800l0\0+0 RpOt0p03VQS \l P80 `V00fl0\0 0 RVpVp 01P? "# $P 00S P0S p-PPLp$`V (0S ,0S 0@0 @0@040  0R b R0q0*0R0,  #@8(@)L0D, 00 < @CL   BD`21C 0 0|` H@l@\@t@x h@p > -L M P\p` (K0@R1S  P(0 S0082(0,0S,2,0qV`f, V , `F, 0HSUV00V0S Y00é?Z00ê?40 0[-(V `@P@ 0Πh10 €0 $@B, 0A 4 TP 0`,40Xp00 L00(8, 0(@L 0(0#`D 0 (80!S  @0S D0S P 0`\ 00$P儐删(Ko404 00 0M_ꤖ55|> -LM@ 0 0=K@0`|>S T 0Q09  d0xQxA H0LQ40 , ,0 0 | \0p@-P0P ;L0`&N,;<0 @P` B[$0K8;`p@TkTkUkG-X1p0\;^M0100110\[`1@ 0T'+ 0 P\[3P`1!0 \[\1!@0T:`P@0 R P0`T 0\+Ѝ0<0 R0 P\[PXA-p\10  W@? `P! 0 00P`  ^`  P0EW#10\^ Q^ V P! 000< 000 \( +-Ӳ0Ѳ000²0Ѳ0| G- M0@SR 0 0`1V0ಐ Z > VEP 008#88#800 "$ 0 c\ 0C0PU0:0. \e0nPLuʰ 0PU00*Y   Z  0000C^ Zh \$ 10. ⨄pP0gUڔ058#88#800 "$ 0 c\ 0C00`F,4 pP0gUu $058#88#800 "$ 0 c\ 0C00sPUNڐF058#88#80 0 0"$ 0a PA~ VA$3pP0gU+= 0%r0P UF058#88#80 0 0"$ 0a P AM ЍTF0 5 0C4Ÿ82 % 2pP0gU/2 %qP UB F058#88#80 0 0"$ 0a P A T0 5 0A4D!058#88#800 "$ 0 c\ 0C0p0P Uʸ F0 5 0+-058#88#800 "$ 0 c\ 0C04p0P USF0 5 0 0@-0@P 0CU0 0 ! 9090 0@S0p p 0<010)EQ )<0803ӗӅ1(0  >> G-4@ MP '!0t`P0fUڜ058#88#800 "$ 0 c\ 0C00,4 Q*04 0CⲐ Yp 3+ 0̣` P0fUڸ058#88#800 "$ 0 c\ 0C0 0\3QU" 8#88#800 0"$ (0a"(R#A IX223pӗqӅ!0` P0fU}t058#88#800 "$ 0 c\ 0C0 0$2QUq 2  e^`a`0>8#88#800 0"$ (0a"(R#At1  QN:0TkpP0gUF<058#88#800 "$ 0 c\ 0C00 0 Ѝ0 5 0S00 5 00x0 5 0X 0 >0< 0 >0Z 0 5 0>>$>>>> -LDMh 0& p`W6@d <d @0 SU 0 5 d  \ˁ\@ 0S0#d0Yd1!0Lşd \ @ ,5 B,UX 00b0 0S0d0h 00?@T  @TQ=0! ğ`K 10\ B ` Xğ` 0Q0CC!10 \K \  000@  0S 8#8  2 P 0 0 `{3p Rʠ`   B10 \ h pP T  X 0\0 \3 \㳐43 ! \ಐ0PU1> 0 L` A010 W`` 0 P0S0\0Yil 0Tl X0@pװ 0#!T R 00" PU`QO G@2 R 0> 0 0 Q0CRA 00 B 000`0 0C BS`0 W> 00L0 # L R 1> 00P!Q@@PE 0Sc0 N!! p^L Y BL pI H K 008#\d0S P@ 0^ `(K 0S08#x 0 ` 0R(K0 rC dPU@(KP=TX< 0@-P@0S S t0 0"$0C0 0< 0 #40  0 -bLP@ Uzژ058#88#800 0"$ 0a\à A882(RpgPPŸ+0Რ08#88#800 "$ 0 cZ"0C0 0!a0P 00eS' U:x0 %`Q XLL0>8#88#800 "$ 0 cZ"0C0 0a0  ;㳠 0 0 0 % 058#88#800 0"$ @P0a\à AX 0 >0>@-0@0Sڀ  0#4 0 L L000S00 0 0000 -@L@ ^pP`A 0>8#88#800 0"$ 8 a#8S2 A00  8#, #808#< U0 0 \  0 >0 -LM`pPP00 @2RU+t&(+oԅ@010> 0 R@DT0ş  5 0 ^ !0S  W R0QS38#88#800 0"$  8 a#8S2 A0,S@ T J048#88#80 0 0"$ 0a P AZ㠂P 30 10> 0 ("(("(  0#40 P0b\à B U  Bp P0 10> 0P U ,0P&M C@   00i00S(K00X048#88#80 0 0"$ 0a P A00058#88#80 0 0"$ 0a P A tJ0 4 0gT0H . @4A0 5 0 Q꜌>>$>0 ## p-L@MXPKX T0 H `l @0D ( 0 , @P KpP@ IT@D@00B@@ -LMO- Y I* Xb$\(  O-`Q* @@ P@ @Pp$DL%T\ @pP$HH @ PpD%\TP ` RPb߬in4_cksum: out of mbufs p pgQMW@PФP``$($,Q@Qx       x         @Q@ Q x        Q0@cA@0  0  0  Q@A 0Q@Х@PP484<  Ԏ> l( 1 -LPX5`5h5p5x5555555555Ⱦ5о5D  $(,04@DHH@( (0 -L0 hZo5(Vk -h0L0S P q00P0S p3 p3rr -L@`PPT T pT *p00 p@P0T0P@iPP\@ 0- <LM00CP@ S 555555l555554娫1??3 0 008 >0  0   00#2+!  R5555 00 K0"880A10 00  Kr8 0A100 0L0 t@UU33 -3LMS`p3P:W) @P0@0PU (P 傪(KQ < @@ l, K00KIP , P UJ U 49$C@$;03$ 466cR 80  "82<8\!l\<  0 R00L @U[ U; T8H"<0S(2@0 :#::cR80 0@0 00 R !p10P1\ R 04 K04 1hxp,0d1 R PpD!,P01\ P,1R' ,4 K,4 h00@0 R p 0P0\ P0R 04 Ka04 hplp` ,PL0\ L0R ,4 K(H,4 0h `B\@r@rrt5 p-L`p P 0 Rx L l3 vw`@P000R+M00C0vL 3|o@8r$Vk 0-PSL@2~s 00H00H00 R-L@/ R-L@/ R-L@/ -L M4  @,  R uRu B,  tR RQY10P%40@0C`s0 40 * U( @  x  `  00 Ep6S 8 Q q U:*P400Cs40 (Ku, RPE @`04 @D 00` tU: PP p IP L1T,P @ 4 8rp@@ @@@a@@L@h@@\@ -QLM@|h莨p勨h刨`儨P$@zH4,tD hp@@x@(@P@x@@@ Q-L .dC@ p-LM0PK  % @`P  0{x5 0- L@P  0h @$50 -0Lp3 0-@PL> `S  `0$$ L000# $008@>@@@ -L,M` ʟPQ 0S @0S @Q9% (K @2S' %.9!  p@A0D0S, +4 3D 4 P0 D9L <)09 < 9 )TH 8 0 @ x #0DWS񟗤55555555555555555555555555555555555<555555$555555555555x5555555555555,555555555555555p55 55\555 P0spA0A0S Q ,Q, 2 8@TJ%40S %%vD T |h4%0%(0 0@%$%%( 0 4 D1?3  ?#%{ u%odj`@pT 04 Z DW p@T w04p@TC ?%90!1 H*%t$%\O8OSp<#B %$40S 3  Z p%p1?3?3t3t#0JS$Jt %L30St 2t  W <%60S %08| thKA; @@ l DW!p `@,   db^LHYgU\THy<%(as5e'><>@ @|>̖>ܖ>>>@@ @l@@ @<@@ @@a@@*@@t@@L@8@@@0@4@<@@@@H@D@@(@/TA @sB`@UA\@HA4@T@DIAo@LBd@ />'L@000 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 2 R 2 R 2 R  2P00 R@A0P0A Rbs_notimpl_%s: args at %p-(O @mmap@r_1@r_2@r_4@r_8@w_1@w_2@w_4@w_8@rm_1@rm_2@rm_4@rm_8@wm_1@wm_2@wm_4@wm_8@rr_1@rr_2@rr_4@rr_8@wr_1@wr_2@wr_4@wr_8@sm_1@sm_2@sm_4@sm_8@sr_1@sr_2@sr_4@sr_8@|c_1@yc_2@vc_4@sc_8 -pL`@PL L^8P$1( <0D $00HL!0C00wwww -tt0 @ ,0L H0 R}hX, DH!室0H1kqrrDWk2-@@Pr?0RW` 5h5t55` B`p Bp` B`RE0C`R9`$555555 55` B`p Bp` B`p Bp` B`p Bp` B` B`p @R B`p R BRR `5555` B`p Bp` B`p RpPP2-B@P00O0RW` 5`5l5x5` B`p Bp` B`RE0C`R9`55555555` B`p Bp` B`p Bp` B`p Bp` B` B`p`p@R B`p`pR BRR `5555` B`p Bp` B`p RpP2-D@P?O0RL` p5L5X5d5` B`p Bp` B`R:08`R/`55555555` B`p Bp` B`p Bp` B`p Bp` B` B@R BR BRR `5555` B`p Bp` B`p RpP% $0000% $00000& $0000DWk0-2P? @P4@54?3P0p-2`? h@@PPP`5P65?3`pp-2`? @@P 0Pjm +1PP0OxPa2 7@0L!0*4  40L0C0$Krporrrrr=vk0Ok@ Wk$WkDWkkq@ -t L@Q00  htk8hɜ0  "!œ @Wk@@@-@Q >0^ 00\R 00$0(000 S-LP`% S S 1!p $pU4W @ PH `@H `@P h`bbp@ PH `Z* ` Pj $@L d,r$rrMp@-`R0 0@PU ^ 0P@PU T0p@ЍT -LPᠠZp` @ (0@Z -LP Zp` @ ,@Z -LPᠠZp` @ 0@ XZ -LP Zp` @1@ \Z p-LM ` 0  @K P`P@ d,P% :8 ^  @ ^ 8: S@21C* "!B 0 :0^ 0 Kp -LM@`Tp*  R $ PR @0PS L   0 P  @R(K @ x -LM< \ 0P 00c80 0匢Xpw `tŸ Zy0 K40K  0 0S 40 Ro >*"*0L,  080< P @,T> 0\:00Q^ (KP 00b, :#: :cS1!\, ,8  000`Q!0S P 0pW@21C0,0,0X ` 21C0 0@T\ 8,0 0 S0@ p 0 , Kr p 8("(8Q, "*46*, (00S 0p r  -L$M$( 8 R`4 080 0 VR"PpPP%4V@1,K080K  `V 00pR00SP 00 4 $00( 0(K -LM`$(p Q,0W80,  PP p 3U00S 0S  @,K(K QR , 0 00$( p0$K -LM\@P$(`3*KpȌ$  K$K pP$0 0 $P(0`p0. . 0Ok -L⧚$@ ->0^0PL@Y`P) 0Y`p@00T*U 0U  0 J0SjZE Z pwm 0OkrL@ -LM0(KpR(0 $ '`00^*P0.Ơ\|@ : c21C!\ c050:00$00$  $ 0S`V  * Kq00$0(0007 -Lp@@`  ,P7P `00  000$0(0  P0@-@P# T!00Q:P  RR*> 00 0 bR !. .0  00 >00 >a 0Q00> 000 -LM4 8 @<0  8 080S 0 Q 8Q 6 6 6 63p(K嶘嚙嘙80< R,` T: `@aQ40pPW ^ U:>0 >0 S00P`8< 0pdWp! <00S<0 @8<0\,` pT: @gpW PV:`e PU4 00Y00   ^e Q:>0 >0 S00`8<pd Wp!0fWp!U <00S<0 w @`8<0P,`k `gpWPU@ePU4 00Y,0  Y Q:>0 >0 S00`8<pf Wp!0dWp! <00S<0 2 `@ ttϘ 0Fc0 0 @, 0 : 幘巘r@@@@>h@ -LM@dPQ $3\ b  S] 2"S0"mp娗ᥗp1E埗p1@8 嚗p1 8啗2XRR0S Z$ t"10@T ``"$Km~P2 RJ D2D R ,, A0B%@gZ$Kap1  \Y 0!!dp PPFLCZ2 : Zp18l9p1 0\4T$Km/H1 1R0 \a0@PLŠB%0P @`p1 c`] $KmA>@r@4@@@ @(r r8>@@=rr0r><r@@@@$@X@t@@8rr@8@H@@h@l@@ 0-<@L`40P 0h1ld!0hrr-0 .!  !!-0 .!  !!rrrDWkrrr@@-``60`t`6 !!@@- 1 xpxp`L! 0 p?`L0 !@Ј! P :PP/ U  Q U  - Tp!W R \!P Zt x U W( Q U0  !@Й! p? pG!@- ?c !iDЍ8joReset vector called, LR = 0x%08x-DMO- @0lP @!1 ! ,OTiDЍN  0O   ! -- -iP00V00S 0[0xK@P00V00SxKDP00V00S 00x1[0xr@ p-LM@<8P SP`: 0!10 0  ($400S @D ݔHڔn廕8< tєlΔH \ɔ 0H”@D>@>@@@@@@@@0@@@@ @,@T@ -|1LM @ H`0SC 0 !41vPL!@  0`KhI V&: pN@ 0 P 0P P 040S" 0S0 F/ |j  0`J\0 R  0?   0`J0kqrL@r -LML@\ 00 H  -LM \`Pp@  0 `0!L1 -L(MCpH #D 000 0, !D 3#P3UPQ\LXpH0H XN@# D :S1D ` 0I PU X H(KX080  $ѓDH 0HN@t T*2 R0S H 0R6BS 0"0S0C80  H0D4 00 , 08, 400JH0&R $20S 6S 2 "0S`` 0 P1 R0 @ 00@ P<  X E80K0DH 0 P RL ; 00 H X@0S <0H0w<  0KDH 0,< Q <  0 R80 H0D4 00 , 040S 0S0 F/ t) 080 `#LDH 00rkq>rpo|@r0Ok00~0 0CS xP*W8@0Sb]p 0`r@rrr@-@ 0 @@00D| 0^D@ L0H000L0H0 0404550055 0404r-@P@0S 0S0S00 40C4P0 Q L0H00C0CL0H0550C0C55r@-@@\,\) 0Q0RD0 0D0 0@0 @"  4400C44 0Q  L H0 0CH0L H L0 0CL0H  %5 0C5%%5 0C5%r@-x@Q0000  00 0 0S00  0io- 0S Q000000 0 B 0S H Q 000000  0io@-0$,@0S!*4*6 ,<10P  21C0P : #P 0S ( 8. :(#8 #:T000 - :8LPP# M Pp#7 2C 0S0. :#5`/\000 0000 00S@pP\ 0R $ Kl$ hp :#5` 0@H8rxrrrt5 -,0LQ  0@rr 0-0LM8 @  0 RP@8 0 Q X1S 8tPpP\ `0R  KP$ hpH8xrrrriort5r0 0 ,rDr-  0 0 0 2 100s00#:$ 1  !!:10!\ 2C 0S0 0 0200 020r@-`Pp !:H$$X 00S | $:1 0P  21C0P :#500C0 p-LM !Q:0Q*0b"!B10b0 @ R  R 0S0P 0`0 0`K 0KP @@0| L000SKp`PpP\ D0R  $Y hpqrrrt5 p-@LP`zT pphP$ !:1  T0 R 0S0S R: #:tWk 0-LM\ ) \0> 0+ 0!0 00@S8hPpP\ L0R  K< hp80Xrrrt5r0r p-LM0!>00P @+.  0;>00 0+. R| 00Pxl`pP\ P0R  K@ hp 00PxrtWkrt5r08r@-X0@P R 0S \ R8r@-X0@P R 0S \ R8r00@-0L@ @0 000 0P0P 0 0 0 0 @0 0 0 @P0?00?l0 0lr|r <rHr@rr$rprr`r w6trpE6rPrr\rXr(r0rrxrrLrr 0 R 0a B0r -LMP@ D 0 S S 8 < 4 \3\#0 <0 P34 080 >0>0S00 m <>D 0+ 00)@ 02@ @RsDD JZQ D0 @46ZS#PP @ ): RyP 8#8ZS#;4D )6?> 1@pPU@" WU>0002 R apP\ 1R , K, hPpU@DJȌZD 0(K 8)6 D;#;  1 0!@QD0:JD0 QpP\ 0R , KC, hptPpP\ 0R , K,, hp\0\ 0 <0 P04 080 7 <, 4)0'Xr(rlrrrt5r0rrxr@@@ p-``LM^P @ 0000@^Kp8r p-`SL@P .:8#*l! #8\ 0"!B Q 00S:#50 600pՍr<@ p-!:LM@ P0S zP[ :#l1L R@" L00L!00S@aHx$!$1 0S : 00 00S`Hxx`pP\ 0R  Ko hph`pP\ T0R  KDX hpblrrrXr t5rd@ -L5 0 `gohr00 R$0 Q! 00܀hrWkWk -0LM0S | 0@T00 KKhL00.*@ @@@c0@hrWk0OkWk 0-0@0 0LP$0   R00 Rt P ` `000@0  0@0$0)$R݌hrrioio@ -3sLMP00L 0, P U4 0So`q@P E201^ 0"!B  APP0 " !B 000 Q P P⩋ UYZ @: JT * P \J▋T:LbLRDDB$ :#5p\8 Q8>0( &#&R+:0R(*0a"!B10b @PP 0T0U 0 D  D 00)G#&R:0R: 0a"!B10b @PP 0T0UD  D 00 0L1 R <1p01P1\ 1R , K, 0h0p 0j0$  0S@ 0 R0(|0h0p\0PH0\ `@0R , K0, hpqrrt5rP-0 R0P  0S 0S  R00L00 08   0 000`gorrt5pWkr -`PL 0S 0Sw000pCWp 1VV 10S 0 V0 謡0s1!VLG 10S 0 V? *X0  0 ( 0R10"my1 R 0S 0S  R0000 0   0 0 0@00#! 0lP0  00#!80$00rrrpoDWkr4rforrt5 -LM`t PP X "&R :0R*0a"!B10b0<0 < p@@@@V  .Y g (K**(":10"P 2C 0S0 Y : #50P4 80  4>0S< (#&R:0R*0a"!B10b< R8 D0< 7\ 0  \ @ @p%R5 SH0SL  0R01X'0QUD0`0óD0`D0`] P` < 0@lV 6 Z0 0 4 R000$ $004S VV 6 RR 0RO 008 00S <Q %Ry5S<SH0SkL R0R01&0ATd 5V2  <<<D0`00D08V  @ @D0`00D0W@d <D0^ @[008 Hu00S_,5 Z 0 *:$  0S@ 0S tpP\ 4R , K, hp}<0L < 5< D0`L R225S&&4< 0S 7 0S4  3L,0SW 38RCp8P\ 3R 8, Kl8, hp  @ P@hH0S- (3((W0P00 0P V 2 Z20 0 \ P @ @p%R55SSH0SL L R0R01H"0ATD0`0óD0D0` "Vb  @ @D0`00D0 P`40 0S\  0S ^ 1Lu<<D0`0D0%@ v@Pp P I 0!V    <0< @@ 0PSt `r40o Wm 0Pg 0S^ 0XX  @ @ l0HK 0S H0X 00H0~hrqrxr>rrrrt5@`go@ 0-LM\vP0 04PT@:80q,0 0t8forr P-LPF 10S 0Aq@p`T P 0S ` U  \`PV \ 0S- 0S0S 0S 10#U@T% 0LT# 0D0 0 0S t0X 0S T0T0000H0Prrr -LM0DQ8@8p@y K@(@0S1[ a A Q88)`pP张\0 S ( K( hx@p0[ Q pP\0 S ( K<( hpdrrrrioiot5r -L M4 @PU 0L04 P0H04" R 0 2000 00  12C 0S0`= 40C4 : #%4p0C40 01 R 1T( 1 R$ 0R!  0@\tTP0 Y@0 T 1T,*(":10"P` p0P0\ 0R , K,, hp4 Y@@ 0S 0 0S \040 @H0(K0 0S $0$0 @rrrr`gort5 -LM< @ D 0@@0 TD n @ @0 08 0 40 8 * `(p":1 0\"X 2C 0S0O :#50QP `F @ P "`0 0P2ZH  < <L0H 0C L0H 4 R 0`00Sc 0S|  0S 42HPU 2P R)0S?  0SA@T(K 0S_ H@P 1Z < <5%0C 5%`Qp P\ H1R , K(T , hp0S0S 0(08 0S  0S 0LP 0S 40S l0H 0S H0XP 0S $0X0Pxrrrrt5 -D0L0 -D0L0AQ6666666? -L M0D S:(K "I0D@ Q጖K#:8#*at@80 TH 8 Par0f0 R 0f0p,6@T) @T$ 0$"*>!00PQ pP\5\, Ke , hp@T0D6Q0D4@#HD5p:#:S,050%$PQ,K Pw '*(":10"P 2C 0S0 ,00*"%0㘤0@Q*0x4P :*#:"*S3*X4X$$@Q  0 P< 8000 %*(":10"P 2C 0S0 000*"%0㤣0@Q*t#0@Pp?t30 P<0 VP3X#$Q,K* P p8 0 P 8, <,!*(":102\"w 2C 0S0n < :#5x 0Q40 c<*㧧0S p<P\ (2R <, K<,*hp  8 21C <0f!0001 0+ !;0 0 P 80,0 0K PMppP\ 1 QR 0 Kf0 hpp4P\ 0R 40 KL40 |0hpp)pP\ L08R , K(1, hpTrrriort5holqxriolrio0 )Р)0 ) ) 0-0Lp4 40"!B P* P(ڨP0 R00 0l1R0C00p1@C\PU T 6 @^@D H0L@0,kWkWkvkWkrr -3LM , 3cD#\0s C0S xC0S ( ("$PxL30p82 嗄P@ n 0Sk @Pxt OKD2~Ϡ K,2 ( <Po00 @pP_"0S? 0" 0-LM0PS Ku@P K0S@00p @  0@@r p-00L ` HP`N@^P@@eN@ 0,0 L 0L0H pxr$Wk@ -LM00 ( H >~p@g00^0L PU@`H@ $@K,0  U$ 40>ZUzjc KYx$Wkr@ -`1LM0800 0(0K wpP (KKfpP@0(4 P 4 Kp0p , 0 ~pP0@@ 0_  Kp0 lpP0 00GH# 0-LM  $ (0 L!\ + 0.Lh 0L!.@ L1:40   4PL1L@E@0L!L Q$Q( 0800` E`0(0004 K00r\6DWkA- QQQQQQQQ RA- 0@P`pQQQQ R@-M Ѝ@-MЍ! !P: ZŒŒ#! !P: `B!,aB 0>ZJJJJJJJJJJJJJJJJJJ }J xJ sJ nJ iJ dJ _J ZJ UJ PJKJFJAJ=Q:Q:Q:Q:Q:Q:Q}:Qx:Qs:Qn:Qi:Qd:Q_:QZ:QU:QP:QK:QF: QA: Q<: Q7: Q2: Q-: Q(: Q#: Q: Q: Q:Q:Q :Q:QA ? QA ? QA > QA > QA = QA = QA < QA < QA ; QA ; QA : QA : QA 9 QA 9 QA 8 QA 8 QA 7 QA 7 QA 6 QA 6 QA 5 QA 5 QA 4 QA 4 QA 3 QA 3 QA 2 QA 2 QA 1 QA 1 QA 0 QA 0 \aBC`B0QA 0 Q@-: R (2 R R -PPPP RrPP B PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R- RP1P P1P RrP1P  B P1P B  R010 1  B R0q0`0q0`0q0`\0q0`0q0`0q0` R 0\6 R B0-81, Ġ%̌T$\D#L0P  R0 Ġ01#̌  R R B0-81, Ƞ%ȌX$XH#H0P  R0 Ƞ01#Ȍ  R R B0-81, ̠%Č\$TL#D0P  R0 ̠01#Č  Rp@-@P`R p0-@P0R0-@P \, 0L 0l4 @P0R0-@P \4, 0L 0lRQ@P0QP: p-QLM@P` S 0V pxpS`@rP`&0-@P0R0-@P \, 0L 0l4 @P0R0-@P \4, 0L 0l51@P0 p-QL M@P`S K 0V Kp  Kp K@rPp`(Ƞ 8!"(,Ƞp@- @PpS`b `c0#3 Q. a l^#(8.(030# 80 (3#0"P@p.8BA Q ! C2Q -L@P-S'pU#`S PW0#03d g0U f  e00#2 S06"l P@X t@P` r0(@pP@-` a@ \B@-@0@-@QP a0 120^0 0100 -L\M@P`p d5w`^0p(KS P  0W p#83K8#8ẃ[0 X$,8`K("X&3KK0<AZ0@L0"[[[2[x h[[$[3[xhWkp@-c@bP`T !L2pQ:P: -LMz -L MKrK K0-@"P#040 $ R ((0"4Suk40 $ R ((0"4Suk 0uk 0  }o -l LM0S 00LH0H@ @@@0垫P ,0 $@rioP>wkwkyk C@ P0-L 1R 1 0xA00hQ 0叟0T!S S00S@ 0S S00SQ00 R R 0 -R R0Q @a0AS066(6 6666666666666666Xp 0Q00@ @ + DSBOorvkvk@ -LMahPEAp, K00Ko:p0嬧,`.VǟP@fwǟ$F@`xǟx 0E`PdpD0 T0b#6`P0X7 @T:00C)0T`0*V0c140 ! I@9#9S &@0^:6BAD@L*t20 1`0b*V0PX} I$ITyƟ0 C\ fs:00C *00 C\Ub:0ܥ0C05 *ş 0B10a\0tJ:0 0C0t5*`ş0 0B1\<0a03:0 0C05*ҝş 0B1\0a0:0 0C04*㻝ğx 0B1\0a0:0 0C0l4*㤝Xğ 0B10a^0:$4L*厝#SA E2T PC  Z @C0pßS@ ^㘣N@PƠ`@&l0@o  0e@eŸ: @^: @W: @P": @I4 9@BhB{o  @P: 7TL2 $\2 0<Ÿ0>0>0 a"&2 !A  $ t1!1XL4T X!X1X T1T!P1 x !0 4 " 1 00 K;0 @|0 (Koomo@yk@rr rvkrr4@rrrrrrrrrrlrC?Tr_"r rP>WkrUUUUrpoX6LWk6HWk6XWkrox@`@@ -0L @R  @'0  "!  nnthn@S <B? S <B? S@|n4Wk1k@@@@ 0-LM@P |in)$Q%8`P:创P0c 0KPP$0$Pn农wkD@vk @ -L(M 0 h;@4Wk -LM$@K0P(0$p0DP `WP@ V 00;000  $K(P(TV0 @0@,((P0 009000>@@\@@@@@,@P@8@ -LM80,$ Q0 lh@p@ p-00P@LqT0`  0 lp0D0S 3S@p 0l5l20940386<5 0 \1PX!X yl70S9088;<: 01@ᡚP&>Q @ᗚP phXl 0phOlMl20 @ Cl@lx; P(;PUPp p-`PL0; @T R0000 0   ;p p- P@`L;0S  R0000 0  ph: 0-LMP0 K@0  : R0000 0  0R Q : R P0000 0 RK06 p-`LP:@@D@:t3p p-`LP:@@@:Tp -`pL@P PP a0P KPP  0-@PLP 0c:Pm:0(0S|Q(0S|Q 08 R0000 0 0  0 0  0 +: -@L4:8 0C8#88 S :h`4 0-PL0@ 0:0S000 0@@090h} -@LhL p- P@`L90S000 0@@09ph4 0-LM0@ PK00l0p0lP9l0S H0 5l0S9p K0x><6<@ -L Mp0`$ K@$0 9  lR0000 0  0R00|Q P P 0S0SP00000PP P 8P0C8 8S P0 ~58SJ9$ R P000 0 0$ RK6D@ -LM@@90S ,0 R50S h9L@ -L,Mp00PK@` 0 pP KH@K$ 0$꘲>6 0-Pt@L_0hr -LPpX  ``@P @C0 `P 0tpr' -L4M0 8PK( @`p $KXK  0@p P @P    a,@Tfꄲ>6 -LpP`@P P 000 00P 00Cp0Pu -LPp`@P P 00 00P `^@0V01#Z 0 pzPM -LPp`o@P P 00 00P `5V010# 0 pSP& 0-PLM@P P D0U<0 0 0 P07P 00u' 0-2P LP+@P P 00000 0 P0P0 -LMP `pP0 @P P 8 0 0 0 pP' 0-LM@PP@ 0$ :㴔      ߔ$  ۔@8 0-PL@P P 00$0 P0 P0' - L@P  fh^X@-  \7 -PLu@@zpp\`S^T W 0m  D r -PLpu@@x``L.^ T V iD  r -LMp`H@P^P  `@P 0>KrL6 p-LM`P@@^P  P@ 0@>Kpr6 -L Mx@T K\ 0Tx@@`@`8 4 0@`Kh `0jot@r|@r -RL(M000 `  L0 \apP  PP D# 000 p 0@T08 <0$@ Y0H D0  08 <040`>0"0H@Qt0@uL  R  `pPm  PPe 42 0a0 p 0 @ @ @}P OP\s0@,0  Y0 040  8 0<0 P 0 8 <040P J` 0@,H, P`0@D00P `  p4 0@ P#D p<P80` !(< 0@p#L4P` P`  `@0s PH K `P`(KY0P`0P`_P`_P`_ N> -L M0S` Rp 0@ 0SZ" S <00SO >0"0Q] 0+PP7 04SP1Z00 00S= ;<00S9  R00 0S 0 480 00S$ 08 <04@P(K  0PPP"BP0 SP R00 0S 0 480 00S 0 480@P꾳> N -LPp`P@P P 000$ 0"U0P  05P -LpP`,@P P 0000 P` %%%Ġ_0 P0pP -LM0*S$ SD AS S08 <04@  (0, $  S (S S |e08 <04@ 0$ $K0 480 @ P``0S<0S P` 0@,P (` ,H`P,0Kp0@PD0` p0@ L#D <P`0@(!(D#Lp4  0  8 <040@ -0LS@`LtPP `G ^00 R00 @ ` 00  0#40   0 0`P=00;000` P`70:0 0p0 p700( R00 R 0(P^0 00 0 000000C2Cp <^P 0 0  `P _` -0LSPpF 0SpB`P p=  00 P600;000p PpP0:0 00 @ @[@B Z (0S6X6666x6060[0 R 06P ] ]P p 0 00[0$ 00b $0[ |b Y 0(k0[0 Y 0(c0[00[0 bpPڿp@A 0-Ld\P P1\ H1\0 Q@ 0- LP|@ 0\ 0| 0\004PP 0S0SP40044\040 R00R@-@  R R R R R\000QA S S S S SL\00\ R*R Q 00\  R\R R R 0B0_S Ĕ\00 "#0  0@801000  0  0  @00000C0S0G -P@L ` pPp@ 0@`p0P  -LM t\ A`  0*pP 0p#\(K  Z\, , 0pP , \@ *DP L ,0 @ 0xlwk -LM &\A`  0pP V [(K0 $P \  0pP8@0dS,K 6r)[0` S @/+0[0 A RY, [4 00 < 8 YUYp00P P P 4 <0AQ8 0xX [plwk p-LMx@PT x $[>0 0`Q" 0$ dP 0ă \ #\ @ 0S@ S Q PT $xhH[UP 꾳>lwk -LM0R pO , 4 P`,  VP- 0`S0S廎8 P 岎4 P婎0 0  84000P 0R ,P ,(K Q-LT`,@A -LM< 0p,0 @P= 8`P \ß\ ^`KD PK=@KL \  0P@'`2 t "`"20 `x@T ] 0SZ 0CS16x66X6P|20  P Xw6666666666666666666666666666666 6_x 03 0SP U0S _x 0PS@ QQ 0A0_S3|_x P0@S0, 0RF(K>0@!08_0`,`0SP_x0P @R_x _x _x _x ĠFD꼠B긠@괠>갠<ꬠ:ꨠ8ꤠ6ꠠ4꜠2꘠0ꔠ.P`8$o<@DAATAAtAAAAAAAAAAAA\@AA>|AA<@Ah@A@AAAAAA @?@A@A@A@A@A@A@AAA@A@A@A@AAA> Q-L@=_TA -LMp`P`& PP` 0z@00@0@L4| (0|`庠p000 0S P W``(K0S 2W02 : Y@P 3  <` : t:YV W`2 |000 Q <0 @R yRz R   pwp30@P0S8p 2  xQ xP Q R 0S ! 0,K >0"0Q_C 202202  202,04@KS!2$022003 S2ձ02ű0 4P <pPX 80S 2 7<1 -V 1<`2 `  ~X1 -B\`Rq0Sm$ P 1!Y2:2A2<2  P 0S:YP 000   뼠 :Xx^xP7 V50 Re⋋P`< : wP` X6lwkȳ>>T66 66C@0@-@QP0 2T?\0S 0R00@ -QLp`@0P/2^,?\0S& 0R#@P 2`,9`P2 00 0SxP?`85 -PQL`0p$2U!2S 0S @ HP 0@ P00P00S 0S  -0`L2SpPP@ P00"P00S@PR -L M P`0pQP  P 2 L 0S@ 0S 9P@(K>0 !0QXP 0 0P)08 <041S,0  p @,0@S 0pS Z   W W꾳>lwk' p-0PL2`S@2@Sp0Q 0Qq0s q0sF r  r 0Z Q 0-LP@{0h/ 0-L@[P T,P T0Z8070 -00 LQP`p p@ 000P @pR -3LSP`p p@ 3P@pS0@-qr@P\^  0@00@0@0 p-0LM` Q08`000 2S020 23 0S0 0"\03S0 @00h\040TP H\xh4\00$P[4WklwkAA @t6BAAAAA0"200 0p0C0S0S 0@ <0= $$R 0A0 0 -L`Ppw@P P 0000P0 P0VB000%$00@0P0p YP, 0-LR@P P }>0GP0 0-PL@@P P  00}.A0 P0/P0 -LpP`&@P P P 00 00G0P0p`0000 P N -Lp`P @  0L 0'̠''D;0(T @0pP@@  p-L`P@P P  0, 0f0C P0`Pp@  -pL@` UPP p @P p  0 0_0C p P0  0#$ 0 pzW 4U 0$ R pm0u -L@` UPP p# @P p" 0 000 R0 P0  0#$ 0 npAW 0 $ BQ p6IU0u -pL@` {UPP p L@P p  0| 0_0C p P0  03 0 "4 01pW U+0u -L@` FUPP p# @P p 0 0p00 R0 P0  !40 00pW00  T0u -@Lp UP @2 PP @) p$00 0` S$t77T7777778777H7[ 0  00 ;0@T0#30T@@\0 @00 30 0  Bv0 @:0@iT00 [0 0030 0 + @TT R[0 0030 0 + i@<T : @\0 @00 30 0  B+0 @:0K@T0000[00 0""Ġ " 030 0 + +@Tr03 0 "#  0 #200b[0 0030 0 + @TO000K[00 \0#? 0@= [0 00 ;0@T-0#30 !  000  00\00    0 :0@ 0u -L@PT S`P e @P \ T0 0x10 R0 `0  !40 00mXDP@hpf0T00 T"" 0T00 T"" 0T00 T""  0T200 T  0T#20 TT T(0T, $ 0T T T8 T<040 TTT(0T, $ 0T@3T 0PT=S0u0S 7 7 7 7 7p -Lp P`5@P P l 00 P ` C0W0000&4 0`P p-ML@`0 PPP0\3 : c 0PKp -L M`S@P VP K Sp PP% T%J 0S0a0a010 @ B Q0B RJ 0 @PRP0D@T ;J 0-0@0@PK@2L  0 0 S:;;S @0S 0@0@00cS -LMPp@`$@ RP   $0K `@@@@]P $Q 00  00  :R K -L MP $ 2pL@1eR`P @+ (K $0K@@@ p*@P$ R@ 00$000$ 0S (0S T0 @Q K0 A@ N -L,M@`,@ pRPP @I ,KN 0@@@@ p@P7,\: 4 0 < 8  0K@@@ p@P, R" 00 0<0 ,  08,0 040  ,0 0Q t 0 Q@Q(K@Q(0 @Q N -L M@`,@ pQPP @( 0K ,0K@@@ pr@P,0S@ ,0 ,   ,0 0 R T0 @CQ(K0 @ N -`LepP d0( 008,d 0>40" P T ʄ 00 @Ą00 '7<6 phI0p"@ᗥ?"wk 8 8-#TL%`5@P 0@ .00p9 p5PU 90.0" "2 *   2<2wk Q- L Q 0 @00w0S A  - 88LM#DP$T5`P 0@ /p0 p9pP@0T X,@ @@S 2Tp 0, 4pP202Q M9/2T0-.2  Pp W T .2 02 .pP2T02P 2p02 .Zp0 [wk 0-PL@V9g09087 p-`@`0 S00Ɓ0,( L0LP2  0\ 0Q000L@S4  (t(00X0ph96> @76 -LMK 0 K> -P L d M@4 &4pP 0@ /@$K 9T ,9T| K0CT 0CT 9T 0S@< .9T '9T Xl9T :cMP ` 0@@P&0"  04"400S@  L@T @ MP @@0@@P0"  <(4"4!<0 2  04"400 S0S00Lr@P 0@ {@d@`0F,S0L 0P`@P 0 $ R !@0xLo1@ke/&@e +@` &@[ s@U 3T D3TK@PJ@ 0@,@= Q@62T 0T,  0@& 0 @t20S @ 0P6@P b:@6(2T 1T 1@ 0@1T 1T@@ 0@P00S 0"  04"40  BR !A@K 0_@00 0S!Q0RPZ!  00002  <4("4!<0^LZwkc@c Q Q@c ccedA c@qdQ ccc cmhdpd dc c c cQ`dc c k~rdA@-0Q0 ""D0@ 0p@-0Q""H"T *(,d @P` pA-0Q#l#x# 0""H"T 0@P `p0G-,MLQ.#L$@( #H#@@. 0@@ "$"h"DL h`@ ##x#T0. 0 @0 @0,ЍR\ \ 0L0_S BR00 0-PL2  0@P  5000 +0C0 P0 000h꠆0  -LM@PP<0 r,8 8#)"Re0!R8 ` `( MP@ Z ?0 20 Q, Y4 9p00 B A@0@P4`0@P/` R.+ Y#8 `P+ ,0@ 0ʌP P@@<@ P 0@v@IT 8 00(KQ 4jowk' p-LM@`  JPP @  0`7@6Jx p-LMP  `@gJ@P P @ 0PPP @Jx 04<S-P08 <04 1 (0, $! -LMP  3JP=  0@P`P 0tIZ   JP& 0 @P`P  I0S`W S Q 0S QP-` ` 0-L@PP 0qP0hQ -L M0   ,0 LIP * pP  <`Kk|@ a0 P<0K0 K2 K1 K;@K/PK -p1@0 P@ Q@\ @ dI@ , 0 RA(K 0@,Hp`0@ PD`p0@ P #D p<P`0@!(p#L4P ` ! 0 8 <041 #000000'$o ND> -L M0  pLHI`P  PP  *@K {%0*0K  000 0`X H K08 <04@0 @1A 0(,0 $00! N 0-0L> h0 @\PP 0P1S1S0h0h꾳> -L0M0P<0 ,0 00 40 80 pPE0EHP Pp`' @@K P 80K @@@PP @0S 0S 202" ` 0SYPp` `H@ 0 0S<0S< 0 S  S  S (KP000~HP Pp` S  S  SR0D#P<3 0 0 0?P0@00 W00U ? V0 `0S<00S S_ 20"S  -L M0,0 `[p-@ (K 0P@FP @D D@ 0K ,0K @PPPi@P,\@  1X ! 0X  AF^% ^00000S, , 00000000S 0` 0 @08 0 l@0Qlwkvdud@ N p-LM@P $DF`xD 7@L 2\ -$ 0P  $Ex  \y$ExpEA -P L D$`,#,pP 0@ &@  2V -2Vh <2Vm 0Vp R @&2V 2V 2V @ @ 0,@T2V L2VR82V8  2V_ 2V0"0 @1VW 1V e/"@1V! :10S @0 /@P  3@Px1V@ /  @0S<@2 eX@ 0/e/x@~ 0!@w Q@p 0 P@i @d%40$ H )@wkrdAud@pd Q Q@qdQ`vdhdtd@AedAmk~gdtG7 -LM  087tG7 -LM) 087tG7 p-0( LP,@l` RDD7\D7`C7`C7C7LC7\D7`C7`C7C7 0SH0C 040<S04000@;000 $)a0F/-@ۚphp04 0 00Cs 0 ph<00 $)a0(/zp0F00pha 040$ <@ DP4$0<@0p0 0 -LMp,`0@a2a , [P0 V 0 0D(040 P @0@<0 8@ 40@$0<@K0\0P4< 0L 20  YC 0@Q Z  0 U0$!:0 0 0H0000< l1 p00@,@l@.0 00 000. (K (Ko ;0 00H00< 0 p0,ls.2 0@Q  R0S0  S,P (Ko R 8#8 S  0 b0  G`B7 p-DL!88#P!*`P 0@ 04000< ;00@ @͙uV phr$02004040p(p OphZ$@ᩙQwk 8 8-#DL$`)PP 0@ @$0p- )@T0 !22 022  F-$  2<2.2wk A-L@Q@J7I7(J7I7I70 0 \0   H 8 0@00do - 88@#tLMP'E)`P 0@ #P 2 # P0 Y-PP p0W Z,p ppS 2WP , 0(PQ0"42 02 2-#0" W-.f208#82.PP W2"02P 2P02.b.^0 wPwk - 8 8LM#T%(Pp 0@ p =# P0" 0" p\  * 0P 20 Rp(PT00` @u(  0 *, 4P,wk 0-P@L(-Q0I-0pJ71k -LM`2`x2t"0 S2p<24XS2֡(92ơ ^,p 0,"0Q000NIG" F0" X 2P P@C 2;T@apAO0 00 d0`G0@G8GL(@K t "P(0S!  0P' 0<- K o @ d A0 t(0 \X 0ePDF<F@lwkt97> @D76|EAud@1k*7vdEAEA -LMK 0 Kd> p-2 1C`L P hR0000 0  000 @TphX rkq p-P@ `L0S R0000 0  ph 0@p-LP`SR7R7R7lR7lR7xR7xR7\@0IPP JaP P/ P `NAP GP #Ph AP Po HP }U# JxPs -U .U ,0E@Tl@i1 (0E0S-0E0S-U TTxpW ~0S V> P b#P AP.U,U`` /U ,0E@TR.Un =9'P =5'P' VLU* .U2 =+3P ='4P5 T|0,S 0Pn .UU V/U?P{@ mw uUP \Pq,0E0Sm?iPPmi ?`PAP*@:@P`j 3P /@ +'{Pl@#P@\P P@ kHW" 0(S( H P "`P00NPP@PV@\P`i~N`P}@PyV@\P,i@wNpPn$@P @lOP OPuF@qX1Pphs j8P  8P+ MP TP TP TP[ 48Pm $8Pr 8P} 7P$ 7P P67P1OPg,0;P*@|`&x@uT q@nT!j@gT"c@`T \Pg H0E0SRPNJ Pf00LUAP@=951-)%!0fLU?PfLUW MUo LU !P@* P}exL0EpW0E0)US@@+U*U T+U*U0Pb WZ?V Pe00OPo]PkE4Pg&PcXPd^kP]@P PUPQMIE MULU NUMULUC NUO@-`P ?)jP|b=#pPlbMULU6 NU4 8X1Py F!P4b v0@Sa bP ?jPanV@\Pa @@XPaH 510 Sa$YP +VR P0La0LJ> P> @L10Sar    10S`g 00 S00S`Y rFAGAHAIAGA`FA,GALGAGAGAHAtHA8HADHAdHA1J )HAHAGAGA|GAtGAGA\HAlHAGAhFAFApFA$GAFA?:Pb5AP P 1P* P,c 4P1@* Ppc @Pc-@{?wP0c0=lbP8#@hPd3 bPd5\P0d [VQP[N@RPVN PddQ=H0P =D1P@ @/P+fX %*% P!4fJ rP@fx 3@PLft qPjXfp?P@|f% /@l phpf b yAuBf ofG0P=fCzPg@ P6 g<\@? g6\@g 4g0 0,0NjDko@koEko -< o;<@jo8IAHIATIA\IAhIA @ -L@M䡟X 0X T )0K pi1D0 P D  L PUN 0SH I U= 0 S2 R@ )0K@@ @s`P9X[TP P0 @@K iX0T0 @ 8 SK4 P L0 PR*H PL U 0SH D D0 0RP D0 (KD0 T' rܷ>`7S72P-- -L|M0pH0 @2D@ `{~G@` pG< "8 D`H0@4 C<`N8`ᒦ1!oHafAL 僁!P \ 儁!Qd 偀 ጀ ` 兀 ጡp 匀L X 兡t 僠ᔠ 匀 唀P 匠 \ X厐`d 0h t p0 x 倀H0 匀 hD0 0hT0 <@0ijh800hl0 x40  0h|0 0 pcT 2l|@PBRb0 0 P @`0K/0K.K,K-@K+PK*`K4 (0K`(00K`c"(P@ P @wP 000:(K00gfffpIA -L!H L P 4 L P 8 @P < H@@D LPp PP` 0 00 IA p-LM00 KP@4 `0K(0c K"(@P @P 00 I:Kp00IA p-xLP@9:0`00 X04 @0P P0D H0H H08L 8@P`  phJA7p7,}7$}7x$r 0-LMP@K\dPK0 p-LM@ PK `g P@ ߫0 Kp -LM@0K 0K @TK 0-L@KM000dP0  `0K v0K 08 -LM@0K 0K @"K -LM00p娡P`%K @ 0PQx0p1x R꠆7|7|7|7H7H7770x0`VDP00& K0P,% [R- R&0[-&0[S*0@d0h@%[ $!B30b 03dh% [31C03Od0h@% [31C03Od0h@x00x0&0[S dhDxk0G` p-LM0P00 #\ K0b`P6[  !9 0 600@ &*gl@ <%g08A@@|aaH22 P@o 38@?TL8x\@800x8x4JAHJA$7 @pJALJA -L fp3\HA -QLM0P@)0KQ0)0K)4 `()K0"(*Kp 0@` pP &2*[0 Œ4 0("( 0*K`` p 00(K Q0 0)0K)0K p-LM00P`V000K0K4 (0K"(@0K @00[0PKp -LM0@`SP  K0 `K0 P0f"pK0P P P0 0!Kp PPP -LM0`004@P%K&KU0L00C0HP%0K%0K4 (0"( p 0 pyP P&0[US20T0@808 <040@ D08`(700$K谉777JA 0- PL @4P0> 0- PL0@)(0( 0$0 0P 00>̍7X7ȍ7$7 7 0- PL0@(0( 0$0 0P 00>ԍ77<77܍70  0-LM@TP(Q*0R840D d00 8 -L^8JA -LX8JA -LR8KA -LL8,KA 0-N@0@@P@@eLB0 0h虡r0Ok -LM`\XVU*0Q`Q 0`0 . ~N,1@pd֣PP ? :#: 0T05*JWZ/ "Z,K00K P`0` 0L000S pP\l0 \P ̥, hJpWZڲ(K0Okrrrt5 p-LP`/P pN@@N^P@@eᇯ0 ph0Ok -LMp@PO>00>N0@!@`dUPP > 0d 0V05 jVJZ/  㢥Z,K00K 嘦Pp0p 0L000S pP\0 \h L, hpjVJZ0Z(K 00b 000Okrrrt5 -PL `,p ,@ ,7$rTKA808 040 0, ,0 0$ $00 К7ؘ7Ԙ7777ܙ7 R!800P500\!400 -LMP@ p 0`40< , P0 S 000P 0# Հ%$    0-LM(0K@P K00P  "!4 (0<\40< KP 0!!40< ,40< \00 -LMp,0K`P0@  "!4<,0 \4P0< \@0  "!K 0S00xk0@-tQt@QU 0R PQPI R0ĠC00P0 R 04! 00 Q0@ TP 0R 000R000R000R0 00 RT0 , !160 !!0!r|!r!r!r06@0 - -L@@00S0  "!!r -0L  "!d0@S s0 S #0 000 R㼓ʀ0  "!᠓ 060  "! 0!!0!!  !@160 !!0 R "0 000 Rؒʀ0  "!ἒ 060  "! 0!!t0!!  !@160 !!0 R " 000 RO 0!!K0!!  !@160 !!0 lQ d! 000 RP7 0!!"0!!  !@160 !! 1 6 0 !!0  "!ᘐ 060  "!0  "!T 060  "! 0!!xk!rh$r!r|!r0!!H H160  !! 0 1!r|!rh$r!r -0L@!r-0  "!H0C  0  ! 0!h$r!r!r -0L@  "! R"10L 000 0 4 R 0!!!r - PL@`p.8 PP& 2! 0W` `4p@    0@!! B 0@0 PP0  "!2!rxKAP-0P !!,160 !!!r|!r -鐑Lp?o`s>J"1d!Z0 !!@160 !! 0 !PU PP 0@  PU0!! & ?o`sZ|0  , !T 160 !$ 00, 1o!r!r|!rkqh$r!r -X0LM RK@K000S  P >11kx$rKA p-(1LMP@`;Q0S4  KP 0 &S  R0 @ 0 ,1Kp Q  (K31C01( $0 pV | 0d#@Ph0 T`0 XB(`P0 @ 0 <08@`00>x$rPLAE.,LA$LA4LAKA>KA 0-L@ `0P?0d0D!s "Q 0 b 0h>l$r$r$r(1@- @Ơ3 1C 0!02@$!Bb  @130` 0Na3QM0 RT d00 R00C0 R@TЍ&60cQ*d00 R00C0 R00C0 RYѭh$r -0L6f 0bSQ0@l   0bSp0 VZP帀6]00C 0@ c0 ` 庲0 VJ0L0cR01 S 0 S$0`` 06 06$0`p$rHlot$r|$r$rdlo$r$r -1L Mq1d 㬡 1\0. 0`K P'0  "!0P00@T V 00T 0!eÁ0`S0c!S0 0!!0@0   0  0 06 &06&0C68 l0@ 0@_T0 (Kox$rol$r Mbt$rCtLAxkHlodlo|LAxk 7p$r|$rxk$r06 &0C6 B&0600 0 S  -@LP  -@LP 00 p-LM@PY/400  `P  xhH/`p0@0h04 0\040 \0@ 4h0\xhLALALA -00 LR 0]p3 p-0LM| @0x0D L0p p0P T0h h0@`(PKX \0H`<\@<@00 ( $@ Kpܲ7̲7l707H77L7 FA 410*0`PRhA0S 0P  0  K 0$$L04 P T0*4\@dplpt`0 H`X``h`|`x``` $3 d0l "3*pt`0 L`H`P`T`\X```L-D|-<y-4v-,s-$r rMA$rhxkLAMA00~N@1p@dٔPP > 0d 0W05JWZ/ &Z,K00K P`0` 0L000S pP\0 \h Ж, hJpWZ0ޣ(K 00b 000Okrrrt500s0zk p-LM@4P 0 0   P Txh' ``04 `,0P x xh' PA$]!PAR 0S p 0P p0 P p-L M8`K@P  UT080K@ 002K2K0 K1 K\0,,0 P Dr'2[2[   i'Kpd'0uQA\QA>((< ;0@ 0@ R<T 4 0 >8#808#8>@ >8#808#8>00  >8#8 08#8><001H $q! ,PPP 4%5mS/qTRA -,!L80Pd(qV 0 @)0 kh 0-01LS@ڼP01 0C01L#Y01SP0 -LCM⤁1 (a$ @0!0P$1KR`77h77p7x7>@L3SDS$<00 @)a0 u01001$ 0R: K Q  IOK,  p-DP!88#L!`P040 4304000< ;00@ @tVV phSp 0<(P040@3:ph9p@t/zk 0-L@P5C %0s 07 Q-L@ Q ,18@ , `, ,18> D0M/Y $0   ' Co -LlM0MO01 x ,x ( |Q ,0 40,!0 03 *PZωQK0 R0 S 00 0C(P R00L7#,6, 10S00x *#> 3 4 44 @4@@ 2k/@H_8C -LdCFM\C\P, `<1  8 8,ß#(*6pP ,8 0 S4 (@hP@ |$0Qgg41 "0 9P@0@`  0O 0 @TPM X" \0<8!0 01S0@@ 0@P`P `쀇4#@P`N >8#808#8>@ >8#808#8>400( ^01<$q,P P 1S(7x7777S , 0R7(K"""41 (010AS0!0cS01 $<S0!,@P`< 0,1KKOK , <x!t!h!`!X!H00zk$ozkzk{kTATATATA @XTAlTA8 00000S0C00000 000 0003 4 0  <040 0 8#8@08#80 p-L `@PK0 8#808#800 0 B4 p8ph p-0L @` P 0(008#808#80 8 phKa -L$M# 200l1  8 t ",0 0,0H0 @@0 PPr Ƞ,Ƞ @00 }(0S0F 0 4@$@ @  2P,0Q08#844@@0@ 80 P,04 0,0T 0$00\ h 03@T@<'P000 (Kol0 0@ @; Ƞ,Ƞ @00 ,0 D L,0T D L  (Ko!  0d@V\: 0 400 (Ko0 003@ 7ȯTUA0UATATATA -RL$M4 P `x4 "3, 8 <0 8<00i1 0(K@,0 aPLŸR00 y00! (Ÿ0 c00 c ^0008 < 00i10 > 600F 3@C 8^@4@ 0  @@Sd@ ,0P 00 00! (\ 40S 0  0<8@00i10 0 >@0400:@e33 0004 \XPH}<,(ȯ|7UAUAUAUAUAUAVAUAUAUA -LMp 200l>@ TP 04 @`=Up20 P( 00  G0@6 0T R P0000r P 0 000tU@ 0@0@000]$KP 0  00 00g000G000>0$ P` 0 0@  0@$ 000$ bQڰ08\{P000  0 @!ȯ0UAVA\VAVAVA@VA 0- L0P@K0h ȯ p-PL@8`'P+ 00 00000 0 (0 S0$0@00 @ ,00( 40 ,0, ,00 400ppp7|77 -LMP \`Qp @p @T V4 0`D @mJT(  c${k{k<@ @@VA - 0L00S@ 00S00 00S0 0  -L M<`Kp@ PI0<0K0 60K@?4 K7@KSK00 5 KyP3[8#8 K -L M@pK0@ `I0  @ 09 K!@0K080K4  PP 0l3K0P ,` IP@  K ^0@0K18 K40 9 K3[8#8}  I09 S" 6 04"40(Q(A 04"40Q. 04"40P3(( SS 'NEFX -LP@pA@`  0S K>*D@ -0LSpP@(`0\ 06`P "0 S0%Ll2@l 00# T@ 0`00S0 X00P0S@T R@@  `@#`WA -@ LP 0 0 - 0LS@ 00 0   000000 00sS 0S  p-0@` PL0 P `plolo0   loloQ - Ll0p0X00 SX0S -0@L0X@ -@0L R 000S 0S  0lololo -,L\ \ lolo 0- 0 @@ @ @ @RLP t0S pl  0t@0R Q 0 0# 0@00 SQ 0 0  00 0 0 00 S  (-"H 8TL`P#x. 0T% 0CT 0S :h 0@Sh0 0 : Sp0Tx0S \0 R00h 9h :n ,5k -LM`0 Q Pk U Rd0Ra0 0@ QP  00KPPP0; S Q Q Q K 0<0 0PUQ W \P\ 0l@L00Tq@P ;; S" 0 @0E8 U:S00P 2UP 30E8S0E8#X8UP 00Q108#XQ0 *@K WO ;q0 9a0 0[0 0U0 0O0 0I0 0C0 0=0 @070 010 <+  0pC p>0Sa00 RLPhWD0W@ ;g80Q= 0Q1<  p-0LM R3 00S 0S, @P`0S0C00  0AoQ*0 R>;  S0S0C00K K 4 0 Kplolo{kloloPH 0P 0Q \0SX0S  D{k-00 Ƞ Ƞ,1XP D{k -LD M\`@ %(4\ :40S P 4\# 43\i B3\ 3\ 0p0  0lP K3\ 3\ 3\ t3\@< S0< S< 0S@hP43\= 3\ 0\s 3\0SJP2\ 0\x 2\2\ 2\M 2\|0P       00  0P0 0       0 00p 00lP!0p ᴶ tPPB uq0P0m 0R 1  tP`㓼PP8Z0P     00 M   0P0  Bp0| 0|lPP{ 2  h Hh0(K 0 (0 $@ PP3 W W WW @W W@WWW@ W @|{kW WWl{k -LM\ 0\ 0\ XP, 0 P0\ 0p XQ 00S00XP 0 r 04 Q}f~fvt|f 0-LMP@@0@0CS08H8@- @.@D{k -h0L Ƞ Ƞ,A0S 0400=00CS0D{k 0-0 (("ALXPU 0 X0 q\0S 0 0 P P D{kWA Q-LWA - (L(" PP#0AT PP 0SP \0S X`VP 4p90H0PP X`#PD{k p-X@LT` 0 ! PaU  2`P%0S0Sp0 ph9, ph000S WA p-\0LSPx0SH1  X@T% 0S" e0`0CS0000 R00$0S/0S&0 31C P0Q!ژ 0 S00 S P0 ḅpP0 00"loCXAuk4bk8 XA -l1` 00x 0P SpLpW900S3 1h0h0 P hl 0 p0 0 Bt 0 AP/h0 |0@00 RWP lh $dh00 hI000P$z{k@XAlol{k|{k @pXAlo\XAHXA0Q 0`c  <8S@08#<@8oS: S>; SP 00S> -L@Q 8888l8000000<000000000000000000 -<00000@ L  pW`V 0S \ R P0 U*\ 0@@000|00U0#pP p300   P/",000b, S{ @0bU ppPo @/",000b, Sf 0P(LT  00t0 n0S0S 0 (Kox0S P/",000b, S\(K<00@ S2 0D SG P/",000b, S* 00D00D U pŌ 80pPS10SH P/",000b, S 00  U p8P0p01PEQ0SF P/",000b, S 00  U p4P0p0/00x  U p@P0px000 ~y p-\0LSPX@T% 0S" k0`0CS0000 R000S/0S&0 31C P0Q!ڔ 0 S00 S P0 pL0 00(C0YAuk4bkt#88YA p-Xl@LT`P 00`@Tp -L 0-l@LTP 0 0X0`@T0 -@X@L p-PP@L# l ` \Pp0`d0l XVp0l@`@Pp@ 00P ` 0V\0d0d0p0d0d` Vl ` p 0-X0LS@\P00` lRd0d0p0d0d0` Q` 0l \00 -LMl@Tp` P0 \ 0  PP`@TU p-LMP`x P@ l0@p0l0, 0` 0 `00t xHB@~k-00 Ƞ Ƞ,1XP R k-00 Ƞ Ƞ,1XP ] k 0-D0 (("ALXPU .0X00 k -pL0PS蠟0AT# Ġ@ `崭P$ V !t< T1 0T0V@ eDu@P ,0 A$@k k?YAdYA -L@P \0SX0S T Q0Q \0Sh -LMP0U`,0 :3U-; t3U. :h3UJ 0Ud 0CU X0S+ l@lZZ p,000 0 `@PpZW 2UF0t02U 2UXP; 0 P (Kt2U /0CU0S Sf S#(KobXQ 00S00lP `P 00 R 0R1U 1Ul\@@ T 00@  00`\@XPU /",000bS` 0jXP 0 r 04 Q(Ko   ^@@@Y0S0SAo(Ko0 00aWbWvt}fW`WcW@- @.@ k  - L@pPP 0S \0SX`V 4@!0H0H 88 #Q 01S 00="R,k p-<2LS 00pdBP `0S ph000 0@@0 -LP 0@R 01S 0 10<P  ,k 0-Lt 0@R01S 0 10<P  i PP  a0h蒫0,kD 0R0!R00 10<P ,k Q-L YA 0-0LS@00PS 0  0S0hKYA 0-0L@00PS * R% 000 00S0 S 00S0 0h" R <0 R 0  0 $r$r$r 0-L@P0h 0-00 ="P0L80 S @0S 4 0 8L\ 0CQ 0dP 0 0d20 0 @|z@klolo p-L@P-P ph0`   R h05 :R`0 0P0R HWph80  @@0 H$r$rlo$rlo0QD@2L p-QL@`" Q Q Pp00V= L0S XP 0S P@>X0P0PS@pphq008Pp 00 p-LM0@=2S @2+ `2S0 R8LwKp Kl 0h 0`Q8 P`=iB0PEB mBT31C 0/L#b1 RbF 080T 0 @2 `2S k0 @20@2 0S0C0$rMb -LlMğ @.`0 =rW@ 3Q 3Qy 3QG 3Qb @(K3Q 1Q 0B~S1 0< RM L@Kl3\` `0 XpKTp 00lPK8008a PU 00 00K0 @0^!0 @ 0 K tp p0 , | xp D@㶩 0B~S1 0< R 2@0 4p q<` 8pK00L@K8008(1S@ 0B~S1 0<P ` S@  @  ZR 0< R Z@P 0@00 0Pd0 `@ 00K l P0 hP T , \ Xp 吩T0PS0@A 0 80<#8 P@ 0Z Q T0Sl K@U}<ό@7 0B~S21 0< R 0@0 4p p<` 8pK00L@K8>0080S @ l K@P0,kUUUUU@6878478 p-L`P@T @T' Q0000 0000;P 00S0u@Tᩧ dP0  lo$rYA p-LT`P@T @T' R0000 0 0000P 00S06@Tj %P(@T0  lo$r$rYA -HL@ @0aP0 000ZP  A8(kYA$kB8YAYAYA -LM|r`PVh 0}/000DR00#`BD2D T4 0 0=2$KTK p0`S0 <20<20 @20@210@X0\P`pd`00 .d0d2SO 4 0@ P=@T0SO 008 R 0 @0 <20C<200="Rh00`"R!000008$KmHTۨ0 @0 @```厦 I 00=r0S @ 00=r00T 800X=r$Km0 @kk,ZA@ZA @4WkT<8$r$r ZAlo$r$r$rloD8ZATZAtZA0S0="R00 00 0\40  40@-00 00D Ƞ00@,Ƞ  4@ 0D@ 0-L  Ƞ ,Ƞ000  P P@% &D04P0D000@-DP @.P  4@ DP00@ @@0Q0-0R00\00^00L80 R2 1C -L00 00L0S0000L0S0S40"00- 04 P#*0 \*0S \0S P -0L 00 -Q  <2<200C<2<2 L<2S 00-0^  0S 0S  ^ 0@- 8 ȠPQ@#,Ƞ R 0 S0^ ^00 -L@T 04 - 0SL*@T 0S0P $ ZA[AZA -@LP 00P 00P[A Dk 0-@LP0H0 @H0P00@0@0 p-PL`0 P(0  00P@@pD08 00D0< -D0L0@80 00 -P@L0(` `0`iP ` -LLPp4@P? 2`@TD @e P: L0 T$0P pQS 0S* S \0 \*S 0S/P e㶝000S 0S@0 R 00 P T0 p 00@ S 04S!4000[A[A[A[A p-LM8P 0`P@P"Px -@L600  0e0C0hU -PLPp4P L0`V@@V4e -LXef\0I 0\0 R0X0R \0 S08 40 L0 T XK 0P @P \\e rPX| \X0 AX0\0!m` d0XgWe@Ta P@eU$r8k8`\A -L M`QP I0S@)pK$0[S I0@S wP K 30 -#0LMAD(0K0CP(K #@K'K&0K%K$K"K!K`@P  K p2 @P0 0pW@W  @ -#0LM`AD$0K0CP$K #K"0K@K!K `KKKpP K @2 P0 0@TT -LM4 @P0 `e 㣚`PPs ,0 00-0 X3,  0 P0? @./12 00 `Q 0XS _ 0S[  R00 !  0PP98pd@ 0pP5 2@[T0 1 00, K.@D 0p|P 2@DTP@D1P0@, K}7 0pcPP  (KX! 90S%  PT0 ^0 0 S  Q 0 S F P?0@S@0?0#80S? B4100 GPP0PP  ` P 0 1 0 <`P 0 0`"R 00d014 00PP ,@K  >\A\A -LMB4( @pT TD\A P-L 00 T>d@lo -LM0K0K⠠P.KBD/K -KNL`(pK0,PK+@K*K)KPP(0S @ 0DĠ)K*@KP(0 0$K -LBMP`Q@Pp P(K!rJKI: ,K 0P,0`W`?0@CT  R JK 04("8  00X00S" ! 01 R101 01XQY QP@S G (0+1X P@0Q0U0SU2G? P0U0T R 1\\ T 0\0  0S 0 4 \\T 01[O&H 0KhP!  -LCMXJOKP@D`K p0,P 0  !@w'W@ p = p<0d i'@;E0:PD`d  Td\'@ dU'Pep N'@ dG'` 08 , 0R(KF$o\A]A]A]A ]AD> - LPp 㱗` ;W $@Tn| Qq XqLW W,qdC@8]AL]A,]A\g@@-  @ 0 4$(8XX"(#!\ R0S$0\ Q 褺>X>R R0l4 -00LT`V( 44 pW0P0@0 PR@ 0WPf8Pf0Pff0 0T0 -00QLT X Zp`000 PU XP P @X0@PpZ` -LMT p4 000 P 50 @0S0 0S ,4  0S'`T00 @B P P0  DPZ P T0S 4 ` 0S(K A 0S 0@ 7  M K mP> jP 04  0 00  0`PP6 T0S  !0S00 0  ,  0S00, x0 l 00 P00 <}~00 (w d^A^A^A^A@^A^A -LLMh0`,0 P 0P,P: 0S=_0`KTpK`0K_K0 ]0KZKYK^K\K[KR@[P00T00SbPT00TT18PfX 0Pff㯕0T0, 0RR(K 44f ӕP @f ̕P 0\ 2TH0S 00S 0SX KlPXGpP< 00S T0B 0Q1 0CĠ YKZ0K_ B<f ゕP8 <X 40 `P y f3q`00>0S Sf UPa T>p00  P0S}?d0 00  00>0S0 S1 C00 ^pT p 0pT  P s0 h[0 R0@0/T 00$oL_A _A8h_A_A_A>8_A_A`A -@L 0S 0 S Q0 Pk0   @   ,D  -t0L \ |0x  -t0L \ |0x  0-t0L@\P 0x|  0 00h p-@0@0LQP`' Q 0CQ Q  t0V  ph0 000000p000ltmt 0- p0@0LP - 0S*$0S (S 0(090S PPt00S |xP l0< 20000 S0k6k -L~ 00s ^ 0 Q-L@Aq =D`AP`A -LM@@Q LDH04  $DP K`8 -L MP@l81 RR` 0S *@ ~| KR @P (pK$K 0 9t0\  0x| p$00Cs$0 (0(0 p$ ,JP  6k\`Ap`A 0-LMR@P 0S t00t0.K0@^$ R0K h0  c t @0t00t0 l0P 20 H 0K6k -LMh!p00Q@U 0S Kt0pa`V H0S HP`P t00t0d0P 0 t0\ 0Kx|` 00 X@T |@\`0  @4\` ~ \p`0 @ kȘ8 p-LMt0P`\ x| 0@  0  @!xxl0 20x6k -LM@l` pPP(K 0PPt0 \ x|  0 PP(1@W1 1W1 0CW P2P0W& ;1WP0W! 0WP00S P0P0P APP00hP6k]t@yt \tzt  0-LMhAT P P8h0P0CS0k 0-x0LAT 0S P0000l40  0P0CS0k6k 0-x0LAT 0S P0000l40 0P0CS0k6k -0L @   0 hܾCP6k 0-P@PL@P L@@PXP EXXPDP 40S DP\P Q40S 0\00R\O -`@LPp #@0@0XP X0X0DP 40S\ 0D0\P %40SU 0\00@0CS0 W t0 0B)t0  0Q4 0SP-00S PU@ 0@!b 0bW l0  t0@0t0ؿg00P\uk4bk|86kr 0- 0LSP@ ><$ 0 (080 T 0<0 4 0L0 P 0d0 h ,0t00 x 0|0\ 000 00 000h蓑`A @@BЙ8H8`A2M -PLt ` p@l0  t0 0t0@ ht00S x|6k 0-L`AT P P00P0CS0?k - (L8Mpddğ(" , a\0 ʿ PR7<q 8@0P@ , 0R(K480l0< D L0p0P \ h0d\P@` t00S x|@PQ400㊿@SP߾t0pp @   \Phw R= t0 y ɾ@ 0-|@L ^ AT \P(P00P0CS0k$PQ0H<0 R< H@\  D0%< %0 0b 0l00l  3 05 0% # 0- 88 L#Ā,200@ R10 20!0D0 1s s 0 P00S S Sd080 00SPD080<600@卽00800kHkkk 0-@ p- 8L8l# 20QT@0 f0`0CS0p5pkD -IMLpM@T, PQP 20!0D00` 0P P PPB P, 0R(K襻P0S 0#0 0L0# "#3R 0"0 00PS` P  R@0T0U0S T@#T@!PK > bPP iPH@P-r 0"0 0L0 " "#3 0!0 00PS( H@P@`T@! 5PPMHD0PH<%@H%PC  0R0U0S< P:D0@`T@!#PE P #PB P H@0MP Pg 0 Sp1{#W% t JNK(@D"(L0D @D @P PP4W SB J? G#P;PPP PP p- 8L8l# 20QT@0 0`0CS0ppkD - 8L8M!# 20, 41 2#0pZ, 00 D0` P  00S S@<P f݊0<0Zp 040P@TPU@k - 8L80Mß# "0 R~0QUz 3 RvD 4Q]P040Y 3" 1 <  D00` 0S]  <D 0 V 0SS 1"0<0X00 = D0p `L 00S2 808ؼ888XA  0D9 f ᝊ8 <8 !p< hŸ@0@ @P <fO8(K0 .PXȐD0401L0X  0P 0$, ,0!C@b@A@ f J@<@HD@ 0P/0 `Pp0P@4 . T,P8#004!2 \0P  0 X@L@040 0 `R<f։00 0PP00U"Q1Q0PP0R@PJPU@DZ tkH8$8 -LM0@P 50S QzP 0S P1 R  @@ K P!K}@PD`,!0[S4p!0[pS.0P( KmP("KYP"0[S(@ >0"[ 3à1"0  0(0@ ^PI`A> -L P@ @$K3"  D   0PL0 0 @L00a 0, KPP @4R. R4R 4R0 @P tӈ@Q 3"  D  0S P 0 000 @@ 0 0 0@P 0s P㥈@0 @p_ @3R1 3R$ 3R0 S@P 0s  0~P  @tr@ap2 00K0P @O0  R Rh 2Re  Zb*Z pP 0@80 0PP0 L@ 0 8K <0 TP X @ 4 H Dp i@0PSn 0XA80#8 @Pp0Z Q @0S] Uw @0%KP%0[@000 KPP 00@^ࠁ0 80KX0 0P0 L@ 08 X KT @p <0 4 H Dp u@0 @P  P2 ԇ@0, KP,P 0@0 X KHpPX KBpHrU~fqUhU pUAdU@iU@fU eUkUmU jUoUnUlU p-L ȠM Ƞ|,@   AdP0 0 =0`0CS0KprkD 0-@L0@PP0  =@P  XP0  080Q P 0  0IaAH`A0D0 0$0(0,0004080<0@0@-p`WP @U13*\0 0!`! T070C>1 g2S p-P`L@ G@d0Pp -L` $Rp |R60h t44p0S* QG ^!1P!B00^T8L8888Op0S:0 $ (U **0DS;88L8 88 0U T񟗾,888@8H8P8X8`8888880 @0PU p T;8848|8l8t88d8888pX0 0C\ X0 d Gr0t4 4S 0t4x4#ptX0 0X0\ Te  .r0t4 p[^ 0 ^8 #8t$,R10 tt$H^0 x40 ^8 #80:^ 0 ^8 #84.D,<*@(8&L$P"H d0(l0h hBh @qpp@ p@lPh qlPplkp8 0 $@\0`/ h x4$S 0|4h 04Q t4! St0t4P0x4t40CP0110t |, h ql0d 0 l0d 0,0h wqlhd0d@"tDl xDVHaAaAXaAxaAhaA 0-PpLP d@㑅Tp@0h芅 -LhM ` dPPpK l@P <0S SZp0S$KD0SlV@P -LhMp t 4`KP?@P @0S<p0 St0 SX80K 0SX@(K -LhMp Pp@`KP p0S<0SW,p,4 00*Pig0P$K - 0Lq 0Q 0s00 00 0\00` -LML0S  $@T0K@KaA -LM40@4 00i -LlMp4P^ `@ cS 0RKK Kkp4@K004 0@M$o> -LM`4Pp00 40pPPP ᭄40@ 0=p004 4 0P;Pg -|1LMQP d1Q& 1CQ KD1Q400Q* Q< Q@0 0 & 0$K KX 0$ S;#0 0 oQ Q Q@0 0  D0 0  0P D0 0 4@ 0@T@p0 KT` VH0 0 H0 0  oUDUU@ 0-50L0@ 050l PBUlPPPTPLP LLP8P 88PDP f؃DP0 -LM50`0P@050l  Rl  @KHP f40D@PH@ 80@ _@P@0rP< @ Xq  4L0P@ 0aPP 0\PTL2 @8/Df㇃50p050PlpP8pLp sPpTP nTp08 0-LM@P0K  (T Td0DS Q020C0 !1*h0\ 50K08  < aA Q-L@Q aAaA -P8LP\Pf%d\ p p`@h0!R h 01dp@\` Qp-L@ `pdQ `P h0!R P00-P00Sdd` QPp p-LhM0 d0 @P`Kd0T@P7Kp -LBM P0004P`p L @ X 0S@00SX 0@SP~   00S|@ 0@S@0s 2Rx (K$ Kf0( Pk($\`< @P]P0D T02T,", @f 㤂Phv 0Td@H0mCKp H0($ 3PpH0PHWH0PT08` H0 1<K!4P h0P180PW @0 $(P0 $(P0$ (P  K0S S Sm0@$0 |$f DP( $ mzy p0  `@0$0 0T0H0@fjdbA<@4@xbA @ 88aAbAHbAk$bA kikbA - LP@ P 0S 0 PPQ<0P R 0-0 ((L"!@0S1s s 0D0pP80< 400@勰00pP800k$k4k 0-@  0`p 0RCK,1Q $1Q 1QQx xP0x0000 xP 0 Q000 0KP Q 4 @0R0 K*P|0-0|00奻|00|0$o}fpUAUvtnU~f̿> 0-LM` @.Q@@v0@0CS088k 0-0LS@D0PU 0 L8P 00L P0 0-\0L Ƞ Ƞ,A0000P0CS00z0k -LMp|0@`, p 4 @0@R@PK 0PP@ P, 0R6(KPP0S0-| P |  姭0PS&P |00|0 5P R@0T0U0S T@#T@!PK P  ᷚPP $ #PP$obAܿ> 0-\0L Ƞ Ƞ,A0000P0CS000k 0-D0 (("ALP PLfxP0k 0- 88 #PL*0AT 0S P0PPP  Df |0L0|0xP0k 0-PP@L |0 lxP  0hh0|0BlxP0 0-50L@0Q!ڌ 0 S00 S P0 P00P0CS0Pohuk4bkP8 p-0LM<00P00@4 K K|`0 /@0 )D0 #D 0H@ Kp8bA`1S`-T1S0T0 cB80K1 0 !p0@ 0 1SWpp# 0P@Iφ  0 pΆ  0 pOφ  0 pRφ 0p p(K80S00 1S480K^Eφ0 1 ᆕbA p-L?L`@P€ i 00@0@p -LM0`S qWDq $ D  H PH!2@  D 0(KP0RFC Q<00D 0W@ ! PA \> R \ 0S0S  QD(K0 0F?C, D \\ P \ 0S 0 S  QD( K00F?CD \ YiD1S BT\1S `DP ]K0 \  D@Ta(KK 5iD_W - 1LSPp @`1 1S`@ !ib1S 2S a1S 2S h+_ iYh#_ hYhj 0-a1LS@P \PPP}0XY 0 bA$r 0-DPLMXa@ $K 0$ P  x\K0Dk8 -@Lp`PP DWW30, Xb10Ya1P @$rd8 0 $rQ Q 0S 0-@LPsP h1l!PP @  P@T0$> -`hl1pPQL @ ,P@T i > 0l 0-LM00P@K4gU p8pZ8 p-T2@SLPP`004|T2S0L P2ph) 0-LMt3@SD0S8PKL P  0z8 -L|M Q@pP` - Q `p 00L 0` KiW@ p-PQL@ t3S` L`PU ph%p p-1LS@`P 3SL php 0-@LL50P0 Q-L@ P㉸0t3 -02LM<00`00p4,K( KP(@0 ,@0( ,D0( ,{H0L0@,(0 $@ P@P h1 R8 \1R #Q@1LS 200+ i K0 S #Q0At 1S 0 @HP0$K,(x @P $0 X0X UUP03H03 8S @>d>Dk>88 -LM@K K? 0PK R00 1p@-QA 1CQ 1Q p00S0C0p@T)^&Q# R `VPU1T^QRT Q V U 0SS0SSp! 10! 1 0! 10! 10pA !01 !01 !01 !%W A W@00 -LM P `p 0S`s "30,0 0,0 K$0 G0@C<?0di1`ST1S Q qAW 0!0ll.e0 !0dd(e0Spp@AHP0D S00 d24p0@S0  000 0S 0 pS ɩ,@0 0(Ko 00C0S(K1S0000 P 0-LM0@S P y0 0S S S \oK L 0P  rK00b(_ \4@<@cA @P#8(cA8cA0cA -LM` ! 0@000p000 00P,K l#0P]PP*(K, 00@00$ #0PFP S  , 0000 S 0 P "0  PP p ,0< 0S0000#000 P 8"0  P ,00S0 -LM@K KO 0PKY0S 0r0Ss 0Rr0 ZR R0S0w000S 0{ z0 0$S$0w00 p-LM8P00 K^X`!KED`!K K0@KK`K`K`KPK`K`P[Kp -0@SL  1S01 1S P 01P P1 0C110C1 cA -LM@P  K8#T0 0 @0#00 <Q P{ p-LM8`0@ FTN!0L0QPSM@N@O@P`RL0@Kp0S0 00 0 B 0 R00 -LQPp` 0 1 s@N=00 00 00 00 00r`3 br 0@P00 <Q A p-LM`PV800@0NĠL0MQN`O`PR`S` L0@`NKp -LMP@U`p10@0<0NĠL0MQNPOPPRPSP L0+K -LM@P  K0 08#T0 0 500 <Q P -L M0`S@- 0BS* 9 9 9 98 9 9\ 9 9  0K@Y RY0S 0S00S S S 00 b0K\T T 0R0 R 4bD 0@@P  RTXpWd  00 b0T T00 =T1  XT%  ,T[00 TK0Q0  0T700 @ 0  0T5 T 00Q q 0@0 PH 0PP_ i[^ GW @P 90Si ad00 05@ 0@H:S 1S dAcA(dAPdAdAldA p-LM0PS@E 0BS$999 9 9 99 9490S HaT00@0CS0000 0PP KphB R 0PR 0($ 0,0Kp 4RC@ 0T\ @`840# <S  j i(h0$k0 0@S<0S =Q X0S| S~ 004 D0PS4< @0~PLX0St 00`@TP`@> VX 0BSXP2 X RW .:R,1T0Y 0BS7X999X9H9d!`!}@!{T!yP!w0Y0R0Y0N0Y0J0Y0FP< iliX@Y@\@`@Y0PX0.BiWi>0S=}`0T04> H0P HfALfA?dfA\fAhfAtAAfAaAfAfAl> -@L0 0 4JS00X0ĵX0ĥ -L@40S 0 0$ R 0R  R0Y00Y0 0-L M8P?00ED0KB0K KK@K0KKKKPKK04 -8LMȠ,Ƞ#83  > -@L>00h蕠 -@L40S00@S010(0RR00(0(00 (0S P( P0(0 e0(0 -LM@Q` $pSJ8!9l 9x 9!92 %㼠 00 " 0>00 01 0@0 T0%(KQ( 0 R* 0Q'0(00 (0S P( P0(0 (Ko/e`u0(00(KoA0>0 0 !0(00(09fA<0S8<0r -LM@P4`0S3 pW00 00 0 ! T@  0 P0(Ko0+ R  RW\30(0(KodT@$ 0AP(K$ 9gA p-L!M` 4 0PS  0RKp0 "K@K : PK1Q K1@K L4 0 0px.$o p-PL p@`@ @0j02408P40012` 902`pp9H9k p-LM`2 <2PK0@!2 700004  屰00CS0xxh6 p-LM`022 < ;PK@ 2 00004  冰00CS0xxh6 -L(Mb@T=0KKP4KKK. K0@KP@K@K@K@KK -LM6`pI $K=004K40K3KC0 & K00K.K-K2K1K/K=0P4K4K@D0,K.K-@K3PK2@K1@K0@K/@KKP08 R06=04KP.K\@ 03K-@K2@K1@K0@K/@K0P64K,KP6L -\ LR`p@P<0PS 0\ <0R@ Q-L`p \ Rpp@P<0S P\ \ pPR@0b0 -LM 0S  0 Ƞ8,Ƞ#8 P @> -LMP@` cP d0b0(K, K pP 4 08 Ƞ,Ƞ#8 ]6 8 2 ,,;0P4帀K\0 2@>K ` Xp PP L H0 d D` P6 = [>0[4S\00\0  >0K 0S/,9,9,9+9t,990[S\0w0\0@PtpK [10ERt0 T  !B200 p0 l p0 l !1#\ <R@Pʃ1T0 P0p0 tP lP 0S;p@0@S,^P  0S00S0@pSWXtK 0< \0 S0 00 I0T0 0T0 0T0 0T0 p 0l T,S+Sj(HgApgA@>kgA{A8`8?gAgAgAgAhAgA@-@0 , 00\#^? 0-@L/Pl 30# 0 0-PLHbP 3lS CT `o0@T/l0 0-LM@TL 6>P t ]K0LX ?P e NL\ \? @|PP N T7̠`34/ P( -@ Ll30CS3h3  03l -L M@Hp`pP K@0FH@*0K>0CGT*K" K)K(@K'K%PK$0K#K"@K!K&pKP -L M`H@IpP K@0HND)0K?0CHT)K! K(K&@K$PK#0K"pK!K'K%KP -@L {  h p-L M@H`PP Kp?0HF"0KB0"K K!KK0KPK PKPK`KP [0[ p-L M0PH`0K@P Kp?0HF!0KA0!K K KK0K@K@K@K`KP[ 0-LP z@@T T ?  ~$ f& ~b? (0h~ V'@iA 0-8P=@L8 XC ?3`P P=`PB`SdP PAdPF0d3hP PDhP0h3P =03P 03P 103xP 0x30l30 iz c`P q pZk \TdP b <K\ (EhtP iATiAtiAiAiAiA p-D3LP%HbH_M8`@/N hM00S 0@ᬘ30CS3ጘp3pG -8LLp3 @@ TP, ` TP`jAkAB9H09 39D9PD9E9-9-9H19jAjA2S -@PL 0P 0hȻ -`3 @SLh#\p# 0cP` pPd `7 -x3 @SL#t# 0HPx UP| xi7 0-L@P ; 1P ; 000@ -LM`4 0P@堾P08@ U UU(K PxU} $dL04  嘾44 ,0KPܾ,p 0 0@0@  ppQ㝕@tP  ́ ,Q /08, #x$ Q%@ 0KQ[2[ :,: 0#AS, Qp0: 08#xQ30, 5:c, YPP0 0@0@D -L=~L9(kA Q-L0 -LM P  0 Ƞ8,Ƞ#8" P > -L0P hA p-PL8`=8hVLP NP>LPDLcPP CPDPPJ0P3TP 7PITP0T3P 03xP G0x3hP v0h3`P ;0`303pXC XC LտP XC |XC dPĿP XC @XC (T峿P kADkAhkAkAkAkA -LM?`PB 008#8႒Ⴁ @ j"K2KT,K d@@LPd30 M0pOP j@hS `d3P/  p>`帿P ;(K0K2Kd,K PpꂒႡ j d3 p303'PT9 0-@L3S 5  P0  BQr0C0 P0 5;50PEQ 0S*DP J5 ;%5 10R!!  10C1 -pL0P`ẼP V VV& 0 0@0@XS V i68h;8 k `2S 0 0@0@i!0P岿lA p-LM0 0@0@P`XX㬓0 K@`μ` 1S^Kp8lA p-3LP4PP̽LPɽTPƽ0┸0⑸3`0CS38@/N by00S 0@(ؒ30CS3Ḓp✛6 0-@L/Pb 30# 0 0-PL3S CT e0@T/Ub0 -LM`0PpP @0?0(0K(0K:0CJGĠHC6 (K%K#K"0K!@K'PK&pK$K僿P K 0-LMP@0( P0(4S  0P0  H0P0  08 0CP0 z 0P0<q H0P0h 0P (0P" -LM|q0,K@p $0 N0kP $ 0RM K 00.Ke- [.0[48 !#8 ! ( "(2S<8 #8( "h808#h 0? 0808P#h PP 0K Q 0 U Ay$od> |> p-LM@G_`0b7Pi 7P 0P=3( P3 P3 EPf 0K? [0[ [ 04@ ?VP XC XTKp3#44D 5>;PP XC 9 τ07PX(L|3x/ P坺x8@0;S8x03 RX, lAlAaTlAL9plA -PL@`p喑D1T% 0CT-  00p@4T ߐ0T 0T0/.⤗@4T5@ @ɐ @ ᾐ@508#8@5 0 R0Z @@ ,@@i 5i 6i( -/p  0p00LM @8@ 3#0S  0S S" S036?0 A0S  S 0 8P (h?  lA p-@PL 0峹P/^ `!`3S 㨙php`9mAO9jA: `04@mA?]9dS9\U9b98a9X_94W9W90K9$mA`mAtmAmA -@PL 0P 0h 0-@LP\$30 # 0 0-PL3S CT _0@T0hU\ p-L M@0 !DP_`$K0 K$0K<0C@K#K0KK"K!K PK厹@P  KpmA 0- @L(,0 $BPP 00 $A0h 0-LM!P00 @ 岵P:98<##8 <Å <9)7 <37<3 C <#K0h2S:P<3 @@ "0K! 0TK0> -L M?0!DP^`p0(K(0K KD0#@K'K"0K!K&K%K$PK@P  q 00KmA 0-4pLM@P  KPP1  ((    :PP8 I8 C88nAnA p-p  4p00LM `69@3 3$0 S$2 * , KP%$0 <#0,@@& <#00000 0  PG @,@  dx Tx$30S S $<#0&%0@0 <#nApnA p-@PL 0廴P_ `)[4 >㰔phDp -LMp`P@$K$0 dT   P@   p-LM @ PP @L唽D ᐽx  s  PPPU @~(0;.PP `K PP @ i@d0: 0 E8 Al*= `P7 3 / -`P01$ 0 #G , /`P#,<30 <3  <# <#@d Pz@L Ps@4 PlnA,pA oAtoAHoA0oAoAoA -LMP` 0Pc2@T3Xc\C`C_\2tcp3xC|C/\P hռ K8/00P R;J<440S@VP 4`d2"91!1 0.N!43 BkB( KP4pL = 堼1!(31_,# @03#t!t1s偐 0hZ#R=  t'׌> 800S#0@S8ͳP   0P# P# ZA$ KP(0$#!$##Ġ"2"0"2Pt9XpAL{9jÂ9H~9kA9H9r90o9o9n9$mA -L@0 P hhz 0-@L9P=9X>zP rP<>PASP gP@3PE03P [PC'P03P 03P k03P 03P _0300 ӻ ͻP  pĻ \徻P  <嵻 (寻޴P iATiAtiAiAiAiA -LM0r:: @KqG:P0$` E0 ::$0 E30 y@ c3X:~P @ @qP J K303',9 0-@L4 5  P0  BQr0C0 P0 5;50PEQ 0S*DP u5;5 10R!!  10C1 -`L0@PP >Up UU% 0 0@0@ U h耈9X;9 P2S 0 0@0@hk4hA p-3LP4P>P;P800D3`0CSD3J9@O hX40S 4@ᚉJD30CSD31*p> p-LM@PyiY7P% p7P( 8 ?P  僺Kph8 9>`P  sKphlKpheKphއ3\/ `Tγ9>@0;90KphÇP  pK0  ?ݴPP x La̠ 3,/ PR̲k -LP哫P8@@ ˂p" )ogd @#T8`   ;7P( 7P u$  # "  3S 8@0;8/hR@ih,ch݁P hց0jAjA -PL`@p0P@ id1T# 0T  00D4P@ ᳁5@(@ ᫁% = S2 @S# @ 5@l3505b0 R @ ᐁ@ T04@@Jl3  ` `~l3 ` i Ql 0-@8=PPL8X ;P<PAS P 0P@ PE0 3$P $PC$P0$3TP o0T3LP 40L3@P c0@38P (08300賸 圳ꭸ 喳ŬP  p即Ꞹ \凳 嶬P  <~ꏸ (x$姬P iATiAtiAiAiAiA 0-LM@ ?خP s \K0 2>ɮPP d LM̠LP3,/ P>L帬7P L3S ªPL ϪPP 070 p-m3LSPpw`0P fO0038@ 00S 0@'~0m3~pR -LM 0S  0 Ƞ8,Ƞ#8!  P > -L@ 吴P/啨P  h˲@iA p-LMQ8#H`@0?0 0K 0KP$4& KPK0KKK@KK`K~Kp -LMpEP8 0 4S ,K0 KS P. !0Ұ(K̰ <̠ČL8 ČD"̌#D!L  0@P( ĵ ` ᭰,6O,P 8声 ̠8Č#Č"̌ 0P  厰,OP,<4("!4l̠ <($Č"Č%̌ 0bP | L ,N  p9@qADqAqAqAtqAqAqA -L MpB^P FK Kç@P 嚧0PS00S#0@S 厧P   0P# P#`3S 3S< , 0P  3 f1C NP0& ~O@`~P  j|0| 8!t0t 1!0@ 0p`xy(0m3G},Ư~rAjAjA$mA4rAkA999\rA p-`PL@ 'P b!P0 @/D0@ R phM(ph蜯 0ph'h(ojA1k9 -(L"M"(@0K K0KKKKK K K K -LMP&/00P02 `@p 3 488S  P @09Vp `0 08#8   Ki0!B!O0,00Õ(0 0P  Ki -LM8P@` K8}@υ 0p@8/  00 00 o@ k7P y7P x3S 8@0;8Khe|LKh^|4ޮKhW|jP KhO|jA0jA -P@lcLVp@ |t1T# 0T  00~4P@ -|5@(@ %|% = S1 @S# @ 5@(3505q0 R @ |@ 0@@Y(3  0L   (3 ?  ("(  i Q0 -RLM R R K0K 嘥\@-03S 0 0@0@5h? 0-T3P@SLPdS\S }PT 劧PX 070 -@RLp` D ; 0 0P PPPP7; '1 7; 00hA -LMP, 03` S@(8@% R2 RR x3 S% TI x3@! }x3 S0x3ʜA$0  @嶤0(K`Ⱝ003ᾲ <姭xÅ ,0K? ,,L, \ p 7,  R 0 0@0@$嘧0 0 @00@ {0 V7P tP  g }0z0 0 @0@(9rArA 0-@PL8LS 27P <3S 圦P< 婦P@ 070 p-LM8@@ KpO{Pq 2SK 7P# 7P&   ?⎨P( ?⇨`P " ( Kphz Kph{zKphtzKphmz@3<$/ `<]8@0;8KphWz̄d ? @ P ܱ ,ŬKph>z\hA'9 0-@L03S 5  P0  BQr0C0 P0 5;50PEQ 0S*DP e5 ;%5 10R!!  10C1 -LMPp0C`T Ky8V;H8 VV. 0 0@0@^ GV) x$K 0凢 P `$0S 0 0@0@2S0~x0 0@0@,,hA p-~3LSPp.y8`@ 00S 0@yx0~3yxp> 0-LM @P LPP  0 Ƞ8,Ƞ#8D  ȢP 8P 80 SS8|> -LMp`r P% 08 Ƞ#8,Ƞ 墢P?8@KᵢῢP pS ᶢP 0$S0S? 0SpᥢPw ,0S@,0@S偡P(0P 0S(0!#k,0@S3S ̡02 `R@0S2s忡P  @ 00S0"30S媡@奡ڡP0pݤ@P囡 #(#0`S0@0S(#0S匡Pg   0@0S #0S 3s (3spW 3s (3s .xZ` O?K0K0C &POKX 2$KO0` @Kew< $8 #44"<,K ,0 r432}x@ ߩ1!8!1!1!0@ 0P`ws'z0~3Fw Z0Sp 弩$K233SC屩 嬩娩妩0 $00B SAB Qa0B7 BSW B? 2"0 P2O T兩H偩<}|>*kAԺ9099sATsAlsA?8sAsAtAsA -@LI30CS3hܤ3 03IP0 p-@LP0`,P 5@00"00pFd30`# p 0-PL0P\3|S XCT I0@T0hbF0 -qLM0P3@0` C;QA40+ @-033H   303l3@0CS3T  d0⎜ K< a<0>P303P9@tA p-@LP0够P|3S 5  `0  BQr0Cp P0`FQ0S*DP b5 ;%55;5p 10R!!  10C1 p-@PL 0dP_ v`E|3S `3 d30S T2 S|#PMphupt -PL0`p:@P uv=W;L= WW" B? 0@1 AR ;W iu< 0@1A pT2St]iu3H03230CS3ᗣhA p-LMP0 0@0@`X%v0 K@G 1S)nuKph? -3 @SL## 07P $DP X7 -@RLp` D ; 0 0Pt PPPP巧7; 1 嫧a7; 00hA -LM`0pPzP&U& UU h0l0h0ПPCUK 0Ÿ0BD0  @x30330CS3'(K,0K P峞,0S 04 C, 0  > 0@1A R"0 0@0@Ģh@T 0   7O p-LM@PP` 0哜PU xK @      K0 k% [0[48#x -L Mda0@0 0 dPP 0RLK}(pK  ,= 8#8  -03S<=d =  0S !0[(<<P!0K PPt K?0 Q0 U As~$o> 0-LP0@P 0$  TtT @ 0hHt' 0-5@=P5LUP[{DP SP1DP6DPHP HP5HP0H0P 03P X03P 03P L030|30֩ h忤Щ T幤DP ǩ 4尤 媤HٝP iATiAtiAiAt p-L@Pr`02.5 0 7P xqp|7Pmqpj b Z AH0S D0S 5@0;5qP%{pfP qpjA0jA -`LP0@p P@ Er41T 0CT!  0tt@4T& q0T 0T0/Sx@5 @ n@508#8@5 0 R @5@@@ @?@t@6i 5i 6i( -d0LPt`$00q3p0CS3<=@O ZAwt0S r=q#qPz -LM 0S  0 Ƞ8,Ƞ#8  pP > -LM`Ppz0` @P q0Z$K2C3CSB2CCS3( Kޚ@PL(0 40 0 Ƞ8,Ƞ #8t4?4妚080@0<0 `R>S4 0@S4嘚P/ 00S@8<0S80s$ <0s! @0s ?q.@K 0pP  ph @LDq02 ~ tP1!=1!!20" h30Ol#t` p3T# 0Pcv  0p@X#R  wolsP |w pAtAtAkA|A99x9909999t9QQ -PL@pp!1`RF101p7@0!0 1SA@@10A/00@ 0@ o 0-@8 =PPL8X P< 儛PA SP P@yPE03P PCmP038P 0830P 003$P 0$3P 03000 *  BP ! p  \3P  <  ($P iATiAtiAiAiAiA -Q3LSP` 8@ R RRpp`30`3PV hޛTCۦ 0á`shA 0-LMP ?+P Ʀ 寡K0 1>P  堡@5 ?@ PΜ@P  T剡ˠ0 434/ @z0p!80 ` 00P`@!0@`xhhRcHl8Ǟ (žjAjA|999\9jA$mA -LM 0S  0 Ƞ8,Ƞ#8 劖P lk -@L>30CS3h3 03> -@PL 0dP 0h) p-@LP0`UP 5@00"00p;d30`# p 0-PL0?P\3|S XCT =>0@T0h;0 -qLM0@P `32C ;R' @3H -  &303块3@0CS3T + T0⿑ K<b<ᅙ303|9tA p-@LP0ٔP|3S 5  `0  BQr0Cp P0`FQ0S*DP ,X5 ;%55;5p 10R!!  10C1 p-@PL 0噔P_ k`;|3S `3 d30S T2 S|#Ptphkpt -PL0`po@P k=W;L= WW" B? 0@1 Aᇢ pW ij< 0@1A  pT2St]ij3H03g30CS3̘hA p-LMP0 0@0@`X:Zk0 K@| 1S)jKph? -3 @SL## 0lP yP 单7 -@RLp` D ; 0 0P PPPP7; 1 7; 00hA -LM`0pPᰓP&U& UU h0l0h0P4Um ̠BD0 L @宓303%30CS3(K 00KP 00 &00S0 0@0@ h@噡 0(停h *KA&) [*0[4  0 0@0@00 @0Ct00 0 0j T7P P  V  l i3D03\30CS30 0@0@p9 iA - @L#$7P 3S 0|P ㉕P 7囔7 0-LM@0PP K034038 D0vP  P30CS3q4< H0aPP  HP̠D3(/ P֒PtABF -LM @0K@K@KMP [0[K p-LMP0P KpA8#8 K@=8#8 @H $(03S<8 #8( "h=08#h G C U(08P#h @@i P 00 @  01 0 0 T&* -LM@0K @c P[K p-`PLP@ 0們PU @pT T Q0T 0|x 凚@T@pT T<Q H( H7tAx>BF 0-LP0B@P 0L@ iT @ 0hi.' 0-5@=P5LUPpDP P1DbP6DPHP P5HWP0H0P 03P 03P 03P 030|30 h TD+P  4 HP iATiAtiAiAt -pLPg2n@ @`T  W >7P帙3g{7P孙(g 16H0S D0S 5@0;5gPuptP g/jA0jA. -`LP0@pZP@ g41T 0CT!  0tmi@4T& f0T 0T0/m@5 @ 8@508#8@5 0 R @5@@@ @J@tQ@Ai 5i 6i( -d0LPt`$0F0C1g3p0CS3=@O 6+mt0S gfqfPUo -LM 0S  0 Ƞ8,Ƞ#8 徐P > -LM`Pp0` >@P  0媏$K2C3CS182CCS3( K.@PO(0 40 0 Ƞ8,Ƞ#8儐?4080@0<0 `RCS8 0@S4P3 00S@8<0S80s) <0s& @0s# f.@K`.0`pP ] el tU@ TLHHf 0A 2 tPW1!=1!2 0"h3 0Ot`l#p3TH 0Pcl  0p5X#R  maghP xl eF"0l"ljA9tA@:>pAtAtAjAkA9:94:T9T9D999R00Q00]Q(0R 1RH00U@ 0-@dLPP (d0d0XP 0hs0Q X0]S r -L M4!00PpABdHD*0K*K!0C" K'K%@K$K#0K!`K)K(PK&K"pK' K -LMD0 Q!00K# "0C KK0K400@@C K@KK0KKKK -LMTS0^4pS@0NTGd!0" $K$0K#K!PK`K"K pK@K@KKT0STS0SSR R R -LMLp@` P@ K4P0ED!0 (K #@K(0K'K!K&K%K$PK"K少@P q! -LM(0KC̠C$C0K00K@K: KKK0K  000K0K< S00K  S00K  S KPKS00K00K]0SR RRdh0Si0 So n0$R HΖp @000 000X<<0 uA -@dLP PdP 0d0轛 (妖dՏP  坖4uAXuA -LM`@q d0S Kh80Ld0 @弑P4: -LM@0@,PK00`pjtP 0S T$S0S00 S00 S00  ZP$K@T 0 S0S0s@ -L+8#+ -L Mp0 P`(K 0  K 0 SGT 0T@ T80 0RK9#9 L`P`"1P8m$o>ظ@> -LMRL0L`i@0pATF@0 $K$0K#K!KPK"`K pK@K@KK -L MpHPg80Sv f*( K R xʖR KRd, ,`@FT0N@0 4K40K3K/K2`K1PK0K.@K-@KPC ;PZ   \\< SP ASPLP0J@0ED ` 4K40K1@K/K3K2PK0`K.K-K圎P0@1K2K 0< 0 @20K1 K20K10K@00@4K 4K3K0`K/@K.0K-0K}P (KS(,K%p SP  SP(,Kp R ʖ R K R0,0 0,0 0,0 |0,0 yKR R0,0 r R 40R 0,0 j0,0 g0,0 d0,0 a -RLM` R R KSppt0@0NFT@0 $K$0K#K"pK!KPK `K@K@K Spp 0 -L8M萟H0\`,0 @`K0A4p @[0K`K_K^K]K\pKZKYKPP , 0R(K=̠X K00 P 00_0K 0C`K\pK[0K^PK]PKZPKYPKɍPzl$o> 0-L<P\@010< y< 0000 0-L@ @QP @AD 00C00A0` `0S -@DLP o0D0 Q-L@ DP1n0H0 -L8M @TpP(@ w (6`(040 S0 80< S X T 0S@ tX 0 @4S@0L0 0S"(PG 00S R00 SR00 S= T 0 <4S@00aD0 0@SX0sC T0sJ 0LS00\0 ^Re00Qf00d0SH0R RRDf e 0f0f f0f0 0 0f0f0f0f0<`<0f0f0 0-dPLU@ DP !PDPHfC0DP0ǖ ,少 媑DيP sArA -LMd0@S?@0s D0Sf LR0LH<@ D0 @P$hPU30$`K0D @p"K K$pK#PK!0K0K0K0KP0 0!K KKKK"0K$pK#PKP K0 0 $pK#PK"0K!K KKKKۋP$: -LMh@^0Aa@0 K0KKK@K@K@K@K@K忋K -QL!0M# 0K"0C KK0K800@@C K@KK0KKK壋K -LMX\0~Xs ^S  8p@0NTGd!0" $K$0K#K!PK`K"K pK@K@K~K0^ \0\0s  0Q0\0Q X r 0q03R0#S0Q0X0R R R 0-LM8P@0E@0 K0KKK@K@KPK@K@K>PK0 -LMPp@`  P@ K8P0ED!0 (K #@K(0K'K!K&K%K$PK"K@P  p-LM(0KC̠C0K`C$00K@K: KKKP0K  000K0K< S00K  S00K  S K@P 0\0s X0s KpS00K/00K Q-L@ `Pvk0d0 0-@DLPP DQHf.0D0`P 7l0`00 -L4MpP0@00pD T0 X0 ё@P  0d0(K0QP9 0QP 0S 0@S?0Ch0 h@4 c@P4;0`80 R)0S&42P  @ 00S@ 0 4L0Ӕ 式0d0 嶏0d0 寏0d0@0sZ 4<0SF 0`80 R@00ST 0@S 4P   00SX X0sG T0s> 0\0X04\0 1,H 8p 4 00 < L D @ ,P P" } f0d0i`0d0c ۆP4 h Q0d0TxK0d0N\K` `0Nn`GP>0d0A<80d0;vAwAvAuAkwAvATwA0wA8`8vAuA -LM 0S  0 Ƞ8,Ƞ#8( P >Ra00Qb00`0SH0R RRDb a \  0b0b0<<b0њ 0-`PLU@ DP FPDPHfh-DP0 ,Վ ώDP sArA -L M#1@R#R1K Qp ` 0 3 Q p ` 0 G Qp ` 0 K Q- p ` 08P00K@0EDK(0K<0C(K K pK`K'K#@K"0K!K&K%K$PKK 4 (` PPp  h0`0 K0径P^ 4 ބPP l U0`04宄0`80 R0P0sR L0sU @0sX 3 #S0W T0 0X <0 < D <4 @0 @1, (0 4 8 0 $@ :TK!1.l\00SL 0PS4xP  00S 04SP @0 4L00`0 l0`0X0`0D0`000`0{wAwA8k8`8vAuAuAvA0wA -LM 0S  0 Ƞ8,Ƞ#8 嫄P `>RR00QS00 -\0SL@H P PPSR0XV0 0R0R00R0 S00S0S0 0S0S0<<S0hiꚑ 僌Dh蓆wA -LM@Ƞ(K,h,Ƞ 0P@p0%K$@K#@K"@K!@K'0K&K(pK@P&0 &̠0$@K#@K"@K!@K(pK'0K&K%K@P Kb KxA 0-@( LK RP^ ږ RW )ʖ RP K RL 0RP 'KRI R;     0088#(#(< S& SP00 R" 0R R KR S  S08#(=P 008#(08#(  p-LM@.\ .@0` K0@K@K@K@K 0KKKPKX@P ؐ Kp xAQ@!Q0SQ550055QP0SQ550055PR R R 0-LM0@P 0KKK0K0K0K0K0K0K @P  vK0RN00QO00 -LMT0PSD@R 0Sp` PN 0O0 Ki賕RR K@ Ki܃pʼn0 `p@ 崉0 S0 $0媉xA$yAXyA 0-TPLU@ @P P@ȂPDf(@P0袎 ,勉꜎ 光@崂P sArA -LMT0@S<0s @0S Kf H)(HD4<< d@0 @嗄P < S(D:txA -LM8`@Ƞ#K,@0 ,ȠpFT0$K$0K@K@K"K!KPK `Kǃ@P00T00S A *KyA00 =("(!% ("(, R   R  R *     Q  M0SM Q  L0SL Q   K Q0-L@P  Q &0Q Q Q  T 0hQ KQ Q  T ( 0hm Q K Q  Q KQ   0-@LP( u0R R R Q-L@ PPc0T0 0-@@LPP ڀ@威Df'0@0PP d0P00 -L4M`0<@00LM L P %@Pp f O0T0 K0PR 4 @P S <0T040P80 R(<0sR P0sU L0sF 4PDT T@TKH!H1@ 0 ,P ( 4@ 8@ $` !gP00SL 0 4<0 0@S4gP   00S SP 0 4D0 0T0< 0 4H0 l0T0Xއ0T0D؇0T00҇0T0yAyAk8`8vAuAvA0wAuA -LM 0S  0 Ƞ8,Ƞ#8 P > -@8LP c080 Q-L@ 8Pb0@0 p-QL!0M# 0K"0C K0K 0 `K K0K0K0K0K@ PK0 P @TKp p-QLMP 30"8! K K#3 #4K0K K K K K@ `K0 P @TKp3 " !0 0K K p-QLMP 30"8! K K#3 #4K0K K K K K@ `K0 㰁P @TKp3 " !0 0K KR- R R iyA -LM 0S  0 Ƞ8,Ƞ#8 ~P > -LԃkgA8`8pgAuA zART00QU00 -L8M U0$ S C0KB K0C BA0K@ K60 `?0K> KD0CD B@P4K=0K< K6@K5PK4S ) Sc  SF  S07@K40K3PK4}0PSF@  00Sp0@S94x}P @$ 0R K SP @S S040K3@K;@K:@K9@K8@K7@K 0 30K 02 K10KN n08@K7K4PK0 K/0K;K:@K9@K?0;0K070K` 08@K4 K30K:@K9@K4 H0KO@P0,PP*H@ 0 ;0K0C70K5 K0 8@K40K0 K+K:@K9@K3K2K1K/K.K-K,K 070K4 K3@K; K:@K9@K8@K040K0C3@K00K`P@ 0 CKL0 0D@LKH @@m@H~ ~~z^$oPzA> -@0L@M 0K ?0CKK0K@K@K@K@K@KPK -0L@M0K 0CKK0K@K@K@K@K@KPK -RLM R KV0SV WV0^8pS@0NTGd!0" $K$0K#K!PK`K"K pK@K@KW0S W 0-LM@0@SLR RR"K00S PL@ 0 0 S *S<K0hܐHK0h  04SUT >0U0U0 0U0 U0< -L8MTK@p4㥱0x00  4 08 Ƞ,Ƞ#8{4i{PPH 0SE 0 80D L P P 0S@00SL 0@S4Q{PB   00S5 SP 0@SP0sB L0s? 0@4`W@V@0 P!1@ ,` ( 4P T@ D < 8P $p b< K$ 0S%  0SWD 0 4P0 t⦃0@00SH囃@◃0@0 參@>k8`8 {AzAjAzAQ Q  Q0 H/L(0$ 0,B$ N..-08 ?0R<  C4<0tN.. 0-@LiQL P0CQ 0S0hP0/ <XN{AC{A -|LM kl1lA ` P 0{P  4@!00CS0K{ ;0 zP  @0  ;0\ PzpP  th@h@h %͠0 +P4  pVvx@H((' b ( C0?`% V Pq%-~_$K0S2*@KP0RK"K2K2R7 0R0SR2K?2K*@K02K00C SFtt:lt:dt:8s:\t:Tt:Lt:8s:8s:8s:,t:0D"02K0"K*@K2K $20Sf 20SZ S08#*@KK!PK0`20pLK&ëW?F K4KṫtP`V000000 R  B⠫h1! K 0 @] 4P `u 0@P @ d0 R08#Q 0*@K2K0"K2K?      '$(({A'( $$$(('i:. -2LM ?Rp` 2RS 0RD Bn2"p 0 00@0$T2T"@ [0 P8B8Ÿ   @t-4 0@? S+ 1 R 1R4 -d0CRD 0RI T1 @1 ;$K0S@? *pK2K"Kl1 *pK2K"KT1PH!0S01R 0R0ASw:w:w:tw:D|A //(($(('p:0|A|A -LM?p`0 \`,0 M \@1Q  A1(A(Q0  0 10Q @60 p0pᴠᶐ,0@0000 [@0 P}@ '/ /((.$(('i:. -2L PRh x R 00 0000ScuP400,AP ,tP%tP00>I{7IFI@p0 {껀 {굀 |{ꯀ h{ꩀ T{ꣀ @{M(H/H(/ /(((h|AiAtiATiAiAiAiA -LM@P` ~P k{ KrpP8 1!@! 0 `p0C `d!(0CP\1p p pr0`S @00S1 0@S rP   0P0  P0 ({0  P { {PZP d {X{P0  DAjA''4/8/(( (jA/0jAjA|AjAM(e: -LM 0S  0 Ƞ8,Ƞ#8' rP >- 0S @Q 0 S  0S 䔄k?#=?c1P20`<Pr0` -|LEMpp, qP W<, 0RI(K(1^ L0p 0 ̇ p04 -LM%PA0AS`0  YHŸ pW|  0 00S0M G.0@ BT0S*8S 0A BT>0S*4H  0p0C 0G 1R0' '  (8(80C0C(8(80 $0  0$ ?P05  H  0p0C 0^G$Q ᘚ5;5 1R0! !  11D0C0C11P  4$ K٧@P P  41G5;5 p-LM PP@` [0 0T TT T0 Kp0K p0S0 0@0@Gtt  0P0C0S 088;8F0+0 0@0@C=ys -LM5 A0AS%P  K04p`PpoG00 @0@CM @`V@ 0S  0$KpAC $ `{V@1SFi p-`RL@P0PS00 0S æ0 00S q00U@p -0CMLP00 @p`pVPt0ArPh `Mr21CC= 0P4  00 pW@7. p-@RL`ƦPP ; 1q7pD ; 0 0P Pp7p; 00 -LMMĒ0P,0 2@`p|oP8A0AS 2ŸB0  @oq, 0R(KW WW G pW 2r>K po01S 0 0$ BL 0! L! 01H 0 0HLĝD 0 0@0@hF@  s7PB D0S 81pp 0 p0!0G@04 1 ,K -`0P| @pULpG?C.qP H;qD0P F, 7P 76  Q-L 0n -QL`@pPt8 Q Q  |0yw P0P A`4>kthS A00 41klpph -L M@8 ȠH`##8,\$|,Ƞ$H0K/ K.0K-K,K+PK)pK*@K(` E|p p 0K P \0 @`gnp (0K@`noD$K  -0LMp Q@  0R,K01g _K3 0PP  H`K(3 T0`PP3 `3yK ZEP$o  T> -2L`Qn0PS@0@0St2 0S\2BnP   0@0S02 0SPP~3eEp v1G PH1 0 0!001!@XXH80` 08 P@?*. *fPd1U@?08 0``414!801!1(!(10@!0*@'k1!# zh B= B0G ` X00[-G 4@0  @00@40 @000h:mtLvkAk=:ȣ:D:l:Х:ԍ:0:86|A -p1LMh!p`A$ p0S@ R K$ KP;$0 SP@! `$0`0dS$0   S@ȠK8#蠑ࠁ,Ƞ@ 0PPyPP ~K8 #Hw@ h0@cPP0  0,uV?Cywk|A|A -L M@03 @<K -LM 0 @K@+P[K -4LM,2 (B`( $ p 0S@Q$K( KPP  0u1ol K$p P0R0O R3 R? R= 1d/w 0R0O$.K0 PP 0A P 0  @ wEu^i 0.@K@P (0 S@181#1K#8!#8! PpP T(00dpPP(0 $k|A|A|A -L M <#83 ~ K p-LMP0@!`0P bxP tx1kKpB- _lP\π Pt P0S04!4000 P P 0S PKP0[SSS0 # > R K 0P 0 R p0 R g0P P!-8 0,-jAkjA(o<:1k: -L M0 @" @K -LM@`P&pKUPD0v P!0[S S X0 K -L`M|K`@P  P, p0@A$|0KV0Cy Kx@KvPKu0KzKw`K *@ Ƞ,Ƞ 0@@ P, 0R (KG4s0KtpKV tK _KM$oh> -L M@Ƞ,Ƞ0@ wK -L8M0TpKP`0 $0 @㣡,0' PKRKT0KQ@KS@K2;: JK.3: 00*0K*0K& Kp0f0 /0)K(0K0'K%0KP $ 0R  KU KIPU0[SL$ox> -0LM @RP `Ktp X0 S K U0 0KP [PP -@LPA5p=`5uP klpCMP klpF, AC <i@ 0-8L@@0P`0A4vfC=Pk@0Pk00S g@0 -L|MĂ0PKp (0 w3· 0@P ( 0R$K蔠Kl ɠT2T" 0Q0Kh @2 K@K@K @K K K@KN21Cc!0 0K#0P+ K0KKKK@KPK9S@K SPK00K&MK@``KP21Cc P U `L)KLIdPE 0*KK,@K)PK+PK l @P  >@P@PP 0PQ@P 0H@Py| 0?@Pp 0P7@Ph 50P/@`K$o>* + > -LMpP@5@%`P)sP!414ABm<` 0mP" ?5@0;5?e@@ 0? K5r1rFP 0 C=mPp@p p0F-\, ` `ikP ?0jAjA6 0: -PL@`p@10&S6:::::::::::::::::::::::::::::::::::::̤:̤:@(@3%1 @;? 4P@5A0AS@4@D50590 R0˸= S @S @ (00  0   -L@e4P 5A0AS 4@ -L8M쀟0XpK`4 @P$0 L)00NKX0KVKO@KT@KS@KR@KQ@KP@KWPKUPK0L)|0& KQt0.PK d0@-K- K*0K4 0C7%0K(K'@K,@K+@K)@K1$ 0R KsJ$o> 0-0LPhPp00S S 0P P.?@00h>0h p0@ 00CSP:X:`:h:H::p:x: P P@7P,@nPX@l`0 $H0AhSw`:x:x:x:x:x:x:`:T:x:x:x:x:x:T:x:x:x:`:x:H:x:x:x:x:x:x:x:x:x:x:x:H:x:x:x:x:x:x:x:x:x:x:x:<:x:x:x:x:x:x:x:x:x:x:x:x:x:x:x:x:x:x:x:x:x:x:x:<:x:x:x:x:x:x:x:x:x:x:x:x:x:x:x:x:x:x:x:x:x:x:x:<:x:x:x:x:x:x:x:x:x:x:x:<:0 0 Rj Q Q0-L@P   0@T  08#0`08#0@jPjܬ:Ԭ::Ԭ:Ԭ:Ԭ:Ԭ:Ԭ:Ԭ:::Ԭ:Ԭ:Ԭ:Ԭ:Ԭ::Ԭ:Ԭ:Ԭ::Ԭ: :Ԭ:Ԭ:Ԭ:Ԭ:Ԭ:Ԭ:Ԭ:Ԭ:Ԭ:Ԭ:Ԭ::Ԭ:Ԭ:Ԭ:Ԭ:Ԭ:Ԭ:Ԭ:Ԭ:Ԭ:Ԭ:Ԭ::Ԭ:Ԭ:Ԭ:Ԭ:Ԭ:Ԭ:Ԭ:Ԭ:Ԭ:Ԭ:Ԭ:Ԭ:Ԭ:Ԭ:Ԭ:Ԭ:Ԭ:Ԭ:Ԭ:Ԭ:Ԭ:Ԭ:Ԭ:$:Ԭ:Ԭ:Ԭ:Ԭ:Ԭ:Ԭ:Ԭ:Ԭ:Ԭ:Ԭ:Ԭ:Ԭ:Ԭ:Ԭ:Ԭ:Ԭ:Ԭ:Ԭ:Ԭ:Ԭ:Ԭ:Ԭ:Ԭ:,:Ԭ:Ԭ:Ԭ:Ԭ:Ԭ:Ԭ:Ԭ:Ԭ:Ԭ:Ԭ:Ԭ:4:      -(L`P@""4"̠00S0p a0V V 0  04Ƞ8,Ƞ< *;"*#"#? ## 000 0 000000BFV Ƞ ,4V 0 8000L0Ba21C0aT  Q  R ,{0 0 颋.P0:8:@:H:P:X:(:(:(:(:(:(:(:(:(:(:`:840,($ ????????08 Q-L 0ep R0-LP 0hn0 @0C 00@d B  0@8C-+d80eP 0F 0hEL~Ap -LM⨐ eP# e<`? p0K ,K0KFMX T0P/K @N+K0.K-K*PK)Keh< g(Kp: 0-CML0@P0PS g000U00 -LHMhP$lCt@$H(K(K'K%PK$@K#`K!pK&PK"0KhP s hn Kp~A -0LMPH.l$|. $H@0(K(0K'K&K%`K$@K#pK"PK!PKhP Ys Bn Kp~A 0-0 @$(LL"(P0 $("(( 0$("(0h 0-0 @$(LL"(P0 $("(( 0$("(0h   0 R   V p-X0(  Q@P PL0@`[o| x phs -d@L h8#H,"(a(R -(Z(R  hRfdh -LHMhP$lCt?$H(K(K'K%PK$@K#`K!pK&PK"0K,hP r m Kp~A F-0- PL@0NB 8Cb[@Q \00HS X00 0R B0HSQ(0MdP 0F 0hIDp p-0L M`?0P.L"0K.B0"K K!KK@K0K PKPKPKgP[KpVr ?mp~A -4L@8$   08 #(hD -4L@8$  08 #(hT -LPp`@  @ThhmT @46%CA($H"(0H$(1 0p? -@0L @R ,0 )0 @ h $) (0-"(LXP`@M^ @T(l0T O0~A -LPp`@MA @T,hlT $("(h-4? 0-@LPT T$ 00C0S 0h p-`LPV@ V@@|0 A QR@ P@  ("(0(  ("(ph p-LP@@;dT hP dT81lp,`@0 @x@TpP?4> -L@0:_#`P00V0SOp3PFl#0Pp1p#S,8:t:̽:̻::ȼ:(#$3!3yDp V ""2! "8S 8S FV  FNe ;iD2!\ (""2!#)D !!1!#@ !}1!x#)D rVP! -lT!gP1!b#@  [$1!V#)D P0V  I D @0!;#)D 5 k -/8 +<0!& " -X>T>>>t>>>> -LHMhP$lCt? $H(K(K'K%PK$@K#`K!pK&PK"0KeP p k KpA p-LMPK 0@[0 0a[0aKQ[e%%% %`  Ƞ!`0 ,Ƞ  .P 0 P3.0G-  0G- <0x 0-0h 50LSP0CS005 0h[(j00 @0@0h? 0-PP#C C-0$ ß  P`8cPࠁehß, 0R(K> PʐX 4!R Rڰ8S S0 x q#H0820 007\mX 494@D 1@D )@H$H@H$(D崑8 < 81S'\ji 74D( 0@0'PS@ @ G0 0/.000b0 q @B `P_7HCM0$@006H!080 $<8\p '.0 |8P֖! X 0 P P`bP@ ῖJ 44@D+ @@H$D p-LM5`=@SP x 10R''  (8 0C(800  P  # hPn1  050 (AR?@q8S q B 1AS P1 RK0A@T:0S*DP  " K┖@P P  " *P Q0#0 0@0@x0 Rʂ.0@ BT0S*0 0  P 10R!!  10C15;5xxd -$1LM`p@)pKaPP  00 aP` (KȐ  )0K p_apP ` 00+V < 0 p^ja@o`p 0-0CMLP00$@0P.aPt ;aE=P$0@ T0<g* 0$g# 0hdp A@A -RL@ ZZ l gZ& 0 0@0@50`p lPM 0@H0 @ m40adAd 0-0@ L`0P `P aPP ;ㅕ 1  d0 0TKg 0<Dg0@g$SdT[  "PP@ $K8p0(3NpF-0 N;H =qU 0621C! c.  P0GU1 `1P@, !ܡB=0  2b@P k ff@1B} p  0b@P@P `fk Lf@fP $f @A!ˠ0C- ~]_P@"(R B 5RN n  08#(50;@05(R  @[ B@UTTfN>"VSp|tAAx\AK\0!#R0 0@0@0@ TD D H! こpPo ;H!姓1 se)1_ p00p0pD0T 48<#8:#:0 0y3@A@ 0S) 01  DL 1p 0 K p0C 0D<0 $1 1 0H! 1 ( eu$o:? -@XpB]PL`%XE ,U;F R; 0 `Xp -1L@[P*10P 8R:4: : :l:႒ a8S (R8s#@1D (0C8p8p0[PE ,g;8ps8hS d'i8SSỐpP  CP /ThsdS<    hddp(Af,? 0-DPL@8[P 0?[8S 0hq]0#p -L@FX4P 5A0AS 4@ p-PLQ2F= `/0 2@BW_00S 0@X1@P \00@P l\:]p@P e\3]kdy1pE ,\:0  F U:p -LMPS VgP 4(KocAM4@ U[`P-[3#0PS@0@0S2 0Sڸ2[P   0@0S|2 0Sh2 r 0 r TT2T"0 E ,0 Q8(2("p F p F8 !B] 1!`<3@2P0 oc18 㤨xx @St1p/WN>0@T1T!8!L1L!10@!0 `,W1!1#3!9U  X0$ 0 D0C @<0D BD0(K(Koc (Koc(KocpAx|tL:\::TA==:::l:::/,XVA(AjA -LM 0S  0 Ƞ8,Ƞ#8 ZP 4> - 00 LR s  0 0-$@0 TLP,00  0@T P0 P 00 0-$@LTP P0 0@T0 0-$@0 TLP,00  P0 0@T0 0-$@LTP P0 0@T0 -LMQ@ 0?.C""0^b [b萁AA -PPppL* 0 $P `U 80S T V0@T404040@S>TW H0 ST404040@C>cA -LM00`@Z 0| pp  0$  0QL< P$ R 800 QPR 4!P00P0S  Y00S P<0W)< < 4<8  4 0 4 @Kd d0, @@ 0 @P $000S$ 0040$0$40HP(00(0(K b::A -LP00S 0 3@Ń 0S 0 S ?>#R 0-X0L @! 8T0 $4T0P $84X0Q;+S  ; S80  ;0R 0 S0@@@X  (RPH0RA0R #R!&R #X00X0l7LT_5 -X0L@l7 0-X0L @TP= \0 C K -  !`0   [ h v D\00L  00h5L0& 5\0  L( 05L0& 5\0L0"5\0  L0# 5\0  L0# 5\0X 0@ X h00<0L 005X0L0 h X0+0 B}5`0  LX  0h0X 0C+ m5`0  X 0@ X h00<0L0 0[5`0 x 0-TL,0@ 0P 0P 4g0St0 gP S tx 00PPx0S -TP 00LR`p @$<0 T ,00c.@'h-, \00Q0S 0-(0LP0I.X0@08X0 T0$4P0T 0h- p-X0@L$!;98 T8}H/PE/dU 8 T0$4` PL0S X0  p8;T$8p 0-X LP@$ `0   @08#  P=8#0T$8 8T$8 <8TDX04R 0\ <C308#(  ;8#(`0 ;8#(0T$8 8X0@ `0T*, <8#(0$8 8T$8 <80 X000 Xa+I0@.}T 8 T0$4 @ @000l@X0 4})60CA : 0-LTP 5& 0 08 $4T0@8$ 4@h d0R 0h Sd0 P0d@Ap0 -T`L0@' 2 1C P ^{_Y$8 80T$8 8X0@80T$ 8 $84  X0  h>A -Tp@ P0P,@`L8 T0$4T0 P8$4@,0 0,0T0$84  00 P, 0P 00S0P 000 00P0P8 T0$4T0P8$ 4X0@@ ' 0PVP0P(0S  \0P`0  8 T0$4T08$ 4    0PVP0P  0PVP0PP0P 0PVP0P    0PVP0P@ 0PVP0P 0P0PVPP0P0P -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84  00 0, 00 00300  00000000T0$8 4 8 T0$48@T0$ 4  006000T08$ 4@0000000000600  006000 006000@ 006000  006000 0-@L8T0 $48PT0 $4<#38T$ 80 0-(0PL@ " 0ES::h::0% 8T0 $4V>0$T8 8Z0090 L0"S 0 L0"S 8T0 $48;T$ 80 L0"Sp -L P > p-`L@P  x9](0pL0 P8 TP0 X0h T$8 40 \pph>@A> -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84  00 0, 00 00300  000000008 T0$48@T0$ 4@P@:4:4:4:,:4:4:4:4:4:4:4::4:4:4::4:4:4::006000006000006000006000006000 -@L8T$ 08 0-(0PL@  0ES :$:p::0%X0070 L0"S 0 L0"S 8T0 $48;T$ 80 L0"Sp -L P @> p-`L@P  p7\(0hL0 P8 TP0X0T$8 40 \pph@>@A4> -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84  00 0, 00 00300  00000000T08$ 400000   0000000000660000 0-(0PL@  0ES@:X::4:0%P00j0 L0"S 0 L0"S 8T0 $48;T$ 80 L0"S-p -L P d> p-`L@P  pj[(0hL0 P8 TP0X0T$8 40 \pph)d>@AX> -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84  00 0, 00 00300  00000000T08$ 400000  0000000000660000 0-(0PL@  0ESh;;;\;0%5000 L0"S 0 L0"S 8T0 $48;T$ 80 L0"Scp -L  P > p-`L@P  pZ(0hL0 P8 TP0X0T$8 40 \pph_>@A> -@T08 L$4@ R\ &RZ X0`0B%S&;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;d;; &R& 0T$8 88 T0$4Tp08$ 8@0&S 8T0 $4:89T$ 8 < T0$8 4PT$8 08T Q-L| p-T` @00@,0P8T0L $4T0@8$ 4 ,00,0 0@0@C0@ @0@pX0 @0@ @0@ @@0@0@ F0@0S p36@0S0@8 T0$4T0@8$ 4 00<00p p-(0L@`P# 0BS;;\;;0% m0 8T0 $4T98$ 8"pp<p L0"S p L0"S 8T0 $48;T$ 8p L0"Sp 0- @L8T0$4T98$ 8P}U (T0$8 4 P0 -L P > p-PL`@z  Y(0$L018P0 0T@?>C2@0 0 X  8@0 SC S  T0$84  \ T0$8 4`phiX0  8T0 $4T@8$0 88T0 $4=8$T= 80$T8 8P0X0 T0$8 40 S@098$ T8P0@0>@A> -@L8T$ 1<8 0-(0L@P0  L0"SU U U $000% Qp030QY됄A p-@LP`bX(0L0 P8 T@00X0( R XphQX T0$84  \pph긄A?܄A - 0LT@P0 3@50  S R ? AZ -$0Tp @0 ,@0`L8 T0$4T0 P8$4@,0 0,0T0$84  00 , 0 000  0000008 T0$4T0@8$ 4   ! 000000 ᩅP 夅P8T0$X 4 000 0008T0$ 4 00@ 000  000AuB -(0Lp L0,S@R R R 0%  T08$4! 0%R T0 8`$@8P0  0T$8 8UXA 0- 0@ LhPP 00 3@5 ? 0P  P00?uBA p-L@P`cP  W(0xL0 P8 T`00X0T$8 40 \pphV?@A?@A -T` 0P00,T0L8 $@4 ,0p0,0T0$8 4  00 0, 00 00300 0008 T0$48@ T0$4 00000 0000000000 660000 p-@Lx8P$`T0 8@40 p 0-(0PL@  0ES`;x;;T;0%C00"0 L0"S 0 L0"S 8T0 $48;T$ 80 L0"Sp -L P ,? p-0L P3 LP@`( 0P?> S0P0s  V(0L0 T`8 0P X0T$8 40 \pph?( P 0 3L ?,?@A? 0-0BPL@ S ;\;;; L0"S0%$u00 L0"S 0 L0"Shp -L P \? p-`L@P  tU(0lL0 P8 TP00X0T$8 40 \pphc\?@AP? 0-(0PL@  0ES<;T;;0;0%L00+0 L0"S 0 L0"S 8T0 $48;T$ 80 L0"Sp -L P ? p-`L@P  p+U(0hL0 P8 TP0X0T$8 40 \pph?@At? -TP 0,00@T0L8 $p4T8 $4,0`0,08T0$ 4  00 , 0 000  000000 0000 00 -@L$8T 088T$ 1<8 0-(0PL@  0ES;;;x;0%z?00Y0 L0"S 0 L0"S 8T0 $48;T$ 80 L0"Sp -L P ? p-`L@P  pYT(0hL0 P8 TP0X0T$8 40 \pph?@A? -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84  00 0, 00 00300  00000000T08$ 40000000000@660000 0-(0PL@  0ES;;;;0%)z000 L0"S 0 L0"S 8T0 $48;T$ 80 L0"SWp -L P ? p-`L@P  pS(0hL0 P8 TP0X0T$8 40 \pphS?@A? -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84  00 0, 00 00300  00000000T08$ 4 0000000000 660000 0-(0PL@  0ES;; ;;0%d000 L0"S 0 L0"S 8T0 $48;T$ 80 L0"Sp -L ;P ? p-`L@P.  tR(0lL0 P8 TP00X0T$8 40 \pph?@A? 0-(0PL@  0ES!;!;";!;0%t900S0 L0"S 0 L0"S 8T0 $48;T$ 80 L0"Sp p- 0`@LPaR 0?.C""YR(0L0 P8 TP00X0T$8 40 \ \0 `0  ph4ph4RT0$8 4`꤆AԆA4?A0 3$ A5S ?>S @ -T@ 0LP 0, 008Õ4_ p,0S,0`0,0834p , 834` , Q( @#0B0 RSQ8340 ,00000000008340 , 00600 0060000000  @  \0  006000 , \0 @- 006000006000@3 SS834CPp \`,0p 006000\0  006000 00000 -TL0h @8Ô4S`\p,0h  834S`h \@,0h  -T0X Lp Z @ }Ty 834` ,: S@@834S@0 \`,70 834S@0 \`,<0 834CPh \`,0h \0 48×4p 1\834S@h \`,0h 834S@p \`,0p 834CP` \`,:` 8×4p 00\X00X0 -LM(0p R R1 R  N L0"S'  L0"S5 @834` ,Pd@d0h 0Sd0X0d@0X0' L0"S5 0X008Ú40 ,0q,Q,  Qb Q{ 834S@h \`,0h 834S@p \`, 88p 06S\ 834S@p \`,C2@0( L 0P80TP 0h0X T$8 40 \pphIX?@AL? -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84 00300 000 00000$8 0T8T08$ 40S4;3;3;3;3;3;3;3;3;3;3;3;3;3;3;3;3;3;3;3;3;3;3;3;3;00660000 5;00@ 005<000000000 0000000000 000 -@LP0X )  `0> T$88< 0R# C2@0 T` D 0 X0|2P0xX0 0h0h0X00X0P T$8 40 \YL0"+X0 P L-+0uP`3\L  0muPX L# 0~L#,0vL&*0oL0&!,gXL00@ ^L00-VT0$8 4`ZuP X3#(x0(Rp0P0y h0Rd0P0t \0P0qL 5000EAL?@A?AW? W?? -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84  00 0, 00 00300 000 00000T0$8 48T0$ 4 ! $ .  0060008 T0$48@T0$ 4   006000006000006000@ 006000 0-0BPL@ S HQ;P;0Q;$Q; L0"S0%R0n0 L0"S 0 L0"SEp8T0 $48;T$ 80 -L P ? p-`L@P  tsF(0lL0 P8 TP00X0T$8 40 \pph1?@A? -Tp@ 0,@00`L8 T0$4 P8T0$4T0@8 $4,0P0,08T0$ 4  00 0, 00 00300  00000000 0000000000 660000 0-0BPL@ S LT;S;4T;(T; L0"S0%@00 L0"S 0 L0"Sp8T0 $48;T$ 80 -L P h? p-PL@`  E(0L0 P8 T`0 X0h  T$840X  \\0 pphkL' 0bL' 0Zh?@A\? -dT`0LSP, 000,84!T0$4T0@8$!4p,00,00S ,0 00 RET0$8 4 000 CE8 T0$48@ T0$4 000000000000000660000hk70A,A8A?A -1`LQPp@(0 0GS ,X;W;DX;X; L0"S0%J DL0 S  L0"S0% `8 T0$4T0@8$d 4@d`d0h 0Sd0P0d@phk?A7 p-L`P@D0 R$(0L0 P8 TP0 0h X0( R pphD T0$84  \pph[ }DLAhk?܄A?A -0 3B5L  ,0QrP ? uA -D0LSp8T$ 08$8T :8T$84 8$@8PT0 8`4; 8T0 $4:8$T#: 8$8T 08$8T 08$8T 38T$8: 8$@8PT0 8`4; $@8PT0 8`4; 8T0 $4:#:$8T: 8$8T 38$8T 28$8T =8T$8w0 88T0 $4:#:$8T : 8$8T `28$8T H28$8T 028T$8< 88T0 $4:#:$8T : 8$8T 18$8T 18$8T =8T$80 88T0 $4:#:$8T: 8$8T 18$8T 08$8T 08T$8< 8$@8PT0 8`4; $P8@T0 8`4; $8T 08(h[e A` -L@Lh 0-D0LSP@?X0T 8 T0$4@ 0$T8 ;8(: -@LP0\ X0,B# 0;8T $88T <$88$   L0"S 8T0 $48;T$ 8 L0"S 0% P0T$8 400S,e;e;e;e;e;e;e;e;e;e;e;e;e;e;e;e;$e;0% PD0S>T08$ 4 >d0h 0Sd00d0@ 6S0 0S, ]S% 0$8T 8<$8T 80T$8 8_`T08$l 4 dPO0 +0S, P -L P ? p-`L@P  TA(0$L008P0 0?>C2@0 TP D 0 0h X0 B40 \ \0 `0   P0pT0$8 4`?@A? - pLT08$48?N T$4$0 0nP$} 0I+S,h;h;h;h;h;h;h;h;h;h;h;h;h;h;h;h;h;h;h;h;h;h;h;h;h;h;h;h;h;h;h;h;h;h;h;h;h;h;h;h;h;h;h;h;, o@ZZ q8@$PT0 8`4: $P8@T0 8`40 ZZ =$P8@T0 8`4: 8@$PT0 8`40 $@8PT0 8`4: $P8@T0 8`4< b$P8@T0 8`4: 8@$PT0 8`4: 脍AA -L+h -Tp@ P0P,@`L8 T0$4T0P 8$4@,0 0,0T0$84 00S0P  00P0P T0$84 R0P@P0P R0PP0P R0PP0P l?0P V0PT0 8$40 0S  <00R6P0PꬍA -RLpP`$ R5 R  00R h, W00R0SZ L0"S5  L0"S 8T0 $48;T$ 8 L0"S 0% n 0So;m;n;n;m;m;n;m;m;m;m;m;m;m;m;m;n; p@6S$8 0T8$8 0T80T@$8 800S 0$8T 8 K?K,K  <0K%P ,0 h 0 00 R( PK@P00\00S T }<   < @P  pQ\ T0@S0T0T0QT0< (p3:QSp     -W`P  0@  0 0P W`ʤQD KT T0@p  0 0 @; 2ᇓ  00 !20@ 5   1(Z   $0   $ 0@, R @0  0010 %0",0 @0  0@ P_-@( 0PW-@ yByB -`Là p" P x| $0 #x 00| Tx@! |0\ 0i[ -遒ၣp LM@P`   0P, f(\0000    0 $0 ,  00100(P@P"!B0,5 0P(P 00 P% B 010(\  $0  B 0 @ 5, d0%0!D0,(K, 0, ,zB- e -2@001"L M`5PSp (K,0K(080K 0,pP  0TpY,=00 0 8K,  04pP=008 0 pP  0p5, 0p.,% 0pP  0pp, 0   pP  0p,hzBzBzB{BX{B -pL`@P30  0 t0S#PUO aP3003 -LMp,0 Pt@`ph0l hl0 0X 0  0  P#0 0X 0  P,0  0 0(K$@+ 0  $+v{B{B -8 LR`p+p@PPLR@"ڰ5Sx0! |$8  3WP8 p $[+8 PLR@{B -80LS@-Pp80PSp$x0 |$0S`3#P 8(+x0 |T80PSp{B - 1L@0@ ,8#8@ p\0` ,0` \80 PU@`$PU@` 3B@ @P80 0*80P{B -0pL0@ ,80 PU@`$PU@` 3B@ @P80 0*80P{B -8 LR`4@P5S)#200%10Rp 0 0QQ+ 0Q( <Q% 0Q" 9Q :Q x0! |$8 PLR@OP8  4S*8    hMhbiMu{B -x0|`L ,8pQ&@PPLQ@ڰ5!S;2 3P8 $0*8PLQ@{B -80LS@-Pp80PSp$x0 |$0S`3P 8)x0 |T80PSp{B -`u Lhl8 R$@ PPLR@ڰ5pS5 3P8  $)8 PLR@ {B -P `lLhyW plht8 R$@P 3sP8 8 PLR@ ڰ5SU UPLR@ p-LM`0 P$p0 4@0$0 0 P $xhI) 0$ 00 P $<xh7),0( 0  ,0xh7{B{BXk -LM1 P$$!`p0ba p  aH1@!  0 P $ o(04 <0N>00 P'4@@0  !  T 00   P@T10 $ L ( 04$,o($o(|? |B k0|BT|B p-4LSP`p @(0@TTp -pA Lhlw8 R@ PPLR@ڰ5SX5#20010`P8 PLR@ `P P Z8 -8 LRp@PPLR@ڰ5S5S #20010`P8 PLR@+P P X8 -L@qPh -d2 @LTH` D2p\4U <\L0@ ,0PS;;;;;0 i' i'0S@   '0S> 000`@VT330033= '0#P P' i' i''  0T 0 $  $ 0 $ 0` $@P$}B|B|B}B @|B|B p-1PL$+` 0\ $+ 1\ $+ <\` 0$+,0S;;;;;0 ph;' ph6' 21CA@c@$0 T k 0 (  ( 0 ( 0 P (@-UT330033ph~ ph&pP$}B|B|B -t0 L@P; XpX`$ H0\$ $ <\hP#20 0p-L!0 00P0@!Q%`tPP p% &p?L}B#200 1t p-Q`L`@ń`OPP 05p%&pDyBPyB|}B -0`L0PSp  0\h@0l hPl0 h p-0L P0`S 0 ,Pphh@0l h0l P -B"100a`10LxP\"Td,100`10x W"100a10|0pS;;;;;0 i% i%0S@   .0S> 000@XT330033D %0#P P% i% i%%  0T 0 $  $ 0 $ 0 $@|?P$}B|B|B}B @|B|B - 0L@p4 PP0`b@D@ 0SP :0S:  Dh  @ 04  0480 ` -LMP` [2p 4 >04 @Lk 84 (b $ 0@ |P %$K00 %%y0t0 S0 4 !A> 000\ 0 506 l1l!<X0d 8 0(K$P9 0( ( @p(  `@1,Pp* W  $80S P@ʯ80PLS@P #20010p5S X\$P$W @$$P}B}B @ܣ;<;D;}B ~B}B4~B FA -L`P@p3& Wh儀l 000 # '8Q 00B90908 809 80h40 lpWOi# 9080Q #:0881 # -L@`p0# 000  083 08P 00B8090908 \^ x!0| Th{ 908PU Ѷ# -P@h0Ll@ p# 000 %8P 00B8090908 \^ x!0| Ti: 908`V Ѷ#038 0:0S0:0 -LMPph0l@ 4 h0lH h0lD , h0lT 0 8 8`#' 000 rO8@080T8@00C9090T080@ 0,0 0  0Xoh00lT h@,0lD h 0lH h@ 0l@ 80S 4x!0| T(Ko 03   90 ,0.8 08@, 0  T  @8 0 00<  :0080 80 80 8@y_?\? -LMP`h0@ lph0P l@h0WT X l, ,0 - 000  :0 S#5!2!50 008 020, 0, 88\080900 808 0CR900G^h0l@ h@P 0lhWT X  0l, R ,x!0 |T(Ko 90800 Y 0  Ѷ -LM`ph0P lhlX h0Pl\ hl` @90h!2# @0,@ 0 Pc@+ 000  :P! d00@ 00, 8 ,  #0  0$0 / 0d8Q 00B90809008  P@Tό00S x!0 |Th0lX h@l,0` (KoT 908 Q 0dж#ѽ 0d d?k? -L$MH 0 R h0l@ 4B40h< D l!02018 L0 L 0H4 D0 , 0@ #+ H000 aF003 0S 8P3P#0<02 < h0l@PH @ (6H @ 0,Z㏏0 , 4 RLH0 RU h<0l@ h@l80D (K 03 0S 9424"002<0< 4  0*4 0 RV :1!1 D  0<1Ì8 < 8 4 04 x4!0 |TH~0 RLh@ <0lh@l80T h0lO 010 BL 8 < ;80 0<04 "Œ< U:0 0 <  28,0 < 8 9404 0<04 "Œ< ~????p?w?~? -L M< h0l@ h0`lD h0PlH <h0l@T H H0<  < 01D T" !0 0  @P04@ , 8P 00 @` 0D 801P %₡140@0 4  F5003`VOh0l@ h@80lD 0`!Q h40lH h00lT ,0S Hx 0|T (Ko 90 , 08 , *8 30S:0 %90@ 08 0 ,*ƌ8 , :\h0, l<0  020:0 ?? p-L`@P3P UOphD303C -LHMP V|(7 0K$P (K 00 (H 0&Q 6Q e0CQ   D 06,p6QK0CQT:  0D   P6,pp0S. @x|,K  0 @@PPtb 0p 000 0@ @@PL5%00\ 0 405 0t%60X <45P9 [0CP =0CP  l 5\0H ,008080$SH 4$L0P D 4 < @ 8 @ <2001T 0p 0L0 00%5@ 䐊 P @04X 40@0 2\0  `10a8000T0/0 PX\ P0@TplU  U !00 @ PP tD@ U4 01040\ X0!c83 01@a<000T0&.0 PL000T0/0 PP vL x04@CQ1P%0CP*z>CP01` \080!1` d0D@ 8pD@  8pD@ 8p0P 0P0` \00P 0PxBt55;=l;~B~B;T;3X;P;;8BQ q0Q p3Q`3Q T3Q L3Q 0Q @0Q 0CQ 0Q 0Q e?Q >Q q0Q: RxR::<R0 D0v"2QQ:0S0<D  00 j h :X"80@D 188 @ 4, 04 , 3b4-,0`S  8 ,`⏏, I 8YH9a<  < ,0Q4\:h0l@ h@<0lD h80lH h@l 0T (Ko50<:< : 0@ D 0, 0Q3@ 9 `4x!0 |T0:0D 0 t@ 9 H 9b<00<0 {%&$vJ$K$$f? 0-@LPv3 0 3 h0 0@ 0 R 400h  @ r  -LMp @x2hl$ P  $ 0A P - )U $" K t0 S01A0\000506 1!`<0X0d 4`8` 0$K$P7 0$ ( @P$  p@01,Pp U! 0 R 80SP80PS #P 3B@@A@@]DP \`,7  0\}B4~B FA @}Bܣ; U 5 001 `p05 0 5S(K=0010@,0K0K @ 5S P U0 4Q U 0%([%VDyBPyBIT;B|}B -<@PL$Dd`pE@0 <00 tp8;80S@ ]80@S贀B -LMp`4 @P T 0t02 4P K 0PP^PPt' 0  Q#* 0x|@P @ P]p3t0P0 H0H H0D0P L0D`K0(tP4BX;ȴ;t;BBB -LM<0P#4` t0 S0 C0CS7<(9<@9<@9<7<7<49<0601X0<x1 R080080`P80PlS`( <P #20010pA0K  ,0K@nŖ \  0" U5S 80PlS` (, 0 0@Pd `:9d (K0S060060}B @ܣ;$;; -LM0`XH< PP+ xPA 8P> 8P 9P :P h0lP 4 0PP P' X8P$ P8P 9P :P 4  4 (8PP 8P 7P 7P 9P :P 40 8   8 D <000 7R 0RR700t0S 00l'A>000\ @4@5,7,'QQ  0& 7Q# 9Q :Q 6QPPQpp06Q <Q \R6Q00SW6 6@060T&T6QQ H6Q <Q 86Q 9Q :Q4&0&0X  <08 6RR 0CR 880%5QQO 5QL <QI 5QF 9QC :Q@ 80Sp`Ph lt5h@ d5l80pSP0$5QQ0(5x| \x0| $x00| Tx0| $x00| T80SPp8 P 00$,4QQ 4Q <Q 4Q 9Q :Q 4QQ:74 ᇣ 0010<80 5S| 0#QQ# d3Q <Q T3Q <Q D3Q 9Q :Q PC0K<8 ,0K@ ,3,#L0P B C0K<8 ,0K@5Sx 0"2QQ% 2Qa <Q^ 2Q$ 9Q! :Q P 0`"QQ:74 < 804 @0!1QQ9 1Q6 1Q3 1Q0 9Q- :Q* "80p\SPH0l!h1QQ \1Q <Q L1Q 9Q :Q hl40P (K 80p\SP 80<80p\SP0CRIF0CQ07' 4)%q 80p\SPʰ060s0CQt080Q07xthMhbiMibu}B3Mܣ;0M8M`;; sE s ;;;`;B -LM8 < "80S"4p4  00S S S S S 4 0BSP! 8@ t0 S0 ,#,3\ (#000X <04504  SRm6800 R{08080`P- KP! 0 2ᅃ0010 Ÿ8, K00K5SE @@A0 @@1!&80PlS`Ss!P hl@% 80PlS` R5 R7 R5 R3 R1 0BS40RS l@hP[ 0 0[ (K8 0BS06080SR4 R060R  40ASh@lPQ W0Q `h@lPU L0U UhPl@Z AZ 0J0 @Y0K 8,0Kmi}B @ܣ; ;;BTB -LM`< 4 ; < t0 S0 40S0004 00R;00L#L3\ H0h@lP<#040X <85S 000S h@lPP 00P h@lPC 0C h@lPM 0M h0l h 8 0l h0l  840S]80SGPp %80p\SP: P 0S #20010<0  15S 4 P1RLA0K@<,0K  @25S P-5S  0 <80p\SP(K y4 0R000C60J40S006060Ch@lPK N00K V8  40h 8 80l 5S}Bܣ;;;BD;; -LM<0P#4C t0 S0 \!\1\ X!000840<56X (18R:0004 "80S4`p80plS`+ fP #20010 0 5S @0K  ,0K@Ŗ\  0U80plS`(KX}Bܣ;4;D; -LMp t0 S10 !00\ 0hlT h@lPA 00A x!h040X <85 l Dῠ8 l@ h@@0lh@ 80S4P`80`\SP+ P #20010 0 5S x@0K  ,0K@ŕ\  080`\SP(Ky}B ;@<\; -LM< plJ h0< 8 <0#4040 P4`@T 0S 00600/-<t0 S0  3#00\ 0S3000 40< 850SQ 000\ 0 506 D1D!X0080d << P"80S"4`80`\SP! iP #20010@,0K0K  @5S X80`\SP(K 04@  04@ (\2R:0R60RP0CRH0CRV:00000#20010840 $5S A,0K0K84 @)5S8 40d1Rz 1R |1Rs0CRp*90CR060lP"5S X5St1R M:=B 0CSI0R 0CRAi0CR 0CR99:h00 l@ |0R 0R'T0R X0R =B 0CS}Bܣ;$P(o&$.0v<8l<\k.Q@p3D 0-LQ@l4 04PST4TS 4TS D4H$T0L4P$T4X$ 0-LM@\# Q (PU $0 B  $  8 00 008 -`"LÐ0PHPlE@" 2,p\^P` "0 \3"RB.+0\3^!0 \3P!0C.\2@S1*3d0C`!S00#A.\3P$!L5-\2S-0C$S%L5S45 Q00+\S0S03 ,#4p \3\ P5\2(8$8888 ` ` 8 p(8,8 p-3L`,0\#T5P1"B/\Q T5S3 z?\p"@0QŖ`"F/2,P\Q0@0("E/\3"R. +0\3#6I@R5@QC SDH @  SDH @  SDH @x#1R @Q3QC 0AS#0,\3P(!.0\3P!5J/\p3 ,#4 \3*,#<*\Q3@  0\38 X5\X (((((((,(2S 0 02@ 0@02 0 0  0 202 -3L@ ,#1 \ -3L 0\ -2LS 3 0\3 0\ -Pp(0` L@P8 8  (#8880P  0-0L(@PP  800 - <L0(8P#8  - L(@0P0   Rp@-P`0 0  0AS R 0ASN0@0 @ 0@0`00 p0`00p -LM3S1 3 ,(3)4F8V,TfXv483,,\F`VTX3,,dfhv\`3d,,lFpVdh30,,tfxvlp3+,|FVtx3+,fv|3+,FV3`+,fv3,+,FV3*,fv3*,FV3*,fv3\*,FV3(*,fv3),FV3),fv3),FV3X),fw3$),GW3(, gw3(,GW 3(,g w3T(,$G(W 3 (,,g0w$(3',4G8W,03', R088#8Y.0(K P -LM@ 1xPP:5Q0c000‘ 0Rp`R:%R 0S0 0:%!V:u!:%R000:%R  Kw! 0 CnC`FR p S Ki! -LM80 0 @Pȥ} 5Syڨ5( "4 \E 000  ŕ4 (` 1BV@  $0  Bŕ $`pVp 85rK0C50p@ Q0a@2Kp2S0A8@p#Hp 0E #P00R00S \S$ |30C^t5P05 %!055 !(\ 04 00 1 5ZSȥ(K|3^x30^c? /T0D8#H @* K5S5 101[Q % 00a 0"[00b05`e0 00W 0 0@0@e00 0 tP  㡭0  00eex30^(\ 04 00 ȥ 5%PB -LME`T/ 0 R&p0pS  5(PU $05$y 005\0 @ RET ;055S05P ] 055 -LMEPT8 0 R/p @Q (0Sڜŕ(`V  $0  Bŕ $P / 00Q %00@0p RʘET 055S05 -LMhĐ@p  p 0` PP  <>00 0(K 000p p *,PP  0$0 0 04PP  00  0hĘ0  P00PP`  (0 8ꄄBBB@B -L MA0P@ 㠐P `K0h$S%@p0` @Rŕ 00 0 `Pp  L(\ `  $0  B `xBB -D0@ L@ VP B -L MPP%@0h$S%Ep0 Rڜŕ?0 0 ? 0 `Pp @ p\ KH0 h0C ŅŅ\Ņ(@ T  |5l B -LM%r1G@`PU  H.70 ;UP5705; 00x#0CR9Ŗ 0P-(\  $0   (\ 0 00 P| ,0@(\ 0 0 0 505 P1[<8#8 1Kx/^`K  -1[:8#8 1K3SH%m#P P1[<8#8 1KH% p-@L `1!!|1|!xÔ8!p1p!LA0`1d0 0@] P01,1(!30CS- 0# 0 0& 02S 0{ 00v 0 q <ph2dS`0 0+@.@^ 0Y<<<@R 0C/000 /  0 4#X4`P V TxP4x#x%x輆BBB -L Mlp P (KF͇KKN @0 P @PHP  Q- !20S' @S@@'T l4 0 D`͇K 0EN]  0@`P \0ASl4 ` E·EM] @P0 P@ P`P l4,K$PP D}\t, (0@,  0p1,P fT a_iZ2S al4K 00K倯P 0 lė 0 03h 0\3L 0\=B0BpLBhBxB( R( pdP Y> RdP  5Ŗ 5("80x2 Ah0PUpP @W0 0dp | %5%05l$70t0 2 S t(Kh(\ l $0  B ~ 0RS570t 5h(\L l $0 B D06SUClY> ( a("( 0` 0l00(\ l $0  B 0 400%p2 Sh(\ l $0  B 0 R 3–@x\p 0 \ Y.00j8#80t`@p D88 -LM5P=@S` @5S 2 S h(\ l $0 B p@0  BQr0C2 S h(\ l $0  B W 3^ 5 \P0@DQ 0S*DP 0p5 10R!!  10C15;588 -3L` ,2pSP 8@07 @ 60 68@ 2S2XeP 3P J/5\L@PS/ u @ 60 68@ <Q  0>X ( -@L*p2 0CSx00P> 2, "<0$0K c G 2[ " 2"x3?0 0wP T<2x3:x355KP #Z 2SS  1 S/ S<$,  PM_P4  "ZE$03#LP9$3S8 0060043 , <Pp<`B0B p-L@ld0PP 8T/06m/ph&HQ 0T&Z.Vph*dBv )?-6R 0CR?:000`0 0\06R6R h6R 0CRO0CR*C=B*0CS80 0P!0CR=:0 0!0 0CS񟗖<<<<<<<<<<<<\<\<\<\<\ 7C=B0CS 0080CR C80CR Q00 , / 0 1 0  ,%R R R  0 \0R 0R00!\00S 0000R 0R00@PDP{ 0-0@LTP+?JG, 9:0+\0 ,0 -0L@ ,(0S< <<< 0S0 \32 -0P1PP0L@`p` ,0S ?Q0d0 0000000 B - L0BS0BS0 ,P0S<<P4, ;0 0 P%Y! A`0 FP2[00I8#8`0VP@ \ *0K  QT(K 0-`0LS@" 0S% 3PPU 0 , 0 \0 ,2 003P ϭPU 0( ,0P[ p-h0SLP!hd0SphP0D ,@ 0 \ph\[ 0-40LS@ 00 , 0 \2^0 ,d tPU 0 p-LP^Pp0,, @0,,  Q0@ T T @`0o/!"+,@T d0R V0  0 0R0a0P0 IAMT -LM @0BS`)@K*@K0BS (K0S 0 ,UF 0)0P qd ) [P* KedYX*0[=#=*0K* [P X$ 00PAp0\) K0d)0KŬ ) [Pd 0#4*0K幬 0000 Y'@* K%*0[0 *0KP 0 0 00 P00 '0!,Pꂬ0PU 0 ,@w0U_< S  7 \@`l0@T 0 ,40T  :0,0\< p-L`P@:P0T U00 4 ,0@ @pp蠆, 0-0LP ,80@S S 0S @0 \0hB0 @ 0\0@0 \0@0 \0 ,ګ0@0 \0 ,ȫ 0-0LP ,80S& S 00@0 \0 ,ᤫ 0 \0 ,0h蒫0@0 \0 ,ါ 0 \0 ,o0@0 \0 ,] 0 -0L00 @ \0 ,hB -0L00 @ \0 ,h* -LM0!@ ,X 0 pKP0'` 8#X0 ,0 8 `#X$ X -LM0PH >r4B,8 0R0 0  R0 0  D0B `K 00 0 0 0  \0 ,Ī~c@ 0 0 0  \ 0-L@Pꪪ08#XH0U #p 0U00 -h0!XSL@hd0Si{ip0,0 }TnpW eP<  0 \h\[ 0-LPP 00 , 0BSR8@TB T4 0 @0 \0 ,0@%0 ,30#@0T # 2RS  @0 \H0 0 \00@ 0\ 0 \0 -L(\P@!h"x V:@0w03 fW0SBP H0S 80SI SM S- @H0S]P W@  0,0 X  1 0\R@P  W #$!U0W 0m%P 4SVQ #g!$bW `* 4`4V0(@p -LM0PSD10208#x 0CSp7@`"K! 0DP`/"[V"40 @0S #00S 0 , 00#0 0 0L1S0psH p-LM`KP 0@Px1[80 0 P0![00x 0-LM0@ ,0P0CS*(=(=(=(=`=`=`=`=`=`=====8=8=h=h=h=h=h==8=8=8=8=8= 0 480#0 0 4$440L0H08 R 80S;51K1[ R028#8ʼ38)#8  0 8020#4,0@ 0#4#4080@03030 420L 4H   0480 0 0444#0 $L0H0P 8 0+#V 0\0 4800 3 0$4$$0 H0L 0 , 0R80;HL3  0    \ 89))90b06#1&$ 0e@030KPr1[;#5S1K01K`@0f -L(\P!h"x V:@0w03 fW0SLQ' 80SMU@P0S W  V 11p02: \0 *0 000\ 0@P @W@  \Q@P0 Z @HH@ 1@P" %@P80S@ W1 P8#s4SVQ #e!$_0 "! V08#HDaP W@tA^tW@# ("(7$ B("(0_W- #&!$  K@08#HT# 0 ,2 T 508#Z# ("($ B("(@@,' p-LM0P@`K1K![1[?T08#K  0P@x 0K a c P80S S xx0 , : \埦꺺' -LM `0BSpK/0BS@P1[@Q08#X 0 08#P@ 0[@@ 0K{0UP pKpK0 o1[  # 0e[ Ɍ #0KT] 꺺 -l(LP@"hpP  8804 \$aN -鈀LP@`pP  8864 \04 ,:N -LM K0@0b`pP T1[1[001K1K![pP ٥0 ,0P , <@ ;\0 9\㶥 0 \ 0 \㤥 - L0@6 \0 , h若 - L0@6 \0 , ht("(  B0-RLM0@p ,U! 4`K0& 0 066 0  0   \0 , FP -0L@B,, 0B,\0 , 0 \0 ,h -LM0@0CS0=0=0=0=0=0=0==0=0=0=0=0=0==============0 ,-1 R45 Q8 9 S0,0  S0,0 S00,0,0 0000000 04 ,00 40,  KP1[0?>C20000 00 40, 00040,0Q00,0 00,0 (Qp-L@"hP40S6 S!x0 :380 \@0T) {0 ,@ 0S p x ppdZD 0pp -LM`rpPp@0SS0 ,0L@0 \0 ,) 0 \0 ,0 S S 0CS񟗤==4=4=====TpL1SV SV SW Wd@@T 0#, 0S S 0S0 h#h3PP( C@, P0 ,@DP@$d1U@@T0 , < \0,,@0", 0,,T2P0ࣇ*KpPpP["[@08#XZt@@H$H 0@HpP$,0K  di}0,, <4<,\0@0P!, 0$!\0\1P p60 ,0@ 1\0 ,0St! 0 \0 ,0S@0Kd'IMP[N -QLMP@0'0Sv S$ x0:38 \P1Ua 2ۢ0 ,P QS0SY 0 Px I0 , pK 60' \0 ,`P8#h 0 ,0 8#h$ 0PU0`0D s0do0 -LM @KxdP`!p [P "[00 2KP"[ ("(P+&(0  ("(PW P, "[ ! ` - LȠ ^,Ƞx? ppP`l@PV  d@T0 @ ĉBB -LM`pPUP*28#H2TF  T0#03x0%x05&80  T0@8W# 0 S VW  '@ @ *"(PW t0S x0S0  $ K<0bC0~P  0%@ -LM0P0CS"K` K0@\qP @ 0SSVS) S @"[1@S("(@P t0SV(*("(@P @T0ST(*("(`V 40q@(*("(`N -L@0LSPp0i(\\ P ` 0SS S S0 S ` `;0 ,U("(J`P t0SU(*("(;`P `V0SV(*("()PU `(*("(P -LM 0@ S @ KP P1S1[1[::1K1K![ ` 0-LM KPj@P1[A=A S 80$ , 1[ 00$ \8 p-LM0@SP x`K 0P1[UP 0 S S ,P Wx|A,P x P1[M=I SP1K P1[3;# S1K 0 0PS` 0-LM 0@ S 8PK 1[  P1[3;8#8# S01K $$ vP +p8@ a -LM8 K@P1[;8#8 1KY0` 0-0LS@P 0JPPd CPP 04 8PP$ 2PP ,PO$ -LM P @P t!@P @P`pK u@P o@P1[0S 0F8#h凟 @P @Pw,@Po @P @P` 8@P 2@P(1[Q0F8#h@BP 0-LM@ KPPPT1[1[001K1K1[;8#8 1K8` 0-LM0P),0 ),0 p),0 T),0 8),0 ),0 ),0 (,0 (,0 (,0 (,0 t(,0 X(,0 <(,0  (,0 (,0 0CS0',0 ',0 ',0 ',0 h',0 L',0 0',0 ',0 &,0 &,0 &,0 &,0 &,0 l&,0 P&,0 4&,0 &,0 %,0 %,0 0CS0%,0 %,0 SK00p%,0 L%,0 0%,0 %,0 $,0 $,0 SS0$,0 $,0 t$,0 S0A,,0 ,$, 0 0CS0S0$,0 #,0 #,0 #,0 #,0 l#,0 L#, ^08#,0 #,0 ",0 ",0 ",0 ", 0",0 h",0 L",0 0",0 ",0 !, M@K         x l ` T H <'@@@@@ @(@0@8@@@H@L@P@T@X@t@x@|@@@@@@@@@@@@@@@@@@@@ @4@<@@@@@@$AAA AAAA A@@@@@@\@`@d@h@l@p@PaQaRaSaTaUaWaXaYaZa[a\a]a^a -LM0@0CS`PPP0S 0,, 0( , 0.,p K PP1[ V !K @@01K1[01KFP1[;1K,![PH@01K1[01K` p-LM0@SS  `x0,P K`P1[+  PP1[9 S\  S\ 0 \x -LM K@P; 0SE   KP31[ 0K1K1[![@01K1[01K1[ <1K <K1K(0S:=d:=:=d:=1[;1K![P 0S  ![1[;;1K1[;1KK -LM@\p`0S\?0Ǒ00 PU! 0S= S 0Sn 0 ,?0@d0 00000 PU0S "K P2[P  P0dS S2[@00\0Sl 0 P2KP0A., ?0 0A.\$ KPU2[2[;;2K2K"[e\00S-0A B8(#8"(p-08#8 1K    ,| pp h |\? xP t N[/s q!y012 0-LM@PPP  R KP- P8026 Pҕ 00CS30S' SPP[PP0 , x嵕1[98#8 1KP㤕 PP5P'T[ p-LM`PV@ x 0BS@T7 R R 0S @P0 x0@Tl KA@PT [@ 0St00CS+@P+@P Rt 0BSR! ! ! ! h! L! 0! |!x t p l h d ot 0BSo Z@P\ T@PV R`t0t0S SY-BR@PB F1`#$%'5439`1DP` p-LM1@S xP x@宔 0BS{ 0S 0BSR)0BS KuP00CS 0.\0S S K^P![40 1KPPK MP0 S S| 1[ 4R00:K1K R:1K:1K![P0S X0P`S0XS0C0< S   P![ 0  00VT0 V V;1K![ x0,, <4<,\ pR R. 0BSO0.,0S SZ 0CSL 0.\0S S  P0.,V1[ :1K  KP1 KP)![10 1KBP![10 1K7PK7 KP s?![t10 1K!P![L10 1KP zP![00 1KP  jP![00 1KP:  KYP1[08#8 1K KIP1[08#8:;1K![/:1K![+: -L M0`0CS- @P  K$ K$@P2[?08#8 2K@P0 ,0SR @0; \Q QQ QQ Q Q Q01Q 0SS? S= SSa S_ S] S SS1S2& K@P2[#;8#8 2K[@Pp P@P 0,\ a= \~@P @P}@T @PvP"pK @P k@P g"["10@108#X UZQ00CS&PK s@PLp $;R P2[;2K2[ R 0K2K R@02K R`02K0"[S0K2KP2[;2K"[@P! 0St0S-p l:R)  8@P 0SJ 2[t p08#RK :p R:0; :0<8#8 2K@P 0S S D@Pj0S ( K2[08#8 2KQ>Q.2K@P 0(@ ,P& K@P"[ɟQQ; 2<<K2K2K0A0S2[L=2K 0 \ 0SS S SS S` *K @P"[@80 2K=@P"[7@P{đ0SI BKP(pK @P j@Pf2[60E8#X 0SSS  @PR @PL @PF2[P 2[凑 ]@P 3W0E@P8.#X 0SSk Si S UE@P0"[S00K2K2K2[08#8 U2K@P 2[L:8#8@02KX*K @P"[50 2K@P2[92Ki &0KJ@P2[%9C8#R5: @P%@PA SO1SL!@P& K@P2[#;8#8 2Kq@P7 1S 0S0$@P&PK @P"[40 2KS@P0 , 5 \P @PP2[08#8 2K/@Ps @Pm"[30 2K@Pc @P]2[08#8 2K@PRS]6@JK2[08#8 2K@P< ]@P62[ ;2K*K Q@P*"[20 2K@P &PKU ?@P2[08#8 U2K@P  .@P2["Q "K Q 0`02K2K"[0S0K2K"[@PD@P6t0S @P @P 0 @P2[ 08#8  K@P2[08#802K @P2[p08#8 2Kg@P @P0p R2[2[;;2K2K"[R@P00CS0S0S@PS>+: A A A40R? -LM0PSD1@0208#HP`>( R Q ( 9 Q7Q|  p0S6  R6`00CS%0.<\ 00CS (0@0PP,Z/0\0P(,0.\ K$1S ( Q0x0x00AS R 0BSQQ0 00ASw0&@Kx0x00Sx0- P2[p3$ K P2[p 0 Lt0pRt=Dt=u=u=u=t=u=u=t=t=t=t=k=k=t= t=s=ls=ls=Xs=ht=ht=ht=ht=ht=Rt Q00 AR0SQ0 ,0@S S^ Qp0Q2K Q (0SxHs=,r=@s=,r=1S'0P<)Z/\0P)<.\YQ "0KP2[:J (0  <P)1Z/Q0AS00S%Q# P!Q Q0 0?QQ Q $0K`P"[8R 0 2K`P0 0j0D(:\(,00 8\0, <\0( 7\$ K!`P `P&@K `P"[p70 2K`P `P `P2[;8#8 2K`P"[`P,`0S` 0$ ;\0 ,P1 P/ 04 , 04 \wQ B!50S  Q(  ( 2k 0p 04u`Pt0%, 0x%\0`0XE0^/0\ 0 \0 ,@㒍0S 0 ,P`@@2T }0 , 2T00`00`P`LDA`84Q} ($(4QQi \ p 4Q 3Q 0Q  3Q g3Q 00CQ 0Q 3Q 0 03Q t0S0 0 \0 0h3Q 0 0R H3Q  <3Q  03Q  $3Q u3Q 3Q 2Q 2Q 2Q 0 02Q 0",>  x `wL2Q+ #2Q5 Z1>CQ 0 00 , 0 \K㾌u1Q J0CQ}p1Q =P0CQu0 0 0LS0 00 0 0 0~ 0 0{0 0x N $1Q 1Q 1Q 4  "0KP 2[02 \0Q 0Q;7A9>CS60QG 0Q/p S ( `!h!@_;`B'  ATTP APT@M A0 A0 T A A A -LM0PS 40S 00CSu0 0\0,0\ 0+\0 @, A0 , p R R 0BSR/ RS 3 \P Rr RPh RS,0A S  Q Rs Q Q Q 0 0\0 , R 0BS0&, 8l&\ 0BSTR( @"<60Sn 0l@  0\0  3\02  ㆋ0 , : \0 ,}n0A S  Q R 08%, : %\ Q Q{0,, <4<,\Qg0$4\^ %>2 1S  3 \$ 0S(1S%0$,Io 3 \ 0 1\t 0BS0,, ` 0 ,\0,,@ }Ԋ`V 0 R0*0\0"0\ 0[,, 5  8[,\w<  P) 00C S @ 嘊0AS咊0 , @T P s0 , : \0 ,"m0 6\L1 S03$08#$0K[0 ,1[ 0 \ SP0qS0D , |'0p XP_eeeeT[ Na -L M pR% 0BS6RRPU1Sx 0ES'U=U 0ES 0ES`@PU 0BS``R`F R  R ` V/PQ@0;! 0\0 ,0@ S @0;! 0\0P ,U: R 0BSP P@ R > >>> > > >>4x5x7r x@t xxxx4x5xxxxx6x 7xT8 t4j 5l@`@`7j @`6j@`4z`<<4t5r@`X@`TT``\\Pdd@4zll5~~4|X4zll5~~X4|r\jr]jr^jr_j\rj]rj^rj_rj|`@`H@`DD@`LLxx5r6r           xxxx(C|zwi_do_hostdecryptwi_do_hostencryptwi_attach??$?D?\?t????? ? ? ? ? ? ?4?4?4?D?D?D?D?`?`?`?`?????4?4? 4?!?"?#?$?%?&?'?wihap_assoc_reqwihap_ioctl 7nVV V@T Tx?0?8?t?4?4?$?D?H?$?$?4??t ?0?8$?@80?<K #(-2>'()*+,-./@ABCF'()*+,-./@ABCF/@ABCDEFGHIJKN'()*+,-./@ABCFMNO`abcdefghik*++,,--../-@@A&''(())**++,,-rt2661_rx_intrrt2661_tx_datart2661_tx_mgt@02D0H0L0\0;51.`0,***|00 0 l(000400000#0  00 `4H< 4s"$4D#(444!,-./0 8  "%')`56<=>KVXZcfk3 3 3 3 3 3 3 3  3  3  3  3  3 3 $3 f`(3 h`,3 i`03 j`43 k`83 l`<3 n`@3 o`d3 h3 l3 p3 t3 x3 |3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3  3  3  3  3  3 3 $5 `(4 `,4 `04 `44 `84 `<4 `@4 `d5 &h5 (l5 *p5 ,t5 .x4 |4 4 4 4 4 4 4 5 B5 D5 Frt2860_set_keyrt2860_txrt2860_rx_intr:: u <<4400$,,0,,H((`((l((,?  04P H ,Fs"D#4 ?LGdthtt@tx@l@tp@@?XD + $3A,B8EF IQ7RbSjTV[\gij5@p  A ! {X,              $ f`& g`( `, `. `0 `4 `6 `8 `< `> `@ `d f h l n p t v x | ~                    bwi_encapbwi_rxeofbwi_mac_fw_alloc7 dKZ-B"5*#    a.@:4@x}CCCCCCDDDFFFGGG G%G CCCCCDDF G G eS./`xZYXzRC./`xZYX zC0&* ZYXzRC   MLKJJIHGGFEEDCBBA@?>=<;:987654210/-,+)(&%#! MMMLLLKKJJIIIHHGGFFEDDCCBAA@??>=<;:98765421/-+(%!  )ZYXCQR bwi_rf_workaround)ZYX +RCz i )) i ) I i i I) i) I I)i)i(h(h(h(h(h(h(hHH( h !H!!!("h""#H###H$$$H%%&h&&('''G((G))'**G++,g-G.g/G2&5F6&788F99f::f;;E<<===E>>>E??@E@@@EAAA%BeBBCECCC$DdDDEDEEEFDFFF$GdGGG$HdHHH$IdIII$JdJJJ#KcKKK#LcLLL#McMMM#NcNNN#OcOOPCPPPQCQQQ"RbRRRBSSSTbTTUBUUUBVVV"WWWAXXYaYY!ZZ[[[a\]] ^^_`a<1??????????*?7?D?P?]?i?v@@@@@@@@@@@@ @@&@2@?@K@X@e@q@~?????????????!?.?:?GT@<wlbQ@;53-/**'%!!%'**/-35;@Qblwzuqlgc^YTPKFB==========================BFKPTY^cglquz˓dfX&ئ͟8ʴ)ǎi+jlbsCv ViDz#((?-җ1h5u85;5=f>?@?r>e 5=5;/u8h5#1E(?- -(1#4T8;i= >C??b?l"?+=;85&Z2X.dϚ)m$bwi_phy_init_11b_rev2###4# n bwi_mac_testohci_root_ctrl_startehci_root_ctrl_startsr_checksumsr_raid_inquirysr_map_rootsr_meta_opt_loadsr_meta_native_probesr_ioctl_installbootsr_meta_native_attachsr_rebuild_initsr_hotsparesr_meta_validatesr_meta_native_bootprobesr_meta_probesr_ioctl_createraidsr_boot_assemblysr_raid_read_capsr_rebuild_threadsr_crypto_read_key_disksr_crypto_create_key_disksr_crypto_calculate_check_hmac_sha1sr_crypto_decrypt_keysr_crypto_alloc_resourcessr_crypto_change_maskkeysr_crypto_ioctlbioioctlhotplugclosehotplugreadhotplug_device_detachhotplug_device_attachdb_fncalldb_commanddb_print_cmddb_examine 88888 9 7 6 97 5 9 423 9 2 9 1 0 9 9 \/|\/O|/-|db_show_regsdb_printsymdb_write_cmdextract_entropyarc4_initrandomread n;AvXaM ְdx cd9660_mount&,&&&4&&<&&&D&%(h&coredump_note_elf32coredump_notes_elf32coredump_elf32elf32_load_fileCopyright (c) 1982, 1986, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. Copyright (c) 1995-2013 OpenBSD. All rights reserved. http://www.OpenBSD.org l&(l&l&i&@i&`i&pl& l&pi&i&i&i&0l&l&k&k&k&k&&ܞ& $$=@0@?@@@=@=@=@coredump_tradcoredumpsysctl_diskinitkern_sysctlsysctl_tc_choicesysctl_tc_hardwareconfig_detachdisk_mapfindblkmajordk_mountrootsetrootdisk_attach_callbackextent_print1extent_freedb_show_all_poolskprintflogprittwrite@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@cache_lookupsys_fhstatfssys_fhstatsys_fhopensys_getfhsys_mount  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~!#$%&'()-0123456789@ABCDEFGHIJKLMNOPQRSTUVWXYZ^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{}~Ͼ󨷵ǎԐѥ噞᷵ǎԐѥ???????????????????????????????? !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?Ѫ?????????????????????????????յݯ????msdosfs_lookupUmsdosfs_mount +*,+*(X+*(|**(*(4*msdosfs_createmsdosfs_mkdirmsdosfs_renamemsdosfs_readdirbpfwriteifpromiscifnewlladdrif_getgroupmembersif_getgroupifconfif_clone_listif_group_egress_buildif_downallifioctln; &C vkkMPG&"֊/aK+d 5ӆ1 q^h,`@yFgKrޔԘJk*OņךUfϊDx%K]?!HpcwucB0 mL5&/ᾢ5̈9.WUGz+2ўfD~T; ʌ)k<(yv;VdNtے lH]nCĨ917Ӌ2CYnڌdҜI%ϯʎGooJr\$8WsQ#|!>ݖa B|qؐ_jiX':'8+3"p3-"< IxPzY e1ƄÂ)wZ{m:,ieee80211_wep_decryptieee80211_wep_encryptPPPPPieee80211_ioctlieee80211_ibss_mergeieee80211_end_scan  0ieee80211_node_attachPP ^/ f ^/ ^/ieee80211_recv_4way_msg3ieee80211_recv_4way_msg2ieee80211_recv_4way_msg1PP8t@Dt@Pt@\t@lt@xt@t@t@t@t@t@t@t@t@t@t@t@t@t@u@ u@u@u@u@A u@ieee80211_newstateA(u@TrB3XA0 ,u@G(hB9$\KA!0u@08qB0d4u@408u@`@7v v@l([@7XAzv@Av@v@xmB7v@B v@7YA6$v@@t BE(v@6,v@6 0v@04v@G$8v@:Xq'Of ɴ:}Jc1`3QESbwdk+XhHpElޔ{R#sKrW*Uf(µ/{ņ7(0#j\+ϊyiNeվb4ъĝS.4U2u9 `@q^Qn!>=ݖ>FMT]qoP`$C@wgB谈8[yG |B| H+2pNrZlV8ծ='9-6d !\hT[:.6$g WҖO aiKwZ *C"< Nj򹨶-ȩWLuݙ`&r\;fD4~[v)C#hc1cB@" Ƅ}$J=2m)K/0R wl+pH"dGČ?,}V3"NI8ʌ6 Ԙρ(z&ڤ?:, xP_jbF~Tؐ^9.Â]|i-o%;ȧ}nc{; x&Yn쨚Oen~ϼ!ٛ6oJ |)11#?*0f57NtʂАا3JAP/MvMCTMўjL,QeF^]5st.A ZgRے3VGmaךz 7Y<'5ah,4$8_@r %⼋I<(A q9޳ ؐVda{p2t\lHBWЧQPeA~S^':k;EXK0 Umvv̈L%O*D5&bZI%gE]u/LFk_眒zmYRڃ-!tXiI)ɎDujyx>Xkq'Oᾶ f:}Jc13Q`SbEwdk+hHpXElޔ{Rs#KrWUf*(µ/{ņ7ӥ(0#j\ϊ+yiNe;b4ĊS.4U2u 9`@q^nQ!>ݖ=>ݮMFT]qoP`$֗C@̞gwB谽[8y |GB| +2HprZlN8Vծ=9-6' d\h!T[.6$:g WґO aKwZi *"4$8,@_r% I<( A9q ؜Vd{a2p\lHtWBQPA~Seä':^;kEXK0 Uvm̈v%LO*5&DbIZ%gE]/uLFk_mzRY-tX!I)iɎDujxyXk>'qᾶO f}:cJ1Q`3SbEdwk+HpXhEޔl{Rs#KrWUf*(/ņ{7ӥ(0#j\ϊ+yiNeվ4bĊ.4SU2u 9`@q^nQ!>ݖ=>ݮMFTq]oP`$֗@Cgw谽B8[y|G B| +2HpZlNrV8=-6'9 d\h![T6$:. gWҖOa wZiK *"$8,4_@r %<(I A9q ޳؜Vd{a2plHt\BWQP~SeAä:^';kEXK U0mvv%LO*&D5bIZ%gE]u/LFk_zmYR-X!tI)iDujxyk>X'qOf }:cJ1`3QbESwdk+pXhHElR{#srKWf*U(/µ{ӥ70(#j\+ϧyNieվb4Ċ4S.U2ኤu 9@`^qQn>!=ݮ>MF摵Tq]o`P$֗齉C@gwٰB8[yȡG ||B 2H+plNrZV8=ծ6'9- dh!\T[$:.6 g WҖOa ZiKw *h8,4$_@r %(I>>>KKKKyyyy xxxxZZZZݨ33331111YYYY''''____````QQQQJJJJ ----zzzzɜ;;;;MMMM****뻻<<<q//^SShѹ,` @ȱy[[jjFˍپgK99rJJLLXXJυkл*媪OCCMMU33fEEPPD<KKܽa ppB>>|ĵqffHHaa_55jWWйiX':'8볘+3"iip٩3-"< I·UUx((PzߥY  ڿe1BBhhAA)w--Z˰{TTֻm:,ccƥ||ww{{ kkֽooޱőT00`PggΩ++V}׵bMvvʏEɉ@}}YYGG AԳg_Eꜜ#Srr[u=&&Lj66lZ??~ÃO44h\Q4qqثs11bS*? ǕR##FeÝ^0(7 / $6=&''Niuu ,,Xt4.6-nnܲZZ[RR;;vMַa}))R{>//^qSSѹh, @`y[[jjԾˍFg99rKJJLLXXυJлk*OCCMM33fUEEPP<!KKݽa܋ pp>>|Bqff̪HHaa£55j_WWiІX:''8+"3iiһ٩p3-<" ·IUU((PxߥzY e1BBhhиAAÙ)--Zw{TTm,:cƥc||ww{{ kֽkoޱoőT0`P0gΩg+V}+׵b׫MvvʏEʂɉ@}}YYGG AԳgԢ_Eꯜ#Srr[u·=&Lj&6lZ6?~A?̃O4h\4Q4qqثs1bS1*? ǕR#Fe#Ý^0(7 / $6=&'Ni'Ͳuu  ,Xt,4.6-nܲnZZ[RR;vM;ַaֳ}γ)R{)>/^q/SSѹh, @` yȱ[[jԾjˍF˾gپ9rK9JJLLXXυJлk*OCCMM3fU3EEPP!KKaܽ pp>|B>qĵf̪fHHa£a5j_5WWiйX:''8+"3iһi٩pَ3-<" ·IUU(Px(ߥzߌY  eڿ1BBhиhAA)-Zw-{˰TTmֻ,:ƥcc||ww{{ ֽkkޱooT`P00ΩggV}++bM櫫vvE@}}YYGG A쭭g_E꯯#Srr[u·=Lj&&lZ66~A??Oh\44Q4qqsbS11*? RFe##^0(7 / $6=&Ni''Ͳuu Xt,,4.6-ܲnnZZ[RRvM;;a}γR{))>^q//SSh,@` yȱ[[ԾjjFgپrK99JJLLXXJϻk*O媪CCMMfU33EEPPxD<<%K㨨QQ]@@?!pH88c߼wuBc!! 0mҁL &5/__5DD.9WU~~zG==Ȭdd]]2+ss``OODf""T~**; FF)kӸ(<y޼^^ v;dV22tN:: II Hl$$\\]½nCשּׁĦbb917yy2CnY77ڷmmd՜NNI੩شllVV%ʯeezzG鮮oպxxJo%%\r..8$WsǴQ#|tt>!KKaܽ pp|B>>qĵ̪ffHH£aaj_55WWiйX:''8+"3һiip3-<" IΪUUPx((zY  eڿ1BBиhhAA)Zw--{˰TTmֻ,:cccc||||wwww{{{{kkkkoooo0000gggg++++׫vvvvʂ}}}}YYYYGGGG𭭭Ԣrrrr&&&&6666????4444qqqq1111####''''uuuu ,,,,nnnnZZZZRRRR;;;;ֳ))))////SSSS [[[[jjjj˾9999JJJJLLLLXXXX着CCCCMMMM3333EEEEPPPP<<<>>>ffffHHHHaaaa5555WWWWiiiiَUUUU((((ߌ BBBBhhhhAAAA----TTTT @6MD5FinalRMD160FinalSHA1TransformSHA1Final؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHG"(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDlɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~[/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxqg jgrn<:ORQhك[ 1Ѭߘr/Ḗ~&jE|,G$l iciNWqX~=t XrX͋qJT{YZ90`*#`(yA8۸y:`l>w'K1/x`\`U%U攫UbHW@cj9U*4\̴ATr|*oc]ũ+1t>\3֯\$lS2zw(H;Kkē!(f a!`|H2]]]u#&܈e>#Ŭom9BD . Ji^Bh!la gӫҠQjh/T(3Ql n;zP;*~ev9>YfCoEå}^;uos D@jVbNw?6r=B$7H ۛIrS{y%P;LylO`@ž\^c$johSl>9oR;Qm,0DE ^J3(fK.WtE9_ ӹyU 2`yr,@%g̣饎"2u<kaP/R=2`#H{1S>W\o.ViB~(2gsUO'[iXʻ]=!lJ[-ySeEIҐK3~ˤAb Lw6~д+MەqՓkю%ǯ/[{AI~-%^q h"W6d$ cUYCxSZ٢[} Źv&ϕbhAJsN-GJ{RQ)S?Wƛv`+t恵oWk *!ec.4dV]-SGjnpzKD). u#&İn}ߧI`fqilRdVឱ¥6)L u@Y>:䚘T?eB[k?ҡ08-M]% L&pc^?kh >\D}W7: P tAu8/;21>8TNmO Bo ,y|$ryVw.?rU$qk.P̈́GXzt}K:zfC cdG27;C$CMQe*P:qUN1w_V5kǣ;< $Y,n<pEㆱo ^*>Zw=Ne)։>%fRxL.jxS<- N=+6&9`y#RnfE{7(2åZl!Xeh;/ۭ}*/n[(!pa)uGa0a4c\s9pL ު˼,b`\ndi#PZe2Zh@*<1! T_~}=b7w-_h)5ǡޖXxWcr"ÃF T0.SHُ(1mX4a(s<|J]d]B> EꫪOlOBBǵj;Oe!AyMjGKPb=bF&[$ti GV[ Htb#*BXU >ap?#r3A~_;"lY7|`t˧@n2w΄PU5ai Z .zD4Egɞs͈Uy_g@Cge48>q(= m!>J=+hZ=@&L4)i Av.khq$j 3ԷCaP.9FE$tO!@MpE/f m1'A9UG%ښ ʫ%xP()Sچ, mbhiHפh'?Oz|Ϊ_7әxB*k@5 ٫9N;VmK1f&tn:2C[Ah xN جV@E'H::SU kKмgUXc)3VJ*%1?~^|1)p/'\,(H"m?H܆AyG@n]Q_2Տd5A4x{%`*`lc´2Of#k>3b $;" r(-Exb}doITH}'>AcG t.no:7`L knU{7,gm;e' )̒9 i{f} ϑ^و/$[Qy{;v.97yY̗&-1.Bh;+jLu.x7BjQ满PcKkؽ%=YBD n *Ngd_ڈ鿾dW{x`M``FѰ8Ew63kBqA_^;Z4ٷ,Q+:Ֆ}}>(-}|%rZLZq)GW;()f(.y_xU`uD^mm%adâW<'*:m?!cf&(3uU4V<wQ( gQ̫_QM08bX7 z{>d!Q2Ow~㶨F=)iSHd$m-if! FEdlX [@X̻k~jEY:D 5>ʹrdfGof,ҏ"W##v215VbuZ6ns҈bIPLVq z2E{Sb%ҽ5iq"|˶+v>S@`8G% 8vFšw``u N˅؍芰z~L\HjiԐ\-% ?2aN[wߏWr:j?$.Dsp"8 1).lN!(Ew8fTl 4)P|ɵՄ? Gy ~tn,fy3jXDD1Zs"*ˁc8:$zi HIĀ@8HުL H_%A@N$A UeQr% 9jyMc@hV 틕Z Vqק)N-fcqw*7 5Wa"ɠBր[t!h!hl iwW~@PճMװx QV$AV ʔUWnྵa$ XK'aU{whkldMDfd~i/IO70j5,s@IvM;B(HDLns) _ɋ}oaOw.+rץ<}+FYYEEهTNoHm| ǥcs_DVj͈prͳ]ny` E`1©\1BN"r\,rN@%/N2g@#x\n܃"ukMxnXO DH?{vw#Vu*F_( +8=6 JRft;QZylu eX&hJpFS(l\v0k)h76*g$ k%ֿh,DUueI40" WIbuU~bڨv^FESGml,gHL|3ەCh\SU2` ߝWc9^28aI37~^b<#NygCHKJf-ۄoH Ja)Yfc(` 0qt&@3/C~A^ l( ؒ0~of˜os*`ژ46K-%#= %IH6Jo8C@TzWOpA:Z„TU|5YŗZ:G:%Sj~=eI&TwQ[P]vlDȨ!帊iX`[ŗY)L;]J5ULkD$5鰽bעT/I18T(q)9H[/u@g+3-fVo*ɛ`( ')dMP˲,\26K_A !PNhذy\CPIMAC8wn\e0Rԋ@+>`xT7}02m-yyS"wuXȃoxkcZ\3]ùzv٣Byqj3ƚ`'PC=+mvN%ύHf6AN( aϩI=߹_d: }+p?PO+Zbbyj.H@,Z@"ғ-ES4n)olIIBr~V>olbfLTq*+9)XLVRf.S9v.i硦>iFt+LVvuOx39]O#2]2=&K/~~<O^?vf)o=E4ӷ+4grN=U"g`k8=ü0}8QcÐӝXyTGָaYwSW-XVcNx.F~eyUڑ0@5㶼P?!@=LXI6QpӱڍyKoqK 0ݻ맕d5w$,ϩ/ tцB*v:-7ޚ, )p@ :$7ѴyN] h1 HZ޻Bf1畏?r 3uQB}\cmd!@ WS1zݨ]3CoFq"8ԚέiGb[UgfN G[oLĎnrWxzdD]Ջ` l_9 ]c2֋~ pIPӻߘ)* mS~H~X.t;/RG'~[!<8zvOB9`55'{ɸ6g {pqT3^-ZId, =4pBwbO&Ҹ$d%FN`7>͕xE_{ ۫v"{.1ן%$r_m L=mPO%os#(ĴyI%4aĘnzn|l6AT޾'VAJJ{` ,8I%vK$%Gv XY f 0NndQ& #Phꃢ@0 /kz%?/?!M@`Iɟ'Կ@uИcnafŽ"o;h(Yy#P_w@CV/|-ҢɡHl4ma/T"2*kT:V"AӢ@f/9/Mҹ-?JDvR7,YQoz Zh{.T"5Y/mKdPIf-徐"3;䎴]4K@E?1.eUʱծ-mԢP @"8On ׿r[O/LVSTIiFXEŅc]ՊSW9j7=T*_}x:vbj Bz)^'rgP8ƌDŽZ*'JkѢ*V`C u\B&Ʉq-ls5&5 M{n0f&%HVV^c ϲc|E pPr(pH# yM;-AB G&LjMG\^ |Y#јr8S#/nqFnEV 9q +A|iCHy}B{BIZݿe\ [ ~iC?9zaz UQry吝5rNcZպ60ę _}֡{/6Y DYD̃Aѱ* ;{ B[A%zzӤ0XޘN?wiy{$[Ĭ%5P_aT1bcKU !h]Yfsc=4·~!+g\ab906;Wd/`:5F- 'zy㠌l0^7%oo;j tE'4:NiOM>dY58EfCr3c%N? (Υ'R¦սTUdpfM w&ۄgC!`X0TroSUGڿ]bVhkʃ;n-Ӧ\= wL3{9+^S_aodC x^c"&gI{ڷ"%-U^7rRyL H[k0 cq/޹ S E!5(T<)c)A|-nRPf4,0P1`sY&D\dwR3A+ٺ|o!PaH?ek«dv&4{^% ;MM1$~I,;jx`]sVz\/1Co0TyXR^/2zj0>՚1B°I #ڸ(0q_`ɣaM/Ǚ."płNؼ40y;'ƸaiH?;(ZC/v7ܱӧßn>ƼB7Q(heRwj-K'5.n\ )^XOX{iT̨g&H`K`8# ~8lI `s5GƱVL>#8d^BFzk Od^AE#\;]>rC|m~ll9`qpsv#E@]%=`GK6DήPQH<p}}d^(O= &g.yr?U+HԼ?^!@WNFRWs3NɷdŸW1O g_?@k{C=K۵cUȗn-J(JqoCCl< _P/~׿PZG.Q>pX.0_|r *,]I鎸P'WIoyR}}Yr@EEt]>uOiVA#. '`vteyvvwHNma}/ 4H<0(Ow Vܒ M"7)}V'|@|硴f^aÝ <є`AFv\;x,WGl"}NC~8<=Q8d{h'فI]j~vh]9K9 ;#Im<Eub'z\aBΒ~Brrp }ȡ[(Ob<51)BSjO[}m(Ki\j#MŌ?,-ҖXRg[HJI \EkӉ7`:SRqDIK @sg4|~q6UO/Т`?mPьGnU?墼38Wg} =3{r3O̫]ňv{{uWBdBc+ri/n+_mazgaq%9̸L!gуb>ܷν8\ =Dmn`I:T`H'W+8$ ږ%Eh;}E `P/(b4 ٠m+1+dZ0RXBA\1>26F3S75 {s{OJWdCQz(~c5_ yCdcdJ$_(͸O@C " 0 O7-{$MgQLq_-_d !S^>'_aB%rqK=;&o~~TLmDl߫I&Ǡ36~?Pa w8Pr.PwWFgOT3ɏ1 i5M\=fȦ[]oڑo/"F}F9mOCCN!и  ?X(>nH&p׋wt|% - y#;(8itb߷@!{7Ȋ@ YVvO@/{U MVi35'#WȯVeka^u˅nwU2?-ɿ[%;з$;mc fÀ(82 Tɪס2Zb,gTzuw11&o6F HjyZVLj~CRv/ t,t* M|k .TA5B=!&|,aRe1i%& !\1cr ^Iy p1 d>>̶Ոî 0rlqn/kءDVÈ9/ű1(x⤣2}o~X$Ū{s0a!-!)۳*)e\,0?Б\,ԩT _w:^VxV޾\!uQųåҶw#)Ei/z毲p[v F98/gsD)k)/Ifingӛ/~p%Q^$Slj>!DYܷ)eyCy9A+MWN )zkS< ~U3rŅ?~                               A@@@A@@A@@@@A@@@A@@@@@@AAA@@@@@@@@@@@@@A@@A@@A@@@A@A@@A@@A@@A@@@@A@A@@A@AA@AA@@AA@@@AAA@A@A@A@A@                              @@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@                                        0 0 0  0 0  0 0  0           0  0 0 0 0  0  0  0          $$  $ $ $$  $ $             $$  $ $ $$  $ $                  0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0                            ((  ((  ((  ((  ((  ((  ((  ((          """"   " " " " ((((((((    """" ( ( ( ("("("("(  ##%%&&))**,,//1122447788;;==>>@@CCEEFFIIJJLLOOQQRRTTWWXX[[]]^^aabbddgghhkkmmnnppssuuvvyyzz||cryptof_ioctlswcr_authencswcr_authcomputeswcr_encdec66666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\aes_xts_cryptaes_ctr_cryptZAES_CMAC_FinalHMAC_SHA256_FinalHMAC_SHA256_InitHMAC_SHA1_FinalHMAC_SHA1_InitHMAC_MD5_FinalHMAC_MD5_InitAES_GMAC_Finalaes_key_unwrap H!x-ML.RN8D( `hz=Skc|j9{Б/Uڅ?AZX_f ؐ53eiEVmv° GJBnI[#Q")yq~ ruo7ӎbwO$26󦻬^lW%㽨:Y*F?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@ffs_mountd000000$00000`0d000 ufs_makeinodeufs_mkdirufs_linkufs_renameext2fs_readdirext2fs_direnterext2fs_mount10{100Hy1w1t1@s1q1(1q1011@p11111Ȑ@11Ԑ@1$1@11ػ1t1@141ĺ1d1(1@X11@uaddr_pivot_removeuaddr_pivot_insertuaddr_bestfit_removeuaddr_bestfit_insert0Ok0k4Ok(Wk(Wk(Wk4OkDmquvm_map_printitvmmapbsyBUSYWANTEDTABLEDCLEANCLEANCHKRELEASEDFAKERDONLY ZERO PAGER1FREEINACTIVEACTIVEENCRYPTPMAP0PMAP1PMAP2PMAP3\sys_swapctlin6_pcbnotifyin6_pcbconnectin6_prefixlen2maskin6_prefixlen2maskin6_ifpprefixin6_delmultiin6_addmultiin6_ifloop_requestin6_update_ifain6_controlin6_lifaddr_ioctl0123456789abcdefin6_ifdetachin6_nigroupget_last_resort_ifidin6_ifattach_loopbackin6_ifattach_linklocalin6_ifattachin6_selectsrcfrag6_inputicmp6_redirect_outputicmp6_mtudisc_updateicmp6_redirect_inputicmp6_notify_erroricmp6_reflecticmp6_rip6_inputni6_inputip6_nexthdrip6_savecontrolip6_setmoptionsip6_getpcboptip6_ctloutputip6_outputnd6_lookupnd6_ioctlnd6_freend6_rtrequestnd6_na_outputnd6_ns_outputnd6_ns_inputnd6_na_inputin6_ifaddnd6_prefix_onlinknd6_prefix_offlinkdefrouter_delreqdefrouter_addreqnd6_ra_inputnd6_rs_inputrip6_outputrip6_inputrip6_usrrequdp6_output0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-     A@!  @a`10  @`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O      A@!  @a`10  @`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O @@ !1Aa  0@` #+3;CScs555 55 55 5 5 5@@<@@@@ @ @0@<@   L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c            (08@P`p   0@`  0@`5Խ5l(55l(@LB@LB@LB@@ sBsB @sB@@ @@@@@@@@@@p @ @p 0$@ @p `,@ @p p4@ @@<@<@`@@<@P D@ @P H@ @P @L@ @P PT@ @ \@`@h@`@\@l@h@l@T@BL@Bt@B|@B@B@B  @DIA@DIA@@@@@@@ @<@ @<@ @<@ @<@ @<@ @<@ @@ @@/@\;Bo@@0/@\;Bp @-@ `@@ @@ @@@ `@@ S@@ @@ @@ @@ @ @ 0@ @ @@ @ `@ @ @@  @$@ (@@ ,@$@0@4@<@4@ @@4@0D@4@@H@4@PL@4@`P@4@pT@4@X@4@\@4@`@4@d@4@h@4@l@4@t@x@@x@ vBx@0@x@@@x@P3@x@`@x@p@x@@x@@x@@x@@x@@x@@x@@x@ @@ @@@@@@ @@0@@@@@P@@@@@@@@@@@@@@@@ @@$@,@0@,@4@<@ @@<@D@<@ L@<@eqnecsccmiplvsvchilsgeltgtlenv0.01.02.03.04.05.00.510.0daiadbibedeafdfasdeppmzlsllsrasrror_bus_dma_busaddr_to_paddrA@Ț>A@Ț> A@Ț>`A@Ț>A@Ț>`A@Ț>`A$@Ț>`A$@Ț>PT0@Ț>A<@Ț> AH@Ț>DT@>D\@H>id@> il@ț> it@> $i|@H>0$i@H> ,i|@H>0,i@H> .i@>0.i@>!i@Ȝ> !i@Ȝ>)i@Ȝ> )i@Ȝ>-i@Ȝ>Ai@> -i@Ȝ>Ai@H>Ai@H>Ai@H>`A@Ț>`A@Ț>PA @Ț>pA 0@Ț>A @@Ț>A P@Ț>/A d@Ț>?A x@Ț>A @Ț>A @Ț>/A @Ț>?A @Ț>OA @Ț>A @Ț>A @Ț>/A @Ț>?A $@Ț>?<@8@D@P@X@d@X@p@x@@@@@@@@@@@@@@@@ @0@@@P@`@p@@@@@@@@@@@@@@@@@@ @(@@0@8@@@H@@@@@@@@@@ @(@@P@X@@@@@@`@h@p@@@ @(@@@@@@@@@@@@@@@ @(@@@@@@$@<@P@@@@@@@ @(@@d@@p@|@@@@@@@@@@ @(@@@@@@@@@@@@@@@ @(@@@@@@@@@@@@@@@ @(@@d@@@@p@@@@@@@@@ @(@@d@@@p@@@@@@@@@@ @(@@@@@@@@@@@@@@@ @(@p6 @6 @p64@6H@6\@|@6@@6@@6@(@6<@\@6t@@@````` ```dumpsys@@@@@@@@(@4@D@T@d@p@@dB@@@@@(@@@X@|@@@@@@(@D@d@@@@@@@(@@@p@@@@<@h@@@ @ ,@ l@ @ @@T@@@@@@@p@@@@<@h@@@@@@P@ h@ @ @ @ @ @ @ @  @ @@ h@ @ @ @ 0@ P@ \@ @ @ @ @ ,@ D@ d@ @ @ @ @ @ @@ X@ @ @ @ @ @4@P@l@@@@@@P@x@@@@@ @(@@@`@ x@ @ @ @ @@H@h@@@@@ @D@l@@@@@@@D@`@|@@@@@4@\@@@@@,@\@@@@ @H@x@@@@@8@\@@@@@@@4@\@T@t@@@@@ A 0A \A A A A A A @A dA A A A!A!(A!@A!\A"A$A$A$A$A$A$A$A$0A$PA%`A&|A&>A& >A&A&A&A&A& A&HA& hA& A& A& A& A&$A&LA&|A&A&A'@'A' A'4A'PA'lA'A'A(A(A($A(DA)tA)A)A)A)A) A)8A)XA*A*pA*A*A*A*A*A* A*< A* P A* l A* A* A* A* A* A*H A* A* A+ A, A,0 A,L A,x A, A, A, A, A, A, 0 A, X A, A, A- A. A/ A/( A/T A0x A0 A0 A0 A0A00A0\A0A0A0 A0 A0 A0$A0@A0`A1xA1A1A2A2A3A4,A5@A5\A5|A5A5A6A7A8A84A8XA8pA9A:A:A:A:A:(A;`A;A;A;A;A;A;$A;@A;`A; tA; A; A; A; A; A;(A;@A;`A;xA;A;A;A;A;A;$A;4A;TA=tA>A>A>A>A>A?@A?lA?A?A?A?A?A? A?<A? XA? hA? A? A? A?A?A?A?A?8A?PA?lA@AAABACADADqAE<AFXAGpAGAGAGAGAG0AGLAGlAHAIAJAKAKAK4AKHAKXAKhAK|AKALANAPAPAP AQDAQTARASASASASASAS<ASXAStASATAUAUAUAU AU8AU\AUAUAUAU AU AU ,AWPAXtAYAZAZAZAZ A[0 A[@ A[X A[p A\ A\ A\ A] A] A](!A]\!A]!A]!A]"A]4"A]h"A]"A]"A]#A]8#A]h#A]#A]#A]$A] <$A]!t$A]"$A]#$A]$%A]%T%A]&%A]'%A](%A])(&A]*\&A]+&A],&A]0'A]1<'A]2x'A]3'A]4'A]5 (A]6X(A]7(A]8(A]9(A]:4)A];l)A]<)A]@)A]A*A]BH*A]C|*A]D*A]E*A]F+A]GH+A]Ht+A]I+A]J+A]K,A]L,,A]Pd,A]Q,A]R,A]S-A]T8-A]Ul-A]V-A]W-A]X.A]Y0.A]Zd.A][.A]\.A]`.A]a4/A]bl/A]c/A]d/A]e0A]f<0A]gt0A]h0A]i0A]j1A]k<1A]ll1A]1A^1A^1A^2A^<2A^`2A^2A^2A^2A^2A^ 3A^ H3A^At3A^B3A^C3A^E3A^G3A`4Aa$4Aa<4AaT4Abd4Ac4Ac4Ad4Ad4Ae5Af5Af85Af\5Af5Ag5Ag5Ag6Ag6Ag<6Ag\6Ag|6Ag6Ag6Ag 6Ag 6Ag 7Ah@7Ai\7Aix7Ai7Aj7Ak7Ak7Ak8Al 8Am<8An\8Ao|8Ao8Ao8Ao09Ao`9Ao9Aq9Ar9Ar:Ar<:Ard:Ar:Ar:Ar:Ar ;As8;As;As;AsL;Asl;As;As;As;As;AsAt$>AtL>At!`>At0>At@>Ata>Atb>Atc$?AtdL?Atn|?Ato?Atq?Aty?Ascsibus_printlink@$@c@c@eaQ@X@W@0@ w@Q2@U@4@F s%^^uhub_attachDВ8 88|8ucom_do_open8888ugen_do_writeugen_do_readL 88@88ugen_set_configuhidev_set_report_asyncp|88<88uhid_do_ioctluhid_do_read8<8t88=@>R> ^>]r>,>b>I>4>JD>R>7|> > > &> J>KZ>>@#>>>>>> >>H@> N@> _>>>\> L> d> L>Ez> >m>K>A>[>>0> B>R>jd>8>?X>n> >J>Z>abcde f g h i jklmnopqrstuvwxyz1!2@ 3#!4$"5%#6^$7&%8*&9('0)( ) *!+ , --_.=+/[{0]}1\|2\|3;:4'"5`~6,<7.>8/?9:;<=>?@ABC D E FG HIJK,L.MN-OPQRS T/U*V-W+X Y1Z2[3\4]5^6_7`8a9b0c.eh i jklmnopqrstuvwx yz{|}~ mMqQ@zy2" 3#6&$7/{%8([&9)]'0=}-?\./0+*1#'2#'345 6,;7.:8-_d<>| .'`0+*~5^q,?azw&12~ "3#!'4{"(5[#-6|$7`%_8\&9^'0@-)].=+}/0$1*2*3m4%56;.7:/8!d<> bBeE hH iI jJkKlL|,?nN~aArR,sSzZyY2 "3!'4"(5{[#6$7%!8&9%!8'0-)}].-_/0$*2`@#3mM4%5@#7:/\8=+g= aAkK~xX}iIpP& eE ,; c d tsrqQ'?ljbB|oOuUv.:yY{!\"12< 3>!(4[")5]#@6$+7%-8&/9'*0, _-=^.%`/z0w123n4m5$#6gG7h8fd/ 2"@ 3#!4$#6&$7/{%8([&9)]'0=}-+?.|/01'*2'*3456,;7.:8-_d<>\ .'`|0^~2" 3"5%#6&$7/%8(&9)'0=-'?.^/{[0+*}]123@4#5\|6,;7.:8-_d<> 1!2" 3!4$"5%#6^$7&%8*&9('0)--_.=+1#~2#~4'@5``d\|2"#6&$7'%8(&9)'0--=.^~/@`0[{1]}2]}3;+4:*5\_\|-+?\0345d<>| .'`|0^~.\0345|d<>.\`0^~xje.> u i d c htnbrl'"poygk,<qf;:-[{.]}//?0=+3s4-_6w7v8z9: ;<=>?@ABCD E 1!|2"@ 3#!4$~#6&$7/%8(&9)'0=-'?./[0+*]1}2}34{5\6,;7.:8-_d<> q,?azw&1|2@ "3#!'4"(5#6^$7%!8&9{'0}-).-_/[0$*]1`2`3m4%56;.7:/8=+~d<>\ aAbBcCdDeE fF gG hH iI jJkKlLmMnNoOpPqQrRsStTuUvVwWxXyYzZ#6^6,$7&7./[{0]}3;:4'"6,<7.>8/? aAbBcCdDeE fF gG hH iI jJkKlLmMnNoOpPqQrRsStTuUvVwWxXyYzZ#6^6,$7&7.--_.=+/[{0]}1\|2\|3;:4'"5`~6,<7.>8/? eEzy1+|2"@ 3*#!4#6&$7/%8(&9)'0=-'?./[0!]1$}2$}34{5 6,;7.:8-_d<>\ -'?.^`~0!]/[34{2"@ 3##6&$7/{%8([&9)]'0=}-'?.<>/+*012345\|6,;7.:8-_d<> .+*/2\|4eE !1@-2_ /3#!;4$":5#,6^$.7&%=8*&[9(']0), -?+'.xX%/{0wW}1qQ|2qQ|34"5`~67fF8\ qQ@1!2" 3##6&$7/%8(&9)'0=-'?\./0+*~1}]2}]34{[5|6,;7.:8-_d<> 1!2@ 3#!4$"5%#6.=+/0[{1]}2]}345'"8;:c.d\|/? IqQ@2' 3^#!4+$"5%#6&$7/{%8([&9)]'0=}-*?\.-_/0~1,;2,;34i5"678.:d<>| /1,;`2,;`3'aAcCeElLnNoOsSxXzZ bB{cC& fF[ gG] iI jJnN}qQ\vV@wW|xX#zZyY>1'~2" 3+^!4!"5%#6/$7=`%8(&9)'-./QP01qp2qp3$4506,?;7.:8-_*d< bB{ fF[ gG]kKlLmMnN}qQ\vV@wW|zZyY1!~2" 3#^!4$"5%#6&$7/`%8(&9)'0=-'?.+*/0123456,;<7.:>8-_d<> mMoOpP1!2"@ 3/!4$"5%#6?$7&%8*&9('0)--_.=+/[0']1<>}2<>}3;:~4{5#|\6,'7..8d /^^[0]4``{8aAcCeE gG iIkKlLnNoOsSuUzZ cCmMrRsSxXzZ1!2" 3#!4$"5%#6&$7_%8({&9)}'0'-/?\.'/0*|1<>2<>3+45@6,;7.:8-=d][ .~/"^4'`eEqQ@2"#6&$7/{%8([&9)]'0=}-\.-_/0'?~1+*`2+*`3456,;7.:8d<>| 4^    l88888,8L88l885dd5(I*LCDEOMPJQNRK099 9, 9999`99P999| 999@90 9(  v      W 1 Q `  9@  0 2 A@ A   @  @ @   P0 P  A   h }  } } } @  85   9  L+ L 09L2 D   O  {9o  A umass_scsi_probed(9P)9(9p(9fGg ---0000 0@0P010`0p0aLfLLLLiF  @@@ @ @AA@:F:FP 43W  !      @ @ @ @ A n@n n@n @nn@0Df @  Q k k"k"k"k"k @^z BF 9 | 89G9>989axe_iff B  w *w +w +~ W UP  < 1b0 0rk {&"79n= wF@W wn a- XO9e9U98O9hn9w949Hn9$$0$0$$$$$$$$$$$$$$ $|9X99\9@ 'W W@ @EEE }WQ  k"BFFeeeZZ Z 0|99P9$92V{%1" `"'`~%ZP `99t9P90w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-udav_iff\9999hF F hF fF d99x9L9$::T:9url_int_miibus_writeregurl_int_miibus_readreg@@9WP P Q@:: : :uftdi_2232h_getrateuftdi_openP":8 :: :`VV !y`V'V%V&V3V4VPVIVVVVVVVVVV}  H(02135HPPQ nY ol\k] ih^_mZ[Xj 2``` ``x     tq?=:>9;<8pq8     JKLIؼټy`ؿۿٿڿHIJprsq"`r``xȽPW8P3 & & & & & & & & & &     < < < l F F ! ========== = = = = =================== =!="=#=$=%=&='=(=)=*=+=,=-=.=/=0=1=2=3=4=5=6=7=8=9=:=;=<===>=?=@=A=B=C=D=E=F=G=H=I=J=K=L=M=N=O=P=Q=R=S=T=U=V=W=X=Y=Z=[=\=]=^=_=`=a=b=c=d=e=f=g=h=i=j=k=l=m=n=o=p=q=r=s=t=u=v=w=x=y=z={=|=}=~=================================================================================================================================0 B9 !PPPPPPPPPPPPPPPPPPPPPP PPPP PP PPPP PP PPPPPPPPPPPPPPPPPPPPPPPP: :  !RR !R !R !R !R R "R !"R "R ""R "R #"R $R !$R 1$R A$R $R "$R 2$R B$R $R #$R 3$R C$R (R !(R 1(R A(R Q(R a(R q(R (R (R "(R 2(R B(R R(R b(R r(R (R (R #(R 3(R C(R S(R c(R s(R (B@  >d l0/:+:$+:*:G W WnPnPA   !^y 4Xhp9{#{{{{ rS#S&@'ah 33.U 1(Ex$ #hp8:5:h5:05:0    `C:@:@:`@:   &  l! eXL:(J:I:I:DO:DP:M:HM: B  Q  umsm_umass_changemodeXPZ:0[:Y:Y:=beeK #(-2>'()*+,-./@ABCF'()*+,-./@ABCF/@ABCDEFGHIJKN'()*+,-./@ABCFMNO`abcdefghik*++,,--../-@@A&''(())**++,,-   Pp < @H ?A ?A ?@A ?A ?A  ?Ap ?A ?? ?ГA ?ؓADA)gA:gA%hA2hA6h$Arh8Ak?DAk@TAkA\AkBhAkCtAkE|AkF|AkG|AkH|AkI|AkJAkKAkLAkOAkPAkQAkRĩAkSԩAkTԩAkUԩAkVAkWAkXAkYAkf AkgAkhAki,AkjAT> Ap>0A6A@A7APADA`AEApAFAAGAAHAAIAAJAȬAKAجAPAAQAARAASAATAAUAAVAAXA$AdA,ApA@AqATArAhAsA|A7BABBACBA6CA7CĭAACЭABCܭAECAGCAHCAICALC AMCASC$ATC0AXCgLA@g\AAglABg|ACgADgAEgAFgAGgAHgAIgAJgAPgĹAQgԹAXgAYgA[gA]gA_gA`g$Aag4AbgDAcgLAdg$Aeg$AfgDAggDAhgDApg\AqglArg|AxgAygA{gAgAg̺Ag̺AgغAgغAgغAgغAgAgAgAgAg AgغAh4AhDAhTAhTAh`A hpAhTAhTAhTAhTAhAhA hA!hA"hA#hA$hA%h̻A&hA'hܻA(hA)hA*hA+hA-hA/h A0hA1hA5hA7h,A8hA9hA;hBA$ A$0A$P A$Q\B$A$%,A$AWAApAAAA AA(A$A@AC AH AI(AJ8AKHALTAM`APAQARASATAUAVAWAXAYlA^xA_xA`xAdAeAfAgAhAiAjAkAuAvAwAxAyAzA{A|A}A~AAAAAAAAAAAAAAAA AA AxAxAxAxAAA AAA AA$AAAAxA,AlAAAAAAAAAAAAAAAAAAAA A"A&A-A:A;A=ADAF$AI,AJ4AS(BO(B0(B1(B2(B3(B4(B5(B6(B:(B?(BA(BC(BE(BG(BI(BK(BO(BP(B)B)B)B) B)0B)<B )LB!)LB")XB#)XB&)LB()LB))XB*)dB-)LB.)LB0)pB2)B4)B5)B6)B7)B8)B9)B:)B<)B>)B@)BB)BD)BF)BH)BJ)BL)Bp)Bq)Br)Bs)Bt)Bu)Bv)Bw)B) B),B)8B)8B)DB)PB)\B)hB)hB)xB)xB)B)B)B)B)B)B)B)B)B)B)B)B)B)B)B)B) B)0B)<B)HB)TB)TB)`B)`B)lB)|B)B)B)B)B)B)B)B)B)B)B)B)B)B) B)B) B)$ B)4 B*@ B*L B*X B*X B*d B*p B* B* B* B* B* B* B* B* B@* BA* BB* BC* BD* BE* BF* BG* B. Ba, Bb, B- B-( B-4 B-dB-dB.D B.P B.\ B.\ B.h B.h B.t B. B . B!. B". B#. B). B0. B1. B2. B3. BB. B. B0 B$1 B2 B@3 BA3 BB3 B4$ B40 B4< B4H B 4H B 4H B 4H B 4H B 4H B4H B4H B4H B4H B4T B4h B"4x B#4 B%4 B&4 B'4 B(4 B)4 B*4 B+4 B,4 B-4 B.4 B04 B14 B24 B34 B84 B?4 B5B5 B 5 B5B5B5B5B5B5Bu5 Bv5 Bw5 B5( B58 B5H B5X B5h B5x B5 B5 B5 B5 B5 B5 B5 B5 B5 B5 B5 B5 B5 B5 B5 B5 B50 B5< B5< B6H B6T B6T B6T B6T B6T B 6T B 6T B 6` B 6l B 6 B6 B6 B6 B: B: B: B: B: B: B:B:B :B":,B%:<B&:B0:LB4:\B5:\B6:\B7:\B8:\B9:\B::\B<:\B>:hB@:|BB:|BD:|BF:|BH:|BJ:|BQ:BU:B`:Bb:Bd:Be:Bf:Bg:Bh:Bi:Bj:Bl:Bn:Bp:Br:Bt:Bv:Bx:Bz:B|:B;B;B;B;$B;,B;8B ;@B ;LB ;TB;`B;lB;xB;B ;B!;B";B#;B%;B&;B(;B);B,;B-;B.;B/;B0;B2;B4;B6;B7;B8;B9;B:;B;;B<;B>;B?;BB;AD;AF;AH;AJ;AL;AN;AP;AV;BW;Bd;Be;Bf;Bg;B< B<(B<(B<(B<(B<(B<(B<(B <(B <(B <(B <0B!<0B"<0B#<0B$<0B%<0B&<0B'<0B(<8B*PB?P\B@PBDPBHPBRBRBe BeBeBeBeBeBeBe$Be0Be0Be@Be@BeBeBeBeBeLBpXBpdB ppB0p|BqBqBqBqBqB qB!qB"qB#qB$qB%qBq$Bq$Bq0Bq0Bq<BqDBqTBqdBqtBqBqBqBqBqBqBvBxBBBB BBB B B B B(B8B@BHBXBXBXBdBdBpB|BdBdBBĄBńBʄB˄BBBBBBBBBB 0B 0B <B B BBBHBTBTBTBTBHBdBpB|BBBB B!B"BABBB(B(BB(B(BR8BTDB0PB1PB2PB8ѬA9ѬA:ѬA;ѬAP\BQlBRPBSPBTPBUрBVѐBWѠBXѰBBBB~B`r8B`s8B`w8B`8 B`84BDB @LBaXBa`BxBBB0BBB{PB{`B{`#B{a#B{b#B{c#B{e#B{f#B{h# B{#TB{#đA{#\B{#A{#,B{#đA{#\B{#A{#,B{#đA{#\B{#A{#,B.00Bv4Bv<Bv@BvDBvHBPBAAABB A!AAABBBB\BhBhBhB}xB}fB} fBB72B7dB7B7 BBBB@BABBBCBDBEBFBGBHBIBJBKBLBMBNBPBQBRBSBTBUBVBWBXBYBZB\BBBX@BX$BX0BX@BYLBXBXB `BA1tB2B%BBBBBBB B <B XBlB|B=BBBBB*B CB@CBACBBC BCCBDC,BEC<BFCLBGC\BPClBQC|BRCBSCBTCBUCBVCBWCBZCB`CBaC BbCBcC,BdC<BeCLBfC\BgClBhC|BiCBjCBkCBlCBmC,BpCBCBCBPB@PBAP$BP4BPDB@`TBA`dBB`tB`B`BaBaB aB!aB"aB@aBAaBEaBBp$BK 4BK#DBK%TBKrdB+tB+B+B+B+B+ B+!B+" B+% B+2 B+ , B+< B+L B++\ B+y!h B+'%| B+8% B+4 B+ B+ B+ B+ B+!B`!B`$!B`,!B`4!B`*BP*BQ*BR+BS+BT$+BU$+BV4+BW4+BY@+BZP+B[P+B\\+B]d+B^t+B`+Bd+Be+Bf+Bg+Bh+Bj+Bk+Bl+Bm+Bn+B~+B,B,B,,B<,BH,BH,BX,Bl,B<,Bx,B,B,B,B,B,B,B,B -B-B,-B4-B<-BL-B<,BX-BX-Bd-Bt-B,-B<,B-B-B-B-B-B-B<,B-B-B.B.B-B$.B8.BH.BX.Bh.B|.B.B.B.B.B.B.B.B@.BA8.BB8.BD.BF.BP/BQ/BR /BS0/BaB>B>B>B >B,>B 4>B<>BD>BP>B \>B l>B t>B>B>B>B!>B#>Bh >B >B>B!BB>BMyx?BMx?B?B$?B4?BD?BfT?Bf\?Bfl?Bf\?Bfl?Bf |?Bf?Bf?Bf?Bf?Bf?Bf?Bf?Bf?Bf6?Bf?Bf Bf?Bf@Bf0@Bf2 @Bf@0@BfA0@BfB0@BfD0@Bf@@BfH@BfP@BfX@Bf@Bf`@Bfl@Bfx@Bf@Bf@Bf @Bf!@Bf#@Bf%@Bf'@Bf0@Bf4@Bf@@BfA@BfBABfJ ABfK ABfABf$ABf$ABc4ABc @ABPAB`AB tAB AB AB1aAB1bAB10qAB13qAB14qAB15qAB11rABPABfABfABfBBfBBfBB(BB0P4BB@BBvHBBwTBB e`BBlBBxBBBBBB$BB%BB2BB3BBGBBHBBBBBBBBCBCB$ CB2,CBH8CBDCBPPCB\CBhCBZ0 xCBZ8 CBZuCBZ3CBZ3CBZq3CBZr3CBZs3CBZu3CBZv3CBZw3CBZ5CBZ5DBZp5DBZq5 DBZt5,DBZw58DBZ=DDBZ=PDBZs=\DBZu=hDBZ ?tDBZ0MDBZ3MDBZ8MDBZhMDBZiMDBZuRDBZSDBZhbDBZibDBZfDBZ fDBZ!fEBZ&f EBZ)fEBZur$EBw0EBw DVBL?XVBLAALlVBLtVBLf|VBLVBLVBLVBLVBLVBLVBLVBLVBLWBLWBL$WBL4WBL HWBL!PWBL"XWBL#`WBL(hWBL@pWBLAWBLBWBLDWBLFWBLGWBLHWBLIWBLJWBLKWBLLWBLPXBLQXBLR$XBLS4XBLTDXBLUTXBLVdXBLWtXBLXXBL`XBLXBY?BXB/ XB/ XB//XBy?By,ByXBy XByYBy YBy4YBy AyTYByLYBy`YByhYB# pYB# |YB#YB# YB#YB# YB#YB# YB# YB# ZB#PZB#` ZB#,ZB#8ZB#DZB# TZB#@`ZB#%lZB#`xZB#ZB#ZB#PZB#PZB#ZB#ZB#`ZBZBZB[B[B [B,[B8[B 2L[B 2X[B 2d[B 2p[B 2|[B G[B[B[B[B [B [BP[BPP[BR[BRR\BSPW3\B`$\B`4\B`D\B`T\B`h\B`t\B`:g|\B`\B`j\B`\B`\B`\B`\B`\B`,B`\B`\B\B\B\B6A\B ]B` $]B`8]BH]B8T]BX`]BYl]Bix]B]B]B]B]B$]B']B6]BQ]BS]Bd]B]B^B^B^Ba(^Bq4^BvD^BP^B\^Bl^B|^B^B^B^B^B^B^B^B^B_B& _B$_B4_B"D_BH]B8T]BX`]BYT_Bid_B]B]B]B$]B']B6]BQ]BS]Bd]Bqp_B_B"H]B8"T]BX"`]BY"_Bi"d_B"]B#]B#]B$#]B'#]B6#]BQ#]BS#]Bd#]Bz(_B{(_B|(_B}(_B~(_B80_B@0_BC0_BD0_BP0`BQ0`BS0$`BW08`BX0H`BY0X`Be0d`Bh0p`Bt0`B0`B0`B1`B1`B1`B1`B1`B1`B1aB1 aB1 aB"1(aB#10aBG1fB?fBffBgfBhfBigBjgBk gBm,gBn8gBoDgBPgB\gBhgBtgBgBgBgBgBgBgB`gBagBgBgBgBgBgBhBhB 0hB 8hB@hBHhBPhBXhB`hBhhBphBhB hB@hBphBthBhBhBhBiBhBiBiB$iB0iB > > >  >> ! >> >l<2,1<"l<0f<.f<vf<pf<qf<4f\kerror %d timeout on SCSI command 0x%x INTRF single step dsp 0x%08x dsa 0x08%x %s: DMA IRQ: illegal instruction bus fault parity DMA fifo empty, DSP=0x%x DSA=0x%x: last msg_in=0x%x status=0x%x current DSA invalid %s: scsi gross error %s: unexpected phase mismatch %d %s: phase mismatch without command parity error %s: selection timeout without command %s: unexpected disconnect without command %s: unhandled scsi interrupt, sist=0x%x sstat1=0x%x DSA=0x%x DSP=0x%x %s: script interrupt (0x%x) with invalid DSA !!! %s: command with invalid status (IRQ code 0x%x current status %d) ! error, DSP=0x%x %s: reselect with invalid target %s: reselect with invalid target %d %s: target %d reselect with invalid lun %d %s: target %d lun %d tag %d reselect without command %s: reselect with invalid tag our reject message was rejected scsi message reject, extended message sent was 0x%x scsi message reject, message sent was 0x%x unhandled message 0x%x %s: extended message too big (%d) MSG_IGN_WIDE_RESIDUE: bad len %d invalid retval from siop_iwr()invalid retval from siop_wdtr_neg()invalid retval from siop_sdtr_neg()reselect failed %s: done without command, DSA=0x%lx unknown irqcode %x != NULL%s: siop_intr() - we should not be here! istat = 0x%x, dstat = 0x%x, sist = 0x%x, sstat1 = 0x%x need_reset = %x, irqcode = %x, siop_cmd %s %s: unable to load data DMA map: %d siop%s: %u (%d dBm) Unknown PRISM2 chip%s: Firmware %d.%02d variant %d, Symbol %s: %s%s (0x%04x), Firmware %d.%d.%d (primary), %d.%d.%d (station), %s: unsupported crypto algorithm %d %s: wi_do_hostdecrypt: iv mismatch: 0x%02x%02x%02x%02x vs. 0x%x %s: wi_start: dropping unassoc dst %s %s: host encrypt not implemented for 802.3 %s: wi_start: xmit failed %s: wi_cmd failed with %d %s: wi_scan_timeout: %d tries %s: invalid data path: %x %s: failed to allocate %d bytes on NIC %s: device timeout %s: init failed %s: wi_mgmt_xmit: xmit failed wiiocwiscan%s: tx buffer allocation failed %s: mgmt. buffer allocation failed %s: wi_cmd_io: busy bit won't clear %s: timeout in wi_cmd 0x%04x; event status 0x%04x %s: received packet of unknown type on port 7 %s: received packet on invalid port (wi_status=0x%x) %s: oversized mgmt packet received in hostap mode (wi_dat_len=%d, wi_status=0x%x) wihap: failed to copy header %s: oversized packet received (wi_dat_len=%d, wi_status=0x%x) %s: Error decrypting incoming packet. : unable to read station address address %sWaveLAN/IEEE nodeIBSSwlanLucent WaveLAN/IEEESony WaveLAN/IEEELucent Embedded WaveLAN/IEEEPRISM2 HFA3841(EVB2)PRISM2 HWB3763 rev.BPRISM2 HWB3163 rev.APRISM2 HWB3163 rev.BPRISM2 HFA3842(EVB3)PRISM1 HWB1153PRISM2 HWB3163 SST-flashPRISM2 HWB3163(EVB2) SST-flashPRISM2 HFA3842(EVAL)PRISM2.5 ISL3873PRISM2.5 USBPRISM2.5 ISL3874A(Mini-PCI)PRISM2.5 ISL3874A(PCI-bridge)PRISM3 ISL37300PPRISM3 ISL37300P(PCI)PRISM3 (USB)Sending deauth to sta %s wihap_disassoc_req: unknown station: %s wihap_assoc_req: from station %s wihap_assoc_req: bad ssid: '%.*s' != '%.*s' wihap_assoc_req: rates mismatch. wihap_assoc_req: capinfo: not ESS: capinfo=0x%x wihap_assoc_req: WEP flag mismatch: capinfo=0x%x wihap_assoc_req: polling not supported: capinfo=0x%x wihap_assoc_req: already assoc'ed? wihap_assoc_req: returns status=0x%x Sending disassoc to sta %s wihap_data_input: no TODS src=%s, fctl=0x%x wihap_data_input: incorrect bss: %s wihap_data_input: dropping unassoc src %s wihap_auth_req: station %s short request wihap_auth_req: station %s algo=0x%x seq=0x%x wihap_auth_req: new station challenge: 0x%x 0x%x ... wihap_auth_req: algorithm unsupported: 0x%x wihap_auth_req: returns status=0x%x wihap_init: sc=%p whi=%p wihap_ioctl: i shouldn't get other ioctls! wihap_deauth_req: unknown station: %s wihap_mgmt_input: len=%d MGMT: assoc req: assoc resp: reassoc req: reassoc resp: probe req: probe resp: beacon: ann traf ind disassociation: auth: deauth: unknown (stype=0x%x) ftype=0x%x (ctl=0x%x) wihap_shutdown: sc=%p whi=%p wihap_shutdown: free(sta=%p) wihap_timeout: disassoc due to inactivity: %s wihap_timeout: deauth due to inactivity: %s %s: power management is disabled, cannot do WOL %s: no auxiliary power, cannot do WOL from D3 (power-off) state %s: can't map mbuf (error %d) %s: tried to map busy TX descriptor %s: unknown imtype %d%s: tried to map busy RX descriptor %s: reset never completed! %s: PHY write failed %s: bad phy register %x %s: PHY read failed %s: unknown bus speed, assume 33MHz : unknown ASIC (0x%04x): %s (0x%04x), %s, address %s %s: can't allocate tx listseg, error = %d %s: can't map tx list, error = %d %s: can't create tx list map, error = %d %s: can't load tx list, error = %d %s: can't create DMA map for TX %s: can't allocate rx listnseg, error = %d %s: can't map rx list, error = %d %s: can't create rx list map, error = %d %s: can't load rx list, error = %d %s: can't create DMA map for RX %s: no PHY found! %s: watchdog timeout RTL8100RTL8100E 1RTL8100E 2RTL8101RTL8101ERTL8102ERTL8401ERTL8402RTL8411RTL8102ELRTL8102EL 1RTL8103ERTL8110SRTL8139C+RTL8168 1RTL8168 2RTL8168 3RTL8168C/8111CRTL8168CP/8111CPRTL8168F/8111FRTL8105ERTL8168D/8111DRTL8168DP/8111DPRTL8168E/8111ERTL8168E/8111E-VLRTL8169RTL8169/8110SBRTL8169SBLRTL8169/8110SCdRTL8169/8110SCeRTL8169S%s: probed fifo depth: %d bytes : unknown uart : ns8250, no fifo : ns16450, no fifo : ns16550, no working fifo : ns16550a, %d byte fifo : st16650, no working fifo : st16650, %d byte fifo : st16c654, 64 byte fifo : ti16750, 64 byte fifo comattach: bad fifo type%s: console %s: can't establish soft interruptcomcninit: mapping failed%s: %d silo overflow%s, %d ibuf overflow%s comprmRT5222unknownRT2522RT2523RT2524RT2525RT2525eRT2526%s: could not write to RF %s: could not read from BBP %s: could not write to BBP %s: timeout waiting for BBP %s: could not enable device %s: could not allocate protection frame %s: sending mgt frame failed 0x%08x %s: sending data frame failed 0x%08x %s: could not load old rx mbuf%s: could not allocate beacon %s: could not create desc DMA map %s: could not allocate DMA memory %s: can't map desc DMA memory %s: could not load desc DMA map %s: could not allocate soft data %s: could not create DMA map %s: could not allocate rx mbuf %s: could not allocate rx mbuf cluster %s: could not load rx buf DMA map%s: MAC/BBP RT2560 (rev 0x%02x), RF %s %s: could not allocate Tx ring %s: could not allocate ATIM ring %s: could not allocate Prio ring %s: could not allocate Beacon ring %s: could not allocate Rx ring ralRT2529 (MIMO XR)RT5225RT5325 (MIMO XR)RT2527ral-rt2661ral-rt2561ral-rt2561s%s: error %d, could not read firmware %s %s: could not allocate beacon frame %s: timeout waiting for MCU to initialize %s: could not load 8051 microcode %s: timeout waiting for NIC to initialize %s: MAC/BBP RT%X, RF %s %s: could not allocate Tx ring %d %s: could not allocate Mgt ring RT3053RT2820RT2850RT2720RT2750RT3020RT2020RT3021RT3022RT3052RT3320%s: timeout waiting for DMA engine %s: could not read RF register %s: could not read from BBP through MCU %s: could not write to BBP through MCU %s: timeout waiting for BBP to wake up %s: can't map DMA memory %s: could not load DMA map %s: radio is disabled by hardware switch %s: timeout waiting for MAC %s: could not allocate Rx mbuf ral-rt2860%s: error %d, could not read firmware file %s %s: MAC/BBP RT%X (rev 0x%04X), RF %s (MIMO %dT%dR) %s: could not allocate Tx pool %s: reset rx ring timedout %s: can't allocate DMA mem %s: can't map DMA mem %s: can't load DMA mem %s: can't select regwin %d %s: invalid max txpower in sprom %s: no tssi2dbm table for 11a PHY %s: bwi_rf_calc_txpower failed %s: only BCM2060 rev 1 RF is supported for 11A PHY %s: only BCM2050/BCM2053 RF is supported for supported for 11B PHY %s: only BCM2050 RF is supported for 11G PHY %s: unsupported PHY mode %s: %s is not implemented yet %s: unsupported 11A PHY, rev %u %s: unsupported 11B PHY, rev %u %s: unsupported 11G PHY, rev %u %s: unsupported PHY type %d %s: too many MACs %s: %dth MAC already attached %s: MAC rev %u is not supported %s: can't select regwin 0 %s: no BBP id for device id 0x%04x %s: no number of win for BBP id 0x%04x %s: bus regwin already exists %s: no MAC was found %s: no bus regwin was found %s: MACs bus space mismatch! %s: config PS failed %s: can't stop MAC %s: invalid IV image, ofs %s: invalid ofs (0x%04x) for %dth iv %s: invalid IV image, val32 %s: invalid IV image, val16 %s: invalid IV image, size left %d %s: load IV failed %s: load ExtIV failed %s: firmware (fw & pcm) loading timed out %s: firmware version 4 is not supported yet %s: invalid firmware (%s): invalid size %u %s: invalid firmware (%s): size mismatch, fw %u, real %u %s: invalid firmware (%s): type mismatch, fw '%c', target '%c' %s: invalid firmware (%s): wrong generation, fw %d, target %d %s: base tssi measure failed %s: TEST1 failed %s: TEST2 failed %s: %s failed, MAC status 0x%08x %s: %s failed, intr status %08x COMunknown regwin type 0x%04x%s: %s disable clock timeout %s: %s wait BUSY unset timeout unsupported rate %dimpossible lna gain %dunsupported lpdunknown PHY mode %u%s: zero tx id %s: wait for TX ring(%d) stable timed out %s: reset TX ring (%d) timed out %s: can't create %dth tbd, %dth DMA map %s: can't create spare RX buf DMA map %s: can't create %dth RX buf DMA map unsupport modulation type %u%s: invalid rate %u or fallback rate%s: prepend TX header failed %s: can't load TX buffer (1) %d %s: can't defrag TX buffer %s: can't load TX buffer (2) %d unsupported modtype %u%s: zero length data, hdr_extra %d %s: can't allocate %dth RX buffer %s: can't create txstats ring DMA mem %s: can't allocate txstats ring DMA mem %s: can't map txstats ring DMA mem %s: can't load txstats ring DMA mem %s: can't allocate txstats DMA mem %s: can't map txstats DMA mem %s: can't load txstats DMA mem %s: %dth TX ring DMA create failed %s: %dth TX ring DMA alloc failed %s: RX ring DMA create failed %s: RX ring DMA alloc failed %s: TX stats DMA alloc failed unknown LED event %d%s: %s invalid channel! %s: can't set channel to %u bwi-airforceucode%d.fw%s: error %d, could not read firmware %s! pcm%d.fw%s: no suitable IV for MAC rev %d b0g0initvals%d.fwb0g0bsinitvals%d.fw%s: no suitable ExtIV for MAC rev %d %s: PHY calibrate failed %s: can't initialize %dth TX ring %s: can't initialize RX ring %s: can't initialize TX stats ring %s: invalid MAC address: %s unknown phymode %d%s: can't drain TX status %s: intr fatal TX/RX (%d) error 0x%08x intr PHY TX error %s: EO_ATIM %s: intr noise bwiuhci_alloc_std_chain: maxp=0 uhci_device_setintr: 0 interval uhci_device_isoc_close: %p not found uhci_abort_xfer: not in process contextuhciabUHCI root hubuhci_device_isoc_enter: xfer=%p in frame list startstop%s: cannot %s %s: controller did not reset %s: interrupt while not operating ignored %s: host system error %s: host controller process error %s: host controller halted uhciohci_setintr: 0 interval ohci_device_isoc_abort: early return ohci_rem_ed: ED not foundohci_add_done: addr 0x%08lx not foundohci_abort_xfer: not in process contextohciab%s: isoc TD alloc failed OHCI root hub%s: %u scheduling overruns %s: resume detect %s: unrecoverable error, controller halted %s: blocking intrs 0x%x %s: reset timeout %s: SMM does not respond, will reset ,, legacy support version %d.%d%s %s: unsupported OHCI revision ohciehci isoc xfer being freed, but with no itd chainehci: isoc xfer suddenly has 0 bInterval, invalidehci_check_itd_intr: not valid itd ehci_check_qh_intr: not valid sqtd ehciiawehciabehci_open: bad device speed %d%s: Error opening low/full speed isoc endpoint. A low/full speed device is attached to a USB2 hub, and transaction translations are not yet supported. Reattach the device to the root hub instead. ehci: opening pipe with invalid bInterval ehci: zero length endpoint open request %s: halt timeout ehci: isoc descriptor requested that spans the entire frametable, too many frames ehci: unexpectedly ran out of isoc itds, isoc_startEHCI root hub%s: port reset timeout ehcidiehci_abort_xfer: not in process contextehciaw%s: disable schedules timeout %s: run timeout ehcidbehci%s: unable to start background operation invalid data offset%s: %s: illegal block count for %s %s: %s: illegal cmdlen for %s %s: %s: %s: invalid chunk state%s: %s: invalid volume state transition %d -> %d could not requeue I/O%s: sr_wu_enqueue_ccb got active wu%s: sr_wu_init got active wu%s: invalid target on wu: %p%s: i/o error on block %lld target %d b_error %d unknown optional metadata type%02x%02x%02x%02x-%02x%02x-%02x%02x-%02x%02x-%02x%02x%02x%02x%02x%02x%s%sOPENBSDSR %s%03d%s: %s: %s: invalid chunk state transition %d -> %d %s: sr_startwu_callbacksr_schedule_wu: work unit not in progress (state %i) sr_sync%s: invalid optional metadata checksumunknown old optional metadata type %u %s: no in memory copy of metadata %s: could not allocate metadata scratch area %s: could not write metadata to %s %s: save metadata failed sr_shutdownsr_down%s: roaming device %s -> %s %s: sr_scsi_cmd NULL discipline %s: %s device is being deleted, failing io %s: wu %p not on pending queueunable to allocate work unitsunable to allocate ccbsvolume %s not found%s has unsupported sector size (%d)could not allocate memory for metadatacould not allocate memory for foreign metadata%s: sr_rw: failed to allocate vnode %s: I/O error %d on dev 0x%x at block %llu failed to get DUID for softraid volumeinsufficient boot storagefailed to write boot blockfailed to write boot loadercould not save metadata to %s%s: sr_meta_rw: invalid metadata pointer cannot clear foreign metadatanot enough memory for metadata buffercould not read native metadatanot part of the same volumenot all chunks are of the native metadata formatsrc_dev_mm == NODEV%s%d%cdiscipline does not support rebuildrebuild already in progressvolume not degradedno offline chunks available to rebuild%s: sr_rebuild_init: can't allocate vnode %s partition not of type RAID (%d)%s partition too small, at least %llu bytes required%s partition too large, wasting %llu bytes%s is already in userebuild of %s started on %s%s: no offline chunk found on %s! %s: %s volume degraded, will attempt to rebuild on hotspare %s sr_hotspare%s: pending I/O failed to complete on failed chunk %s, hotspare rebuild aborted... %s is already a hotsparesr_hotspare: cannot allocate vnodeHOTSPAREcould not save metadata for %sunsupported state request %dchunk not part of arrayinvalid foreign metadatanot valid softraid metadatainvalid metadata checksumcannot read metadata version %u on %s, expected version %u or earliersr_meta_native_bootprobe: cannot allocate vnodenot enough memory for fake disciplinesr_meta_native_bootprobe: cannot allocate vnode for partitionnative bootprobe could not read native metadatasr_meta_probe: cannot allocate vnodesrdiscould not create discipline workqcould not initialize disciplinechunk %s already in useinvalid metadata formatdisk %s is currently in use; cannot force createfailed to clear metadataone of the chunks has corrupt metadata; aborting assemblychunk sizes are not equal; up to %llu blocks wasted per chunkvolume level does not match metadata leveldisk %s already assembledtrying to bring up %s degraded%s was not shutdown properly%s is offline, will not be brought onlineno free target for %sscsi_probe_lun failedvolume %s is roaming, it used to be %s, updating metadata%s volume attached as %sunable to create sensor for %ssdwd%s: failed to allocate boot volume %s: failed to allocate device array %s: failed to allocate ondisk array %s: failed to allocate hotspare %s: found duplicate chunk %u for volume %u on device %s %s: not all chunks were provided; attempting to bring volume %d online sr_locksr_hs_lock%s: controller registration failed%s: bogus rebuild restart offset, starting from 0 %s: resuming rebuild on %s at %d%% %s: could not create read io %s: could not create write io sr_rebuild%s: could not save metadata to %s sr_yieldsoftraidsr_raid0_rw%s: %s: too many ccbs queued invalid strip size%s requires two or more chunksRAID 0%s: retrying read on block %lld %s: sr_raid1_intr_cb%s: permanently failing write on block %lld sr_raid1_rw%s: is offline, cannot read invalid volume stateRAID 1%.2x %s: permanently fail write on block %lld sr_raidp_rw%s: can't get wu_rDisk %llx offline, regenerating buffer %s: is offline, can't read %s: %s: invalid volume state transition %d -> %d%s: %s: %s: invalid chunk state transition %d -> %d%s requires three or more chunksRAID 4RAID 5%s: sr_crypto_finish_iosr_crypto_wu_get: out of work unitssr_crypto_intr: no wusr_crypto_done: no ccbs on workunitsr_crypto_rwcannot open key disk %s%s partition not of type RAID (%d) %s is not a key diskCRYPTOKEYDISKunable to allocate CCBsincorrect key or passphrase%s requires exactly one chunksr_raid6_rwDisk %llx offline, regenerating Dx+P Disk %llx & %llx offline, regenerating Dx+Dy +Q singleDisk %llx offline, regenerating Dx%s old_state = %d, %d = %d, invalid new_state%s requires four or more chunksRAID 6sr_concat_rwCONCATRAM diskfictitiousrdattach: out of memoryrd%drdattach: device name too long%s: insufficient message buffers %s: %s htplevhotplug: event lost, queue full Not set. All breakpoints used. Already set. Too many breakpoints. No breakpoints set Count Address %5d the kernel did not panic Bad function Too many arguments Argument missing %-12sNo such command Ambiguous Bad modifier Count missing ddb> procscalloutpoolsmountsvnodesbufsallbcstatsbreaksextentsmallocobjectpagepanicpoolprocuvmexpvnodewatchescrashdumphaltrebootpoweroffmachineprintexaminesearchdeletebreakdwatchwatchstepcontinueuntilnextmatchtracecallpsshowboothelphangmandmesg.strtab[ %s symbol table has bad start address %p ] ELFbad e_machine.symtab[ using %lu bytes of %s ELF symbol table ] bad magicsymtab unalignedsymtab corrupted[ %s ELF symbol table not valid: %s ] ELFAddress missing Value missing : %*lx%*ld%*lu%*lo\%03o= 0x%lx %-*s%-*lx%-*ld%-*lu%-*loSymbol not found Syntax error Divide by 0 Negative shift amount () Score: %lu/%lu ^R Bad character in number Bad escape String too long Bad character Faulted in traceback, aborting... Starting stack trace... End of stack trace. -%#*lx-%*lx-%#*lo-%*lo-%#*lu-%*lu--db_more-- %-12s%s %s+%s [after %6d] [%s:%d]invalid symbol table nameSifting table %s: Unable to find symbol table slot for %s.No slots left for %s symbol table%s%s %s bsd[ no symbol table formats found ] After %d instructions Breakpoint at Stopped at RUN AT LEAST 'trace' AND 'ps' AND INCLUDE OUTPUT WHEN REPORTING THIS PANIC! DO NOT EVEN BOTHER REPORTING THIS WITHOUT INCLUDING THAT INFORMATION! Unknown variable No value radixmaxoffmaxwidthtabstopslineslogNo watchpoints set Address Size %8lx %lx All watchpoints used. Too many watchpoints. Unknown size %s = %s Nothing written. /mnt/etc/firmware/%sRRIP without PX field? SPIEEE_1282IEEE_P1282RRIP_1991ARRIP with incorrect NM flags? RRIP with incorrect flags?isoinodefhtovp: lbn exceed volume space %d fhtovp: crosses block boundary %d fhtovp: bread error %d fhtovp: directory crosses block boundary %d[off=%d/len=%d] CD001%/@%/C%/Ecd9660_mountroot: can't setup bdevvp'scd9660root_devicetag VT_ISOFS, isofs vnode cd9660_strategy: spec%s@%dOpenBSD#!/dev/fd/%d/dev/consolewarning: /dev/console does not exist warning: /dev/console error %d initexecinit: couldn't allocate argument spaceexec %s: error %d init: not found no initswapperfork initcfpendcannot mount rootcannot find root vnodepagedaemonfork pagedaemonreaperfork reapercleanerfork cleanerupdatefork updateaiodonedfork aiodonedscheduler/sbin/init/sbin/oinit/sbin/init.bakbqquiesbqqueuebqwaitbqdestbufq_init: type %i unknownbufq init failbqinitinitclocks: unable to register softclock intrfdlockfileplfdescpldup2: fdallockqreadkqueueplknoteplwaitinit died (signal %d, exit %d)thrdeathcpu_exit returnedprocessppwaitunable to allocate kthread_qWARNING: thread `%s' (%d) exits with status %d No KMEMSTATS compiled in %d,malloc(): allocation too large, type = %d, size = %lu malloc: allocation too large, type = %d, size = %lu malloc: out of space in kmem_mapphysiomawnusage: show all procs [/a] [/n] [/w] /a == show process address info /n == show normal process info [default] /w == show process wait/emul info PID %-10s %18s %18s %18s COMMANDSTRUCT PROC *UAREA *VMSPACE/VM_MAP PID %5s %5s %5s S %10s %-12s %-16s PPIDPGRPUIDFLAGSWAIT PID %-16s %-8s %18s %s EMULWAIT-CHANNELWAIT-MSG%c%5d %-10.10s %18p %18p %18p %5d %5d %5d %d %#10x %-12.12s %-16s %-16s %-8s %18p %s PROC (%s) pid=%d stat=%s flags=%b CONTROLTINMEMSIGPAUSEPPWAITPROFILSELECTSINTR SUGID SYSTEM TIMEOUT TRACED WAITEDWEXITEXECPWEUPCISPWAITCOREDUMPINGSUGIDEXECSUSPSINGLENOZOMBIEINEXECSYSTRACECONTINUEDSINGLEEXITSINGLEUNWINDTHREADSUSPSIGSOFTDEPSTOPPEDCPUPEG pri=%u, usrpri=%u, nice=%d forw=%p, list=%p,%p process=%p user=%p, vmspace=%p estcpu=%u, cpticks=%d, pctcpu=%u.%u, swtime=%u user=%llu, sys=%llu, intr=%llu chgproccnt: procs < 0procinit: mallocprocplprocessplzombieplucredplpgrpplsessionplpcredplidlezombiedeadonprocplimitplcpu_switchto returnedfork idleidle%dstunrsensor_task_unregister: unexpected state %dsensordevpausesuspendsigwaitusersystempid %d (%s): %s write of %lu@%p at %lld failed: %d /var/crash/%s%s.coreissignal sigaplhashinit: bad cnt%02hx%02hx%02hx%02hx%02hx%02hx%02hx%02hx%s:%s,sysctllksysctldlkthrsleep%s%s(%d)Timecounter "%s" frequency %lu Hz -- Insufficient hz, needs at least %u Time stepped from %lld.%09ld to %lld.%09ld dummynanosleepdenied attempt to set clock forward to %lld denied attempt to set clock back %lld seconds ?%9d %2d/%-4d %8x %s ticks now: %d ticks wheel arg func boredunexpected %s wq state %dunable to create workq thread for "%s" wqdestroywqtaskssyswqsmashed stack in %ssetrunnablepreempt: cpu_preempt not yet implementedfailing resume cannot be handled resume %s config_defer: can't defer config of a root deviceconfig_defer: can't allocate defer structureautoconfconfig_detach: forced detach of %s failed (%d)%s detached config_make_softcconfig_make_softc: allocation for device softc failed%s%dconfig_make_softc: device name too longexpandcreatconfig_make_softc: %sing dev arrayconfig_make_softc: duplicate %s>>> probing for %s* mapply: no match function for '%s' device>>> %s probe returned %d >>> %s probe won >>> no winning probe %s at root%s at %sroot device %s not configured not configured unsupported /dev/%s%s%ccannot obtain vnode for 0x%x/0x%xcannot open disk, 0x%x/0x%x, error %dcannot read disk label, 0x%x/0x%x, error %droot filesystem has size 0filesystem type %d not known.. assuming ffs use one of: exit %s[a-p]dkopendisklabels not read:root device (default %sswap device (default %s%s)root device (%s) not foundnetbootroot on %s%ccan't figure root, hope your kernel is right (%02hx%02hx%02hx%02hx%02hx%02hx%02hx%02hx.%c) swap on %s%d%c dump on %s%d%croot device (%02hx%02hx%02hx%02hx%02hx%02hx%02hx%02hx) not founddisk_unbusy: %s: dk_busy < 0 disk_detach: disk_count < 0dklkdisk_attach: can't allocate storage for disklabelwrit%s%d%c: %s %sing fsbn %lld%lld of %lld-%lld (%s%d bn %lld; cn %lld tn %lld sn %lld)%s: NULL extentextent `%s' (0x%lx - 0x%lx), flags=%b FLWANTEDWANTEDNOCOALESCEFIXED 0x%lx - 0x%lx extnt%s: start 0x%lx, end 0x%lx %s: region not foundextentplklog page %p, nmissing %d POOL %s: size %u, align %u, ioff %u, roflags 0x%08x alloc %p minitems %u, minpages %u, maxpages %u, npages %u itemsperpage %u, nitems %u, nout %u, hardlimit %u nget %lu, nfail %lu, nput %lu npagealloc %lu, npagefree %lu, hiwat %u, nidle %lu empty page list: full page list: partial-page list: no current page curpage %p pool(%p:%s): page inconsistency: page %p; at page head addr %p (p %p) pool(%p:%s): page inconsistency: page %p; item ordinal %d; addr %p (p %p) pool(%p:%s): page inconsistency: page %p; %d on list, %d missing, %d items per page pool(%p:%s): page inconsistency: page %p; %d on list, %d missing, %d expected usage: show all pools [/a] %-10s%4s%9s%5s%9s%6s%6s%6s%6s%6s%6s%5s SizeRequestsFailReleasesPgreqPgrelNpageHiwatMinpgMaxpgIdle%-12s %18s %18s Allocator%-12s %18p %18p inf %*u %*lu %*d %*s %*lu pool_put of NULLpool_do_put: %s: page header missingpool_get: PR_ZERO when ctor setpool_do_get: %s: page emptypool_init: too much uptimephpooldma%d0123456789abcdef%llo%llx(null)0123456789ABCDEFbug in kprintf: bad base%s: table is full panic: splassert: %s: want %d have %d spl assertion failure in %skernel %sassertion "%s" failed: file "%s", line %d*FOUND**UNKNOWN*0%o0x%x%3d free slot (for add) %3d %s count %d disable (pseudo device) Unknown devno (max is %d) %3d at ??? %s flags 0x%x %s [] ? Unknown argument command args description [count] number of lines before moredev add a device8|10|16 base on large numbersdevno|dev change devices enter ddbattr val|devno|dev disable devicesattr val|devno|dev enable devicesdevno|dev find devices this message list configuration leave UKC[attr [val]] show attributes (or devices with an attribute)[mins [dst]] set timezone/dst toggle verbose booting don't know--- more --- Error unknown state already%3d can't enable free slot %3d %s disabled %3d can't disable free slot already Unknown routine /%c/ Value missing for attribute Unknown attribute change (y/n) ?out of memory. flags changed %3d can't change free slot count%3d %s changed Unknown pseudo routine /%c/ %s ? Not same device type No more space for new devices. Device not complete number or * is missing No device of this type exists. Clone Device (DevNo, 'q' or '?')Insert before Device (DevNo, 'q' or '?')Unknown command, try help Argument expected Dev expected 8|10|16 expected DevNo or Dev expected Attr, DevNo or Dev expected timezone = %d, dst = %d disautoconf verbose %sabled Unknown command User Kernel Config UKC> Continuing... addchangeddbdisableenablefindquittimezoneverbosepollselectpipeplpipelkpipeclpiperdpipewrttckoutqload: %d.%02d not a controlling terminal no foreground process group empty foreground process group runningrunnableiowait cmd: %s %d [%s] %lld.%02ldu %lld.%02lds %d%% %ldk ttyrub: would panic c = %d, val = %d mbuf %p m_type: %hi m_flags: %b M_EXTM_PKTHDRM_EORM_CLUSTERM_PROTO1M_VLANTAGM_LOOPM_FILDROP M_BCAST M_MCAST M_CONF M_AUTH M_TUNNELM_ZEROIZEM_LINK0m_next: %p m_nextpkt: %p m_data: %p m_len: %u m_dat: %p m_pktdat: %p m_pkthdr.len: %i m_ptkhdr.rcvif: %p m_ptkhdr.rdomain: %u m_ptkhdr.tags: %p m_pkthdr.tagsset: %hx m_pkthdr.csum_flags: %hx m_pkthdr.ether_vtag: %hu m_pkthdr.pf.flags: %b GENERATEDFRAGCACHETRANSLATE_LOCALHOSTDIVERTEDDIVERTED_PACKETPF_TAG_REROUTEm_pkthdr.pf.hdr: %p m_pkthdr.pf.statekey: %p m_pkthdr.pf.qid: %u m_pkthdr.pf.tag: %hu m_pkthdr.pf.prio: %u m_pkthdr.pf.tag: %hu m_pkthdr.pf.routed: %hx m_ext.ext_buf: %p m_ext.ext_size: %u m_ext.ext_type: %x m_ext.ext_backend: %i m_ext.ext_ifp: %p m_ext.ext_free: %p m_ext.ext_arg: %p m_ext.ext_nextref: %p m_ext.ext_prevref: %p m_copydata: off %d < 0m_copydata: len %d < 0m_copydata: short mbuf chainm_copydata: null mbufunknown type of extension bufferm_copym0: off %d, len %dm_copym0: short mbuf chainm_copym0: m == NULL and not COPYALLmbuf prepend length too bigmbplmtagplmcl%dkm_apply: len %d < 0m_apply: off %d < 0m_apply: null mbuf in skipm_apply: null mbufWARNING: mclpools limit reached; increase kern.maxclustersrequested tag size for pool %#x is too bigm == NULL in m_pulldown()unixsoaccept: !NOFDREFnetclssoclose: NOFDREFsockplsbcreatecontrol: message too large %d sbdropsbappendcontrolsemi-panic: sbcompressnetlcknetiosbappendaddrnetcon2netconacceptunp_disconnectunp_connect2unp_attachuipc 1uipc 2uipc 4piusrreqCurrent Buffer Cache status: numbufs %lld busymapped %lld, delwri %lld kvaslots %lld avail kva slots %lld bufpages %lld, dirtypages %lld pendingreads %lld, pendingwrites %lld bremfree: lost tailbiowaitbufplbiodone alreadyneedbuffernobuffersbuf_get: dup lblk vp %p bp %pgetblkbuf_needvabufinit: can't reserve VM for buffersnchplwtf? leak?vop_generic_revokeallnameilf_findoverlap: defaultlockfplrelookup: null namerelookup: lookup on dot-dot vp %p lblkno 0x%llx blkno 0x%llx dev 0x%x proc %p error %d flags %b AGENEEDCOMMITASYNCBADBUSYCACHECALLDELWRI DONE EINTR ERROR INVAL NOCACHEPHYSRAWREADWANTEDWRITEINPROGXXX(FORMAT)DEFERREDSCANNEDDAEMONRELEASED bufsize 0x%lx bcount 0x%lx resid 0x%lx sync 0x%x data %p saveaddr %p dep %p iodone %p dirty {off 0x%x end 0x%x} valid {off 0x%x end 0x%x} tag %s(%d) type %s(%d) mount %p typedata %p data %p usecount %d writecount %d holdcnt %d numoutput %d clean bufs: bp %p dirty bufs: flags %b vnodecovered %p syncer %p data %p RDONLYSYNCHRONOUSNOEXECNOSUIDNODEVASYNCEXRDONLY EXPORTED DEFEXPORTED EXPORTANON EXKERB LOCALQUOTAROOTFSvfsconf: ops %p name "%s" num %d ref %d flags 0x%x statvfs cache: bsize %x iosize %x blocks %llu free %llu avail %lld files %llu ffiles %llu favail %lld f_fsidx {0x%x, 0x%x} owner %u ctime 0x%x syncwrites %llu asyncwrites = %llu syncreads %llu asyncreads = %llu fstype "%s" mnton "%s" mntfrom "%s" mntspec "%s" locked vnodes: %p, %pall vnodes: %p, %p,brelvp: NULLbgetvp: not freevflushbuf: not dirtyvflushbufvinvalbufvinvalbuf: dirty bufsvinvalbuf: flush failedvwakeup: neg numoutputsoftdep %d vclean: deadlockvclean: cannot reclaimvclean: not cleanvgonemissing aliasvgonel: not cleanmissing bdevvgetvfslockunmount of %s failed with error %d WARNING: some file systems would not unmount retrying syncing disks... giving up done kinfo: vp changed VNONVREGVDIRVBLKVCHRVLNKVSOCKVFIFOVBADNONUFSNFSMFSMSDOSFSPORTALPROCFSAFSISOFSADOSFSEXT2FSVFSNTFSUDFFUSEFSsyncer vnode syncermount: lost mountunmount: dangling vnodevn_lockspec_badop calledspec_ioctltag VT_NON, dev %d, %d spec_close: not specialspec_fsync: not dirtyspec_fsyncspec_read typespec_write typechkvnlockdead_badop calleddead_write: lockdead_read: locktag VT_NON, dead vnode dos2unixtime(): month value out of range (%ld) detrunc(): can't truncate root directory, clust %ld, offset %ld deextend: file too largedenodedeget(): pcbmap returned %d extendfile(): attempt to extend root directory extendfile: pcbmap. .. doscheckpath(): .. not a directory? msdosfs_sync: rofs modmsdosfs: reducing max cluster to %d from %d due to FAT size RRaArrAatag VT_MSDOSFS, startcluster %ld, dircluster %ld, diroffset %ld (LOCKED) dev %d, %d, %s msdosfs_strategy: specmsdosfs_rename: lost to startdirmsdosfs_rename: lost from startdirmsdosfs_rename: updating .. in root directory?msdosfs_write(): bad file typebpfattachbpf_mcopybpf: ifpromisc failedbpf_detachd: descriptor not in listbpfifa_update_broadaddr does not support dynamic lengthegresstoo many interfacesifaddritempl%s: can't handle af%d looutput: no header mbuflo%difmedia_add: can't malloc entryifmedia_set: no match for 0x%x/0x%x ifmedia_set failedcan't establish softnet handlerrn_init: radix functions require max_keylen be set rn_initrn_init 2Mask for route not entered rn_addmask: mask impossibly already in tree rn_delete: inconsistent normal annotation rn_delete: inconsistent dupedkey list rn_delete: inconsistent annotation %s %p at %p rn_delete: Orphaned Maskrn_delete: couldn't find our annotation rn_addroute: t->rn_p is NULLNon-unique normal route, mask not entered next == NULLraw_usrreqrt_timer_remove_all: rtq_count reached 0 rt_timer_add: rtq_count reached 0 ifafreertfreertfree 2rtfree: %p not freed (neg refs) rt_timer_init: already initializedrttmrplrtrequest deletertrequest1 RTM_RESOLVE: wrong ifa (%p) was (%p) rt_timer_timer: rtq_count reached 0 rt_timer_queue_destroy: rtq_count reached 0 rtinit: wrong ifa (%p) was (%p) rtentplroute_init rtable_addroute_outputrouteunexpected mode %uUnexpected mode %u%s: invalid channel freq %u flags %x %s: invalid channel (NULL) Bad IBSS channel %u%s: bad channel ignored; freq %u flags %x number %u Pairwise key expansionPMK Name%s: Michael MIC failure %s: station %s disassociated by peer (reason %d) %s: station %s deauthenticated by peer (reason %d) %s: %sassociation failed (status %d) for %s %s: received %s from %s rssi %d mode %s 80211scanfreeing bss nodenot in ap mode, mode %u%s: station %s purged from node cache %s: number of cached nodes is %d, expected %d,possible nodes leak unable to setup inital BSS node%s: no memory for AID bitmap! %s: no memory for TIM bitmap! -%s: tsft offset %s%llu %s: ieee80211_ibss_merge: bssid mismatch %s %s: my tsft %llu beacon tsft %llu %s: sync TSF with %s %s: rates mismatch, BSSID %s %s: sync BSSID %s -> (from %s) %s: creating ibss activepassive%s: end %s scan %s: begin %s scan invalid group data cipher!invalid integrity group cipher!management frame too large: %unull node%s: sending %s to %s on channel %u mode %s %s: no node for dst %s, discard raw tx frame %s: failed to queue raw tx frame %s: station %s deauthenticate (reason %d) %s: station %s disassociate (reason %d) %s: received msg %d/%d of the %s handshake from %s group key4-wayEAPOL-Key frame too large: %u%s: sending EAPOL-Key request to %s %s: sending msg %d/%d of the %s handshake to %s "0x%s: no recent beacons from %s; rescanning %s: bogus xmit rate %u setupassociatedsynchronized%s: %s with %s ssid .5 channel %d start %u%sMbshortlong protection enabled %s preamble %s slot time%s newly%s: station %s %s authenticated (open) %s: open authentication failed (reason %d) for %s assoc_reqassoc_respreassoc_reqreassoc_respprobe_reqprobe_respreserved#6reserved#7beaconatimdisassocauthdeauthactionaction_noackreserved#15INITSCANAUTHASSOCRUNauto11a11bturboaearazbgbhbnbrbybzcacncocrczdodzegf2fifofrgrgthkhnhrhuidiqisj1j2j3j4j5jmjojpk2kekpkrkwkzlblilvmcmkmomxmyninlnzpapkprqarusasgsisvtntrtttwuaukuyvnyezazwAPL1APL1AAPL1_ETSICAPL1_FCCAAPL1WAPL2APL2CAPL2DAPL2_ETSICAPL2WAPL3APL3WAPL4APL4WAPL5APL5WAPLDAPLDEBUGETSI1ETSI1WETSI2ETSI2WETSI3ETSI3AETSI3W,ETSI4ETSI4CETSI4WETSI5ETSI5WETSI6ETSI6WETSIAETSIBETSICETSIEU1WFCC1FCC1AFCC1WFCC2FCC2CFCC2AFCC2WFCC3FCC3AFCCAFRANCEMKK1MKK1_FCCAMKK1AMKK1A1MKK1A2MKK1BMKK2MKK2AMKKANONEWOR01WWOR02WWOR0WWOR1WWOR2WWOR3WWOR4WWOR5_ETSICWOR9WWORAWWORLD la_rt=%p la_hold_head=%p, la_asked=0x%lx [NULL][ ifa_addr= ifa_dsta= ifa_mask= flags=0x%x, refcnt=%d, metric=%d rtentry=%p flags=0x%x refcnt=%d use=%llu expire=%u rtableid %u key= mask= gw= ifp=%p (%s)(NULL) ifa=%p genmask= gwroute=%p llinfo=%p Route tree for AF_INET (not initialized) arptfreearpresolve: %s: route without link local address arpresolve: %s: can't allocate llinfo arp: ether address is broadcast for IP address %s! duplicate IP address %s sent from ethernet address %s arp: attempt to overwrite permanent entry for %s by %s on %s arp: attempt to overwrite entry for %s on %s by %s on %s arp info overwritten for %s by %s on %s arp: attempt to add entry for %s on %s by %s on %s arp_rtrequest: bad gateway value arp_rtrequest: malloc failed in_controlinvalid argument to in_lifaddr_ioctlIPv6 pcb passed into in_pcbconnectinpcbplin_pcbinit: hashinit failedin_pcbinit: hashinit failed for lportinterneticmp_do_exthdr: m_getptr failureicmp_redirect_timeout: bad route to timeouticmp_mtudisc_timeout: bad route to timeouticmp_erroricmp lenipqeplipqplip_initaeshmac-sha1deflate%d.%d.%d.%drip_attachrip_detachrip_usrreqsynpltcp_pulloutofbandm_pulldown malfunctiontcp_output REXMTtcp_outputtcpcbpltcpqepltcp_inittcp_usrrequdp_usrreqipip_input: should never reach herelibdes v 3.21 - 95/11/21 - eaycryptopcryptodesccrydevcuio_copyback: off %d < 0cuio_copyback: len %d < 0cuio_copyback: empty in skipuio_copyback: emptycuio_copydata: off %d < 0cuio_copydata: len %d < 0iov_copydata: empty in skipcuio_copydata: emptycuio_apply: len %d < 0cuio_apply: off %d < 0cuio_apply: ind %d >= uio_iovcnt %d for offcuio_apply: ind %d >= uio_iovcnt %d for lenSoftware crypto device cannot initialize!DES3DESBlowfishCAST-128Rijndael-128/AESAES-CTRAES-GCMAES-GMACAES-XTSARC4HMAC-MD5HMAC-SHA1HMAC-RIPEMD-160HMAC-SHA2-256HMAC-SHA2-384HMAC-SHA2-512GMAC-AES-128GMAC-AES-192GMAC-AES-256Keyed MD5Keyed SHA1MD5SHA1DeflateLZS1.2.3start = %d, len = %d, fs = %s ffs_alloccg: map corruptedbno = %lld, fs = %s ffs_alloccg: block not in mapffs_freefile: range: dev = 0x%x, ino = %d, fs = %sdev = 0x%x, ino = %u, fs = %s ffs_freefile: freeing free inodedev = 0x%x, bsize = %d, size = %ld, fs = %s ffs_blkfree: bad sizebad block %lld, ino %u uid %u on %s: %s bad blockdev = 0x%x, block = %lld, fs = %s ffs_blkfree: freeing free blockffs_blkfree: freeing free fragcg = %d, irotor = %d, fs = %s ffs_nodealloccg: map corruptedffs_nodealloccg: block not in mapffs_clusteralloc: lost blockmode = 0%o, inum = %u, fs = %s ffs_valloc: dup allocfree inode %s/%d had %lld blocks out of inodes %s: create/symlink failed, no inodes free dev = 0x%x, bsize = %d, bprev = %lld, fs = %s ffs_realloccg: bad bprevffs_realloccg: bad blocknodev = 0x%x, optim = %d, fs = %s ffs_realloccg: bad optimfile system full %s: write failed, file system is full ffs2_balloc: block too bigffs2_balloc: unwind failedffs1_balloc: blk too bigCould not unwind indirect block, error %dffs_indirtrunc: bad buffer sizeffs_truncate: newspaceffs_update: bad link cntsoftdep_flushfiles calledffsinodino1pldino2plupdate: rofs modffs_statfsWARNING: %s was not properly unmounted WARNING: R/W mount of %s denied. Filesystem is not clean - run fsck ffs_mountfs(): obsolete rotational table format, please use fsck_ffs(8) -c 1 ffs_reload: dirty1ffs_reload: dirty2WARNING: soft updates isn't compiled in ffs_mountroot: can't setup bdevvp's ffsffs_fsync: not dirtyffs_fsyncffs_write: nonsync dir writeffs_write: typecheckpath: .. not a directory First bad Second bad %s: bad dir ino %u at offset %d: %s bad dirufs_direnter: newblkufs_direnter: compact1ufs_direnter: compact2mangled entryi_ffs_size too smallufs_strategy: specufs_readdir: lost in spaceufs_rename: lost from startdirufs_rename: lost to startdirrename: EXDEVufs_rename: same fileufs_rename: lost dir entrychown: lost quotaifree: range: dev = 0x%x, ino = %d, fs = %sdev = 0x%x, ino = %d, fs = %s ifree: freeing free inodebad block %d, ino %u dev = 0x%x, block = %d, fs = %s mode = 0%o, nlinks %u, inum = %u, fs = %s ext2fs_valloc: dup allocext2fs_alloccg: map corruptedext2fs_mapsearch: block not in mapcg = %d, ipref = %d, fs = %s ext2fs_nodealloccg: map corruptedext2fs_nodealloccg: block not in mapext2fs_indirtrunc: bad buffer sizecheckpathrec_len is smaller than minimalrec_len % 4 != 0reclen is too small for name_lendirectory entry across blocksinode out of boundsbad directory entry: %s offset=%d, inode=%lu, rec_len=%d, name_len=%d ext2fs_dirbadentryi_size too smallext2fs_direnter: newblkext2fs_direnter: frag size%s: nonsync dir writeext2fs_write%s: typeExt2 fs: unsupported first inode positionExt2 fs: unsupported optional feature ext2fs_statfsext2fs_reload: dirty1ext2fs_reload: dirty2%s: file system not clean; please fsck(8) ext2fs_mountroot: can't setup bdevvp'sext2fsext2inoplext2dinoplext2fs_mkdir: blksizeext2fs_rename: lost from startdirext2fs_rename: lost to startdirrename: linked directoryext2fs_rename: lost dir entryext2fs_rename: mangled dir- uvm_addr %s: NULL - uvm_addr %s: %p (%s 0x%lx-0x%lx) entry %p: 0x%lx-0x%lx G=0x%lx F=0x%lx free: 0x%lx-0x%lx start=0x%lx, expected at least 0x%lx 0x%lu entries, 0x%lx free bytes pivot 0x%lx, epires in %d, direction %d empty 0x%lx - 0x%lx free (0x%lx bytes) contains pivot %d (0x%lx) %s: entry was not in tree%s: duplicate insertion: state %p inserting entry %p which collides with %p%s: duplicate insertion: state %p interting %p, colliding with %puvm_addr_invoke: address selector %p (%s 0x%lx-0x%lx) returned unavailable address 0x%lxuaddruaddrhintuaddrbestfituaddrpivotuaddrrnduaddr_linuaddr_rnduaddr_hintuaddr_kbootstrapuaddr_bestfituaddr_pivotuaddr_stckbrkamap_unadd: offset out of rangeamap_unadd: nothing thereamap_lookup: offset out of rangeamap_add: offset out of rangeamap_add: replacing null anonamap_add: slot in useamap_lookups: offset out of rangeamap_splitref: split at zero offsetamap_splitref: map size check failedamap_cow_now: non-resident wired page in anon %pcownowcownowpageamap_wipeout: corrupt amapamapplamap_pp_adjref: overshot targetamap_pp_adjref: negative reference countanonpluao_set_swslot: uobj = %p uao_set_swslot: attempt to set a slot on a NOSWAP objectuao_flush: strange, got an out of range flush (fixed) uaoflshuao_flush: weird flagsuao_detuaoeltplaobjpluao_create: kernel object already allocateduao_create: asked to enable swap on kernel objectuao_create: hashinit swhash faileduao_create: malloc swslots faileduao_getpageuao_getudv_faultudv_detachudv_attachuvm_fault_unwire_locked: address not in mapanonget1anonget2flt_noram1fltamapcopyflt_noram2flt_noram3flt_pmfail1fltagain2flt_noram4flt_noram5flt_pmfail2uvm_init: page size not setkm_free: unmanaged page 0x%lx km_allocvakmallockmthreadvallocwaitkm_alloc1wkm_pgrmuvm_km_suballoc: unable to allocate space in parent mapuvm_km_suballoc: unable to create submapuvm_km_suballoc: submap allocation faileduvm_km_init: could not reserve space for kerneluvm_km_pgremove_intrsafe: no pageuvm_map_clean: weird flagsuvm_mapent_addr_removeuvm_mapent_addr_insert: entry still in addr listuvm_mapent_addr_insert: map %p entry %p (0x%lx-0x%lx G=0x%lx F=0x%lx) insert collision with entry %p (0x%lx-0x%lx G=0x%lx F=0x%lx)OBJECT %p: pgops=%p, npages=%d, refs= refs=%d PAGES : <%p,0x%llx> PAGE %p: flags=%b, vers=%d, wire_count=%d, pa=0x%llx uobject=%p, uanon=%p, offset=0x%llx loan_count=%d [page ownership tracking disabled] vm_page_md %p >>> ANON DOES NOT POINT HERE <<< (%p) anon backpointer is OK checking object list page found on object list >>> PAGE NOT FOUND ON OBJECT LIST! <<< page found in uvm_pmemrange >>> page not found in uvm_pmemrange <<< checking pageq list page found on pageq list >>> PAGE NOT FOUND ON PAGEQ LIST! <<< MAP %p: [0x%lx->0x%lx] brk() allocate range: 0x%lx-0x%lx stack allocate range: 0x%lx-0x%lx sz=%u, ref=%d, version=%u, flags=0x%x pmap=%p(resident=%d) vm_refcnt=%d vm_shm=%p vm_rssize=%u vm_swrss=%u vm_tsize=%u vm_dsize=%u vm_taddr=%p vm_daddr=%p vm_maxsaddr=%p vm_minsaddr=%p - %p: 0x%lx->0x%lx: obj=%p/0x%llx, amap=%p/%d submap=%c, cow=%c, nc=%c, prot(max)=%d/%d, inh=%d, wc=%d, adv=%d hole=%c, free=%c, guard=0x%lx, free=0x%lx-0x%lx fspace_augment=%lu freemapped=%c, uaddr=%p (0x%lx-0x%lx %s) any[%d]brk/stackvmspplvmmpeplvmmpekpluvm_map_splitentry: split address 0x%lx not on page boundary!uvm_mapent_alloc: cannot allocate map entryuvm_mapent_alloc: out of static map entries vmmaplkuvm_map_setup: rw_enter failed on new mapuvmspace_fork: no space in map for entry in empty mapfork: encountered a submap during fork (illegal)fork: non-copy_on_write map entry marked needs_copy (illegal)uvm_map_teardown: rw_enter failed on free mapuvm_page_physget: called _after_ bootstrapuvm_page_physget: out of memory!uvm_setpagesize: page size not a power of twouvm_pglistallocuvm_pglistalloc: Upper boundary 0x%lx not on pagemask. uvm_page_physdump: physical memory config [segs=%d of %d]: 0x%llx->0x%llx [0x%llx->0x%llx] STRATEGY = RANDOM uvm_page_physload: unable to load physical memory segment %d segments allocated, ignoring 0x%llx -> 0x%llx increase VM_PHYSSEG_MAX uvm_page_physload: can not malloc vm_page structs for segment ignoring 0x%lx -> 0x%lx uvm_page_physload: tried to add RAM after vm_mem_inituvm_pageboot_alloc: out of virtual spaceuvm_pageboot_alloc: pmap_growkernel() faileduvm_pageboot_alloc: out of memoryuvm_page_bootstrap: no memory pre-allocateduvm_page_init: lost %ld page(s) in initsize 0 uvm_pagereallocpagersegpgdaemonpagedaemon: deadlock detected! Ranges, use queue: * [0x%lx-0x%lx] use=%d nsegs=%ld maxsegsz[%d]=0x%lx free=0x%lx #ranges = %d pagedaemon: wait_pla deadlock detected! pmrwaituvm_wait: failed to free %ld pages between 0x%lx-0x%lx uvm_pmr_split: lost one pmr Flags: 0x%x, will panic now. Current UVM status: pagesize=%d (0x%x), pagemask=0x%x, pageshift=%d %d VM pages: %d active, %d inactive, %d wired, %d free min %d%% (%d) anon, %d%% (%d) vnode, %d%% (%d) vtext pages %d anon, %d vnode, %d vtext freemin=%d, free-target=%d, inactive-target=%d, wired-max=%d faults=%d, traps=%d, intrs=%d, ctxswitch=%d fpuswitch=%d softint=%d, syscalls=%d, kmapent=%d fault counts: noram=%d, noanon=%d, pgwait=%d, pgrele=%d ok relocks(total)=%d(%d), anget(retries)=%d(%d), amapcopy=%d neighbor anon/obj pg=%d/%d, gets(lock/unlock)=%d/%d cases: anon=%d, anoncow=%d, obj=%d, prcopy=%d, przero=%d daemon and swap counts: woke=%d, revs=%d, scans=%d, obscans=%d, anscans=%d busy=%d, freed=%d, reactivate=%d, deactivate=%d pageouts=%d, pending=%d, nswget=%d nswapdev=%d, nanon=%d, nanonneeded=%d nfreeanon=%d swpages=%d, swpginuse=%d, swpgonly=%d paging=%d kernel pointers: objs(kern)=%p warning: resource shortage: %d pages of swap lost swapdrum_addsw_reg_strategy: swap to sparse fileswstrategy: vnode type 0x%xswap_off: swapdev not in listswap0x%04xdisklabel region/dev/%s%d%cblkdev0x%xswapctl: copystruvm_swap_init: can't get vnode for swap deviceswapmapuvm_swap_init: extent_create failedswp vnxswp vndswplkuvm_coredump: user process with submap?sbrk: grow %ld failed, error = %d uvm_deallocate with null mapuvn_iosyncuvn_getpageuvn_getuvn_cluster: offset out of rangeuvn_flshuvn_flush: obj=%p, offset=0x%llx. error during pageout. uvn_flush: WARNING: changes to page may be lost! uvn_flushuvn_termuvm_vnp_terminate: io sync wanted bit setuvn_attachuvnsyncNULL pointer passed to ip_ecn_egressNULL pointer passed to ip_ecn_ingressin6_prefixlen2mask: invalid prefix length(%d) in6_are_prefix_equal: invalid prefix length(%d) in6_savemkludge: no kludge spacein6_unlink_ifa: interface address %s has no prefix ADDDELETEin6_ifloop_request: %s operation failed for %s (errno=%d) in6_purgeaddr: failed to remove a route to the p2p destination: %s on %s, errno=%d in6_update_ifa: a destination can be specified for a p2p or a loopback IF only in6_update_ifa: prefixlen should be 128 when dstaddr is specified in6_update_ifa: valid lifetime is 0 for %s in6_update_ifa: the prefix length of an existing (%s) address should not be changed in6_update_ifa: failed to remove a route to the old destination: %s in6_update_ifa: addmulti failed for %s on %s (errno=%d) prefix ioctls are now invalidated. please use ifconfig. nd6_prelist_add succeeded but no prefix invalid argument to in6_lifaddr_ioctlin6_ifawithscope: output interface is not specified in6_ifattach_loopback: failed to configure the loopback address on %s (errno=%d) %s: got interface identifier from itself %s: got interface identifier from %s %s: borrow interface identifier from %s %s: interface identifier generated by random number %s: failed to get interface identifier %s: ifid: %02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x %s: no ifid available in6_ifattach_linklocal: failed to configure a link-local address on %s (errno=%d) in6_ifattach: %s has too small MTU, IPv6 not enabled in6_ifattach: %s is not multicast capable, IPv6 not enabled in6_cksum: mbuf len (%d) < off+len (%d+%d)in6_cksum: out of datainternet6icmp6_redirect_timeout: bad route to timeouticmp6_mtudisc_timeout: bad route to timeout(src=%s dst=%s tgt=%s)ICMP6 redirect sent from %s rejected; must be from linklocal ICMP6 redirect sent from %s rejected; hlim=%d (must be 255) ICMP6 redirect rejected; redirect dst must be unicast: %s ICMP6 redirect rejected; no route with inet6 gateway found for redirect dst: %s ICMP6 redirect rejected; not equal to gw-for-src=%s (must be same): %s ICMP6 redirect rejected; no route found for redirect dst: %s ICMP6 redirect rejected; neither router case nor onlink case: %s icmp6_redirect_input: invalid ND option, rejected: %s icmp6_redirect_input: lladdrlen mismatch for %s (if %d, icmp6 packet %d): %s icmp6_notify_error: in6_embedscope failed sanity fail: off=%lx, sizeof(ip6)=%lx in %s:%d ../../../../netinet6/icmp6.cicmp6_reflect: source can't be determined: dst=%s, error=%d ICMP6 checksum error(%d|%x) %s icmp6_input: unknown type %d(src=%s, dst=%s, ifid=%d) ENOBUFS in icmp6_error %d icmp6_mtudisc_callback_registerOpenBSD-currentip6_nexthdr: m == NULLip6_input: packet to an unready address %s->%s ip6_initcannot forward from %s to %s nxt %d received on %s cannot forward src %s, dst %s, nxt %d, rcvif %s, outif %s assumption failed: hdr not splitscope error in prefix list (%s) nd6_init called more than once(ignored) ndopts == NULL in nd6_optionuninitialized ndopts in nd6_optionndopts == NULL in nd6_optionsuninitialized ndopts in nd6_optionsduplicated ND6 option found (type=%d) nd6_options: unsupported option %d - option ignored too many loop in nd opt unspecnd6_lookup: failed to lookup %s (if = %s) default router list contains a non-linklocal address(%s) a router(%s) advertises a prefix with non-link local address nd6_output: can't allocate llinfo for %s (ln=%p, rt=%p) nd6_setmtu0: new link MTU on %s (%lu) is too small for IPv6 ln->ln_rt == NULLln->ln_rt->rt_ifp == NULLrt_llinfo(%p) is not equal to ln(%p)dst=0 in nd6_timer(ln=%p)nd6_storelladdr: something odd happens nd6_storelladdr: sdl_alen == 0, dst=%s, if=%s ifp == NULL in nd6_cache_lladdrfrom == NULL in nd6_cache_lladdrndp info overwritten for %s by %s on %s nd6_rtrequest: bad gateway value: %s nd6_rtrequest: malloc failed %s: failed to join %s (errno=%d) nd6_dad_duplicated: DAD structure not found %s: DAD detected duplicate IPv6 address %s: NS in/out=%d/%d, NA in=%d %s: DAD complete for %s - duplicate found %s: manual intervention required ifa == NULL in nd6_dad_na_inputifa == NULL in nd6_dad_ns_inputnd6_na_output: source can't be determined: dst=%s, error=%d nd6_ns_output: source can't be determined: dst=%s, error=%d nd6_dad_timer: called with null parameter nd6_dad_timer: DAD structure not found ???nd6_dad_timer: called with duplicated address %s(%s) nd6_dad_timer: called with non-tentative address %s(%s) %s: could not run DAD, driver problem? %s: DAD complete for %s - no duplicates found nd6_dad_start: called with non-tentative address %s(%s) nd6_dad_start: ifa->ifa_ifp == NULLnd6_dad_start: memory allocation failed for %s(%s) %s: starting DAD for %s nd6_ns_input: invalid hlim (%d) from %s to %s on %s nd6_ns_input: bad DAD packet (wrong ip6 dst) nd6_ns_input: NS packet from non-neighbor nd6_ns_input: bad NS target (multicast) nd6_ns_input: invalid ND option, ignored nd6_ns_input: bad DAD packet (link-layer address option) nd6_ns_input: lladdrlen mismatch for %s (if %d, NS packet %d) nd6_ns_input: duplicate IP6 address %s nd6_ns_input: src=%s nd6_ns_input: dst=%s nd6_ns_input: tgt=%s nd6_na_input: invalid hlim (%d) from %s to %s on %s nd6_na_input: invalid target address %s nd6_na_input: a solicited adv is multicasted nd6_na_input: invalid ND option, ignored nd6_na_input: multicast adv without TLLA nd6_na_input: duplicate IP6 address %s nd6_na_input: ND packet from non-neighbor nd6_na_input: lladdrlen mismatch for %s (if %d, NA packet %d) in6_init_prefix_ltimes: preferred lifetime(%d) is greater than valid lifetime(%d) in6_ifadd: wrong prefixlen for %s (prefix=%d ifid=%d) in6_ifadd: failed to make ifaddr %s on %s (errno=%d) nd6_prefix_onlink: %s/%d is already on-link nd6_prefix_onlink: failed to find any ifaddr to add route for a prefix(%s/%d) on %s nd6_prefix_onlink: failed to add route for a prefix (%s/%d) on %s, gw=%s, mask=%s, flags=%lx errno = %d nd6_prefix_offlink: %s/%d is already off-link nd6_prefix_offlink: failed to recover a prefix %s/%d from %s to %s (errno = %d) nd6_prefix_offlink: failed to delete route: %s/%d on %s (errno = %d) pfxlist_onlink_check: failed to make %s/%d offlink, errno=%d prelist_remove: failed to make %s/%d offlink on %s, errno=%d prelist_remove: negative count on %s nd6_prelist_add: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_update: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_update: nd6_prelist_add failed for %s/%d on %s errno=%d, returnpr=%p defrouter_select: called unexpectedly (forwarding=%d, accept_rtadv=%d) defrouter_select: more than one router is installed defrtrlist_del: negative count on %s nd6_ra_input: invalid hlim (%d) from %s to %s on %s nd6_ra_input: src %s is not link-local nd6_ra_input: invalid ND option, ignored nd6_ra_input: invalid option len %d for prefix information option, ignored nd6_ra_input: invalid prefix len %d for prefix information option, ignored nd6_ra_input: invalid prefix %s, ignored nd6_ra_input: invalid prefixlen %d for rfc2374 prefix %s, ignored nd6_ra_input: bogus mtu option mtu=%lu sent from %s, ignoring nd6_ra_input: bogus mtu mtu=%lu sent from %s; exceeds maxmtu %lu, ignoring nd6_ra_input: lladdrlen mismatch for %s (if %d, RA packet %d) nd6_rs_input: invalid hlim (%d) from %s to %s on %s nd6_rs_input: invalid ND option, ignored nd6_rs_input: lladdrlen mismatch for %s (if %d, RS packet %d) rip6_attachrip6_detachrip6_usrreq invalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect header checkunknown compression methodinvalid window sizeunknown header flags setheader crc mismatchincorrect data checkincorrect length checkneed dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible versiondb_fetch_reg: botchaddress %p is invalid branch_taken: botch address 0x%08lx not a valid page Faulted in DDB; continuing... spsrr0r1r2r3r4r5r6r7r8r9r10r11r12usr_spusr_lrsvc_spsvc_lrpcund_spabt_spirq_spframetrace: pid %d not found at %p scp=0x%08x rlv=0x%08x () rsp=0x%08x rfp=0x%08x%sr%d=0x%08xBad frame pointer: %p Bad user frame pointer: %p frame address must be specified frame address = %08x r0 =%08x r1 =%08x r2 =%08x r3 =%08x r4 =%08x r5 =%08x r6 =%08x r7 =%08x r8 =%08x r9 =%08x r10=%08x r11=%08x r12=%08x r13=%08x r14=%08x r15=%08x slr=%08x mainbuscpu, rrx, %s r%d, %s #%d#0x%08x[r%d][r%d%s, #0x%03x#0x%02x{r%d-r%d}^f%d#%s0x%08xcpsr_p%df%d, c%d, c%d, c%d, c%d, %dr%d, c%d, c%d, %d[%c - unknown]und%s %08x imbimbrangeswiblxblmulSnmsmlaSnmsdumullSdnmssmullumlalsmlalstrtdaWldrtstrbtldrbtdsbisbstrldrstrbldrbstmYnWlldmXnWlldrsbldrhstrhldrshswpdmoswpbmrsdpnopyieldwfewfisevdbgmsrpFmpF2bxclzdmbkptSdn2eorsubrsbadcsbcrsctstDn2teqcmpcmnorrmovSd2bicmvnadfPRfghmufsufrsfdvfrdfpowrpwrmffmlfdvfrdpolfpbopmvfPRfhmnfrndsqtlgnexpsincostanasnacsatnfpuopstfQLvldffltPRgdfixPRdhwfsrfswfcrfccmfPRghcnfcmfecnfemcr2#zmcrmrc2mrccdp2#ycdpldc2L#vldcstc2stcNo support for this CPU type (%08x) in kernelUndefined instruction in kernel real mem = %u (%uMB) avail mem = %lu (%uMB) Warning IRQ's disabled during boot() WARNING: not updating battery clock _bus_dmamap_load_raw: not implemented_bus_dmamem_map: size botch_bus_dmamap_sync: mix PRE and POST%s: curaddr %#lx not in range_bus_dmamap_sync: ARM32_BUFTYPE_INVALIDunknown buffer type %d _bus_dmamap_syncProcessor failed probe - no CPU ID %s %s (%s core)%s: IDC disabled IDC enabled DC disabled DC enabled IC disabled IC enabled WB disabled WB enabled LABT EABT branch prediction enabled%s: %dKB/%dB %d-way %s unified cache %s: %dKB(%db/l,%dway) I-cache, %dKB(%db/l,%dway) %s D-cache %s: %s does not fully support this CPU. %s: This kernel does not fully support this CPU. %s: Recompile with "options %s" to correct this. unknown CPU (ID = 0x%x)ARM810ARM920TARM922TARM926EJ-SARM940TARM946E-SARM966E-STI ARM925TARM1020EARM1022E-SSA-110SA-1100SA-1110IXP1200i80200i80321 400MHzi80321 600MHzi80219 400MHzi80219 600MHzPXA250PXA210PXA27xIXP425 533MHzIXP425 400MHzIXP425 266MHzARM1136J-SARM1136J-S R1ARM Cortex A5ARM Cortex A7ARM Cortex A8ARM Cortex A8 R1ARM Cortex A8 R2ARM Cortex A8 R3ARM Cortex A9ARM Cortex A9 R1ARM Cortex A9 R2ARM Cortex A9 R3ARM Cortex A9 R4ARM Cortex A15ARM Cortex A15 R1ARM Cortex A15 R2ARM Cortex A15 R3CPU_ARM8ARM9TDMIARM9E-SCPU_ARM9EARM9EJ-SARM10ECPU_ARM10SA-1CPU_SA1100XScaleCPU_XSCALE_...ARM11JCPU_ARM11CPU_ARMv7wr-thruwr-back**unknown 3****unknown 4**wr-back-lockwr-back-lock-Awr-back-lock-B**unknown 8****unknown 9****unknown 10****unknown 11****unknown 12****unknown 13****unknown 14****unknown 15**rev 0rev 1rev 2rev 3rev 4rev 5rev 6rev 7rev 8rev 9rev 10rev 11rev 12rev 13rev 14rev 15step Jstep Kstep Sstep Tstep Bstep Cstep Dstep Erev 10step Gstep A-0step B-0step B-1step B-2step B-3step B-4step B-5(IXP1200 step A)(IXP1200 step B)(IXP1200 step C)(IXP1200 step D)(IXP1240/1250 step A)(IXP1240 step B)(IXP1250 step B)step A-1step C-0step D-0step ?step C-5step 0badaddr: invalid size (%lu)kernelFatal %s mode data abort: '%s' trapframe: %p DFSR=%08x, DFAR=%08x (imprecise), spsr=%08x Fatal %s mode prefetch abort at 0x%08x trapframe: %p IFSR=%08x, IFAR=%08x, spsr=%08x r0 =%08x, r1 =%08x, r2 =%08x, r3 =%08x r4 =%08x, r5 =%08x, r6 =%08x, r7 =%08x r8 =%08x, r9 =%08x, r10=%08x, r11=%08x r12=%08x, usp=%08x, ulr=%08xssp=%08x, slr=%08x, pc =%08x Fatal abortUVM: pid %d (%s), uid %d killed: out of swap data_abort_fault: Misaligned Kernel-mode Program Counter Non-emulated page fault with intr_depth > 0 uvm_fault(%p, %lx, %x, 0) -> %x Vector ExceptionAlignment Fault 1Terminal ExceptionAlignment Fault 3External Linefetch Abort (S)Translation Fault (S)External Linefetch Abort (P)Translation Fault (P)External Non-Linefetch Abort (S)Domain Fault (S)External Non-Linefetch Abort (P)Domain Fault (P)External Translation Abort (L1)Permission Fault (S)External Translation Abort (L2)Permission Fault (P)mmrwpmap_map_chunk: no L1 table providedpmap_map_chunk: no L2 table for VA 0x%08lxpmap_map_chunk: can't find L2 table for VA0x%08lxpmap_alloc_specials: no l2b for 0x%lxpmap_bootstrap: No L2 for L2 @ va %ppmap_init_l1: can't get PA of L1 at %ppmap_bootstrap: No L2 for va 0x%x, pa 0x%lxpmap_bootstrap: out of static L2spmap_bootstrap: WARNING! wrong cache mode for L2 pte @ %p pmap_bootstrap: WARNING! wrong cache mode for primary L1 @ 0x%lx pmapplpvepll2dtblpll2ptpplxscale_setup_minidata: can't find L2 table for VA 0x%08lxpmap_map_entry: no L2 table for VA 0x%08lxpmap_map_entry: can't find L2 table for VA 0x%08lxCannot allocate L1 KVMCannot allocate L1 physical pagespmap_enter: failed to allocate L2 bucketpmap_enter: no pv entries dump to dev %u,%u not possible dumping to dev %u,%u offset %ld dump area unavailable device bad device not ready area improper i/o error aborted from console succeeded vunmapbufvmapbufcan't init serial console @%lxunknown option `%c' cpu not recognized! OpenBSD/armish booting ... initarm: Configuring system ... physmemory: %d pages at 0x%08lx -> 0x%08lx initarm: out of memoryinitarm: Failed to align the kernel page directoryWARNING: powerdown failed! The operating system has halted. Please press any key to reboot. rebooting... boot device: lookup '%s' failed. boot device: %s cdDiagnostic Failure on Component 0x%02xTagged Overlapped Commands (0x%02x = TASK TAG)Decompression Exception Short Algorithm ID OF 0x%02xASC 0x%02x ASCQ 0x%02xCDBParametersError in %s, Offset %d, bit %dActual Retry Count: %dProgress Indicator: %dprobe%s(%s:%d:%d): %sCheck Condition (error %#x) on opcode 0x%x AT BLOCK #: %d (decimal) SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Set INFO: 0x%x (VALID flag %s) COMMAND INFO: 0x%x ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s DEFERRED scbusyunknown error category (0x%x) from scsi driver scsi_done called twice on xs(%p)unexpected xsh state %usyncxspendxsscsiiomvscsi_xfer pool exhausted! scxsplscsiplugscsi_cmd_rw_decode: bad opcode 0x%02xNo Additional SenseSoft ErrorNot ReadyMedia ErrorHardware ErrorIllegal RequestUnit AttentionWrite ProtectedBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare ErrorNo Additional Sense InformationFilemark DetectedEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnCleaning RequestedErase Operation In ProgressLocate Operation In ProgressRewind Operation In ProgressSet Capacity Operation In ProgressVerify Operation In ProgressNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Not Ready, Rebuild In ProgressLogical Unit Not Ready, Recalculation In ProgressLogical Unit Not Ready, Operation In ProgressLogical Unit Not Ready, Long Write In ProgressLogical Unit Not Ready, Self-Test In ProgressLogical Unit Not Accessible, Asymmetric Access State TransitionLogical Unit Not Accessible, Target Port In Standby StateLogical Unit Not Accessible, Target Port In Unavailable StateLogical Unit Not Ready, Structure Check RequiredLogical Unit Not Ready, Auxiliary Memory Not AccessibleLogical Unit Not Ready, Notify (Enable Spinup) RequiredLogical Unit Not Ready, OfflineLogical Unit Not Ready, SA Creation In ProgressLogical Unit Not Ready, Space Allocation In ProgressLogical Unit Not Ready, Robotics DisabledLogical Unit Not Ready, Configuration RequiredLogical Unit Not Ready, Calibration RequiredLogical Unit Not Ready, A Door Is OpenLogical Unit Not Ready, Operating In Sequential ModeLogical Unit Not Ready, Start Stop Unit Command In ProgressLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorLogical Unit Communication CRC Error (ULTRA-DMA/32)Unreachable Copy TargetTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureHead Select FaultError Log OverflowWarningWarning - Specified Temperature ExceededWarning - Enclosure DegradedWarning - Background Self-Test FailedWarning - Background Pre-Scan Detected Medium ErrorWarning - Background Medium Scan Detected Medium ErrorWarning - Non-Volatile Cache Now VolatileWarning - Degraded Power To Non-Volatile CacheWarning - Power Loss ExpectedWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedWrite Error - Recommend ReassignmentCompression Check Miscompare ErrorData Expansion Occurred During CompressionBlock Not CompressibleWrite Error - Recovery NeededWrite Error - Recovery FailedWrite Error - Loss Of StreamingWrite Error - Padding Blocks AddedAuxiliary Memory Write ErrorWrite Error - Unexpected Unsolicited DataWrite Error - Not Enough Unsolicited DataDefects In Error WindowError Detected By Third Party Temporary InitiatorThird Party Device FailureCopy Target Device Not ReachableIncorrect Copy Target Device TypeCopy Target Device Data UnderrunCopy Target Device Data OverrunInvalid Information UnitInformation Unit Too ShortInformation Unit Too LongID CRC Or ECC ErrorLogical Block Guard Check FailedLogical Block Application Tag Check FailedLogical Block Reference Tag Check FailedLogical Block Protection Error On Recover Buffered DataLogical Block Protection Method ErrorUnrecovered Read ErrorRead Retries ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block ReadNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite The DataDe-Compression CRC ErrorCannot Decompress Using Declared AlgorithmError Reading UPC/EAN NumberError Reading ISRC NumberRead Error - Loss Of StreamingAuxiliary Memory Read ErrorRead Error - Failed Retransmission RequestRead Error - LBA Marked Bad By Application ClientAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRecord Not Found - Recommend ReassignmentRecord Not Found - Data Auto-ReallocatedLocate Operation FailureRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorData Sync Error - Data RewrittenData Sync Error - Recommend RewriteData Sync Error - Data Auto-ReallocatedData Sync Error - Recommend ReassignmentRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data Without ECC - Data RewrittenRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With L-ECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteRecovered Data With ECC - Data RewrittenRecovered Data With LinkingDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationMiscompare Verify Of Unmapped LbaRecovered ID with ECCPartial Defect List TransferInvalid Command Operation CodeAccess Denied - Initiator Pending-EnrolledAccess Denied - No Access rightsAccess Denied - Invalid Mgmt ID KeyIllegal Command While In Write Capable StateObsoleteIllegal Command While In Explicit Address ModeIllegal Command While In Implicit Address ModeAccess Denied - Enrollment ConflictAccess Denied - Invalid LU IdentifierAccess Denied - Invalid Proxy TokenAccess Denied - ACL LUN ConflictIllegal Command When Not In Append-Only ModeLogical Block Address Out of RangeInvalid Element AddressInvalid Address For WriteInvalid Write Crossing Layer JumpIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBCDB Decryption ErrorSecurity Audit Value FrozenSecurity Working Key FrozenNonce Not UniqueNonce Timestamp Out Of RangeInvalid XCDBLogical Unit Not SupportedInvalid Field In Parameter ListThreshold Parameters Not SupportedInvalid Release Of Persistent ReservationData Decryption ErrorToo Many Target DescriptorsUnsupported Target Descriptor Type CodeToo Many Segment DescriptorsUnsupported Segment Descriptor Type CodeUnexpected Inexact SegmentInline Data Length ExceededInvalid Operation For Copy Source Or DestinationCopy Segment Granularity ViolationInvalid Parameter While Port Is EnabledInvalid Data-Out Buffer Integrity Check ValueData Decryption Key Fail Limit ReachedIncomplete Key-Associated Data SetVendor Specific Key Reference Not FoundHardware Write ProtectedLogical Unit Software Write ProtectedAssociated Write ProtectPersistent Write ProtectPermanent Write ProtectConditional Write ProtectSpace Allocation Failed Write ProtectNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedFormat-Layer May Have ChangedImport/Export Element Accessed, Medium ChangedPower On, Reset, or Bus Device Reset OccurredPower On OccurredSCSI Bus Reset OccurredBus Device Reset Function OccurredDevice Internal ResetTransceiver Mode Changed to Single EndedTransceiver Mode Changed to LVDI_T Nexus Loss OccurredMode Parameters ChangedLog Parameters ChangedReservations PreemptedReservations ReleasedRegistrations PreemptedAsymmetric Access State ChangedImplicit Asymmetric Access State Transition FailedPriority ChangedCapacity Data Has ChangedError History I_T Nexus ClearedError History Snapshot ReleasedError Recovery Attributes Have ChangedData Encryption Capabilities ChangedTimestamp ChangedData Encryption Parameters Changed By Another I_T NexusData Encryption Parameters Changed By Vendor Specific EventData Encryption Key Instance Counter Has ChangedSA Creation Capabilities Data Has ChangedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedCurrent Program Area Is Not EmptyCurrent Program Area Is EmptyIllegal Power Condition RequestPersistent Prevent ConflictPrevious Busy StatusPrevious Task Set Full StatusPrevious Reservation Conflict StatusPartition Or Collection Contains User ObjectsNot ReservedORWrite Generation Does Not MatchOverwrite Error On Update In PlaceInsufficient Time For OperationCommands Cleared By Another InitiatorCommands Cleared By Power Loss NotificationCommands Cleared By Device ServerIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledCannot Write Medium - Unknown FormatCannot Write Medium - Incompatible FormatCannot Format Medium - Incompatible MediumCleaning FailureCannot Write - Application Code MismatchCurrent Session Not Fixated For AppendCleaning Request RejectedMedium Not FormattedIncompatible Volume TypeIncompatible Volume QualifierCleaning Volume ExpiredMedium Format CorruptedFormat Command FailedZoned Formatting Failed Due To Spare LinkingNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorEnclosure FailureEnclosure Services FailureUnsupported Enclosure FunctionEnclosure Services UnavailableEnclosure Services Transfer FailureEnclosure Services Transfer RefusedRibbon, Ink, or Toner FailureRounded ParameterEvent Status NotificationESN - Power Management Class EventESN - Media Class EventESN - Device Busy Class EventSaving Parameters Not SupportedMedium Not PresentMedium Not Present - Tray ClosedMedium Not Present - Tray OpenMedium Not Present - LoadableMedium Not Present - Medium Auxiliary Memory AccessibleSequential Positioning ErrorTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyEnd Of Medium ReachedMedium Magazine Not AccessibleMedium Magazine RemovedMedium Magazine InsertedMedium Magazine LockedMedium Magazine UnlockedMechanical Positioning Or Changer ErrorRead Past End Of User ObjectElement DisabledElement EnabledData Transfer Device RemovedData Transfer Device InsertedInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetLogical Unit FailureTimeout On Logical UnitLogical Unit Failed Self-TestLogical Unit Unable To Update Self-Test LogTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has Changedcomponent Device AttachedDevice Identifier ChangedRedundancy Group Created Or ModifiedRedundancy Group DeletedSpare Created Or ModifiedSpare DeletedVolume Set Created Or ModifiedVolume Set DeletedVolume Set DeassignedVolume Set ReassignedReported LUNs Data Has ChangedEcho Buffer OverwrittenMedium LoadableMedium Auxiliary Memory AccessibleiSCSI IP Address AddediSCSI IP Address RemovediSCSI IP Address ChangedRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureATA Device Failed Set FeaturesSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorData Phase CRC Error DetectedSCSI Parity Error Detected During ST Data PhaseInformation Unit iuCRC Error DetectedAsynchronous Information Protection Error DetectedProtocol Service CRC ErrorPHY Test Function In ProgressSome Commands Cleared By iSCSI Protocol EventInitiator Detected Error Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorInvalid Target Port Transfer Tag ReceivedToo Much Write DataACK/NAK TimeoutNAK ReceivedData Offset ErrorInitiator Response TimeoutConnection LostLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureErase Failure - Incomplete Erase Operation DetectedCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedMedium Removal Prevented By Data Transfer ElementMedium Thread Or Unthread FailureVolume Identifier InvalidVolume Identifier MissingDuplicate Volume IdentifierElement Status UnknownSCSI To Host System Interface FailureSystem Resource FailureSystem Buffer FullInsufficient Reservation ResourcesInsufficient ResourcesInsufficient Registration ResourcesInsufficient Access Control ResourcesAuxiliary Memory Out Of SpaceQuota ErrorMaximum Number Of Supplemental Decryption Keys ExceededMedium Auxiliary Memory Not AccessibleData Currently UnavailableInsufficient Power For OperationUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change InputOperator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedFailure Prediction Threshold ExceededMedia Failure Prediction Threshold ExceededLogical Unit Failure Prediction Threshold ExceededSpare Area Exhaustion Prediction Threshold ExceededHardware Impending Failure General Hard Drive FailureHardware Impending Failure Drive Error Rate Too HighHardware Impending Failure Data Error Rate Too HighHardware Impending Failure Seek Error Rate Too HighHardware Impending Failure Too Many Block ReassignsHardware Impending Failure Access Times Too HighHardware Impending Failure Start Unit Times Too HighHardware Impending Failure Channel ParametricsHardware Impending Failure Controller DetectedHardware Impending Failure Throughput PerformanceHardware Impending Failure Seek Time PerformanceHardware Impending Failure Spin-Up Retry CountHardware Impending Failure Drive Calibration Retry CountController Impending Failure General Hard Drive FailureController Impending Failure Drive Error Rate Too HighController Impending Failure Data Error Rate Too HighController Impending Failure Seek Error Rate Too HighController Impending Failure Too Many Block ReassignsController Impending Failure Access Times Too HighController Impending Failure Start Unit Times Too HighController Impending Failure Channel ParametricsController Impending Failure Controller DetectedController Impending Failure Throughput PerformanceController Impending Failure Seek Time PerformanceController Impending Failure Spin-Up Retry CountController Impending Failure Drive Calibration Retry CountData Channel Impending Failure General Hard Drive FailureData Channel Impending Failure Drive Error Rate Too HighData Channel Impending Failure Data Error Rate Too HighData Channel Impending Failure Seek Error Rate Too HighData Channel Impending Failure Too Many Block ReassignsData Channel Impending Failure Access Times Too HighData Channel Impending Failure Start Unit Times Too HighData Channel Impending Failure Channel ParametricsData Channel Impending Failure Controller DetectedData Channel Impending Failure Throughput PerformanceData Channel Impending Failure Seek Time PerformanceData Channel Impending Failure Spin-Up Retry CountData Channel Impending Failure Drive Calibration Retry CountServo Impending Failure General Hard Drive FailureServo Impending Failure Drive Error Rate Too HighServo Impending Failure Data Error Rate Too HighServo Impending Failure Seek Error Rate Too HighServo Impending Failure Too Many Block ReassignsServo Impending Failure Access Times Too HighServo Impending Failure Start Unit Times Too HighServo Impending Failure Channel ParametricsServo Impending Failure Controller DetectedServo Impending Failure Throughput PerformanceServo Impending Failure Seek Time PerformanceServo Impending Failure Spin-Up Retry CountServo Impending Failure Drive Calibration Retry CountSpindle Impending Failure General Hard Drive FailureSpindle Impending Failure Drive Error Rate Too HighSpindle Impending Failure Data Error Rate Too HighSpindle Impending Failure Seek Error Rate Too HighSpindle Impending Failure Too Many Block ReassignsSpindle Impending Failure Access Times Too HighSpindle Impending Failure Start Unit Times Too HighSpindle Impending Failure Channel ParametricsSpindle Impending Failure Controller DetectedSpindle Impending Failure Throughput PerformanceSpindle Impending Failure Seek Time PerformanceSpindle Impending Failure Spin-Up Retry CountSpindle Impending Failure Drive Calibration Retry CountFirmware Impending Failure General Hard Drive FailureFirmware Impending Failure Drive Error Rate Too HighFirmware Impending Failure Data Error Rate Too HighFirmware Impending Failure Seek Error Rate Too HighFirmware Impending Failure Too Many Block ReassignsFirmware Impending Failure Access Times Too HighFirmware Impending Failure Start Unit Times Too HighFirmware Impending Failure Channel ParametricsFirmware Impending Failure Controller DetectedFirmware Impending Failure Throughput PerformanceFirmware Impending Failure Seek Time PerformanceFirmware Impending Failure Spin-Up Retry CountFirmware Impending Failure Drive Calibration Retry CountFailure Prediction Threshold Exceeded (false)Low Power Condition OnIdle Condition Activated By TimerStandby Condition Activated By TimerIdle Condition Activated By CommandStandby Condition Activated By CommandIDLE_B Condition Activated By TimerIDLE_B Condition Activated By CommandIDLE_C Condition Activated By TimerIDLE_C Condition Activated By CommandSTANDBY_Y Condition Activated By TimerSTANDBY_Y Condition Activated By CommandPower State Change To ActivePower State Change To IdlePower State Change To StandbyPower State Change To SleepPower State Change To Device ControlLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackPacket Does Not Fit In Available SpaceIllegal Mode For This TrackInvalid Packet SizeVoltage FaultAutomatic Document Feeder Cover UpAutomatic Document Feeder Lift UpDocument Jam In Automatic Document FeederDocument Miss Feed Automatic In Document FeederConfiguration FailureConfiguration Of Incapable Logical Units FailedAdd Logical Unit FailedModification Of Logical Unit FailedExchange Of Logical Unit FailedRemove Of Logical Unit FailedAttachment Of Logical Unit FailedCreation Of Logical Unit FailedAssign Failure OccurredMultiply Assigned Logical UnitSet Target Port Groups Command FailedATA Device Feature Not EnabledLogical Unit Not ConfiguredData Loss On Logical UnitMultiple Logical Unit FailuresParity/Data MismatchInformational, Refer To LogState Change Has OccurredRedundancy Level Got BetterRedundancy Level Got WorseRebuild Failure OccurredRecalculate Failure OccurredCommand To Logical Unit FailedCopy Protection Key Exchange Failure - Authentication FailureCopy Protection Key Exchange Failure - Key Not PresentCopy Protection Key Exchange Failure - Key Not EstablishedRead Of Scrambled Sector Without AuthenticationMedia Region Code Is Mismatched To Logical Unit RegionDrive Region Must Be Permanent/Region Reset Count ErrorDecompression Exception Long Algorithm IDSession Fixation ErrorSession Fixation Error Writing Lead-InSession Fixation Error Writing Lead-OutSession Fixation Error - Incomplete Track In SessionEmpty Or Partially Written Reserved TrackNo More Track Reservations AllowedRMZ Extension Is Not AllowedNo More Test Zone Extensions Are AllowedCD Control ErrorPower Calibration Area ErrorProgram Memory Area Update FailureProgram Memory Area Is FullRMA/PMA Is Almost FullCurrent Power Calibration Area Almost FullCurrent Power Calibration Area Is FullRDZ Is FullSecurity ErrorUnable To Decrypt DataUnencrypted Data Encountered While DecryptingIncorrect Data Encryption KeyCryptographic Integrity Validation FailedError Decrypting DataUnknown Signature Verification KeyEncryption Parameters Not UseableDigital Signature Validation FailureEncryption Mode Mismatch On ReadEncrypted Block Not Raw Read EnabledIncorrect Encryption ParametersUnable To Decrypt Parameter ListEncryption Algorithm DisabledSA Creation Parameter Value InvalidSA Creation Parameter Value RejectedInvalid SA UsageData Encryption Configuration PreventedSA Creation Parameter Not SupportedAuthentication FailedExternal Data Encryption Key Manager Access ErrorExternal Data Encryption Key Manager ErrorExternal Data Encryption Key Not FoundExternal Data Encryption Request Not AuthorizedExternal Data Encryption Control TimeoutExternal Data Encryption Control ErrorLogical Unit Access Not AuthorizedSecurity Conflict In Translated DeviceXS_SHORTSENSE scsibus at %sscsibusprint: qualifier == SID_QUAL_RSVDscsibusprint: qualifier == SID_QUAL_BAD_LUdirectsequentialprinterprocessorcdromwormscanneropticalchangercommunicationenclosure servicessimplified directscsibusprint: device type T_NODEVICEvendor-unique targ %d lun %d: <%s, %s, %s> ATAPISCSI%dremovablefixed %d/%s %s%s naa. eui. t10. serial.~ offline: %d targets, initiator %d, WWPN %016llx, WWNN %016llx%s: unable to register bio scsibusPLEXTORCD-ROM PX-40TS1.01MICROP 1588-15MBSUN0669DEC RZ55 (C) DECEMULEX MD21/S2 ESDIA00IBMRAID 0662SIBM 0663HIBM0664H3171-S2KZ-CDFRSS2FQUANTUM ELS85S iomegajaz 1GBMICROP4421-07SEAGATEST150176LW0002HPC3725SDCASSONY SDT-5000 3.WangDAT Model 1300 02.4Model 2600 01.7Model 3200 02.2CR-2801TE1.07CREATIVECD3630EAC101FX320Sq01GCD-R580B1.00MATSHITA CR-5741.021.06Memorex CRW-26421.0gSANYO CRD-256PSANYO CRD-254PSANYO CRD-S54P1.08CD-ROM CDR-S11.70CD-ROM CDR-N161.25UJDCD87301.14ATAPI CD-ROMSCSI CD-ROMNEC CD-ROM DRIVE:260SCSI opticalSCSI disk%s %s(unknown)%s: %lldMB, %lu bytes/sector, %lld sectors, thin%s: WARNING: unable to establish shutdown hook softintr_establish: unknown soft IPL %d"%s" at %s addr 0x%xiiclm75alm75lm77eeprommax1617xeontemplm93lm81lm87adm9240adt7470adt7476adt7475adt7462adt7466adt7467adm1033adm1034adm1030adm1031adm1025adm1024adm1023adm1028adm1022thmc5047m192sch5027emc6w201asc7611asc7621ne1619ds1780adt7460adm1027lm85adt7516lm63lm86lm89lm89-1lm90gl523smadt7461adm1021adm1032g781g781-1max6690max6646max6657max6642tmp401sa56004xw83791sdw83627dhgw83792dw83781dw83627hfw83782das99127fw83783sw83791dw83l784rw83l785rw83l785ts-lf75375asb100gl518smadm1026se97max6604mcp9805mcp98242mcp98243adt7408stts2002cat34ts02ts3000b3lis331dlit8712lm96000emc6d100sch5017it8712f-amtp008w83795gw83793gstts424e02%s: addr 0x%x %02x=%02x words %02x=%04x: %s%s: ricohrtc_clock_write: failed to write rtc %s: ricohrtc_clock_read: failed to read rtc %s: ricohrtc_reg_write: failed to write reg%d : RICOH RS5C372[AB] Real-time Clock ricohrtc: F75375 rev %d.%dVcc, unable to register update task unable to read reg %d fintek: PCA9532 LED controller pcaledi80321_mem_bs_free(): not implementedi80321_mem_bs_alloc(): not implementedi80321_io_bs_free(): not implementedi80321_io_bs_alloc(): not implementedpciiopaauiopiiciopmuiopwdogi80321_intr_establish: IRQ %d out of rangei80321intcresettodr: failed to set time WARNING: preposterous time in file system WARNING: preposterous clock chip time lostgainedWARNING: clock %s %ld days WARNING: CHECK AND RESET THE DATE! clockstattcr1: I2C controller %s: unable to subregion registers, error = %d iopiiclkattempting reset %s: unable to map VERDE registers%s: unable to subregion MCU registers%s: unable to subregion ATU registers%s: unable to map IOW registers: i80321 I/O Processor %s: unable to map PLD registersiopxs%03d:%02d:%d %04x:%04x WARNING: unknown PCI device header. mem %02xh %s 0x%08x 0x%08x NGOK [%s] Resource conflict. No available resources. fixup failed pci_addr_fixup: fixup failed. (new address=%#lx) new address 0x%08lx PCI I/O memory spacePCI I/O port space[%s]----------------------- device vendor product register space address size -------------------------------------------- System BIOS Setting--------------------------[%3d devices bogus] PCIBIOS fixup stageirq %diq80321_pci_intr_map: no mapping for %d/%d/%d (%d, %d, %d) board id failed Thecus Nx100I/O Data HDL-GCertance CP3100 addr 0x%08lx intr %dobio_bs_free(): not implementedobio_bs_alloc(): not implemented: failed to map registers: %d %s: unable to establish interrupt at CPLD irq %d com_obio%s: standby command didn't complete %s: standby command timeout %s: standby command: drive fault %s: flush cache command didn't complete %s: flush cache command timeout %s: flush cache command: drive fault ST506wd_get_params: bad return code from ata_get_paramsST506/MFM/RLLESDI/IDE disk__wdstart: bad return code from wdc_ata_bio()device faultdevice timeout, retrying %s: soft error (corrected) %s: IDENTIFY failed : <%s> %s: %d-sector PIO, LBA48, %lluMB, %llu sectors LBA, %lluMB, %llu sectors CHS, %lluMB, %d cyl, %d head, %d sec, %llu sectors %s: enable look ahead command didn't complete %s: enable write cache command didn't complete %s: freeze lock command didn't complete wddump: try againwddump: polled command has been queuedwddump: device timed outwddump: drive faultwddump: DMA errorwddump: %swddump: unknown error type%s:%d:%d: bad state %d in _wdc_ata_bio_start _wdc_ata_bio_start: bad state%s:%d:%d: timeout waiting for DRQ, st=0x%b, err=0x%02x BSYDRDYDWFDSCDRQCORRIDXERR%s:%d:%d: not ready, st=0x%b, err=0x%02x wdc_ata_ctrl_intr: state==RECALpiomodedmamodegeometrysetmultirecal%s:%d:%d: %s timed out %s:%d:%d: %s drive fault error (%x) %s:%d:%d: bad state %d in wdc_ata_bio_intr wdc_ata_bio_intr: bad state%s:%d:%d: device timeout, c_bcount=%d, c_skip%d %s:%d:%d: intr with DRQ (st=0x%b) %s:%d:%d: read intr before drq error not notifiedno media/write protectedaborted commandmedia change requestedid not foundmedia changeduncorrectable data errorinterface CRC erroraddress mark not foundtrack 0 not foundbad block detectedwsevent_read%s: can't attach mux (error=%d) wskbd at %s%s: event queue overflow wskdetwskbd_detach: %s didn't detach mux %dcannot load keymap: console keyboard%s: attach error=%d wskbdwskbd_get_mapentry: %d(%d): bad entrywskbd_load_keymap: %d: recursion too deepwskbd_load_keymap: %d(%d): bad entry attach error=%dwsmouse at %swsmdetwsmouse_detach: %s didn't detach wsmousewsmux_getmux: no memory for mux %d wsmux: attach out of memory usb at %sendtaskusbatskusbtskunable to create usb abort task threadusbtaskunable to create usb task threadusbpalock: USB revision %s, not supported %s: can't register softintr %s: root device is not a hub %s: root hub problem, error=%d pre 1.01.12.0usbusbd_desc_iter_next: bad descriptor usbd_desc_iter_next: descriptor length = 0 usbd_desc_iter_next: descriptor length too large usbd_start_next: error=%d usbd_transfer: not doneusbsynusbrefusbdetusb_detach_wait: %s didn't detach out of dataiface desc0 lengthusbd_fill_iface_data: bad descriptor(s): %s usbdly%s: device addr %d (config %d) exceeds power budget, %d mA > %d mA %s: port %d, set config at addr %d failed %s: No free USB addresses, new device ignored. usbd_new_device: cannot find HS port%x.%02xvendor 0x%04x"%s %s", class %d/%d rev / addr %d port %d configuration %d interface %dNORMAL_COMPLETIONIN_PROGRESSPENDING_REQUESTSNOT_STARTEDINVALNOMEMCANCELLEDBAD_ADDRESSIN_USENO_ADDRSET_ADDR_FAILEDNO_POWERTOO_DEEPIOERRORNOT_CONFIGUREDTIMEOUTSHORT_XFERSTALLEDINTERRUPTEDXXX%s: illegal enable change, port %d %s: port error, restarting port %d %s: port error, giving up port %d %s: strange, connected port %d has no power %s: port %d reset failed %s: device problem, disabling port %d %s: hub depth (%d) exceeded, hub ignored %s: no ports, hub ignored %s: bus powered hub connected to bus powered hub, ignored %s: no interface handle %s: no endpoint descriptor %s: bad interrupt endpoint %s: cannot open interrupt pipe %s: port %d power on failed, %s uhubucom at %s portno %d%s: lost %d chars %s: read start failed , %sucomlkucomugenwbugenwiugenriugenrb%s: secondary, not changing config to %d %s: setting configuration index 0 failed %s: setting configuration %d failed ugenBAD LENGTH %d Main bTag=%d Global bTag=%d Local bTag=%d default bType=%d uhidevwiuhidev_intr: bad repid %d uhid at %s reportid %d%s: could not read endpoint descriptor %s: unexpected endpoint %s: no input interrupt endpoint %s: no report descriptor %s: iclass %d/%d, %d report id%s%s: no memory uhidevuhidrea: input=%d, output=%d, feature=%d uhidno usable key codes array%s: was console keyboard ukbd: %d button%s, Z dir, W dir, Z and W dir %s: mouse has no X report %s: X report 0x%04x not supported %s: mouse has no Y report %s: Y report 0x%04x not supported ums%s: got polled xfer %p, but %p already pending %s: CBI bulk-in/out stall clear failed, %s %s: CBI intr-in stall clear failed, %s %s: CBI reset failed, %s %s: CBI bulk-in stall clear failed, %s %s: CBI bulk-out stall clear failed, %s %s: Unknown state %d%s: BBB bulk-%s stall clear failed, %s %s: Invalid CSW: sig 0x%08x should be 0x%08x %s: Invalid CSW: tag %d should be %d %s: Invalid CSW: status %d > %d %s: Phase Error, residue = %d %s: transferred %d bytes instead of %d bytes%s: BBB reset failed, %s %s: BBB bulk-in clear stall failed, %s %s: BBB bulk-out clear stall failed, %s Bulk-OnlyCBICBI with CCIISD-ATARBCSCSIUFI%s: using %s over %s %s: isdata not configured %s: command protocol=0x%x not supported %s: bus attach failed umass%s: Unknown status %d in umass_scsi_cbumass_cmd: large datalen, %d %04x%04x%s: failed to set configuration, err=%s : failed to get interface, err=%s %s: device is neither visor nor palm %s: init failed, %s GenericDebuggerHotSyncRemote File System%s: no proper endpoints for port %d (%d,%d) uvisor%s: open rx pipe failed: %s %s: open tx pipe failed: %s %s: open intr pipe failed: %s %s: aue_send error=%s %s: usb error on tx: %s %s: %u usb errors on intr: %s %s: no memory for rx list -- packet dropped! %s: %u usb errors on rx: %s %s: reset failed %s: abort rx pipe failed: %s %s: close rx pipe failed: %s %s: abort tx pipe failed: %s %s: close tx pipe failed: %s %s: abort intr pipe failed: %s %s: close intr pipe failed: %s %s: tx list init failed %s: rx list init failed %s: MII read timed out %s: EEPROM read timed out %s: setting config no failed auemii%s: getting interface handle failed %s: couldn't get endpoint descriptor %d %s: missing endpoint %s: address %s aue%s: usb errors on rx: %s axe%d: abort rx pipe failed: %s axe%d: close rx pipe failed: %s axe%d: abort tx pipe failed: %s axe%d: close tx pipe failed: %s axe%d: abort intr pipe failed: %s axe%d: close intr pipe failed: %s axe%d: usb error on tx: %s axe%d: watchdog timeout axe%d: rx list init failed axe%d: tx list init failed axe%d: open rx pipe failed: %s axe%d: open tx pipe failed: %s %s: media change failed axe%d: write PHY failed axe%d: read PHY failed axemii%s: couldn't get ep %d no valid PHY address found, assuming PHY address 0 AX88178 AX88772B AX88772 AX88172axe%s: warning: Failed to write register 0x%0x %s: warning: Failed to read register 0x%0x %s: warning: failed to read SMSC_COE_CTRL (err=%d) %s: warning: failed to write SMSC_COE_CTRL (err=%d) %s: warning: failed to read initial AFC_CFG, error %d %s: warning: media change failed, error %d %s: warning: timed-out waiting for reset to complete %s: warning: timed-out waiting for phy reset to complete %s: warning: failed to set the MAC address %s: warning: failed to read HW_CFG: %d %s: warning: failed to read HW_CFG: (err = %d) %s: warning: failed to read ID_REV (err = %d) %s: warning: failed to read MAC_CSR (err=%d) %s: error: smsc_chip_init failed (err=%d) smscmii%s: warning: MII is busy %s: warning: MII write timeout %s: warning: MII read timeout smsc%s: cue_send error=%s %s: read MAC address failed cue%s: kue_send error=%s %s: warm boot, no firmware download kue%s: failed loadfirmware of file %s: errno %d %s: cold boot, downloading firmware %s: failed to load code segment: %s %s: failed to load fixup segment: %s %s: failed to load trigger segment: %s %s: loading firmware failed %s: could not read Ethernet descriptor %s: no memory for multicast filter buffer %s: usb error on rx: %s %s: too many errors, disabling %s: open interrupt pipe failed: %s %s: abort interrupt pipe failed: %s %s: close interrupt pipe failed: %s extra ethernet descriptor %s: no data interface %s: no descriptor for interrupt endpoint %d %s: interface alternate setting %d failed %s: no descriptor for bulk endpoint %d %s: could not find data bulk in %s: could not find data bulk out cdce%s: udav_send error=%s udavmiiudav%s: upl_send error=%s upl%s: url_send error=%s %s: %s: bad register %04x urlmii%s: failed to get interface, err=%s %s: couldn't get endpoint %d url%s: Invalid notification length! (%d) %s: abort notify pipe failed: %s %s: close notify pipe failed: %s no %s: data interface %d, has %sCM over data, has %sbreak %s: no endpoint descriptor for %d %s: Could not find data bulk in %s: Could not find data bulk out %s: could not set data multiplex mode %s: status change notification available umodem%s: failed to set configuration, err=%s uftdi%s: failed to get configuration descriptor %s: failed to get device descriptor %s: failed to get interface, err=%s %s: Could not find interrupt in %s: failed to get second interface, err=%s %s: reset failed, %s uplcom %s: failed to set configuration, err=%s umct%s: uvscom_intr: abnormal status: %s %s: uvscom_set_line_coding: %s %s: uvscom_set_line: %s %s: uvscom_shutdown: %s %s: uvscom_readstat: %s %s: cannot open interrupt pipe (addr %d) uvsopuvscom%s: this device is using CDC notify message in intr pipe. Please send your dmesg to , thanks. %s: intr buffer 0x%x 0x%x 0x%x 0x%x 0x%x 0x%x 0x%x %s:notify serial state, len=%d, data=0x%02x %s: ubsa_request: %s %s: failed to set configuration: %s %s: failed to get interface: %s ubsa%s: unhandled set request: reg=%x onoff=%x %s: no proper endpoints found (%d,%d) uipaqumsm%s: this device is not using CDC notify message in intr pipe. Please send your dmesg to , thanks. %s: umass only mode. need to reattach %s: truinstall mode. need to reattach %s: no endpoint descriptor found for %d wiusbthrwitxlwiIDLwi_usb: received USB_BUFAVAIL packet wi_usb: received USB_ERROR packet %s: %s error=%s wiTXsyncUGH TX UGH RX write_record buf size err %x %x invalid packet len: %x memsz %x max %x %s: %s: error=%s %s:%s: invalid packet id sent %x %s: already detached %s: open pipes failed wi_usb%s: could not get card cfg! unknown-device%s: %s loadfirmware error %d %s: reattaching after firmware upload atuatu-rfmd-intatu-rfmd-extatu-rfmd2958-intatu-rfmd2958-extatu-rfmd2958smc-intatu-rfmd2958smc-extatu-intersil-intatu-intersil-extatu-at76c503-i3863-intatu-at76c503-i3863-extatu-at76c503-rfmd-acc-intatu-at76c503-rfmd-acc-extatu-at76c505-rfmd-intatu-at76c505-rfmd-ext%s: could not retrieve Tx statistics - cancelling automatic rate control %s: could not write MAC register: %s %s: could not read MAC register: %s %s: could not read BBP %s: could not read EEPROM: %s %s: could not allocate tx xfer %s: could not allocate tx buffer %s: could not transmit buffer: %s %s: could not allocate rx xfer %s: could not allocate rx buffer %s: timeout waiting for BBP/RF to wakeup %s: could not allocate AMRR xfer %s: could not open Tx pipe: %s %s: could not open Rx pipe: %s %s: could not allocate Tx list %s: could not allocate Rx list %s: could not queue Rx transfer %s: could not transmit beacon %s: could not set configuration no %s: could not get interface handle %s: no endpoint descriptor for iface %d %s: MAC/BBP RT%04x (rev 0x%02x), RF %s, address %s uralOUI 0x%06x model 0x%04x rev %d at %s phy %dmii_detach: phyloc and offloc specifiedmii_attach: phyloc and offloc specifiedmiiautmii_phy_setmedia: MASTER on wrong media: %s, rev. %d nsphyDP83840 10/100 PHYqsphyQS6612 10/100 PHYinphyi82555 10/100 PHYi82562EM 10/100 PHYi82562ET 10/100 PHYi82562G 10/100 PHYiophyi82553 10/100 PHYeephy88E1000 1 Gigabit PHY88E1000 2 Gigabit PHY88E1000 3 Gigabit PHY88E1000 4 Gigabit PHY88E1000S Gigabit PHY88E1011 Gigabit PHY88E1111 Gigabit PHY88E1112 Gigabit PHY88E1116 Gigabit PHY88E1116R Gigabit PHY88E1118 Gigabit PHY88E1149 Gigabit PHY88E3016 10/100 PHY88E3082 10/100 PHYPHYG65G Gigabit PHY88E1000 5 Gigabit PHY88E1000 6 Gigabit PHY88E1000 7 Gigabit PHYexphy_service: can't isolate 3Com PHY: 3Com internal media interface %s: ignoring this PHY, non-zero instance xlexphyrlrlphy_service: attempt to isolate phy: RTL internal PHY rlphyRTL8201L 10/100 PHYRTL8201E 10/100 PHYIP101 10/100 PHYlxtphyLXT970 10/100 PHYLXT971 10/100 PHYluphyLU6612 10/100 PHYmtdphyMTD972 10/100 PHYicsphyICS1890 10/100 PHYICS1892 10/100 PHYICS1893 10/100 PHYsqphy80220 10/100 PHY80225 10/100 PHY84220 10/100 PHYtqphy78Q2120 10/100 PHY: Generic IEEE 802.3u media interface, rev. %d: OUI 0x%06x, model 0x%04x %s: no media present ukphy: internal PHY dcphybmtphy3C905B internal PHY3C905C internal PHYBCM4401 10/100baseTX PHYBCM5201 10/100 PHYBCM5214 Quad 10/100 PHYBCM5220 10/100 PHYBCM5221 100baseTX PHYBCM5222 Dual 10/100 PHYbgebnxbrgphyBCM5400 1000baseT PHYBCM5401 10/100/1000baseT PHYBCM5411 10/100/1000baseT PHYBCM5421 10/100/1000baseT PHYBCM54K2 10/100/1000baseT PHYBCM5461 10/100/1000baseT PHYBCM5462 10/100/1000baseT PHYBCM5464 10/100/1000baseT PHYBCM5701 10/100/1000baseT PHYBCM5703 10/100/1000baseT PHYBCM5704 10/100/1000baseT PHYBCM5705 10/100/1000baseT PHYBCM5714 10/100/1000baseT/SX PHYBCM5750 10/100/1000baseT PHYBCM5752 10/100/1000baseT PHYBCM5780 10/100/1000baseT/SX PHYBCM54XX 10/100/1000baseT PHYBCM5481 10/100/1000baseT PHYBCM5482 10/100/1000baseT PHYBCM5722 10/100/1000baseT PHYBCM5755 10/100/1000baseT PHYBCM5761 10/100/1000baseT PHYBCM5784 10/100/1000baseT PHYBCM5787 10/100/1000baseT PHYBCM5706 10/100/1000baseT/SX PHYBCM5708C 10/100/1000baseT PHYBCM5708S 1000/2500baseSX PHYBCM5709 10/100/1000baseT PHYBCM5709S 1000/2500baseSX PHYBCM5709CAX 10/100/1000baseT PHYBCM5717C 10/100/1000baseT PHYBCM5719C 10/100/1000baseT PHYBCM5720C 10/100/1000baseT PHYBCM57765 10/100/1000baseT PHYBCM57780 10/100/1000baseT PHYBCM5906 10/100baseTX PHYamphyAm79C873 10/100 PHYDM9101 10/100 PHYDM9102 10/100 PHYDM9601 10/100 PHYAm79C875 quad PHYacphyAC101 10/100 PHYAC101L 10/100 PHYAC_UNKNOWN 10/100 PHY%s: %s: enter updown%s: %s: link %s : RTL internal phy urlphyrgephyRTL8169S/8110S PHYnfe%s: unknown CICADA PHY model %x %s: unknown PHY speed %x ciphyCS8201 10/100/1000TX PHYCS8204 10/100/1000TX PHYVSC8211 10/100/1000 PHYCS8244 10/100/1000TX PHYVSC8601 10/100/1000 PHY%d:%d:%d: mem address conflict 0x%x/0x%x %d:%d:%d: io address conflict 0x%x/0x%x %d:%d:%d: bridge io address conflict 0x%x/0x%x %d:%d:%d: bridge mem address conflict 0x%x/0x%x %d:%d:%d: bridge bus conflict %d-%d dev %d function %dpci_mem_find: bad requestpci_mem_find: bad 64-bit requestpci_io_find: bad request%svendor 0x%04x product 0x%04xunknown vendor "%s", unknown product 0x%04xunknown class 0x%02x, subclass 0x%02xclass %s unknown subclass 0x%02xclass %s subclass %s, rev 0x%02x) rev 0x%02xmiscellaneousfloppyIPISASethernettoken ringFDDIWorldFipPCMIG Multi ComputingXGAvideoaudiotelephonyhdaudioRAMflashhostMicroChannelNuBusRACEwaySemi-transparent PCIInfiniBandserialparallelmulti-port serialmodemsmartcard8237 DMA8254 timerRTCPCI Hot-PlugSD Host Controllerkeyboarddigitizermousegame portgeneric386486PentiumAlphaPowerPCMIPSCo-processorFirewireACCESS.busSSAFiber ChannelIPMISERCOSIrDAConsumer IRRFbluetoothbroadband802.11a (5 GHz)802.11b (2.4 GHz)standardvoicenetwork/computingentertainmentDPIOTime and Frequencysynchronizationmanagementprehistoricmass storagenetworkdisplaymultimediabridgecommunicationsinputdockserial buswirelessI2Osatellite commDASPundefinedOZ6729 CardBusOZ6730 CardBusOZ6922 CardBusOZ6832 CardBusOZ6836/OZ6860 CardBusOZ68[17]2 CardBusOZ6933 CardBusOZ69[17]2 CardBusOZ711Mx MiscOZ711EC1 SmartCardBusOZ711M1 CardBusOZ711MP1 SDHCOZ711MP1 XDHCOZ711MP1 CardBusOZ711EZ1 CardBusOZ711SP1 CardBusOZ711E0 CardBus3c9853c9963CRDAG6753CRPAG175V.90 Modem3c9403c3393c3593c4503c555 100Base-TX3c5753CCFE575BT3CCFE575CT3c590 10Mbps3c595 100Base-TX3c595 100Base-T43c595 10Mbps-MII3CRSHPW796 802.11b3CRWE154G72 802.11g3c556 100Base-TX3c556B 100Base-TX3CCFEM6563CCFEM656B3CCFEM656C56k Global Modem3cSOHO-TX3crwe777a AirConnect3c940B3c900 10Base-T3c900 10Mbps-Combo3c900B 10Mbps3c900B 10Mbps-Combo3c900B 10Mbps-TPC3c900B 10Mbps-FL3c905 100Base-TX3c905 100Base-T43c905B 100Base-TX3c905B 100Base-T43c905B 10/100Mbps-Combo3c905B 100Base-FX3c905C 100Base-TX3c9201 100Base-TX3c920B-EMB-WNM3cSOHO 100B-TX3c980 100Base-TX3c980C 100Base-TX3cr9903cr990-TX3cr990-TX-953cr990-TX-973c990b-TX-M3cr990-FX3cr990SVR953cr990SVR973c990BSVRVoodooVoodoo2BansheeVoodoo3Voodoo4Voodoo5GLINT 300SXGLINT 500TXGLINT DeltaPermediaGLINT MXPermedia 2GLINT GammaPermedia 2vPermedia 3Wildcat III 6210Wildcat 5110Wildcat IV 72105000/6000 series RAID7000/8000 series RAID9000 series RAID9500 series RAIDFE2500 10/100PCM200 10/100FE2000VX 10/100FE2500MX 10/100PC4800 WirelessPCI35x WLANPC4500 WirelessMPI-350 WirelessACCM 2188 VL-PCI2051 PCI2051 ISAATP850U/UFATP860ATP860-AATP865-AATP865-RAEC6710AEC6712UWAEC6712UAEC6712SAEC6710DAEC6715UWMPX 5030/5038EN2242EN1217RhineIIrtl8139AWA-100M1435 VL-PCIM1445 VL-PCIM1449 ISAM1451 PCIM1461 PCIM1489 PCIM1511 PCIM1513 ISAM1523 PCIM1523 ISAM1531 PCIM1533 ISAM1535 PCIM1541 PCIM1543 ISAM1563 ISAM1573 ISAM1575 ISAM1621 PCIM1631 PCIM1644 PCIM1647 PCIM1689 PCIM1695 PCIM3309 MPEGM4803M5219 UDMA IDEM5229 UDMA IDEM5237 USBM5239 USB2M5243 AGP/PCI-PCIM5246 AGPM5247 AGP/PCI-PCM5249M524B PCIEM524C PCIEM524D PCIEM5261 LANM5263 LANM5281 SATAM5287 SATAM5288 SATAM5289 SATAM5451 AudioM5455 AudioM5457 ModemM5461 HD AudioM7101 PowerAL981AN983AN985ADM8211 WLANADM9511ADM9513AIC-7810AHA-2940AU/CNAHA-2930CUAIC-7850AIC-7855AIC-5900 ATMAIC-5905 ATMAPA-1480AIC-7860AHA-2940AUAIC-7870AHA-2940AHA-3940AHA-3985AHA-2944AIC-7815AIC-7880AHA-2940UAHA-3940UAHA-398XUAHA-2944UAHA-2940UWProAIC-6915AIC-7895AHA-2940U2 U2AHA-2930U2 U2AAA-131U2 U2AIC-7890/1 U2AIC-7892 U160AHA-29160 U160AHA-19160B U160AVA-2930LPAHA-3950U2B U2AHA-3950U2D U2AIC-7896/7 U2AHA-3960D U160AIC-7899BAIC-7899DAIC-7899FAIC-7899 U160ServeRAIDAAC-2622ASR-2200SASR-2120SAAC-364AAC-3642Dell PERC 2/QCAIC-7901 U320AHA-29320A U320AHA-29320LP U320AIC-7901A U320AHA-29320 U320AHA-29320B U320AIC-7902 U320AIC-7902B U320AHA-39320 U320AHA-39320B U320AHA-39320A U320AHA-39320D U320AHA-39320DB U3201200AABP-930/40UAABP-940UWASP-3940U2WASP-3940U3WWaikato Dag3.2Endace Dag3.5Endace Dag4.22GEEndace Dag4.23PhysXAT22AT24AcenicAcenic CopperBCM5700BCM5701AC1000AC1001AC9100AC1003AMD64 0Fh HyperTransportAMD64 0Fh Address MapAMD64 0Fh DRAM CfgAMD64 0Fh Misc CfgAMD64 10h HyperTransportAMD64 10h Address MapAMD64 10h DRAM CfgAMD64 10h Misc CfgAMD64 10h Link CfgAMD64 11h HyperTransportAMD64 11h Address MapAMD64 11h DRAM CfgAMD64 11h Misc CfgAMD64 11h Link CfgAMD64 14h HostAMD64 14h PCIEAMD64 15h Link CfgAMD64 15h Address MapAMD64 15h DRAM CfgAMD64 15h Misc CfgAMD64 15h CPU PowerAMD64 15h HostAMD64 14h Link CfgAMD64 14h Address MapAMD64 14h DRAM CfgAMD64 14h Misc CfgAMD64 14h CPU PowerAMD64 12h HostAMD64 12h PCIEAMD64 14h NB PowerAMD64 14h Reserved79c970 PCnet-PCI79c978 PChome-PCI53c974 PCscsi-PCI79C974 PCnet-PCIGeode LXGeode LX VideoGeode LX CryptoCS5536 PCICS5536 ISACS5536 AudioCS5536 USBCS5536 IDEElanSC520 PCIHudson-2 PCIE751 System762 PCI761 PCI755 ISA755 IDE755 Power755 USB756 ISA756 IDE756 Power756 USB Host766 ISA766 IDE766 USB766 Power766 USB OpenHCI768 ISA768 IDE768 Power768 AC97768 Modem768768 USB8131 PCIX8131 PCIX IOAPIC8151 Sys Control8151 AGP8132 PCIX8132 PCIX IOAPIC81118111 Ether8111 USB8111 LPC8111 IDE8111 SMBus8111 Power8111 AC97Hudson-2 SATAHudson-2 SD Host ControllerHudson-2 USBHudson-2 USB2Hudson-2 SMBusHudson-2 IDEHudson-2 HD AudioHudson-2 LPCHudson-2 PCIHudson-2 xHCIRS780 HostRS880 HostRS780 PCIEMegaRAIDMegaRAID Series 428MegaRAID Series 434ADSP 21535 DSPAD1889 AudioSafeNet ADSP 2141TC9021BanditGCOHareHeathrowPaddingtonUni-N EthUni-NUni-N Eth FirewireUni-N AGPUni-N GMACKeylargoPangea GMACPangea MacioPangea USBPangea AGPPangeaPangea PCIUni-N2 AGPUni-N2 HostPangea FireWireUniNorth FirewireUni-N2 GMACUni-N ATAUniNorth AGPUniNorth PCIIntrepid ATAIntrepidIntrepid USBK2 USBK2 MacioK2 FirewireK2 ATAU3U3 HyperTransportU3 AGPK2 GMACShastaShasta ATAShasta GMACShasta FirewireShasta PCIShasta HyperTransportK2U3L AGPK2 AGPIntrepid 2 AGPIntrepid 2 PCIIntrepid 2 ATAIntrepid 2 FireWireIntrepid 2 GMACARS106SARS0303D1000PV2000PV2000MT2000MIARC-1110ARC-1120ARC-1130ARC-1160ARC-1170ARC-1200ARC-1200BARC-1202ARC-1210ARC-1220ARC-1230ARC-1260ARC-1270ARC-1280ARC-1380ARC-1381ARC-1680ARC-1681ARC-1880AX88140A/88141ASM1042 xHCIASM1083/1085 PCIE-PCIRadeon HD 6310 HD AudioRadeon HD 6500D HD AudioRadeon M241PRadeon X300 M24FireGL M24 GLRadeon X600FireGL V3200Radeon X600 SecRadeon IGP 320Radeon IGP 340Radeon 9500 ProRadeon AE 9700 ProRadeon AF 9600TXFireGL AGZ1Radeon AH 9800 SERadeon AI 9800Radeon AJ 9800FireGL AK X2Radeon 9600 ProRadeon 9600Radeon 9550FireGLRadeon 9650Mach32Radeon 9500 Pro SecRadeon 9600 Pro SecRadeon 9600 LE SecRadeon 9600 XT SecRadeon 9550 SecRadeon IGPRadeon 8500Radeon BC R200Radeon IGP 320MMobility M6SB200 AC97SB200 PCISB200 USB2SB200 USBSB200 IDESB200 ISASB200 ModemSB200 SMBusMach64 CTMach64 CXSB300 AC97SB300 PCISB300 SMBusSB300 USB2SB300 USBSB300 IDESB300 ISASB300 ModemSB300 SATASB400 AC97SB400 PCISB400 SMBusSB400 USB2SB400 USBSB400 IDESB400 ISASB400 ModemSB400 SATASB450 HD AudioSB600 SATASB600 AC97SBx00 HD AudioSB600 PCISBx00 SMBusSB600 USB2SB600 USBSB600 IDESB600 ISASB600 ModemSBx00 SATASB700 USB2SB700 USBSB700 IDESB700 ISASB800 PCIERadeon Mobility IGPMach64 ETRage ProMach64Rage XLRadeon 9000Radeon 9000 SecRadeon X800Radeon X800 ProRadeon X800SERadeon X800XTFireGL X3-256Radeon Mobility M18Radeon X800 SERadeon X800 XTRadeon AIW X800 VERadeon X800 Pro SecRadeon X850 XTRadeon X850 SERadeon X850 ProRadeon X850 XT PERage128Mobility M3Mobility 1Rage P/MRadeon Mobility M7FireGL Mobility 7800 M7Radeon Mobility M6Radeon Mobility M9Rage 128 MobilityRadeon 9500/9700Radeon 9600 TXFireGL X1Radeon 9800 ProRAdeon 9800Radeon 9800 XTFireGL X2Radeon Mobility M10Radeon Mobility 9550Radeon 9500/9700 SecFireGL X1 SecRadeon 9800 Pro SecRage 128 ProRage FuryRage 128Rage 128 PXAIW RadeonRadeon 9100Radeon 7500Radeon VEES1000Rage MagnumRadeon Mobility M300 M22Radeon Mobility X600 M24CFireGL M44 GL 5464Radeon X800 XT PERadeon X800 XTPRadeon X800 XLFireGL V7100FireGL V5100Radeon X800 SecMobility FireGL V5000 M26Radeon Mobility X700 XL M26Radeon Mobility X700 M26Radeon X550XTXRadeon X550XTX SecRS300_100 HostRS300_133 HostRS300_166 HostRadeon IGP 9100 HostRadeon IGP 9100Radeon Mobility IGP 9100Radeon IGP 9100 AGPRadeon 9200 PRO SecRadeon 9200 SecRS480 HostRX480 HostRD580 HostRadeon XPRESS 200Radeon XPRESS 200MRX780 HostRD780 HT-PCIERadeon 9200 PRORadeon 9200Radeon 9200 SE SecFireMV 2200RD790 PCIESR5690 HostRD890 HostSR5670 HostSR5650 HostSR5690 PCIERS400 HostRC410 HostRX480 PCIERS480 PCIERadeon X300Radeon X550FireGL V3100FireMV 2200 5B65Radeon X300 SecRadeon X550 SecFireGL V3100 SecFireMV 2200 SecRadeon Mobility 9200Radeon 9200 SERadeon X800 XT M28FireGL V5100 M28Radeon Mobility X800 M28Radeon X850FireGL R480Radeon X850XTRadeon X800 GTO SecRadeon X850 XT SecFireGL V5000FireGL X700 XTFireGL X700 ProFireGL X700 SERadeon X700 PCIERadeon X700 SE PCIERadeon X700 PCIE SecRadeon X700 SERadeon X700 SE SecRadeon HD 8670ARadeon HD 8730MOlandRadeon HD 8790MRadeon HD 8530MRadeon HD 8600Radeon HD 8570Radeon HD 8500Radeon HD 8670MRadeon HD 8500MHainanCaymanFirePro V7900FirePro V5900Radeon HD 6970Radeon HD 6950Radeon HD 6990Radeon HD 6930Radeon HD 6970MMobility Radeon HD 6000BartsRadeon HD 6900MRadeon HD 6870Radeon HD 6850Radeon HD 6790Radeon HD 6730MRadeon HD 6600MRadeon HD 6610MRadeon E6760TurksFirePro V4900FirePro V3900Radeon HD 6650ARadeon HD 7670ARadeon HD 6670Radeon HD 6570Radeon HD 7570Radeon HD 6510Radeon HD 6400MRadeon HD 6430MCaicosRadeon E6460Radeon HD 6450ARadeon HD 8490Radeon HD 7450ARadeon HD 7470Radeon HD 6450Radeon HD 7450FirePro W9000FirePro VTahitiRadeon HD 7970Radeon HD 7900Radeon HD 7950Radeon HD 7990Radeon HD 7870 XTRadeon HD 7970MRadeon HD 8970MPitcairnFirePro W7000FirePro W5000Radeon HD 7870Radeon HD 7850Radeon HD 8800MCape VerdeRadeon HD 7700MRadeon HD 7870MRadeon HD 7850MFirePro W600FirePro M4000Radeon HD 7730MRadeon HD 7800MRadeon HD 7730Radeon HD 7700Radeon HD 7770Radeon HD 7750Radeon HD 7670MRadeon HD 7550MRadeon HD 7000MRadeon HD 7400CypressFirePro V8800FirePro V7800FirePro V9800FireStream 9370FireStream 9350Radeon HD 5870Radeon HD 5850Radeon HD 6800Radeon HD 5970Radeon HD 5900Radeon HD 5830Mobility Radeon HD 5870Mobility Radeon HD 5850Radeon HD 6850MFirePro V5800Mobility Radeon HD 5800Radeon HD 5770Radeon HD 5670 640SPRadeon HD 6770Radeon HD 5750Radeon HD 6750Mobility Radeon HD 5730Mobility Radeon HD 5650Mobility Radeon HD 5570FirePro V4800FirePro V3800Radeon HD 5670Radeon HD 5570Radeon HD 5550RedwoodRadeon Mobility HD 5470Radeon Mobility HD 5430Radeon HD 6370MRadeon HD 6330MCedarFireProFirePro 2460FirePro 2270Radeon HD 7300Radeon HD 5450Radeon HD 7350Cedar LERS100 PCIRS200 PCIRadeon X1800Radeon X1800 XTRadeon Mobility X1800FireGL Mobility V7200FireGL V7200FireGL V5300FireGL Mobility V7100FireGL V7300FireGL V7350Radeon X1600RV505Radeon X1300/X1550Radeon X1550M54-GLRadeon Mobility X1400RADEON X1550 64-bitRadeon Mobility X1300 M52-64Radeon Mobility X1300Radeon X1300FireGL V3300FireGL V3350Radeon X1600 SecRadeon X1300/X1550 SecRadeon X1300 ProRadeon X1450Radeon Mobility X2300Radeon Mobility X1350Radeon Mobility X1450FireMV 2250Radeon X1550 64-bitRadeon X1300 Pro SecRadeon X1300 SecRadeon X1650Radeon X1600 ProFireGL V5200Radeon Mobility X1600Radeon X1650 ProRadeon X1300 XTFireGL V3400Mobility FireGL V5250Radeon X1700Radeon X1700 XTRadeon Mobility X1700Radeon X1600 Pro SecRadeon X1650 Pro SecRadeon X2300HDRadeon Mobility X2300HDRadeon X1950Radeon X1900AMD Stream ProcessorRadeon X1950 ProRV560Radeon Mobility X1900Radeon X1950 GTRV570FireGL V7400Rv560Radeon RX1650 XTRadeon X1950 Pro SecRadeon RX1650 XT SecRadeon 9000/9100 IGPRadeon RS350IGPRS690 HostRS740 HostRS690 PCIERS690M PCIERS690 HD AudioRadeon X1250Radeon X1250 IGPRadeon 2100Radeon HD 4870Radeon HD 4870 X2Radeon HD 4850Radeon HD 4850 X2FirePro V8750FirePro V7760Mobility Radeon HD 4850Mobility Radeon HD 4850 X2Radeon HD 4800FirePro RV770FireStream 9270FireStream 9250FirePro V8700Mobility Radeon HD 4870Radeon HD 4890FirePro M7750Mobility Radeon HD 4650Mobility Radeon HD 4670Radeon HD 4670Radeon E4600Radeon HD 4600Radeon HD 4650FirePro V7750FirePro V5700FirePro V3750Mobility Radeon HD 4830FirePro M7740Radeon HD 4770Radeon HD 4700FirePro M5750Radeon HD 2400 XTRadeon HD 2400 ProRadeon HD 2400 Pro AGPFireGL V4000Radeon HD 2350Mobility Radeon HD 2400 XTMobility Radeon HD 2400Radeon E2400Radeon HD 2400 Pro PCIFireMV 2260Radeon HD 3870Mobility Radeon HD 3850Radeon HD 3850Mobility Radeon HD 3850 X2Mobility Radeon HD 3870Mobility Radeon HD 3870 X2Radeon HD 3870 X2FireGL V7700Radeon HD 3850 AGPRadeon HD 3690FireStreamRadeon HD 4550Radeon HD 4350Mobility Radeon HD 4300Mobility Radeon HD 4500FirePro RG220Mobility Radeon HD 4330Mobility Radeon HD 2600Mobility Radeon HD 2600 XTRadeon HD 2600 XT AGPRadeon HD 2600 Pro AGPRadeon HD 2600 XTRadeon HD 2600 ProFireGL V5600FireGL V3600Radeon HD 3600Mobility Radeon HD 3650Mobility Radeon HD 3670Mobilty FireGL V5700Radeon HD 3650 AGPRadeon HD 3650Mobility FireGL V5725Radeon HD 3470Mobility Radeon HD 3430Mobility Radeon HD 3400Radeon HD 3450Radeon HD 3450 AGPRadeon HD 3430Radeon HD 3450 PCIFirePro V3700FireMV 2450RS780 HD AudioRadeon HD 3200Radeon HD 3100Radeon HD 3300Radeon HD 3000Radeon HD 6550DRadeon HD 6620GRadeon HD 6370DRadeon HD 6380GRadeon HD 6410DRadeon HD 6520GRadeon HD 6480GRadeon HD 6530DSumoRadeon HD 4200 HD AudioRadeon HD 4200Radeon HD 4100Mobility Radeon HD 4200Mobility Radeon HD 4100Radeon HD 4290Radeon HD 4250Radeon HD 6310Radeon HD 6250Radeon HD 6320Radeon HD 6290Radeon HD 7340Radeon HD 7310Radeon HD 7290ArubaRadeon HD 7660DRadeon HD 7640GRadeon HD 7560DFirePro A300Radeon HD 7620GRadeon HD 7600GRadeon HD 7500GRadeon HD 8650GRadeon HD 8670DRadeon HD 8550GRadeon HD 8570DRadeon HD 8610GRadeon HD 7660GRadeon HD 7520GRadeon HD 7540DRadeon HD 7420GRadeon HD 7480DRadeon HD 7400GRadeon HD 8450GRadeon HD 8470DRadeon HD 8350GRadeon HD 8370DRadeon HD 8510GRadeon HD 8410GRadeon HD 8310GRadeon HD 2600 HD AudioRS690M HD AudioRadeon HD 3870 HD AudioRadeon HD 3600 HD AudioRadeon HD 34xx HD AudioRadeon HD 48xx HD AudioRadeon HD 4000 HD AudioRadeon HD 5800 AudioRadeon HD 5700 AudioRadeon HD 5600 AudioRadeon HD 5470 AudioRadeon HD 6670 AudioRadeon HD 6400 AudioRS100 AGPRS200 AGPRS250 AGPRS200M AGPS5933 PCI MatchmakerMyrinet LANaiAST2000AR5210AR5311AR5211AR5212AR2413AR5413AR5424AR5416AR5418AR9160AR9280AR9281AR9285AR2427AR9227AR9287AR9300AR9485AR5211RefAT76C506IDE-2015PLL1EL1L2CL1CL1DL2FL1FL2Vortex 1Vortex 2Vortex AdvantageAVL2301AVG2302ALG2301ALG2302ALS4000Dual SerialQuad SerialBRI ISDNFritz ISDNFritz v2.0 ISDNPRI T1 ISDNRT2890F5D6001F5D6020V3F5D7010F5D6000VME 617VME 270655015601BCM43224BCM5752BCM5752MBCM5709BCM5709SBCM5716BCM5716SBCM5725BCM5702BCM5703BCM5704CBCM5704S AltBCM5706BCM5708BCM5702FEBCM57710BCM57711BCM57711EBCM5705BCM5705KBCM5717BCM5718BCM5719BCM5721BCM5722BCM5723BCM5705MBCM5705M AltBCM5720BCM57712BCM57712EBCM5717CBCM5714BCM5714SBCM5780BCM5780SBCM5705FBCM5754MBCM5755MBCM5756BCM5751BCM5715BCM5715SBCM5754BCM5755BCM5751MBCM5751FBCM5787FBCM5761EBCM5761BCM57762BCM5764BCM57766BCM5762BCM5761SBCM5761SEBCM57760BCM57788BCM57780BCM5787MBCM57790BCM5782BCM5784BCM5785GBCM5786BCM5787BCM5788BCM5789BCM5785FBCM5702XBCM5703XBCM5704SBCM5706SBCM5708SBCM57761BCM57781BCM57791BCM57786BCM57765BCM57785BCM57795BCM57782BCM5702 AltBCM5703 AltBCM5781BCM5727BCM5753BCM5753MBCM5753FBCM5903MBCM4401B1BCM5901BCM5901A2BCM5903FBCM5906BCM5906MBCM4303BCM4307BCM4311BCM4312BCM4315BCM4318BCM4319BCM4306BCM4309BCM43XGBCM4321BCM4322BCM43225BCM43227BCM4401BCM4401B0BCM431358015802580558205821582258235825586058615862BT848BT849BT878BT879BT878 AudioBT879 AudioBt8474 HDLCMultiMaster NCMultiMasterFlashPointGPPCINITROX XLNITROX LiteNITROX PXOCTEON Plus CN50XXCinemasterNx10 10GbEPE9000 10GbET302E 10GbET310E 10GbET320X 10GbET302X 10GbET320E 10GbET310X 10GbET3B10 10GbET3B20 10GbET3B02 10GbE643106554565548655506555465555685546900069030CL-GD7548CL-GD5430CL-GD5434-4CL-GD5434-8CL-GD5436CL-GD5446CL-GD5480CL-GD5462CL-GD5464CL-GD5465CL-PD6729CL-PD6832 CardBusCL-PD6833 CardBusCL-GD7542CL-GD7543CL-GD7541CS4610 SoundFusionCS4615CS4280/46xx CrystalClearCS4281 CrystalClearVIC PCIEVIC ManagementVIC EthernetVIC FCoEAAR-1210SAAAR-1220SAAAR-1225SAPCI0640PCI0642PCI0643PCI0646PCI0647PCI0648PCI0649PCI0650AUSB0670USB0673PCI0680SiI3112 SATASiI3114 SATASiI3124 SATASiI3131 SATASiI3132 SATASiI3512 SATASiI3531 SATAGigaCardEX110TXSmart Array 64xxTriflex PCIQVisionQVision 1280/pSmart Array 5300Smart Array 5iSmart Array 532Smart Array 5312Smart Array 6iSmart Array 641Smart Array 642Smart Array 6400Smart Array 6400 EMSmart Array 6422Hotplug PCINetelligent ASMCPCI HotplugUSB OpenHostSMART2P RAIDISAPnPNetelligent 10/100TXNetelligent IDENetelligent 10 TIntegrated NetFlex 3/PDP Netelligent 10/100TXProLiant Netelligent 10/100TXEmbedded Netelligent 10/100TXNetelligent 10 T/2 PCISmart Array 5300 rev.2Smart Array 5i/532 rev.2iLONetFlex 3/PNetFlex 3/PBCompexeRL100-ATX 10/100PMAC 9871356k WinmodemSoftK56 PCIHSF 56k HSFiMUSYCC CN8478MUSYCC CN8474MUSYCC CN8472MUSYCC CN8471CX2388xCX2388x AudioCX2388x MPEGCX2388x IRCX2388582C599 VLBCY82C693U ISAFEther CB-TXD 10/100FEther II CB-TXD 10/100CG-LAPCIGTRTL8192ERTL8190PC-Bus II-PCICache Coherency FilterSoundBlaster LiveSoundBlaster AWE64DSoundBlaster AudigySoundBlaster X-FiSoundBlaster Audigy LSSoundBlaster Audigy 2SoundBlaster X-Fi XtremePCI Gameport JoystickSoundBlaster Audigy DigitalEctiva 1938Cyclom-Y below 1MCyclom-YCyclom-4Y below 1MCyclom-4YCyclom-8Y below 1MCyclom-8YCyclom-Z below 1MCyclom-ZIQ80310Cx5510GXm PCIGXm ISACx5530 SouthCx5530 SMICx5530 IDECx5530 XpressAUDIOCx5530 VideoDM9009DM9100DM9102DM9132PCCOM 2-portPCCOM 4-portPCCOM 8-port210502104021030Zephyr NV-RAMKZPSA21140TGA2DEFPA21041DGLPBZLXP-L2Memory Channel Cluster Controller21142/3Farallon PN9000SX210522115021150-BC21152211532115421554SWXCR RAIDPERC 2/SiPERC 3/DiPERC 3/SiDRAC 3 Add-inDRAC 3 Virtual UARTDRAC 3 Embedded/OptionalDRAC 4 Embedded/OptionalDRAC 3 OptionalPERC 4/Di i960PERC 4/Di VerdeDRAC 4DRAC 4 Virtual UARTPERC 4e/DiDRAC 4 SMICPERC 58139Viper/PCIDFE-550TXDFE-530TX+DFE-690TXDDRP32TXDDWL-610DGE-550TDGE-550SXDFE-520TX C1DGE-528TDGE-530T C1DGE-560TDGE-530T B1DGE-560SXDGE-550T B1DGE-530T A1Memory ControlSmartCache/RaidPCI-PCISmartRAIDSmartRAID 2005SPCI-SCIDMX3194UIS64PH ISDNRT2860155P-MF1 ATM25SS-3010 ATMSpeedStream 1023QuickStep 1000 ISDNLPFCLP6000Lancer 10GbELancer 10GbE VFLPe121LPe1250LP952LP982LP101LP1050LP111LP1150LPe111LPe1150LPe1000LPe1000-SPLPe1002-SPLPe12000LPe12000-SPLPe12002-SPLP7000LP8000LP9000LP9802LP10000LPX10000LP10000-SLP11000-SLPe11000-SLPe12000-SLP11000LP11000-SPLP11002-SPLPe11000LPe11000-SPLPe11002-SPEndace Dag3.6DEndace Dag4.23GEFlash memoryMemory StickSD ControllerCB-1211 CardBusCB-1225 CardBusCB-1410 CardBusCB-710 CardBusCB-712 CardBusCB-1420 CardBusCB-720 CardBusCB-722 CardBusAudioPCI97AudioPCICT5880ES366H ModemMaestro IISOLO-1 AudioDriveMaestro 2EES1989ES1989 ModemMaestro 3ES1983 ModemMaestro 3 AudioES366H Fax/ModemES2838/2839 SuperLink ModemES2898 ModemRoadRunner HIPPIRoadRunner Gig-EFreedom GBusWL11000PSST-64PSST-128PSST-16PSST-4pSST-8pXR17C152XR17C154XR17C158ATM PCA-200ATM PCA-200e801 SoundMPC8349EMPC8349MPC8347E TBGAMPC8347 TBGAMPC8347E PBGAMPC8347 PBGAMPC8343EMPC8343FL1000 xHCIFL1009 xHCIPW008GE5PW008GE4PRIMEPOWER250/450 LANioDrive v1.2ioDriveioXtremeioXtreme ProTMC-18C30GL24110P03GL24110PGL24110P02Pulsar G7370 ADSLPR103WinTVPN672TX 10/100Visualize EGVisualize FX6Visualize FX4Visualize FX2Tach TL FibreChannelTach XL2 FibreChannelJ2585AJ2585BDiva Serial MultiportElroy Ropes-PCIVisualize FXeTopToolsNetRaid-4MNetServer SmartIRQ82557B 10/100 NICPluto MIOzx1 IOCMercury Ropes-PCIQuickSilver Ropes-PCISmart Array V100Smart Array E200iSmart Array E200Smart ArraySmart Array P800Smart Array P600Smart Array E500Smart Array P400Smart Array P400iSmart Array P700mSmart Array P212Smart Array P410Smart Array P410iSmart Array P411Smart Array P812Smart Array P712mSmart Array P711miLO3 SerialiLO3 SlaveiLO3 ManagementiLO3 WatchdogSmart Array P222Smart Array P420Smart Array P421Smart Array P822Smart Array P420iSmart Array P220iSmart Array P721m77516500781179517814/7851/785480658165815479567955/7954HB6HB4MSVCC01 Video CaptureSH7751 PCISH7751R PCIMCACPU - Alta LiteCPU - Alta MPISA w/PnPCPUAuto LANStreamerGXT-150P82G267582351Miami/PCIOlympici82557B 10/100RSAFireGL2133 PCIX-PCIX4810 BSP4810 SCCCalgary IOMMUEnvy24 I/O CtrlrEnvy24PT/HT Audio77201/77211 ATM89HPES12N3A89HPES24N3A89HPES24T689HPES4T489HPES5T5ZB89HPES24T3G2WDT 50x Watchdog TimerINIC-850INIC-1060INIC-940INIC-941INIC-950VirtualBox Graphics AdapterVirtualBox Guest ServiceIPN2120IPN222050265027502888498853Twin Turbo 128Twin Turbo 3DEES ISA21145Core HostCore PCIEHD Graphics3400 PCIECentrino Advanced-N 6205WiFi Link 1000Centrino Advanced-N 6250WiFi Link 1030Centrino Advanced-N 6030Core 2G HostCore 2G PCIEHD Graphics 2000Xeon E3-1200 HostHD Graphics P3000HD Graphics 3000Xeon E3-1200v2 HostXeon E3-1200v2 PCIEHD Graphics 2500Core 3G HostHD Graphics 4000HD Graphics P400080303 IOP80312 I/O Companion6700PXH PCIE-PCIX6702PXH PCIE-PCIXIOP332 PCIE-PCIXIOP331 PCIX-PCIX41210 PCIE-PCIXIOP333 PCIE-PCIXDH89XXCC SGMIIDH89XXCC SerDesDH89XXCC backplaneHD Graphics 4400HD Graphics 4600HD Graphics P4600DH89XXCC SFP82375EB EISA82424ZX Cache/DRAM82378IB ISA82426EX ISA82434LX/NXGDT RAIDCentrino Advanced-N 6235WiFi Link 6150WiFi Link 130WiFi Link 100i960 RPi960 RMi960 RNHD Graphics 5000Iris Graphics 5100Atom D2000/N2000 VideoAtom D2000/N2000 HostIris Pro Graphics 52008254282543GC82544EI82544GC82540EM82545EM82546EB82541EI82540EP82547EI82545GMPRO/10082559PRO/100 VEPRO/100 VM82562EH HomePNA82801DB LANV.92 ModemPRO/Wireless 210082597EXICH8 IGP M AMTICH8 IGP AMTICH8 IGP CICH8 IFEICH8 IGP MPRO/100 M82571EB82801FB LAN82801FBM LAN82801GB LAN82547GI82541GI82541ER82546GB82572EI82573E82573E IDE82573E KCS82573E Serial80003ES282573L82575EB82573V82598ICH9 IGP AMTICH9 IGP MICH9 IFEICH9 IFE GICH9 IFE GTICH8 IFE GTICH8 IFE G82598AF82598AT82576ICH9 IGP M VICH10 R BM LMICH10 R BM LFICH10 R BM V82574L82571PT82575GB82598EBICH10 D BM LMICH10 D BM LFICH9 BM82577LM82577LC8259982578DM82578DCICH9 IGP M AMT8255282815 Host82815 AGP82815 Video82806AA APIC82559ER82092AA IDESAA711682452KX/GXEE Pro 10 PCIEE Pro 100EE Pro 100 Smart8255x82437FX82371FB ISA82371FB IDE82371 ISA and IDE82437MX82441FX82380AB Mobile ISA82380FB Mobile82439HX82806AA82870P2 PCIX-PCIX82870P2 IOxAPIC82870P2 Hot PlugICH8 82567V-382579LM82579V82576NS82583V82576 SerDes QP8258082599 T3I350I350 FiberI350 SerDesI350 SGMII82580 QFX540T80960RP ATU82840 Host82840 AGP82840 PCI82845 Host82845 AGPI/OAT7 Series xHCI6 Series SATA6 Series AHCI6 Series RAID6 Series PCIE6 Series HD Audio6 Series SMBus6 Series Thermal6 Series DMI-PCI6 Series USB6 Series MEI6 Series KTZ68 LPCP67 LPCUM67 LPCHM65 LPCH67 LPCHM67 LPCQ65 LPCQS67 LPCQ67 LPCQM67 LPCB65 LPCC202 LPCC204 LPCC206 LPCH61 LPCC600 SATAC600 AHCIC600 RAIDC600 PCIEC600 HD AudioC600 SMBusC600 ThermalC600 USBC600 LANC600 MEIC600 Virtual PCIEC600 LPC7 Series SATA7 Series AHCI7 Series RAID7 Series PCIE7 Series HD Audio7 Series SMBus7 Series USB7 Series MEI7 Series KTZ77 LPCZ75 LPCB75 LPCH77 LPCC216 LPCQM77 LPCHM77 LPCUM77 LPCHM76 LPCHM75 LPCHM70 LPC82801AA LPC82801AA IDE82801AA USB82801AA SMBus82801AA AC9782801AA Modem82801AA Hub-to-PCI82801AB LPC82801AB IDE82801AB USB82801AB SMBus82801AB AC9782801AB Modem82801AB Hub-to-PCI82801BA LPC82801BA USB82801BA SMBus82801BA AC9782801BA Modem82801BAM Hub-to-PCI8256282801BAM IDE82801BA IDE82801BAM LPC82801BA Hub-to-PCI82801E LPC82801E USB82801E SMBus82801E LAN82801CA LPC82801CA/CAM USB82801CA/CAM SMBus82801CA/CAM AC9782801CA/CAM Modem82801CAM IDE82801CA IDE82801CAM LPC82801DB LPC82801DBL IDE82801DB USB82801DB SMBus82801DB AC9782801DB Modem82801DBM IDE82801DB IDE82801DBM LPC82801EB/ER LPC82801EB SATA82801EB/ER USB82801EB/ER SMBus82801EB/ER AC9782801EB/ER Modem82801EB/ER IDE82801EB/ER USB282801ER SATA82820 Host82820 AGP82850 Host82860 Host82850/82860 AGP82860 PCIE7500 HostE7500 Error ReportingE7500 PCIE7501 HostE7505 HostE7505 Error ReportingE7505 AGPE7505 PCI82845G Host82845G AGP82845G Video82865G Host82865G AGP82865G Video82865G CSA82865G Overflow82875P Host82875P AGP82875P CSA82915G Host82915G PCIE82915G Video82925X Host82925X PCIEE7221 HostE7221 PCIEE7221 Video82915GM Host82915GM PCIE82915GM Video6300ESB LPC6300ESB IDE6300ESB SATA6300ESB SMBus6300ESB AC976300ESB Modem6300ESB USB6300ESB WDT6300ESB APIC6300ESB PCIX5000X Host5000Z Host5000V Host5000P Host5000 PCIE5000 Error Reporting5000 Reserved5000 FBD5000 PCIE x85000 PCIE x16E8500 HostE8500 PCIEE8500 PCIE x8E8500 IMIE8500 FSB/Boot/InterruptE8500 Address MappingE8500 RASE8500 MiscE8500 ReservedE8500 XMBE8500 XMB MiscE8500 XMB MAIE8500 XMB DDRE8500 XMB Reserved82801FB LPC82801FBM LPC82801FB SATA82801FR SATA82801FBM SATA82801FB USB82801FB PCIE82801FB HD Audio82801FB SMBus82801FB Modem82801FB AC9782801FB IDE6321ESB LPC6321ESB SATA6321ESB AHCI6321ESB RAID6321ESB USB6321ESB PCIE6321ESB AC976321ESB Modem6321ESB HD Audio6321ESB SMBus6321ESB IDE82945G Host82945G PCIE82945G Video82955X Host82955X PCIEE7230 HostE7230 PCIE82975X PCIE82975X Host82945GM Host82945GM PCIE82945GM Video82945GME Host82945GME Video82801GH LPC82801GB LPC82801GBM LPCNM10 LPC82801GHM LPC82801GB SATA82801GR AHCI82801GR RAID82801GBM SATA82801GBM AHCI82801GHM RAID82801GB USB82801GB PCIE82801GB HD Audio82801GB SMBus82801GB Modem82801GB AC9782801GB IDE82801G PCIE82801H LPC82801HEM LPC82801HH LPC82801HO LPC82801HBM LPC82801H SATA82801H AHCI82801H RAID82801HBM SATA82801HBM AHCI82081HBM RAID82801H SMBus82801H DMI-PCI82801H USB82801H PCIE82801H HD Audio82801H Thermal82801HBM IDE82801IH LPC82801IO LPC82801IR LPC82801IEM LPC82801IB LPC82801IBM LPC82801I SATA82801I AHCI82801I RAID82801I SMBus82801I Thermal82801I USB82801I HD Audio82801I PCIEICH9 IGP C82946GZ Host82946GZ PCIE82946GZ Video82946GZ HECI82946GZ PT IDER82946GZ KT82G35 Host82G35 PCIE82G35 Video82G35 HECI82Q965 Host82Q965 PCIE82Q965 Video82Q965 HECI82Q965 PT IDER82Q965 KT82G965 Host82G965 PCIE82G965 Video82G965 HECI82G965 PT IDER82G965 KT82Q35 Host82Q35 PCIE82Q35 Video82Q35 HECI82Q35 PT IDER82Q35 KT82G33 Host82G33 PCIE82G33 Video82G33 HECI82G33 PT IDER82G33 KT82Q33 Host82Q33 PCIE82Q33 Video82Q33 HECI82Q33 PT IDER82Q33 KT82X38 Host82X38 PCIE82X38 HECI82X38 PT IDER82X38 KT3200/3210 Host3200/3210 PCIE3210 PCIEGM965 HostGM965 PCIEGM965 VideoGM965 KTGM965 PT IDERGME965 HostGME965 PCIEGME965 VideoGME965 HECIGME965 PT IDERGME965 KTGM45 HostGM45 PCIEGM45 VideoGM45 HECIGM45 PT IDERGM45 KT4 Series VideoQPI LinkQPI PhysicalQ45 HostQ45 PCIEQ45 VideoQ45 HECIQ45 PT IDERQ45 KTG45 HostG45 PCIEG45 VideoG41 HostG41 VideoB43 VideoRCU32 I2O RAID3124 SATA31244 SATA82855PM Host82855PM AGP82855PM Power5500 HostX58 Host5520 HostX58 PCIE5520/X58 QuickPath5520 QuickPathX58 GPIOX58 RASX58 QuickPathX58 QuickDataX58 IOxAPICX58 MiscX58 ThrottleX58 TXT6321ESB IOxAPIC6321ESB PCIE-PCIX82830M Host82830M AGP82830M Video82855GM Host82855GME AGP82855GM Video82855GM Memory82855GM Config82854 Host82854 VideoE7520 HostE7520 Error ReportingE7320 HostE7320 Error ReportingE7520 DMAE7520 PCIEE7520 ConfigE7525 Host3100 Host3100 Error Reporting3100 EDMA3100 PCIE7300 Host7300 PCIEI/OAT CNB7300 FSB/Boot/Interrupt7300 Snoop Filter7300 Misc7300 FBD82801JD SATA82801JD AHCI82801JD RAID82801JDO LPC82801JIR LPC82801JIB LPC82801JD LPC82801JI SATA82801JI AHCI82801JI RAID82801JI SMBus82801JI USB82801JI HD Audio82801JI PCIE82801JDO VECI82801JD Virtual SATA82801JD SMBus82801JD Thermal82801JD USB82801JD HD Audio82801JD PCIE82801JD LANP55 LPCPM55 LPCH55 LPCQM57 LPCH57 LPCHM55 LPCQ57 LPCHM57 LPCQS57 LPC3400 LPC3420 LPC3450 LPC3400 SATA3400 AHCI3400 RAID3400 SMBus3400 Thermal3400 USB3400 HD AudioQS57 HD Audio3400 MEI3400 PT IDER3400 KTE5 HostE5 PCIEE5 DMAE5 Address MapE5 Error ReportingE5 I/O APIC5400 Host5400A Host5400B Host5400 PCIEI/OAT SNB5400 FSB/Boot/Interrupt5400 Coherency Engine5400 IOAPIC5400 RASE600 HostPRO/Wireless 2200BGPRO/Wireless 2225BGPRO/Wireless 3945ABGPRO/Wireless 2915ABGWireless WiFi Link 4965Centrino Ultimate-N 6300Centrino Advanced-N 6200WiFi Link 5100WiFi Link 5300WiFi Link 5350WiFi Link 5150Turbo MemoryEP80579 HostEP80579 MemoryEP80579 EDMAEP80579 PCIEEP80579 SATAEP80579 AHCIEP80579 ASUEP80579 ReservedEP80579 LPCEP80579 SMBusEP80579 USBEP80579EP80579 CANbusEP80579 SerialEP80579 1588EP80579 LEBEP80579 GCUEP80579 LANi960 RDPRO 100 Server5100 Host5100 PCIE5100 FSB5100 Reserved5100 DDRI/OAT SCNB82371SB ISA82371SB IDE82371SB USB82437VX82439TX82371AB PIIX4 ISA82371AB IDE82371AB USB82371AB Power82810 Host82810 Video82810-DC100 Host82810-DC100 Video82810E Host82810E Video82443LX AGP82443BX AGP82443BX82440MX Host82440MX AC9782440MX Modem82440MX ISA82440MX IDE82440MX USB82440MX Power82440BX AGP82443GX82372FB IDE82740 AGPUS15W HostUS15L/UL11L HostUS15W VideoUS15L/UL11L VideoSCH PCIESCH USBSCH USB ClientSCH LPCSCH IDESCH HD AudioSCH SD/MMCE600 PCIEE600 VideoE600 ConfigE600 LPC82450KX/GX82450KX/GX Memory82451NX Mem & IO82454NX PXBEG20T PCIEEG20T Packet HubEG20T EthernetEG20T GPIOEG20T USBEG20T USB ClientEG20T SDIOEG20T AHCIEG20T DMAEG20T SerialEG20T SPIEG20T I2CEG20T CANEG20T 158882802AC Firmware Hub 8Mbit82802AB Firmware Hub 4MbitI2O RAIDRCU21 I2O RAIDRCUxx I2O RAIDRCU31 I2O RAIDRCU31L I2O RAIDPineview DMIPineview VideoS21152BB21154AE/BECore DMICore QPI LinkCore QPI RoutingCore ManagementCore ScratchCore ControlCore MiscPowerstorm 4D50TIntense 3DExpert3D5526 FibreChannelPRISM3PRISM2.5Prism IndigoPrism Javelin/XbowPrism GT/DuetteAEONGV-BCTV3AGX016ITT3204 MPEG DecoderIT8211FIT8212FIT8213FIT8330GIT8888F ISAIT8892E PCIE-PCIJMC250JMC260JMB360 SATAJMB361 IDE/SATAJMB362 SATAJMB363 IDE/SATAJMB365 IDE/SATAJMB366 IDE/SATAJMB368 IDExDKTIHSSIDS3SSIDS1HSSIcAppian LiteParallelDual ParallelS3 805Leadtek WinFast TV 2000Leadtek WinFast TV 2000 XPLXT1001EG1032EG1064PCMPC200PCM200PNICPNIC-II8031K56flex DSVD LTMODEMLTMODEMVenus ModemUSB 2-portUSB QuadraBusFW322 1394FW643 1394ET1310LS242 DVD DecoderPMAC 98715PMAC 98727MX86250Smart 16/4 PCI RingnodeSmart 16/4 PCI Ringnode Mk2Smart 16/4 PCI Ringnode Mk3Smart 16/4 PCI Ringnode Mk116/4 CardbusPresto PCISmart 100/16/4 PCI-HS RingnodeSmart 100/16/4 PCI Ringnode16/4 CardBus Mk2Collage 25 ATMCollage 155 ATMi740 PCILibertas 88W8300Libertas 88W8310Libertas 88W8335Yukon 88E8001/8003/8010Yukon 88E8021CUYukon 88E8022CUYukon 88E8061CUYukon 88E8062CUYukon 88E8021XYukon 88E8022XYukon 88E8061XYukon 88E8062XYukon 88E8035Yukon 88E8036Yukon 88E8038Yukon 88E8039Yukon 88E8040Yukon 88E8040TYukon 88EC033Yukon 88E8042Yukon 88E8048Yukon 88E8052Yukon 88E8050Yukon 88E8053Yukon 88E8055Yukon 88E8056Yukon 88E8070Yukon 88EC036Yukon 88EC032Yukon 88EC034Yukon 88EC042Yukon 88E8058Yukon 88E8071Yukon 88E8072Yukon 88E8075Yukon 88E8057Yukon 88E8059Yukon (Belkin F5D5005)88SX5040 SATA88SX5041 SATA88SX5080 SATA88SX5081 SATA88SX6040 SATA88SX6041 SATA88SX6042 SATA88SX6080 SATA88SX6081 SATA88SE6101 IDE88SE6111 SATA88SE6120 SATA88SE6121 SATA88SE6122 SATA88SE6140 SATA88SE6141 SATA88SE6145 SATA88SX7042 SATA88SE9120 SATA88SE9123 SATA88SE9125 SATA88SE9172 SATAMGA PX2085MGA Millenium 2064WMGA 1064SG 220MHzMGA Millennium II 2164WMGA Millennium II 2164WA-B AGPMGA G200 PCIMGA G200 AGPMGA G200eMGA G400/G450 AGPMGA G200eWMGA ImpressionMGA G100 PCIMGA G100 AGPMGA 1064SGMGA G400 Twin HeadMGA G550 AGPMGA P650 PCIeMGA G200eRMGA Millennium G200 SDMGA Produktiva G100 SDMGA Mystique G200 SDMGA Millennium G200 SGMGA Marvel G200 SDPCI32PCI509PCI511PEX511GPS170PCIConnectX ENKSZ8841 10/100KSZ8842 dual-port 10/100 switchRT3090MN-120 10/100MN-130 10/1002IVDC-PCX1MiroVIDEO DC20Media 3DMiroVIDEO DC10/DC20Powerstorm 4D30TGUI AccelSerial MCS9865MPC105 PCIMPC106 PCISM56Raven PCICP-114C104HCP-104ULCP-104JUC168HDMA4 serialDAC960P V2 RAIDDAC960P V3 RAIDDAC960P V4 RAIDDAC960P V5 RAIDAcceleRAIDeXtremeRAIDZ8EMyrinet LANai 9.2MTD800 10/100MTD803 10/100MTD891 10/100/1000MV1000CH352NCP130NCP130A2PCI-GPIBNET2282 USBNXB-10GXxRNXB-10GCX4NXB-4GCUIMEZ 10GbEHMEZ 10GbEIMEZ 10GbE MgmtHMEZ 10GbE MgmtNX3031DP83810 10/100PC87415 IDE87560 Legacy I/ODP83815 10/100DP83820 10/100/1000CS5535 HostCS5535 ISACS5535 IDECS5535 AUDIOCS5535 USBCS5535 VIDEOSaturnSCx200 ISASCx200 SMISCx200 IDESCx200 AUDIOSCx200 VIDEOSCx200 X-BUSSC1100 ISASC1100 SMISC1100 X-BusNS87410PowerVR PCX2I/OVersa MaestroVersa Va26D MaestroMagicgraph NM2070Magicgraph 128VMagicgraph 128ZVMagicgraph NM2160Magicgraph NM2200Magicgraph NM2360MagicMedia 256AV+MagicMedia 256XL+MagicMedia 256AVMagicMedia 256ZXXframeXframe IIMA301GA620GA620TNm9805Nm9820Nm9835Nm9845Nm9865Nm9901Nm9922CMI8338A AudioCMI8338B AudioCMI8738/C3DX AudioCMI8738B AudioHSP56 AMRCMI8788 HD AudioNSP2KNetVin 5000Universe VMETsi381 PCIE-PCIFalcon PFalcon SEF100253c81053c82053c82553c81553c810AP53c86053c1510D53c89653c89553c88553c87553c151053c895A53c1010-3353c1010-6653c103053c1030ZC53c103553c1035ZCSAS1064SAS1068SAS1064ESAS1068ESAS1066EMegaRAID SAS2208SAS1064ASAS1066SAS1078SAS2116SAS2308SAS2004SAS2008MegaRAID SAS2008SAS2108MegaRAID SAS2108 CRYPTO GEN2MegaRAID SAS2108 GEN2SAS1078DESAS220853c875JMegaRAID 320MegaRAID 320-2EMegaRAID SATA 4x/8xMegaRAID SAS 1064RMegaRAID Verde ZCRFC909FC909AFC929FC919FC929XFC919XFC949XFC939XFC949EYellowfin61C10263C81553c1030RPacket Engines G-NICPI7C21P100 PCIX-PCIXPI7C9X130 PCIE-PCIXFNW-3603-TX 10/100FNW-3800-TX 10/100NX82C501 PCINDR4600 PCIBS21 10/100E-mobility WirelessImagine-128Imagine-128 IIImagine-128 T2RImagine-128 T2R4NV1DAC64Riva TNTRiva TNT2Riva TNT2 UltraVantaMCP04 ISAMCP04 SMBusMCP04 IDEMCP04 SATAMCP04 LANMCP04 AC97MCP04 USBMCP04nForce4 ISAnForce4 SMBusnForce4 IDEnForce4 SATACK804 LANnForce4 AC97nForce4 USBnForce4nForce4 PCIEnForce4 DDRnForce2 ISAnForce2 SMBusnForce2 IDEnForce2 LANnForce2 USBnForce2 AC97nForce2 AudionForce2nForce2 FireWireMCP04 PCIEnForce2 400 ISAnForce2 400 SMBusnForce2 400 IDEnForce3 LANnForce2 400 USBnForce2 400 AC97nForce2 400nForce2 400 SATAGeForce 7800 GTXGeForce 7800 GTAladdin TNT2GeForce Go 6800GeForce Go 6800 UltraQuadro FX Go1400Quadro FX 1400nForce3 ISAnForce3 PCI HostnForce3CK804nForce3 SMBusnForce3 IDEnForce3 USBnForce3 ModemnForce3 AC97nForce3 250 ISAnForce3 250 PCI HostnForce3 250 AGPnForce3 250 SATAnForce3 250 SMBusnForce3 250 IDEnForce3 250 USBnForce3 250 AC97nForce3 250GeForce 6600 GT AGPGeForce 6600GeForce 7800 GSGeForce 6800 GTGeForce 5300 PCXQuadro FX 330GeForce256GeForce256 DDRQuadroGeForce2 MXGeForce2 MX 100GeForce2 GoQuadro2 MXRGeForce 6600 GTGeForce 6600 GoGeForce2 GTSGeForce2 TiGeForce2 UltraQuadro2 ProGeForce 6200Quadro NVS 285GeForce Go 6200GeForce4 MX 460GeForce4 MX 440GeForce4 MX 420GeForce4 440 GoGeForce4 420 GoGeForce4 420 Go 32MQuadro4 500XGLGeForce4 440 Go 64MQuadro4 200/400NVSQuadro4 550XGLQuadro4 GoGLGeForce4 MX 440 AGPGeForce4 MX 440SE AGPGeForce 4 MX 420 AGPGeForce4 MX 4000Quadro4 580 XGLQuadro4 NVSQuadro4 380 XGLGeForce 8800 GTXGeForce 8800 GTSGeForce2 Crush11nForce PCI HostnForce 220 DDRnForce 420 DDRnForce 220/420nForce APUnForce AC97nForce ISAnForce SMBusnForce AGPnForcenForce IDEnForce USBnForce LANGeForce 7300 LEGeForce 7200 GSGeForce 7300 GoGeForce 7400 GoGeForce 7300 GSnForce2 PCInForce2 AGPGeForce4 MX nForce GPUGeForce3GeForce3 Ti 200GeForce3 Ti 500Quadro DCCGeForce 6150GeForce 6150 LEGeForce 6100GeForce Go 6150GeForce Go 6100GeForce4 Ti 4600GeForce4 Ti 4400GeForce4 Ti 4200Quadro4 900 XGLQuadro4 750 XGLQuadro4 700 XGLMCP51 ISAMCP51 SMBusMCP51 IDEMCP51 SATAMCP51 LANMCP51 AC97MCP51 HD AudioMCP51 USBMCP51MCP51 HostMCP51 PMUMCP51 MemoryC51 MemoryGeForce4 Ti 4800GeForce4 Ti 4200 GoGeForce 7900 GT/GTOGeForce Go 7950 GTXQuadro FX 3500GeForce 7600 GTGeForce 7600 GSC51 HostC51 PCIEGeForce FX 5800 UltraGeForce FX 5800GeForce FX 5600 UltraGeForce FX 5600GeForce FX Go 5600GeForce FX Go 5650GeForce FX 5200 UltraGeForce FX 5200GeForce FX Go 5200GeForce FX 5500GeForce FX 5100Quadro FX 500/600GeForce FX Go 5300GeForce FX Go 5100GeForce FX 5900 UltraGeForce FX 5900GeForce FX 5950 UltraGeForce FX 5700LEGeForce FX Go 5700MCP55 ISAMCP55 SMBusMCP55 MemoryMCP55 USBMCP55 IDEMCP55MCP55 HD AudioMCP55 LANMCP55 PCIEMCP55 SATAGeForce 7300 GTGeForce 7600 GoC55 HostC55 MemoryC55 PCIEGeForce 6100 nForce 430GeForce 6100 nForce 405GeForce 7025 nForce 630aMCP61 ISAMCP61 HD AudioMCP61 LANMCP61 SATAMCP61 PCIEMCP61 MemoryMCP61 SMBusMCP61 IDEMCP61 USBMCP61MCP61 SMUGeForce 8600 GTGeForce 8600M GTQuadro FX 570MGeForce 8500 GTGeForce 8400 GSGeForce 8400M GSGeForce 8400M GMCP65 ISAMCP65 MemoryMCP65 SMBusMCP65 IDEMCP65 PCIMCP65 HD AudioMCP65 AHCIMCP65 LANMCP65 USBMCP65 PCIEMCP65 SATAGeForce GTX 285GeForce 7000MGeForce 7050 PVMCP67 MemoryMCP67 SMBusMCP67 Co-processorMCP67 ISAMCP67 LANMCP67 SATAMCP67 AHCIMCP67 RAIDMCP67 HD AudioMCP67 USBMCP67 IDEMCP67 PCIMCP67 PCIEMCP77 MemoryMCP77 PCIEMCP73 USBMCP73 IDEMCP73 PCIEnForce 200GeForce 9800 GTXGeForce 8800 GTGeForce 9800 GTGeForce 9600 GTGeForce 9300 GEGeForce 9300M GSQuadro NVS 150mQuadro NVS 160mMCP77 SMBusMCP77 Co-processorMCP77 IDEMCP77 PCIMCP77 ISAMCP77 LANMCP77 HD AudioMCP77 USBMCP73 HostMCP73 MemoryMCP73 ISAMCP73 SMBusMCP73 LANGeForce 7100GeForce 7050MCP73 SATAMCP73 AHCIMCP73 RAIDMCP73 HD AudioGeForce 8200m GGeForce 9100GeForce 8200nForce 780a SLIGeForce 9400GeForce 9400mGeForce 9300ION VGAGeForce 320MGeForce 210MCP79 HostMCP79 MemoryMCP79 PCIEMCP79 SMBusMCP79 Co-processorMCP79 USBMCP79 ISAMCP79 LANMCP79 SATAMCP79 AHCIMCP79 RAIDMCP79 HD AudioMCP77 SATAMCP77 AHCIMCP77 RAIDGF108 HD AudioGF116 HD AudioMCP89 HostMCP89 MemoryMCP89 PCIEMCP89 SMBusMCP89 Co-processorMCP89 LANMCP89 LPCMCP89 SATAMCP89 AHCIMCP89 RAIDMCP89 HD AudioMCP89 USBGeForce 425MGeForce GTX 550 TiOTI107OC2325OC2183OC232682C092G82C557 Host82C558 ISA82C568 IDE82D568 IDE82C621 IDE82C70082C70182C82282C8613G+ UMTS HSDPA010L100L110L200L210L400L800Lx10H100H200H400H/800H800H200HV2011HOX16PCI954OX16PCI954KExsys EX-41092OXCB950OXmPCI954OXmPCI954 DisabledExsys EX-41098OX16PCI954 ParallelOX16PCI952OX16PCI952 ParallelQStor SATAPMC/GNIC2ToolsRZ1000HSP MicroModem 56Virtio NetworkVirtio StorageVirtio MemoryVirtio ConsoleCMIC-LECNB20-LE HostCNB20HE HostCNB20LE HostCIOB30CMIC-HECMIC-WS HostCNB20-HE HostCMIC-GC HostGCNB-LE HostHT-1000 PCICIOB-X2 PCIXHT-1000 PCIXCIOB-EHT-2000 PCIXHT-2000 PCIEHT-2100 PCIEOSB4CSB5CSB6HT-1000OSB4 IDECSB5 IDECSB6 RAID/IDEHT-1000 IDECSB6 IDEOSB4/CSB5 USBCSB6 USBHT-1000 USBCSB5 LPCGCLE-2 HostHT-1000 LPCK2 SATAFrodo4 SATAFrodo8 SATAHT-1000 SATAHT-1100HT-1100 SATAVerite 1000Verite V2x00SH7757 PCIE-PCISH7757 PCIE SwitchT1/E1/J1Dual T1/E1/J1Quad T1/E1/J1ISP156x USBSAA7130 TVSAA7133 TVSAA7134 TVSAA7135 TVSAA7231 TVPS5000PT80C826PT86C521PT86C523PC87550PT86C523_2PCC-ISESPCI PC WDES1849I/O 1076I/O 1077PCI 6520PEX 8112PEX 8114PEX 8517PEX 8518PEX 8524PEX 8525PEX 8532PEX 8533PEX 8547PEX 8548PEX 8603PEX 8612PEX 8613PEX 8614PEX 8616PEX 8624PEX 8632PEX 8648I/O 9016I/O 9050I/O 9080Cronyx OmegaPDC20265PDC20263PDC20275PDC20318PDC20319PDC20371PDC20379PDC20378PDC20375PDC20376PDC20377PDC40719PDC40519PDC20771PDC20571PDC20579PDC40779PDC40718PDC40518PDC20775PDC20575PDC42819PDC20267PDC20246PDC20262PDC20268PDC20269PDC20276DC5030PDC20268RPDC20271PDC20617PDC20620PDC20621PDC20618PDC20619PDC20277ISP10160ISP1020ISP1022ISP1080ISP12160ISP1240ISP1280ISP2100ISP2200ISP2300ISP2312ISP2322ISP2422ISP2432ISP2512ISP2522ISP2532ISP4010 iSCSI TOEISP4022 iSCSI TOEISP4032 iSCSI TOEISP4010 iSCSI HBAISP4022 iSCSI HBAISP4032 iSCSI HBAISP5422ISP5432ISP6312ISP6322ISP8432PWDOG185008580RT2460ART2560RT2561SRT2561RT2661RT2760RT2790RT3062RT3091RT3092RT3562RT3592RT3593RT5390R1010 IDER1011 IDER6021 HostR6031 ISAR6040 EthernetR6060 USBR6061 USBRTS5209 Card Reader80298139D81298101E81388169SC816881698192SE818081858188CERTL8192CE8187SE5C465 CardBus5C466 CardBus5C475 CardBus5C476 CardBus5C477 CardBus5C478 CardBus5C521 Firewire5C551 Firewire5C552 Firewire5C592 Memory Stick5C822 SD/MMC5C832 Firewire5C843 MMC5C852 xD5U230 Memory Stick5U822 SD/MMC5U823 SD/MMC5U832 Firewire5U852 SD/MMCRS56/SP-PCI11P1 ModemViRGETrio32Trio32/64Aurora64V+Trio64UV+868ViRGE VX86C92886C864-086C864-186C864-286C864-386C964-086C964-186C964-286C964-386C968-086C968-186C968-286C968-3Trio64V2/DXPlatoTrio3D AGPViRGE DX/GXViRGE GX2Trio3 DX2Savage 3DSavage 3DMSavage 4ProSavage PM133ProSavage KM133ViRGE MXViRGE MXPSavage/MX-MVSavage/MXSavage/IX-MVSavage/IXSuperSavage MX/128SuperSavage MX/64SuperSavage MX/64CSuperSavage IX/128 SDRSuperSavage IX/128 DDRSuperSavage IX/64 SDRSuperSavage IX/64 DDRSuperSavage IX/C SDRSuperSavage IX/C DDRTwisterTwister-KProSavage DDRProSavage DDR-KSonicVibesSafeXcelMagicLAN SWL-2210PA10xNeo-4Neo-8SK-98xxSK-98xx v2.0SK-9D21SK-9SxxSK-9821SK-9843SK-9ExxSK-9E21MBladeEngine2 10GbEBladeEngine3 10GbEIOC3Rad1TigonIOC4ImageSync 1STG 2000XSTG 1764Kyro-IISTG 1764X64GXDVDmagic-PROSC9230186C201 AGP86C202 AGP648FX AGP86C20585C503 System5595 System85C503 ISA180 SATA181 SATA182 SATA183 SATA1901915597/5598 VGA6215300/305/630 VGA315 Pro VGA85C50185C49685C596530 PCI540 PCI550 PCI85C601 EIDE620 PCI630 PCI633 PCI635 PCI640 PCI645 PCI646 PCI648 PCI649 PCI650 PCI651 PCI652 PCI655 PCI656 PCI658 PCI661 PCI662 PCI671 PCI730 PCI733 PCI735 PCI740 PCI741 PCI745 PCI746 PCI748 PCI750 PCI751 PCI752 PCI755 PCI756 PCI760 PCI900 10/100BaseTX961 ISA962 ISA963 ISA964 ISA965 ISA966 ISA968 ISA1182 SATA1183 SATA1184 RAID1185 AHCI540 VGA530 VGA551155125513 EIDE5518 EIDE5571 PCI558155825591 PCI55965597/5598 Host6204650 VGA6326 VGA6330 VGA5597/5598 USB7002 USB7007 FireWire7012 AC977013 Modem7016 10/100BaseTX7018 Audio7019 Audio7300 VGA966 HD Audio83C17083C175FDC 37C665FDC 37C922Voyager GXLynxEMLynxEM+Lynx3DMLynxELynxE+Lynx3D910Victory66 IDEVictory66 ISAVictory66 USBVictory66 PowerPirahna 2-portTulip, power, switch extenderFPGA I-Bus Tracer for MBDSZB6120CXD1947A FireWireCXD3222 FireWireMemory Stick SlotRS780EasyIOVelocity128PCIO EBus2HMERIO EBusERI EtherGEMSimbaCrypto 5821Crypto 1KCrypto 6KPsycho PCImicroSPARC IIep PCIUltraSPARC IIi PCIUltraSPARC IIe PCICassiniNeptuneSBBCST201ST1023ST202140XX4018A50XXNE-344S2P4SSpectrum24 LA41X382C10182C10382C10582C565 ISAMC322TC9021 GigEB2C2 Sky2PCTN3009TN3010TN3014DC-290(M)DC-690CDC-3x5UTerratec TV+Terratec TValueTerratec TValue RadioTLAN3DLabs Permedia3DLabs Permedia 2TSB12LV21 FireWireTSB12LV22 FireWirePCI4450 FireWirePCI4410 FireWireTSB12LV23 FireWireTSB12LV26 FireWireTSB43AA22 FireWireTSB43AB22 FireWireTSB43AB23 FireWireTSB82AA2 FireWireTSB43AB21 FireWirePCI4451 FireWirePCI4510 FireWirePCI4520 FireWirePCI7(4-6)10 FireWirePCI7x20 FireWirePCI7XX1 CardBusPCI7XX1 FireWirePCI7XX1 FlashPCI7XX1 SDPCI7XX1 Smart CardPCI6515 CardBusPCIXX12 CardBusPCIXX12 FireWirePCIXX12 Multimedia Card ReaderPCIXX12 SDPCIXX12 Smart CardPCI1620 MiscXIO2000A PCIE-PCIXIO3130 PCIE-PCIE upstreamXIO3130 PCIE-PCIE downstreamXIO2221 PCIE-PCIXIO2221 FireWireACX100AACX100BACX111PCI1130 CardBusPCI1031 PCMCIAPCI1131 CardBusPCI1250 CardBusPCI1220 CardBusPCI1221 CardBusPCI1210 CardBusPCI1450 CardBusPCI1225 CardBusPCI1251 CardBusPCI1211 CardBusPCI1251B CardBusPCI2030PCI2031PCI2032PCI2250PCI2050PCI4450 CardBusPCI4410 CardBusPCI4451 CardBusPCI4510 CardBusPCI4520 CardBusPCI7510 CardBusPCI7610 CardBusPCI7410 CardBusPCI7[46]10 CardBusPCI1410 CardBusPCI1420 CardBusPCI1451 CardBusPCI1421 CardBusPCI1620 CardBusPCI1520 CardBusPCI1510 CardBusPCI1530 CardBusPCI1515 CardBusPCI2040 DSPPCI7420 CardBus5634PCV SurfRiderR4x00TC35856F ATMR4x00 PCIToPIC95 CardBus-PCIToPIC95B CardBusToPIC97 CardBusToPIC100 CardBusFast Infrared Type OLongRun NorthbridgeMem1Mem24DWAVE DX4DWAVE NXCyberBlade i7CyberBlade i7 AGPCyberBlade i1CyberBlade i1 AGPCyberBlade Ai1CyberBlade Ai1 AGPCyberBlade XP/Ai1TGUI 9320TGUI 9350TGUI 9360TGUI 9388CYBER 9397CYBER 9397DVDTGUI 9420TGUI 9440CYBER 9525TGUI 9660TGUI 9680TGUI 96823DImage 97503DImage 9850Blade 3DCyberBlade XPCyberBlade XP2HPT343/345 IDEHPT36x/37x IDEHPT372A IDEHPT302 IDEHPT371 IDEHPT374 IDEPyramid3D TR25202ET4000w32pAET4000w32pBET4000w32pCET4000w32pDET6000/ET6100ET6300IGA-1680IGA-1682IGA-1683CyberPro 2000CyberPro 2010CyberPro 5000CyberPro 5050CyberPro 5202CyberPro 5252Santa CruzUM82C881 486UM82C886 ISAUM8673F EIDEUM8881 HB4 486 PCIUM82C891UM886AUM8886BFUM8710UM8886UM8881F HostUM8886F ISAUM8886AUM8891AUM9017FUM8886NUM8891NUS201USR9979023CP5610V961PBC i960 PCIV292PBC AMD290x0 PCIV960PBC i960 PCIV96DPC i960 PCIK8M800 HostK8T890 HostPT880 HostPM800 AGPKT880 AGPK8HTB HostVT8363 HostPT894 HostCN700 HostCX700 HostP4M890 HostK8M890 HostVT3351 HostVX800 HostP4M900 HostVT8371 HostVT6415 IDEVT8501VT82C505VT82C561VT82C571 IDEVT82C576 3VVX700 IDEVT82C585 ISAVT82C586 ISAVT8237A SATAVT82C595 PCIVT82C596A ISAVT82C597 PCIVT82C598 PCIVT8601 PCIVT8605 PCIVT82C686 ISAVT82C691 PCIVT82C693 PCIVT86C926 AmazonVT82C570M PCIVT82C570M ISAChrome9 HC3 IGPPM800 ErrorsKT880 HostVT82C416 IDEVT82C1595 PCIPM800 HostVT8251 PCIVT8251 PCIEVT8251 VLINKVT83C572 USBVT82C586 PowerRhine/RhineIIVT6306 FireWireVT82C596 PowerVT82C596B PMVT6105M RhineIIIVT82C686 SMBusVT82C686 AC97VT8233 AC97RhineII-2VT82C686 ModemVT8233 ISAVT8633 PCIVT8366 PCIVT8653 PCIVT6202 USBVT6105 RhineIIIS3 Unichrome PRO IGPVT8361 PCIVT8101 VPX-64VT8375 PCIPM800 Unichrome S3VT612xCLE266VT8623 PCIVT8233A ISAVT8751 PCIVT6420 SATAS3 UniChrome Pro II IGPVT6410 IDEP4X400 HostVT8235 ISAP4N333 HostVT8377 PCIVT8378 PCIPT890 HostK8T800M HostVT8237 ISADeltaChrome VideoVT6421 SATACX700VX700 HostVT6655PM800 DRAMVT8251 ISAVT8237A ISAVT8251 SATAVX800 DRAMChrome9 HC IGPVT8237S ISAVT8237APM800 PMCK8T890 IOAPICPT894 IOAPICCX700 IDEP4M890 IOAPICK8M890 IOAPICVT3351 IOAPICVX800 IOAPICP4M900 IOAPICVT8237S SATAVT8251 AHCIP4M890 SecurityP4M900 SecurityVT8378 VGAPM800 PCIVT8231 ISAVT8231 PMGVT8363 AGPCX700 ISAVX800 ISAVT8371VX855 ISAVT8501 AGPVT82C597 AGPVT82C598 AGPVT82C601 AGPVT8605 AGPVX900 IDEVX800 SD/MMCVX800 SDIOK8T890P4M890P4M900VT8633 AGPVT8366 AGPVT8361 AGPVT8101 VPX-64 IOAPICVT8363VT8235 AGPK8HTB AGPVT8377 AGPVX800VX800 PCIEVX855 IDEVSC-7174 SATAGDT6000/6020/6050GDT6000B/6010GDT6110/6510GDT6120/6520GDT6530GDT6550GDT6x17GDT6x27GDT6537GDT6557GDT6x15GDT6x25GDT6535GDT6555GDT6x17RPGDT6x27RPGDT6537RPGDT6557RPGDT6x11RPGDT6x21RPGDT6x17RP1GDT6x27RP1GDT6537RP1GDT6557RP1GDT6x11RP1GDT6x21RP1GDT6x18RDGDT6x28RDGDT6x38RDGDT6x58RDGDT6x17RP2GDT6x27RP2GDT6537RP2GDT6557RP2GDT6x11RP2GDT6x21RP2GDT6513RSGDT6523RSGDT6518RSGDT6x28RSGDT6x38RSGDT6x58RSGDT6x33RSGDT6x43RSGDT6x53RSGDT6x63RSGDT7x13RNGDT7x23RNGDT7x18RNGDT7x28RNGDT7x38RNGDT7x58RNGDT7x43RNGDT7x53RNGDT7x63RNGDT4x13RZGDT4x23RZGDT8x13RZGDT8x23RZGDT8x33RZGDT8x43RZGDT8x53RZGDT8x63RZGDT6x19RDGDT6x29RDGDT7x19RNGDT7x29RNGDT8x22RZICP82C592 CPU82C593 ISA82C594 Wildcat82C596/597 Wildcat ISA82C54182C54382C53282C53482C53582C14782C97582C925Virtual SVGA IIVirtual SVGAVirtual NICVirtual Machine InterfaceVirtual EHCIVirtual UHCIVirtualVirtual PCIE-PCIEVirtual VMXNET3Virtual PVSCSIP9000P9100WD33C193AWD33C196AWD33C197AWD7193WD7197WD33C296AWD34C296WD9610W83769FW89C840F 10/100Linksys EtherPCI IIW83C553F ISAW83C553FW89C940FW6692 ISDNLinksys EtherPCICF32APlatform DeviceVolari Z7Volari Z9s/Z9mVolari V3XTX3201-3CardBus EthernetMini-PCI V.90 56k ModemMini-PCI K56Flex ModemCardBus 56k ModemCBEM56G Modem724734738737740740C724F7441221PCI-ST32Genie TV/FMDVDZD1201ZD1202ZD1205D-LinkMartin-MariettaHauppaugeTTTechDynalinkCoregaRhino EquipmentCompaqSymbios LogicATIULSI SystemsVLSIAvance LogicNSTseng LabsWeitekDECCirrus LogicWestern DigitalAMIAMDTridentAcerDellSiemens Nixdorf AGMatroxChips and TechnologiesToshibaMiro Computer Products AGNECFuture DomainSiSHewlett-PackardPC TechnologyAsustekDPTOptiElsaSGS ThomsonBusLogicTISonyOak TechnologyWinbondHitachiSMSCMotorolaPromiseFoxconnNumber 9UMCITTPicopowerMylexAppleMitacYamahaNexGen MicrosystemsQLogicCyrixLeadTekInterphaseContaq MicrosystemsBit3OlicomSunIntergraphDiamond MultimediaNational InstrumentsCMD TechnologyQuantum DesignsBrooktreeSGIACC MicroelectronicsSymphony LabsSTB SystemsPLXMadge Networks3ComSMCAcer LabsMitsubishi ElectronicsSurecomNeomagicMentor ARCAdvansysFujitsuMolexMacronixEvans & SutherlandNVIDIAEmulexIntegrated Micro SolutionsTekram (1st ID)NewbridgeApplied Micro CircuitsTviaRealtekNKKIO Data DeviceInitioCreative LabsHighPointSigma DesignsVIACogent DataSiemensZnyx NetworksAcctonAtmelVortexEfficent NetworksIDTFORE SystemsPhilipsCiscoZiatechCycloneEquinoxAllianceSchneider & KochDigiMutechXircomRenditionServerWorksAlteraRicohCorollaryAcardZeinetOmega MicroMarvellLite-OnV3 SemiconductorPinnacle SystemsAT&T/LucentDolphinMesa Ridge (MAGMA)Analog DevicesZoranPijnenburgCompexCycladesEssential CommunicationsO2 Micro3DFXATMLC-CubeAVMStallionASIXIntersilNortel NetworksSilicon MotionEnsoniqTransmetaRockwellDavicomITExpressPlatformLuxSonorTriTechAlteonUS RoboticsNVIDIA/SGS-ThomsonPericomAurealADMtekPacket EnginesForte MediaSIIGDTC TechPCTELMeinberg FunkuhrenCNetSilicomLAN MediaNetgearMoxaLevel 1HifnExar3wareTechsan ElectronicsAbocomSundanceC-Media ElectronicsLavaSunixIC EnsembleMicrosoftOxfordChelsioEdimaxTamarackWorkbitAskeyAvermediaMSIAironetGlobespanMyricomVScomAvlabInvertexBroadcomPlanexConexantDeltaMyson CenturyTopic/SmartLinkENEAralionTerraTecSymbolSybaBluesteelVMwareZoltrixMellanoxAgilentQuicknet TechnologiesNational DatacommPacific DataEumitcomNetSecZyDASSamsungAtherosGlobal SunSafeNetMicrelVitesseLinksysNetoctaveAltimaAntares MicrosystemsCaviumBelkinHawking TechnologyNetChip TechnologyI4ArecaNeterionRDCINPROCOMMLanergyRalinkXGI TechnologySilanRenesasSangomaSolarflareOptionFreescaleAttansic TechnologyAgeiaJMicronPhisonServerEnginesASPEED TechnologyAWTFusion-ioQumranetASMediaEtronFresco LogicTekramTehuti NetworksHint3D LabsAddtronNetXenNanjing QinHeng ElectronicsIndustrial Computer SourceNetVinGemtekTurtle BeachMosChipXenSourcec't MagazinDecision ComputerQuancom InformationssystemeIntelInnoTekSigmatelAdaptecAtronicsNetMosParallelsTigerJet NetworkEndaceBelkin ComponentsARC LogicINVALID VENDOR IDcy82c693_writecy82c693_readcy82c693_initcy82c693_init: bus_space_map failed (%d): broken match/attach! : unable to map device registers : couldn't map interrupt : couldn't establish interrupt: invalid memory type %d , using %luK of on-board RAM, can't map on-board RAM: can't subregion offset %lu size %luchannel 0channel 1configuredwirednative-PCIcompatibility, %s %s to %s%s: %s disabled (no drives) %s:%d:%d: bus-master DMA error: status=0x%x %s:%d:%d: bus-master DMA error: missing interrupt, status=0x%x %s:%d: unable to load xfer DMA map for drive %d, error=%d %s:%d: unable to allocate table DMA for drive %d, error=%d %s:%d: unable to map table DMA fordrive %d, error=%d %s:%d: unable to create table DMA map for drive %d, error=%d %s:%d: unable to load table DMA map for drive %d, error=%d %s:%d: unable to create xfer DMA map for drive %d, error=%d %s: couldn't map %s cmd regs %s: couldn't map %s ctl regs %s:%d: bogus intr %s:%d: bogus intr (reg 0x%x) %s: couldn't subregion %s cmd base %s: couldn't subregion %s ctl base %s: couldn't subregion %s channel cmd regs %s: port %d: device connected, but communication not established %s: port %d: PHY offline %s: port %d: device present, speed: 1.5Gb/s, speed: 3.0Gb/s%s: port %d: unknown SStatus: 0x%08x %s %s channel: cannot allocate channel queue%s: %s cannot allocate channel queue: unable to map BA5 register space : DMA%s: couldn't map native-PCI interrupt unknown interrupt%s: using %s for native-PCI interrupt %s: couldn't establish native-PCI interrupt: couldn't establish native-PCI interrupt: couldn't map bus-master DMA registers : couldn't map IDE registers : DMA %s: channel %d: cannot allocate channel queue %s: couldn't map channel %d ctl regs %s: couldn't map channel %d cmd regs %s channel %d: can't subregion DMA registers %s: no known timing values unknown SiS IDE type %d %s:%d:%d: multi-word DMA disabled due to chip revision %s: no compatibility interrupt for use by %s %s: unable to subregion %s ctl regs %s %s: cannot allocate channel queue%s: %s %s to %s mode %s: %s ignored (disabled) : no DMA, unused (couldn't query registers), unused (registers at unsafe address %#lx), unused (couldn't map registers), (unsupported maptype 0x%x)%s: unexpected PCI function %d : 5597/5598: unexpected PCI function %d , (unable to map ctl registers): cannot allocate channel queue , %s %s to native-PCI compatibility %s: bus-master DMA support present: ATA133: ATA33: ATA66: ATA100 (unsupported), (partial support)not responding; disabled or no drives?other hardware responding at addresses%s: %s ignored (%s) %s:%d:%d: cannot allocate DMA maps, using PIO transfers %s:%d:%d: using DMA data transfers %s: restore for unknown chip map %x unmap not yet implemented for this chipsetpciide540620630630S633635645645DX651652655658661733735741745746748750760962963964966968port 0port 1port 2port 3: can't map mem or i/o space em_rxeof: NULL mbuf in slot %d (nrx %d, filled %d)%s: em_dma_malloc: bus_dmamap_create failed; error %u %s: em_dma_malloc: bus_dmammem_alloc failed; size %lu, error %d %s: em_dma_malloc: bus_dmammem_map failed; size %lu, error %d %s: em_dma_malloc: bus_dmamap_load failed; error %u %s: Unable to allocate rx_buffer memory %s: em_allocate_receive_structures: bus_dmamap_create failed; error %u %s: Unable to allocate tx_buffer memory %s: Unable to create TX DMA map %s: em_get_buf: slot %d already has an mbuf %s: unable to fill any rx descriptors %s: The EEPROM Checksum Is Not Valid %s: EEPROM read error while reading part number %s: Hardware Initialization Failed: mmba is not mem space : cannot find mem space : cannot find i/o space : flash is not mem space %s: Unknown MAC Type %s: Unable to initialize the hardware %s: Could not setup transmit structures %s: Could not setup receive structures %s: Unsupported media type %s: watchdog timeout -- resetting %s: Media change is blocked due to SOL/IDER session. %s: Unable to allocate tx_desc memory %s: Unable to allocate rx_desc memory %s: EEPROM read error while reading mac address %s: Invalid mac address %s: PHY reset is blocked due to SOL/IDER session. %s: No GCU found, defered attachment failed Could not write PHY the HV address register Could not read data value from HV data register %s: phy read timeout: phy %d, reg %d %s: unable to read phy %d reg %d gcu0%s: init failed, error=%d : can't map i/o space : can't map mem space %s: timed out waiting for BIOS %s: pre-2.0 USB rev : can't map interrupt : can't establish interruptpciide_machdep_compat_intr_disestablish calledpciide_machdep_compat_intr_establish called$rd'(3  ?? [@? ???$?,?4?\A8?H?T?\?d?l?t????  5&*+'(),-%#JMLNH IG `CtC CCHVk\Vk CCpVkVk CC DwkXwk CCpwkwk CCwkwk CCwkwk CCwkwk CCwkxk CCxk0xk CCTxkhxk CCxkxk CC ykyk CC ykyk CC zkC CC zkzk CCX{kD{kCC~k~kC C>,k CC$>Xk CClkXk CCH>k CC%|>k CC>k CC>k CC7 >Lk CC7D>`k CC7X>tk CC,>k CCh>ԁk CCP>k CCl>k CC>k CCh>0k CC>Dk CC>Xk CC8>tk CCL>k CC>k CC>k CC>$k CCL>Xk CCt>k CC>k CC>k CC,>(k CC>C CC>k CC>\k CCpkk CC9kk CC9kԇk CC9kk CC9k$k CC98kLk CC9`ktk CC9kk CC9kĈk CC9؈kk CC9kk CC9(kh2"u-$-kE}Qt!TzKb3,|#8]J-sUuȡy2 LWMu Ja+$e9EXHroBc/'BM*G z&e+__m_w$ KY[MQz_zQLwT%QHj}7M֪:rge)ta)k݀M+ ZҭPt"iie'"p/ H]uh5ag1a :OPK8@[H M zVW~V|dE<Ufr&DCV=Mi8ѧ`4v)cQ8>P`6fYi& X21Jx@$D:Q% 6S8DYN T;х/ YDqNX`|LIyt @ 1/U"fE8Qcda=Wfr9'c ... export VNAME=$(sysctl -n kern.osrelease) export VERSION="${VNAME%.*}${VNAME#*.}" export ARCH=$(sysctl -n hw.machine) export OBSD="OpenBSD/$ARCH $VNAME" export PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ umask 022 set -o emacs set -- $(dmesg | sed -n '/^root on /h;${g;p;}') rootdisk=$3 if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES mount -u /dev/${rootdisk:-rd0a} / echo ! : > /etc/rc echo 'erase ^?, werase ^W, kill ^U, intr ^C, status ^T' stty newcrt werase ^W intr ^C kill ^U erase ^? status ^T cat <<__EOT Welcome to the $OBSD installation program. __EOT while :; do read REPLY?'(I)nstall, (U)pgrade or (S)hell? ' case $REPLY in i*|I*) /install && break ;; u*|U*) /upgrade && break ;; s*|S*) break ;; !) echo "Type 'exit' to return to install." ksh ;; !*) eval "${REPLY#?}" ;; esac done fi  . ..@ bin dev etcA mntmnt27&sbin7&բ tmpB usrvarinstbin.profile2 install.mdupgradeinstall  install.sub md_installboot() { } md_prep_fdisk() { local _disk=$1 _q _d while :; do _d=whole if [[ -n $(fdisk $_disk | grep 'Signature: 0xAA55') ]]; then fdisk $_disk if [[ -n $(fdisk $_disk | grep '^..: A6 ') ]]; then _q=", use the (O)penBSD area," _d=OpenBSD fi else echo "MBR has invalid signature; not showing it." fi ask "Use (W)hole disk$_q or (E)dit the MBR?" "$_d" case $resp in w*|W*) echo -n "Setting OpenBSD MBR partition to whole $_disk..." fdisk -e ${_disk} <<__EOT >/dev/null reinit update write quit __EOT echo "done." return ;; e*|E*) cat <<__EOT You will now create a single MBR partition to contain your OpenBSD data. This partition must have an id of 'A6'; must *NOT* overlap other partitions; and must be marked as the only active partition. Inside the fdisk command, the 'manual' command describes all the fdisk commands in detail. $(fdisk ${_disk}) __EOT fdisk -e ${_disk} [[ -n $(fdisk $_disk | grep ' A6 ') ]] && return echo No OpenBSD partition in MBR, try again. ;; o*|O*) return ;; esac done } md_prep_disklabel() { local _disk=$1 _f _op md_prep_fdisk $_disk _f=/tmp/fstab.$_disk if [[ $_disk == $ROOTDISK ]]; then while :; do echo "The auto-allocated layout for $_disk is:" disklabel -h -A $_disk | egrep "^# |^ [a-p]:" ask "Use (A)uto layout, (E)dit auto layout, or create (C)ustom layout?" a case $resp in a*|A*) _op=-w ; AUTOROOT=y ;; e*|E*) _op=-E ;; c*|C*) break ;; *) continue ;; esac disklabel $FSTABFLAG $_f $_op -A $_disk return done fi cat <<__EOT You will now create an OpenBSD disklabel inside the OpenBSD MBR partition. The disklabel defines how OpenBSD splits up the MBR partition into OpenBSD partitions in which filesystems and swap space are created. You must provide each filesystem's mountpoint in this program. The offsets used in the disklabel are ABSOLUTE, i.e. relative to the start of the disk, NOT the start of the OpenBSD MBR partition. __EOT disklabel $FSTABFLAG $_f -E $_disk } md_congrats() { } md_consoleinfo() { } #!/bin/ksh MODE=upgrade . install.sub while :; do ask "Root filesystem?" $ROOTDEV resp=${resp##*/} [[ -b /dev/$resp ]] && break echo "$resp is not a block device." done ROOTDEV=$resp echo -n "Checking root filesystem (fsck -fp /dev/$ROOTDEV)..." fsck -fp /dev/$ROOTDEV >/dev/null 2>&1 || { echo "FAILED." ; exit ; } echo "OK." echo -n "Mounting root filesystem (mount -o ro /dev/$ROOTDEV /mnt)..." mount -o ro /dev/$ROOTDEV /mnt || { echo "FAILED." ; exit ; } echo "OK." for _f in fstab hosts myname; do [[ -f /mnt/etc/$_f ]] || { echo "No /mnt/etc/$_f!" ; exit ; } cp /mnt/etc/$_f /tmp/$_f done hostname $(stripcom /tmp/myname) THESETS="$THESETS site$VERSION-$(hostname -s).tgz" enable_network startftplist munge_fstab check_fs umount /mnt || { echo "Can't umount $ROOTDEV!" ; exit ; } mount_fs install_sets finish_up ELFa(4"4 (|M|M||Q|Q88]TTTۣe$$OpenBSD -LP@0! MP@ -0L@ 0pS`0& 0 /R0 R S000  P P00<Q  A P 00  00P 2 h0-L` 0 R   1S0B@Ct1P @D0t0$<0< 0 R-L @ R0  0S002 -x@x @0LS ``00T0H 0S 800S$0h 2  p-L 0P `P dp~P E@POU8  (4oPP t>@t4 -PLU`p 0S /t0PPQ @Q EP P0 5i4@ Pp-L@P`D ph0,0d -"L<MȂ0r"`8K01P@H =DP  P0Sl Fv`Ÿ X08@ T P4  0` $8 000P  10S000 B B1 0S0 S v10S 1!0!0S !l 7000@1@1@0,10S0(!1 P R `@T00SRT!0L$0S 0S  0L$0S 0Sl 1u(K, (dP?̎ d0`| -LM K `}p@Pqx1 pw 0SM bR KR MR(mR wR kR!$+%$+*$&U'T$0@P 0 !$/UT0 0 @P 0xS S *Sd1#pUT D0"@  048u 0 3u@P Ƞ̧ -L0 $, -L0 $d 0-LMK P]p@1 iw 0S7 bR KR MR mR wR kR$%*T0@0 !P00 @0xS S *S T <0"@ 0,t0 t@8 Ƞ̧ -0L00(d -0L00(, -L0l -L P00 -Lx0 -Lp 00d, -LM$`K✠p圀& @PBP @Q` 0 D ^t 0R00 (0SP(8lB0 R0 ,d -L K 0C8t 4 D , y|P20-S) `P00QD @ Q? P 0V0S D 0 YppV 0`pY" 0 0 p 0oSP00 ,K`, ?R0S@p @ `o0 p000"S 0(o$P 0 0o8lī -LM`PP( @(K,pK 0 g(0@S 03$Kq -0L $@ -LMP@`0pvT U@ 0S T  0((藡4@ p-LP@Q`P P@Wqp P@o@ -2L`M2\Ÿ\[\ @ll2` op 0-t0L0PS Q @Q  ;P,0 r300 R00p -0LS0 R3 ZP"p`0@S 0  tP "10c0\/ i9p Xo 1"0co0 Rop -LMp K`P @PUO :PP -LtM`P$p/ P0@$S$xhX8P#pD3D#Q 43 R(K ᠞P A0pS h3P( PKp Py0: S Se ! 10bP(AnPkt2 Rk (`1 i tPE pPWn v(`@P:PXUO Xi1 R]  w361 R\1]1 Y1 U1 1NX1 Jh1 X1C41 ?( < t 屋"10c(0VPPk(`啋0 RX 0 RT 劋P w3(` `Okm px<mܭp`8\<  -|BLM0 j 0`PP\%D2R  0`P $K\% 2R004 쑟 000\%1RM = 0@8P3o , ( F,,@K0d @P,@ (P @P<@md@d_ .,@K00A`Vp0@0S@0 @, 0C@$0(@,0 @\@`@0[PZ 0Z t )(d  80&`p<(@dlA_@TP0  R0 0, 0C@$0(@/,0 TT[| -pMLK 0@0P#41RL0S `f`0R30 @0@c5p(50E`5` @b@cP @P   0@Q  0@$0(@0 \0`0,0 @PZ B Z > t c)S[ -PL8P@@ẰP O7`P @8P |~8Ply8pP \t8PDo8P < 0$蠮| -L 0m^ @ -LM@`CV$ P$pKVh P 0S -SD01!@!=!8P0@0@V@8l p-LMPP` 0S@j-x\8@Y8@@3P ( 0 @`7V-x k똯 0-\ P0LS@ 0S  0S 0S00x p-`PL& 0S# nS$ 0 @@,7P00PP@`00@,7Pp48i0oS0 ` kt 0-t0L0PS Q @Q  7P,0 r300 R00t -0PLMP` nPp$ ` @$K7 78`p`3$@0&T00S,8l -LM` KopP 0PG7P? U @>7PP@ -L0M`0@XpP,0 0St 00 0DSH  `T 7 R P R   0S`7V 00@T0WS6P1|' x7``W@ TLŧPD7Q$`8' V嶧! 6`V'嫧!@ 6`V&堧! 6`V&啧! `l6Vhh&劧0S!! R 46`V,T0L&z0S!! R 5`V0&j0S!! R 5`V0%Z0S!! R t5`Vl0%J0S!! R 45`V,T0\%:0S!!R 4`V0 %*0S11S TD`V$0S `V1$! !!4V, 0R(K0SJ 3`VX$!@\P% `V )0D$4` 3V0Ӧ0`SS l0F@KLKL0 0.0KĦ@5P 5P[ 5Pz0St"Rh 2`V\ßX0P#P裦0S"\ 2`V(0 #喦 2 t2`Vll"勦 2 H2`V@@"倦 2 2`V"u 2n `1V"jeN_Z 5PZ X_VPKLKZ`1PPV|A@t20"PLG\T"G`L^"1R"T5P!2 0`V!*2 0`Vt!2 `0VT!@-5P 0S 1 `D0V@ !8\x ܯ  (0<DL\h|t[TaЯȰḬ̇0`@ذ*H P -L)MMğ~KpG`pG , P@P #T@U `4P^ Qe@-PP K@A@ A <0d Sd: D3qd A R (wd:S@pd:@S }))Ÿ, 0R(KCrp@r PeNK@Db@DO0"3@c`0S l mf0SU0Sx d8P$,`&NKhPaw_KZ 4P {K 4P1 R( @JoKZ 4PW{?K w)u)KA P<h:#4(1 R0SQP@D fX)V)yftP q 奅k&NKhPae\ e|xeRhg`岤[(:Pht@(P`Ƞ4h}* -AMLM6 `Pp, &pJ A0@6S6P<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<H<<8<<<<<<<<<<<hX@ P<p%ᲂp5 `bA0V84 Vm VZ @ 'H`P PD@3P $;3PP PP (0JP@4 sPnpi4 RD.`t4 \HPW4pR84 RM pIrPDp?3 ;963 R `84@ 0@@Z00S wjP; `3 RZBKHHP (:PI ]P@0 0  2P -P 0DPt0 0 04 2 0@PP B.K B BxP@4Pzp_ >BK@@㒖`Pa Vf GPP7 @c2P \2P W2P 84 c`wP⨑n1P`hft?2P@T@h@X`Px DfFPP84FPP84 ccFPP0D{0S e84 c P@ PUO 0t`P 0pe|P,ȱt`8T`Hбı0hܱh} -L. 0@ -GMLp1M ha d!@0P$4 @!p oP: !p 0bSQ`A~K pG0pG4 ܩP- $$004 4 =K 0C0C LoPP -P P| z0$\cA.KP0 B BD{ ,Ted8H|L`8| -LM@pP4 PP 0S nS6 =81`P00QD @ Q? P 0V0S D 0 YppV 0`pY" 0 0 p 0oSP00 ,KG, ?R0S@p @ `b0 p000"S 0(qb$P 0 0ib8lī -LM`PP( @(K,pK 0 g(0@S &$Kd -@0L R  (0( 0@Ĵܴ -Lp' 000p3 P@@0PP``0 p kP` sPP aP`  pt0 RU ` Po 808w,.[$X -Ll@-0 S R@4 00 ӑR^ ^R-0S \ Q-0L Q* a a4H -LMp@` $KԁP0S 0S $0 UR#U 0saX -0L $@d -MLMp0,0 /#pI B0@3S3l<|X(xT$ > >~> > .~p. 0b0CS/[>KQ0C 0C /p g>K0C 0C6 dP$ϟ@T |6: S-  S lK`F `F؝@ /pW@P  @/P @TDP ``= t=%p=^<= X=T= L= R =.4=0=I<\.=@<8.$><7<,2<.<<)h< << < 8< <|< l< < \*@9*6&C#00R* FP Q F 6 S6 6S<6 A*6 S<^:;A*P  0&"1. ``  cc  &  &6 R R &A)60#r0P`6 1 H$0@T ^ P *&R 6pp 1H$P`P`V  m;^3 R|0Sd3 R  )P3T@1t K@@ĕ|V崐P | ,P p *p R00Y0S 0rS Z ``? V5  U@ ,P0@X S a,P \,P 0] Q  Xw^ \ P Q U e/P 00B0R SO 00B0R SQRE  00B SQ? `RApR?qa@B 7 R.R4pup300 Q &R&  5S 5S]KX ;p t8@T2 RS |] (6q0#0P` k]@`8X TH$4(l,T048<@ DH =<=Ph>/@edA tTa[$<H\dhԸ L`\gfffX |(Al̺lĻ`@ pHDļ$4б| 0BM &PF_ SV&\\6 S F &T$\ 6!&a 0 . `& @P 0 2" p0! 6 ^ 2 6S22S \< D2^0B0 (& R 0@, & l& '6 `@P p! 06@@T@!^1: Q0 &R0:S P03 83Q2S*& RXC 6Sh3B@6 L!!  u|6R 00 T@君5S%%R005  P0xc5 0S 05 Q5 5 % & 6HoQXkQdgldQx`%5[QW5S%PNTDPFDQ? Pv$@T , 0RP(K [ ([ K@ @y5 K@5 E%pP9 % R%6"&  P660X*0 ^PPS00SB %5R> P;X9:@X &0ST#3*&p  6PX&  \ 6S X*cQ&P50U&00Q* ^ 000S 0@6 # 06U0 $!4060!40 4 05 0!4 0  40 ,40!̠!4!05#Ƞ##0  %$0""Ƞ"$ %@"̠""    $ !$ )0`L(00ST \8 4  (0d8 [NKR@D@D 6(( /0S66 { &j?p 6P &)GX $9Q  ( 520#$ 0 0 P0C"$ "40 && 9  0@!Nav. 4 0 %9R X2 5S X R 0SR0aA006 6 r0CC C C C CCCU B!!!Ƞ C CCC CC  0C0 [0C*00S @T 2'&U0& U 0A Ah 6,%PD gz[NK@D@D6d+9(P \00 5 % \6 S(+p 5S,+h 5S0,` %?RM5 c02?  5 % B QT<Ps 5P n @ S%<T E I @ )6S DPPM&Y<Q &Rp5F0%Y%"\=R 66  Qk T  UtX%YdY p0Y |YY0YYYT{ 0Y Y ?[&0Y&[yYA $6~0#0P`6 S ^ʠ 6d]Y5oxXY|Y RY[LY' -LM00PKpa@ 00p `7P2 `00PU4 @uT <T  0BS0^T0(@ 0 0 K?P@ -P0('P0 0( z'P 0`7P y$K 㨩P@$0 R 00(@< y$yԿ P-L XX| -LM( :$'P( (( Q5 (K`P0 0S- ='@PS 00$pK PcU% iU, lU3 oU: 1Q@ Q 0S&P0$ 0 Q (Q K( &P($00&P($00&P($0 0&P($00~&Pt ($0$0T&P@ ($0(0b{ 0-LM 0 P`vX0Q @0D0 l Q<@ϓ 8h_$0 C 0+ 0| B-00 $0 0 0+ -00S 0 $: 00 $ 00 $: 00 $ 00S 0 < 00 00 < 00 0$ 80 0 ( =K 0  $0 $@+0S  $", 0 0 $ -LM0@S 0 K0"050 00 K0"  50 0`t - L5PYot 0 - L4PYnt < -LM K00"4PYtH -L h蜖0$喖T p-L MP@`0KP 0S00Kp Y\ p-L MP@`0KP 0S00Kp gYd -0LS@ h?FY 0 << 0 -@L墧z;0 0 -@L喧P0 0 D0$ D0 -LM Pp0`-S,0C000P(K 0(P T5@P  0SK0 Q0vC$v>  (l% p-L0 `RP @ R $P0 00 0 0 0 p01Q @ Q $P0 000 00 p0Q @ Q $P0$ 00$0 0$0 pp0Q @ Q $P0 000 00 pp|  0-,PL0@S |p000@0lp -0L0CSQ 0M - LP^0? 0  P@ ^00 ,00$0 #deH p-x`L@PTd0 \#p$HP@8p$0plpȠ< -LMR p, `0 P 0LS < PI:@TT   @Q ۔@T` @a Rb:          0 Ql }@!` y $T u L &q?QPP  ( gU b  ^U XU RU  LU @  AU   @ 8U x 2U  d ,U T    H #U 8   0 UP0  P U  Ua@  U@ U U  Ut 2h@  < S S @8 U $    U  U U0S k\0 `p \$ ^ 0 R AdPd␐K 0h'r"0 ^K0p4'g" W ̇ʇ pG\W K‡K, 0R(Kp0S i^0b ^ R@ |W0S  dP^  L/ E80A$=@061U4  +@3'5# 7 U6 i@8  < S1x 5 U2     @U.  ., 0 2 *0S2@T P`K0 0d$! @TO0xtld0-W  R0Q4@eU   L@ZU _ 357 9.@< 9{ [ wU8 @8pq:dm <Xi F LeU;  ;8_ B ,[U:   9S@ U S?  SsGp mX @ R @; 8  45 02  .stY@t$+\!"0 04 t  27PF3PB/P>+P:'P6X倳yx,<d -=i-\=Mm|$0A-e %4!  5 ,<h,]<Ll}@\hx@P -0L ѷ$@  -#L`M#0㘣p , 0x0 0S`pAᕎP UH#op a0@S<D`0`K1`x ` Pxt K/P4Kx /PXqL\\B3Px tRT`0S0 t 4` l h 0SD PKx@K 00 Q/ PP;P `000C S61|K 9|0`SpP @6  0l0 00 Ql0S$h0S x)/P(, 0R((K` t `` Q P  0l0 xVPSqxQpQch`SXbQ0 SPXt@ht@`8gt|p` -0L 0¶$@ -NMLM0S( `@p2"IK\A2A0PR2 R4: S 2"t2Q0T/ 5@P> B^KPEPE0H"@ PINK2@D2`1@D2k*HP0S: 2 RV0S% NPP( 0Rf$KINK@D@DP4: SRQlMQ<1c\ 0册P1K0PA A P+%4R%4R0 R pEP0S?00d Q00HQ@Q00X><x|t0  -LpMP@"0np1 F0@-SD41 0bSQ`( S+ S 10pK᪤P60: S" 0 0 0 0 0 0  | wQP @P PQg  @RX|tx -LP(@`>-pE(B@D 0 TX!h!\!\!\!!\!\!\!!\!!\!\!\!\!\!\!L! t0 l 0p@8P- 0g ,0  0  0 p=>P?> *Q-L QP!004 :8 6G<PP@ 0x+ @P\0@SlPUPJ0p,0 ,00P,0 Ap0@ @00@0  00,@ `Pa0P`0 ` @@0P0 P 0S S/`!1X  0S ,00P,0  (Ko1 0S1  03  P0    (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpxhpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    h p x _00C   l 0BX 0:|X  t p-(@`TL:P0(@e/LP 0S0PpG( -1L M @R_1 R 1 RI a -%P|Vxx a0(Kpg@ A0BCGpD@EPF`H,KP`@ Pp`g)`1`V <(0aPPP,@4@PD(*P,*P`V\),/ (- 0St$Kl0ST`h $PTIP$P@I8I T  rdA, ,edA|sd Th0 p-0008L`@P0S pd $P PUDD $Pp(pfIWEV-gdedA | p-L`@PbsP e/P ,V  phSp F -L─ M0 `("HPpP@0,  40 0 `("8@@p00@0N 0  0 00C 0SX 0㠹Pl08#HP P0@@4Pa 4B0Q0, @P: 0S# ,3 0S% ,!,10!R ,$1 RX, 00CS0W, 0 0(K h1,!`  0S Ƞ,Ƞ,8 0 00C3 0 01 0 0 0 00C 02P ("8 Ƞ @,HP``pP00@p@P,0`a 0p, (Ko, (Ko04H[,Pp,8 - LM,0 r3  Rp3 !hd 0 T 0 BCD@EPF`Gp@ A0$ P@ P`p 0 _X02 R00CS00  0( d, `0 \8 X4 TG<PP@ 0 TI7B0S007|"0002"000-HB0S00&{2~Ta @ᔨTW<@TO1 RE ET@0DS?e/PZ`PG <0@PD0@0- 18!0*0DS* e/P$@P @@ 0M>0 0 |@Th lE \DT , -  `8D,-     `@820P#! 00"8Q#(-0 P`0@p` P0@ ` R VUQ -LMPP`0 ` TP4`@p080 00 R0  允    -LM@ pH 0P`PBT 0@i ictd -LM, (0 v@T 0p-`\ 0G`P 0p<,K 0 XXX 38S P 0< 8PS$K  H  -p@LpP20` ````aPUPɯ* /0 , `p 0h!4d@P `p0a`vp v 40(@PU 0  !  3 00 ,0 w 0 w 0T @ , 0@0ᖄ## @84 0@DgPt @@0MtA@@ 0  t @X  -L(M280 4 400 , 8` 9ᘀ@\\@P`pP@p@ P04xx! @P0@K0p0pp* w1 P8 84 0P`0 10Z  0 R00衼$/ ,0X%! 8P4O p徉q 0px h0gh L0`(K0@W0 K $4pYH   @T X4   -QL M, 3 aIZ00,0(Z` (KoJ,  20P` p0@ (Ko8,0(, $ 0 Tr, (Ko6 88bP,0 (Ko@ 4 P  -$ML4 `)p@@0P\0XX"`p `p0Pp] xi 2 R B0  00(Kf A0 SP40 @P 0P /0U T04 P ༙9@㘀p@ 0`Q 0 , 00K 0S@P`V00 ,@ :,4@0 O09 T 0 TSq 0q0Sy h0cSQL# 00U U   @ X  -QLM`N aP@U00? (Ur \9@ @0@00 ,@K$P K(` Kh)5PPaPPP H<Kh  44DP(0 Kh@   -LMPpd U a@Q00ϓ4 TQR4 "<  0S 9@ @0@084\20    8408#8^8<0 @ 0 @ 0  P `   R0SRP `  hp d劺(K. L2Lh<4 8 8Q`P弙ᘀ4O:4xP580P`0(0 @ Q Pd&  V]Z V^[  Pʀ q @<04P4P 4P4#P @00 0000*PK0@ @00@000\00S a0*PK*0K 0xx)0KJPP P0\x\ @(oUU@ й H  -L M<G 0PP@@P!0 `p0 `p0 , 0 rT 7<@ 0@,@Q0 PG 0PP@@PDL1` X0K0@TP !p0 `ppP`+ 7<@  0@ 00KQ V$ 0KP,0``|dTP00KP0(K,0s\\0 (KoOq880 (KoFU  t    @ -LnM0e/ K,0 ~t6to0hFh!dP2 XgP: Lf@P _PD p@PT`U o 5oP` 50P@!`pV5 R`00CS`0X0  X0Udo00@@V UP`8#8@00, $P  O<,@P0 $`p `p0p pw ,0@P0 $`p `p0p p} 08@P0 ll$`p `p0p px 84@P0 $$$`p `p0py pl 484C 0C`F ! R! _ 0SST 0P`@@0@0Q a H $0p`p@ p@ pQ    11({ |1yP0@`@w_K`0@a0@TḀp+r?K 0S@ $@0PoĶ K !_0B 0S" 0H @P2 0<S0Sk* P0x~.Ke/)PO 0<p 8唎@ P,l -L*MgKJ0J e/ ,0 0: \P WP QP ; KAA  O PP[( K0S@ (K0@ @0@0 5 S:5 5S:5  e/ K\ e/KX `:K@0@: J :   P @P |PuQUQ 0ApS$ԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭ<ԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭԭTԭԭԭԭԭԭԭԭD8( ԭԭԭįԭhtخԭ8ԭԭ, T 0`p: @P 0STHK@ @H Lp 4iPP  0O6i  0  Ke/PA =P< NKKAe/ 37 RR  `@ h f d Pa ǟ, 0R(KTk 47 Re , JP7ǟ e/SNNK@D e/LK e/He/KD x l _UR lô@Pl  0Fቶ `@0p`p @TP0,,@ P0 0  0ӴnU @@ 0 c5 R  [ \WU $0N VK0 $YE PB > <: 7 3ğ$00s03S09k' Ke/P NNK@De/ Ke/ e/K @ = :d/_04 R L4 R 2 44C ( < P3 @r|#00@@T  ( P~ Ke/s:^(K0S (K (K@V0`@ N lß(Kh3开(KⳀ 廅Ką 弅KNKe/K@Ne/ KJ    3 R `00CS`0QX0  X0q0 |:K{*KX U`2 RT2 Rf "+P P|"0000ӑyS PX"0000ӑnSP4"00ӑyP/ @pPYA^`A 000=00C0V+S+JX # PPE 0SB 7 1x兽;  @P e/K ,0e+(( K%L e/@PD^ 5刋J@/* -t6j,(4P?-  ,P@  pdx$ hrdAnhp,dD<dP3 -X0L R H0P808 0,bC]C--t.|H -Q@PL0. P0 R 0 0Q@P`0 p8W  0 tQ\d cC0@ 0PV0@0Q@`p- -1LM RKxa0S l!00CSP\QT1  L1\*\&81 H@ T\q 0'Q_ 00@TP 0Q00 BL\ 000SBQ0 0 X0@X$ KK @ PP@4B-H- --Lm -?MLML$LD0\,0 P`040S- S! Q4 0Q Q R30QC00, 0 R(KQڐWB0p0\?KK(@D@DV ?{KL(pGLCpG(0K8 P0(K  0P?KK(@D@D?+}PŸ?+}P㨢00?K@ 3N@PdŸX@'  Pw ?K#N @ P[0":BR?+}Pʡv[!+BC1V\ pǏ 0(@K 0?KK\(@D @D PoP[M[0L!B0 !0T01 R DWFPDQBP@+1[  A0@09'[  A![ AA[  AXU [X A[T m,-(Lt@ 0-QL@T0 R 0 |P0 @ 00 |Pڜ0 P ;;Sx0@@0P@L0 D(A0Z, 0$ bA---pL -?MLMt0t` R   0RKHp0S?KK@D4P@D?+|PÈH -r0LP@4 TP< P002`V%Pyڀ;;S@[h00`2 0SPPU>TA y42 Q @P>@VU@@Tʼ!000PZ0 SX Z0SE Z0SA Z0S= TU@H}@<1 4v@$q@ 0 Q 0O Q *P@`@@Y0S Y0S Y0ES0X@0yYT 0P ~@@6@00-LpT -t0 l0RL T@ 0`  R)PY I@ p-LMP K`@#P1M30P/T  M-J-@ C)A) 0xePKpT 7- 1)/)/-,-@@ '-(;) 8) 4) -L$MePp )x5tp5 llu d%d5PTT`U  %P4p 5Q ~0STP uP T)Pd0: S   S  S00  0 p 0Z0X4X$T4L4DqX0S0C00Z0 P6U #?PX0#j?Um t#/P00pn P3Q  0SdL3L# 03 (K# <003 "?;00Zr H2 ARRŸ:0Z P% 2 ZN 8pxŸ?;0P`? 0L L9 T2@P`? uv ;0Z 2?+ "2 P1!1 1!0,H KLP00Z00V;;S\ @1`V 8p ?q1!``0Q 0 vW0 >W0 >LW0 >X0 [>' 00 KW\ 0x >-H- - ------,-Lm @T|h -LM T0St0Sfc0S3 RCu'P$K d0S 3 R 0 0R R3 KtC 0 S `#000 R HS0S@ <3 R(00CS00  000`V 2@_P[2@0} +0 0冭r00d2 Rl2 Rd `2 RxL00CS0~0  0(24 abĸ0Sy B'Ps0: So<08@@k1Nk@f1!11 R^ XAP[aXP0  000X`D0K'vR 0 )9v|00 a-zDPK`<0K-|圀\0 H0  w LL..D.,.. ..\<.pH.  d -L%M$MŽK5HU@(KHd%,@  P-KL' 0Z/S /0 0 0*KL5%K(II (tKLPnKHD0: S p8, 0R (K.0[/S b8Q0$8G.PP-PT4 RmK(`F(`FP% 4 (K )PPt0S3 R5 :KH5@/Q  zKHP #8ZP  /,4 PP|0Sx H3 Rx a=( Q0 <SHy/P%P,:KL%.$PB0S2 R  P0Su 2 R a=( Q0 <S`R0SBTT2  Q 7 P 4<S S8 0CSWP[0Sc A0S_ 1 RK!00CS0Y0  000Mm-PF"d1 Ra=( Q@ډPX1@1  p(KP$@P'( K K(A,Aa=( Qڐ.b0 wE,P <7UK(A,AO {TX. 0! !L.D.,.T!.. ..-4.<.p\lx! -L Ml 0,0 p@WP P0,P2,$00Q./?`CPz(P3 , Q# .Pd.P V 04  3 R(K,PI+#WX<30 SS S p$P,Ks+R P, EP0"6+2 R6R0S S=ڜ2 G"000 P60S \R0S P2 RO4"00CS0r0  000,K+`p-P,PU~\,PM11 0,4 K@,K`0S XQ0SV^4KQ..PWb=0Q!&PO`20 ],K(+@0 R 00CS00  000P`P,K! L@0 0 DLL.D...x!h..\-<.p -bML$Mx0x@ R  v.P P L0 DPb K@$@ 0RK }D.Lt -bML$M 0,0 @P T T 05, 0Rp(K0DPA0 P0SN0 XN!0Sb}K(pG$pG h1h `[b}K(pGT1 $pG -PX ,PDPK`<0KP AP&P0S 0(@P>*wP0S @0S ,-P+P8 D0 00(}L!D..\t.!<.|0 0? -1- -T2LMR`u<0S1,5P}""0\ 0 0"Pl1!!0ȁPp P+0@PB 1 V PaB P 0O0@U <01 1 U Pa`n,` pPoP` , `, 00 0Q ,@P 0  `P0SPQ~8 @0 0@,0 --!---L8. -PQL`tt 0hpcPP@@ o0Pd0U`00<P-- 00b0T- -ĀL0S` pP@P 0@`Ph0lP/`T0 P<0`  `00----8. -QL`ڀp P P@@ 0Pd0U`0 0cPʥP eQ -- -a=LpM00UpE``a 0 cR#?S }oP/0@TP0U0 P-0 0 30(KR 0 P0TKPa=p Q 00C h3T&M< 0< 3M 0 3--<"`"("h -LM a a= 0T ^,  r  K PKX0S`pP0 PU ?`p n@P 00Kڤ\,K  PU ? U?l1 R \1 P0%3P ,\ 0S4  (KL!0R30SK9P$ a=x Q 00C 020S zLl 0d *3<0 RhL$ 0$ 3-P""#"# -LM Qa  0p" ,0   KP|X0S<0 0@W0 m 0 cPL@_1UC@ ,K  00Kg PKڬ1 R000  PJ0 RZ0O`VpW' ,Q 0SE  W+ڰ 00 1 R `(KT@PPV0 R  D2V K0T u2<0 }V,0 R --h.@#"P Q-LP`.Āp 0cP 0OT @ ^ ?PU`V S0U 0cP,0PP-- 0-D0DP LP0,@  `*0 0h--- - LM q00l ?S 0P`PU`@00(KR`1 ȟ 08 80 4@ !,0( K@"4@@4@ 8K8P6 0r00KP`PU`8KP` V0 0bQ  Q 0PU`0V0ʴUP QP---- -@L0S< 01 R; 5P=qaPP RPR $P PP 0@Pڠ0/0P0 l 1PPPH1PP 0@H----#l# -@2L @RPv("0S "00000aPv0 0bȟ` 0 F!#PY(% &P@T PUJlta0`!0Q0:D0 R 19P0X@P`P0 00 0 0 0S @0  NP0 pj0 <D 00 00T8.-----$--H# -0@ 0RL0 0P00 0 0 R ? Rʂ;;S \<"0P4?;0H-1------d$4$ 0-A!0QS0 L? Q!ʁ P$~ Q0 09P 0@ 00 ~<|/0 h?;/0 P3,[|{W|Q  @4S4S  P00q-& -$L00; Px0F#0  00 PmP 0N0& Pc0V#0  0 PX P^0 PO n[PDVP? Po000c@`P300S S, S* S[ 4b-  0@na- p0P`@0S@b-P ``6 0x P] T0 t)hsq (0 P)0h.q'q' (,$t'' -LTMs0 $0 PP2b@ @0R2  0@`p@KSA 0 P| 0z P d2 \L)$ 0R K a=0A 0 P 2 4)1 0S P1  0K P1 0C P1 0; P1 03 Ph1$ 0+ P 1* 0# Pa=0 0 P`0;  PLZP UP00S S S S  DPT0 l(z`pv(0 H(o0q( ( (,$l(H(0 fh.d0 h. mQ-L }P ( mQ-L pP ( -2L pRPk nPdb0@ N 2 H 댢  B x2 < d2 .6 P2a-0C 6 am` &% 2 > @ F 40@44!00 N @ V 40@44!00 ft1 ^P@nzP0@0Pn000c@01P 0: S  0@P`0@0S@P`   mPP` P`PU`0@Pmh. (,H$0 KQ-L P ( p-PL`LPpb-0 @ y1 s1 mp1 g\1 aH1 $[41 *U 1  00P ?P+ !a= a= 0 A aM@ ;5P0@05Pl 0: S 00 0 <n? KH 0P &? K 0( &`()h$) R0-LP@0 0Q D P?0 00hu&? 00hn&HX)@) -RLp`` 0S 00000SPP0e00 R  R0S@0S@Tz /0EQ'`R=  00z z  P`Xi@pWvP  0ipt@W? 0d  &O? 0H &,4$%@|.x.p)X))) -@L!TP*? 0h%) -!L@P? 0h%) -L@)Pd0d P ?0S >08 %(0 R*P t.,). -L@ -Pd0dP >0S >08 %(0 R*P t.,). -L@ Pd0dP >0S >08 ^%(0 Rh*P t.,). -LM\@ 0    |0 R p0  Q KGP K@0 R0 K0 GPm>0 !%PT* 0-LMPQ@0P-0Q   0;0Q*0 R0 RP 8a= 0 P2>h 0K0h$P0P 0;P0 l.. PT84*(, -SL0M@  0 0 0 R0  Q c K0OPKL0 R00 c K0@P=0 $PT* 0-0LS@P 04 00S0 0  000h.8 p-LpM`@KP X0PUH0 Q Kp0 Q $.\* -LpM0P/Sp/00/`K@P+ 00P vpP0 R PP0T@  /0pG0$Kl.? 0-LpMPK@nPK00 R |0: S xQP7=0L #-PU (=0 #.** -ML\4M T4` , ( pᤔ ,$00CS6665665 q#ß, 0R(KhPB <3@P Yڌ3 R3 =P0\## HA#  $3 +3P2 R84S 2P 2 Ru 2 pB0SF R0P0Q0S<"0;0QY0S8 TB0SH2 R. <2 0a=Cf}I.K B B$ (K0pCP4: SB^KPEPE!p@[<! 0 #U\1RP  P 0S8A0S,1 R  zj0 t0C @IKAADP40S$D0  d@ <4p "  +.(,H+*0t.0d.l..PT8*4?`+ -LtMpPK@P1 R! 0R) 0: S/  PPP ;0` R "P X  KX;0p e" 0R H"P0 @N"..+|++(0 P0C 0 p-LKtM @`KPP0: S  0Kp 0!b;0 "++ -0` LK$KP P0P p P8;X0p RD0D P0$ ! .(,$,0 R00X -̢LP z,봒00@T) "0S@T B 0S 0x0t2l 0P P2P~0[P: 0"! 2 `R. qP00CS00@0;t0  R P- U. 0S ܒ@;t0 U@@0S0@q< \P  P@0S10 2 V0@0E 00CS000P p 0 S 坒  ᵒl j:\ !ďP @LTX--H.,0.p `,8,  -<#L M0`S$$/P 30C S1AAtAA,AAAAAA0" " 2 R D0, K(0K3P0,( 00\"  P b]b-0@ PpK| |@Dp g2 * RV  R,  R1    R 0! P;01 1$K R1    R!  R`1  aL!0!00 +P590 0 h h0 0S 00a͠ 00  00~PJ90SuPC9X ; 0 | -LP,,.,,   -8, 0-0L R0@T P@T 0S0S 0SU 88劏@T0P.T@l_(-d0 R00T0 RL0  D0 R80 R,0Q 0 x*X@.-$.PL p-@PL` 0SpPP [@P0/S/0C0T 0SD0 00@ `PPPPpcpX-T\t- -0 0R000000L R0000 R0@00|0 Rpl0P PT0 RP()d.-p.`.T -.-@-PP:P 00S S R U3 /R07Rࠓ, /R7R10P0CUࠃa0AVp7@AW0A  W UPB0A A0A R` S- L Q0000L B 0Q000B 0Q00P000BQPQL0 S0W0 ̕0̅  RL*G-MP : \ 00S S R 0 SY/QV7QpQ/Q 7Q 0AA1/Np 0\Ѝ Rp6p  RP"00NPo0A@N S@'.@a0N ɯb"T'nɯR'.0 0@ pS 0@ p pA- R`PN) \1>A P0 0` NA 0\!00 ` P0@ 0\!00000@\\N@0pXW0@ W@%2>&BP` PA:@0pXW@-@S1Q0 \ \ PT00΅ p-0LM @RP)P Q `K0 EQKpYPEp -0LXMp Q P@ a Ѳt`K 0@0PtK4@K  0\ 0R Ka=@%HL( (0T@@5eP. --- -3LpMß@0 ßT S, pP`$T2 R0 CR s00`, 0R(K6Ep2 R GT2@K  D2 R@u a `뀐K 0@ ?2PK0C@1Pf0 @P @@後!00CSBa 峌tA D0S'0 CR F0  0@10 CR 0,S 0S0 CR 0R X ݌ 0` 0,8,$8 #4ka-0x8

@垌0P 0@WP 0: SU /00K40LSP  ,Y0 (: -LM K`G 00s@P04 P, 0b0CSWTWTWTWTWTWTWTWTWWTW,WTWTWTWTWTWTWTWTWTWW:$6U* 6 @P 0xS# S *S @Pr4;U$5$;U%1$?U! @P d!#pU @PTTT 0-LMKP@P 0 S R a0P   B@0 0 C8@H0 <0 R0#30@4P-p -LTMp/f됟P0000@tPd/0t x `0@/pW 00@JS^x^]]h^X^]H^8^]]]]]]]]]Y^]]]]^]]]Z]]]]]]]]]]]]]]]]]]]]]X]H]]8]]]Z]D_]]4_],___^\^^^^^]^? -pt0S>g -= /0CQXZ] Q1pZ1@TZ pP0`VQ T=pPHPxN:!P @ P,PyP%X= R  !Z `PVJ@bP\ x< p TE@P <Pp=" P < -RZ < t < ,00 \xLAP040x+8< L< ,+00`D; x  R4 < I: ; +0*00*; *|; *l; *\; *L; *<; *$; : ; ; *000P+00@+00: *000`l: x*x: V): |9P sP=Z+@T @PPU p PPJ *YPPsP@9 R  Z PUJ P 9P pVPI hJ@P |)0Sp)8 X8 t0SH0S 0S P 0S70(K#PkP8l8D(8 @Lg ('dp 60@DSfffffffffffeeefheLefdLeffgffLefffaffffffffffffffaffffffffahfXffB  P!1 h" Q<L"0S(!x1 4"0SH0l0lkktl "\!01@Q񟗲hhhhhhh@P0 P@ RP 0 1P@0SP1 bt.0X3\4-Ы<4T4,`3(.333333ȋh44.4X4,5p448n9-4 dVL,5D5`4.X.D..5Tl..P@.4..3-L.-$. .- ..`.-d.p.(5,.`8-0.x556px3 0H@`544t.8wP1 R (Dy R0t0 0 0 x0 S@P  P ! Rh 1R B P 0 0/U!d1 4QAH0pK @p 1P@  T1嬏2` H@T 1<埏BP2  `B0X000X0+KP*B0X<00X07PB0XHH! 3 3  $3  2+P20 R @a0BSm`m`m`mm`m`m`m`m`m`m`mm`mmm Rc3 3 4 4$ 4 $04 <4  DL4 〠 ?\4 @ :l$l4 6t4 1P4 4 +4  &4  !D4P 74  5  5   5Pl,5Pd`5  x5 5  5  5SPI5@P5   L5P36  $F$VQ^8 `0@0X6  l,``&0 0 R 07 Sa6  s@6 @0 S:i ;P6 R00CS010  0 <HD'0 0\\'0 0l 㜄P ql  e ♄o DY` p-0@0?PL`A PQQSp[P$ 0QSA?P0QSp*P0*S0*S S 0S P P 0SQ\ 0!SPPU0]S@ S -R \0]S@^ T P ]P \@\ 00 R /Qp$. p-@PL/Q@d ^`\0Q\0@0CR0QR0@00p 0p@6 p-@P`L 0P@ 00CSp  0Pp 0-\0L@T P @@V@T 0UP0<@l_\6 -LcMK M <KK(@D ,@D KK(*K, K$8 岹 KP b-K( BŽKHK(B:K(H K@ KKK8  Px3(K -KY X1 p! * p00Q  X #R X[ K*K0* R &R@P \R  U+* R( &R@*K80/S89S6 K00CPaK2@0Q S``V 0eVO P& U:hPEK"(K00a Xp 0S  K@0 S@  X$:0 X0H KQ *K(0 -<[SL:Kh(d倂-<[S<, 0RE(K0 X*0S:K8S K(K:KK A(KT"K KR(/0S K\  K>K(\ 0CtK>K@( 0C(1,:Z-K8 X6@666 -MLM`s0\cP$0 0S0S 0/SK0S.00 @ b00C00S2 00S2P  0P 20SSQ SO 2 R0$ 0R KK @ ,<B0C<0S0S PP `PyP ` p`P8 400PPPP8<@8 -MLM`0PP(0  R 0`S @\S@ R 0S e`( 0Rd$KpP<  :PX00 R @\R@ 0S  R! H5R 0000S!  PS GS) 0 0gS pS0000 S0 0P 00pppp000\WBNK@D@D ;s 04κ989$98D X9 -0LTM0 0P  d@KhP  i-@0 R d@KO .<.9.9 -L(Mp4PPP 0S s@P  0R/S 0R B/S@T#cP T /003HPKP P Pv Pi E3ß3( ,PK ß8@K0 $0 , PF8P>  P=80Sq  P480Su  P+80Ss  P"80Sq 0  ,0 P PP"00CSa P(!E1 KQc v@0KH0 D@ @0KH0 D@ @0KH0 D@ s@0KH0 D@ |fa(!1 yP0 lP eP ^Pl0 RmDH.:T.\.X:P.P.,H`:8.$:9,:-:-1^ 1!3h,`H -L` pR @00B S R ;T PP~ .RT@ *000G S8 ЌX|0!000!.CDRk?C `0 0!000!>C s 3 S R00C0` 1   !.B0r03R0S `0!000!>CS0`0!000!>C;S0Hp 0!000!>C10!0v>C 0C0   !.B ` 0!000!>C=S0pGҁt -PPL @TU /YpP 00@T`  `00D0 S 0,TV`0B .TQL@Tν@Pv W 0S 00 R MR- (CR1 0  0020S&V 0S00L! 0P@!<10@ @@@cR mR000 R000  P000  ῷP000 R 0` ᪷ D ᢷ, :;;`d:,;d;H;: p-@PLp R @a0S6 #R. \R' ᦚP@9 / 1"#200b100c!QR 0S  RP% @ 00 0#R@ @\P DZ 4 T  O h/>3=;; < p-@PLp R @a0S6 #R. \R' P@9  1"#200b100c!QR 0S  R㳼P% @ 00 0#R@ k@\㻺P D 4    l/>3=D<x<< -@QLMp)@0@P`@^ K00\ 0U@V 0Q 0  K0P0 0@9!QU`@ p-T`L0S P0@T  0@T0PUpx -pL0S& 0`SJ2ጠ匀PC0 S@0S  0RPEH Q S`VZO000pt.PT p-LPP`p0"#200b10 0c1@T0@S 0 S0S00 00px/>3 -\pL0S ` PU 00@TP0`V萌' -0L^2 0 R.x00S* S( S& 0<%100b1010b 0c1@T0@S 0\< 0S00彵h躵萌$qv -MLM440S, `p 1 RQA0Q( @P:xBP) 00(00 徠 000, 0R (K0/S BKAAa8Pp ` 她P (0  ${ JRp,t-<<  -L@L0S 4 @00P[ p-= -@@L0S (PD x=@= -@@L0S (P- |=x= -@@L0S (ٸP 脌= -@@L0S (¸P 萌 = -LpPP 0"#200b100ca R  R 0S0So@P ZwP 80pP  00@ᨴo x/>3> -p@LP 0"#200b100cQP 0S P\ 2`P 0@0 00` |/>3<> -1PLP 1!@ Q0``ppP  R R 0S0HH!00 @T@p qP 0$V00Sp00S@0ڂP0 P  2 / ǹP 00 tp 00dP 0S 㳹P `$ 000|\>> -0LCP -$L@pTP> !a@T vP @T {@P fvP avP 00@PYP 嫳ᩳTᢳCvP(脌?>> -|0L@`TpP \ AT #P @T خW0G0脌 -鰁LP\^ 1 RS x0C RO0Cx0%100b1010b0ca@pT#0p@S 0P!0S ! 囮0  S;00 S0000 00CS 0"Ӹ@P uP 0 0  0  00@800ꐌqv @? -MLM"@0T,0  pP! @T@T 0S030S3 l!!!h, 0RH(Kp@PJ Da 0Q : kP K!!ᣲa= 000@ 0SnK`F`F ICP  ᆽPa=0 S0Ÿ!\ H_O!@ ,ꈌG`??x?(?? 0-@LPU 0)P t0t@p ] `0P#50 08 0$N0舌G\.T. @0@?  P 0S  PR00S0S 0-B0B N N S0N0B S00B N N Q0000L  0Q000B 0Q00P000BQP 0N0Bp@-^ 00BPB ` @@ ^0@0B ^00B @ @) \1> A0 P A0` 0\!00 ` P0@ 0\!00p000@\p 0@0B-P0!̠#*̠ 0 R0 R*0P  -t6LMl P, f PK PPKR  0P T4 LR2010"K+1K1K d4".K|0 P"K  ۹"K">KAЃlp ҹ 0P S0S 0\  0P"KXtp 0P 8S0S ,0\  0sP2".Kd 0jPa=">K  0P2PUwl2b"KB X2".KJ }"KcK 0>Pe"K}Pb R7000qa-1K1K <P`@0S@p">K|  0SP^ d1 A".K|5 0K P2L">K|6 0KP'A0 pV L0"K#0  0P$wp_ ">KB <"KJ 6 P 0S S00#~@ -T@x@0XA86(|<--@,--A (.@@4[ -3LM3 0A, S D`|<:864;0Q xt#lhd#T!PhH0 $#$(,"(h# Q Q  0S#hC <8#"h#F$F@F`FFFFFFGG$GLGtGGGGHH8HHH\HlHHHHHHI8IXIIpIIIJ(J8JLJ`JxJJ -3LM,MQ (K@ 30S  lldx K(@T*kT IK@3(@D8#0 K(@*\K(HJK0#(@Dbڱ*M0"ѱ*D20S "ű*8P% `V"己!@P 0O L2ם 0m 0("垱 KK(@(A* K*(@ 1 Ra 10S] 1K@1@P 0ၺp` 0z6(J@P/1)K0 B0/0g9K00C/0*/0Y/0/0 M/ 0 K0L/0@)K0 B0/K 80 2 K(@ *㤱JK(@D (KpJT0J0J`0J\0KKY@@K0̌ԌČTK -@LyT  p3p3vH`0 -L M@D 0KH D000T 60  H Z D@j 0 S<@ @ 0& S6 0 S pC @8 K048,< 4 ,$!4 !$, <c00Q,, b=90 = B, 0 ,0 0&,02#`pǏşP ` P`0S%0S0S*@ 0#p5 ` R0 H 0 0 B0 00 0403  rH0@0 04!48#8<!D !|40S /0:/@0 h!Y`!<0XD C0RL5y!;@D4p0 S Ai!@PRb! _!P<0 T$*0T@:< Q* Q:L30  @< 0010RPH0V< X7!@DHP`Q @11:Q1 Q#!p@WJ*P 0@$4,<4("4 !! %!pGW JiTO "0S=l j0 JR !pR@T 0W T( ኁP 0 00@ c>'W` pV *P 0@$4,<4("4 ! d pW\ J TX RPfP Bt PJ 0.RP00@: *K LP A  1eD R k 000000]00z0 0w00t9 yeD d9RG 0Tˌ 0eeD )KR4 0  0UeD H R0d(H0Kap0<11 6eD t8R 0dP(upD8p 0gS0HPg ׬肑004 077 㿘wg A ¬0P0P~PP  000 eOKK,㜝d7@6 0SL   <F0S,7 0080 ЧP F p60! 0 Q:460  6 60<2S4&000 FP c50000 0PP<+E0@ x5 40K0 L5 40K   50<2ST%;0000U B>BS3  % 4E 40K{00@000 ' 0)[R00@ 0  0 00  0400L40 ! 40<2S@K(P #K K0 KP>Pl30 3@ *0K@,P(30 P3@ )0K@Ph30 3 00K PBH@KP#<0K@P Ps< 80R\#80KPPLe0;CS00\Lb$CP#0PP 2Qx"_ې"XR0S@ 0 z㗻㔻㑻@p a0 hA0 02qሦPP@lKPKL`K<0 @2 X0 \@ 00     \K0PT TK8 0j@PD0S :  P0 ¦ @ ṦP R ,0S:რ5B0ĞL`8X0{Gz?0M(MADM?\M0MMMM!MM N/.At00NT0DNhN0/d0NN/NO$ODO`O|OOO܌OOPh}'0P`0 -1P p0u03W0SL`F 1ɧ`P,*W# L0S'0S 0 U0/S \0S /S   0S /S  \0S*`0X=|6 - @L R000!= -LA6L 0CR1 0P 0" `000 L0S X1` P1 P`(p@W  0000 嵨0001dU0 a`o@ 00C0S _00 0S 101>,a0` 000|6== -L4MP04   0 < @0  K00 ,0 (0 $0 0 0 0 8 p@Kz Kx -ML M P00P0Sp, M3Q  0P1#\CSAEKI I0#X `$ d 8 4K\ 6d3&?Գ( 7 BnK`F`F 0$l#60 c S1 Q PP1t4 p(0S, 0Rq(KS"V0EOo 0!5!,@ = JPh 01p4 ( l ( h(,"6O0@ 0l0!0(0PS1YpP^ 1&屧!h0PS" ᕞp$t( 0P( (PD0&0b0(!6 OQ a0h0C0^;0&偧ml (w0PS0&  l 0 R t 00 v\PP < 80m?X=|6@PQH=Q$Q@ p-,@(`LP0S p P  L0S `00 0p 08#80C S PPxPpPhP`0 0p0000000|6< p-L@Ah1PS* 0S" 0 : SW@ fQ0S V` 0S 10f1ph}l|P p\0 P@ph B,e=4Q8QH=HQxQQ,Q`Q -LCM M$E~KpGpG 0,           `$ d \$ `0$: SYx@p#d0S0X,P$ L0S@{0 44 ,4P\4 0$KXT }@T40 0SN h0ࣟ: S= P, 0R(K 0S  3 @CPP[ H3 PT DS@#004K\$ XD @A$0 %2 Q  20S BKNN"1A\0A 2 0!00c000l\#0 0@PRY B Y00C0%u!0S 1 Pd  bPE l0SZ H WkPS  5d4s d!G101T0 00(:dp  0S 76 1W9BKNN+4K@T 10C1$p(0SZ 4QQH=Q= R,RQ=HD=dRQX=8RQQQRRRLP -MLMp0P@AnK 0 `F`F 0  U00U0S0 Ut 0RK&@eP < 80 Q ( 8X=R4QRTP  -`LMd&0 H" @{P 0STYPPW 0SK 0Y,0 ,0@0 p p @TP@P!RP YU3jP\1 PF@p`0OQ PP P  @, T000000S0ST0S  @wh 0TP0PPP04 6  6OPy|6R -LMܡpP, h 0Ql$0S V0 P# /00S@0@,%V E0 @0 o 0 J 5"@0@ /P @ ,,0(0  0P` d,@@.@,0S0S,՚$ 0i<|6\=P?@S p-0 P!`UL*@PP 0S 0 @0VP \ 00\ <0 0S \ PpL6T6= p-@L,},!PL0(S `0 0S0 0 00 lSp 08#80C S, $ < D 4  8#80 0cP 0` ,_ p````````|6< 0  = p-`ML@P0 dP T0 `0ASx M00x00x,S=$1 \:q`\!50: 1 Q@(@F@  ,6" 0 0 6P,0 $F! 0  0  P00@ ,0#0Z0L 000(K H{D0D  =X==0=|6===P6=lS== - @6 80(P@ 0L 0cp`@徠먠@@娠P300@ 00`S lPᩞP P,&|6==0=======S P00P0 S-L30 P/쐟0S P-*`$F(pP@r,6 R0`00Uc뀀m$FZ00D0# 0 `$F0P5P@2*X=0|6=S -1` LV@p$`.P  %#T*V&0 R  05"| P%#0VL0 R @ 05", =|64=SS T$T 0-PLL@T d0h0 R \d0T@0d0x0000,0 P|6H=tT\=@TT -0L: SpP` RHh PR@l qPqT -PLM@ l1 Q PP1P*<1P 0ES0S PUPQ z W W  W؀0 0`DP( 00P蔀0 0`3P( @$K$ `@0 0 /&8$ 000a 0G =X=|6P=< p-0 : SLP` V pu6pl0@@0P` 0-LM@  T00T0S0 T8{P'0H{P 0 R d0K0 寁 D804(TX=TTH=UUDT -L`p1&@B_?^ PP1d(PĜ@P( 0姞0V 10 A `   g! $ ((dPd 0RX` 0 A8`d00P|6=H6L6@6T6(U -LML 0C\ß, p@  L(,P dß, 0R(KPCL8j6@GTPo#1D 4H <8  #1<8 6"0\P`u!#Znk 0 0@ @ 0ͬLH2 Ra D8pW8 :O4HLT >L@?88pS@Y RLH00S00   LNK @D@D01PLg@  Q $1D(000yL4 0] D(000mDH000gY<< P*D< 10pSH8  H(pR0S L(BNK0@D T P( P@D0 2LPPP0D0`0DjP2L@ $|6L%lUUU=HUD=`P -LIM0dS 0, 00$0@30: S S?  S= S&Q6J~KpGpG 2,P&`0BO? 00 fSRQ` VP8  0R0 00 Sy > @, 0Rx(Kq BNK @D@D0Q35P@1&C1`/E1P@! VPP1\p&t 21C` OYR+00S00   BNK @D@D0  P & 4P0U4 6 #1@`p YR   0? ;PSd1"@p  Q ,(0$ m|6lUUU=hP 0- L4M00 H0 <0 80 40 00 ,0 (0 $0 0 0 D PK@ HK@8 ߝ(0(  00C0K0HD<=P= -LP@pT` @0S N 00C0 㴝|0  had`P P0*L R  <B 0S H=UP=<=U4Q p-L@M P`K\!0S 0S   xU -0L ;Y6$@U -6LM xf@P, j00X&Hp" b0@S"""t"T"@" "%%p5`@TV ƮP 똥0SF1p`0Sp`FV X @ 0S 45 Rjp P 0SL0S P$0S 0S~u0DS 0S 0S U 0S t4D |T0x x 0S D4\ 0  `Q$6S@ @ 0&@R3 3 hbQ0S 3@T @T &딃0S  @T t @T X#00#LS000Sq,3f$3c3`0SQ 0S 2 RzR PG &KP`"0S d:"00028"000"000l2h2m `0>0P"Sn@00!0002  0b1  d1 RO 1P4K0Ad2@0008 00 |tl d\ TzLwzDt8Z0W0(s`d(->K P j =VTsH=4=|6V<$WP=<=WX==X8XD6@XpX======(:L=T=`8`Vw@=(VWV=\=VWWhWHWWXxXVVWfXLV -@L`pPWPU#!1S<000!0,!$0PU0$0 @W P $0PU0$0 @lh 6 Sh (KP_t3 R  X (C H 008 P0\ L (< flPU=  PE 5(K0 zpB0 0S1P ,00XP!D2!0/1 R ~ _ 1 R V0 m 0S1 R ` AQ;P:00@@# P@ 0@S 0&"!0l 0CS @bP p00d0 St0p0    pZPe QSP|6=<=L%P===H==<00ZY4=YLZU<< \$0S00$L0S$ `0! $5 ("( B R\ATA@LA@DA@.9! Q ! E 0!R!0P52 5:1  11^ʤğ0S ,6 1R 0l p JKJH$ 0 f,6 1RK rK }P$0Sh# 0 Q&FePM0S{ 0# A1&6eP`1!̑0  1 +d3 0ASH$IKKK$I ?,1   1pG1[0S1 S,6!0  ,6!  eK P l2&1ˑ001&dP,B HL4F eKP 1&ᨑ00&dPA{ )!#o,6KQ01,&K p,6hAQ000E0S%\!)0 R !Q0 S  1 0`S rKP A?h, 0R(K! |@1! 0 w000SL_H %|6=4=]]],^=<]]]^$^\=P^^P00 $ 0$0 -LJP ^ Q-L@ "P Tv^ P-L P i^ 0-/LPB)@P 00+8./00,+ p+l000^ p-LpM/P#)@P KkP0: S Kp0`rS@ᐒ c P0-L@P0 R 0 R 00hEBt0 R0h0l H0 R <0<808)0 $^D$^ --LM0 0 ( --LM0 0 K --LM0 0 K -L@+& h/ -LMH0@K0PP`AK<P0: S V@@ S00S F`PP$KQP T P`0 R000 ]K@P l1: S 8a((rV(:<__,_ --LM0 0 n(@@-@0 0   0 0 0$  (@$, (@0@, 0000 D@0HD LH0L 330## 330## 330%% |6p@-`L0(&SP d0 60PpP0\ lSQ!A\SQ0|6 -T L@HP4T5% f4edA\_p_ -L`p@ἐPPP5:Pa0@0S 00B S0"a>CPP R R,1,,!!00@ S c.g P 00C %`fᒍP0Fx3 @O&6F n  P~ @06w  ဍ?P00`CP_$_ P-L@ 00 R$hm1H=_D -LM0 Z3 ?ʘ3s ;@P (K謓k  `収#3R 0X 0@cX, 40 "8 @0E8  OƉ 6F&V3 ($6 0( "0080S2 4 ,0|B 0S<PUL2   00  0 0 00 ,0,0 00000 330330 33033 @0L@0 D0PD00 550550 55d00d0d0d 0 d  `0d0 1 R0H0C+`P 0 R04 0 / d0\=Pd0L `P@ 0R@X  aA* T@==P6\=|6S`X6\64=X```$``` -kMLM0',0 7K@0AA`@`6 P6P6: S 02PR ።먦P%0S~ 6 Rn 0`St0Sn dfd6d&@`v@@ @@@@ 0SL PJ P(0%%<0000PF%0S 0Se.K B BPL, 0R4(Kp5p@d5 R\U,3S. &(0<%04%S $R2 %P0S ~g4 R}T^T0Sph" pK0S 升P, 6S!@Ƒ` 6S3Ɠ,6@ \   0P VX`ZP `3 00B10@Z3P LHCP`3P HD3P @(3P 6cS00 ,20!6 S 2"  B0"S[ PY &<" p`\P@5͜D"D2yܚj@@)1 R_a,YP @0S@@0@S H6<4"D0#@1 ]P @0T!1zxtA1\kHg@8`(Z 1R  zX6=D=aYP6H=T=ha\===\68==@=b4=|6X==`ctaPabbXaac==<==L6@6T6H6==|6|=d -2L `R^Ջ@p@3 T1 RL1 RH0S?T 1 R9qQOQ0SK00CS0JX0@X0FTI T00CS0)0 R0' 02P0S G P 0S DPP c^G PyTYT nTNT aYTyTXEG@XEG@00H=YT=D=L=pdddd -0L@Sllll|00S \DX0 R L)00,FP0000eH=de 0-L0L PR@  ,)(+P 0  H=0eYDe -LMpP`4p 8 <0 Tt@_0/q,0p , , 0K裡QH< 4<P1  8 80K40㏡Q0<\%0 4۠ ` 0P @_4 0K@P o ć8 `0<0 S (Ko(K,88|==`eheeXe -0LS@p PU 0 嗇0U ` 0`` r0T xP 6Sƕhp@X0Ɠ,6@ \   0W 6S=[ee\=|6D= -TLP@ 82 R),r@T T~ `U@ PU` Qm!0Y0011 RC1oa  ? @_ᛒTG p1 Rd"P  ?㌒DA P PaP[Q30 R% @C~@H0 R 0 @P2!0 X0o落UdP `fHFD=\=X6|===4=P6=H=e\6|6f>=4ffe -LN  -LM< !<@`_',0 , , @0 @00K8 >Qb8@ @ P4 V <W0K80+QS@ 2PI@ R 4 ?0440 <啀 m@i< 240040 0@Q$ 8V `P0@_8 0K@P |0 d0PR U;< L 4(K0< <=Tf\f8=feXe p-d0@LP`\ D0l88 000 0Y `Pp|6D=>P6 0-PL@T 0!S0S @T@T @T 0 d 000X 0000 0 @P@0B|=|6>=f -$1LpM R  1 qf0S!  p@, P1 P@T P ឞP pkp`0SxKPL0X S;30xP<Q808p00 $Kp,>h}>> -qL0`S8P00@T P@T# 9P0SP@`0S t ᣛPP@X,T0 @T$@PPp>0HЫ> -\v0LS` PW00CS00@0tR U T` T 5 Rk 0 0S`0 CR` !X0M  X0`0 CR` )X0-  X0@tO 5  0 H 0SX`0 CR` X0^  X0`0T C?@R` ş .X0 X0p P0S C@t0S40#3P50S$6#3P4 R 0Sh`0 CR` X0$  X00SG4ğ`0 CR` aX0X0pPPAPP 3j0 S3 0`003 R TR 3 RW # 0T0Q0SO pp pA0S06#3PA 4A03 R 0SL`0 CR` X0^  X0`0 CR` X0I  PX0hp0R QAAC@ $xApP} YZNMDApP 0S< -${ApG^ uApB 0Sp T?@kA.^gAp4 0S] I_Ap, P"P4p0RAX$gApp0RXM]Ap 0S `0 CR` p0RX-KApp0RX^BApp0RsX^9App0RtXI0Ap P^PJp0R RXAT@Xp>P>>>$> >>f > -0L0@`TPp B@T GPPp@`8U|0 R0`00@TP)@PP @0p,2$0 0H>Ыp`> 0-@PL`!ep( b0@S܂̂0\1\ X"@L1 (!<p,1,!0S1 R% wAP2 帹d 0000 0 000 0000 Rl0 RX0 R00 RJ<0[f$@f>>> >$> >>f -LL0 L \ 00 (0 $0 0 $F4F0xC(F -0L0 (F -0L0 (F -$$ 0L00  $F(FQd d00A00d0XF( 0 QP mq-@0 0 S RPDmq -(0L00S 0 (F80S 00S0 $#$("(  @-0S\\ @ T2  R T2  R 0 SR 0-h0L0 X0XPT0 P@0D u40, 0hѓ0 FTFDDCDF0F5i 0-LM@ᨄP@K㿀0[P00K_PPdL\@\ Pu0 000 (坓P K0qqCDF0Fi q 0-L M4PK @0 ႓Pptl !u[T0DT 00000 40402KkP$]K0C0Fi rDFCi r p-,`M@_L0 Pȃx(> -T L0R S S0RS  P0 孃q(?(r p-L$M<@K$ ``P׃\ tP P< 0,` P Kp0FDFi$0ri$Dr 0-L M4PK @+0 Pxt t[T0D\ 00080 <0<02KP(㮷K0C0Fi XrDFhT>h9ttp p-LM*@KxPx` ~h @ pP  ~0 01Kp ̲KpC0F:i t9i t -L M K0, @6$0 x\p  0K06@K|P`x  `~d @ʍpL  @rKp0Ꮂ KtC0F:i t9i t -LM"@K X~TT0 L@堍p [Q"0[S "0[ S \KC0F:i tt -LM0@KQ 2~!.~  P o0 sP d- 03`p@P0S (0  # 0S-|-80lS v P8PU@K0?DF0Fiu0uDuLuTup`utu -81LM@8Kq`P  }V@! V/P  0p@ 'PK 0~}P !400`ᆲPO@P 0 >| LP  Q$K舍uut p-L M.@K `}P0 @Ȍp'  fn00SA[T/90K 50SK XT001K,0H 堌p4mKpC0F:i t0u9i t -L M Kp,`0 q5$@\P  0 t000S \ڮTL}PpH0 p@h  4B}P$0 t@l  K@Bu(FuuXFvuv p-x0LP @ T 10S ] p7lx0 XLX<S`RV( @da@c]bd0SB0S 0B00S " i75P +X00SL  8V7x07D phpvpvv(vML@M|10ld@K P`|L Qm 8始pP 0S=:>[KD@K$PE@PE >kF| B| ,P 0` 1m 凋P x40S >KK$@D`@@DPW?-0tS  X6P|@40HUZ<V$K,AT 1S1S1S(Q$!000C S0:S Q $ s4P`T 0S,4,{3Q]V@P T "R0S x@K0S,PEK 2S*0S' ,80  10 )0 "0ZhU"Rd0S`t2S |[`1P|!A tg0l 嘇P01S H10S  3|0 10S  x200S 00S `p@Y(KC0FDFi i8i4iiiii$yyyyi|yByyzzzz(z[y8l4zP/K4[S SoKL[ <P RP,gK[K[ 0QppPK OKL[K < PRP,g 0 $KDDFC 0 0 !8 a Pp8  P`!$0 Y,0pW @40Sڠ!0S`0 CR` #X0  @X0`!0ST`00CS`0<X0  X0000 S00 (K O @ J p0RX Z @0 R0 R ` 0BO?=q }l #_@P 0P 0@kX 4 00Z$ 0@@0厗ȍFp@GGG -0L x$@l p-LQP@4 `@q 0  00 R?`0 CR` X0X0@Q 0S q l0  0X0 R?L@Qpp0R0 SpPG -pL@P`nP`  ^p00pT@P a@Tl0 P @ dP@0㕓#PU`pW*LG@pЍPG 0-LM@P  K0K PPbp (00S K0LG -L MP@ `$K 0PPbp $_pP 0 PPbp ,00S p  KLG@0P0 R0 RPM -LM0 Cr  0Y0 Cr P Y1 @,K@P\,PU 0   0 R$ PUQ ]PD 01(1$1 R Q @0׵0@S,Z&p`@dP @ T0 Rż]pPh` d0@pAP 000 ,֗$ӗЗhldd@\px -p-M L M0` R P  0 R 0RKp  \|ST ANK@D@D08 Bc $pt@p p-LM0 0`L0<0@0R  `   0``!Kp800 S80<@080<@8@<@LQ6 K0@!<@ 0Q =9A =CD H H00D R_0 040S@<@@<@_0Ϡ AIl$!B30b0@@<@LQ 0,D a<0 R@0<@L0 x?Bd@BCx -LpR`PW PPJ`,^@PV ` b` Ạ`P/ X^PL z0V\0PPPPPPP$0 ( h(0S<0 0P000 P0000B 0S0@ 0,0 (X0dh PX X0$8 XXM@<4Њ  -@PL 0S@R 80&b0PdS J 0 &@ -L$MP`U@ 0S XxXXXD  ұpH 10@<S< ቱp7 7pg RP0S6  0S 0S  ) :  )P .P0 80 @ #KP\0S1@TTPo@ PPz0KU &@T PL0SGD00Q  R4 0S0%000S p DD5 C00@00=L0090060030D0 040SPL0S DU9 W 00S2Pp@TU 0 R 00S 0000S_0t$ pD0Su Q H R 00S T0Sl R(KHFP000 P0000000`V 0#@i0003 R 0ST3  0S/P  㐳30S 0@⁳0S) /P :*P )%P IJPᰳH ,0R  (Q  "31C0La1 @KiP=ں3[ 0KU "@T"aH0S00;,00cS b0=9 = B 0C!00040 Q $0< 0bS$00$00p,0X00#0S @0:Pm0  l ~Tp xLpd|`tMTTxTGЍxMbLDX0 -LLMsC0 0 嵯Pp Q20S/  0)SP`02 000 R%U ^ PO0PU3 ^ K.00K@P0"@3 0RK")S  0)S00.S /S00Q  Q `0P0PU8PU ^ K.0d0K@0!@0!)0!V- 0S% ^ K.0>0K@0@T!^ K.0 .0K@0!@! 00S@P ^ K.0 00 T00 0RT0m04000gx^ K.080K@妰0@ U8MMhHM܎$<h -L(M⼁A0@K$0 `q@0KP0\@0(P D0 X0@0 ) R ࠓ 0 .@0@@@ PP00 00 P0   DK+ B|]P0 0+0 iPX0P 02S T0TX 40$040 Q K00 R %TMdMdt -"L(M0Sr 0S\ "P@PPP PPPP@XP`T: ㎜8P_(@K`$p)$ 0ptP_0)% p,` tP`@ : L0K0P < LP HP DP @P 8P 4P tp@W x!10@Pp|!0x1 0p1@0 `P `(K0{YP((!p!0p0iY0P vpL0 lpB0 bM8l0| XC.D0X NpꠎMTMpM\G8MMM*00 0 MM0S GS  -L$M,  (K  K0K,@K$ @(  \PK -L M@   (K K0K$ @(  @[PK 0-LMPKcPP@@T ]P 0SX0P @ \EB@8 -@@0LS  GS ,, @0 h[ȉP -LPM☡0H@Kp⌁P `(0 HP DP @P (0 >8P0 0 Poh<̎@@0` 'S0-LP@ 0h*(@0dS<Q<8J,J,J,J,J,J`J,J,J,J,J,J,J,J,J,J,JJ,J,J,J,J,J,J,J,J,J,J,J,J,J,J,J,J,J,J,J,J,J,J,J,J,JJJ,J,J,J,J,JJJ,J,J,J,J,J,JJ,JK0h001@U 0$ 0h 0$ |0hpl0\0h跸T001 80h,0%<EE 8 -CML Mw@0 @ 0 PR񟗋MMHNhNMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMNNNNNOOO(O4OMOO, 0RKQ񟗜PPPtPhP 048< ("#Q{ Q Qt *t 048< ("#<4,$ 堷NPK .0"P  .0P urp 048#8 $#$("(RC\QPQDQ8Q,QH\<Z 048#8 $#$("(RQQtQhQP\yC@sSpPmMjJgGd.2  @ Q32#8 pl2  / 0`S fC -*Rb L$< 8 0( Q 3-SRNPK .0yP 1 |/V( ppMK @D K`@D @@ 0Td P 0$. v:. q+NPK .0FP@ 4HFȗܗ $0@P  XIHF@FhPDo|8ИphtpI\pH*dܘ -2L4M  , P@A 0Sp SV 0gԡ0S[`00CS`0cX0  X0TTڜ1PZpK""2! T`` h`00CS`09X0  X0@DT$PV @D <4("4! .0P V x 0S @D T, 0R(K. 㺎X  d T`XPX 8>Dopxdh\TT -FML M,ENK0@Dp, P4 HW `V Q 9   , 0RI(K0SX 9    np 4 P| 0S - Sl ,I0     ȟ08 R`00CS`0FX0  X00 1 P ȟ0 ȟ4Q8l #8 4  0x$ t4 DH(04$48#84 TM$ R000 P0 ǟ0 0 BP0 0r@D  Rf CP 0GP#|7  $Mdǟ R000H'P0G0000H@ 0Q :Q $j巡2 u2v#4 L&0  H@ 0@ @@ <@ 8@ 4@ D@ |D0G0KHK0@K00 HK4Ɵ0S xt$U0  E0 P4  R b5Q% Qa00X P$R0 S 4PP  0 S Xw FKAhd , <$ 4!$EK 4A,,.<A`$ \4 X4 42;@TP4 49 09D 0x t 9x$t4T; 9pD xtPxt$LDxt Px$t4 X  048#8 $#$("(R * R 0HS0∄ l4 P4 DTmK`F0`FHp4 P4DPT :@TJ4[S QO(K#D@PT $$ ߿P4Qw ßp$06@Pп`@"0 N ɿ@TK TPPD0jS'U <4("4!L,Ś0G TA`媿V@! T,D墿l$R t ,㬚l$$唿d1 R X`0 CR` X0)  X0l4P ST,{xPp0RX)6 ) lh`d`\P q 01  0 PP4$RP `x$ j jrDoKHLp`$Poo OLodؙ @`$,NL@@Ԏ܎Ď̎P<[Ԛ̚TPd -NML?M? $ $ $ $ $ ,  h$       \/^p= E0@2S2sbbsxsbbbbdsbbbXsrbbbpbbbbbbbbb`onnnln@n0nm mbblllbllXlbkkbkkr d. pX>@dXXpHI^P00 p Ο1 1 0`JKI I8^ " 0@D >!Pt0 R=|= `0Q  K=VP-0 k4S- -K B B@@@@@F>K@0C @"0C D !Pl$0S 0͟0   00 )qcPul,0  %cp` ̟ 0Sa  ,0 R t,00`- AN.HP : T̟0Tڴ+00B0S ^w[+0 00000000`@TI`@ T @D0XD @;˟@ 0\$ SE>K0C0C5  \ d)* 5\ cp D-K B B0$ * R44:0  4 4 ˟: 4bP0 ʟ$0R pspW@$R$ 4S P 0s 00) /d:   t)00P@@X04 .PH] 00) 30 ) B0t]pP UFnK`Ft `FP@  0 PGl4 RL\PDPlU@(ɟ0) h$R ɟ0RFNK@DPh(0PfbP9)0P]bPsɟ@)$ 5\ @QbP+d9)% 5@HbP9(@7 @|AH;Q @$@T8\(\ǟ0@ g00K @w娗FKKAHJ A H0 J PUT@T0SX'0 08@6t (K@HxP PP7PƟ 04 H0K4 4 4 ̤ D (Pz $46 R Ɵ0Rڈ&6  0 aBQP6 50SPU %5 &0:;:0{%0<0v%0:;70o꜕EKAA 6Pb0 R^ `4 RZ%PY|X%000QDş 5   H %080C ?PRДEKAA P-0 R) `4 R% )ꄔEKAAP0`S `4 R 4P/t@@C0 0E5 36/T3P#000CEKA A>4@ R `4 R0 S Lu|`304 ꒂPd#0 00vD#0600#0@00bEKAL L0 P d$2R 0G|뵮R0EK0AA `4 剜@h 娮0S 0 R `4h$TQ ()|P2, *++ 0S @A0C2S2plpplplplpplplplplpplplplplplplpplplplplplplplplplplplplplpplpplplplpplplplplpplplplplplplpp0SL!0<0 0:0 0;0 0:0 0;0 090 0:;80'NN\@$ 4 /20GP-   z 3PW03@R ]PKT0 G dC&0S? |5{&_:0S6 ,{_13p3"=K0C 0C 4 HI3 P |1 0`POMT3F>K0C0C@)& lD _P8 `| 00) 0t   0,0Q @@$ -C4P @p$)+ 5\ ^p|X$E>Kd 0C^bb0l4 ~@Ph5P 4 xx%S00  4). ^P u|0 Ps `) 0`^P0s 0) `^P (Y|Q 0)3 ^P hH|pl$tPF.K B B$|P|LXGKA  A|4 xD 4 D ^6 R=;yl$E.K B B% ) 5H^p3L|tYT yTlyty y y y y zz00~y00xy tyAY oy{ {{{${,]y4{'Y$0DTyPQyX{`{h{p{x{?y{9y$5y{(0 SW˴8ɠE>K@(0CX @]a 0-8P8@L4 G  0@$Ԡ[ - L.h -AML MpP!E0`00 ,0 7rP dP jP4`- aP* uP zP# tP#P, 000I`|4pp zp `000C Sp0 $$倖p00S4@,0S 0K~P {Z墙p 1 dR 0+S 3D4  D$ H@TPp00F S.VWpqP`V &W0P 0p `.GP` 0RR!>C 2#=S0W!G@ PRh(~~@ Td0 T?#C0 2#0@0TT!>C 2"0r03 R0S 00C0@0TT!>C 2"0r03R0S @0TT!>C 2#S0 0RR!>C 2#;S0%XQP l781@T%$10S @KՕp0M @0 c8K8 4@ Rp 8K8 40 ~P7z P %ΘHQ 0+SD HXڜwY T yD%CNK@D@D0D$6"P04[`8ooo,0<ELdġoC0 S S  -`0@P@@T0 La <00S 000S.99oؘ -L?@PM/耣 p-L@$FP `6p p-2 B 0L`@0PP 0S00 |2P $ -8L2@E0P/S @P,EP$2 B 30S ", ,,, 1RjP @EP`F ,V 0+S-S0SZ*PW*P *_L10S S*PT1  @` XPg,P`T@D00S<PUPP 100S 00St0Q. +'29s8P1PQKp贘И\ 000Tt 00@`, 0-L@PU0 0 LLE0PHKP @P@DHP00 P00e-5@K 44444P4P4444444ŬPŨ40$4P 4 P4$0tP`4h$0\P@4P$0DP<$40,(P 0S$0030 K30S P 0S#0030 KP 0S#0030 K#P 0S  30 \C\S\3c pK LL0`444#43Pp   # 3Pp # 3 Ppze"0P00IPBYP 0S20 KNP2 PP0PS@  H|"  `2 @A00 0 P"bH2 K@-1 `P0`S@ 2  BG!  `1 @A00 0 Q >1 @K1 P  `PPPp0P0ASP `100ST1  KHPt$P $T X\| `ܘdosZ8X[@t8DthHtLttlt\ t4ptttt(P t$tx\(t,t0t4t|8t  06S000 ,0 0@S200 Xt 0PXt 0- L0S( 4 @ 0   04@0Q@ DLP 4r 0T4v40@0h%0Xt -0L Up0q 0 -0LPU5 40 0@044D 0S040P`0$44p Td$T(d,t$0@044D $ 0Upqh5(Xt -0Lp`PP#70 4@0$($,T044Dt T$F P 404(0$00 4siXt8 p-L@ 00s'0@$ -4LtMP3 Q $$0R($0R,0Q00 :$($? 20€0 S 0S0,$R030 5: Z02Z00 L R 0s0s* 30S 4 3 R 4SU7P3 3@ 40 400@000  D3   0 0 0 $4(D0@0 00 2$($6F`Ip\ 20S C. rs SʝR4S4S 4?  0Tp@Pq4.'H20dtŸ q 00010*b%ph P'(1 4D0O4D0P00/0d4t`10S% 0S0+K H&S<10S01pKP1 0S1 0S 0 +00 00S$00 S 0 0 0  0 0  02 0 ,0PK*0(KXt  ,0$<048 0-0LPU ,4S0C$(QP40@eP $4(D 0@$4(D0,40h0Xt -l@L0S{p D0,$R0,4$4(D 0@$4(D0,4Xt -1LpPW`` 10S CVYqr V0U00I0O,?   69F$4S4S  P4S* 4S&p" 0ꀀp 4S4S:AX0Q$(0<0@00,00Xt, -LP l0 P 0R 0R Q0$4(D0,4Xt 0-PL@T 4 j 04P X00S Cpq 0hH0 0@ p0Xt,p$ 0 010#PQ0S4:Ss0p 0 00 P p-L 000 x 0Pd `,P @ r 0 04 (0$ Y; PdH\tLP00 , (0$0 0 0 vdtlvdvpvtv0 0 0 vhvdvdt -LMp@P `@_00C0 S%"0 .S0K0 $ K Kdt p-RL@Py0` ;TUp -LM`p$ @PL0 `pdt -L|@||PM$pK(`K  R(0S0C(0 0$ 0b0 0R 0 000 Kdvhvlvpvdt -LMP@p`i;   e0` p-L@LMPK@%T;`@@00S xdt -LMyP@܀,pK(`K, 0(  R,00# (000 0S( ,0S(00#D@(`K,PK 0S#@0 S$Klvdv -H0L0S00@@Y$ 0@00dtpvlvxv -P1LMH!0SK$@K0$p,`K0PK),0S(0S 0 ,00R$ 0 ܠ p@4`K8PK4  80@00l?T 40S4 h0 c\0@d0 ]H,0 ( c,0 0 ]00S C$Klvdtdvhvpv 0-P0@LT0 0S0 <@/800 0P0s300lvdtxv -0L M 0 PK Ѐp %@(`K(0@00l?T $00S, (0S ,0$0 ,PK(@K$ 0S$ (0 c,0@0  Kpvdthvlv p-LM@ 0S0 K K 0P 0 0 R0AR00S t 0 d@0000"`K PK 0S ʉ"000 0SKplvdv - 0L00S Llv p-PL`@90 Rpl00 AP@*D0P0A0Q: gpdtlv p-2b0@S2LTP00P P} P PS PMP $ Po  P> J1PD eP PyN{yJB00S SAA00 S nrQA0S0S S gQA0S\0S SXx1@@`1pDA00SG?/=-p1 1R0R S P@0S00S S ,P@0S%0S S!, 00 S@ #h@00 S 00 SS 00pPphp(tv|vlvdtpv -LMP8|||p`,K  ,P }@TN!,0PT@:0S0 0 0 0S(dvhv0PPv -0LMK0 ! KȘX -LD#P x0pq  T0 hH00S <@ L*.0S.0SPK !>P 2 P L>d P p>0S E P =D>U Pz 8^0S2 @T1$@$PZT 0S:8NP>0S 0S6>(0P 5?;r>`-0SD0eSKpd](4-@TD0eSe @D 0S Sf Sc S S/S 7S[ S00G.W S}dPx @,0S P0!W@  +W W R0R00@0#0<0WT <0WP <0WKE+Pn@ @K0@0SP +aGQ0+sx;/$P%W} W W W !Ws W*W @W07S,g 07S+b07S ]*Z W W LP 0#0CS<P9&0S <P P )0K*pK*K 0K0 @0PuT 0DcS|pLT`Xl,ܾ`@P llD(@8TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTܾ 0IRQ|80S0SL80S8q  2RQ80S0Sf +0S0S0@W70S 0S0S@7=  ? 0S0S0@9 ) 0S0S0@)60S'0S!#0S 0S0S0@0S0SmP60S6 (6  5@T 0S5 %0D020D0 50S 5RQ45t50S85 5{RQ44~ )# k0S0S0@!0S0@40S0dSd0@h4\4m EQP < :{0S0@(4 8 /,m!8 8KR%f{"00S0S00S00 0S0@# a0S 0R<00S0@52P0  0S2P0   ,Sl2 0S0@02P&0S0S0@GP hP P %g 0S0S210S0S0@P 0S0S1x18K80 b0S0S0@Pdzw0@ P P kx h00 1! j X0H0p0PN 00PJ 00 PPE PC ,Avvvvؘ4v\<vv[,TH $4HvdX`lD8 xvv0L X0p0P h00P t00 PP P : 0GRQ000S00գ?0O0 R0S0,! 0c0RQ\1h10Sp10գ?0O0 001 0S  0 `p10S !1 !0SY,00"000S( -LMS0P`p2p (K0`!00 40 0@80 < K0 40P00S T AQ:0 6 R0S 08 R PP,00,0  ,0 P ,0S:<0S r 000 R00 ӑX 0e!0S 0f0@,Y: T00"! 0T S@D0Z00e0X,0 e0f1(KPD -L@0 !0S@-P@p`E5 p-0SS%0P gP' 00dP ^S0gS 0S 0S  0S  \:QfPd 0@ 0< -0LM0@P3 00P/ 00P`+ P=pK,KUF@@ PP`  0@Sd`0dV0S0E@U@DPE,P `(K 0-LM@PK ^P8d/P  0S NP 88 -LM@R,  *P @- R P`Pp /1Pڤ`0 C @R`0P R0  0S0@  0R@S  TP1:, 00蘦 - LPh< - LPh@Ħ -L hD -LMph) 0-L MP0S$ @Kg 0s0s cdP@T L0UH0 %00(0 0 0 K0ԑv04PM -@LPE -LMB0PP 0S U E0,K0 K00 `P@@00SpJ<0P42p0,0 A P8  8Km8W%X 0 zO%D K%I%Z f fCP, 8 8K|10SP ,!P P8K8` yPYP ,cpZ$1 w10 @ 1 P0 , KŵP 0 0 0P@ $PG0 0R0 A{z0Ul00S(8K8` $(KЫБԑvĘԘ04ܡ̙ 0-LP@6@P \P0h$0 -`LP`pW!&`V@ZP PT 0  0  0   0  0   p-L@P`P U  P V  P php -L@h P-L 0h -00LP T hБЫ -L@%/ 0r/S@ R -LpMK@jcPHK 0|EK -L0P<L -LAMPP2  0bEpq) NK,㰴PKp@%`@ 0S PP  } 0S*# P fP` 0S:VK謙 -HHaLp@P#R %RT0TS 0S %R #RP I.PP@ R_묐0ਠ`P@#R %RU0US 0S %R #R P ! dt.@ P R  0-D@L0PS0P(000-P0P` -L M`?, H.@pP@0S 0S P W @P RX Y"'.@XP@ d \00T @Y- P  d,@000S0(K01| -LM@pP 0S `PKh-@-@@L0H P`-" כ@"K輠` -(1LMP, UARuOpP; -@-@,-v@`PZ0%S00sSZ,  R- -N-,-P@00@-T:@"T o5И -2LM0S4 8 2@TtPP 0|S0P0@ 00 0-SP < -P U-@R- @p`Y0%S 00sS  ,:-@`00@1-T:+P5"UV 00S h10S@ R@)K P ̚B)[980P40@p9d0p@d0S 00CS00`Ӥ0` V g0H v R @R!,p@`00ዚ0Sp(K脙ИЫp -L@, 0 pS` R0S000S,`PUګ,P@000S 0001 0-LpMKPTP@|0: S@@!K0 p-LpM0`0SP m,@1 P K)PPl00S0: S N,*@ P, +PI!Kp蘙ؑ<00S,0P 00S00CXx'00SfL 0S00\@ -Lp@P`WV 000CW`K@tPuZ :X`qgRpWZVX (00S8 mW d -LMp`p@P qV i 0 0-t0L0Spq p@Pq0T0U0000, -LP  00SR -L@pP`\T p200CW `20SWD200CW @w$200CW |UV jUVP@ y1P @1@T@ ZZP`!hpP`qX:p4q2P P AP!=T 0 0S0uv 0 0S 0S0x  Vp 00pWZYT+00 o\ 00Su|x@< -LMp`iP P &@;P9  Ki`p@P(q&V 0A9P 00S CP@P 0p@Pq Kif 0 K,0PP 0PP < P000S SP000S0 0HP0000000   -0L`Pp@)P `VV'(` W  00P`p0@ 0 @ `000pW 000 H 0-@PL tP 0T T00 00C0 R( 00C00h0 H p-L@Pq P`pyp P P@P40`0pl@Pp P P00 -LMpXtWr`#0S PHC0S <#0 QPW 0@PQP B0S %$@ T T "06 P P p/ `B0* P 000 ,0 p|0 , 0KP0K0PK`p@ !0040  6` P P=ڄA0S9x!0S5@K 00< 80  @P(!0S!0S4@ 1@O P ` 0P`@DTʵ0@0Y@XW40K@Pp6T00S 000K@P*(K萙hL`D\ -LMpwx 0S P#0S t3tC 00S@_ 0kP0p , @P0p P:0 K  00 ,0 80K0KL0@K00# k @0P`Pڴɯ`V* @T PXW5 p@q P P`pR0gt T"@sTP`80S4!P00PUo-b  + TPPx1@Tl0ST!0; Pp@@F41P`@ ? P?P`@0K@PpA00S ' 000K@P*00SZ 0 P` D@ P P p\(Ko(K萙hL,D\` -L MP`, *P,0@cT D dqw@P X(Kopw0x0XW0@,@p(Xy z  V0 U00 1 ,0@c 01pP`q @,0T (1(,0@d@ 0@7pP`q XW 000S (Ko@00CT{ h00S]D0@@]$0 0@@(K踧@8x p-L`@PP  P p "@P$00S phꜙ -L`ppq|Dp@PqTh 0<UT0 hܧH -L MKXK  K p-LP phP`pqP0  Bph4@  B@PQ php -LM`pp@Pq DP |00Sh0 W V @P,0 $K!oK蜙H0TP\0 0TSP0 H0 D0 @0 <0 80 40 00 00hvvvvvvv000 @00ؒܒd00S X00S P~0 @P 00 000000vlܒؒ0 0 vv -p堀0L@&PP  `PPrY `L% `G%P`@Lؒܒ Q-L?P=0@P60 `Cp, PP 0p V@P  @P@P 0`d0`FP@PZ<0000Y$000C0f0@PLؒ p-Lpq0 9PP-p@) 崠`t T 0 @P00CV]P y@P@P0@`@40W 00 X`@PLؒ -L0<0  000 $00 00 ܘ -L0<0  000 $00 00  Pp-LP@1 00S PP@&` Rڔ@00SP 00S@@P @0 R 4000SP@p(vܒ P-L0X$Pv P-L@ P0G$Pv M-LMP0X20 p@ 0(K>P U@P20S62 0@ (`K( PP P& (0 S P1P-!0 xA0(0 P (0 SPP b<1 F$10SWW 11 0(K(  4``P00S 0@0@0@Tʐ0X 0 K0 0CphRd\0 0X0H0P0 0 0P  KؒvvLܒ -LM0@#`p P@D\0@@0@T 7P \ 0  v, -PLM@`pS3 R 33\ ڼ0Sڰc000S0  R0  RtS(@K  00$ 9@ p,0 0l0. 0`  0P0`0 2 \0S000S0 2 Ÿ0S#ڔ2 t2Rx2  d2 0TP _TPP^@20SPPX_TP@` _RP0P0P TJ10SnSSjK11 1 1Q0cڨ1!0\A1!1@ ``` 0 B\AQL!01`l  @0J$!00 0S10! VP`F(V(00S TP 00S STT0  0 -P(Kęvvvܒؒv(vВPԒ  -2L M`2 0 f0fR R @, oP"0L"S PP02P 00dp@40  004 0PpL 00WI 0SEPP &PpP3V!p0ŀ!0S0Wx!0l!ӷ0P#L! 0 P0!09!P0W !0P P  P0W !P, 0iSC`@,0Y| T0  000 @ `@HH0T,80 0i `0 (Kvvvؒܒv -qL0PS`@ 0 0Pp1 T 0P0p@0`$0Q 0p00\p0p 0 ?R\0X0 00lW 00psp3vvę(vDvؒv0v -2LM0PS`prp10S' 11 001st TS !0S0S1 @0t1 0l0 L1  010S (1 @ T 0S0S: p\ 000  P`0 Rh0P0 RQ0@^0 00 vw  Q-LP`pr1P PU 0 S0S:Q R`\ x1U 0Q 00X@R%Q#@zPE(`@0 -0`p9pq7  0@P Y0$X!WP"`@0 0`ppq 0@P U0T 0/`pv$$0S0  00lt8 0-T@L0S0dS0 PP(000P=000Ш -2L0`Sp pq WVP2 X 0S0S:0S 0S{ 1X1 0 0Q 0 @0S@T6S4P[1刡@0l0@P3pqI  0 W0V  0U5T30@. P'0帠@00@P Jpq R 0 U0T 0 Z tv -L@P`p@Pt 0u 0 X00S L0XR@P*TU0@0 50S(, -50 S  R(a0@ S-00LA0@S0F 0-L MPP @K0 000K0 'Pp-L7 $P'.P ^P"L1L!@00 0%cP !1 !1L0 0 0  P- 0s0sph0^ ND3s H3s 0@D3HCP0 d00@#L3800 `P0 ,P phphH -L M@KB0s0s ?00@3K( -,0L R00F0@BH -,0L R0030@B0P 00ᴙP Pr 0  -PL M P P"P00  R 0ShX0RH0  80< (0K0 K0K0 0K0K0 ? K10$H -PLM@) T TV\Q@p ` "00C0 S10R!@š0,STT901 0b 00@0PK U  0Sp` T1` @0|T @KaT @K,0`04 0$K$@ KPԒВTH8l`l -@PL ThL0 D5@3<18/4-0+,)h6|Ș$\P+ P P0p 0-PLM@& P P*0mS MS hS =S sS wS pP hPdP`P\PXPTP@[$808 0K10 cK0ܙ P-L (0 00Sh(: -PL M0 " P P>00K.S K 000 0S0-0S $0 0 00S00K,@Kp 1@P0t @0S  K0 4 CK,0K0 K萪Ī -PL M0 " P P>00K.S K 000 0S0+-0S $0 0 00S00K,@Kp @P0t @0S  K0 4 CK,0K0 K (H<`Q PPP0SP 0 d 0Pᬓ$0$0S0ST -LMK h K舫 -Q0LM00SK0 W K褫 -Lp@P000C0 S @ h,,@0`0 C0 ST @DT  0@TU0 `0 p-L`P@0-S000C0 S ph!!00 C0 ST00^ap -LM 0R0*, ,0* xȫ -0Lhdꬓ -LPPM0 pb @`V0@ , `,KWV0  , <,KM 0S SV000S`B V? i 7 fV V V 0 1 0 0s03 V V V&@  00 0FSPV V V 0K$ KO$0S0e90S V0V 0 @00SSS 0010,K0,0 @V 0 \0   000CS 1D1111111 KԫH8 -`LPpP`$T X P$T T T-T00@f 1W 00P@T -L@0 袓l -PLM8 B Rp,K4K 00S S 0 8K@h2 @9P8@ 0Pz`#80 %5*$P  P P+P -PnP! `$0+SX080 p!000 l, 8 0+S0,0 =1[X!0Sn`z`@YPPT 4@ p,p 000CS9 6(666666\6X@ 00s03X@ 00$aFQ 800S8 80 S  08 800SL0P8K @0S,80Pi(K謓p< S 0 Q $ 0S C  -LyP 0S0  @刐匠匀pP`0S dR`P PP pP R000 $@$ TR蠬̬ -p@!`PL PQ  0  0  -LM d 0 K p-LMP`d@H002 0@?Kp'@B -LMp|v`e@b@@%0 P`Ƞ -LMKj -锠PLp` 0@SP0000ST{0S{0#S ,X -L P P Pp h -0LMo@p@`!0K!PK  000e@PV-00e i K -QLM@Pp@tPp0%0K%`K 0$00 f 0@PW-00f ?$K -QLM@Pp@tPp0%0K%`K 0$00 f0@PW-00f $K -\0\0L@S L0 P\-P p5 0 0 茘8 0-L L0PS000@00 R+0 P00 0Йԙ -L@0@S -LMpP`5K+%P0 p`$ pnR sR dR @`0@SP  1 06(`P K 0-0L0PS@ t00Sx P0@0S @00S `$00S0 Z08 0-L@PSD 0 0\Й p-0L0 S P` 00S 00S -0@@ct0P0S h00S ph1XJ}P0 @@@400T,0 ph̙dx8 -0LM0  l0 `0Pp `K  0T0CP`@PA8ؙp3 -LMP @` a\Q  0R QW@X@T11: \ 40K]p3Q 4 ,0 0 0 00S0!P$K -@LP900 -0LM0@SpP s 0Pp@ @8`P  4@Po9@@U Pp p p @00C000C 000C?0010@-<0  0|0@P4 p 0q-  + Q 0%P#Pp@q 0Q 0r S 000 JP mP808 PHZ0P:j|DЫtԘ[(0$0 0b0c0AV -p0p 0LS@ 0@s@3H0H0@0<0 80b0cA6$0 ܙԘ0&ꔘ -XL9P@L5D2</804+00,'(0蘢ܙ̢4@-p^ 001`0S10tu 0S 0Sqr, R*Q'00S  0S qr 0S0S:\^00H00S 0S000s3h 0-L@PL<0  0S0S0 R0蠘 -0L  0SWp3 -L& h記-  0R 0RQ^  QP 0 0S  SR 0 0 0R 0R 00 0- LP@ R  0@ 0脘ꠘ괘 -@LPf00h.$00S0 0  ꘘP -@Q 1LMPp@  PP=0T0 `Kp@&&P@ p 000  0S : L0R  @00S 00 0 0 蜘PP 0-@LPT 0S$  0 0記8 -LM` 0 , R\4 ԠP 0R0pK0 0f 0O 00f0pK0O 0@ @T U @  0d 4PP(K蜘 -L@MP`X T0 d@P <` @p < P`00X r T0s  T@0TX\00 Q R` 0@0C 0 , K00K p 0@, K00K p 0@P`wx R@0K0S @ 0bS0c S  0>PB0SH 2Q H l20SHH  S H  H QH ,B00SHH Hk@L H@D ,LD 00K@cP  AP 8K00L 4@K @sP ` p\XPB H008KL 4@K@ WP3 PQ 4H@8D00L  @"AQʸ00S C4H@800DL  @LDQP 0 `LD@@(Ktę -L4MP43@(3$H D @ < PP Z 08 40 `8 4 8 4 V8K0`2pq tu Q P`2YXtu 42 0@_` pH D *tu UT@P1 0@_ QP1 0 QP`p` p`VpH` Dp t u  80s04q 00 4 U80T8@K0t u U0T00" 0 0K 0 )Ph0qr ,0S00S0K@ < 0HK@K 0(K脘L -LLMvwJ 010 @0R0 , (Ko00S )p@Pq , R00Sp q Q0P 00 t8 00CXZ (Ko(K@ -0L0@SPTpW"0000S `zpI@tPq Ab9`00CVw0p@ 0-LM K @K0tu  0K0 -0QLMp 0S#BP 0y:*R B0S 0S"0S002 d P\B0S vH2 V0S YP `@P1p@Pq@P$10S S  1 ````KV@P 0@PLa0Z @Pt u Z J@Ptu t,@ (P u(y$,K  0pP h00S00X0S  D0,K q $0P$K蜘 H@ -L 0 0S0 h萙 -<L<P(h+ 00s030hꜘ 0      ᜘ 000 000 000 -LM0 $ KK0 0 %P$ K -@PL \TL h8gPghg -1LX@ @@ -6Izu0  @`Pp0S0S 0` 0?0080  N000S iPg8 -LMLp`KP p@P0[SPKT[ - Ls P00 D -0L $@ܷ -LMP@ὼP 0S 0S1 S K R3 ╼P 0B?S⳽P (K⇼P (0Sp`$K $0(RpQ tP` ⒽWQP00 -L 0KM#+N -L(M< @ 0<[ ,0 8`pZP<@d @PP 00@@P 44 04R0  00 4 8  00#0S83C尠o,0Z0 C@ 08 S00垶P8S0 00CS00S 00H@P!>>>L$000<!#0S 0@Sv #0P o00g< \x2 ` R p @  0SO ,K04 胷@T# I\24P"L"l2 0  H"<0P P R0|\Q0|  001 `80S1 RE |`\Th4 ,0K]@hu|b0 , 4"4@ 000 00D(Ki@P 0 t#g>:<m @PLP`D r @2@ Tp -@LMh w&>oo`p20p0`W` K -LM @`, pP` poO&>@P2Ό P, 0U@(K -GMLM䐟0,0 qoK 0P@4t K@PLL 00npK`2@PΌ  0`0Vp, 0R(Kʒغ -P<&> Y0L\"]280` R0<2<… 0S30@20D2 叏00CL2 0 0CH20P20Tr( $@S 0X2g0`TX2i=ST0S0@2U D _R 0S2! 0 D0S0?S4 0S 0S0?S0S -!0LS PU  0 0       0@P@c@@cPE@@PcPPcP@ -`!LQp 0 P 0CA2$,0 %@$U00e0PD100e0P00 -LHMpD W@ !!8 2@  `0 @Pp1C4p 0V< 8 `*`p,0 <040(@00`@P 0@<P 0, D 800$,p(K >d bU0 -L4M0t(K(0 O(0`S $pK0 p尵$@\P  ~n Kb0( p噵$0`Sp ( gnP# 2pL`K2A@ @N P0LK000 ;nhH -L[ -L!M(1`"( S92RS]2S\@NAP KP n/0p 0 00`( 0R $Ka@0/0`@?P 0-PL@Vm0$ -L MP$K@p`0 $0S  m K"100!aRRl@0S`VXaLmDm@_ ?0mhT\0 -L M`(K@0 蟴(PpU  `mm$K A2@ @ 1Ph p-`L|yP @ ;`P J00ap5 [h5 X8 40R00 40 I80<@ 18 IS0$00< 0>4 8$0 $04 @4 4 '4 $ 4!00 4 $0@|P hP0LP @1*84 (4@0p`S`@0 @HLD 4@GpP3H 0cl@80T 3P)`ps@P 0 S 00KPX0S0#3 >\PP   D,PU< @R@X00SX00SL0  %H20S\"0000SD"0000S 10S`\B\TRD2p` (,"0QP 0B1 aP !<&!)Anp`0Wp10SMeX 10S00S1  XSp3 0P @P PDPHx@U1 P 00S0SȎ$Ģ$`8\Тd `,آ@DxhԢlpX`px``pt̢ܢ| 00 0PT0P$ 00C0 R0 PXT -LP -LP@P-  p-PL0` 00 0@ 0T0000D S0`8``0 0 0S0ڬphpPTX`-0 CR 0R0 S伱00 -h1L0`SPp@Dzi@<10S T (10S 倱g@00S T 00Skg@T 00Sp`YWc80 ׺400S h  hBꨢpH -L3P* \ -LP* # -LPx* h} -L 30S:S0S6R) 20SQ b 0R20SR Zp2 2R T"&p2HR 0R08 KPK:r D2b PKR8 K-i00C020S 0S0`KH Z\ 0S00R0S QPK000`` ``` `P 0S!0S D10S`10S h10S`@f X`f`0P <0KD0 @@ TPK H  -0H +0K) K$=p; T0L%S񟗰D04 #000C+K *KH#J=p30V1P@`P@   0] Z P@, "P Py0P p@`P P P 5"000s20K ?p `B0 0cX2P R^ :Py 00@Td@Ta  P  C1 妧|!00070SQQQ4 F 0SC nS 1 4@K t!,hPPHP 01oD10AD0 @@ <0 8@ 0oS1 4@K 4 0PoH0S @H`K0 0 (K P | ptx,Pı0`8@$@`[8l|8^H00 ᜞0᜞0ᐞ -LҤP  ^ Q-L@ WP T ^ P-L P  ^ 0-/LPw@P 00+8c/00,+ +00^ p-LpM/PX@P KrP0: S Kp0`rS@   P0-L@P0 R 0 R 0C]0hzwt0 R0h0l3] C8H0 R <0<(]808$]M0]ꔞ^D$^ --LM0 0 4 --LM0 0 K --LM0 0 K -L@P` h/ -LMH0@K0 rPP`AK<rP0: S V@@ S00S F`PqP$KP T P`0 R000 ]K@qP l1: S 8\((P\ꐞ(:<__,_ --LM0 0 T㣂@ -LM @Tp`P0S ڈ 0P P 000褞 -L,MD H &L0 0@  0 40 P @?@Pl HP U@ `0YX 4\{ V 4 R08  C@Vp<@ 0S00C S000C S BV0VPpU @ xP0S PUWP80 0 %0 00 ğP0P00 @TT@TQ P<@PX! 4  Y4 @0T l`VR h[ @T P[@T 6`V$`>SVXg 0 0(K4 [k 00 U  0L P0 I @8 <00  0@@30f0cß`D0S D0XX @T` LP@ 0 ,K ppq Ÿ@TM@TJ 0P,@,4pp PB ^^I R0000 0W G 0020 0  0PP2  A R00C0VV X0Q1 `V` 0S 0SLP 0 Yt; 0`Z, ^^  0(4P?p][Y0\/ @T3 0Q  0& P 0@TRf LEPa 0 ||;0 FO0  h@T@[<  4 -LOMP"\垣NKp5QnK @ dp➀@T:+oPP@@K ᵣE0@l_ P-L <@< 8墣 ,,垣t0 嗣$l@H p-0LPP` @`P PS`Pp -LM0@0cSz bSz8 PK ; 0`S R  : 0 S PU0$ ā,40V,((0 "4^ LD ;P   -LP@@s<1<Ppp`!08p mP Z &8p0 !0@S( W VVW# ]0`P 0jP P /0 pRpp8&"V[$,H`84 @-1PR  P @^! 0n <,4$<, 4,$. !,00 0 0@SQ:00a0\ <# \ 8#,8# \ 4("$$#  4S,   8#8S,,8 #  < 4<( "4,  8 , #44,  괪ح-0^00 *0Q AS^*0rS 00n00 0S 0 \*00b\:\00\ q00l P: !00S괪8P8LDDDTDDD\DDDDDDDDDDDDDDDDDDDDDDDdDDDlDDDtDDDDDDD|DDDDDDD@<840,($ [(0  p-@L M0KP`  @ሟ0S"V8#4,|4 <0 @!0 0 Kp@8<#4,4 < @0  -L M A`+QOx0  Qp &0S 00000@0 KP  0SKt|XX0  QPp <04  Q  d뀪D$P -L,M0 K@ Ҟ P0U`p@K$ K(0K@< 0@ ,` ( @ 8P 4P PPp KJ - h -H@L"0 0SP 0;0 -0@LP pF`0 A0 S` a0A0SW`AA0A0S7`AQ\ |pll0d0P*P2 -L Ml pR R P P`@0 (@K@`7(\;@^ ^ T$K耠P`0 Q  P  R t:  T1<`0حXԭ|0ܪtlXl P-L 0=5,0, (幝$? 0噧z$@ P-L@ L02p pS,t_GP~G $ p-L@P`@DT(0-S<@P $ $ $  $ $ $ $ $ $ $ $ | t $ $ ` X $ $ $ $ $ , @DT!`h0h ph`@T y``(0 `}z 4 -pQLP@S \ 0LW3@ \ \\PB T1 RG0 CR F0>  0aP0,<S*0 CR )00 \ 0 CR 00 \0S N \0 R \X>0R PL>h00R>h@p -pQL@ᬡ0S:`00CS`0YX0  X0xmp`_S``!o0SD@`00CS`0FX0  X0 Q 0 CS  \  XQ P`U I &S0S0C000@` VP  X U0 㿜X ҜX Μp0 p-LPL`@LDR0  0R$  php@L -LM`@ RQ |o3Q P 0^, ` pP , Rp RP R0S0C000 \  R  R  R,  R P @U@00R pRT dB0P0 LRPW 0yZ  ${RX  tRY %@  iR @ bR`R!p m-, R TRhF(NR00 L 4GR8@T700 L T=RP1 R) 0 43R0! C$1 R)`00CS`0'X0  X00Sd0S`u o2 2<o 3@`8@% RH o講X o进갭Xl8 4H\tp  -L M4B4r0 S P Q 2 0RvK0A0SQQ0 0CSx1Q QQN QO Q , lQ 0 XQPL!0S 8`V;0 40 L @L@(`@~Qz0@KwQ1P oQiQ bQxx r xWQpTQhr2``8`ꄪlhDt0`ht -LM0@0 4 80 CDxu/ aT,  cT ,  gT0,0 ) ( (@şş0`4 ğ4P 48 4X0 P$`0 4 dX@ 4d0S0C0Y  @  \\@a0S4$0 <400S0C0PP  N0@Sß0 30S0C0PP  :0@S0 30S0C0PP  &0@SD#0 X30LS0C0PP  0@SŸ0  30S0C0PP  0@S}0  20S0C0PP  0@SmT"0  t20hS0C0PP  0@S@g@02 R (Ky0@gS@ W1 RQ bPR,0SlA/UeP 0SL 0R!0S|B  ) ( <@A0K0C0C@ @ap> 1 R1 1R w8s`9 8  0@FpnK`F`F+&bp@@0S p.$ K@ @ʻ HL0( )Ğ -4L0M@PT`4\+PEU50-S"@P,++,,,++,+++++x,++++++++++PU  ,K@?0貓, RPEUʤ30L0  0CLpK0PKH <0 4 D @ 8 P  0@@py?0 S@ 0@@p 0QPr0SX X *0@P0 0S" @U(K2! {2 wp2 s`2 oPUt 嫐Pi 4 0SP 20S 2  Q 0QY 0 SZ 0 S0S 1 R00P001 00l1&`PNP00P0 `1 R0S?0 `7 (K0S0C0K?00Ps?0 Rq Kl=S 0|O =\X PKY| << x\T\4 -PLM`P0*ē#)p1 T0@"S",24040404040404040404040404040402404040404040404040 2404014040140<03 ")p2p2A*"P "P0`gSX@@cP P 2 Rj |t2p T"0SXc 0E2Sjx22x22x22232222l222222222222222222222222222222222222222h1 `d1 \X1 XL1 T@11 LP =    00  p0 0p 0x0@ @app pF7p ;p@  T|8`8Ğ$0 R P"!P 80@-t0Q Pl@ O\ 0 l# BN0R0.0N0N 00B0 ,P4x4p4`4h4 dx- 0`S$1S00CS55$5$5$5$5$5$5$5$5$5$55p565$6L5P01 `R$0SX01 `R:H01 `R:D01 `R:01 `R:01 `R:L01 `R:T01 `R: P-L   <4("4#6$ $d ^0Ы -LQ 0S 0S S h-`h=0 ?0 -LKM−0HK,0 @T`? 00CSPPU`p@\K P0 0Z000 00 R@U0 0Q0V @0S <0S80S40Sd ZDX1R_K@\H[ <@P;0!`, 0R9(KP` P` P` P`P` P` P`P P P)`4 `Ej80 p-<L 4(M"4Q l 0SPx1 r3VQ0X1@@UT ,80Kp <4("4!\ZP@ 00@U FIT!P`UU U&Ƞ& &< PP;&Ƞ &<t hP1&<X HP*&Ƞ& @&<, P@ P80 -LM@0DS<l<l<l<l<l<l<l<l<l<l<l<l<l<l<l<<l<l<l<l<l<<l<l<l<l<l<l<l<l<<00 0(hkhhhM0 -T0 ML\@4 <@زP ,K80 p-PLM@  0 R (@,h`xK ∨`P @.PP (P@T 800 p-L$M|Ÿ|b0 S P? R6 @!T#>>P?>>>>>>>>>>>>>>>\?>>>>>h?>>>>>>>>D?"RH 90!M 0RYKp|,qlpA00P! 00t8@K0 0 80 40 00 ,0 (0 $0 0 S08 K70K ?.wP ,< B700[S S/0[0S S Q"[-K04"48#8 0 .K0h/0[0S@00  0-L(MtP9@K0l 0 0KS00 R00G 0RK0nh@ p-L`!\P@ p0R0S 4 LF. 4F$phF# F4 p-L\P@` !\ "10Q0S 0S- S ]T)0 R phFpM 00S S 0004"48#8008 phF 00SphF84 p-L@\ `PFTN  00ESCCCCCCCCCqF00CStDhD\DPDDD$DdFaF^F[FXF R R |phPFNF RxphHFpFFhCF`@FX=FP:FHph6F@4F 0 (xl\dDP<( 0-QLMP@& 0S S Ux0 R h 0K0hF U04"48#Ƞ08hE0 E880@SdF -0PLM 0- -dL @ᰍP H 㪍P 4 㤍P  ZP -pPLd!`P 0@0P +R %R0s 0D 00s 0D hP P@ Rd P 0-@LtP 0000 hP%T r 8000D p 0D00P-0 CR 0R0 SR00 -l?LhϟM080 0 P<0 ᐉ P" 4s 0 P2@p  P@p  P"@p`r ,"/`P 0S U V T x 0  S2  0S` UT8 "PB B U0P/S4P 4 40S 400ST   0&P00S 2 s 8 80S8X ㎌P80p 8< ㆌP80p 8 "P " " W 0S "}0\/S/00LP 0S00@@P2 0S/ PP:P   0Sp "R o*PT   "*0p( @008:*  0@Sp  "" V *< <@t P02 2<K@p0@0Kd,<@T 4  , @ @0S 4 B <0S; V@ 0D0 H0 P D0SDtH0S Hn h[0D0 @0x@K dP  8UT`H :R0@@Zp@4 KHwP P0P0`P0 P R 0S *0S ʟ0S#g#寊0`0S0S*嫕*<!VP P H :0S/ 90S+:R&Q$90OTS 90S9#-9#t90S9  p9 g`9lP@T `g890SDPQ0[S ]fP 0 :SSp`  :wf@P00 Ko7T00 00 7PK0`K 0@px70X p@K d'P0 0/P  02! 0P0lK<0 B 00   0 P,$ǟ0S' 2 < <0s# < PJ30S F3<0@A3`0@<0  00p@K00@ 0تPPU0k<0S 50<6 0S6 OdP`@*P@PUPx@Pd"P00  0@PUPP8@T 50S58  "R ğğ $ 0nEğğ $ 0d;ğ$ 0\:P ᵆPP\ %P@@$0H#0@X  P0#5ß3#.`40SL4 Έ P p@P " P K(P K0BP0 P R  00 S S  WP P,@K LK> ^L0SPKPP 2P "0 S00`ڔ`"0@LKP KP @0BP0 P R  00S S S  ㉉PP@ᝉPP0 L0 "S5 V2  nPP,2 @"Pp @P\ #1PP0S18 \ ᝉ<0s<4 'P!T, <XxP?$TpxHȠ$TĞ[<Tp`@3$ ,@LlP8(pHwt$Tlp0D|d00 S 4|| @ @0S 4st00S0S@ 0D0 H0 P D0SDSH0S HMIP0D0 @0a@, CP L0\P0 /DpǏH B:"b0@PP @ ,p@4HPP `P`U"0S 0S 0S#:#傇H"0pÏ0S0S*}P0SH20S/ 20S+2R&Q$20OTS 20S2#3#K 30S 3 43 >D3CPQ h.x3qr P0S0S0S 30S 3?30SDP 10P2 2 )P\ 6 <0s <7`'2 P8 (K -MLM0X ,0 \ `$ $@P 70Sk,0@ =PH  0 S H$ PD  0SD 6C.K B0 BT4 d$ ,0\: P ,0\$ 0PP4 H D ぇP P0 {P  Ɵ0PD`$0Vpa^P k@PH$R P`$FpNP4/p:`@@P00T00S/ T-*P0#03V0S& H@ P@@PTT*TlW P$0S,0\ pL  L$ 0[S]P P0#03V0S @T 0:S*0p0@T# :u/Pq U P00S P:R V  R0305P1 :P:ZPt`PL PW 0S V @@V 0S /bP@@@`@ß0Si(#U0 @0 K  8K DK0 K40KpK埤 P 00Sd40Sa80S^ V [0[[(,[ D0[@[$Č<4 4 "<, 0 K0 p @P`$,0( 0( ,00 K0KK4 80< 8K4 80<p@DDKP0 K40KpK@P`$DHCP 7500S40S80S  [[0[`[ [P[[p[@[h1 [唠[lXᤀ[[[\`@p[D0[H[L P [T d4@1 D|<, ă $x q  1,(p,4Ɵ&<.  01*$t$%,.t0pMD@Po86D@ 00CS, Kq4H K1@ţP ,575-0[ [R~[Q}0[S q5 @ Ƞ,Ƞ0 4,40&0S le@T f$ 00 p`'D  PP0S((0K  # P `K` |ğt\hğ\p/D 28$P,cV 0t0p0S \,0KkPL4ȓ0S S ß,  ,0KWP |, ) ,0KIP,@P00HΟ@P 0 , 00 $8 X` Tp L PD D0S = 0RS 0S  R00-S 4> {0S> {=0S D0S   \= 04 S< 0@ D00S0H0 , ZPMr0SMP00<0S<80S88=P`P,=`*0<0  8 RxPQ 00|SM P>~$0S z$0 S $ <z8w< /8W@P000T  T T/00P;0SQ$0 S P|;0S D$0 S X;0S  0S DQ(;0S  ;;0Sz :P P-D0S :0 PbPU   POx 0 00S `V%$PH:,0 :`) 00|S @ 8., ,0S  (*P0S00:P9 y, ,0S9p 40 90S,0,EFKeP0S;0 \i0 SLI 彺P0P0$ P0: S ,)0S009  M80S N0CSK8 00 80S,0,FX80<Q $40`S|8 `t8 j#,0lxL0JHP0S,0,E7 rp@Q#0 S YPdU<W0/S' g0S 70S0SB#y&0XKPo@0X0 T@ 0XKS#0S*帄0S000Ef6 'E`PYPPv000 # 60S3 60S 60S+6R&Q$50OTS 60S46# 6#py50S6 5 cy5hV ` V "Sy%0@Uz Yqpnt,E  , 6PP@",9p50S,00#30#,x"p3P "00 P@T@, 6P"0S @0240 S4P 4P 40,N TL00L0 Q N0Sm#xX0K 0OX0 T@ #0S #0S @#0S 0XKS#0S*0@0 P@H0S 0S,00#3 ,"PP)0S, +, xT t T 0S,,x0@R刂尢`p0p@`20S000@0!P ,20S,00@,!P ! L0S BL xO010S. 10S <10S&XK0S0S *h10S1#p1#Dx410SP1 <1 7x,1<00S000#3 0u!PP 0 S QA 0@00S3,00#32l ,0pLuwЫp(:8X`Qp<8h}$8|dT\LD,+!PP @Q \140PSl0`Pt0`40,<481@0S@ ,0x0RnD0Sk RQ610S` 4 (1R\ pP V 0` P0`K\0 pKt1PK@P尜1 0(w?@0 S1P 1P@ 10S1<  #Q01@P@@40S ,0S40,00S0xH"0S0S<8(K -\4LWMPpP` X@K8k g$4X  00KT P LP ;p!xPK劼P 兼P#xK 0{P#xK P0x0[S xKX K00KP pd  PH3 004`Q,,#30P ^K E000S  <ܗP,0S2 ev`P( P 0S* 0S 0S  <㲗P(,ˬ  @@`PUV1 0 3w\xq X0040 @'w4 K0@ PB0S (0K  # PLHx@A@x00QS Pt  00S 00 uiPPuwP qw 80K8 ,T0<0 f(K\xPHȠ@ $|ĞT\`L -,0ML  0utR$@ 0-LYPH10S 0P 00SA@ w00@P 000 t00S h0P \00SAD@ v00$0 (0  P0@LpL -L\ -4&46LAM (&(60 S&P 0S605+ 55PP5uP5eP5܅P55P5PP-@P 0S ѺPP ʺP xúPP d彺PPPPl L5L峺P5  40%P 0S50T0S 40@TN @@P 0S 叺P 劺P 兺@p@3@40S@_4P(4  h4p0Sh4T4@OPDTHDHP l660S5PU   P@ş` @Pşş!`@`0#K%0 p90#K%0150``Vdୱ#NKP\ş<şea0@%p0ş_K`pP`%5V;FE  U WX#NKṴ$0 \ Ba$@PX0 b,L$^4B0=ɌBJB ͌BS08BS *Z?K00K3 3 0`^c=iB@B mBb@P^ 3冞 0o@BT-P6@P#K ia0#妳 `ah#垳#^K`T<@<pP$#Ld0k2WV  0gXPڌ24^ 8"R#NK*"aZ#NK "a^B2#KP@P 0 0 0-PȰ@P a0!9 a!1ᙰ#^K`<@᫰<p፰P|!Ld0d1d0S0P :P#NKʳ <2S v]!@BT<W00S 00CS0 n0  0 mH@P 00x0x(KTHX@T0D[0%L ` t h  .A @  0 @ p| -LMH@0s0 K7p 0Swt@ -L@P 00s@T -LANKM @D+`᳣"PP ~K pG'+@Pp8[/S)@ .P K08SS/SKP  0-0L0M0@S DPK0 ჲ 0PD0SHa) 40jP K0x  -AMLM4 p@8 T2 0S2@ P 0S 0S4 00P0SxPP 0S`Rᱲ0 S0/R0 S?F0 BnK`F@+(0K 4R/S@/04B+d[PLh !X0080 0\0 ,$ 0BnK1儑儡4D`FP t1p3\\ PP 0P @,100CcSX108P 0p30$0, BNK0@Dk**P X000a$P 7@Pm@hhm00(KP:$:  $ pL` | T -LM0 -PQ00`R0LMSpF ,20SB K"@f,^KbHPPAZPQPOK@D^Kl0!Q`$3PP,EP PU  0kt kPd!7P Tl(0KP@x0[SPlH0x@KU @p KPV`APT @7pP 0w03T0S +P X0 SpP h00S`0  (KX!  $ 4 |@ H T \ h p Pp@ p-2L0PS 22 .k2 p2 R22PR x2P 0S\k.P 420S 8P(20S 12 j1@ @偡1 @{1 @u1 @o1 h10S1@1 T!0`0PV | ㅰ@Ph 〰@PP 0T.S@D0P008,!jTP$$ ϰP10S 1 1  V  d0 j R00 V   㱰P0" 00`p@|  `     q<hd;PX$ P, LH p\ h  0- LM0P@0P  P Kh0 R r X0000 T 8@,y" >j0P8 LP| -!LTM1Pp`PPW1A0 @0s 0 @0s 0` !P P1P>"000 0000,K0K4K(0Kd@K$ K8K 岐, v80$ d0 40(`0 00v.B\0 ,0A BX0 0D0 T P Ŏ0V0p0S@0@@ p0x\ i V P@D! i@0tp0 K PL |  , -00L((\ 0 0ikFX$[T@ -5LLM % , 0-S ``P@CPp00`lp $p d0@ S LLLLLLLLLP$wpD4 U@P ZY $咲W p  pL p@H P9p Hp hpP UX@KvT00 T0 ,,#3b0S0jl0 `pl}`K 0S `0#40Sj@\K \@ *PS WV  p@ @ T  p0S 91p ^ h d `KN hK0P`@ 勬pTa0-SP pMU@P9 Q 0" l0S$  @=F0S (U"  , \EP 4515P@@uB zTh$Xh[$0Xp -L+ 0rD(@ -GML1M a |!@0P$4 X!*p oP9 4!!p 0bSQ`A~K pG0pG4 %P3 $$004 4 =K 0C0C gP"P -P P A0$tA.Kh0 B B\T0$8D ,id8H|T|`8P -LM@pP4 iPP 0S nS6 =M`P00QD @ Q? hP 0V0S D 0 YppV 0`pY" 0 0 p 0oSP00 ,K\/, ?R0S@p @ `0 p000"S 0($P 0 0~8lī -LM`PdP( @(K,pK 0 g(0@S ,$Kg0@-PQ @p`0N S3. P P 0 CS @ Tp@-PQ @` Q 0 CS @ Tp Pp-L@P6 PQ5  0R1$ $0 0R+P P% Q# qP P`@PP Q bP (0(PS ,,}P`@ Upp - LMp@`,K4K+0 0` 00B1R bP  0 <4 !4,<00 ,` ,00  , 4` 刪40S 0,0   0 R:(K -0LMPp`4K00 0, @4 c,0PS  [4,0 400S ,K:(K 0-LM@P  $ K@ @  $K00P $0K0 0-L@彫PP, $2pP@ 0hA $p? P 4P 1185;$%$0hY0 p-`LP֠PӠ P Ϡ (0PS,ɠ U@phà@P -@̠Lp`.0'.TP! .U.S Ut! 000t0 00000s03-T0S _T _TX00`@TP, -LM pAn0 `, P00 I@P 00X0+4Л PP:d'A n t,0400P4 .0@pH?HC)p>?$(Ko7(Kp8 -LAMJ_K, ,KOKᕪgfp`P#0S @ fP @T T | R 0SR( K0ACp 8=f`V000 JKp, (K L 0-L P2p@z>8 %pn> 0h0 -L@㑣pP`8 0 0 $ $0 0 $ $0$ 00 $ `P DbP P =bP((gP, ,( @❨TP P@`( -LM, P<0<0S`A,i(, 0V 0Vd18S_a@(0S,M01(00Ea@(0S,A, 0p1(( P,B 0!B0,( ,0q`(0S,#,0@1((P,$ ,( &, ( 0!a@(0S1S (00ԢP, 0! PU `X,P`0HL -LM@P4K H0S   Kp0 0 ha 0S 0S  4@K$ $`K PdP 0S pt @T `Pᔩ4pK@0PS @ UT $1 1P @ሞ`40(K  p (pPK`P ( (m   g@4pK0S  \@ T<0 80Q Kd[p L08 -L$M@PPT ppdW @@K$ ឨD Ꮩ8 p  0SC ==0`P, 5  ̷p  =),P@Q#PUT@D0 XP <`,\@0 EP,Ki$,Pht8 P-L@`Pp\i. r 0000SR 0 ᝨ``P'R"R $R `R \R `F0 `F P@T:V00\P{ p-0L0S00@T,``0@p Pp 00\PD8, php  -L Mp@p P lZhHp`U \2\D٢@P<H Ấ,R,,Ka( 0,0 0 2K1p  0S  < P 2[ p ;`P S"0S tA`0S p ; 8a0S D@KP C 30X 04 000 5@T00\0(@^0^0@N ; tH0s TQ>$K (:8$(0 HXDttH -L M`*1$ PA1@'qP0!0裦p Pa*0pSj` !嗦pPU*``p0SR l!勦pP``0p0I:F1=U(0 (0S $1 AO0!opPp``+*P U {0 lP @`Pp0 aP @`Pe0| VP @`` BpP 5:DP(K\j8[0DdL p-ML M00@S`0 ZKPE*QTP *ㆦ P%*FP  K@*v P\%*TJK@DᲦ 00i/@.KpD 8 p-DAL0S8 k$1` P@00S  0S $0 P @T00Q P 0rh@kp00S0@ ,@8P  000S0,ph\`@)tp -LMMD1~K pG`pG@P+PK尥_-૥1!0x6 p& V !0K@QF t6 l& =8 46 p@ 06S B0 ; ;KSK?;05 050%50$H0 0 &&&&a  K@L8 -LMMA~K pGPpG0`+0KS_-N0Kt6 ,0x6 d& <0@h6 0S1!l6 p& 0SS0 ;0& 6 0ˇ0S R0 0 PK @@<p@ 06S 0 ; ;KSK?;050 0505 a0$ 0CST0%0060 666 0 ⊣K@L8 -MLMq`KP @@+@@KӤ_-Τ`1V 0Kt6  0@0f@P# @1S 10p`00S ŜP@T   00 (P H0S L0S 8P $0 [0 K08+4+ -LM,KKPH,`@@A0pW<PP6 @0S#05 000p WP=SpP 000 E}00=0D0S ݐ@PXL  ㉆0D@`V$0D0S< ,PK*8L\+x  -L\R\\r\M,Ks`0SDg X@?T,A0S * ,0R0``0c!S0/0S (qA!0 D <0 0KKK40 0S #K DKpc0#S- _0S) [)4 3[ R T0S (0s3[ 0S2[ ⸒p2[ 100@S 0S 00M p0s Lw*,(K8Px++ +  ++@, -LMPap00˒NK 0$K( $0_. 4@ 00 , 0+s( P4pK0, BP@K 0 L0 0P` Hp D0 0 p@;( K@8, p-LMP0  ( ,  p@}(` 0K`?pn(T0X0@ `0p_( 00@Kp8(,@,!\, -L4MPNpK02 } h`PP 0S :(XZP@P0D P @+(@0 HKx,,8lB , p-LMLS8 SS<7fS7 bS4 eS49sS- tS% lS-&TJp +4 $ 0s Lp0 QQtx0:p@p 0 P p 0 @ @@$4 (o0ST3 0T00w0S 3 0W pWڔR t30C @P W@cXP pYH H bQ IQT BQLQb SQqsQj fQ lQTtQ xQuT0S"PE- r 000X0SR 0x"7P``'R"R $R `R \R PE0\  PE `@X0T:T0Q"  PE0O4 < 8#" ᅨ 5PY   0!pPKP`@.8C80@!pP9P`@ !!0؏pP* 0Q   PP`@P`UP:Q X` 00ƴPE XDYP PE ƴUY)(K`0/PT////0$0HL0(8(D0aK -0L0 S 00CS00Ӥ0-L L \00! P 0 000p0 T0 p LPQ(0  B000p \ hb    -LM℣儃C`Ppp 0  0#Pp P "P*3@P3pPpUP\PPP" P 00 U@T00S Rp R R2匂7\00A S-Q5P"T2PH"@8TpPpY0%xP00S P0p 000D1 T1 @ TA1弁  !0Z\JqH d0 00A L!P1PD!pTp Pp@B0 -P_P p 000 0 T0  p 000D @ T@" 0P D0 P<0p\0 00i  PlX `0x0 0  0Y`  -錠0LSt`tP 0lpl@ 0\P0 H0  0 0X,0000 lX  h`  -L@\ pp00S`0 \0 X0 T0 0000 (0 T(0 00 l \` X  -PQ@`Lp "  0|0 `t0Pp0pl0 h0d0 `0 \0 X0 T0 P0 L0 H0Pb    h`dp      Xl\ p- 18MLA10 P`垍   PR^0Ӆ۸00S H@ F@0P80 D @@ KKOK p @0PK  c?[ 0, ?KP @ 0@K/Kp0 @@PK O/[ 0K 0?0K< /K@@Kpx@|P0 @PPK 9/[ 0K 0O0KL /KP@Kpx@|Pr@KqP 0/[; K0 " "0/Kpx0|@@PK 7p@A0S =03S 9$9T K\4|4 -LXM pR,1 (1!D  pux@K@ ܉ P`010P D` 0HKhKp @R lL8@K´ ᶉ0H80 0(0 800 $0  0 Kt4i@44 -LdM0 X0 0@`XK,KPT0 D @ P L H  0 PPهpu ,0Sp ?pP 0 APPŇp`0 S ~|AT  ,0XP ap`$,0@C $ 0CSL'@B]$K+8$FHF`FxFFFFFFp@-<@< `P 0000PQApT -$0@LP @ @ -d@LP t@PHKDg0,0( 0@ 0 @ G -L 0LR RP 0R >|$G |00-PPp0Ll Pd,u\Vp@ L:AH0P 0(,0'4G@HGLG -DL@ P(0( 00000 S| 0-@AL81 PP,1, 0P  R0 L\00P  BRʔ00 0 0 QT0@0<0UP<@00{00X\| 0-DP@L0000@@0 0 0 0l -`L~pP_{0 SPfu% ࠟ0S @ PF00000 G`PV p 0@.\Jx@P`0 @0OP?dGtGG1 P-L`h 1 @0Q0S 1 00P\DX` Q0DQD0 Q@L00|pP00CS04@0U0, )0@0CSp0@0B0@p00 >PP \, 0O00|tG`dP?GG-鄠儐Pp0 0S0 0 BS00R \P@`A-D0D@00  R P  p-P@0|`00t0L@l0@d0@`0@w0@0CS0 @@00 ph&p耤 -1q00SL-P`0L00| P100CS0#@00 0@0CS 0`@0x0(000   P? -LMP@0 22PB ,K A@P zhhhrhb`"PYm 0 P40S0`00P, 000S SPp PP aP PTAZ,KPPU 1 ,0Q.0 Q@L00h{ PzH00CS0<0A004 [100CS@ 0@00I,  @p0P@ e P P \0P 00S Pp(KdllpGGGhP? -LMP0@ T T4pP- 弐0帠S0@0+@P`P 0S  0  01p3PPP0T@G-0 CR 0R0 S;00 -@0LP`rPe`Z !`0Vh`c0SUJ L0SF I0S\\;@U`T x߀P 0`!Sb/*0S@,0@0f;0US8080W;0US00J;`zUB;PX*\00S` lP 4; U 0@0^S00\P0SpH,H H -LLrLLL`~@0S 00CS00PӤ0<<PuG  Q/0 Q@L00y P00CS0^A0w0V S0`0CS@ 0 L!0d800 S0!00 U`!00000 +0S0#3 PP 0S0`00` 0S0`00|V @V00 00 0 <0 `pP?p0H$H -3LM, 0 0 S@`TA9P, `3@, P00T$0S p>0`>PsP0 nR pR lR 0P0P00PP 4=  Q =0S ==~PI==QP?P0 nR pR lR 0P0P00PP d<  Q <0Sz <<JP,0 0SS0 x<0S <0S( p<0S r ;000 8@P P0 nR pR lR 0P0P00PP 4;  Q Y;P+ $P\PP0S!SH +d0S, 0S @P ; ::;0S[ rc T:000] P 0!S4  P0 nR pR lR 0P0P00P\ 9  Q 0S+ ;d U9`V 9sPaGTPPgTPXVTP P0 nR pR lR 0P0P00P\ 8  Q  P(00090SP0 nR pR lR 0P0P00PP 8  Q ) 80SP0 nR pR lR 0P0P00PP t7  Q it'00cS0 `'0S TT-70S. P0 nR pR lR 0P0P00PP 6  Q 860S @7@c(7PP\0 nR pR lR 0P0P00PP 5  Q H60S 66P} $0h&@ 0R P0 nR pR lR 0P0P00PP 45  Q 5&@5ZPH 0 nR pR lR 0000P 4  Q $5 55/PT`pP40Se @Tk40SgV`pT P0 nR pR lR 0P0P00PP x3  Q j30S? h3P( 0 nR pR lR 0000P 2  Q >d3 \3H3P 0 nR pR lR 0000P 2  Q 2 220S;P0 nR pR lR 0P0P00PP x1  Q 10S |1 Rt1 d110S  0 nR pR lR00P 0  Q L10S d10SqT\ P6q 0000 10S1  1 g@P" P0 nR pR lR:0P0P020PPII|Ԩl_@J``8I0JGШ̨ȨJ$GPI0ILJxIIl`~P 00  Q X00S- 0S0!S+a0S0S @0P 00P 0 @$q,Q`0gS  S &:00C S#pS rS` 0`0`0`0 1@sTP000`00V FwV 00 S 20S@ p02  1 0 S 0 Sp pRV000|2@  @P00CS0MB0y0E BRT P e 3 @ #00CS0,C0[0VPP?PT3h#0$S0000W0#00#0#00# 00 0nS pS lS0 00 00 0 0\ 3PP0 nR pR lR 0P0P00PP X4  Q N40S# 444 ~g4PD{P40S(0pW50SH'P0 nR pR lR 0P0P00PP |5  Q 50S #50S,P0 nR pR lR 0P0P00PP $6  Q PTRpqW QWPd6 Pt60 r 6000}`P8 60S6 R6 6  68P&0 nR pR lR 0P0P00PP \7  Q 0S0!S+_0S0S`{7WT7 70QP7(0P00 0S 80SqWP<80S0 nR pR lR00P 8  Q D B8 8 P010C0S  I1@s qP00 0 nR pR lR 0000P |9  Q 9)00Q0 mP0 nR pR lR 0P0P00PQ (:  Q H:T 0S8:`:=Ml:0Sx PCP0 nR pR lR 0P0P00PQ :  Q \;%;➇ ;0S, 4; <; P T;  PPt P -LxM  Vl5 InPڠ0000SrSh5hehhhhuhU@sP xP pP00 @ T0  5 (%&p0 10 00b0 0S 000-S 0@S@ʠ000 00C0 5TP@KKP0: S  0Z040{5P } }}}}@P >7*#000S 000S 04P 0oPX30S 000!S 0+L^0S 8000S  20SsRcT0S o'䒟䢟"P 2PB-"0S& <"0S"p820S  p2Rlh2 0E'IP20SH"0`008y"0@09"000 S 10S!@0`00]@00@P @P  @Pt t t$ @!00B,00S  1R 1 0&0 S &#h00Sc 0R0 0&V`JdhJ@``8J``JJJDI|Ԩl_lJ[JppG0^S0]S[S 0.R =R:R  S0Q]S0]S S]S -1L`@[S \S`P t0 S\`0S S,140 pcQ0A0 QP\00eP00CS0-P0/0% 0P0CS0@00\@DP Xj H0 0`S  0o JKP? p- L P p P 000 S S@0S~ pk`Pp0P 00S{ f|0P@Gpcp\0P@P PP 8 80刚`PppG(KP?Ԩ( -L Mğs@, 0 40 0&S903` 0hQ0 QP\00d P{ 00CP|S 0l#0uX0, $3 0P0@ 0Sv\SC00S@9S>400CS:0 2`2 0hQ0 QP\00d P5 0l0CPdS 0T"0/@0,  2 0P0@ 0S0!`V&0 VP\00sd P00CS080t0CPlS 0 \!0H0]01 00@ 0 0c SC R/`p0 RP\009d PKg00CS0@00 ,0P0CS 0PP00(0 00@(KxP?| -LM  @$" (2 P  Ld0S  0@_K  0 B 9P$" b  ," (2S  S ;#rPU0 U@L00c P; 0ß0CS@ 0 h0KT#00ß0S 0B h K 0P 8"RpW$0 W@L00c P00CS0U0pŸ0CS@ 0 X0D"0s Ÿ0S 0 ;hK`0S 2S ,\    ?K圱Pk  "向0pf 0 Q2 /hQ`0 Q@L001c PC<_00CS0AA009 $60@0CS 0@00W "1 $ 4p00S 0T@ g HgQ"(KxP?4 R, D$0S PD00CS0 0`0 Pp@@ 8$0S0($0CS00 Pp0@@yVYV u`v兔D{0S 1 ,u`v BKPP$1:( SPPj@P0?8 0 y `. Xxp  0T00(J@PU 2 3P/0xp8 t  00 dP)0?PX 00S 00CS00@Ӥ08@d`dP0S 00CS00Ӥ0$ PpyTpp@M p-LM`PP@L 410SH(10SD10S  0@O5 000 姲P 0S0;06PLQ $Pt 0$(0 \(0$ , 0 \(K uP(Kp    YYYY - L(Y -LMK }P[ [4 0 S0S 0SM -MLM(%pQ urPP40S J`240S 'P 40S  K P$ 40S ԰JNK`@DdK@ @DK 0H  P 40S  Ғ`40S 4[S /P `+^+O3 3`V KJ3@T u)Kd!KP04#:  SK RP Pጒ`)KD 4rX20S K  0`x tP `20SX`[K(PEPE9K) 4@P `?V00S 10S t0S o $h0S`` K DK0P Vd10S T ``T0S H10SD R ( ,0 $0V f x  P V-00S)>%V00S D0)KS(0D0 D K d00S<0@K08K0 9K4VS B`(K   ZHZ`   hZȠ  -MLM99 , 0|igS0,0 pY,@ 0L L( 00D]P 0H( 0 0uS0nS0 0, 0,@]P ]P0H8 8 0@KP8 oN\P, ' P 0@K rP`@p@T k#WPPz,01$ ~r, ,0SU CKI@pKg ID X( 0 0 !0@S0dTL STv 1T9T-LT NTYaT- VT~bT* cTnTI gT4 fT.hT| lT|2rTr oT> qTtGtTZ vTo`0H8 nP M0@DLH gdF,K h,00SZ |娎00?l&BP ML KL 0 0086 @%P=035 +M P 3D( 51:5 *E,p 00.S.0@0KX8,0 , g bM0,0 0%00Il%000 BT000IL $,0P! 5P p@K5@XUP 4@0D(R 40TS4T 0DST 00 RÀś$0s400s030 ㆶP CK.KI B BI`T( H(00 @0-S 0SD8SCC000S30C S;(L)L)4)L)|+4)L)L)(l30S 㙱0S.P,  @K>\P @KT(#0[ P *TDHPD00: S  JD00: S S0S2P" 8TH0S h"0SP h(D8S)0S D+L!0S  +P10SP嚭 @pK !0pm[ P: ጭV`<d!0S x0S810S  D0x\0p10  L8 P P`0S00S 0S P 0S娍V`\PPT00S $   tZ|Z3ZMZ Z`8Z   Z   NMЫZ ([ 0HL[Ƞh[[t[[[[@[[ 0-D0LS@ 0PUKPHP)_PP0D00 0C0 0 -L`pP@@PHpD@ R-LP` q@0@P T@T O0 0VX1Xq 00 @0D00 00 0@T:p VOp@@0P00 V4vpV00 0P00 d@ep _]8 000DP  O00 NH@L@ -鈁LMPpH,  F@T @ )PD p` p 00;P'  gIp:0P n 010P 000 <@PD`  (PD0S0S(@  g0, cP@L@ -PPL`p/ (0S 00wSp rS"ppV 000x000p000 0 0@00@ ;WߍpۍbOT@H@P@L@ -`QL MH p0rSwS ?R@@T W00}SPw 1,@@0@0@4@@@@@@D@ 1嬑0 PwS 0 !@0q`P OTH0090岽` 0HwS:XW@ W@@0 #020Kt0"̠10K"$}000K- K0 ` )0KX20K/K,K+K*@KD0 . K@  < Y 08 0X  DKlop  05P  KP  0(P(KX@H@P@T@L\L@ -RHL`p$H X 0P @@ R,B BQRQ0Q@P`Fvd2TLDX@D(V00 0 0 0 0 0 0 0  0  0  0  0  0 0 0 @^PlUd@UV}VmFP0p0`F@@ VV1E0\\0\ 0 \ 0 \ 0 \ 0 \ 0 \ 0\ 0\ 0\ 0\ 0\ 0\ 0\ 0\ 0 @`FPV 0 0R@P`Fv  U@UP[ -PpL 0e눀H`$HU%XL\8@#8P@'XPfTPLD@DTLD@D(0U[E>^E0PEU\EPE@- 0S  00 0 0cRÌ`@0  0"0Q1 P0 0S($N -0L0S$ -`QLp@00SP(0^ ^0 01^ 4# # !^#$""1^"4##!^#$""1^"4##^#! ! !@D!$""1"#T T $0@T0 01 #$ 0 "Q p-L`P@@Tp -pLAM0`, . 0J/K(1 |00R0@KJ_K   Pf@0    pd`0,1((K 0@-@P $^ 0 SΎ809P  L0  ( , 0 8 < lPP0P@-@ $P Q < ^ 018 0C0,0<8 0 Rp-PL@4 0@Q1S``.Pp(0 `S00`(0,0S0 ,00(PpUE20Pe$00E`S0,0$0p040$PphpY Y0%0  -@PL $Q ,0S 4Q00$,0$0P $P 00  00 0@-@P \00^ ^l\P:0 -LMpPL $`VI 0S<0S0S < 80 0(K08< 80080< #4 B80< <0 S0 h0 hh0  `h0S @ 0 0P 0@P0P $P 0 S<0s3 -P00@Q0SLT$PUQ (\N ,0SK 0(! `P 4P $ 0(P0,p TLS.Q :%<,0Q P0b0bS.00 L P0l0S.0b0S>0Wl0 $0 #4wT4p$`0% -$@L40pS` $P0 (P47 (Q$ 02,(000( PcU4:b JT (0,00 0e0`U`1`!  ;TPU 4e 4T(0,00P00( 0S00, (00PR:0,0 -pPL`P4 $@T1 0S 0 S+0 S  > ;0P P 00( 4UbS(0,0e S,P0 0 -L0MPP  $PU 0S 0S0S0 S00D < , 0H0 8p<`@ 0S񟗗DERRRRRRRR0EdFFFGH(EDIKLMDN@OOPPR8EEE< y< !  ;< 0S  0  Z  0RJv`V0'RP0S'r0$ 0SH͟`F 30 `  0 0p8Z  0RJv`V'4<'<,4<0`80 00p 0S < H  D00<`8p k 080P\ 0S  07s`0Z  0RJv`V 0 S@GHGtG|G 0 0T0 0+X0 00LP 0; 000!q`F<07s` Z } 0RJv`V@˟("('8,Rc`0@ 0p@0Sg DQ01 S@1 @!T`  HR@0D H0d d dD H @0Z M 0RJv` V"'5t  0 0Q\0`d 'w`FR0 0h Z + 0RJv`Vʟ00 0'hq`Fh\0Q* h00h0S S.0L T0l T/p l0PZP< 00<0h0T03L@ C 01QZ  0RJv`P Z  0RJv`V:7q 0`ah UP  Z  0RJv`V:^`a7q< 6 0n00'q`F(P   Z  0RJv`V:71a q`AZ  0RJv`V:71a  s`AL 0S \7 000 h0 0h P*d `0h ^L x:0S! S>/΅T 0 l@L0T l0p` 0P< Kl0`P00X0X 0  p0d P0< 0 h6 05T030CL01 P0 Z . 0QJv`S4  03 @C403<1 R0 Z  0RJv`7|`lS``@ 7p0  0@ L% 0H000HQ Z 0RJv`V:1H0C07q@ `a @ 00X030CP01 P0 Z 0QJv`8 03 @C803<1 R0 Z 0RJv`7|`l@``7p'0H00D 0HQ Z 0RJv`V: 1H0C07qD `a D @,0DD 00`R00< jD Rr @D0 bSH @c 0 bR a(00b@40bRD@0 Q10l@0D0H0lD0 0 R0@0HS 0L H DQC @0H AD 0H 010S4  Z 3 0RJv`V@0Dl00@0@0Q00 H0 a8'4<,'<4 <S D@  00D`@ p0 0< H00D(08pS<`0S 0@P @P0< 09,0@ pc`b0 00@ 0@0 0RV0 f q8 QS@00<`P  \ 00R40 <P<  < <(KlZNNN(NG-|M⠀P00\ 0 S |@0 2R02BQ0`\ @00S@T@ \0@ @@@'@\ 00S@T 0 sJ QR0Q0P0S< # 000 Q | 0S4Q 0$A\0P P 3ß(0,  (,0 3ß(0,00S0!Tp!p1' PP#0 \00LS`$P08 8  8 800@0i^040@(,Ŏ0@`@0ià0%3l l 041 R @0@# R@0B00|0 02S0C8#(@  P P@@a800@|0T"C$ \ YPi0 \00cSPR :  0<Q00SA 0P0 0pa 0bC1 0wY $ 0S0`4 @8914 @00Q  0A0000S@010p|ЍWVULUL\ 0`WE:Kz -0L R0 R P0 |P0 |@||M 0S X@` @PQT0D0L = 0S 46 !!$!@\]]@] -L M0@SKh(P K0 R 0`t] 0-L M0@SPK0 *P K0 R U0>] -L4MP@8*'唧0匇oS000 `gR   0P` mS000 HfR  pT` H` $'ߞp= H0@0S0^\\\]\\\]\]\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\ H ,&塞p 0P0 0S 10 -R% 0bST0SL  H0SOWppV00Lp L0 `QV< (  8 000C0S004K 8@0S540 R- @ D 0@  T q`pnp`kp`hpW0S `:NP p @ ` D < Lڨ`Pp ᛧPP+ 30C S4`^^^^P``^^`^\_\_@ np0S Z 0fP 幀pPPp0S 劂0SH 0!R0S0S Z@Xw [P P R 0S0SH0S[ D@ wPP PQ@  pT RJ 0S0S@000C0SUQ4K` PPlI0S40 R| @ XP D c8K0K, K;rPl0@0 ,00D ,0 TD0 L00L0D, L00L0D LEfPL sD@ (P fD0\z0P0S0L00@ D0 #{P\ 1 0@0 D0 .MpP@  p D @  @ `ܱ"00ǁ|bt8 ^d8 庁X8 V HR 8宁[$! !!!]Ƞԇ]]]<o@- 1 ,0^:*\7 /+0;;0b p6!  p0p0t@\E\%0\Q) p0! @p0t@(%(5\%R 00OQ  44\%R 004OQ  D08 +P` wFp6 Sp4^  & |6 00P @@b b3a R`QR|6VFU 4@^  850L 0 0 0@4;D$+4 0@0P1 0( R  0 OK,iIHß00 0PSc,[I3 L00 R  OI 0L0 R"0 0\2^ pF1 0p & l&R0 0@S1 p)I d!`2 R T寯0 0fK A ?p6 S1^t  & 6 00P @@b b3a R`QR6VFU1@^  850L 0 p1 0( 0Ox6 tF 0 h04h000O    p l& 1 0(p6! (0 h04Ch000OQ  p 1 0( p!1 0( ( |& pF1 0( 0O6 F gP*P z & -\q-T^4Q,Q$Q -LP`eJ0pS000000 `S8#80 @0c 0 n)0p0 `H 0-P L@ tP 0 00 S)0 00 -L@Ah:0,qSP: !0S2 0 !: S0Q @ f0S V&0S v*P 0 Rm*P嚮0S 00f0hd0 PHh さ4 -x-4Q8Q,HQQ+xQ,,Q`Q -LMd%EnK`F `F 0,            d$ `$ h P0: S4X@N 4ؔP4 R 0$\Qp  00p 0S#Pm)P |0S!h 0pL4 X4T4 0$KHt ? @D40 0S (# $, 0R(Kp0: SP+  )P 3 pP@{ 3 O@t O#004KT$ Ht X(AP($3>I(0S $ 00Ԣ0S20S BKNN"1A\0A 2 0!00c000l\#0 0@P$b%P$呭<!0S" 2 WPk 1 PP 1 R] tZ`'0X0C0W2)PI  h4s h!000'0 000Hhp  (h'0000S 0"xBKNN+4K}@T 00C0 , 0 S 4QQ,-+TQx-,Q R,R0dRQ-̈RQQ8RQRR^ -MLMp0P@AnK 0 `F?`F ߓ 0'U0 U| 0RK7@$(P 0D: S40P ( -R4QR^  -X2LM (40p  f, ;;S  0SSYPPV 0SJ, Y, P` ,,0+@+PU`RP ` YV4 P,$/+0;;0b\c/00S@\,0 @ ( @,0 T0000 00S0SU$0S x( @,0 TP0PPP4@ 0,0P<  ,0~-R -LM⸑40Qp,0 [0P (0 4P* /00S@0 @P, 0R(K0Q`0@0 P`0OO 4D;$+4 0,P  K1E?K0P  {,0@ hKE0 0 0<. 0SP0SP-$^S 0  L- p-d`L0S TPT 0@1@P;0S;;000ph+t+- -@LP;00! p-LM`@P 0|0h S%00CS ꔀ%00Kp%%00Xa TP0 R 040 @/  0$(l--,haaaaa 0-PL@T0.EPT0 T @0- - 0LS   }C -((!0S1!1L ! 85H:pp\0Q 0'TP@BĠ``A 40P0Pp0?P|Vd0SP@AL``A88 30!---!--T--|--S -L2\%RPj 0 0BO?AP PppW1( ?`Pc 1A1U 10aP   @H1\%R00 WP1 P#U 0p 1\%R(0 ?p  ^ $0 W0\%RX0 ?  ^ 0|@|0Qpp 0 aDpdP=PP$ -T-h+--t+4b b -1LM@\@c1 \_a \5M:1!P@PP0 <0 A18 @x dpP4 `@P0@ F P1P  , 80Ǐ 87 H$pǏp`1<p P@4@00@#0 09 i20 Y($R>Kh d 0 T5 PE 0BO`E?DE 1Kh\ X T8 4 @E Kh d lBNK @D@D0$P]"2\%R 0 L5O0@2 H @E(0/"08 t2( l2\Pk 0 TuP21COpW<2PoP `H% / D5 0  R+ 1PX0OD0 H 0h!H5DE0@H5 SDE t0w O\&.x1P`pWPX0 S R40S00X 0 BNK @D@D0 H>P 0Wh0SN?hd%T P%  0\Q 00S@0@pKl0 %0 L5O0 @W<00S@0 @-TlUUUt-4^ 0- L8M00 < L0 H0 D0 @0 80 40 ,0 (0 $0 0 0 KP0 LK@4p0 l0\Q \,x<n|H  0@K0 f<-T+,* -Lp@PQT$ @0S ݢ 0`@P``0 0\Q ,:<?00i+P 0p : S`0P T @ <0S ,U,-T+U4Q* -PLMHH RS, @$ȟ 0S 0Sp P ǟ'0S0@0 G0S ǟ0S7 R sa$l0@S 0S 0S 0S oH 80   O   Q ?KP``F0`1_K`P`P`B2 MP`K 0E2/R 0O? 0@l& @Ācp 0E 0bJB K2@şU0S %0 0C@0S@Q 0N|5 R E0,P/OQ o 5 pTş@@_@P004@9%8Po% "2"_K`PU`P@`P`D0`ğ0S 剭|4@T 傭@T 㐈T0S9 tw@T ` p@T ~*#0S40Dp Lp00Dp Ep00, 0R(K`" (?K zPS3P@@@@0S3 R2 (ß 0S. p, R*@0 O  & _? d0 0< l21 \>Q,ʠ0p, @RʬrD"0PBS4000, R|b tb@ 10\1Ÿ@ ,0SDR@R1@O1@0LJ1G1 2D1!0S pA0S 0Sd0SԠPx &KtpPf 0S7 CXK2|0!Sdϫ00!000|1 c 0|t1PdT@1 T 0bqD1  8婫0!000 1!0000z0pJP`g J0 RJV 1P@@ 0T0PlJ\X-c$c,`80`V,Xc+lcw,(V,,`'  -p LV -L`( pDP(X-x"1> R.#T 0@ 0. 00X000 0@P`Z  P 00X000  0!0@0@Q  1 R=  / 5P1 `XQ 00D1 R R 0S0S R0S 0S0 0S P 4PPSS| 0`p 0@0@QL\ PZ`-,l]$!c,XP-,(YY[f!X -,LpM,0SPڼ0@Pt@ pP D NtP0, @tPK`P`RtP p` 8ڼ0p/t@ 00T 0 PoPpǏ`pT 0/ X0P`1> 0P@`UVW4HTLd@b6pǏpX63 -=@PmP -0000h|-|m  ,0 `0 , K\0 X0 T0 L0 H0 D0 @0 <0 80 40 00 , Rg|@ xP |0 l ,x|0 O*| Ql0`  0ǏOP`L 0<\%R  l0SN x< RJ \,h< R\00S 0C1 0R' sR"Q ,|@0A@ +@0[0  |P,0 @|PK`P`Q|P x` ʈk00?(Kp P`0@0@0A@D`ePT@ D[`|0V ` 1`Pa `  :@ P0@` S0 @ `+ h d *Y TlJ`0\0ZE:Q d:Q  000hK@ h d R0d@SZi00 R:Y l@QC:Y@c0T@A Q Q%T1pP RO:)@00pdl()00PO/ 0\u9@W 0T \9W 45S:  Zv H0S Z 9W 0 0BO?CQ6p3@P2 Z Z@ Z8 T1!(0p  P P0S  \d8W00S0S 7 R 48W 1100(p @7 R 7W 0啨   00poP@: g@ 0'\Q 4,6* k'T7Wa 0S0s6 R 7WW `(0  PO   {7P4V 0&\Q d,5%O?@0\ud6@W605p ` P P0S 00 U0x R ! 8S5WXx P0S 0005S:8P TH5\uW,uT` 00$@0T0R,0 0Xd ) DPt@P4PPU^1!X0   0 S PUK\4W00S0S 3 R ,4W1100X  $5M 5D3W  (Ř Q \3W-  0 0 0@1>@ T DR @Ӝt0 BR @P  0@" 000S00S Z 00 *60"2@P00`KD z!0 404 l20 \Ph0O0 /S <2APh00  > 0S 6 hQ!0\Q00h0 00O0@Qpq$kPv1W|0 0@#1?@{W1> 0P@`UV# ]` 0`\%R] 40O0@00L 8P0 c5-`-,,,!l,T,+U ,d-, dYLZU+Y+0 0C0(K 1(K@@@T0ZP00 0 Pv "00C0q00S0S\$ X4 RL4 R@$]PPv @0: S00S00000CS񟗄P||$$h3(KPMK /00@e 0 00C0 '1@!P0 0 R%Q 0.S  PPP! 00S00@0S "20\0P00C000ST" P0S 00Sڒ^K PEPE0RNK@D @D00!1 R a 0kPd0P 0 x0  0P,@0S <P!00n t0(K MK/XqP 80P  00[Z-\\l[[\,+\-\,]\\\e<][[ \@[X\\T^$\ -|!|01@phh1PL08X0S5 0pGS.000PP 0S0S `P @ 0 R@ P`P 0S P 0pGS00h 00000C00P0@00-t+@!-x- -LM$$ @0 @/P-@!e -LM(p`W0,0 C0,0  P0,0 "1> R*A R P) R 0S0S@00%T pW 0@P`0:0 @   0@pW,Q`-,, -l2L8Mddd"P0 0, ,0K` \ X T L H D @ < 8 4 0 ,0S|ڸr a0S:ڐPTD@ 00CS5D`00$`K o P0S@0`!\QB  000S/ `K(T P0S,0S4ڸ 0`K =Q R Q0S R`Kx $A`K6 00 0S 00(K-,,QTh]<]*\] -@0 ML8 `@pP0$ 0p}.PKD!d-e -MLMtXO0 KPK(J8!J,0 HK 4Q.> R K0(K8!Lqt QG >hK8aXQK0 ţK8$UUd~UUP~K8Q$HK8AQ`PHK8A`0\3  BB00B"1hK18a0 000S^0S  yK8$PQP`ӼhK8a`0^3  BaK80@%0 B 0HK0B!8A!L0   XK0L͟ (K8! LqHK8A0XK  Ba 0p@WHKATd7  R\0?00 10  B\ hK a Vʜ (K8!$5S.p`l h0Vp0&P P U 8K81$%U  1P01p`0SVU HK8A$%U  101$0XKXQO0@0@0KOX0@0 @P`(K,!  /  0`O0@K8L#P P8K01S XK8QHK4  De*0 0K8K,,KL0` P@`R`YK8``L5HKsKD!8KP%81X?^ PTD, 0RM(KK$\^K8 K8!Pp(KP `p$41> 0R#4  R`0?00 1HK08Ap80P@`PW8 W#$0#0$0QK`08800cPKϊ/.Q00b\KK8T!0K880O8K 1 SHK$ATXKQ`XKa0XK008Q$%RK8(l 0 0 08S8K>C`(K8!8KK 4L!P2 RQXK4Q 2Q\01\XK4QHK4A\0KH!P KP8 P K41 XKR(K4!\0t1 daR\0H!0 0hK4ax0 R0R0 C(KP P 0 0hK@aVK4p 0Q\0?0`0RXK4QHK\04A0?00SF P!+Lff$Q8fH!hL!bT,<]`-+ffff,TU pf,e- f$fe`^PU 05 D0RK4K\040?0S5K8K0品!K4PU 8K@1pWHK,8$U'UP P 0Sg cl0S -LM$$ @0 @a)PL!H! g00 ሱ0ሱ0| -LP ]^ Q-L@ 4#P T]^ P-L $P {]^ 0-/LPT@P 00+8@/00,+ )+~)00P!^ p-LpM/P5@P K}P0: S Kp0`rS@)  P0-L@P0 R 0 R 0 0hW?T?t0 R0h0l uH0 R <0<808*0ꀱ^D$^ --LM0 0  --LM0 0 K --LM0 0 K -L@ތ= h/ -LMH0@K0PP`AK<P0: S V@@ S00S F`PˮP$Kc=P T P`0 R000 ]K@ᲮP l1: S 8s((儍h|(:<__,_ --LM0 0 1〿@ -T L@H7P4TZ幼W P%edA\_p_ -LM`pP?(@PP5!:Pa0@0S0 00B S0"0a>C0, ,0 ,0 R R2"!2(K00@ S)"', P 00C 4,  Q0 0C#4 4 404P8080 00,4 徐`Bⴐ00($|, $8<0 0@@,@@8@଀@D ?$4$P%402,P$e<@ @ @ T 00S  0D0 00<$40A$40 0$, $0I $ Z 0,d 0S d V`0P3  B  B00B11@ 0008ST0  000( ,0 R $ep^ g$_d\- P-L@ 00 R$hkA,_D - 6LM , RvfFXS$3S Pu T$0ȟʠ 0 Pş5 \5 SS SU us :0,\ڴP\%85R h0 S0 0B RR40NRR00^td0OS),`$ ?|/t$0ttS} \%h4R& 0O044D $0O84 R  0S> NS0S \ϟP>.`@P00`` `` `` h / O c 0_Ss Pq nP(0..<0000P@n = R0  TIM0S T^m 84Q ,h\`P &R[Pb F06 00`pW V p0OO  Q^Pa `0O?0@@ c@PQ5P f0,H5P 0%?>T 0 5U  1p5PXE )T5P l|ş 5  05,5  w +h4 H\Ն4 帓 , 0R(Kx0Sß@T" 0o"ßP@C0SI nFD唓+#P, $勓(`SsVL3-K B BFP ^P S@Td 002P c\54 S0 `5Sy@>xEp϶ XS20L,`p|md5S/x5tp d0 pP!tx5/ W.O/0,@`0@L l3B \AQ<0P d5WwXX\\\\"\2Бgttgx2x |2R -BMLMp0 0 Ƅ0P0S ANK @D@DPP 0R K24`Pt0@ h0 < 84 4$ 0D  CKH0 A, A (4 $ 6gTײ D0 ^ -l0L pR:X0 PH0a@p0`P 1  --,k -L`@d6c0`0V@ 0-LMMpPANK@D0@D\ 0   \680 B0 0RK0 yPd-_ -RSL8M@P`pE 0S  $K0S 0S0T o8 `3\K(0 <0 (K\0 X0 T0 P0 L0 H0 D0 @0 40 00 ,0 <@ ) < 0L0 @ ,<K0K404Q5@ R*0 4#4@ ` P0@_4 0K@P 4 <0K0@ hю0@@ T (Koi(K4<Kt <Ko\-h-`ehePcXe -LM 0@S `V 0 V p̐ pp d T 0`V0p8d HDLTL? 0<` @\ l2>4Q,h\pC00p`V\-[ek-, -LM,00K, K00 0S3\%RX` B2 R7Br @T T `U@ | PU`Q\"\0Y00/H2 RB3Q}H 叢pP4 q   0KH0*3Qn 1HQ4 Y 4 0 !A `gPP@0A#O 1"1?0P HA`p-8PP`# P P 0 r3p1>0 R! "A@e0 0@A0#O 1#"1?0P01 FA`$ -LP`  PT  P P@  P8  P( $ 0 B D< PD F G 3 ı$0  00 0( R- C 0 - -@LP P  h 0-L@0PP HPg.P@@P[.P0\l -\0LM@(0K( 0 @ K$ K0 P K$K- -0L@P  h[ --@0L M,K0,K  G K`l -`0LM00 0@0 K P @|< K-|l -t0LM $0K 0  $  K K0P $0@| K-l -0LM0S P |X@0 @00P |-ll -LM  K K0K p@n|ͬ aKl 0-LM 0PS    KK0up @J|婬0 ;K0l -L@V0=.)4m 0S00̱ -p-LM@0`P0 R|P0200  0S CKp -0-L$@KM0 0 0P@$0 S000 @ 1 00 0SK0 --LM0 0 OjHj K p-PLP` 4 2  0:ipK rP@ @p0S P P@PpUP@ 0 @pp#Hmhmm - 0LP`p) 0S& 0S# ,, @T0 0pll 0hp\iK PP@ V0(0(0$`@(@$`@訥#- -T1L 00 0(Q,p5@p 0`MP0 (@T" 0 0R 0 0Hp 0 0S 00 0IP 6 00 0$ FPPF@ 00 0 (@T -mHm C 0-|0L@0S(@TH0@?PP 40PP@FP PyF0-I C --LM0 0 >i7i, K -LM@Tp`PK! C-P4 0峅 0 (mmn -LM@6i 0pP,K:(pl PcTp`dP U` (\J,K 㝜P ,TJ`T,PJ0[ 1S00 0KU% ,EJ !)pPhz0S dz0S `z0S (v,(,J* (o,(%J#JS,W0`SʌUH,0S oA,0 $K$0 020 ,N'`KDnhnn p-`L0S* @P'   0P00 $0( S ( ( R$0$0phSp, ,0 phphp-D< ı -Lpe0@ 00 0(@T dp`P׃py0S P, 㫆p0Sy0 Sy0 S @ T -[@0 @@00@0d:  0 Sdjpz   (0@Sd*Ph:0@3C 000t30SvL3 Q`0P0 20D080U00@ d j0 0G4K(K//U wwx/ - L0R  P<@x -d2LM0, Sʻ,0l,@P,2,R@ d 2 0> 2Q)< 00C 0 ԑP\01 P\0?0 0! @ d 1 0; 0@4D\1 00C0p帀,0Z !0# #,%<+ 0 OS d&0OP `x`0d 0@@0 0P`x00S0 x0, 0 x0,,I $000 (00(Koꄲ//U w/`xT/ -LMK@, 0 K`_0@ P A P @ P {Z " 0!C Bp  0 K4 0@ 0 @ ^K`pL =0@0O$+41 ! d e,04 0B KA/T/ -LM@`pGK,P= 1@ 0 A SA  )0K p P  0K $Z " ,K01B00@S  0K4ZP L=EK0@0O4;0 dD04 0GKDKd/A/T/ -:L4M` ?P L0 X @P T@ ɯ08D`;:Q: `: Sr\ mQ (:  S4Z@ ,08x J @P@PPjɟ 00T 0L59 0$: 049 0B90A  ]8`0UT X0PD RD: R48R0?8Y00 8 04 000cH0 400cL0 H00O85{{{#TT,|d /ht@X/T/T|/Pch/d/p||// ĐY U400S40|  00 00 ,00p0$@QPU``0^3  Ba0B 5 =0 B110L 000@x0`S0 0OH4LD ,L=2 000`1PH P=LV>00h0 h0 S:h082 0<0H2 0\ T2 0 0R0PT0XT0P0P0HU 00 ,00@ 0PP40@0, 0a84 0 =(0 H4LD0 ?>0 ?0 ;0 4 D0 40S0 8<`4@P4 d `p8<4 00@ Pt@p4P`~ @5P`8 , 0ls@@ < @K8 K00K0 @@P8PK`VP ` Uap` p 5嬐K8 4 6, 帠 8d 0A@@c00@ Zᴐ 尠 0Y @K$'J F%*0)ZTP;T70S@P'D*0\\%7R7\5*0#xG*0P7'8Q0\570S Hg 7P.P HGL8X@ KVp [PxP rPP\80X0 h R01:0-P&{ H *Z`p㤐K9),`0S-80O ,00 /@_d x)P0d P{cP@c@t 0 S M  r s`pP0I,0V0S M :0S :PИ :,0S;P @< ?>0 ?0 ;0 4 D0P  *3J*0`PKTHLV0Od ^00 f0 R 8000`P pV0 008P40 r @@rA@; 008#80(K 0-LMReX0@K P0,L 0P< P [=ePK0///| -0L i?$@| p-LP`@T 0@T *0P/S @0P/S00@T:/ۗP@0.S P@Tp0S .S0S`V (0  0S0R/| -1L MС`V( p1 R 0: S \2P8( 0RX$K dd\a\q^0SB@F00CS0A0P0 Pp 0S0!0CS0 0 Pp0YUyU廼ټd0 S7K7. [0 R@@4P40d6 KHP嵺@FᘼPᵼP(嵒//}@p[ }| -RLM`p, $0 W @P p  ,fP `VpW V@ PVQ -LMq0@QP(0  0: S ( 0R:$K 0S t0QoK2)P`% @2341  ] ~p` K4P  <3S 83S c00@'43: SK)Up T2 S!3 P 80dP =P3 3,}/|d} -LpM`@T PK(P 1 R c0S 10 @TK0 Q p0S  Q 0 RwP 0S x0 Rh.QT0  P 0 Qb#/////p} -bL0Sp2 R p PYPP X@P# 0A S5` ܝ WZ 0Sj P @勓 P1 W@Pc0SchT0SD )P `T0 00SB 0AS) d  d @ d d @ @W 00 0S "P 0S00 0 R Q ADwP 0S b0Sl0 RpyvD Pt 22//Ƞ///ԇ -L@Pa80p0!Mp- P0@"S"꼠 l < Mp0 bQ!@+:0S I0W 0i0 0|0 t0h0 p0000M(0 R[/}///// -000 0LS    V, /}@}-0 CR 0R0 S䲸00 -@RLP 0S Dn 4nTH UF 0@SB 10S<p `(<n0C3@ R 0S, ,]0S|T@ l R @0 S0S400S(>h>h9ttp 0-PL@0S(0hxnBQP xqnt d\00SP e <  0Zn (0hUn}}~p ~ ~ - L | PJ1m @/4~ p m -LM@/"P0002BPp2 lR dr`XT2T"PPPfP tP  }Lp2 10 bSP PP P 0@SX :P010S Ya@a,@ EpQl 4  EPP `@a0<S 00K@P `0S 1 0S0.+0S% 3KP ,K  04 P,00S F.040 8K[P @00S d0 0X0=㲓/X `8h43D~H~ط\~p~ȠP -0L 徶㔓$@~ -LpMp`@ V,*U&/00]j@0 PsP3U @V P X`KrP0: S M`0 0 $K:P =` (: -Lp`i[[!Kp mP2 pP X!yKpL1 ApPE @` 0@S 0P/S @0P/S00 R:X  xPPP )@P m(PCP00 U030"S 9PH-` 0\-?P` [`8< -`LV@pPq \V Vfb[RC[VS  0 ^S0 0]S0 $0[S0.P =P:P 0SE  0]S0\\S0nS  0S ]S00]S*@P"\R0[S  S nSP \SW0R0000P R @DJ -`RLp00@P0@ s0@0S S ;S s0@0S S\ 4F0gPV@v @Pt -L`?0rS aS bS6tS {S1-000, XP & 0R0 S 0A 0Sp P 0  @T0S04  ` V2/ p-L`@P @P 0S0  T X0 R P 4 0$ 0S5p22 0-LM0 9SP0S*$S /S\S @PP 0@00 00 K6L@@8 -LBK@tCM @ P T L$ Lt TT1P@, L4S4nP?@/PLt ,0S , ,0 r p000,0 R#R ;R Pp0000Pt 00,0PPL j,wP,  , ,0 r 000, 0,S0P0-0S,0  , ,0 r 80008,EP, , ,0 rP 000,00S ,0 M00,R @0 S0U,  P0 SKԴ P ij 0 İ d ܸ $ Ծ ,00S,0  , ,0 r 000 0"0 00,00S,0  , ,0 r T 000L ,0P$ 0S0L0P0z L0pL4 ,00S,0  , ,0 r 000,0 ;R R  X,00S,0  , ,0 r 4 000,00\S <,00S,0  , ,0 r 000,00S, !0P`0K00 )0 0eS * e 0`S01:-`   \S0S S@000S0lQP 4K@P0  00M,00S,0  , ,0 r ` 000,00S , M PU00B,( p;,@y\، 0t1,00S,0  , ,0 r 000,  ,00S,0  , ,0 r 000,0S 0| , K w,00S,0  , ,0 r 000,<, K 0S$V `  0b0 S01@ 0S 0 P  P 9 @Tj0 @, 2, 0,0 0\SSh% Y,3P, @ ,0@,0  P<$ R<H l 00  `84 @4 D4 8$ 0hS * h 0`S8 01:@@ @4 P<D$\SQ# RD `@T`FD + LP \  0 S0@B 0T0S@\T&T\00<Si@`Hd  S 00`0Sd`P0iH$0, P4 ` 0p40S 4 40 r 800040 gR 9R1R*Rj R;R_epR wRZVk`UpSVb44K ly0@s@\X`@0S40 4 40 rT (000 R  A40 40 0RT0P0- TT"@TT@@"l p ZB$0T$40L40040 wS,0  , ,0 r 000, 0;S}0,0@,@ 0\SS ` @PiD PP`0 HP0s 0@T E 000 S 0 0Q5t2/// 00H|(2 Ƞ4DLXp|2Ё܁//$T(PxPԃ2222PU,P  , ,0 r h000,0 ;R0,0 R P@ 0`S0 E f@TP U0 0n1!00g1(K -"LM0S>̂r`P y @R"2 0  կPP@Y. 0ld"0S 00CS00 Ӥ0ڱ r@ \w{00010S 00A,K*1P0S00#3 uYPP h1@Y0S Y 0H 0 , P4! 0qa00!<0P 0 0S 0[PP@UY崉 0| 0S 00CS00 Ӥ0` r@ v1 220H`Ƞpx2|2 -@L 000@蔹 0-PL @ 0P@000萹 -LM0S`p00S; :SiP 000S S,"PP 0@X? 0l0 00T2 0DD"cP<< $"0 00001,KH@P# Q000 ,0S: , , ,0  RO0#SL0nSt1 G0H00]@$!0S 0#S0nS 1  0,0 ,0S ,0+;, a0 @\ \0 0 0^0^ d 0000H000 0 00,00C茹22|2`2Ƞ21 22 -鐁向吡L`Pp@)fP aP eP EPrP uP nP 41 @@p 1@maf1 ^Cp0 00@pQ @0S@Pd0x@婯P W7< `82222@Xt2d --LM0@``0 9f0DSL0@ D0D0  n TK@p|22x -L.@PW  -L@PW  -P@Lp`8 0m"P 0d"$2[ -LP`p/0wS {S& sS'0 p &'P 0@LW嫇 0p0 pp 'P @:W噇 0(npPUȠ -P` PLpK y@ W000  0 0 -LM`0PPp@0S1 T 00S S@D 0@0V l0 l00 T00:0P S  0P$ hp222-0 CR 0R0 Sb00 -L`zK((MP$pG!0 0R R0帶哬@P 갶*0~ P0Q` P0V00S06#3 dWVPP 08`VQ<  VQP̌`[~ [~VQ`@@<@TU Qh`bQAVQ1:ZQ3ZQ3`+:dAVQ1:VQ1:VQ1:aarCWQuWQuWQubML5AWQ(Ql1&Ql1&cGCWQ(WQ(WQ';@d7֖AWQ';@WQ';@WQ';@e0%AWQ';@WQ';@WQ';@fXZQHZQZQ Ų)ZQZQZQgƆ-ZQO ZQX ZQ> H 8 @    ( 0 P PԋAZQO ZQ> ZQ> X ` h p x PL lZQO ZQ> ZQ> g RolZQ˿lZQ˿lZQ˿l TZQϞZQϞZQϞ/tmp/fstab.shadowZQ ZQ ZQ /tmp/resolv.conf.shadowz ZQ3ZQ3ZQ3/tmp/hosts dQl1&Qn2Qn2  D8fFlڠUtsJ? !n 4]~;; h*^^sZX9W&<1qGy#O69ʯ]3'Z?]eNV{Q `e=Qsm56b~zD'sK-2QNrwN޹$Gl{ɅqOZ@ǑC92Н)Z"^+5fqZT﯉0HHODyBImv\,Wj!Ew$oD"pOd\uS#%y2hJ0_YWp]Ft{+ϣ$) Z6FhSqv0V D R000P RM 0S͟0SP) l0Q|M 0Sx͟%!%*ll000 R000 R$͟M 0Sl0 p3Pl  g l@0=0C>S񟗭| T  T d D ` p \ ( \ $ t [k0SK0000P 0 0 0l0 0 @l @ Sl  l L00l@000S6 ˟0S= 10S? R  B DPd 002d 0` c : J0S 0 ʟ 0 0 l 4 0J`0s hP Ps P K#P4[S 0y䙟䉟PD9< 0U UPVp )000 \P 0SqP" P 0S\ \tc@V P 0iS@0RPaP`0VS80S$$=80S  2T80S`86#3 sTPP~ T0S T q880S0S 8 }P 00] tPW70S0S7| m0SH 7rB0S? R  B JPd  00bh@ 0 ,7Zd\h& 70S0S 6I xhƟhf 0SXF 0 zP4 0 0 0l@0 0 @l @ ZPP6l 0p0 @T\@ X 50S  0S0xl 00 " \X0P< E0l0  @` `P\0 HX0T4   00 `Q{l D0p`Z&Up% \U 000C SS p0&S\SpPğ0@0S :K@ p0@` X$P0001 @D"0T 00tu& qr ßPd0@00S :K@ 0@` #T@0X `000PUl0@0S :K@ @#0@` `0PS@`@  ß0 X0 `A` "0XSX00X0 0S @X@0 SS S X0` X0X0 @`0 /Y00 \X 0P'`@TVYXX 0PK  @PK l 000S 1l @P- PU* 0s<@ 01p@Wk `PVk 0S05N KƐ0S2 TPr 0S0PP 1S0S@T 10QT NtA ppQp0_? P .U?0#K"0KR0(0+0@ ;0-Q6  㲔 #K⭔0@ RU t3MM0+0#0K"K!pK  0Q , 0<I<|Mz6|gܑdhth 0gđ 0-PPL $0$@QmPP0gth -LMPP 0-S- `pC#op lP sP ?P`K9`PhiM`PCP#oppV OA0' #0@| 2  0 `Px @T3 3P @, 0T00S&R+PppT] 01P` KkrP@ pKZP=@T 0%SSP`zM`T; 01P `K0S L@T' VrPw !0LSLL 2Q0 dLXL`O( 8L```TL`O0 R @[$ R @LTL`@p@ Cgp`0QU Dp`0@ R V"T WPDpHe@P `D\0pGx4Dpm@g|gpġ,hl_dht -L0M8dP0D($fp LP PP ?P(KC#fp0S DAΈL 弉H X PU 0S xsDl3p0S\jD@P `T @gT 3p"P  "0 @T0 D P 2 ; 80 4 g80 0x@0 < hnj0pK@`K,K0 < ,0@P)00S "0 kZP<k<@rU DD0Sh !bFLw C\.t10S<<@0/S4ZBT0 mL 㯊P  3D0S> !D7  k1P+ 0D0 P0 PH\0P DP P |Cl<@H }CxCl@P<@XCg|gpġ,hdh`JЫpl_0fP -hAPL`!e`pp mP <1 8 jC0hC@u`P- @p ep01 PR @@1ST TVp OX b@V tOX0C@0 pR@D b@|gHlg̖ -`L0 R$ p@@ T P 0@P0 s 3T R @0 0S  @ T 0 0dhg -LM@PKp@6c0@0  (ep ?P pP :P8C 0008B@0S  ڄ`P@ PR1S0 01 0S00S 000@$KT4dh -LMQ@   @UϠAl  _0 Dp K`lO LBd,#!BU`bϠ0 Nl _(0` p(pꭋh[Xh -LRMPp<K`0Kg GKd P`y @@@@@@@  /`0SY DK0KH YKE 0  c0Rc=9 =( (0 (0,  A, B, Q=9A =C, ( , (0 0 c0Rc=9 =0 00 4 00 A4 4 Q=9A =C4 0 4 00 \B ^b A, K0@O4 K0@G_0DKPA0K YK W 00!X 0R=9B( =C , (0 , ŀ0! 0R=9B0 =C 4 00 4 \@ 80D c<0Rc=9@ = AD @0 D ^ @D K0@D K0@t, KX0\@4 K0,j$KHff?Bxf -LPM@lPK`ሀv dK 0lp 0e  0 0$KHf  -LPp@ cp fP/ vP ?P>@@ ycpp01@T `XP0 [Pᚄ@T W,@Tp@|g p-LM 0S@P1  KgP/0S"  D 1`0P @Lf0P0fC10C0 0S0 ,0 R$0xxxdhghH 0-hALM`!Pb?PA 0AT00  KfP5 \51 R= 08S9 R 08S S\ 000 R\ 0 S Q0000 lp0"@0bP[K0@`@ (0@|gdhؗtȗ 0-ALM Pb?P80AT KeP%  0 0 rR P0S @ZF[\DP0@0d0 R R 00C8S@ 0  ?|gfDhdh -DLMKP`@0 0=00 0<00^L@D,00tP@T@B>FD>A|g<h,  l_  p-AL!`*a?P8 0Q@P zP# PzP@ yPp@B^ 0S > `l>T @pT>pP@U 0-S0S>@p|gj8D -`L @`?P@ hpM0T 10 00PS<0< Y@s|gdhghf -0L8MT0 0\0 0CPX0 XEP%`p2 rP ?P pP,K<PT ,I>(KsP uP@PT  , KF=PT , 1>D0$X0 y`p01 `Rl40&Tp=`$Tm?@PP 00TP  n=X0STp 0 40 0 140P0<0 8 `0IVP0 8`u UD 0S C0 P0U u0  $0SkwP 0;0 0S C0lP0\0 hX0S L0 cRLK ^pPp<0  cR<K^`Z4 UJ uPu U0S8V  Vx 00S 0V0 R`FV00Ȃ0`D2 R98 OPf0\0\U00Su U 0!0  80S 0SPr1$ RPkT5P LP1 L PE][  0نfP0==fX0S@x@3u00#T uP0  D0 @ TD0p0H L0 p` 000H>5H@ T;|gT\d.fdhhg@hg 0-PLM @C_?P0 01P@PK $C0PS80S08PKCP0|g p-,QLM$!@_?P5 0aV/ 1 0K&P+ 00 R 0 0  Q  0S  0XPx?o X<xx>@xP4  <xo|gfdhȠ|  p-0LM` P@^?P 0AT K0M4\0\  00 0l x4O<xG<dh|g\ R4 5:0QBa -0L` Q\p 0PS @0S 0SP00@ST - LR@:Q0AS Q 80p3P000 蔇 -LM0P@ @ P&0 pP#0:0S0: pP]  `PG00< !@@p@3{0@ `P4!@ \P `P  P. @ 0@@ @ P @ 0@L @|4 @u @nx L`8 p-L@PY0`PP p P P` `V`p p-LP@0`PP p P P``V`p 0-L@0P 0 P 0u30 ꔙ p-LpM`Pe @PT0 RKpK_P@ : S I@@g -LM`PP@p1 0A#SM,8 8 7 7 7 h7 <7 7 6 6 6 3 `6 46 3 5 5 6 5 \5 05 5 5 4 4 4 4 X4 X4 X4 X4 X4 X4 4 3 X8 KbP0#50#0# KK_PBK_P:p 0RK_PBK_P 1R 1R$K 0O2P000QP0  V_p30  L_8Mp3Gp3KP050#0# R  K_P 0 00 KP\0S0 KPy3 RsKP040#0#i gp3bKP\@ TWKPQ0: SLKPF0: SAKP;0: S6KP00: S+KP%0: S KxP0: SKmP0: S K^p3K\p30!SPPU@\P0 0 e1U ` 0p03 0 0s30S!BKu^PKp^Pp 0R3 HPBp3(K 0,1P 0ES񟗭9 9 p9 X9 @9 (9 $ (0Rӟ$ (0R$ (0R$ (0RÍ$ (0R$ (0R`0Sgg:@-0S0%@0#0%*0Q00 @8 @8Ƞ -L M@2@"P40 0 020"P,0 ( @ @ @@1SP1`6 T8` < >@T\J`@pK T; 4P` @TJ4PP*T 04PP<<00C<0 4P`<  @D1`P 8$K@pK 00 RsP @ 0, p3p3@pK 0 0  ,@0 - , 9 9 xԙ̙gؙ 0-LM@P$K $Kp  ?<#8K0 Kpq8` -@LM`P@Q $K 00P $P 0 08 K0C4pK4@ 0P ,@ (P P:@T :=k$77h$  -LL0PS8H 0 S S0 0   0#  A0A0 S00`pB"Zp?@C "P@ ? ? ? ? ? ? ? ? h@ ? ? ? ? ? ? ? ? ? ? `@ ? ? ? ? ? ? ? ? ? ? ? ? ? @ 0SV0SR 0RQQ  RP A!Ypp?@0!R i7``WhA\!Yp . ?0B"S@ ? ? ? ? ? ? ? ? |@ ? ? ? ? ? ? ? ? ? ? |@ ? ? ? ? ? ? ? ? ? ? ? ? ? |@ 6W |Q @x7QQ@T  8P$2|g4\h0 e0@-@^ 0#S^ 08 S00S0 0#S 00 R00^P P0 SPR R^ J0Q S0 B00Q B\0AZ# 00000 -L@`{AT- p@PP 0`pc@W P`rP lP@W L -LM@R00?P`p@ 0pUWlŸ (0K P{ T0\\S@DLT\"0'P "P `P =P :P @DL^m0 g'Qe "Qc `Qa =Q_ :Q] PP^0 'Q "Q `Q =Q :Q \QP^TJ q7 1  01 0D@q* 0' \ZU-0/S '0/S PPpp0PdpU@{ Wl{y0Sp(  0 0 008PpPI hPO  Q-L@' T# AT *0Q/S 0/S@T:0/S d 0R /S @T:0/S Qd p-`PLP@VP 0R  0RQ^p^p -PPL`@p 8p@@P LThEdh -@QL.0  \00X p`@[T*T ?T $T P(U /TpU @\T0 SP` U~X 0* 0 P Wdh( -RL|MJaApPD0pp0wF P P4`$KP10Kt!( , 0 0(0Q*PP, 0` 00 @P/ ``QUV V& @`, @`DA A@(@ , 0 KP0 R7`T (0`0}@dhg,`h  0-@ 0PL`P 0c0 -LM0K` l lPp   XYP P0xU*YP lPp  (K @`DA }AP@Pdh -L,MP L T @fL 0 40 0 H J40T0<0 8 p P:P8@w  YD  0< 0 bR<K_T@Y R   P /00D00D0 H<0  cR<KET@PH ?T 80 T0b CAT00jC1T@0 $1`p@pW` 0,0 , KP LPQD p@ 9@`WT 1 00 R P80(K,0S 0dh -RLM<0 ; @3P`4`KvH#8#000 40 , ##0@T T@T"0 !x{2P 0 0p400gCz @W `2  @jY8 @ ` P X`P @ 00kV 0P dP XP @  81K- 80 1 RW 1 !0 04 4,0Q8*00040 ` 40 3<  (K !(VIZ0 P`` VP @PA0<x 0X0@` DA A@,@ 0 4  40, 8dhg0g0hfH(L -/L`UhHPDp`@PP@ T iKXP̍ -!LHMp0W,0 H PM dpK PLAXK@0[?[ 0H0[XL0D[1EP[C`[@b0X KX L 70K`:K9K8@K0S0S 0S0 S0S0S  㫢P H, 0R (K40$  ' Nc2fn H -@TLPL x0S C x  Tp0@ p0TP`\@f(x R p0 Bx p0`\f -`RL@YPPT^ Tp ppTPW oU 00 S/R  0R B/S PUW10@  `1`0V0 T@j DA  1A` 0V@0T00  o{P@j DA  A dhZxf 0-LMPK R@PL40SH0 R l Q@PT[8 h -L M0S 0 0@Q@ K0 K<P1[S S|ࠁ ࠓl 0@zP[yx1[S < 0zP [kxephg ht@ȹ8 0-L@P}\ 0S0S @p00S@ @gd0 -@L! @@@ @@44jP, 303 0 h fB nje P@p 00 P 0-0LSP @P0PS0 0 pC<0404 00, (0 BBBBBB-l 0S ^S 0000S$ >R@0̗?R!00:0 0 BC0᤹ -tLQhd0d @pT *T0`VPUzTP@00BBBBB - 0pL`P@0 ^000@S@0C@0000`XP  r 0  @P2 0p-Lp0s TT 0RHHr P@4bU0c00D0c "S00!000o!0PL 1pW)a0 S@10`PcU]0 0CSX@0 0CS@ TT 0R( 0R <qt Q!0@TtP0S:00 0R>*@DVt Q00 QP1>d\@P d0 R} X0 %>wr@BBBBBBBBBB@hC|C -\0LT0L0L0@DP 0540 ,0 7hBBBBBBB P P p-P0P`0 0LR@ 0 R R00CRphp!0DS la a a la a a la 00C0000BBB p-08`PLP @0U@PpB -L - L p0   B -LM`@p0Pd K"d@P `00`H0H T wBBBBB,0 (0$ 0c0ALghh CC P-L@ p D 00 hK^IT?@hvP4 -$0L x vf -Xp@LP P <`0T: 0S0UPBB 0-LPP @@ T0 0-0 L\+ 0P @ @T!:\$Q \ q 0_Qq 0_Q $Q\@T*@00BBPB 0-0L@Q 00P:|0@0hlP P: U T00B0R T*0B0R T:BBB -1!L@P\j q``VE:\ 0$R \ r 0_RLUD r 0 R0@!0 ӑ  T q 00 _Q $QUU q 00  Q 00ӑ\`V* `yq 00  Q` 00r 0 R0, 0 &BBBPDCL}U{ -4LP $0 A CB -0@LQ 0 Q 0 R 0`S Q0S0S0S0 SS CCQ0y0Sv0S  CBBBg -0LB -0LB -H0H 0L S 40R BBB -H0H 0L Q 40R `BBB 0-0 L P- 0P  @^!: P$Q @ P@ Pq 0_QPq 0_Q $Q@ P@^*0H@BBPB -L -L.0 gB -LD0<0< 800 00@@KBBBBBB -L> -0L `R0 PhP0@z|0 p dۻ@`0@dTPT0T @@@Th ghhB CBBBBB -T0L R D0404 00 0@BgBghh - 0 0LB C -0 LA CB -0Lhh -0L|g< P00( 0S P0CBꤹxC0@ Q-L@!00@0@ QP =D0 @<0 40V 000BBtC -LMpP` ȀȠ04 <0 8 0 00 , @@@@4 0 b00Z<08 040 00 ,0 0DJY Y (KBBBBBȐ p-0L@`0 ^P :ϠQAQ 00S 0U^@*ppBBBB -|p|0LP R`*\@  ` 力0 0 0 BBB -L@,P嬀`@P0 ㌠ 0 |pS030#0j0V 00@0Ttw0S:00BBBBB 0-1L @Ts 1 RD0S S S "S 'S0S  B0S0S"S 'S 0S S S S S "S 'S0S B0S PU "U 'U PU U U00zP0 D0T'* P P "P 'P 0CT: P P0_0 P P "P 'P 0CT:"P 'PhhBB -l0l 0LS`\00000C0P 80 40 -$hCClCBCP 0-PLM T@00Cs0 0K0KPK 00Cs088B p-d0LX MQT@T`0PP88 1?1c"10c QpBBhCCgfff -tpPlp@LX`d@D0 <0 40,0p pBBBBBBC -`PLP LPD < P0P0f 50%QA!V0Pfp p@@Tp e` PP0 0 B cRW@@T P 1U@@+T00T0 0@Pt0S:\CBBBBBB p-0L MP 0 K$KK a0a(@K @`PKp0 !$0 `xV P0APYH aPU$PBBBDr  p-P`L@T @00TPc@PdH@pCB p-0 LQ 0Q` 0 pl`tP0P `0@d0S00CP 0pC4u hz lChCdCB -0 0Q tt0 `L X0R 0`@RJ@dBBBBB -LB -L -H0H 0LQ 40Q,BBB000 0Q 0 R BBB -T0T 0L Q @@0R `9BBB -1L Mxx 0,K n0nP(K4@K0K @`P3 U (4 ) ($K,00 (pcVW00S@ X (0  0R/S 0!U00SQ((4 0,-(0 vBBBDr -L -L -L -Lx -Lp -Lh -L` 0-0L^S@P Pe0@ P0 -0QLp @aT`*@DT:PPX`0@@0@^SDN(0P   CgBhh - MLMKK I0 , -1KZ<p`P@1p@0T-9K.yK@ ^KPEPE@T9 P0V 3 p1R5 h1R; `1RK-0KS20Zp0'81 @nP 0i-![ ^R@Z /`P, 0R*(KV Z ^Y *00hY ND bZW | u B|\ -@0 PL 0px@`00Cs0 V U ~PPyPPVBBBB -L,`p 9\ 0S  2 1C P@T@T 0U qP0@T @W0@0 P6} 00  0@@1&ꄈCB -p-ML M` 0 R0 $ P#  $ 0SQNK@D$ @D NK@D$@D $ 00\ | 0RKp$ +Wl 0-PLM00 @R 00   Rp0 RP0 R<0 R$0008C| | v [ \ -h8LM \ T8  ,@P 8P,8  $ȟ@0 i0 d 0@^ b0@X <0@R0 M C0@G c0@A #0t@; 0`@5 0L@/ 08@)0 $$ =0@0 0  0@ 0@ h0@ d0@0  B0l@ L0X@ l0@@ >0,@0 0 0  0@ *0@0  C0@ f0@ g0@0 <0 \ ?0L@ ?08@ 0$@0 0 0  .0@| _0@v0 q 0@k0 f0 |a 0l@[0 XV0 HQ A04@K U0 @E u0@?0 :0 50 0 y0A@) [0B@! [0C@ [0@D [0@  O0@ O0@ O0@D O0,H`@ [0`FP@ [0,P@ O0`@ O0P@ 00@@ 10(@ 20@ 30@ 40@ 50@ 60@ 70@ 80@ 90hPE `F5p@ [0@ [0@ [0@{D [0H@s(KP CBCPg[ j $l n j h b h  ( ~ | | { \n h n \ 0 d l 4  Z   R 0SD0\ D0  =Za R  _ 0S    ZPY 0 0 "" "Z  R Y ZS Y 0 -00 40SL  00 Z !  0儠 0C0 p Z nذ h X Ȭ ܫ ȫ D@T QA  \0P00S Q0 T,0P 0`S !0J]Sꬨ ܨ ܨ ܨ ܨ ܨ ܨ ܨ ܨ  ܨ ܨ ܨ ܨ ܨ ܨ ܨ ܨ ܨ ܨ ܨ ܨ ܨ t ܨ ܨ X ܨ  ܨ ܨ ܨ ܨ ܨ ܨ ܨ ܨ ܨ ܨ ܨ ܨ ܨ ܨ ܨ ܨ ܨ ܨ ܨ ܨ ܨ ܨ ܨ ܨ ܨ ܨ ܨ ܨ ܨ ܨ ܨ ܨ ܨ ܨ ܨ ܨ ܨ ܨ ܨ ܨ ܨ ܨ ܨ ܨ ܨ ܨ ܨ ܨ ܨ ܨ ܨ ܨ ܨ ܨ ܨ ܨ ܨ ܨ l R0 B 0Z ZW  RK 0  0 0 R 0 0  䨐 0 00  R0 S0 P(  |9 0 x0 t Gx00| 0 R pp0P/S @j0P/S W :S 0 cR ڀKS= @ 0S 0SS|p0S+ +S. -S  S`T0@Q {Z @L 00 Fp P)0p 0 |0 〠 p C00p p  B 00#0CS` ` ̴ H  4@Tp #T  Q00  0 C 00  000 \QT@T*T#0@S  #450SEx00 R 0@T@@@ 0 @PD0   0@ 0` 5P00S_ -Q=Q ?Q@ ğ0S 4P  0S  R0S 0 400c0P \  0 #0C SD D  p * `p $0P $00(   0S @80 cR8K;0Tp00S) 0  `p   $0( 0 0S 0@80 cR8K;0Tp00S)00 `p p  p Yp 004, ` `@TQ P0U*n PZK 0 ( 000 ``, H000 80 4 Yj  20Szuz7JP0 t 3 0 0C   0  oP  R00  P0UT*`ZP(K0Ĺ h[hȠghlg4hg`J dhP400c0 0+ 儠 A #40SqpP P0Uq*p P UHL 0@` DA AP@P!l1z01@` DA AP@P6@   0S*0 0R00  !` 40 `ቹ!0@Pq ab0Q   0 0  00@"00@40bpP0%S! ڣS S `V0S   0S` p | >PPPEW40 P@XC '   0<0 0`00 WS(pp@`Q `Q. 0S K- I` P|P  ;|n0 @20h$@> 00 D`     v` ` 5 0 | dPK@K0 `  b0S @80 cR8K900 R ` `PV 0S}[;P 0@S*S0]S @V*Vo5@ 0Q  00S00S T  q94&00 >  P   R: AV` [P?0 00 \[P 0@S*S w  =R f 7^Pa@ 0 :S0  0 0S     0 R  #70SS PLU @` @0(Y`0 R0@T 0S 00Saf 00PI`P|(|  p3X@ 00s03S0+S@ 0 ]P)a@ 0]S  #0BS 8p[]PP@ ` aPU 0 TT@g DA A`p@#SKW@G`UD:0` 0R=P p`90` 0F=P`EW+0` ( 6. BpB K041,Q"( 0 0% P I0 0. >$0 P0R@@^F0  0S B h0  -`$0@;F 00dhg`hH؟  -0LM  00  P,0 0P, K  0 ".\? R>0 R@ 00 0;0  0S O@P< 0 @ ñ0 R^ 0 RY `(X >$Q \KP00>X #,QT X 0HS񟗥  0-S 08 KpP<0S! WN= P @0SP  YQ  ;P3X jW 0S 08C80CS4t 4  T   h h t  d < R  ,pWw 000 00 S<  0S0 00|,0,000S 0  P 0S!M< R0(Kxpy; R 0@H  kWZF @+\0KAS C\K003Wr\+AmPh 0Se 8;Ra0 [0 R  0J0 R 0 RK6P0: S`0Sz ?M0 Rt: @@d:  A4 0 29# R& 40 R" VSZP q?40 R @440 0\9 0_?40 @Rt ;40 R| 40i x0 O0 0 R  C0  + (\0K R@^D 0X (XH (8XX@@HD 00  0 0 0 0 p30 0<P0 000\0  7X 'P0 L 7'\KH0 D 0 0 0 0 0S00Q0#S0<\0 000 0 080K 0Sx 0 64 006V@P t6 ("( [0DSXT0 r00@ 0Sg 0 Rc0 4 40 R 40 qP  5Pg40040 4 0S0 0SB0 R> 0 dP-0  [0 .,5 5@P 5 ("( 0DST0 00 0T00 0 @ 0 @ 0 R@@K <0@0  @J000 00 0S C0 A0 0  @}00 0 4 00 0 @Y4 dJr*04 0Sx|@4`@UXPP 0S0SLS 0 0P0 @=C0 !8 K]p2 K@P@"0S 0SH,R|0 @& 0 @ @`K2@PVTBP<0P0PT @8K &1 00 07 20 0*4K\0K ,!P 807***0 00 60 0  -0  @$@0 0< 0< 0 0 P0 0=PPH|PJ hdhg f8<xf h@gDlTHX  x ĠggfL).Ƞ0@ 0 Rd 4@80[ R`  `0`SQh?TW0SPPl5TWY P(TW0S 0P00V00SP 0DQU000 t0@ 0 0 0  0 S00P0#S\@8@K0S U0 y0 40 RH 0S40 40 rU0 e0 40 R48K 0))A LP -L$M< \@0 0,0 ` 0S<0 SH < <0@T8<0<) Q <0,) Q <0) Q- .PpP(0pP pU H  8 R=0H0 (01@PTs H0`< <0SX 0S <0S <0  x>Y<0S <0 R4 0D0 7 0R Ru Pp"0'0Q70 ;00 R   0WD R I p Q0SO 0 47@# R WDS{V4 ;@PTP  < <0S  `H 0PS @0 0H @0 0SE @\ <FW }T7 D 0@p7W Q0SPU <0S < 00CSYD d d 8 <0  005 `0S 0SLe0 <0  8ş#000 < <0#20#0 ,4 <0<0 00Ļ@P 850$<<#04 <00< 0< S T'  @0,(K6. XH BXLD <0 `<0 R <0m@ 08 ~0,0 < 0@<0 R <0 0U)PqcE P 0< l< 0 0,0 <, < 00D0  `3 , 3 R /P  ( 0,0 H< 02Ģ@W`D@ B\ @0vŸ<0  @  0`, s^ ,p n04M  b l2 , d XN 0,0 ]2''<0@?0 < 0,0 K0`H0 <@ K<0 RS <0? 0( ~0,0 7<0  < 000<<0 H< 00<0@  L1@ H@ 00 0P0㢾@0 0S @E Ey <U<0 Rka   0,0 , d0 7'g  d |gT@xf8hdhhDCfx \thjР4+ 0-L M$Q0 0 @R! ^0\ 0A|3SQ/ P 0R+K00ɪp3P000QP ^ K K  L0S0K\ K00{<@ -8@L Ӽ?0000 dh -LM0@00Q ( < P d 6 & &0BS ' "  | 21Ch 0 X 0K 0 K 0K4S0Ƞ<T\ԡ -0L(S 0S     "(0!B "0!B \ -`L@t `2  @t 0T(0`0< (Ÿ00:0R _T{ 000#T0Sq 000#P0S _PqPA f L2@;0<000 @ ISPP л'0`0`@0 [T5 0S(Q ` "2@Oᴻ&00`Pp+0 0pS T21C   P0p`040)00`MP`(  Phdh\̙ 0-L$M@8 0 0K, 4 $@ @ p%1ظ@P  R050$ T+40S)K00PK1(0(S }#(0(S8 0 R4 8 Q$ [R0C(0  K%g  dh -0LS@P 00S p `RP @0u@050R0 050p c -`Lp@T  00@@0A   P  LRX @3QX @ - QL M`4 .@TPP!0DS00STk #T T&0DSpQh(K4~!T 0p0 0 "T^ U 00c 0400C00 @pPDU%21C0 40RaT  , \ 0D,0 Q, p RSTT T 0B0DTST U\ H ,  t < $ ,  T ,0 S(0    Qp@PDUT$21C0 40RwT ,    0  ,0 ST  0S 00 008 P 00C 0 0Rö 0R 0R 0PSPUv  p0%SU 00 0  00C 0 0S 00 00 0SL 00C 0{ P [ t P P m 0Rh 0Rb 0R\ 0X 0"T 0P 0RL 0H 0cD 0@ 0S 0SS 0 0 O> 0S. 00 0  0p0C 0 0S q q H p,{!p 0Jp 00s03 0 e0p$S {  00p, 4   \| 0-L M,P0@4K4 0@ (00K00C-D0D 0lCQ  /10 00hhgC - @L00C -L P訹 -LMP@:- ᯦P00PT"QaA0 10Q*(K媸0100CQ*00 0!  BR 0FP!` pP4 ) P 0@0pP 0 R @40 c0 0C0. 0PP `E̠E-K0 ED,K+K-0K*@K)PKa ᕦ0 Z 0$0*gClhhhgCC -RLM@PB `0S  U@PER@      0U `0 d0 h0 lX0 p W:0FS 0bC1AVV0a1,0 PL @a,,0  ``  hhgg -ML3M 3R, , 0R(Kl#00d#dK]OXP L.,P -$@P sTl 0R܂P  0@P0p` 0S0SZfJp J@ @0S00P :S x p h ` P P0*2PI P PEV.*0S PEV:U&  RU! BKAA! 0!5-常 P$ cP@f @d DT/ _]P[i@t000^@0 J0T 09-P 3IKAAP$00yP8'7gCCCg CClhph0 -<@L0S (0}/ }0 @ glhghh p-0L R PP P l`PdphpuL0@D@@娶80( ,0 B @@CCCCCgghh -`PLl0V ``p0`C!VQA8 ɶ0`0Qe @vlhhhgg 0-L L0L@P& P 0dCPB00P0ghh -LMQ@,0 ``pዤ PhEQT00?@AP*Z:a@ 僤P X@0fPZ :,0S MP 0hChhg -D0D 0 LS:PS0C  0hhg p-LMPK`@D*P P11 0 b! PU3 S'x0P?S0 b@@0 @{0P 1xS*U xVSTxD 80 x xChhg̢ -$!$A0LS`: q Q0 R 0B0 呵00C0 V pP oP@ 00 R0 plP@ @0 ,TP 00DghhCgl_g -:LM$ `R pp p p p I)&pV 00@CS< < < < < < < < < < 4 ,    p H PPHx(9&p0XA P YW pW 0S㴀 Q Z0S0S  @TK X  7  000 , 004 080 pP ^00S  8  bR#P@  0 PpᰢP `g 0 .8KQ}yu(K6 3^ # Z 000   ᗢ$6@  * pFW  l0S0l Z o S[Qo @Y@X *P X  "X Z 0 r 3 Yy H%H5^ppQjZ00 ` & 0  fB!A0@0@ PP0 d 0Q00`Z  X 3RI,h|dp`d\^ 00S 0Y   ZJ =㡡P 3P (00c  Z  `0P3F/P`U RoZ00 @  $F00S00@Z  X 3R1pZ UG ?IBWPPP 02PP K Pp0T20 (0,0 儳00@ `4 8  1P08 @d\400c00b S8Kژ"8 @` RP _Y   aZ  @0 j5 I1004`"4`$@W5 481?80`@ cR8KT"P@ M4, `2>q@45 gb40E'([@ g|gЫdh`,ChhHfl_ġ8tg0     g(0$0PQ00g4 -0L`0V`PpϠ@@⻲P,@ p0PP *1r P 1$0  00gDph -@@L |10 x10 Dt1 0 HfC P0-LtP lPP 0SP@0  0,@P00P00g -(@L0SS 00g -8@ LP0SS 00g -0@L0SS 00g -@Lh p-0`0C QL@ R pS0S T0P0Ppph,PuP0&P00S 0P0&10P0` T 0 00P0P0T0P0 ꘤hT -LpM|K@Pt0: S K --80LM R 0 0 + ) KCxf P-L( `@T PU pmPp0 -R  *.@T PU 0 S0HL. 00$0$  -R  h.ghxfD --LM4@0 0 ;+ *)Kxf --LM@HH-0 40 "+( *)TK5Ĥxf --<0LM R$0 0 + K$hؤHf --LM0 @0SX)0 0 R   p0  KUP0 R 4@-0 0 * {*$hfxfhglgD --LM\0\ @0S<))0 0 * V*$hfxf P-L@ ?@P 90 S@  -LM@KP0P@0P9K 0-LP3@P0U0 S U P0-LP@ T U  0h0(T0hxf0SS   0SPS00Q00Q R 0S 0S R C -LM@K 8㉙00 R000  0gCC 0-LMPKD p<00S@ @0@S b8gC -L`\M0V,0  0p#@00d3 Q\# Y+0x t0  0 S 0-0t0 0PUR  p R P% $ d$ $# 0"#4020lK@ b@VR 00Sn x b,Vo VG ŸR2 T l K0O,p PU  R0SVb V$"Q$2 0  6,PUp0S -,, 0Rl(K0 0@:V0@60 SS@@l K/l0[S x!Tt1 0|l K ,0p0 V0@l0K 0#40/lK@@ @00S $ t0+V  +lK@ ݍy 20lK@ Սr @Q 0@ x P@+lK@ -@ R x+4hP  +T2/C0<jtp L`lDT<- \\00S^(0000S 0 R00  p 0Sd 00C0X0X L P000P00 $rCDphC DCC -LM pK` @T P 00CS0<0@T 0S 0@ d X& PT 0@  Cggxfإ -Q@LP 0= S; 05 @`p40 0^@Q Q 0  P  0RQP tK0^0   ^  <00,h$4CCCCC -@P#0L0F%T0?S[+ |+ |+ |+ |+ |+ |+ |+ |+ |+ |+ |+ |+ |+ |+ |+ |+ |+ |+ |+ |+ |+ |+ |+ |+ |+ |+ |+ |+ |+ |+ |+ |+ |+ |+ |+ |+ + |+ |+ |+ |+ |+ + |+ , |+ |+ + + + + + + + + + + |+ |+ |+ |+ |+ <, 2P 40S 0Qk R0S Q PZT1`@T P0 PUSP@TU D1P(1 P 0R@0R P0PU p0@T `፛P Wp@TPUW |0P P00Q 00Z 00Z 00hC -LM,Kp`P\ ᢖWpV@ 0K@P> U4T P@T ,40#00 W  @ 00CS0<0V 0P T 0@   T  b(KU<0@  T0$0!gHfC DȠ 0-0LQ2 0 @P ^ T\ Q  P 0S R pp0R`  0  H0H0 P 0S 0Cphgg[(08@ -LM`00̂000pSp Q  Q2 R  5P 0@`00@ 0060@00 00/ 00 R 2 R 0S Q[ 1Q/PБc 0SY 1P 0S4 ! 0S0;004 S 0S- (h1, ` 0$ 0 P@ 0S 0S $!$p$ 0S 0S U 0S0  aPP 20 6x0;P0h;00< 00aP@!. 00g\hhD DnffxfjX -L M0K px,,KPP  RI Wx0@T `0S0C00$3`\# ~@Ty#V @GW. 0SB0SU0000 U00 0S W@ 2 R0x">0@  ݔ(K ה@Z@ 0SrP>W`A00 R ܑVQ0PY  㱔- 0@0 t- hP0 -  㓔0@ hPPb-0  @  —,0!@c#k괐< 0S0n  x 0S T0P@,- 0LgHfDC  DDȠnȦ -LM$`K@p( 0PTP  KP0 0S$ @ T0d0K0P 0 P 0S 0S @ @  R@ $0!n@gphCDȠ 0-LMPK ؓx0P h  ͓}@8008, @ 㻓8gC$<T p-0@LTP` `@T P @P`Tp -LM$pK` P吓 K@P'  R 0S )P @ {KPH, \@UU   _ 0! @gȠD0000 R 40S0 Cph -LM@K 8640 R 000 )gC -LM 8g@, K%`V00 0 0000S D0S $p0``0$ 09<PP@h0#SqTo 4@ Rjc*PP@@T vT$0S Q  $4 R 4?Y0$(33 T_;V @,K 㳒#pW00x 3P \1 0S, R 0' 0H3, ( $  ,00008 2"0`p` ,K s1A>0@!`X.2    | 8 0p00% t(" 0S DD %0@T $(%@T  q"*!@1 0lp!(@p C^ E ,KX!0S = @!0S 1d`1@!@ 1@ @@O92 M$M 0S ^1 Z1_@P  ,@` PD@D =1TgDCCLD(hgD  DCphfggxfԧ`ܧCjjXj -RLQ5 0S^ܢ܂P0Br `D@D 1T0rS Bb0S PxP d2 00U P@ P8m] 0 "S Br `D0@D2 T 0S m8! 0Aq `D@D 0T 0Sd80Sh1 R80P0Ho00囫aP @20S#  00R  P) LP00l) A00P`v)x 500xl)T +P00KgD XjgDnnl4m ,L -1L@TX pQpqpa@T 0Q 0S S0% P 0S @TP. 0R 0SM 0SP 0S 0 R0Q`0  hT@QH0% P p `Cphgg  -1QL@P` @d0Ǡ) /Vpp 0S00 %0 S0 R @` PD020@D /T0S80 R h7h{C\hgmdG gDXj -LM댤 R x4 R 0S0L4 |00(KtKᕽ,K  VPPڼpKኽ`V 0@T@T 0U0,ß Q,=A A¼ ,(p0(c(Q=9 =t ,,00$b @(( Q$  =A A$ h0 cl Q=9b @ = $ $0H ᓒ,00, 0S|0C0 0SS0000v 00S  R R 0QS4 0Sd S000000 00CS`@ R0S2 s 0Sn 0S& 0 S" 1 R  0S 0SA RA $ < 0S P0SC@ 0S= (1 V 1 0,0 000.`V8H & q"0#400 00CS@0V 8 R 0R 00CS0kT@00OCphC?BgdhDإCCg -!MLM,̟, l( Pp8 d ; 0 ST  @T @0Pd( `( \8 , `\b TQ `X( \ \Pr !P- @\XX00SH p8S hx R p0 Bx p0`0, XQd( d( Pp8Sl\, 0dR(K0!S@ :LPK 0*0#JX@ Xd@@hpQ`(\0" XQd( d( @ P P0d8  `X8  P T8S`,`X ` `X \PPU 9 RZ!0EVSVQ p"1K0J1J0  p6: ᾐP0/SX6:KJ0J0 \ pfgHgxf`J(:ĐfLDhgdd  0 0 0-0LMPP)@p690 0 / ☟P 0  K0p00`AP-040P(E690pgdh(,g@h,0 0-00P @L (@= 00dh p-@L@`0DSt0 P    $ < (`8 , 0 4 p<408`B400,p费 p- P0@S0C0 p0LPT`` 0P0@00p( @` 0<0Dg --`LM 00CS< 00CS,@@0 0 gxf -0@=C0 0 L m]dh -<L@Pk RV4^ \ \ ] ] ^ x^ D^ ^ d0P 0S R  p, ; bR,P0W0PP} P0S0So )0PP0@0S <4  X`0a0Q Y 3 R 0S  5Q $0 bP $0N <00$ $ $@} 00S44000 00  0R 2 à<@@[2 RY0,00e 2 P `> 0R, SK 0 , b  nR,PL 0 R Pq 2  0 <@@$00$0"<0Q0$ $ $Pa $00$0000<0@ 0  $0S `1 R, *,P`0S7 W@5 * RH  00S< 00S60 S6$00p p0S Y)0t |0,n<0 Y  <@ggfpgxfdhP hh@h p-1L R 0 0P0@0 p`0SP 0  0P0@0phyx@\T0 0R0 P 0 0R@0a P 00pDgD - 1LM  0(,0 ( ,00P40 0 p@`T`\T00S 0 R00 @``40 cRP4KP[T@p ]TpGW00S T000( `ğw3$KdhgD -LM0/K,0  " ?@ 0@ 2 ! >K*.KH! 0  B 募101 ? @  p@`00`" <` `X/ P\PH @ϟ0S00B P P #PL f? $0 0$0.0S, 奟Kb  P\P Ο0S00 X V V00.01 cRKZp Vf f k j j pj ,l 0k Dj j i 8i h pj 0S0C0  P\P ͟0S00 )P \X[ `X $X  00p8= R X-!X  $01 P\P (͟0S0@0 @ TT T !Tc 00D-T S}t  l 00  " PK@K T T% T# @-0KU t  P\P \̟0S0@0 n@TPKPU+1PUO 0 !RK 0(n0˟00; 0 0< 6}Xm |X (Xw @X*X ?X+X !X 'X \X= "Xm000 Y 0 p`0)X |Xt (X 0 0 0 Y p 00"X \XP* P\P ʟ0S00 $X> "X; X9  \00 p2\X 'X "X, 0 `0 p(X000 )X p}X1 IY 0`0p"X1 IY{ `00 p'X00p1 IYe ` V 8 00 p B `X0u \X  P\P ȟ0S00$P "P? P \00py)X (X000 'XI 50 V0S0T0 0  Y * 0 p`0Y0Sl l l l Pl 'Xx @T~1 IY, `@ pB"Xr \X@00@0C0(X@@@ O"X 'Xd  000@X' P\P @ǟ0S00(P 000 Y] 0p`0(P Zt x00 }N[X`  m.P [00 p` P\P HƟ0S00P00pP00p0 Y 0 0 0C%00 pS  `0S CCR 0S BR 0S0C`0L% P\P 4ş0S0P0 P(U| {U 000@ X0 0 1@ cRK @P P\P ğ0S0P0 yP00  0 X  pV $ P\P ğ0S0@0 Y@$T "T  1 cRK pT3 0\  p@) 0@0p 001 IY ` p00 p1 cRK p P$<XPP>X V`  Af V` 00 !`X0FXbSB(@T0"0PQA  `෉T0S   N#@  #@Pz 0w 0S  0To   0Tj < 0S (  @lh0 <0$1 ⹛O 00 p0W S WV婛(X* ;X |X>0 P\PK 0S00EX^ |X&PF+ )000 p`0j\TA `T?  $ ;Pgf(g0gh`hdhgTg @DDgXhpdhgD4X, 0R(K0 Y  0` 0  p`000CS0^0 P\P 0S00)P1 IYm `00 p P\P? 0S009(P:0 Y 0 1 0c0` p  1 cRKf p X00p0P@0  $PJ p(P 0 Y 0@  ` p 0 0 0 Y  K0P0Pp @T\T 0S00 @WTw `w |x 0x w #Tp9 D3 0p2p/ p+W)00Xp P\Pa t0S00[:P\ %P#Pn VVS0 Y 0`0X$0 1 cRK P@P`$0[TKP @0S @1 cRPK P00 R$94 P\P 0S00 ":P@00 P\P 40S00p%P#PK0 Y/ 0`0\P `Pf\X6 `X4 X2 )X@@D@ \X@00  &00C0@@00{ X &X|<<0008& P\P P0S00 P P00C00S0&0 0`00C06 P\Pe 0S00_X >P00S00 &P Z00 0|P0@00 000 0 写7E`KPs 00p0S @1 cRKp00  0pSP(]A0S p:K@00E  KKf  K  K`$0 0 sp  K  K.!p0 Yc 0`0Y` Q@ dX00( 0C p( B`0 ! 0S   0B)000: < 1 ! 10 1  `0P pa P\P 40S0@0 @T W T p0T 1 cRK"`@`P P\P0S TT @ UC 1 cRK@P@8  P\P P0S0P0 P U 1` cRK@`P; R P\P+ 0S00%(P( D  K0PC  K  K~  KM  KH;9  K?P  K7;XȀ |Xㆀ =&XK00  K#AH  PP1 " h=R }R(d= |0(00 00 < ^0`!<000C02 S " :2,,tx  KP  KWh.>X00`0  KF  K>X00) 00 P\P 0S00 -P0 00U000,04D -LpM`P`U @TD P僗$倗00 `P> K:`pP000T\S/ V%P@PPD0 R ㏗00@`P b P0: Sl0 0 0 00W0P `?*@P 00$KDgg 0-LpM|P@Pp+P`'T 0T  K, P 0 0K0|0: S\0 0 Dg p-LpM((!0S00cS1PU3 P K `P0: S 0 0PUKpP L0 `  `  0S h0R|* @,0S\P/Q)`  4*P 0 P0D4DD|l_t D 0-@PL 4P@T  0R@T0ph -$0L@T @Tdh p-t`LPU R @0@8C8SE @Ty0 0PU 00pdh -(@L0 01h膖dh -laLPp0S  0R90 R @@ T 0Q A@ T 0S 0S Wo 00h. `V0 R:0 xP0@CTT WNHP@0 P42 dhxfgfgj -P`LpG&P@pP P00 Q @dh P-@L 0 RP0S 02n T000e7PPh0 R \0 RHP0h9hfh[e P-L@Pp*`@U0S)Q |Q00W0S V  ,}@P`U`V* P-L`H* p V0S@P*T ?T [T ]T$ |T' )T/ VX00S% z3|P XpX0S pX Y 0X0Y0S X Y:0 !S ]SppZJ0S0P  -LM@PTp p0 `V  Rd @-Q@ 000#0+Q0SY00-SX `SR 0-Q  0 p@ p@:V?V@ ,V;V00,0 0:S0?0` 0402 ,2 ` 0? X? (K#V :|P :P& ;P$ ,P5 #P0 `@V4 !0`W ,0@000@@ R0p00p 0 0Q  0Sp0p @@,0010 ,0 0 @T! 0 0 0`@0;P :P00 0hP0 L0 H{P 00({P`h[0 h{ p-H`LP@@%T 1S {Pp&@Dp̍0 -PLM@ RPD .R*@ ZD 0D @  ҅< < @ S @ < RD0Y@  RD 0SD ?SW @[S S D 0R< 0 (KS:SI0CSD  P D 0R@ SpBP DP  Y, 3 Z@!':,0`C@Z!: 0P   0P *SD  R @0@C D  0~P T@:,PX<0SD  P D 0R@ S`B DP  Z8 :p@@@Z: 0QP  0JD0P C  0V @P@Z*8PXuD  Po @ pBZk:`DP  @ 0D!PPX  0P`Z*O<0SL D0 RD 000 040 [Rt R R8 QN <0S < 00 R00S 040 QO  R [R 0  S   R( 0:S R@@`:hzP 0S 0S l 1pf@T P zP0S$ @T0-S 0S0 \0]S4 00R D D R0:S<0S 0P0S40  s R0[S#0:S 0 @0]S  S  0^P   0UP 0]S 0k !R> 000 <긺 -pPLDM䀟00PQ0S$ @ $ 0R) K%z`"zT@P0e@@Td`K ᇹyp3 0 0` dh 0-LM@P K0S  P00Q0Sp008 0-LP@P0 p-`PPLP y@ᴋ P2jp 0-L,MxP0>Kp0 @Q X0 R%\<000 0RK0 ̍gdh p-LMH@P4 `0T0 @ Kpg̨ -aLMpP0Pp' PPR 0000p U0HS0 0Q$pP PSQ U00R0S00QR R @K$ d0 Ȏgphgg -LMT0Sp! j W4|1  DK+x t DK|!p@ 40AT00#`9 oT" ?T WsT0x1  @$PP%U 0T0  s%U l(K<@T  PS0S 10   VV<00t1 VGphdS@0PS PQ^@%T<Y4( !ixC* Pix䂟Jψ0S 00 Q0W002|1 t0-S /P 0-S`RLŸ | bd@PpA `AT sx1(K! 0 DAHQp1`Pp P%Up!>KD40D !R 0-S+S00S 0SQ h!0S#0D0 \ t1S P D0! R  t1S 0S w0S  7x\ D 1  Q 01 0Sl t1SD D  ! tD1S1 0D S D<bD8D̍gܦȬHHf ܑ Ь 0-@QLPÉ0 00h?0@-@Q$ /Q``V/Q P Q7 .Q \ /000S/S 0S/S/Q00/^^ 0 .^0p/SS0&\00S \/00 0 P0 \.00\ L U*0/S -`QLM`< /QpPy .Q8 | < X 80S40 00 ,0 , 0S:S00S,0   0S:S00S Q00,0 P00<R04 0 ,  0/S4  0  000 4 ,0 Y 0SR0,0  0c0@w P0 bR,@ &u80S<0(K40@ cR4P@4 u4 0 S/R/000@80 00< .S0S/S000#80 Xy8 4 0 , v0@ cRP@ t 0 S/R/00P괹 -MLM0 c1\, @ TPA @/T@/T T9 />vP `eP V9 V:  @/00 0 0  cR@B^K pPEtPEp _P@'( K0tC,$[/R0  0a P PZ, 0 R(K.T.T0.S Y0y/S0SAv`0 -LM@2v0     00 K 0  fP 0Q/0000 `Kdh -`PL@$ vP0Up tT t0T l0h讇LpP P tT0@P@tg,hdhg 0- L @ 0  0 0S[ :Q0 a/ 0,0 0 P0  00h 2 U$0 0` -`L p 0SL;z ( S , 0P@aT#T KPP@`)0S[` k`  0Q$ 0% ` 009 0~`j`0i `0` F000 0= S, 8@0  d0d`0 0 `$00t -P L`pM WP@T 0P Wd@ s0 0 dX`0 WXDp X0Q@ q@`Td#T! 圊P`@`z0S#0 ;0q 00$ \BWL <X r 0 0h0 0ꈮ 0-@PLP t 0h0 p-LM @`, v  0`KS' PK+ EP P#0S  ;00`$0x R 0 B `0xTH $0`0p`  괮̮ -LQ@M0\ ,0 H H X  P %P`  R 0 B 0HH P0 H00H0 @, 0HR(K0pT0 P0 L0 W 0GLSL $ $ $ $ $ $ $ $ p X $ @ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ 0 ~ @0G0 P 00D@SP 000L0 X EpUpUX `T P plWpL0L@0  `L0 L {L p `L uL0 ` LppL lL p,0 `L P0 dLp `L ^L0p0 `L0 X\ L \0 X   pX `\ P JL p `L DL p `L >X0Sp `\ T0 6 pL\ X  b `L T )+A0G0S 0LP pc0G\L S \ L p L L0;@L0 \\ `d0GS\     \      <     |   < V0X0 Pu`X ,Kh  0d |d0l 0d %~ P`duWt XQ -00lh lL  XL T L T XPL0TPh p L Pe= S L0 p0pUX@0C0 0 @0T 0S @d TdHH US@0 B @Tp0  R @TH  H >L 3#,Kh %2> &BP0`lLT ^x0X00L L00B0Bh0l,Kh 1>A P0 0` lL: 0R 000lhlx,KuL  0\0\  P`P`\ \ &L\ 0 L \ CKC0KL!40#0X0S^ \CKCpK\0\0 02\ d rdh lA-P+PR PP 0P 0pT0Sf 0C0 00 HHXH 0xS0SW 0C0 00 H  H0pH 0L05 +00lhl @`` 0 B p0` @0T  R d &` @0TdH00ePH0 0S 0C0 00 H00H0pH0 L E 00lhl d d d d d dhD --LM0 0 4 K 0-@LP" 50u    P  &P0 : @0 P@ 00 00 0S P0 X0PS 0@0 0p   - L @ 0S# & -*  P 0S0 0S0:0x  $00Np 0+ 0 00$ 0 - L@ R 0 B 0,Up R, -P L@3 T6 pD `Q!   _8P 00a0S@@ npW   0Xd0P0 `\p Q V` T`D -P Lp! X `$R9p R V@@ |n 0`d d0Vp0 V f4X ` 0;Xl 0-0L@P 0P  0000   ,00 0- 0LS@P >P 嗣 0P 0P 0 0- 0LS@P'P 倣PP0  0,宁0,婁0 -L^\`pP@%T㼀& 0W, pE <  p0$ (P PPPB0BSU@P?ppE©k(;0l❁@dh --L4MD@K0B 0 0 SVK -p-`P00PQ0 L4MS P 0 L@K0 0 0 2P4Kp蘯 -pl`LP@)# T P (0V0W< `0``0$     ⧠dT 㙠P PPp P PPpPpد -l`LPp@% T9 V`+0 0,0$ (` p ` P  \} SPPP P PPH[рP 0\ǀ00@0dh -@`L#0p᱀00 0,0< (0P @P T00ӧ2 0 o3Q00 X@,Pdh@- 00Dg0  D -<0@L b  @     dh p-LP`@@P`p p-@L0`S 0 P p00P@0T * 00p00@X0T0@` DA 7A000 0@@PDD`hdh -RL0pS@3Q0@A0ZT2 P- T<2P``V 0T0 XQ P@0T*00T+ T4 T- T: 0DSLQB`1 P1 R|1@` DA A000 0@@P41P``(P``Q 1gm`p`3)P``0  0Rm`p`3TEP0  0BS Q` L `P H040R@0@ `wDDfdh`h  -PPLML H00@!@1  Q@ - EQ5 Q 1P AQ 0 S P0AS0KK0K@K0  YP 0  QP 0x  XF\ 0KT  0<p @A}= @0@40 8 < 7}ԭ@0l S` 0P0=URʨMUq0KU t tt 0KlpP `p1@U@PBPUt  t 00K00Sb h7 7P_ {P0Cd0 N0 Sh \ i d0P 7@{`0pSr 6 (P0@@P0 &00P 6 |P  U:t@f DA n{&A0P@0`P|P T1@@ f S{)]%0S d0S  O\Q\ hp p0\p Sx5 t oD5@f DA "{A`P _ %h t0K 5t P<@40PT*$! <@ <@40T*4lp  `<@ S P0 ylpP`t E@P $z  0 0 4 3  PwU*00Pp3@f DA zAP`@@3  &0U0;0g0S7<80 0c0S783 RC0S!3 P<- `X :2@g DA zzA@p`@ 00Uap0PhP|t, <80 0c0SX2 R40\?*(00< d P;PppT;p f 9zd yU8h1@` DA ,zA @4@ @8 < ,8(1@` DA zA @4@ @8 < 80 @` DA zA @4@ 8 < 0@f DA yA`P)P806`t w0UgP} gPx |gPLrdhDD   g|  `hfgȀ  HP -LP@Q 0  *=Q&0  "=Q QD1@P U0`0$ 岀00$Pp  000{ 0 @Yy0@Ry P0P0 :00 0p0 p@;y 0p PhgdhD 0-0L0@  PP0S p0P0S 0 P 00_,00DgXhDgDDD 0-L| Gt0@T P@T 0S  ,0 00 0 0@T0gg R 20 R00 00 0BS 0 0P0 00BS 0 0-0@Lx0 S@P0SL 0 0 R0S0eCA 000dh 6f -L\ P0L `01P@U 1pT@P4U 0S fP0 -p@L BxTP 01 R1 0d?A1cX0@ P. Z$` $ ` V AT 0 K 0B0S 1 P00S@0`0C V0mwwgfff -LMZ, 0 , 0 0J @01P`U ,  1pV`P6U 0S,eP(K0Szʊ x_w,e@w000 @0 0P, c00C0P$R    T8 0S 0  0R 0jnT0S R 0S 0  R 0P jn 0- L @P 0Q0   Q Q 0 00  0<  0Q0    00004 p-L M@`!PPP4  "   0 R)00 `0`S 0` $K$` 0 0 }KpT$ K}$ 0R    g DP 4l -P@L1  !R 11j 0-D@LB^T @ 0 ! T @0j1 0) 1xj -0L 01!"Q0  !Q0 $4($B0TPt`q40000嘠@0P`0  B@phTPt`q4=  L9  @5<  o0jTXD Dhjjtlj 0-P LP@2v0T̃ 0 0R0q03 00S  H0 R00 0h00Q00 0000g g 0-t0p@l l0LB^T @ 0 0S 0S T @0 hj(hh - pWL` % 0S !RRP, 0@@   p <00l0d@PPLu  @ 0  0  f@gg p- L@PT" P0@Bn0 0S T @0S UTp@80 000 0 hj(hhp0 R (h |0p-"L@PC`T0 @ H0  0S40,  R+`pj h(hh -LM04!0`p Q 8{P ccP0U) P@T WcP QcP UcPbP| hPMP L0UP K5P R R0Ղ"Phjn p-LL`P@T PpyP 0@0Ppx(h -pPLPH Pt0S P @tP0t0S P @tP0t X @T `Pt PtPtt@T|tirt -L0ML`K@ B 00P Sh          x  @$((P P))@$(P P)'K|@(@}P@$p{P PP @0TPS@@ `0-L@P^$?@0h0S 0h^$?0h p-L`P0@ S $   , ,      d d VU@ PEP@p0P@SP Ts0TSU S 0P@SPꐱ p-L`P@es ph_ -LMP`0  s0 00  S  00R  0Sb@s0@0P PP00 R00  0Sb@ts0@0P PP00 pW7 @Tg@WsPU%  , Ls ,@0,0 00 R s 0S m 0S oPU0 0p0 pj0 e0000(KLp -LM`pPG %P?;0@:S:                         l               X                   ?P(K0pP @2P p?dP00S b -00@@@0SppX @80CS t      L X!  \  ! !   L 4     0@,0 0P S p @   ` D    |  ,0@S `T"T\P,@  pW@0  ;P  7)@}P@${P} PP @0TPS@@"@0,0 "@0,0 |@(@p$}(z(wP P)l)iP@v$c(`P P P@] 0S&$Tok @Y @ @@D 8TT 1@T,~)d0 %0 SG 0S x%  0S @ P%0S 8%4%0 % 0Su @T P  @T 0@TP  00S @TR[  W0S  ڨd$0 P@ 0 <$HX:0 $? $08 #00P0#  $ #0#0 #|#0 R 0S @ #0S R 0Sv @ "0Sm ""P 0  "Z "00S @ "00@S x"C h">X"0@0Sb0"0 0S! 0!@ T! ! !0PU 000 !  0S @\)| t!}0S00T!uPU 0 RH80  RX00  R(l0  R L0 R^FPfP ^@D@TY00S@ HXEPtUh (0 R00PP0g P-L@ 0 p-D`L0@ PR  a8" e 00b 0pXE p-@QLP! R `0 Q 0Q 0  " 000pT`  0Spp0 a" 00 0XE 0-hPL@T\@D P0R  P 0,0 0S0C0000U`EhMXE 0 0  !XE]U 0-4@4P0L !0 0 0XEU] `,0R- 0!pUXEpMP0 0ɿUU@h -pPLP@`0e R0@00U0C0P 00 0b@~0U00P ~8 0U00~0U00PUU -PL@4M<$< 0,4<<0 pP@p WV0`@T3`VG3 Vb 4 у 0U{3# @<0S 4 _QQ„ V^00@0!0<0pWS0N 040  VP\ 0SYW00S4 0 Q 0 V0WP ژ 0?, PÐ @ 0 ` 0f S,0 0P0@  D `~@TD b$2`?ÐY 0@m 0` S PPT M0 V0 0C V00@p40 W0040  V080   0Q00l 0C 8 00@!V@8 0P 0 qS 0S  }000PU@08 0S  +@R<@ P0S | 0 }0@0004S  , 00c0(KP @>@UXEUUUgUUU -`0` \0@L bNT } }$0$  0 UUUUUU -,@L0S `0000Ug -L}h~ 0- P@Lj`0hf`g -L0L @R TT^b}@@$h^} @}@g 0-@P LL 0 00h p-X`@Lf`Pb` L0 0 pg -LM@Pa0SW P 00|q$K(K0 @,K @x`PJ (1 ($9 $0V0 P,0AP-N 5xP#U0( bQ P0P00Ť0 00 @@ K lP P4Q (0Ph@@6P<լ.Pը^0l0ŠnN cR0N 0NRtN lNh.0YP.Y   B > . >.@@LvQ4  P 00 S v@t) R ] 0S 0S 0S# RPh}  | ~ ~ @~ @~ @~ (}  l~ 8-0 0 @[00,QB T00^@  T  0 TPPU Qb Q < R B 0AL c0  P< 0S P"0S S S00j000S 00LPmP , 4 T00e ˟0  @0 000D S` `˟Q\;X;  H;  @ T " +0000010DS 00D 0 1:ʟ @ T  *0 00D Sp 0!0000C00 T T`` 0(*TT 0T 0T :'Q{  :@ 9 R 0  R)l9@ M0 0 0C0 TT70  R@9 ^0 0@0$0  00^u@t 0u .uu R8 0 R0W $8PȟȟH yP0S cQsQ CQ d8P#P8 po8   0 B y T TPP& '10DSP00D P 0iǟ`@` P 0 S0@ @@E t t tBuH0 SD Q 06D 0 0 (Kt&0SLƟ00*Ɵ0 ( 0>600u P!s\@T] P6 D 00`0 0Ɵ 00@m5@T5 R@0T 0T 00ST  R %PTdꀆ 0 4 4 @  b,P% #@E! 00C0>0 R84 0@ L4 P 3ß P @ğ@$a00@yP P. pc00v3! R|S0 0CR4#@0#Q@3 $ß0 @0S 0P0 0ż/ 20P~ @ R B0 0P0 0 з0C 0 0QH2P0" @0S 0 ` a1 0 f0b 00R0bP0`l"2`<0 @0K0` 0PFP @ `v}PE`X@ ڰ 00z P  a 1 0Pc 0/T PP  XPx\b,10cSsS8 CS6 2 rP aX )0  c 00 0;UhMUUUUdM`MUDE(@h\EXEȹUUUUUUgUU]UUUf<E8E EElMEg|UxUȐU`Ed(: -"MLMŸQ p,  S P2 R P R+ PP 2 RkKAACxp{ hV~8: S}BNK@D@D Pw CP 0@(K0$S RM  uBNK!@D@D0+xPP X$ ^K!PEPE0+xPZ C`CV_CP +#C+CHt CC 0p~GP0+ C, 0R&(KdCtt ttt wwt|ttvpSht+B0t`p`pX0Hܵ lTܶd 0-L MP@P Q 0SP R:00 0 0K00Zt(Wt Tt PtNtt̷ -LD0"3 00Q@0P 00U\o -LSM✀0YOKp $ Qp `IKPK@dK 0<@g$ 0R KfvLtd@A -L$M@0P0 , 0S ,S0 0,SS af\ n\ 4@K 3 XsS 0R KSs z,  -GMLMȑ0Pp,0 h 0S@`LS@( ,S0 0,SSBKHH j 2 0ApP< IKAAvp: u41` V,0@SV1S   Q RQ\ ^00\0S l`s`, 0R(KDUs 8uu $uHsxPd<0 p-L M`P 0(0P`0,P 4@0 0 0 =400 PPKpsTt - ,` N@P"YnKK`F/>0$K0 ᳀ r NPr( 0R $KD, r 40]p(r$BlpB$B80 -LM 0/KAA ,0 + {POKℂ/v>;lr 3K; TK00 MP2Sd St ZNK@D@D/[>0 5 M@PvZK@2SXڊK`J/ F>0 8 e M@PXY l>P;5S8ڻ^KPE PE5@S0/%>08 ; i I lMP*_1( K+Q0(K+P( K0+Q8[S K+@, 0R(K2`S܏tr.K1`ҏX\Pr0+@o8qlpL$B B"B!B\hT<L -MLM/NK0 /`q(0 =0 2 M@P0K00S$^^KPEPE2K=P 00@S/=0x 5 P2"3K2#K3K<Vq8 ,n0 nlpL%B´< p-LM@a0_K@/0 = !0d0C S             n0$0 0 @LP-K30gS 0R|| 0RKp0$0 0$0 0$0 0$0 (p$DlpĺL#B¸  -'MLM40OK /,0 <&Ɵ0 3 K@P ٠0So 3ş, 0Rn(K;K0SjKAAI  I / <|%|ş0|e6 9tu4 (K0P)\0PK@PG)R K<P9S (K06PK8C8sj@K 6K $'<( K0S3S dA?KK $<3s s 4 R K K?C^ c^ Kj@K6K 0K8K @F3S c'}KpGpG`/<#09 9 g 7 cKP' K@U 7Sꐪ x p h  p G 3CSL GWT3 Rt  K>@#(K<0( K0#(KFK#;6[SW V@K ,6[SI PK , 0KχK2 RK3`S)0 S) *x 7K d"y;3CSGWK@<"<2m;40,($ bEaC bAb?a=a;PK ~,V@K x,0K@!PB;  0P勬OK0K0@t!P/;C^*h 0KKjKP!#;HHHH!H1n 3S0C9 # 0KKK6KjKY3S9 WoToQolpL B,."B<`hp!B LpdpT08@(phx`X[H4$,̻\LT̵ -0L 0a7$@ -H&LM0@Pp,0 B VC P`C C B B B B B %cp> C0@3S3ܱ d H p P < 0 د $$p$0cP1 @ P`T ?K f:tp0 Q"#U U U U0 @ 0@0 0@0 l4 {#0 @P`0# 2 q3 m1 K@"3R_ 0k Xl3x#SX#8 @P`# K8303 G0@P`B(3 >0@P`92@ P00@ S` . 0K@ A2S8#82 "0 @# P `" `"0@P`D" 0@P`02 02 " 0@ P`" ! 0@P` 112 1 /'x, 0RB(K?V=  /V08LTMp= 8..K0@ H@P2K1" 0V cV" 0@0 P #-k*k|'kt$kl0 D0k\4 {mLLxdp`8XT0`phpPBlpԵl8 -LJ -0L w$@ -LM@P]I!ᭈpt1` fRAP !0000CH!0?A1cS @PQ.Q00A   S$K.Q 0 U0S,K,P ( RP ꜀`0`( ?Vᘠ*Ac 0VpS0C P0V0C0pS0 C RZ00[ gfffB 0-,@,PL(  @$ؾ -LM  P: K 㰩p* 0#4 P; K 㡩p 0#4 idK^Yjpjd@dd d0%TjI @,8 ,0ꈿ\ <0( -LMp D K`P= -KPr UP< @ 5R 0S㘂 b@P *p2^NT ` Pj xPU l l(KH0 0>3P@;j@D5j< @ dk@0SO ᩱPG 00L ᘇP4$, x1ϠA/ 0(@@lN#b 8K80 4 0@ , iNP kP  i ik iDP Di iЛ0-SL0S i i<@@  l0 R \iD,ir <itpppMbxpп -LsMMxKH0H`,0 p`P%L3Q iP03 R;$3 RA P, 0R(Kn0S  {iviH7: Sl mKAA|`P 6: S ፯PPvH7: Sm mhP, (v"hP mKAAMP;K8n2 [1 R A@k PJk0: KP`R렑0SQA00CS0P0P0 Pp 0S0P!0CS030 Pp0yUYUw {fNK@D@D.P! 'KkP{K6P喈c f^hYZP| p}JL@PPxpp|pM@[ }p8TȾ$ -GML Mp2 P@, X"p fP. iP% ,"p 2 PbaU5m2IKpJQAA疼P4: S X1 11 1sBKAA +' P: Dgc6$ `0V/S /004`04 X p5 p@/PP 0PST @T 0/S 0/S @TPo60 S`ЇpHX  kPp<|pxppd@-0@S00-\Q\ 0 00L S0 ^!00 000C\0LQ0c0 -L[g -LM0@S K( (p 0 iH -LM0@SKP + 00  -0LS@0s30 RP 0s3 -0LS@ h** -L@0P 0\i 0-LPw0@P bP 000Hi 0- L0@T) 0P0Q 0S =S 0S <Q >Q !Q0 0l0 \0 0XP%5P <0 e 0,0 00 0 0 0ppp 0-\PL0S S0@ S 00@0)pp -LNM`0\(0 0P S:NKXT1*D1S8 @1Ho@RPX0P Sv` %WP V?K|P 4P=@hF@( 0R$KP.@JOK I`$ (0Rpp31<`$ (0Rpp&$/`0D S񟗯 X         I `dIPpp`VIpPp`IIPpp`;I`/Ippp3`" Kp p-L|`P0S @PP 0PS pp p-LT`@0S PkP 0@S pwp 0-@PL Tl2PX0H0@ R0S(ã:ԗ[pp! -0L $@-0 CR 0R0 S`00 -PTL8Mp`@MPP NP@"pp3&@pK0K`< , K00 @` 0@P,00,0 -PPd , D20< ,0 0 @@0P \UfXK 0pL0T PR0T0 T0@`5K,0T@X >\P <\00S \ 0   \PPC40[S  5[0Sl|t `@L0VU D00S8 W $(K`8 Hp -0L =$@d -0LAM @Pp  Mp sPp  Cp0` fRAT +2JPNKPP WƖ.1PPeeTa -@LM `Py1 u100 Q03*,  0,, pW00P0 U 00 @ep 0 F"P02@0P5 :0="P *0@@,0 PdW p` 0-LXM@PI! @\@0P00 lK(T`00\0P0  :&K0|6pp -LXM@#!\@0P00 hK(/\00X0P0  :n&K|6pp -Lp`<(P%@P04`0K*K0C8M4>K0C4A=K(0C4$QK 0B*K44(I C:K$$P0B*Kp(I4 0 S9H h 40S0000 0 0*}#p 0%  (00?0bS fS)0S00 (< 4<̠Č8#Č:K"̌,K$,4, (*K 0K 880S&0 0000 0 0:K P$ Z0`<`:KdK #p 0`04Z@`3|0  0KP T d K[P @T`P d &p@ d0Kp @T `| 0%`Г*K@˓V@Ǔ0SS h8J'P 080(x0 0S$k $@`PO dK 'dK<K)K*3[0C3K:K3[dKS3dK ) R)0S S S"Z  Z:Kp0S   p ,<4("4!< 03[0C3KA3[S$`$$VY0 0000'0S<0 00S 0S$000 0T`0 000 00S0T0 0-0 000 000 0(K` p-PPL@00=&`#@P L00040 P0 :#7#@F&p -L@M` P. .0 \13000 55:W00000 0 S,0 ,, pW0000P U>*0  0 @ep 0 }P02@0P5 :*0 tP $*0 @@00 PdW p0@ TP3 : 0S 000@ 0@,0qU dP"(Kd p-LXMP@`c0 |P0P00 pK &md00 `0P0 @@ :f@ #T  00Y@Kp|6 0-LXMP@3u+ P>@lK%9`00\ \0P PP :1@#T (0 $@00SK0|6 -L@000  Ph6G-M T 0 $0@(@ P,P`0`p 4p@0Tp  <0P<` 0Ԣ($ 0,($0P00P4@ h ! @(`$, <@0g\ P. 0@!g.,P(@T<@`0$ 04@, p$0( 04$(0Dp4pHXLP @ @0 ! 0@!0@ Q18 P!@`!@08P! LPpHI$PDHpf.. 0 p 8D0#Hpj!E$ 0#j 0P%@@X@ 0H @^LP@D PpX  `DHL@PPT@00P0 00 pD0 00H000000000 L@000 PP`000Ѝ -LM@ D1>?  08^P0Q8 n< ?^Q@ n< ,<P@ < 8 ,<P8 < ,<0P0D0#<00 , D04 #880 @0D#\#.pT.l0[#4<8[0@0 @P劐pP0(Ko 0-PL@U  0#<00#800#400 R0 0h},0 -RL`? D@A1>?0( @PcXPp: +@0!0@@0D@e*@0!0@@0D@y@00 @@0D@@H@?X X  P*@0!0@@0D@ 0-PPL 80P $,@0@0D@0 -LXMP`@Ep+ 0+P;0 S 06 0p xK#d0 s000+l00d0 KQ`0 S0$00DS$0 0!$0D -L`pP1#y @P 0V0 P0 W P4 U\   +`P  @(# -L0M`PpP) K.0 P 0S ȏ0"S UD@K +00 K{P(@{u("(04"48#K -鈑LM`, W0RSd0 S SMZK hP0U UP SBU U8p UpK0C*K8M4.K BJK$RMK(@D:KD*KDp DB=K(0C4@ A$$(0B44P@CD 0 S D , L 00S0,040S l0SJt0SGp0SDx0SA\07@"0"S000`0SS S000d0SS S S000S4 PB$`0S S d0S S R  h0S S R  r 000SS\ 4 <h0SS\ 4 p88q < r qr h0S r q000{0000S2WeEP\0  % DK"DK 0P0<p0S=,0S:70 "p DK P&0sDK0S$,0S!\0 000.ap0$0 00&$0` R$01D0s0,0S00 0i(00?0bS fSa `0|S$01D0P S 0 (S 0 0 0S 00 S 00PP: `X0$ 01D:K$3/P0 K pp` @ K=P`K >"p@T T \0"  `KP 0 S 000 0 0 0:!P 00( r0 `@K$!K #E$:[0C:K:K:[Shh``K\JK #KKK :TRP0"(@K0 SJ|@T:K*K!,K)( K0K~DCoP|:  |K7)*K$^ 4 | K { Kx0 ^#JKDtK0|K{0KK\0 :K*K,!JK):K$(K0~4@ | |KP`9[V(/0 S 000 0 0$ 0 000 0 R,0000H0H0 0 -0 0 000 00M0(K4 ,(` -@LP 00ܗ -@L>h>ؗ -4@LP :Pܗ`0 0-L@(>P0P@ P>0ؗ -LM8 Y< pP x4 2n ǮP!X20S002 PP 20S00#30#jp3Ps 0m,`  v(P00CS00 Ӥ0 R r ,Kx 80SW00S b(P<,K0,K@P 0K ,z00S p00RQW00S < P,0S  ω R ,0,SP SS SP00P,00,0 0004  0(KܗpT p-LM@d`P=P@ 0  ;,0@0S =TKpؗ rS-@L`P"@3:܋p 0P@ы@ϋp p-LM@d`P=P@  0  ,0@0S =TKpؗ rS-@L`P"@3:p 0P@@哋p 0-@LP 00=,@r.0 }= 0hsؗ 0-@LP 00k=,@r.0 e= 0hؗ p-LM 0`|R=0tr.@lL=PXG=\00SgP  0`P@6=Kpؗܗ 0-K*K0C M8>K0C8a=K(0C8Q=K(0C8(P 0B*K88 C:K((40B*K88( C:K( 0 S8  P            40P0 P 0000 SL0SRL0S 000 00S0  .V S:Vz` 00FV08 KQPp40p@P  dp 8K pP@?0 00dp 0q (00?0bS fS0S4 0R  0 :K(4x5<*K 0880S 0K P<:K P(t 0S<`:K(05`P0`0*K84pL*KpK %p0`0>:K8S@ p KP@pH KP TpH KPHK P`P l p@p0Kp @ T HK ;p`K*K@FV@P`A0S 8P 080(pw0 0S$0P04 $`J@Px  pKpKHKnK`F4[0C4K4[pKS:K"rX*KpK:K8"`VK0S SE& S S@/Z:K -5*KOP1*K"+Z)*KAP#:K KZY:K A*K Z Y :K 3*K p 4[0C4K4[S @$T0 000090S <L p`뒄0 0+0S00 S0S0P@00 00 0P0S00 00S0P0 0 -0 000 000 0.`(K` -L@`pzP 0X@~ -`PL@@P00bpPP d0T04@0 T0L0+P0 YVPe`   -LMB^KM`PE@p x0RP 0 @m@P <00PP<4p84@ KP -L@P 0@0B -LMBKMH@`Hp 0 S񟗶  p p p p p p p p p  8  0D00W0 pS048 rP@ 0M0 0J0(S 000,@P. @p0S( 0S%$ 0 0D0 0 0S00< S00<000D0s00 0  00($p-0 0 ?(K -L@`p+P 0@/ -0-LPM@a?KC/_K@0 Q Q 06Kp@ `@ 5,0 pK\ L0 ,P l  K0 -L1M`0pPKA4 8 0 p 1S01 R rP P 00000C00SP0 r [000%R@QgQP'eQG*GQEQC*9Q0Qk*%QA *QP Q7 AQ6 DQd[Qv OQg XQl LQBcQLP aQ!pQ jQ3 hQ4 iQKnQ MlQ1tQ6 qQ1 sQ xQF zQ. uQ?PP0SP 0S0 0C rK@@0hS@@0lS@@L@@ 000C@P  P0# z@KP0pKp"KP0 n0^S  0J_C0 S RJ!- JK0P-S ]S S@Q00]Q0SJ_K0 RLP9"K @P3 0p0p@  0p p @p p 0Oq '000 @P 003 P 0 0SP  00CS0P0 r T000U񟗰($ $ % & p) X  PT0*0PdP # 0hP P 0?P 4p4 X P0P0CU  SP U/0(K 01SSU$@P0X0C000  0SoP Ti (K001SSPTd 43p043 BX @ 0@ B0T0  RFP 0 r U000 !P@ 0C00X0  0S(P 0 r 000 4 0d p4 dT0HʏKS8SJS0 9R 8R%*0R +R+ -RH(XR+ A0BSAaR>:fRxR:0PI0 J"00003 J000S03 03 S  :J   60K0UI0 0 0CS0000PU  ?K0CUUUXPxPPE ;-0 80#G80#   0p@  0p 0p @pp4# 4# 8 0`Y H?K8RPPJ,0 9R 0RJ#*-R .R +R!ER eR  J  J9S:J0 0CS0000<PX   _K@PEt~T-xePEP txq;0 8{0p@ 8㓖0p8W0p4# 4# 8S 0e4P4 4(KP -DpL0`S@P8n 0@S2np -L M0`ჀpX0S 0@P0Gp 宪@ d0P0Gp@  Z@  b$K -L A : A xM xM xM xM = xM xM G xM xM xM xM xM 8I xM xM J xM xM xM xM xM xM xM xM (@ xM L> > A : A = > = xM = xM \E ,G lH $> xM H 0> DI xM xM : xM <> d 8g@+)0[S 0)0Kp TU 1cRP@`00C Q$S@PK|H@ K0@ S@0`SAp@G @ 8g P @ @  p@'R[R& b@' p70{+)KQ80*S8 `@ 87@7*T 1cR @`00C Q$S@PK|H@ K0@ @0`S !p8g P!   p/<'  T 1j8R0S@0J Q87 $Z pp p'  @0S1'*p7@ @0S1 8CX0 8CXp@  P 1 A PD70  c`D7 p, 0RD000`D & 0^0 0dP`V U00DD 0DO/KD' H %2 D>&B aP`D D'O?KPbdU<7P7 kZ 0K⠡K)0KP7 D P)0[Pp'PS*0[L L SLL  t' ,@7L@lT(`$H` \0 R0\0 ` xdKPK@DT 0@` \0 0R\0 ` xdKPpK)0[S )0K000`  \0R0\0 ` xdKPZK*0[S 00+0K+0K000` \0 R0\0 ` xdKPBKtP,@L'@bT㜨`$H` \0 R0\0 ` xdKP'K@DT 0@` \0 0R\0 ` xdKPKP7@eTL`$H` \0 R0\0 ` xdKvPK@DT 0@` \0 0R\0 ` xdKaPKp D!` \0 0hQ,ァh d'R80S\H:000`  \0R0\0 ` xdK8PK<7Sp 00h`  \0R0\0 ` xdKPK80@cTkP$(` \0 R0\0 ` xdKPK@DT0`@` \0 0R\0 ` xdKPxK<80< a<0D'\G0bT@T` \0 R0\0 ` xdKP[K\? @cT,lP$(` \0 R0\0 ` xdKPCK@DT0`@` \0 0R\0 ` xdKP.KD<\'PD p7 00h`  \0R0\0 ` xdKPK<0DK000` \0 R0\0 ` PxdK-PPKDX'0B0` \0 0R\0 ` PxdKPPK<7X@iT$`2H` \0 R0\0 ` PxdKPPK@DT 0@` \0 0R\0 ` P D00`  \0R0\0 ` PxdKPbPKXK`` \0 R0\0 ` xdKPOKp'* @7L@lTaP"(` \0 R0\0 ` xdKP4K@DT0`@` \0 0R\0 ` xdKP L'@l1R 0aR\0Sl  xdKP 0㤐K`0 \0S xdK|P0`0 x'0@0l7 Ttp 00lw TY h@P 0KP DO< Ml(K茻 -DpL0`S@Pb Z0@SbpQRP000S0 0-L9@P& 0S\00R001S @  0T 00 X%T00S <0@@ \ 0 0:<06<p -LMGPPX 00z`10>CNKTa@D @D 0P3KHH v p* T0S \ PT3 4`K Xp{QK0D@K0@3[<3K03K\ Tx  (0!"(80S s00 @3[P3<8P@<0X0P(K^  0- L@KMpP  Ap  Ap  ;p Ys0$S Us@'CQsP@0 p-`PLU@`U P`0h`  h0S0#*P0h``0p -AMLM8pK`d P(K,0SF"[3RB2[S?2[p< : 8 CNK"[ @D0@DD0H  ,0S+#[<0R'#[80R#@_P2[  rW0 02["[[AmK0`F@`FT@D,Pd 00S  r00 K -L0MP`XKBhr@p0`h p^r@0BZr0w@0 dp"pOr0 S Kr0WS00 0 0s 0L 1\p 0l0lP@@ X0*K8#8 $`#$0@"K<0 8 TX0( K0`0   0L0 P +w]p@ r0Sl X0 0Rl  0 00l 00A@al0S'p cpD l00Sl07#!dp4 0K<0  L:pq0S&P l0`d 0Cpc@ ֓pq0SPq600 l d0 0Rl jvp qq@sAq0@0q0SZ q0 Sq00RL 0,1\ "d0(0`0$0` D0 0 0A R  0$ (0 7H0S H0000DP* P0 P000-0 00000h S?0000 00000000 0 0p (K -L@`pSP 0F@W -BMLMp`?PP& 0 0<@K*00  X`\`TpmK`F,Kl00S p00 2[34[<03[80P@ .P K^ .S 0S0( <0R0(0 -LM`Kp&@P0S@PU_P -L M `p6P2(>@P/ P+ PP&, 00S S0L,0 ,0P4P 0 JPO ,K4K @P C``(K` -LMp`P(K @PL( 00S S0B(0 (0 P 萪 -0LStpPB`. T@! 0PU`pPE@TU E000  -PQL`p@P j P) 00S.S%b P 00S.S 0.S PP*L  P *   P*h>  -p LP >`@:TP@@3 T`h-`P@ P00CS0 -@PL @@ 0!@T 00 h 蜻@ -LtP =00D00H00L0(0 P00T00X00 \0  0-@PLP P 0000000 000 0-MLM0P S ANK@D@D @0CP @bAP000K0 -LcMXK M`\ , $@P X&KeK @ (K00C0eK S@(K0eKXK@ 0CYP X@`' PPBT0S ZT 0[SOK,] P P0:S 5P 30K 00S8#X VOK`p W1[S S04%40T0VK1`X![|T00T0D PZ 0ST  P\Vp 7p@ P @ TP Wpy<X KQ 0P @  P0b @ ` P 0f@< p W8t<@Tp  PP@P U@ @ X0K@ TWx P*Z00Z0SP IXKAPh P pc P= U`@PX KX PDP@ U$!0@0' H PXPKp @@ P000  P , 0,K 7,0SpP W0SX[T@HAP`*(K8$N,0X8@ p-LM`y;P0:0/JPP JK@D** * |*  P11;d0PP JK@D*L* $*  P11k;KpHT`l 0-LMP^<0SY T0ST 0S OKP. Ph 0S @ . @P@ P TK0t[ -AML8M0PSL $K3pG $ 0bSR@Kℏp:  l0R6 pP3 l00X@P# A K@08@ C0`0S020# p3P` v A=K0C80C  ypG0 P^ pK`p p-!L0@S00K`PP6 T:Pi@P@0P!S[P Fp P w 0SHP T3p DBP Pp蠻 0-@PL\\0 0PS@T0@ 000 0蜻@ -0L@S4$w \w \w pw pw pw pw w w py<TP 00  `P@@P<8P0 PP0P4P|P `Ph p-LP@ol`P@ el`p -LMpP[l`(K0 S00( 2K 4pJl0S @P Al` K0A>SP00 r 0_R -RQAP0 00 0 -QLMD H0  Qz H<̠Č8#Č"̌,,H0 @,̠D!d , 0 @ P ` p @0  < 080  4 000 .2 0$20%20&2 0'2(0(200*280)2@0@0#2H0<0@#2P080P#2X040`#2`000p#2h0"2p0,0 #2x00 , @l  D<,  L8  T4 \0   t DH4 d @P`$p,4<,(K -QL MPp` Q QiPc  a$ KҾPZ@ @$00@PP%aP d@PF  f008 K⵾P :8 K⨾P0@  80K@ X 80[S70[0SS 70[0S SᙼP @0(KP 2(0S K p- `LV@P p 0P*(0 0p000pD -L M`Ạ pḀ0@P `4 ĠDT"4!Č'(D*T0K 2KKKBKRKcK$K -LMK![K04"4 1K -`LpHX$H %X P p- `@VLP p0lS*(0 0p6000p\ - Lp @P`p 0$ Ġ4%.$$&Č'40  - L@p ,<4("4!<0 - L@p 04"40 -LM 0`ST8  , 4 8R100 5@1(:=S 8 P60D,0,@ T0*X1@8 T)p& ZY  R !  b0X10000 40 PpU0ZYPv 0S0%50 r(0 0R0 0(KP` -LMkP"{`@p|yc"Kr 0Sn"[0hS*1 0Q Q Q QD1Q Q6 Q=  P4!Z;   !P! K'# 00S   0S   [`0 $000 0S 0"[0hS,0 0 0S\ x 0-< LP@ P0 -0L.S@P&P-QR00(+P00X0`dSp U `V@1@! WP P0@0S.pJU000 -LM0p (0 PPUoK0K/ KP@'L1[S  E0P,KKL1 H1 D1 @1 <1 81 41 01 ,KoW0 d K/KP@ 8( 0R$K  -L@,00S )P -LP@ @R0000 0  -@L]8p- 000s00 (p-"HLPp p`p -LM   PS0  X0  !K  @PK@h@"00 K p@$ -LM pW@P 0\8#Ƞ0`P W@PU ("(pP@00 p-LM ` Ƞ,H@PPx ~p 00fx -1L`PV@  E0pA("S$:V: 00P  000x0 *VT0   @a J,0 @g"0 0 ? -82L8M ,00b@ 040 P#00E.U  0 S00S R40EQ7 Q  A1!O  4  4 P P 0O(,  p^#< a00 (KR P`800S80 o A1!O p p1  0^0 QQ \a00`Yp L1  0@!100 , 0 K 9 QP` /  0/V4A4 ,00 R2"40`S S  0P4Z`000,0 <0   Uja"00zp4 ZPDx$ -L M4 0 0?O4K#$XY8  0OO$ !5BE;t  8a"0 0(Kr \B 1W2\ , ~  0   @P04K 4 0 0@aQP#o` P`0OO${p' YHZ0 Rr04K@4 0 , 4 00@G ,00|03P 1 0 Z@0\A04K@4 0 ,H!4004!8V V0 r/, 40 0 8B t4cQ4K 064 0  8\ _Y04K@ 4 0 40ds04K@ 4 0 $\x -LMȠ0`p  (0 PPqK 1P 10( 0R$KUOK 9 SK9,KK9,KNK/`KP cK]0傎 -LM@  K K0K  @@LPK -LMd`0@V,0  pܠK?PK@  T@060#0@@T Sb h  h *i  8@@D0\0#0@@T 7b  h h iT, 0R(KܠK "b@@K h hp`  -LhMD` VZ, P@ , 0Re(K0Cs P  VW 00p0 0  @x t l@ | TpK@PK|l <0 ( p@ t |x0  0pRZ h@K  0@B0D0  00#0Q Q V@1@# `V |  | d刍  0T0 P0 L0 H0 D0 h0 d0 `0 \0 X0 @0 <0 80 40 00 zR-A ^ QQ 0SL\* -LßMS 0@p8@ 040 < @ 0@ Z0,K00<僴PP3 ,QW 0U*@@0S 0S Pa ,@0SQ  E04 SA, QP 0 ST 8 `q`3R`V2 X 00Y00S! 80S  P 8@ R 8Y=   0R Y5   R0080 @\08(K00@P@ 0 , 0,08@ 0 `8eQ\,  IP,,A, \ W04@ T@0 Y@0 W 40 S Y@Q  R88@  p-LM`0`@K KKK`K/ZPP +0 000KpD -0L: dYPD -$0LM KYPD -ML M⌢0划`,0 +PphRpP 0/Sf PKPj BNK@D@D+BNK@D@D+J^KPEPE D 0S :S S000S S:S  0SA0W0 0S /SHBK@@P 0T ]@PV00SV00S040 t, 0R=(K0P 0+Y:bP 0SPBNK@D@D+IP 0S BNK@D@Dt+:8ZPೱBNK@DD@D04  P: 始D`J P-L 3 c@pP 0S %S@ ß V *00SS@f| Tt0%0CMS$ H P T  ط ̷ 0PUUwWx 2 Q PP U W1 PP U V*PpgWP Pm Ux cUh Vz*p!?A1c000 Vr*P!?A1c!000c000 Vd*!?2c!  000Pb`*`(P;/".000bPE4p P10/A!b000c"P&0 U0@@P@ V0*%00" U,0 R@EHR,P8T8gfffQ p-PL`( 00@ SP$.P1 *PP @PU 0B8 S8 7B@PڈP@Tp1  0B00@ S!0.PP00@ S 00@ S00EPX82Z8 L"-L@Ÿ  RP`@ j QuN:R^0Cʠ &   B b< 0`C46H&0/p0/Ơ@ Q a@ p Ђ0T/`P@^0SR S PP n B2c `@0 T/ 0:56!ǠP `Uv00p   0F 0P`10 Q 0 0P` -QąL@P$ML@ HP @PD SUp`=TKTA*T 006P%0\! 0aa9s&F2x'x )8HR@J*RJ@@b1P 8#8R0PE*RPE 0U0D L H0 RLK p(KT `V:4V006$0\0@f(&x80 2 *j 0j7C93&x40 < < 4@($8HR`y 008 0pp`= 0P-L7 -`EL MpS@`Hp D P>R[R0:4R005%0\, 0l\9c%>*x'x )8HR@J*RJ@@b)` 8#8R0`F*R`F 0SS:4\00< $ࠃࠓ0^,  VY0!#*0H D0 HK(KRPU:4U005|#0\@e(%x8 2 *Z 0j6C93%x40 < < (4!8HR<0@0C<0 :@b`48#8R`F:@b< h8`  )8HR@J*RJ@@b` 8#8R0`F*R`F80 S00<!ࠃ ࠓ0^, q ,0,p# 0c5'6C93( 00 j @ Vx@ 'x0!8H,0RS@@A@ >:@b R `>0p8#8R`F(:@ b.Ƞ%8 8"H 8R:,00T00S+ N0(U 006R 00R`FRA@@ R`F]R0C@<0 FR0@-@P l^0,00 nSBS\N_0 0- L@0@PᘒP $0W0R0A -@`p0 0V@TL  0@P 0 sP 0@0 <0@ `P @0`p?A -Q؅L@P,MT@ PP @PL S0 KUH `pJTzT:4T006X%0\, 0ll9s& < wX%X a)8HX@*X@@h e Q 8#88U0*U0H0eP < 31P T0 T0KL0PS0KUT P TK0 , L0S 0Kp0 , (KU:4U00<#ࠃࠓ0^ WY:Y pH R T Pp PT0KT`VW:4V006T#0\@f< (&x( <0A -OL@dUPO66d"*`"*-R 0R\ p-PPL @T0. @ p  @U *P/P /P BU:R  BU*0/S 0e` V*p@ 00p/P  BU:00/T/. @ T@?00꒠1 xB 02 #4xB 024=> 0&@-/@d4xB 02d @-M)Ѝ@4=> 0 SP -L 0KM#' -LMK  KP K -LMK  KP K -QL M@ K0 0#0  # 0p03T0S00#0K -@@L0MP 0 0 D 03000 K( K P(KS00\888Z!* -RL p@@@pT `v%  P DP 0AS2 0SQ0S 0S .P 0S0 .SQ00Q0S 2 0S .PQ00áP00@-@T   0000S  0P0S  0 RR00ӡ? 2 -LMp0 S( @0 ( 0R$KP !ᥠZP2`P8@KE X`PED` -PRL@`pP@ 00PPPPPP p- @0PSL`R p0S 00 ~  01 0 0pQ)03 0 00  F, *FP  xtplhd`\XTPLHD@<tH|dD* M0-LM0 0 0@ Pu:K0\Q0@-P0@  % < ^9  < X t ^@7!10# ^00S10# ^00S3 @\^` 000  RE C ;@\00M00q 2  0  ^0^0@0C@0@000*^?^: :!20# ^00S  0D ^Sp 1  0~ ?^*^ #^[^\00!0 !@00 00 0000@@000[^#^ s @1  0y0\  @  0\  @  }\00 L0 R,0C@000ĕ@p0\  @  i0\  @  b0\  @  [0\  @  T0\  @  M0\  @  F0-  @@P p-0LQ`P @0 Qf`00p R-Lp`P@@D 0T 0G 000jR -LM8  Bp`4 -PK 0e@YX: \p`WGQ< L VJ*\Q  Q *Q?Q< [Q#Q9 q! X1  0 *10# Q00S10# Q00S @\Q @Y7@*20# Q00S  0A QSq 0  0  @80S00Y*<Q @-PK0 A0eS`40c(K@P* -@LP <00蔨 p-LpMP@T b KpdKwr`P P L0  0: S MPO0 0F P ꔨ4` -AMLM0唣,0  Ur@P |_d`PW B^KPE PE` XsP 0#S 8 (  P @ @@P BnK`F`F0 P 0DT P 0 P04SBNK@D@D +D @P +PO B^KPE PE  qP 0#S   P@ P~  @1P Po BnK`F`F0 `季0DT`  PZ 0 P螣04SQ%`P& `P `|P `vP `pPX `q@P00, 0R(KT` <} 8lTHLPı,< 0-L@P0PP 8P0蘨 0-L@P0PP #P0蘨 -80L R PP ꔨP@- ^ 0S^@0 S 0SS00@0DP0 괨 -QLM@<0 zR| P8  h0 p 0Q `pY:%o$<0P  0Q0` pY*0@0 0Q"0h 4 ,0 @ 4 080 R@4 0 R0PI@Y :&D! 0 R0P@Y*U p P8 @<0P  0 R0U p 800 R4, Y4 8 (KPN0 0@< PpPp< P@`* p-L`/NPP!p@ @ ^OP T  0RpN0S p*yy*QQ*vv* 0NW -0PLM 0 K0K0 [P  Kj*f*( ==Z*iiV* P-L `hWM00::E*))A*$ -0L MK , K0 0 0 P 0S$$$  K#*SS* -LM KPwt@* 0-@PL PU0. @ 0 @T *0P/S 0/S BT:R T*0RB/S T*0p/S0Pa U*T@ 000/U$0 @P AM@?00긨 -L M0 0_5 K -LDM`\`, 0 \ M/00@, 0R(K^PK2 1PZM@(000Qq J00A SGsP@g P!00@T8Q 00A S`V:/QQ@ .Q(%00A S"00A S  Z R r@g P!00@ TQr 00A SPL@00/@P00 PT@ 0@dK 诠d0S@| L@00w0XSxS Pr 00 D} V po Q( &q$ !000D  Q|!00ӑlAadPH0W02p0 `VI:00pQW`F/Qt Q@Z t 0h1 T'V00h!. 0T 0Q %{zv 0&0S SS 0h1P@@8e4 80$ 0 tPDP` -LM 09U@ -LM0 -I@  0-LM4P [[@[0[ P@tK0踬L""]*jjY*++U* -L$Mp0`QP 0 " @@K0#" 00 P 0@0$0 @0 <0 80 40 00 ,0 (0 0RKAP `yX -LMX0@K`P$0 p# ׺$ 0R Kyd -MLMK@ , p p`PB@F XN 0QMOKHHV !+ gmpP#  ᚺV'0OPU`>K@ :K@ ph, 0R%(K U CmpP&K@ "KW@UVKAAp X4U0eʶW$Qy  p 0-@MPL 00}K0 9iu - LMK0 @ @ pK..`* -p-LMP0U0  @ 0 ]0Q a0}`PU 0  Kp` 0Pd C ,K K$0K@( $@ P, PP 00̬$D̴77** * * p-LMP4K@1 K70! K,@ Kp`( P  K0 4KePa$K@ :W ` KTQv$Kp K 1pX 000 P@ 00ӑP 00ӑPD0 S000д p-`L^P%*00@ S!@ T  00@ S00S !000V0@CT  \00S p@ p@-0p@T` P 0 0  00a^0200C S  00C 00S 1>3 01 -L@ X 1:%\" \0PS0]S0phPU ` P0S PUW kfH 0-L @\*0S:00[S.QPQ*0R0.S :06 \:00]S p-0LSP@p `P @ `p p p-0LS@`P\ 0  !p0P  -L M@ 0S-: @0 0 T4 `4\ Q| ?>   cP"T001 X   R!*0^SD ]S5 -S000 -00-0 -  R%*0]S PU-S [SY < PR*0-S& @ 000 T   R: 0Sk 4 0u 40@^Zq9  0#@TfJP0` t4 ]040 4@ @00 @(KoL-S G P0:S% =S0S0* 0-S]S =  000  R*0S*0=S  0S0*p0-S]S P r `ǟ00   r 00  PPg7@T ` fP0S? @T  R*0S*0:S  L0]S -00-0 -  S0҅>]S00:<, 2P  ,P  000(K0P  000   P`0S  @  eo0 `R P .@P@ P @ q mpZ hQ d 0-S]S* \& X R|*u P R,*%PPP 0!0P 0T ^001  ^0 f 040 >00  0 R (KoI & 000Y 4 Y& ^J 0@ @ 000`000^Z040 40 0 0  0 0C0 4 40^ @ 0@QT 4 0@2000  T, /*0,S  T R" ^w p0`P  00 2 0 00QP ^V 0 @R4   bB"(Kos 4 %00 ]00]0 ]   R !*0P0]S Q*-P0@0 @P#:T0]S000 0]Sq(P 000   PE v040 1P p-LM0K KP` 0 ^00K K0C B@0K K#P`x -LM0` @8P pw 0  0  0S04  4pP 0KP00K@ 0]0pK0K K@PP -`RL@PpP  0!T000 p-L`\P p@  A$0S0$0L0U0L0 P  1 e! BW 0Ap -LP`@p0 S#T TW0 W000SL,hg0f0c0  f00   fA  f" 8 B a  h.@0 fw  f#  f"  B a   @pG`@  f0R  fh-@DpG`s&@D`m -LMP\@, *0^S) `.U ^*U Q*0*S  ^\S $U`\?* RP%*P U5 \U $ 4U* 4Uy p>E0CS<0pC!`H0S   H   0H0^p0 0D4\U0 SP,0X [UG JU0D  D D` V1 0  i R *0Q0\S \) j V1 0H  R@R*0^0\S0)Sn Si3UbKa F\MXVR ;N 0 M J/  0 hb  h   h0V  h@70{S1 `R*0,Sa P 0`@QO* ^C0\S@0}S:= H  (00(000000,0XAo0)SX[  (00(0,00,0P0}S ^  R*0R\S ^  @Q*000C S\VP ){} - LMP,  ` R*@|T T  $0D XSaT<<d<Pd R*000C S  R*@*0D0?TS{T `| R :` VU RZ*0|SW0, 0R1  i00 aC80" 00 P (00(0 ,00,0  R*0D  D D@ T1 0  R*0)S ) T1 0H   R*0)S  x(00(0 00000up 0@ Gg R*00T]\g000C Sc^g+Tj 7*T  R`**0A0?QS{QN0\K000C SG A ` 0  fr  f   f0f  f?T= {T& @Q*0,S p 0s Rd:    000C S|Tp  +T   f0&  f 0  f  f  f/"  B a&  j  G 0  j 00 ,0 0}S00I0}S  \  R:, R (K0  a  i (Koo -0LMS@ `  PPa :P  0    P   (KP00   | @ 0KpK H 0S0\P@40  ( , 0 < @ D P `8H@ K00C 0 0R*K  0R: K8 0A $00S0 00 ) PP QP: (@#L D0 03 0Q  Rʠ    0S 00B\p0S?0 0S7 Q^`L0>#Re ]R R @0^@@R@P(@c P<@ @\ >3S R 0L00QP(@F40 00 4 Q 0眀MQ @00BaVP 0R 0R0\000XwR R RL>310>#R R "R (@@(@0>3S  S S 0>3S )R@(@5\ BK)6KK K 0R:K PP Ee -t0 LR  @T P0R000PtPqPn<PkhheE * * * -QL0 M4 0 0R000(K00* 4南PP- 0 P0S p`@P `@ P$ pW21C0 R4Q  000W |_PP(KY  0W0021C0 R 4 R 4 0W00 p- LP@P` x`P T,03040S000 R   R0 \00p * * * -LMpx`P 0SLXQ0LL!PP00P00@$K(K ]P (0 RP@Pʐ T,LP0SMR kR mR gRPAx,GR KR R P,L(P8PK,PFD[ڴtQhP\E-p0 @  R`&@P0 L 0@B?AsP00 R00S 0/S9ST00T0S@gfff -LP( <3aL1aa Q -LMPR, `VP `ZpA  P p WVP,0p -SL M` -= =  , Q qg ͟0 a ,P0s 0 00  P,P r`QP=q@ 4=,-0S0v>C 0C0 000p4 0v^ Pj ,3`20!0Ǔj   0C\0 1 0\00 pp ` 0 K 0 0, %Q`p ,P0S,P (KWp%0AUS1111111111111111111111111111p44|7T7l7667,7111511115,6P6h66h665d:111111p44:,:,:194199:781P8181881 9T9p9T3,~pʟP,P ~ 00 +0N, /S<;<;;;;;;;;;;;;;;;;;;;;;;;;;<;;;;;;;;;;;;;;L;;;;;0;WU,P0p X 1 0@p P Ap ᶔP Q0 4W2,P0p  !0h@xp ᝔P 8@np ᓔP Q0  ,K0KH8P 0  8v.B B 000 ,K;0PW,0 ePP, s ,K =0PjW,0 ,K0K50P[,K0K 50PS0(, W,0,P P,P 000C S<,K 0P3,K 0P)W,0Wp  ,K0Kc0P 0010!00 ,K 0Pz 0C000Wp,P r şP,P r 00 W]%@,P ̓P/0 SM Pp,P WG,@0SA,K0K 0EP: 05 B`10`c000 ),K0.P# 0000ğ, ' ,KPc0P,K0K c0PW,K 44P 0C000WB WI 0 ,,K  0P x000d2,@ .PiP ,P X@#2`10!0U D1 V R`c Q P"? 2c10!0 c;Q0 0 0.0MS, ,P0TS,P DQd00N, P@0@K0pp",P p0P,0 ,P"pPq 0 0Xz 0P00,P Zp 0P00,P 00K!P00 0@E{EA!/0C!b10bcd0 B!a10b cR0 0+0 0P,P 0 Qw,P!000 A RPPn:Q{0,P @mp ᒒP0 S S 0P0,P ,0L CA0C0  RSP,P lPQh'XlL@`$InHX0aj*f*uub*%^*% Y*G-Q M 0ࠑ@90PP@e1A 00 q$b%(?P @RJ: 02!!b?P J$0  ^0 @Z) 0 0 0 0 00 R0P P:02.2"!0Z  01%3 0 =00@T* 00 Ѝ =00ꫪ -LPp@Q qP D2  0=QM (b0P ThAPA@ =X @ D0H0 @D 0X0C S񟗦DStOtOtOtOtOtOtOtOtOtOtOtOtOtOQtOtOtOtOtOtOtOQtOtOQQhQQtOQ\QI@D0S 0 Ď@D D R  @꒠@I@Z W:<  ₑ < `Po 0e0 F pP8 0D p=X @ " H+X00\0S W:<  ₑ < ``PI 0e0 F pP8D H0X pH W:<00⃑ <0 E`P. 0e0 F pP8D 0w@p_I @H [D '-D DD D0C>0D0 DΌD `   ,KV#,0P R>0SK l5"0 0`0+S -SXS S P0`+S0 -S0   +S0   XS00P^ -0 0 `Q +0 0 `\ X0 0 ` W@1 :`@Ppv C808 =0 08g50 01 -L8M4\( p& < R R S @9WP  ( 0R'$KR Z@K2 |PU`@ PU PZ@K024 QZ@K2 K@bLH(99.* R  #R , R R R  R "R, \\R0 0 R00A0"S0 0D0  0 S S S0 0 0Aܵ -,@LP -00 -4@LP FJP` - TL0S D ZVP  ,P q 3  00 qQ#Q cs0 0n0@S0000 0PU L aP q 3  0 00 0y OP q 2  0 00 0g =P q 2  0 00 0U +P q H2  0 00 0C< P q 2  0 00 01 P q 1  0 00 0 P q p1  0 0 0 0 p P =Q yPP@Um0#S+ #U) @0PS0 cP  000 0 R r 00CS0 Q#Q 0P  0 S S 0@S0+ @(Pĵ̨ܵ7 0-LP@P %P0 -LKM䡟0TK(0 p@P4K@P/0j VXW"( 0RV$Kx fl 0@mPP 0l Kh0 0d `0 l` 0dK\ K @P X 0GR8"2 *@P +VP 0R 0GR -SKTPP L1R H1RO)K)G),`\ 0-TLPA/H0P@ @A/kPP02@P* |8!!* --LM0 0 -H0@L`P8 4啈T   嘈be$@D\\*;;* @-LP7aaaaLaLaLaaaaaaahaLaaaaLaLaLaaaaaaaLaaaLaR0 0" ؾ lҾ X̾ 2 00,   $Hp s* --LM00  K p-L@P1X0` PPT  4吽4 0'b ph$@D0 l_ p-0LM@P0 ) 0S& =S$ 0 S =S00SRPd`K P X0 ! 0S0 P x1 00x1 -LM0@=SS00S $  0=SS00SP$Pd$`K P! q$0 A$  ~P $0 1 0S0 pP B10 0p R`  0S0a`LPP  0(pS PP@0 0 1 -0L M`Pp,0 P" 0S =S 0 S =S00SR@fP, K PH ,0U00PK00  00 0(K P 00 1 0S0 PP,@P 1 ,0Q! =Q =S 0S0=000S0 ꐀ R4   0S0aC140 P -PP < 0S  0P P4 ,  1 -L@$y@P0 @s -pLPf@Tx` $*P00 @ƥT R<T",PT0 H 0-`L! 0T<P>0!@PP@T 000P00* *- 0-Y+ ̌!00@  0 --LM0 0 -L@Pp/\0` TT3T  8崻8 $0 K`  "b$@D0 l_ -LM0  K ?0-Pp1@ LR` 0S .P P@ |0S@D0Sޢ00Z0 70, ?0-Pp1@ LR` 0S TP P@ D0S@D0SW00Z0 D@0]]*Q  ;8??*IϠ$*E-M00L SJ20\ p` P0 @ 00L @  S4$ 00L @ UQ | 0D A0a00cB.\! 0W @00L S0\p PX\x\PPT*0S R<8@%Ѝ\ Q| 0 0hC10SmXnnmnT0SQ R<84@Z,<$!$$, T*0SLP -LMKnP@0 ! -LMşR!  ,   e! e 0@A0!S1S UK  xş@K0 K0 X0 T0 P0 H0 D0 @0 <0 80 40 00 0 0 |0 t0 p0 l0 h0 d0 `0 \0 0 x L  K K,K  K K K K~ KzQX0K1   @0PC⅀K  bPPp0[ Q- Q+ T*00K[q 3  0  Q#00ӑK[ Q #00 ӑ K[  1PPp 00.L0l XKK, 㙛PHK &K "K K K K K K  K Y=P@@!T 1S *7T04@P!TU!X}w Q (Ÿ, 0 R(K  Kp-0SX0S 2p !RK  v X K!  ?0KK1 厑PXK L00L0 60[X KS060KI0@K0 1 K0 0  K K,K  K K{ Kw Ks KoI-~F-0 A 0{A-0  0u [nPD D0 0tD p-L0M`0@0 P HK@00@0 H KQ Q Q -00 0R Kp0 $>[t,t,t,@: Sb00 ^ Sl00  Ss00  Sv ?00 r0-000w0-000!=@Sx00 > SS00 ! SS r0-0t!00w0-0 00Rx00 # RS00 ,1R8 r0-0!00w0-0 00Rx00 - RT00 0R 0 0 R-00S-00 Sc00  Sd00  Sp00t00 00 s00s00R-00 00 -00 -LM Q00    K  Kdd*KK**oo* *zz*R0S 0S0S0  R00ZZ*GϠ*''* -0CLMs,0 @ Q* 1 RPIf 0R) 10CR 0YS!Z0s3(KZ 0S  T1R@Z TK  ,0PD0PSpYW P0`U00S00 P0@U 0U 0R W`P0@U00VW:0S`#@ P0 S@T 10P`@0YS?*!]:-0P P000P R* -`LP p0W 1@PPP@żU00Q R @1@S  R᭼00 -LM`qpP r 0@r   t00 ( pDW PAbRP P  0  R 0S 0{ U@R s00P=  t!, Pc 0Sa 0 0 0S0 g@00PP  dPk0 0Q 0@0A   0, 0STU /0 0 ,\P% 0S4 U, 0p 0  R=*@0p@P  00p  001 0  g0S S1J0 R0(Z0 0Q0S S1J0 R0)Z* @mٻ ix*0 0d -ML M,  @  pT2 /T ` 0 @C@T/TPP  0 W*Plğ, 0R(KRs/T ` 0 W:/@/T W: 0@ 0  0 S00:!*P/@@BNK@D@D+PA 0@ ^KPEPE(P5 0 0Z/S 8: S S 000 0(PNK@D@D+bP( 0S B^KPEPE+VP@)P 0PZ~P)P0SNK@D@DD+ヶ 0@x $ Q 0P@ 2( 8 P. 0  0 S00b* .R2 Z4* @R  W.0S0T(*  @0lP  D0@ PP 0@6 $ W^KPEPE_0.S @P+P^ 0@" ,PU8: SQ0S /0 0IP|  :)P0/00NKDL -LM M:K0P~UK4  >KK0C*K080K₎KU, @H ?U@B [U4 *U00! PU5P(K R*K, Q 0 ` I0*K, 0b5 8 (K*K 08 <R 0 XX5R P50PP!U00S !U[ @DP 0%< 0 P`].P 4!Up0:0C0Pp00-S@= ]SH P`[U8#80@0:S0@ : P 0]SPğ0i@T 8Q:0 RR0SF @T 0 8#8000 @-S@]Q 3 00p]S@ 0#< 0 PUKLK*KA KKA(@4 0 Pa*K, QJ 0y :KK0 4 0Q"0a1 0 0P[Up`^0:S  0  nK`F0F[*KV8`@*0S /S  *K/S 0 R@ 0S00 R P* ̝P*K0 PUP" U R^ 0*K S C  0R0S0 U L1 (KP\/PK0P ]U@Mb< S *K, 0pb@P@ W(Q@00 \  0 0 0P@P  00**?[-]:`J -LM0@{SB {P T႞KI p KI0pPC0 P\ @ `{Q` }Q Q [Q]QQ 0  0]SSS@Q  (KV `F0}S0SU0[\ 7,\ T:P[\0]SS   0]SSST0*VU  S:0S0 wP  000{\ }\V`F` -ML M@,K`pPMS P K0 000  <R 0p Qr q 10bQ KK @ @ 0 S L \S0N @9R8#HA@L.0K^: X0 Q  R00   GT\@ro80 R00CS000}~~pRR*R0S0  RR B0 0Q0 0Q*__*VL*A*//*aa*P0 -$0L! 0-$@LPdPa$_P\0hY p-LM$`0PK@.0.qpP pP 84,00SKp,0 -L8M$@ 0PR 0`00\pK@` 0` 0DKp 2P 0 \0 2X00S$K,K,0D0 \` X0 2P  -LMpPW $K$`3S Sh 3S\ S S WS= S S S00> QS0PW @ SO V&Sv S1X 0PS DS S>400 2Qa A0B !>3 S >3 !>3 SQ!1XX 0PX >320  0P0PS "S>0!># R0\PSu0S qXn 0PQ>30Q,  0P,  0,0 ES @J`@` 0P  T00S0 R@ 0 \ (K>3!>3 S,  0`,  0,0 FS0H P0>3@ P 1>3 @!>#"R@D0  @V 0 @_ywQ& .Qr,  0@,  0},0 DSP`J  0`qP 0 `4N 0>#" 0c OEQ QA 0>#" 0c O0 @6G-Q` $P @>3 S Sw 1S S S @XSO <S S S0>#00 00@0S0   @XS xS S 0>00l0 S00Sl@@ S G&Sr S1Z0   @\ p!>3 S >3 !>3 S 0@00Z >320  0   @!1ZZv0   @"Sl 0>00 1>3 S`  00@0Sv @USQ0 S @MZI0   @h80Z @=3S`" Sb JSl >3Sc Sq S S `(KS{ S0^zQ>3S V >320  `0^d&SC S0S00S* Vr 0_R0^JS S V `0Sz 0 S0 0^30S0 0S0V S V 0R` RQ Q0V SG R* Vr 0_R V* r!>3!>3 S0^~S S; Sj @>32@d00 _ 0 0 .P `RP R r 0H_RsE00 090^B0^>30 @C  1>3 S% 1>3@!>#"R@D 0  @P `0 V0C 0 >3 a 0c  P A> 28 0qH D c @ < H  R4 V 4 0lS:@   ᒍP80P 1 0P 4 @>32@d,0 _ @ P 0 PU0,`0  0pPA>3q 10 `g 0dS0 0r~00`0y` VuuP -L,Mp P@6Q >3S`" Sb JSl >3Sc Sq S S `(KS{ S0^zQ>3S V >320  `0^d&SC S0S00S* Vr 0_R0^JS S V `0Sz 0 S0 0^30S0 0S0V S V 0R` RQ Q0V SG R* Vr 0_R V* r!>3!>3 S0^~S S; Sj @>32@d00 _ 0 0 .P `RP R r 0H_RsE00 090^B0^>30 @C  1>3 S% 1>3@!>#"R@D 0  @P `0 V0C 0 >3 a 0c  P A> 28 0qH D c @ < H  R4 V 4 0lS:@   ߋP80P 1 0P 4 @>32@d,0 _ @ P 0 PU0,`0  0pPA>3q 10 `g 0dS0 0r~00`0y` VuuP -LM`< 004 (@40 0P8 Q p0 0 AϠ0 @0 S0 0,, ,0  XPy  X| , p R@ ,0 S T  0  Ppm@TP2W  X* x| p00 00_X00So 000_X0S 2WX ,0 S sS 0 , 00_R00SHA?G0CSE@ 00S 80 < ZP]  4з0 8˷, 40 P0 S,0,, ,0  XP00, ,@ Rp0 0 0Wpp@vp 0  PpP,  R r h  0, 00_R0P Sp X x $v0O0(KP -LMp S, WQU Q0 Q Q Q Q  \A0A >Q>30Q,  0P,  0,0 ES @J`@` 0P  T00S0 R@ 0 \ (K>3!>3 S,  0`,  0,0 FS0H P0>3@ P 1>3 @!>#"R@D0  @wV 0 @_ywQ& .Qr,  0_@,  0W,0 DSP`J  0`KP 0 `4N 0>#" 0c OEQ QA 0>#" 0c O0 @6 -LM 40 \  ?R(00 Sp 0 000 $   0  X 00 00_W00S1 000_W0S 8U  Y y 0  00_Y00SA?E0CS <80^  R@ 0t`  ` p(K x0`  `p`d \ |   0'00_\0Sp Y y  0 l0l't7Wpp@0 ,@8w\0\0hH 0S x P H0S `KH0H0   0PP ^u X0S `0D R X" 0@0 @`0D PH0S\0  LPD0S H  0dH E U 0 \PP 0 R HMP P( TH0`0`O/\ `PX`^  D0"P0@0@0@X`VΪDP˪<ɪ" ẵ urD L0SPX嵪 H  R @T 0`   Y y   0#00_Y0SP W w ` 0 00@#3UPP` 0 ,@lS~\0y` \0z` lSH  v ^H0S `KH0H0  0 PP Q X0S `0D R X" 0@0 @`0D PH0SV LPD0Sp H  0*H E U 0 dPP 0 [ HP R8 TH0`0`O/\ +`PXp^  D0"P0@0@0@ ۴ ` \0  H 0XXpWԩDP+)H0STH0X``0`O/ H Q ` H0SaTH0Xp`0`O/  H 0EeEP`0DGP`X M<卩 <D L0SaP_X@O`0D+PpX # XoDm<kXgDe@0`0 R T`0 CR` X0 X0(np0R RXnpH`0 CR` X0 X0p0R RXnU*E-,1M p 0R  ``XRxR `R,! B00BP@ S0A Vr 0D A0a00c BR,! 00BP@0jC R17 1RЍ.R0X r 0P -pa`LP @s`P` 0`jP0i~V1P Uj!0\1 X -LMßß8 < 4 =@0 `2P j @Ty Pp0 ,P P2@pT&  ~PpP2  0R0X0S00s0P  0 20RE P2, @pT, R 2 Rt2 ? (K<0:S  H0P 0p, 2@ YR00S5 1 R <0:S  0S 11   < 0:S:? 0R 0R RRd1 R < 0:S Pd o0BS-R @0S0 R 0 00 R0 R <0:S @0S 00   0<0C0 :R:?Q l0 R48L 10  4 0L0g8T`8| -LMR4 , 0 80  F0S0000s %0S40 -R 0S+R 5 0R0%0C00%5  huPu` X@t  00  e00b 0 000%0S0 R#, `4V ^0 4A@-QPpU4P @t $0s`U p$-Up 80Sc T 01S\ -Q W :Qs 4影Pn 048 0mpPF 3#0 40P -Rt44 u+Rr44 n-U30S5P(KPsP3PLu0 0 @00#@d00d00P00"0P@0Ђ0s02`p@P:U@30S0002 R 40:S |t2P?P0Su0r0"P,2u a  000 d0b01 r-U0S4%P 8 0R0WU0S0 0;S7 :S 0S000|H00 R@!0:S 0, 0R0 1! 1Q  40:S 0P40 :R:P?PV0 100 0 0L0S0,0Q0 |0l  Q 4 0:S010048 0yP d8`8[` -LM@@ZK -LM@@OK -LM 0D K*7*7tt* *$$*6*6PP**33*##*- 0L0 0 0 0 0 0 0 0 0 0 0 0 0 0 0  0\0 * -`L pPIwP%P 0Q @Q PX P @TP k@ - L0 0PLh8 -pL P@ 8`P0SX P @TP k@ - L0 0P\h8 0-PLP k00@@@ @@0h8 -LM0PS ,K,i@P ,Q 0#S S 0i@P $K0 S RA,  #wP0d,0 ,`P , ,0pp'P @p0 S S0 S S '`P 00(K 1(0S ?R0SP("(04"48@#80 @PB `8l'P7 @00T2 P.@]'P( 00@T# P P P@ 0@!0SᩨP 000  b `lliP0^q0 0n ,P@. @_` -L70Ph8l 0-0LS@P 5% 00 00h 00 00`h8 0-LM@KPUdPPPQ R 0S0S g:d@@84dP@@8 --L]MqPM?KC/`KK `1 4Q 0Q @Q0 K 0KቩP   0 K|1 1 8 喕p@ 1PP 0RKP 01 00O@ 00@B --LM00  K 0-@0@LP 00jhT    0hlh$@D -LM0`0  P@t 0-T^ +T0@,0 ,  v 3V00S 0TS R0p00D S t, (!000& W070 cV \Q00R00S!! "00@0T  Ѫ p㽪 `,0\00S00aS \0E(K@ , 0XSxS@P `rP0P04@0|@ -LM0  @ p-LM@K`P90 x --LM0 0 K -LM@KPTK 0-L@Pp Pp T U 0㚾0X p@   T0(: @b2b 90*{{*0$0 -0LL0 -Q Q Q0  0  00  0-@L0PS P00SL 0h -LDMP pħP d`Pd p 0S, R00U@ @@0K LP` 00 X T P \@ [`K7[P0S Wޡܡ0d0 *0  W@P04,"40ˡdɡd@ P0P H0S00A0@!1HuZP! d(K &\P P00  0@Up 00100@ 00*00d@ 00#00p 000@08p 000d 0$@$9 -LTMp \ 0Qt x0 | 0d@ `0 0 @ L`Ro  l 0h0 $ L |00C,̠Č| 0("ČP@|H # P] P0\KPV p0  0PM xt PF lPN l0SO `Pd RA 0A尡L0LPK0<0 8 B XpKP ZP$P (KX0Y$Y$P) h00Csh0 p  0 P$`0SdPl $0S0$0$0$00$0p0 0P0 $0(  H0S 0L0_Z$ P$0S0$09 \ -RLp`PU Qp@`P`. 0$0(  -LMpRP(K !31C0Ϡ @l1@8K00 2K}@K 0K` r4 <08R@0= Bc 0 B ABS=ɌBa!@B ͌B31C0/A#b1@TV0p$0V v  0p@ P06 p$0( 2[   000S 0p($0 00 0$0( pMb@@2* R-$L  00 P-L @T p-@LTP 0@T@80Sܟ$0``PPҟПΟvP (Pi@;e@p -$0L@@LP`ph0P@  @0(`004$0H000D0H ᯨ 0- L<R@ P㏟00.?0 00庣PPP P} P -LpM$0@0PKDP  +0P0  P# P 0  P00K P 00p © 0 p`P 0`pH00.S, 040I0S H040. S  80S  80S,0Q00P0 00 p-LpM$P@PR`"KTPP T@ @Kp0 0R P00, 0RMPa `PP -0LS@P`#V0 P 0U`   L0\01000(pPpP㫞pp -L0M X P `|P X0SZ $ 0S X 0R  T <0 8 @ P 0iP30$D @0 P0$00 S/RL 0/  0 P 08yZH , b , phL H 4 _0PP3 $0 0.S  @P W8  00X$0D0Sv < R 03D  03 P 00,0 S00L ,@ @H0L@ 0H0 +0PP h40S  R H0Q00c 00 R,  Q00c 000S0 80HS$0 0H RS000C00 0 00@0S X H0SR H0S 0H SR,(KP0 4 00 R< X @@R  0@0 D0 0T 80 N  8 ><0SI 8 R P PA$0H00c ;< R{0@8PS B< tp P R $0 00  40 4 08 ph 00X$0J፝, P0 #$0 :, $0" ?00$00H00 03> 0S 040. S  @P P,i P0 #$0 :, $0 Pp0( 0 0HyT ,P 303 D $@ @ < $D T P 80S$$0BP> P 03$0 :, $0=,(Ko: P 00T R0,0 - PP0 P0P X0SP 03 P 0, 0,0 P0 # -`Q00 V@@TLP 00p @$0 C T T P V$0@:$080S0 /R $0` P ݺpP P! 0-0LSP@ Ꭷ0T@1S00 -`LVp$0*-0Q4X Q#( R> 0`VR t80Se 4S S 0$  0R/S@/00(  Hx`$0  `# 0B8S P$0 iP 303Q $@O 0 0RK 3P 103P80s 0$ `8QC$0 0`S003P$0@eP( H$  ;x/m=P XW @P ,x(P00 00 `\P  % :$00P| `e34 $0 )PX = FP6 04N 0P T 3 03 P 0  Q nI0S  0xP} $0P:$0Pt $0 ᨹP 303$0`:$0s `` @ @$0P:$0 0 #0 0 #0 -0LM@p` 00 00(K(PP0P  0P `00$@0 0$0 P aPW hPO 080@T . AT%  P5 R@PH 2 080 $  P03VY`, @, ,@ ATVX# ,P  03$0 X ߚ 00 ך՚Ӛ 0 *   P$00$0[ -PL0@S0( 00Cp0嬚 媚0Sᥚh,,`0S }p -LpMpK`P 0: S % 0P0$KP@-P PlL0@0"P  0 ( `(0@`( 0 `0`0@,``$` , pQP 0-LPp"  00R00S 0㟻p  @P  0@ 000q@0 0-LCp@P  PP 00 -L,M, P ,"pT0 0 rpP W ZD oP,@P0PC$@,P(P@Z%,`)T0PcT0P`@DQ,0, 00 ,,嗊(8 H @@ 8@ PTu*Y H,j 0lS0P`S& DQc,X 0\0 0h@dgQ!Q D\a= 0Q0 W:WF*@`d,` ,P  P0ZD0 , ) R@100*, Tg`g $ 00 `, 0R*@PT0PDP DQj 0P0 `, 0R:  0gY@(K,T0Pg`g " 00 g `0S @t:,T P0D\ DQI 0\0 DQOH0@8 H 00 HH @@ CDP,Ř 0P0 .DP @08@ 0 0 @gDQ 0Q0 0 0P0 0 0Q0  T0,3DQHł 0P0 P,1 T  `,0PL0 T P0i<0 T P T PL0i0c40 T PT PPT0PT PPT PP@0,0, 0P 0 ! 0^0 #,0, 0\ 0 T P`h0H0H 0Q 0 $P, 80)) S@10*,0Tg`g $ 00 `,0Q*@PT PD\ DP 0P0 `,0Q:  0gY@0 0P0 0 0P0 tT P\4T04PPST P(,T0,`P`T P)<T0<@P@ 4T 4PP)<T <@P@ ,T ,`P`11* M0-LM0 0 0@ PYK0 p-LM`PQ @Q ]P0fCKp000C S0 Z -L(Mğ PK<KP0 L@ Pe/h`< @ 0S0  @ 0|S :S 4 R@ :00$$<: <P#DKX00X0< ZpD0ß<(0 <QD0ß00 <JD0dß,0 <CD0Hß<l@ K40P@Tv3 D<1p3D00 ,0Ÿ  80<%2p8 40D0Ÿ<0 <pD0Ÿ:0 <pD0xŸ:+K0 4 .K0 1K, 4K(| 7K$ hb'aP`@HK<  6PK3PK0PK-PK*PKp00% D04K <0H0<1K 0p H@T<<7K p3 H0[S0F <7K@ K)P@F@0PqU``0D p 8ޑdQ0@ < *@K0pH @ 5T P(1<00a(K00F<.K PpHpF { @@xA@F`< ypD080#80;@ | qt0\x  $(,04 08WEV 0 @-@T' :T@0@S S S 0S@ S@^ :R ^0@S :R^:^-^  0R R0:S|S S |S 0R:SS  0-LP# P! 0\ @ >.00La L Q A0LRW0LQ70LT0X\x\@@0 -Lp= @P@dBP`d 0@:SS   P0PfdⱙP `d P@f ᤙP` D`V b -Lp= E@P@dP`dP 0:SSo ^S \S0@ PUPfduPl `dP0S:SX 00@\:\O 0L0S 0/R@ 7R 0 B1/P07P0 @10@0B0L@2SDPDh\8, PDh\8, 00U@f  P`VD`0T0 00} 00z 00w:00t00q 00n00kᯔ -8@LP [000 0$  0-@PLpPP㎔d0@@0}LP00740P (0@ @劝00 -MLM@d  ^, ` h8 l p( @0S`WP lmPm  P 0pS LH T hL(Q\(  h T80T8 X 傎KHH`YP 0 S 0Z@PY+h8YP `0 SU0U@E\S 00 HX #RR l#Pp^ 0:SP P0:S0@0p៞P@ P( = @Pr P0S :SP:0C0EK0@ @A\(h8@c`P vV v:0P E0E 4 0S :S00i c 00 4  S`D:R:0 00H0f c a0 X0;0g@ۗP H0g gg0 0H( `pPH @ eo40(o ዓHDH ;PgᷗP: 0g@pPPX(RhYH8dg S0A0:P`@^@pß, 0R(K3 Rfh(02@X8S\T 0h8 0L0SL JT(R@@WAX\K@ 00BNK@D@D"j P)*2 R% h 0ExP l^K< PE@8 PE @D 0 p& P$ D0Sh@8 0C<( 88 L WPh TT X hgYhV@h`Y@ 00TT a ⓘ0P  p000\H H8 X Ph H/X\!ƒ@ZÒ@WWX(R2 ṒZ@ 00JPp@Wn ᫒kᨒ@DQ? `P0`?SP``L0@p go艑@pb@ ᄑ {?0YP@p s?0Y@P0 -L M⼀0`P$0 ,pK  !62 b1 R<0Q0^ph ~?@ Q R $ 0R K % 0-PL@U 1  !1P\ 0h耒0<<3*(-*=)*=G$*G 0Q0   -RLMPpkܑ0SaW0 P @0P ׇ0000 R r0 11@```CNX@' ,K0 KXW@,p. Z, ,0WKX@0@p0  g00 p0S&X(K,0W`'0C0 0 00S >P` Z@假?R0S` p$`p9-  S 0S@nhh*$%%}* p-LMa0PS-@T 0S00S @ R0S)xT! 00@0SM`K pP 0S xD x( @00 pL p-LM, 0( rSwS@T 0@0Kp 㦌 0S $K0P2 RRpPB P#1@T 0O@T 1 R , 0rSU ?$P[(0!㺢d1 R6, 0rS8 , -N@$%0(a@ P0S00  0 R$ @㔆u Pq  000Q0 g d a $M@  @$T $bipL$ -0L 1 -BML Mß0P,0 T$  0S 00ß, 0R(K/ҐPP0P4 L 04  T$L00C=SX8V8V8V8V8VW8V8V8V8VX8V8V8V8V8V8VXX8V8V8V8V8V8V8V8V8V8V8V8V8V8V8V8V8V8V8V8V8V8V8V8V8V8V8V8V8V8V8V8V8V8V8V8V8V8V8V8VXX R  1!S  b-1A L401!0T$%BNK@D@DP  ᷐p0 SP&1KH4 1D A  @d < 84 4 BXK`P 0SDa BNK@D@DPQ ; 00UBNK@D@D }(0K@/04L  t(K 04BP"0S<8w0@P@j00 c-!!R0$ 0  πBKA@@DAPT L 4H" 00$Hp0 1 -0-LMP0 S  @     0S0! b-1 00   0S0 0  Q 0RK0! 00 --LM@0 S       0S0! b-1! 00   0S0   0S000 * 0RK!g 00 -0-LMP0 S  @     0S0! b-1! 00   0S0 0  QL0  0RK0h! 0010l --LM0  0 ~ K 0-LM@P?PK0 AP ?P  ?P $@ 0@P(\ -LRp` @PU  PP@ -L@pPu?P `V0S p ṋVU Vp @0pP00@V00S P0S00@T TpV ᕉPP  L 0Rp@` `      P0T p-LMP` P P |P0l ֍`0 0 Kp@"4P0( @Í@$9P|p -Lh@ -L  hNHl_@ 0-LM0@ K Q0!唍p@\ Pڔ!劍|K0@\` 0S-bbbbbb\bbb\bbbbbbbbb0!hpP,؍P'"0 WpP0  Jp0 P0 R@` p01S ` 6pT0< -pTPȠK V4 -Lrh@ p-LM Pˍ|` 0 S 0K,0 ( $ 0 R r 1S0C1,KQ0@SKpp -LIM0 P$0  0SQKO_K`FNK@D "@ᐍ gl0! %$ 0R  KD! ~,0 MoKK_KQK@ <1 8! h0 -0 S 0Q S0 Q(,0^ 0a(00 0Q<@\ 0-L 0Q0l0CP< (4"4!<0 @@b T 0 0 0@-Q @0S 00@  0S* n B!< 4!4"<0 0 0  0- @P  0SL 0  <4("4!<000 0P 0 0 0-@0LS@ 0, $ 0 P bp 0,0(P0 p-PQL@U  0(0PbU (,0`SPppcP0à - @LDP`Up$P  bLP"W000H$P1 H04 X0T  cP@ X0T PX> 00࠱PP L0 R0L00P ࠑ0H<,$!$ H \ QT0PR<0TPU$ᏅP $(0lH0 (0, P$8`ᩅP, 6<PᡅP$, 0 @0 X 0,`H 00`(40L P,0 D P @ T ``0 (KoN @08No 0{No@ 0- @LP 0 p 0S S 0 00b0q( ,00bc0 p-L@` Pp 0fS  0 `P0P3 5: pS0( P,0 `R$0R0` #00%( %*P 00 -(0LSP< 0S2VO0 ! P` 00/`VpP <0O`Vp0S R 00cO`p 0(p`p 0fq 00`p0p -LQڪ W00 p - L@<0 R0`000000p 0-HPL0@S0`0000`00 R 0hp -LMPD \l (Q  &0SfXF X X7 `p@R, 50 S g5QR ;0NPK0@p 0P @0P ~0000 0@8 0@0S E0S0 0(KtN0  P` 0S  0bO`p0K0@0 @ @008CJKⒽP0: S0P ;L 0XoKT  P`0 0`VpS < 0O `Vp08  c0 0@P@ 60# Q0`ʜ ` 0@0@ Tmj L00cO` p  0@p 0@0P @0P }0@0@Y 00Ÿ0Sd + j00/`VpP <0 O`Vpr XKP&`K K q* Ÿ0SK D X00SG <@0@ 0 @p`p" 04# S@ 0` c00 P @0P }000 0D0 R lNq0S  Pa_ 00   a0@ P0 Bq_ 0@p`pq ADP T0 d00 S0 0t=pt0/`P  0S SL E* -2MLM|$@0TP,0  <S   0/Sk @P B.K B B, + Wx X030#` V0#ScVH < VD / {P< PP#@aTQ~KpGpG (K0YC`d   Y,@B0 /S ,3X5/00,8[S XP SPP0XP /,0VbPX A0/S/0C0@0@0S_`, 0 R{(K%?00,R,  {|0<  +#rPKAA 2PPh<: S Qk®KJJ  ;pP( K`\F,<[/SD XP /P0aY 00p 0-@P00QPLTP  p 0z@00 ㆁP @P{@*||* --LM0 0 j K 0-L M0KK 0PS؀@ AK09"000@@@ 0$0%K -LM< |<0D @  Pu 0-U +U 0P8 80 D@ t 3T00S 0U RUD0 ?4 00 8 RX 4 K W4 K `ㆎV0D0@`c`f,` `p 0E Qࠑ uz \B000t W070cDPmR8Q4 YNK V0_ , ^00SD041 ,/@`p`Vp P0U8  @@RD@ 4 0 4 K 4 K , - W# 8 V0& ,@^00S0040 ` `Pp Xw"00P`q Vm"00P`q W0 W0@Q RJ< <0@ 0(KP8 ?0XSxSEP D 4 0 CP -L@)T`p@P  @00#:k0cS:UV@ 0p`p -LxM`OP0 U80   0@D0 @@ 4 40 -SXȆ``````lp@`PM  | EPeP Y|0x@0`V ptp 4 @T400t`VDK(K@0D`t` 00Spxp | /Q9Qp@`9Qʇ!000T0pCچ!000T0`C@4 /QP R 0S J0SG0 RT4 | t 0@ Q  |040|0 R" |0S  P 0BSpچ0R`|PU 0A R;ʇ!00 p0|0 04 0t0 4 0Sn 00Spxp 0XS xS 04 00S S_  x r4 @t@ |x 0 N 44 0+Q -Q,A    00@ S4 20P404 0P 10@S%40P@p p 4 /P 04 0@!00/PP9PpL*0aUS RaY T @l@ P Ē Z@PD@ @P D:H A xo@PᲒ 0mD @ YQP` 0j@T 9 DK]oD @ 07 MSp`p dp \p Xp )0@ D0 `\ 8(d(\(`(X(|"00 4 s&Pƒ~P` ẃ (tP᳃x8L d8 0%P` d \ X  X \ ` (Pd `0  ! ⭁DK, K00K)P8 W*P\ P@, TP`PPf00ࠡ࠱Rbp t B gR 6cT PbP @0"00C`T0 T @0` @T00 S 0S p pc@c`cU \a*P\ c 8)PP_ 8d(8P T8Y)P8 T XdJ*Pd L VdI)Pd D W\A)P\ < d8(PX 6 0 0\'PK X\;% 1@P7'PKYe u` l h @5 Z 0Q0jZ0S lKx%x5'P lK詏P l h Y l0K`pk6pjDKt 0Dn 0DKlD @ P@`\050Zp 8'd'\'X' 4&nl h Ylph@@PQ"P`p 4l`p@D0SH@ 46SE 3&PA44 ml h l`A0`p | ]I0@%SfꌓȆȆȆȆTȆȆȆȆȆȆȆȆȆȆȆȆȆȆȆȆȆȆȆȆȆȆȆȆȆȆȆȆȆȆTS@  2r` l h0 I0P|@  |@ 04 |00P0|0 10@S 4|0@ | w\2 l h0 BCbVD@K0@1 ` m@PVD@ @P @05&C@ ! DKtmD @ @"1 R6CR0!0 5&0C@@ D0 @ @ ?4@K#P 40 (R D @ 4@KL#P 40C44 #P40\!04 @ D0 Qt80K4K< K2!0S@t 4  S S 8 RL`K L`K#8&0DK<  PP\ ~\cʄ0 DK mD @ TNP?A|x&|?5?55P9?<5&HDK@PD`K@ ` p  0l 0DK\kD @ @h0 0S56@0 0pW @0 0D0 lKye-f 0lK/kY@PD0S46S !(1p%Pu8\&dZ&\X&`V&XT&h!h1^%P|!p1D$P\l`hp0A;h@d 1 DKkD @ DBZ T30j0T0 DPK`2 @ hlP`TDP @` `V @820#:kcQ Q4Q0 AD0 0"7&@ @ DK 0P&p`p dp \p Xp 0@D0 @@ Ry|nY| @#46S TpW  Y DKD@K0 0jD @ 8%d%\%`%X%Q #0 0 K DKlD @ 3@ 0S}YD0S@ 46S30kSX 0S0SX&0PX0 \A%P@ ڌ`V L40kS7S8%d%\%`%X}%Y0ц!0М `0| |0 տD0l0 h@ D0@ 46SD0SPiP0Q; E DKkP e kD @ D0y jP0s$|DKL #jD @ DKD@K0} 0i @P0D@ @P P2 XL K6#PH0$L0&@ D0 @DT (60jS#:k0c&B# P)X6Q `60&0@ D0 2|606C#**0@ D0 )D0 1D0 p 0-P0@LS ꜜxT(H000 0100]"000 00 1 000 0  010000 00100C.0 6:0 0100 -RtL$M@K@P`p0D 0@ K,@K$0K4P @P$ 0 K T00 5CS0cC*R7S0BS c020 -LM< p ?4 00 q4 K , P` 00D S t= 0007 W070c Z1R V" U0& , \00S0040 Po P` @0T   04 0 U"00@P` V080R00S Pu`@Q RpG <2 R] 00SV0 R r 1S0C10B <000PD `0S@0PL wpP- @ |0 @p000CC000 R0@ <08 000B 0C B0S [CP, 0S0%0 0R0 R*0\SL xP 00π0;0B #A03@ #0000ht=p -`R00 F"R00LMS,  Q00 ",P0 @t 0-T@ +T@ v 3V00S=R 0T ``Z[ ~zzXfphp 00D S t> ? A10N@b@P, P0@ R?W@pG 0 _?W@P0 W(K (Kox@, x I,0!pc?WP -L(M< 1>?0@0c@ S80 D ,;8#8?C0C0V`p Vpp@P 0C P00@PP00T0#S 00@ P00T0#""S T % * 00@ T46"*C2&b& :460V0+ Vp0pS0Z0p0GT0  AT,K 1 c, ( 0 #2>;8#8`t.t>bp.p>`@ P|[\.\> b 0`@PZ 0P-\ࠃ|  >  P0L࠳|0 | 0jS SaB0Ct U U Et0 E\t t p   Q00 @  x !Ps \00S ^$-01NB0H D    ̟ ?`0`p@0 T P< HKP aH D  @H K "`X T |^ XK4< CP00Q00S ROXK; na0X T 0L0 8 4 ZX K _a; _40@S UA ;XK_ 0`pP 1 P ` \   pd \`0S d\\`h 0S00 p` p00S  0?o \00Ӏ!  \ `: a 0P ` \ p100 d Q @ B¤ Ť0@ST x x 0Z J∠ ӄ 删  x 0S00 0 0 x x ,00 0C Q 0A63@ a 0aCAJ Al  4 8 Dx\@` 0tS\t0tS0ct @cc Rx0S `4P` [ hyPPW h7hP P\ O pQxP R00Sp Vn46Sj70Sf t0@0t0 p\0\t00t 0 t @Tt0S|\6 R`U XY` ` @P `0  ! rP `` pd ` ` L <hP Q U00S 0S X^00S \W UbL 0`R h  pPh d`\u d  ePd `  ^P` LL \hdhH`\A@P 00`S P Q  0 cc p 9Y0 _P00C0 x\ 4@5 (Q^ 0*^@ < XKiX@Y 0XK^0@ pP`@@K 0PP< 0 ^ 0@KDPv4Q i^@ K M4 P 0jW_ @K 04~_ $4@ < w_`P-X@X 0]0@@@ K `P*P 08 ,P0@ pP0 V_@P 0]X`X 0I_ 0]000 0@PP 3 P\P  0]@P  0P  0P 8  w9R W8008  000800 hPh 40 820^  XKW`_X 0XKa] 0@P~PP 400 p\00W 1^P@W`?X 0A] 0P@^4P00 000 <1KB] 0|P K &] 0_P0w0S 8p t408`0 \0 @nT/X T   H` 0cS0Ct @4S2+  P` S d '<0?aCoc?`(?yPD??$@@@?<0  c^Db 0@P0 pH0 p S^@P `X@ TP p@Ph  \h0`h`h0  \0Sڈ T@d hPh \P0w9S{ W p100  h\vPh  yPh UvN  \010I 0`l^,0CN@6@cSP` t @t E0SS\ MP\ \h\;Pʔ}P\ W\|P\ xzhtPh mr`lP` rjh0S0SU%`qd o9V00k90000ez0w0S p] X T p`  P` ;h5Ph U \P `:V `>9V X1``8`3 -LTp3 -LTp3 -L0MP T 0 R` BTL X 0X@P0T 00D0 nPPH , 0 ITPPAH0H 0,@p, pP0 `PU`,0D  PU `@R P 0*L@P 0 R000 CZ *0S 0SL0 B@^L :L P H(KH @ <  8 4 8 14pN$P @0`PU`@KPU`D @R @ < P*XP0 R0 0BP *0S 0SL00 A0CRL0 :LP@i 02@ U P-L@ @ 0S@iP@ 0-L@PP 0S0   0S0U 0! !"o3P񟗀 ,<<TTTTTTTlllllll41 01L P 1 1 1 0  10 10 104 10 10Hl0 \0 P0 @0 00  0 ,[hX 0-@LP8"pP(000pP000h0p8QRP000S p-`PPL . US@  0PP@ @00\ \ @UR!000p0@T00p00pU  RR@PP @T@@-@P RS 0P 0 R! Q\00000@ P-L Q T00 Q 0S0S QbP0s3 -0LS \0 0P  0  >0S@  ?0< B<R0LA0 0!88S@  ::S 0T0 0@ -L@\`0P0Q`  RP \  P p|3U 1R 0 S 0 S?0 ^^/0nP  VPPPPT00p0 P 0S 0Sp0CP 0Sp0CPp0 PXH06+@P00 R ! 3R$0P VPP [ -LPp SR 0S40S1`T000` 00R` 0SJ0S`@S @Z`0 d 0Fp> p P` P@ 0 0R @`ZWP0  d 0%p p P @`ZW0P  0 0`` -LM`P4 8  0P0(KZA 8\S00P0P 3 P S0M 80P SV#4pe00 0@SW p@40 0P00,K@p,K W:Nl 0 40 0008 RP P @Q 80@TP 4 0Q,K ZpP4 0 0-0LPM@ dK P6@Kp l 0<K <0 'i0 dK0 HKD0 @0 H0 峆~Xt p-0LM@Pt`U@ T%$K 0K$ @ PPmp 0 S 00 0P0PKp -@L0 0 0  -LpM؀0 s`$ Q $ 0R' Kj@PK  mph K@KpK] 喙p@p@ p  Ӟ0sa P-RL@  ?  000 -- LM 0  M K -ML M@H,  P, PL, H$\4#0$@K$K0 S2d, 0R(KD 0KN@N0,$P Vl 4HPP,Qk`p H<VF``p  @ R@ 0#5lVF ``p0S V`FV:000C0`F RBKII ! BKII KT @D R %RP0mSL %S00T0S0 @D P R@@ L<5V 0FP `aC0S: P 0 (P`pm 0j , pPdP >2lPPKn@1AlA 8 4< <\ 0L NH^6 D 0!kPD@`P  0@,d0a0cK8< 00< @<AA 4 << O0!kVF``pY 0 S0GQ D<|k07S^KPEpPE p 00@ ~^KPEpPE<< 8L :P 0'@P07S v8[$ 0-LM@00 P>P8 -@L w -L@TP`pJ 0 T0#03/70! >\W8?XQd@@0 1T  R#*0B0L!000c00R0nT-0 0@ L 1Z \W@ <"@  0-LMP40@ L0 @K0 -LM`p@P0PP@0  pt@TPPKl( p-L@ P  BO`  0 0 p-Lpd ` <4("4!<SVJ@L@TP0? " !BP <4("4!<0cS ,  < @4( "4 ,\,.<4("4A$<U@%LPU!0? " !Bp <4("4!< 0cS<,$ 00 q 0 @ @p@ 0+Q> -Q  9 00@ S@p 0P@0@ 0P 10@S@0P@ 0@ /P 0@ 0@!00/PP9Pڌ*0aUS RaD040 @p 1 @ l 0\ P0`40  P  p3 Y ppT @@ Su W@PP@ LP 9H A R@PAu 0PP L 5RYO\0So \\NP 89R QH  HK 5@`\L9 PKQ@P L 5T@@4K 0PK@@@P 40S D0XS xS 0@ 00S S  @ @KD0K@P4 { PD @p \ 0g@T 48 PKQP L 0 PK< K80K PD W 80<@cT< <8 <  0 @n0TlT @  07  0CP| + |2 P $ |0  ! cD0% P  D  ! c8P<@ Px  \i\\ pnp  0@Pc@0 d0^0j00n`PU00S0ScPc`c\ x Px   @P  @ iQڄ P  Wڀ P  Vڀ P  Xx Px  F Pt  0St0@ p @x= P00\``V 0 03 0 4  W !0@ 40 X T 倔 <\` 8,  , K00K pP| ,QZ pPu D`R, 010 D PD e 0@S20@DT@ T D9 PD R <0C< 5 A 0 D? PD = 0 0CSv R 80@0T80   Q6` <08 @ STQu "2 IP @P2XKN 1`p P 0P[ 0@N 0XKPO40040 Q80 @cT D PD < d< 0  x | t @<0 R 00SO SI S D 00 @021T0D 40 * 00Q   0 b320PW   x t lP tx 1@P~PW 0` 0 ` p 0^0Z0S0   R 0S NH?V瞯<A?x&<0S0 RT@   0 @ R0 0 @ Q" R  P 0BSچ0R`Ф0PU 0C R.ʈ!00 0@ D@Tj0DPD0C< @8 PD =Pcy^P` c "TPc20S60P40 Y RD0SR@ 0 SJ @DTʳ 2NW @@"2@ P G SH@P  0SMX T ^ ^ ^ 3P 0 00c 0 6H@P@@  CbVڈ3@ h d L 46 56,ʠL0 LLPKh K @N`FVP L L0# "*/B B V L pP@K0D4 ` N@PVpP@ LP XK 0$P40 040 G0P@  @ 0@ 00P00 10@S @0@  ` X T ` @@KDP 0 40 0@ 0(S@@  000 Rc 0SD40 0R  04  @040 Z"00D@@KP @0C@ |P@0@ 0 40 D0 4 9"00@`-A0=@P9U}R@d 6 PKxLP L 0D CbV6@ p l L 46 56,ʠL0 LLPKp K @M`FVP L L0t' "*/B B V L pP@K07 p` M@PVD<0 < *a P@jD2PD K <0d8 < A0@PU <ZD0P 4 "00D\  PbU,D P80D 8  \< ! 0\D0D 0@@P040 Pw XK 0PfoQl.aN* Y!ц00 `Ф Ť W!0040 W R 8D210 R*0s  R*0 s 040 @ T00\0SD0 W {PD 08@100@ @d@P80!08 40 W040 !0Z40 ʘ\00P0SttPt x"P040 ŗژPv <0Db< 8 w^\ 80C 8 ?Pi\0\K PKL\e LP L 0PK4K 0PKD00 P0< 40 RZ!040 s4  4 4 1L0HK6H0 @`y\|\PKL J 0 1SN  @ 0CD0  !08 < 40 D!040  R0S0 DdRQ8 eDIZ |040 qD08  -L00h 0-@PL0 C@0 -LMIPU8 < @0  00SU @  00R@`0`@ `0R 0S)\ 0 \,0 0p00  70S30 R 0S0 0R@@ 0R 00s03p`00 0 00 p8`pQ  0S\P P0`10c , ,0  PR pR 4  V0G000S@Z)0g0CS  0SRP/ 0S  0S W @!`#*`P @ |0S ` Q` `00a W:`@iDA@80BP`Q @a P ,00d,0 8 p0, R80, R@I,0`cU-8  0S; S S- [P@"00F R0 0S 0S0 R@0Sc  0S@[W@FpT p2 02 p 80Pf0@,0 W 8  0S S S @@0,0< 0(K0+S- -S 04 40 ) Q! Q 4AP P\ 0>!0L0P40, Sa ,  4 0C000 0Cp,0 p,0 @000 @e P D21 0 " \  Pppp ,  , 8 0, R2 @"00 0,0 4 R 8  0S S2 R/ %P000.@r`^YPPPF ^ 7OP>W 00S `P T@ 0VP @F R 000@0b@8 0< 0N"00:1 0W 0eP %8 0,  R, @"0S@ 0bVUE P0S 8 00CS"@21 0 02@"@8  0S: S4 Sh 8 0`BPP0 0@0Pr TP0 0Q0 0U f R!10 8 @0< 00S{J R20S. 890\  0@RZR R 000A10  R*0\0Q00Q- 2R  101.Q  10 P *0 BSP*02SP: -LM@(KPp`,K0( c,0 c R0b::p  0G$K -L` B/ bR@pP00RP 0 WP0 0@ P VU  0 B_PP P 0 BV0PP0 U @980"p@-R`1Q0@  0 ^2$ Pd050 ^2$R  0fC1S00p^0^0 0fC1S00p -LM0 10R@# *P0@ @0S Q @K0 @0S" 0      $ ( ) * + , !-" . # /D0S 80 00 00 t|x0-@P 00? b@-A d0.3Ġ Q -LM4 4@00S 0"! 000 004 APP@Q Q00S p ,  QP- 2`VM Qn,X W0#03R0ST WՕ@ `' , P@ Q0Q0XSxS0 S@QPX\ W0#03R0SgZ1* 0Y0*00Y*0S  Z QZO 0AS (K R WՕ@00' 020@ 8 _800S 0 `0320)QX00S400Q" 0R )RP  R0'O0 XSxSa0 S҅@\00 &Z*4 00890S  0 S  -4@L,    h890 -L>` -L>` -0 `R0`LP: 0P10p@ 8!#800"( (!( 0( W"H0 0b1 P 0("( #8!80 P#HT 0Q 10  @P  ! Y  0"1008#8S"("$"""!   88S00000P 00-0 S 100 0C\AP: Rࠓ -0L100`p@PC 0` P0 `6<W05#3̠10W#55 P 256U b>003<0S00S0 0-@PL  QXP0SL 10A00hO4(10 AR 0hp -pL0PS U AT01 0S0 00 U e10SUP@ @T}0eD!<0 0c1S10@0`p -LM@Pp`P# 46 Z(0 6(0 T$@ (K(0 0 @UC>E0C05 `0  C>@0C!0 B@`@ K$KP(0$  `!30$0 0(0 (0S@@0@ -LP`pP@ 0`PhP5 p0!1 0 P`0@ Q Q @P` XP` P *0 @0S@P`YP`00S 0pGS B p -P0 0p -0 0BPU`Lpڂ UP# T  0R010C 0@10 d 040 \2.R P0E00\00\0 -LMD PpU0D0 D 0Pp0 RD0< P@ O < 100Q80 * 0080S10000 !PD0  4 "*, 0S D ,pP`5 J$40  Sp 0 R,00,0 < R 8 0S 0 BS<00S<0 <0@ 0@(K -@Lp P00@ -LM0 0pǏ,0 ɯ0@*"P,` QPp 0, 0R ,0 10p00  0(K<PP0P  00  ! W0 0P 0-L@ODa TAPU/ ` @T P /@P/ `p0S @T 0S PP@ 00p0S |PU 0S \LgPP 00, 10 ePpq -tpLp"n0S \hnTPT@]n`00@XPC/00WUEO00t=\49\ 2-C PbL SPp 0@`U0p(@J0e1P<X WV00P100C/W`VX@Z -LZL 0cP R@P $m 0@@hm -0L R5 m SZ RX@J0S m00 D0 HC/aWQ<m @P $~m$ 0@@@Nt= 0-H+LdM0@0 PV8EDEEDCCEhDFhDhDLE`DDxDECDCDCDCCFxDTECDDDxDCDDDDDDDDDDDDCDpDDDTFCCCCDhEhEDDCCDChECpDCDCCDhED`DCCpDE|EDDDDDDDDDCCDDDDDDD0ED`DChEhEhEEDDCDDDCDDCDDDDDDDhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEhEFEDDL#K0 @KzP# 0 00 ,  K0K0KSp  !" ++@KyP@Kp Q@W0 00K K0K$@0 ,@ WSp P 0 00 , r.0 00 ,  0 00 , 0 0,P@p K00K0K,  @0P @(SpD p! A/0 00 , d z@KyP@Kp@ QpQ P: eڸ @㲒 Ӹ@P X U S@0 0K$ K0K,  @@RpM $@K0D ?G] 9Spj 4qd 0q , i,  -L,Mo,0nD 0Kp0 ``0 庒KPr`P 0@p 00< 8 4 * K0 @ P @0K P2[Sl0  00p5D0 [(K,000@_[$90,0 -0L80 -AQI(I@ITIlI 0$0( ( $00  00  00  M-LHM@0 l p OPh o   p0`d OPPhM `00X04Ka0Slp 0IP@IE04,"401(0($0\` Tp'Pl0p `d X0 T `` \ 8@ X0dKiP <0P 0S`+0h0P (K 0@ 00坷00hH@ 00哷00 |0|@| 00凷h00 @,@ Z P 0, K b@ 0@$9 ~f M0-LM(0 00 PJK0`" 0-@L0PS <00S8H0hH -LME ` , (~   0  0$H0 @08 4K@ 嬐 080P<0X0K00< P   0P  P <00 0 @X@ 0h PX^, 3唠K 0PK 0 M x3#A!B La! HKIP 0 43Q0=A0 AS  R0 0,0B, 0R(KP p$ P0S0h0h0 0-LMP@)P8P 0S 0*8  0-LP@P0 >0h 0-LP@P0 P 0S S 00P 0h-  @ @-0S@ 0C0@ <(4"4!<0  -0S0C0 <(4"4!<0  0 c0 Q0a0  R %3 a 0 0% %  0-0LS@P*00b0 N 00 00 0-0@SLP*00b0 N 00 00 -LM0@S0C0K< 4("4 <0!  N 00 0 0-LM0@SP0C0  KN <(4"4!<0  8 -LPQFM0`,0 @] TC TR0 41 8! 0)p@S810(KOK 0< e@P! M?Kf@P8!ҽ@ѳTK?KS N/K⠃Pij8!彽@, 0R(K081 4A 0p 0ePꣳ@.00<K_K<N/K81 pp 8!+A[`O@ 0-L@PrP0kP fP  0h` -0LM $0 $K K 0-LM@PT :T 80K0! 80KP 0088 0-LM@PT :T 80K0! 80KP 0088 - LR *0R0 - LR *0R0 0-LM@PT :T 80K0! 80KP 0088 0-LM@PT :T 80K0! 80KP 0088 0-LM@PT :T 80K0! 80KP 1[088 0-LM@PT :T 80K0! 80KP 1[088 0-LM@PT :T 80K0! 80KP 1[088 0-LM@PT :T 80K0! 80KP 1[088 -LM0@K0!P00 -LM0@K0!P00 0-LM@PT :T 80K0S00! 80KP 00S0088 0R0-L@ P0PeS S S00P U00 P U  0, 00 0 0@ -Lp@`PP \ 0S 0S \0S 0  -LMpPW *0$0 (  (KP KW0(KP 0$KP (0$@ @0P``0$K -LMpPW *0$0 (  (KP KW0(KP 0$KP (0$@ @0P``0$K -LM0@Sp`P S  KP R `V *V U _M fB00 U 00  HPP  0P@ -L@P`pP @T PU * iU 0SW $B00T WGPp 0l@ ; -L M⠠P@8K0`px ( 0+LP00P0#S  O=( 0R$K聰00 -L`MH\,  0 \ h/00 ß, 0R(K 0|0 x0 t0 p0 l0 h0 d0 `0 /0 (K!0 0a T0c1\Tp q R |K1S q w Yp Rq w Ppw YpZKZK`,K 0S WR `V00P0#S w WV. @T*:0V0) |KPdd0IQ00 h  qG00P,T !R\  B\ yh0@@dI> ?DB> -0LMp,`K,0K@PT HPe 0!00P XZ@`PTZ .T00X0S Z  ,K G -LMpŸ0P,0 P@ P /00<, 0R|(K@@0:T<0 80 40 00 ' D@ >D D@ @Tܧ@ԨDa  -`S00LMV00Sp@ Vg$!V00/0 (! 1$1P 0S] \4 V (!0 R 0(1 R  0>P  R$1 !0$1(! (!0R $1 0 \$1(!$Q(0U  0S (0PS(! : 0~>P (0U$Q0$1}00,1(1 8#0PS  0 P 1S 000^ P 00c0 !000 0 c -L M@  @4 < 0 D0 0 *>P8 u 0 00尀X8p 8pP` 4 0bSE `XPڲ@TT 0 >pPU 0`㲀 XP<0LS8 @ D0fPq8 00014 00 `Pv9(Kp!  P9 ,  0=pP8@00004 gP<Q#ꤧX@8000(K  D0_ P 8 @0008 000,p8  ^ P8 0008 000 L P @ D0P 8000 0SD00 00b0 -RL@1  0hi00,1c00,1 0-LS00\00SP@ 1 \ 00hE00,10?00,1 -SL0@ h-00,1Q  0R (08@l0 0" 00" 00" 00" 00" 00"0Q200" 00" -LM@p`@!  0, S,0K80 4 ( 0 0 R r 1S0C18K0PS U 0`8@$KXUPp -LM0 0`SV  0S 0 0P60,0 K U& , R  Z p1p!@P00W0S W ,@PZ 0 00dS0 PdUP0,0 PU  U 1+#,PP`0 00`S0 (KPU B<B S@ p:  ' U@1 p190 0g @p0 0 00gS0 PdU PPz  0 00PUb UR:,pPG@@Up0@p` 0@T:4P3  00b0 @p@0 K90 @0g Z0 e6P, _  P0h0,0 : .9000PH 0 @00l 90 0e p@0  9000Pt p-LP `V 0@f00T`0T  ,P`@`ʼ0@00pp p-<`L0PS0@Sp p p-@PL ``0S0 P0SpIP 00php -PLp`PS J0SX@`PUZX 0-1L @R P Q. 0 0 0c0 0000  0 P @0P W/0 P$000 08#8("(00B< S 0 t= p-LpM0@8CP`Z0+0 KpKtnP0@: S  Q;  0  SL ( 0R  t p-LM0@C 00   KpK K`4PP h 0 SPP P 0000C0  0lPP9 -L MpP`0S9쀟@T@0S 9P 0S$K$Km9 0@P0ep h0 F00!0C 0@000 p 90S 9px= -LMpP!8 0H!08!X0 P 21CPU@ J 0S W 0S `D@PUZX W00C0 (K `D 4Km78 0,9P Z 4@ 8 t9Z4@S00P @8)xT 00x= -L MXP`@@0!0SG$q@T 0 0S6 0@P0ep0 FR    0000@10 0A " !B 9P@ < 0S9(K 9P @9px= 0-LMTP@T K0 L K 0K  @@6p(l -L@Op 0PT:0q0:0 p-0L @`P 0 N0: 0phFN 0-LP=P/P00@P0T@00:00 -L0M4@0@K0  0RKI, Gt,@R 0S  R@ -L` 2pP @H1B@A01 7 P d7 020 0 0 崜8q -LBMcP< , @$ D4 y8 *5iPx BNK@D@D0"=7 Pa*BnK`FBK `FA0A 04 $3 p ѯ Ci 3yj  02R Pe 0CZBNK@D@D<p`004 0 ^ 0D\1 @<@PZ@$00@_S c4R SQQC 0<8$PHp. 8\ GO00B?00, 0R:(K5P@4<`%0BTD @ F@d : :<0@JBKNN``0( K` 0T 0@@D@:4 -LMp`xQ@ 00 0 0C0``(KSL RK 004 0 64 P 00000 @0000 0 0C0` 004 0Sʆu P80 D0 P0D08#a`V F! D10DDAuD `P{P 1 JȘ00P -P0`@P@`H$HXpL %XJ0@@bH$HBPX%X 0b0C@0P0@ -LM`8 < @0 尀X! 0PSGpᶐYUYS<@ 04 00Q0 V*0 S80f5P7 `尀X0S7 8l@P+ 0S <@0 0 0  Ro< @08XP000808  8 8(Ko p0 S80.5P(KX pp<@0 00S<@ _+@0F@bH $H, @<0@0@cH$H@@ 00,40᷐@< 0 b c004 B  00@00088 8(81840PӞʬ <@  -LlM@ 0  P4P\ (K 04Ph \0` 00h8 #8  x0 R0Pl0 tP Xl 0@Sp pxPp| t #81@x@  |P| R @p8ڰ0SN0 00c ,0 x0K 0e8 K P8 0080 0 c4 t08#8t0 P08#8 ax0 0x 0c |0 lP txP a("( l0E0a0  P\000h0   o\h `t0 p0 \0B8h p#X d @` U*00C8Sr^  08#R0SP%0S <0 D 00SH Ps 0@KH Kp800008 #XR0 S@ b< 00H0 0 cD 尐$\0S <0 D 00SP 9 `@KH K000@KH K@KH KdP XK d0 :PT\  XX Pd d RL P@ 0 8d`p#` o\ 000h0   pP0e0CxP8#8 E `0 0d 0P0d3Pd ` 0d8#8Px0 @ `.  08# d0P`0 pP 7 P#`Q  -LM8 `p@4 \OR4 F 0, 08 DF#8, 0lR8 #X0 0$ 000 儐  bT, 0S0000T 4(1S4 0C(1000 D 0, 0004800C808   (K(Ko -PLp` Q@0@^  Q Q \2PPP0S -LM@`Q 0  P n, 0 00S02P&p(KpP&,P Z 0(10S$1 0 !$1, 8#R0 0  0 pPvp0000S 0_2P  0P$1 0$1 -L  @RPp  R 0 0 0S092@P RW 0` R. 0 S00a0 0S $10 (!$1  0 0S 0 2P  0(1 P$10$1  0S0 ᰀ `1P0f8 (#"  02p 0 S 100 0 0S01P  0`8#@ Ҕ00 -L M@`AQ 0  np, P 0 00S01PP(KP&+P  0 <P   0PP, 8#R0 0 ꁔP00 0-LMP @p108 -LM<0 @ P80K0 K p@P 0(K0,  <K` fP40@ VX 000P`08#8@ P("(000 P0@0< @0P00Q<X000 < 1P0A 8#8 @`0 0 0@<P` -LM`@@0 < L ȠT, ,Ƞl 0 4@ 0Z@0Z` 8  T @PH$HPdX%X g0PC,  ,  d d 080P0`004 0P0C8#Ƞ8 40 S 08 @8#X@eH$H 0908#8 l@0 B 080 @ <00P000 Y 4P4 0p@,T 00BZ ) \ 0 08 Zp,#X" @ @eH$HZ08#8 ` B @0 00@000 00(K@ 0Z0E8#X00 <>, P , 0`00 00C8#Ƞ -LMPႠ ` `("HQ% 0 Rp#p/`P) P 0 0`8#H0S0S 0P  dp  X0,  pP,  -LpP@` 0S"0Q00 0/W@pT? V  R 0B8S`R 00  0R0S00ڲ00000 B! 00C0C0 0 00T00 PWW800C80C800C80R B 0\R! B@-,P  00P  -LpM@.?P0S10@T.0`dY**0VXS'p0WXSpGY:0gSV P@>*00TZ! Z Z KDWP$X@000@0(K RP 0S @ H-Ap@0S 0S@@@ -L @P  - L@p0 S0 R0S 4Q R00B,R S-R+R0S0 C,S R-S+S0SS0SSP0@-P@000L S0!00 00C^00L ST0 0-LMPK@ 0P $"B20b0 :R 8: B;0P  31C 0:S0 P0 00 0-0L-S@P +SPP U00c00 -0LJS@3 MS 00C S00 [?P 0/S 00K0C0  0zP 0.S )0CpP 0.S (0Cfh~J0C0 0[ mE-@`p "2n10!0Tp 0S' S1 S  W43Cc" a*B-B ;\*-3n20!0Tpp0S0$#Bb20a  LZP3!2CP43C" cb PPT1 !/ b21C\c(1@D$"!B Ϡl   B 100/0cN!bS  \@! A!0 BA`10aR0BSB\2l 1C 01 SS Q 43Cc" a Q*gfff$I -LP( <3aL1aa Q R 10bSP001bSP00 -LMR@0 < 1=0 \J02X 1\&0080 4 H&@v0Ca P,p ,&0CqU0K0p P,p0`0g#A@@!F@@dPGP`pPe,` U0%Ϡ2l10!0W03l20!0W00H1U43Cc"` 54ĠL l ?Bc  a$<#B0b8 0l0b"0 a`SQZjmVH4VjF4mFVX(,PK,pP4Ϡ2l10!@ 3l#20W0W1 Z/P 0@0 @(K,pd0#Ϡ2l10!0W03l20!0W001Xa^0@#Ϡ72l10!0W03l20!0W00,KAP 4 8 \20S80 040 1"0080 0L1lb P8U 4 \d2A  Q 0R=0040  0 0R 0 0RA4  R4 @ pPt@0,@PD{ND@D/0C!bb@ae0 B!a10b c@R 0D!0Ϡ0l $ "Bb 1a `34 1Cc@0, 2n10!0P3n20!0P @ 000S @c 1 S@ 0 0 < $ <-E.²ScQ?Q-$Ių R 10bSP001bSP00 -PLU`p@ G'0c0h=' 0R 0R 0R 0R 0R 0c -LM0`pK0`0S\@K \@K< PXPK< P (KTK PPLP%0౨%??0cc( K2"1C0c P0 tP\oPT\*0T0P@,0 05T“_2e10!00 3e#20 0\ \ 4!0\T ʴ<P P@,|4\ )`4T“2n10!P 3n#200P P #1 0cT0 PwTP@,3_.2e10!00 3e#20 ^0 ^  21CT0!0 R b ST P0 <P@TPD` ,0;R L0 v>" 0S` 00P0SP@?0/0U40 4P T4@ 4K  KP" KP- 40S% T UP4@4P0P0 P,:P`00 ;0`0 40S0DT@40 PS4P @Ql0Q4 ? R0#S4K  0 4 P004L1XH1H1000 0 ^ 0 S J"10^=0P\ 0PE0S0 J@0S J"10^=0@0  S K0K 04 n0 PK XPl @0R @D R J@0040 ꫪ*lQn -LM@P`pJ0S 0@-H01=0\J 10S1 0- -MLMPP8 <( 0S` `,0K,0 S (K `V 08 2Q22Y PBKAA 01 R0SJK=0 0( Q(@K1$0HR1(@KA 08008 04 PZ0HTڂK `LLD 4 480H0S48 48DH! !H( 0!L 0QHL8DH @( 1"10 p 縀^8<(,0K @@`v`3d `G,0 S@0 ` 0`v3 c` 0(Zꑋ0 0n P0 0 P P0 0 I -?@P0SL?Q0SQ 1!0 0S d0 R0 R0 R, =0G'p3 -LM∪0@`x,0 a pP@ 0T00 XPP P:U /U .'P JXP, n, 0R(K:UP/U V' P*/\K(PEPE++'+&.&P@ @tXPg:p@ ()PZPUK\@ $(2Q P P\K\^2^*K\?SSTT1 !0C  K0\0, 0KH/0 g0 bR\=P*KH:K`KPH?\K:KPHK`\ KHd:KH? 7KPd  U*K d/T7Q L:K`?KSH*Kd/R 1^:KT00 S50*Kd?KTH/SK0*KT H?KHc KH0S0/%&Pd^&P Ti^:KH*KH/ 0$& ^:KH0 S5ڶKL KH.KH)*KL/KH0*KK SLH Kd*Kd/R3^-  0 KH?K^d  :K\?S0 KH0S0^^-  KH:K\d T@ KH0S0 K`A 0Rb\0S KH 0gcPKH00QXPM0 SN  K` K`P=3@PK`@T 3  P P 00*K`/R JBT3K- KP@X XPE@DJ*KX UP 10P 001K` @0 S 0*K`?Kd0 S/\K(PE PE @P0S 02S@@0 0 \0 0 @0R P;0*K`?10 Rd ^[ 0 S1K-0 Kd @*K`/KR" K`0!S:K*Khd/`?*K0`?1 KhK`:KdK`:Kd?^ͅA2@@^M@ PKdKd2 ^^K(L P @*Kd/00 Kd/Hq(:+ -RLLM`@0<S p@ d0Sg(K@>0 >Sp@ d$(6p@ P1!@,  pP00PUJ <Ua l@ d0S,Sl,0>C00 0q03W0Sh;Q,Qe QpWx5x%0  00@T H50D%  00Q ^ W ş^ @0^M^͆0@, 04 a$0` B0P0 P Z00 P 0 0 Sv p Z o l g;S 0KP_DKPY 0,SVXKPQ Pt Mß^ @0^M^͆0@K=`0 |30 h0 h3, btp \#0l0 BP0Pt03 p`  0 ` dp \0 0h dh@X Kd00T\0` 0B0C@0B0hpp0h h0Ϡ"2l10!0h R0 3l20!h0Q008"1$#Bb20ad Q\0\KS`00`0 \ Sh0,0h0 d 0!0Ta !0!100QP0@D0J0 >Sl@ dn\0@`00A\ 00A[(Q -L@ P  h4 -LpP`8 0S@ t8@ 0V X0(0T=H00(0(0000@P `/  - @L - 3LMPU$ @ 0S" 0^( 0^N010 2 b B/#b0Ca"`0c(0 (0Sf%0S$\>^- 0 SP 0Q^M@  0$K @$ 0 !0 1( K 10 ^( 0^!0n0C?t3c Ba`1"`( 0^\  0! 0^ QA!01"1,010 Q(K ^X $0R0@0@!. B2!Nc0@0@!. B2!NQ"Y`X -<1<`8!VL C 0S^͆®]P !0"100 !0S X @pP!P_0@0XZ]PpZ0^=0 @!PpDo!P00Z$000X`+8 -tL0Sd@0 0R  Ph,0pmP/ -@L&7h#7 0-8L}@PA (Q0S!P2 h!PP+P0S. \0   B,0hE PxP 0:S  `P 0,00h, P,/ 0-4PL@6  @60 P0 0 p-8`LP@6 *@6p -@L6th6 0-LM KG0PK@@%A0@`TK0@@@ 40@`T0C@@D@ '0@`T0 -LM K@0` -L,M@<K K -,L@, 0E6P h -,L@, 046P h| -Lhj Q Q0!0a0PR- \1,0l00 ?\0 00R- 0bR R ?R0̑03012<000QS@-@  \0l 1<0̠ \ L ?\0 0@@\ P T  0 0-R ,0l0>-S0c012 0 00 S 200 0 3# R02 P0 0 bQ B2c0 @- @0cR#3n\0CQ0C2 d  l0p@- HXH$H%X!! a. $.ȌT2Vh`@pP1#3P1 <2PQP3100QP3100Q#2QPP ;; ;Sq0 P0-9XpTP@ U` V( 0@0000# p-L`P@@@`@p -LPP@`p P B`B0Q40A"A`R0E0U0@ EPU0r @0P 00`04S0`P0  0  ld -X1L0ps3X@@`S P S `8?SPQ QU 000@U000#? 0S`Z?45VCq00ࡣ0aS S4#0C@@PUQ @T@Phl p-`LP@@!aph -L@P0, 7 `p P  0G`pe -L@pPe P eL -;PpLg45^@càU WN^a lAi^<.0n0ðVU, UPp V* f(\\0"?DE iW U0naS S6#0c``< 0S00O@`V`hA-;P`f45^@s àU VNŒ^ 2 0N0AA A^<.0n0ðWU U ?1"C 0\ A<V U0nrS S 7#0spp\?DE pWp/R 5/R 1 -p!   PLP` &:::S@ W 0@ 460@ P S460 PXP -p!   PLP` &:::S@ ?P @ P0@ 000#460@ 460 W V  RXU -p!   PLP` &:::S@ ?S@ S 0@ 460@ 460 W V0 PXU0 ;p-@TTLUo Z~T 000p54 "d a3000V `pT00U0SpP |Vpl;0 S-L@ ;0S P 0045S P [45S PP;0 S- L ;0S P P0045S -45S %R 0#03P;0 S- L ;0S P P 0045S 45S R 0#03PPPO? ` H !:0-LʠʠAL@N$^?&P@)0\^.0n04.U`U00P00S R 00000\ U0 0H0\6n "30  0000l -;L0M^P( $ 堏' ^ (P=O*1@@^ `0OO0   K\0O/ $K( K,$N$ \0O/@0 P0@00 ,@ $p4 < 8p PK4B0 ^0 ?^4@^ @T@0X0@@`" Ѝ) Z 030#0Z& ` 0 `0O PO ` P`` ЍG"04C0X0 Y ZnfQ&030#Q0516!P&030#0O/@0  Q ?Q 063UP030#&@Q `V`UP&0 A030#& -顏OLMX`p P  -顏OLMX`p P  -LXMt p p`| x0 x&Jᄪ.J`pDE媪ZoO`&l` t@|`8@ 4 , @` < 0 P d^ ^P 0 0(p(K |@K0 K<0K,Z48l p0O჏8K, K40K,8@4@<0*6々/00 E cXh 8@ 4 Šh0O⨀8@ 4 h  @ < @< @0"HXH%X$H\0 #Ƞ 88#8! Ƞᑃ.,Ƞ\d  D X c.D ᑕ,$.( 40T 2VD0gh`.8C \0C2 8\0CR0CTbP0CX`SdH ZHX \@ 0 3 #Z0#033#d` `FH d` JX H ;#;S` T<h)XX&h@%X (,8 ("( 8ᐂ.#8T Ƞ,ȠL r.L0P ᐖ$".H`LR20cWxp,8C T0C2T0CRZ0C2 aP0C X@S b`ZPT03#030# 3 #```F@ `` J `00` d`:%5ʠlhp` ^ l 0O/@0pl p 0O჏00 T030"S  pl /O p -LlM  ` 0 &J,JJJ@ 倠HD `^oOP`&@px` P`8@ 4 , @P < 0`  @cT ^ x 0O8K, K40K20^ <@ xP0O@K0 K<0K0`` 40@6|0 8<0 6*(|x("('x*D0 ,XX%X8`h0 D0l |`#Ƞd@ H Ƞh`.,Ƞl& `0 ld0!$Hខ(P` <#``X0 a&8H0 \` H` j&t p` X`P h(T` `g&T\唗)L xHp(Q2Pt.!8l@|T!LP\ 0V02PPhV0*(d`X^ 2\H@` V\`XP\xp*T3#0 Y2 Y 8 S030#p p,0Q0WC)*D@tP|`x 0<@ @P 4` (K%V! 0! 00 x  0O/0X@? ς^p x 0O/ -L,M0PPp,0 `1  9@KR0! 蠟 R0!  0ĀH 0P0 0    0@ypV@@, 0R(Kv00 <vpW00 h(P  -0L@H $0(P H h  Q *0S00S0 Q -LMTp,@KP` 0  "  0RKȤx -0LobfrgRBQ Alnn  `` @`Väp"d@`FT00æ?d@D`R ?V00S X W  40W  $@0iQ8$ -LtM` \, Pp *: 0 0 plh*d: 0 p l 0 U 00\ %\z^pTQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQxTQQQQQQQQQQQQQQQQQQQQQTTTUQU UV WQQQLWQQQQlWxWWW UWX(XLXQQQQQQpXXXXYQ UXQP0 U  ^00U#3   0 P[ p-0L@0  0$RP`@) I2#8# c .@1QS P00S 0N!QR P00S\Pp80\ -L M 0`^K~`r@P x10鎠:p@PJ XT0 00 Q 1p\ ,&("(30b,>0A!0 S00Q8MP& 01C0 0 @0 0 (68#8# cN(. 0B 0S   00C 0(K  -LPM0d(0  @0P ,0 U U  UXh@K? #P$ K0DPCM0SJ @<0C>S񟗶(fXf8fXfXffXfXfXfXf ffeXfeXfXfXfdXfHgXfPD |s00l0 R 0Sp 00 8`,弞 |=$pP?x ->0>0L MS`4 0  (Ko?24, !Q, p0B0c, R,c0 S*0r 0P#R R * 0000#22Y1 (",0S* px 0t0 R!p00b b0 p0x 00h0Yp ,0S0C 0Q@t0S x0UKP t`1, R B0 A0t0SP Pt0S P00AU00, p0S(K0pS( 0S 0 0t ,xp00p0, U S(Ko04 KPh 400a0ym40 9 04 XC0<   Ld| -sLP"`P *"*R@ R@  B0B Ts0STD3 R8C0 S*(3  0 ""! ttXPUV P 2@` 0 S A00C:#:30#" 01#e3! Q1(1"(@0@R!o 1S$ R000 !R 0S *l1S1100S00@@( 0b SP1:U xiR>0N@ TK: X>0N@4 0( 00b00!S 0S  |i/ic  Vii(  b R 0@@. @0N(@a A P 80     -L`nVp P0S0 @0T  @00S0 h0 0CR0 }np <0< @80T 0S$hU p$  0 -LMX`0 0&P,  8=>0>0S 4p(K80\>0>0Sp0(VUeB0 Ss*0帢 0p#r R k* ,0000#22P~ @ 00 1@tpW x t0R% U0QZi 0 0e6RpAC0SJ ,0 e Sp00ep0<0S 0S   0|S70S=xtp0, 0eRp000S 0S  (1@P026pp{ !000v D   h ^A 5  v Z PA h0@P05pD p000p ,0RA$r=P   \ - PL M8 P6(0:CZ*`>0N&@8 ppe 0 +PP6(Qx0PSb ( a R^*0S98:b0Qp 0S(K0 0(RC 0JS1p00@`V 0R 1%S@ U0 S*5 00#2 @T0N@$20!0RPp"@^@Z p 0 #2 p0p080Q$0S 80Sb (0c f058#Ƞ@^@0000!1 B("(0,R1!Q000$$00c02!0QB !R 8p00Q00Sg Ze u`p# 1lp 00Qa  PxlP3( 000/di(  bQ< p4 p4 W:370#2000,0 < 0, <0 `00V00 u Q000, +0V 0a WI< !q114 4P^  ,20 B0R ^ ,"   0 ^ @@Q@0`4@00@`0#4 0  a(0 c:37 '8#8!1q14  kp 0044*p@ 0P0N4p@  0,00 P 000S0@00P@0,@0`a4*ZQ0``w<`R   l  -LM@8 `kDppTPPU4 @#0SG"0S2 䒟00S0 k@k4  (K$0 T,0 p(0:CVH*`>00`  Tn`\:WZ0TP0 0/pP$Bf(Ql0 "S- ,0SV (00 c b", p 0dPP `< FP<]phFPS|!U00d0,k 00D1 0R0C0U k4 @ 80P 0S  k 00 V!1PGPwo(  b jP 00a vP`( 000H< ,px   P?  -LP`jLq0S<<.0 N. @T, D *Q#Dp,0pdS@@p <@ 8 @0 ,00@S|0<0 t@ Q0Px0640 EPt8px p080bp0x040h0TpW'  3@P TUX0 0CR0T iH(K/ZJJJJJJJJJJJJJJJJJJ }J xJ sJ nJ iJ dJ _J ZJ UJ PJKJFJAJ=Q:Q:Q:Q:Q:Q:Q}:Qx:Qs:Qn:Qi:Qd:Q_:QZ:QU:QP:QK:QF: QA: Q<: Q7: Q2: Q-: Q(: Q#: Q: Q: Q:Q:Q :Q:QA ? QA ? QA > QA > QA = QA = QA < QA < QA ; QA ; QA : QA : QA 9 QA 9 QA 8 QA 8 QA 7 QA 7 QA 6 QA 6 QA 5 QA 5 QA 4 QA 4 QA 3 QA 3 QA 2 QA 2 QA 1 QA 1 QA 0 QA 0 \aBC`B0QA 0  -L@ho+a3*+I@-PP@p0`V 010P T \ 0 S  ^ 0^\0=S P0fC101 -LM0 S=S  0S=S` K@-Q:@- R (2 R R -PPPP RrPP B PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R@- RP1P P1P RrP1P  B P1P B@  R010 1  B R0q0`0q0`0q0`\0q0`0q0`0q0` R 0\6 R B0@-81, Ġ%̌T$\D#L0P  R0@ Ġ01#̌  R R B0@-81, Ƞ%ȌX$XH#H0P  R0@ Ƞ01#Ȍ  R R B0@-81, ̠%Č\$TL#D0P  R0@ ̠01#Č  R -- L^M⼠0Q`(0 qOoK`FppA@O?KC/MKl1 >0*NϠ80* 0 0C0S2-S0!1!@-0@0 @0!00  -LMAPTpm V R0 X 0W@ P  ~ 0xAV0KP -LMR`  PU 0SPR U< 8 % ͆0! Q0pPP(K0 13 B1 00 0<0 8 010s0380 PU4 q 1S X!0R00S,  0S X 0SRQN 1SK 0 @ T0{ 0S00S\t@TG 00B Y > 0 1P0  @0 @, @' Y$0 S ಐR 0P |t0Px  p, lPg  $1S0C1, 0R00001p0q =W0 pU 80x03 >PJXG<4 001A  0 <30 BQ 1 11  00q ͆0! q0pq5 !D00^ 0 0P QK -LJUsage: %s ..., where is one of: instbin%s: %s not compiled in mount_cd9660dfmountmount_ext2fsarchsyncnewfs_msdossttylndisklabelpaxtarcpiofsck_ext2fscatifconfigsysctlrtsolping6datelessmoremount_nfsfdiskgrepfgrepegrepumountmount_msdosfscksha256mknodreboothaltmount_ffsdhclientcpgzipgunzipgzcatchmodchgrpchownfsck_ffsnewfsrmmtejectmkdirksh-shbioctlsleepmvexprdmesghostname Ѝ$(|~0d@@80<4@DD @@H\PXunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs cannot be zerocbs meaningless if not doing record operationsbuffer sizes cannot be zerobuffer sizes cannot be greater than %zdseek offsets cannot be larger than %qd%s: illegal numeric valueunknown conversion %s%s: illegal conversion combinationcbsconvfilesibsifobsofskipnoerrornotrunc%s: end of device%s: short write on character device%s: short write on tape devicefiles is not supported for non-tape devicesstdoutinput bufferoutput buffercase conv and -DNO_CONV%zu+%zu records in %zu+%zu records out blockblocks%zu odd length swab %s %zu truncated %s %qd bytes transferred in %lld.%03ld secs (%0.0f bytes/sec) skip reached end of inputmain8D,PT\hpxusage: mount_cd9660 [-egjR] [-o options] [-s offset] special node session number is %s: %segjo:Rs:realpath %scd9660%s: Filesystem not supported by kernel%s on %suserquotagroupquotarwautoaccesstimeatimeexecsuidrdonlyupdateneedsdoes not need-o %s: option %s a value-o %s: option not supported%s: illegal value '%s'usage: %s [-hiklnP] [-t type] [[file | file_system] ...] df: %qd: %s 1024-blocks 512-blocks%-*.*s %s Used Available Capacity Mounted on Filesystem%-*.*s %*lld %10lld %11lld %5.0f%% %s %7s%-*.*s %*llu %9llu %9lld %5.0f%% %7llu %7llu %5.0f%% %s %-*.*s %s Used Avail Capacity Size1K-blocks%-*.*s %s Used Avail Capacity iused ifree %%iused Mounted onempty type listonly one -t option may be specified.hiklnPt:-h and -i are incompatible with -Pretrieving information on mounted file systems%s is not a local file system%s mounted as a %s file systemffsext2fsprmountmountfsmainnfs:@ufs%s: fstab uses outdated type 'ufs' -- fix pleasemfs%s: fstab type %s != disklabel type %susage: mount [-Aadfruvw] [-t type] mount [-dfrsuvw] special | node mount [-dfruvw] [-o options] [-t type] special node -o%s,%s on %s type %.*s (%sunknown flag%s %#x, ctime=%sv3v2udptcpsofthardintrnoconnrdirplus%s%s=%dwsizersizerdirsizetimeoretransmaxgrouplistreadaheadacregmin, %s=%dacregmaxacdirminacdirmax%s%s=%lu %smsdos%s%s=%u, %s=%uuidgid%s%s=0%onowin95direxecnorripgensextattprocfsversion %dlinuxstatfs %s on %s type %.*s: %s already mountedexec: mount_%sfork%s/mount_%sexec %s for %sno mount helper program found for %sforceAadfo:rswt:uvrqnoautogetmntinfounknown special file or file system %s.root_devicecan't find fstab entry for %s.%s has unknown file system type./var/run/mountd.pidsignal mountdasynchronousasyncexported to the worldkerberos uid mappingNFS exportedanon uid mappingexported read-onlynoatimenoaccesstimenodevnoexecnosuidwith quotasread-onlyroot file systemsynchronoussoftdep/usr/sbinmain8D,PT\hpxusage: mount_ext2fs [-o options] special node o:specified device does not match mounted devicefilesystem not supported by kernelmount table full%s on %s: %susage: machine [-a] usage: arch [-ks] machinearmisharmOpenBSDmainľ@@Ⱦ@h ̾pоp Ծp ؾ` @  $%s: no default %s%s: illegal %s%s: bad %susage: %s [-N] [-a FAT-size] [-B boot] [-b block-size] [-c cluster-size] [-e dirents] [-F FAT-type] [-f format] [-h heads] [-I volid] [-i info] [-k backup] [-L label] [-m media] [-n FATs] [-O OEM] [-o hidden] [-r reserved] [-S sector-size] [-s total] [-u track-size] special [disktype] %s: bad FAT typevolume ID"*+,./:;<=>?[\]|%s: bad volume label%s: bad OEM stringbytes/sectorsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorsfile system sizesectors/track/dev/%s is mounted on %s%s: block devicewarning: %s is not a character device%s: unknown standard format%s: can't figure out partition infoioctl (GDINFO)%s: can't read disk label; disk type must be specified%s: unknown disk type%s: partition is unavailablebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %u-%c is not a legal FAT%s optionblock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectorstoo many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) bps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs=%#x bkbs=%s: can't read sector %uNO NAMEFAT%uBSD 4.4%s: can't write sector %u160180320360720120014402880 $( P08< DL T\ d Ehlt: (08 @ H#P3X#`3h2p3x3#@@,I@@ $ , 4@<@DLT\dlt|  $,4<DLXdpx@@@@     @@$,4 < XC$DCLC$TC\ht  @@ $,4printmainoption requires an argument -- %sundefmaximum option value is %d -- %soption requires a numeric argument -- %sdiscarddsuspeofeol2lnextminquitreprintstartstatusstopsuspflushrprntillegal gfmt1 option -- %sillegal gfmt1 option%lxcflagiflagispeedlflagoflagospeedgfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d TIOCSTOPTIOCSTARTTIOCSETD%d %d rows %scols %sillegal option -- -%scbreakcolscookeddecekeverythingextproclcasenewoldostartostoprawrowssanespeedttycs5cs6cs7cs8cstopb-cstopbcread-creadparenb-parenbparodd-paroddparity-parityevenp-evenpoddp-oddppass8-pass8hupcl-hupcl-hupclocal-clocalcrtscts-crtsctsmdmbuf-mdmbufignbrk-ignbrkbrkint-brkintignpar-ignparparmrk-parmrkinpck-inpckistrip-istripinlcr-inlcrigncr-igncricrnl-icrnliuclc-iuclcixon-ixon-flowixoff-ixofftandem-tandemixany-ixanydecctlq-decctlqimaxbel-imaxbel-echoechoe-echoecrterase-crterasecrtbs-crtbsechok-echokechoke-echokecrtkill-crtkillaltwerase-altweraseiexten-iextenechonl-echonlechoctl-echoctlctlecho-ctlechoechoprt-echoprtprterase-prteraseisig-isigicanon-icanonnoflsh-noflshtostop-tostopflusho-flushopendin-pendin-crtnewcrt-newcrtnokerninfo-nokerninfokerninfo-kerninfoxcase-xcaseopost-opostlitout-litoutocrnl-ocrnlolcuc-olcuconlcr-onlcronlret-onlretonocr-onocrtabs-tabsoxtabs-oxtabsonoeot-onoeot tablet disc; slip disc; ppp disc; strip disc; nmea disc; #%d disc; ispeed %d baud; ospeed %d baud;speed %d baud; %d rows; %d columns;lflags-extprociflagsoflagscflagscchars%s = %s;%-8susage: %s [-a | -e | -g] [-f file] [operands] -aefgaef:gnot a terminalTIOCGETDTIOCGWINSZgfmt1illegal option -- %stcsetattrTIOCSWINSZlinkitusage: %s [-fhLnPs] source [target] %s [-fLPs] source ... [directory] %s/%s%s: disappeared%s and %s are identical (nothing done).FfhLnPscmplabelduid_parsegetasciilabeledit$mpsavehas_overlapgetuint64editor_allocspaceedit_parmsedit_parmseditor_resizeeditor (:  @ @@  @(@ %-@(:  `N@_(:@d(: T$pop [[[[[[[|[[[[[[[$,08@0HPX`hptx@@,( (,8,,Pp0t484\s6㿂;{v&tDZI{ "UN{$8;d"@g߿9~^׺|qq^llW[Uw-kUyPy;N&o_&/w%gOa*Y]M$7eLH:YI{L_SNoer'm0 Zgjֵ5Ʌ`/O2yKerߝһx N)V[( )62Ga_*8j뭳% iA !Ro-6AL/60ΰyUFæ bZt]WZE$H XL&5+UoX*e~Ъfq% lWQu2b@1uЋo{Uw8tdٰ3pF< deۂZVgvVӽF?>0O~":7 +}BdFp'_X,2=Kdxsg? 1uUߨڠ&xc&{%Ǔ &X.q?ʵA]E ӽ7BK1ۥɖ`[270벺-yo doz4 8$3٩eB-tUQb{VTpeFӹ5͒D'fI(g1 &&M ^6_VV71\U+2ֲ2pz=f'&6Bz_t a*}lA(J#\Pުk_g QR傅o?o \c ZچOܻoYUII[LiM6 cfMaizbj&߬&z܇ĸ=b&K_syPI@M'@!#VDzGC]Gռֺ7#Z1#VP"1>h¶j>$@h WӉal0.|+662FI}ByPyN'38D:: rT EI܅Z=o}Gg#k8SYjOQͬ~SȀ>tKH(4.|d>Vnt,v";*+4f9kHߺպA禶MzvRb>@VAb{oCal0yfj-9+Ъ'%*ǍvrY q6!p,Z)l";.A+Urِו:b@%cpW]& ZeKĊBaq0ezRp`V# Yv~%lZTBg骵oϑ.&Bx!bFz X8 #  O4=ˆݛ5m0 &Fs;JJe9А eI++m>l $c#DE`ـV]|EEI՚հ0nY I I><ɼjk8=L-܀Zs37]ER6h yA+[p'`5jIj9;e*Oٗ ]G?X&glݘb5sWEsqT8`'L7*'teՋx.?R (Xb ~ LrTy,`C@ &{dC]oui jёf* V-}|`c,չj*´.'p8&-iGղny%@Sk|wV&@.c2`W[=Fޚ]v[b0ΧblXgbx5V4Qp,HpU|C`wgRjZ=99{(k8QIIŨ\]]EFgf$bh+姺vl^>iEP[\`ZպRq]%]Dag}Kؽc]kF`jQmlVP"OZ #c +LzsUP` w}aWMvەm;Zy@K\ '7 +.ܹ2NssޫEr8&"!%EIq42 Ӻ USZ'y#d0 1y,ܙa+4?.@Ņyr_14g]X7*84ξk2g(W1Ȓʷ8PɭFW( ήa}])L#~ P.Ӵ^/rdAz.va˃))a~+$N^RR$#2,kpB~2~\\S}Jb4 ]يR8 JQ`2RnYI|*Bb @b< Q}}kXy\Ey=LpqK Gm'@A]Yq !  x1rZ Y bR# Vjhr+QYr<bu?,#g;2o~8300Jbl’%oAC\.qsrN%$dbpu3t^-O/vf dhx*hĈU/LC{=!/ʪܧv(as J0H!o[~4 HYP5 HU uh!~Q˩+2 QFXnd|G R3fϵYֳT>\_ <x'!OɧHY0.$%=:X˜\CȤ`3cF잧WlISzS;u]OBIb@Q͛!(C9j(0 ]np &-@-Q=/,R7LJoBy sVLDAL. B8 MZ\ In["&Cfʮ_ebF+Z13r YUG+is3w+-X8%OīԿFq"wyW$6aֲh5mmOP]pvҗ_lt8l}pI؆pF _ ({iX[71* u[M]CAL;.A],Lf5BcLkx#٦4͛,u=vޯ\ON2~(B."I]jviB ȤPj}~efkí]8Jȓsl l hTm.[w t]+mQTvNKIG {|Ֆ=>vHLx0lf<ֵ !''Q3?S:S b* cL{(b+C]M9*u+Q]Õ¤u)AbGa81j#|DGd{mLJy(unV4"< "}^I0"hBblf֬9}z~AƔ]H?[ 9l:{ `i0.[3~*ϕd d"Fc!ZүpfFxu?hﬔ5?:0d ΜΛ㚖rw4 &9<ߞ\$ܷ%6C9 lhXn#f AVª+ rpsCh1xMG>oy`E| o7n/r%b$`t(z'A:fX' JhQԏ;38ϓ3Ayp[86SEKf4eÒ$N`hcE|4SeR0ke>jŠ.$U˸ҏYH) ]^"N CU߂D&|C%a'x0qT+]pnhߩ@dX+9 F#%FtY]ܸj\/H\|FI)Yװu$(פ򎡟jސ`Y,}del!~8o|0{~6O_O ~5:kje7uD怉?_˅pاGC+D<>q0|֙p=rz|ZWIȿG_<ČIzt8W0(9SrrgχVς'~-3ݪmz&pyMțg#]-y ޚOa;)yxoԔDLe`9o#4vC_ P ВN6GGG՘[af3pc0,)*WB¸zW)vE|g;b0q؉[]@ck[k'FVr0!.?5cBkN>ZQ6)R?`hF~C);H5i(9AsAtT`{(1R´ؐu)}\ U$?d|IkjCfCn#}k:# \Wċml^>Qoe2'2in#}glK`g%^Z80N[KRI:}ir P6RV*cQ#ڰ@eNJVkiή+oXnK^B[|'L\ _]\~zi8w~0wFp9iB,N:6sMtI]8P4c3yC1F;JKF\xfS?2-: `<ݛij3U^ΉY;;!p^/2.=g'_ܧ+/(лLkf&uÿhwꆚUzyO=2IMӣ@#HRusage: disklabel [-Acdtv] [-h | -p unit] disk (read) disklabel -w [-Acdnv] disk disktype [packid] (write) disklabel -e [-Acdnv] disk (edit) disklabel -E [-Acdnv] [-F|-f file] disk (simple editor) disklabel -R [-nv] disk protofile (restore) `disk' may be of the form: sd0 or /dev/rsd0%c. `disktype' is an entry from %s, see disktab(5) for more info. /etc/disktab`packid' is an identification string for the device. `protofile' is the output from the read cmd form; -R is powerful. For procedures specific to this architecture see: %s fdisk(8)sector size %dsectors/track %dtracks/cylinder %dcylinders/unit %dboot block size %dwarning, boot block size %% sector-size != 0super block size %dwarning, super block size %% sector-size != 0warning, number of partitions (%d) > MAXPARTITIONS (%d)warning, partition %c: size 0, but offset %lldpartition %c: offset past end of unitpartition %c: partition extends past end of unitwarning, unused partition %c: size %lld offset %lld # line %d: syntax errorunknownIDEESDIline %d: warning, unknown disk type: %sbadsectvendorline %d: bad flag: %sdrivedataline %d: bad drivedata %s%d partitionsline %d: bad # of partitionsduidline %d: bad %s: %ssectors/cylindertracks/cylindercylinderstotal sectorsrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekboundstartboundendline %d: bad partition name: %sline %d: too few fieldsline %d: bad partition size: %sline %d: bad partition offset: %sline %d: warning, unknown filesystem type: %sline %d: unknown field: %sVISUALEDITOR/usr/bin/vi%s %s/bin/sh%s: No disk label on disk%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of disk%.*s|Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:nc#%u:sc#%u:su#%llu:d%d#%u\ :p%c#%llu:o%c#%llu:t%c=%s:t%c=unknown%d:b%c#%u:f%c#%u:Bootstrap doesn't leave room for disk labelioctl DIOCRLDINFOioctl DIOCGPDINFOioctl DIOCGDINFO/dev/%s%c%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx.aioctl DIOCWDINFOunknown disk type: %s %c: %16llu %16llu %c: %15.*f%c %16llu %7.7s%7d %5u %5u %4hu %19.19s# %s# %s: type: %s type: %d disk: %.*s label: %.*s duid: %02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx flags: badsect vendorbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %llu # total bytes: %.*f%cboundstart: %llu boundend: %llu drivedata: %d %hu partitions: # %16.16s %16.16s fstype [fsize bsize cpg] offset # Notes: # Up to 16 partitions are valid, named from 'a' to 'p'. Partition 'a' is # your root filesystem, 'b' is your swap, and 'c' should cover your whole # disk. Any other partition is free for any use. 'size' and 'offset' are # in 512-byte blocks. fstype should be '4.2BSD', 'swap', or 'none' or some # other values. fsize/bsize/cpg should typically be '2048 16384 16' for a # 4.2BSD filesystem (or '512 4096 16' except on alpha, sun4, ...) No changes.re-edit the label? [y]: bckmgtBCKMGTValid units are bckmgt ABEf:F:hRb:cdenp:tvwSMDMSCPold DECSCSIST506HP-IBHP-FLtype 9floppyccdvndATAPIRAIDunusedVersion6Version7SystemV4.1BSDEighth-Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSHFSADFSNTFSUDF-cTreating sectors %llu-%llu as the OpenBSD portion of the disk. You can use the 'b' command to change this. OpenBSD area: ; size: ; free: # %16.16s %16.16s fstype [fsize bsize cpg] Can't stat deviceAvailable commands: ? | h - show help n [part] - set mount point A - auto partition all space p [unit] - print partitions a [part] - add partition q - quit & save changes b - set OpenBSD boundaries R [part] - resize auto allocated partition c [part] - change partition size r - display free space D - reset label to default s [path] - save label to file d [part] - delete partition U - undo all changes e - edit drive parameters u - undo last change g [d|u] - [d]isk or [u]ser geometry w - write label to disk i - modify disklabel UID X - toggle expert mode l [unit] - print disk label header x - exit & lose changes M - disklabel(8) man page z - delete all partitions m [part] - modify partition Suffixes can be used to indicate units other than sectors: 'b' (bytes), 'k' (kilobytes), 'm' (megabytes), 'g' (gigabytes) 't' (terabytes) 'c' (cylinders), '%' (% of total disk), '&' (% of free space). Values in non-sector units are truncated to the nearest cylinder boundary.%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx.%c%s%c none swap sw %s%c %s %s rw 1 %d failed to sort partition table%s: [%s] [d]isk or [u]ser geometryEnter 'd' to use the geometry based on what the disk itself thinks it is, or 'u' to use the geometry that was found in the label.Command aborted BIOS geometry not defined. Note: user geometry is the same as disk geometry. You must enter either 'd' or 'u'. noneWhere to mount this filesystem (ie: / /var /usr)'%c' already being mounted at '%s' Mount points must start with '/' The disklabel UID is currently: %02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx The disklabel UID, given as a 16 character hexadecimal string.Invalid UID entered. partition to deleteThe letter of the partition to delete, a - p, or '*'.Partition must be between 'a' and '%c' (excluding 'c'). Partition '%c' is not in use. partition to nameThe letter of the partition to name, a - p.You cannot name a filesystem of type %s. can't get mem sizePossible values are:"IDE", "%s"Disk typeWhat kind of disk is this? Usually SCSI, IDE, ESDI, ST506, or floppy."%s" is not a valid disk type. Valid types are: Error, partitions %c and %c overlap: Disable which one? (^D to abort) [%c %c] %s: [%llu] %lldRounding size to cylinder (%d sectors): %llu FS typeFilesystem type (usually 4.2BSD or swap)FS type (decimal)Filesystem type as a decimal number; usually 7 (4.2BSD) or 1 (swap).Invalid entry Unrecognized filesystem type '%s', treating as 'unknown' Size of ffs blocks. A multiple of the ffs fragment size.Error: block size must be at least as big as page size (%d). Error: block size must be a multiple of the fragment size (%llu). Align partition to block sizeRound the partition offset and size to multiples of bsize?Rounding offset to bsize (%llu sectors): %llu Rounding size to bsize (%llu sectors): %llu fragment sizeSize of ffs block fragments. A multiple of the disk sector-size.Error: fragment size must be a multiple of the disk sector size (%d) Zero fragment size implies zero block sizeSize of the partition. You may also say +/- amount for a relative change.The size must be > 0 sectors The size can't be more than %llu sectors, or the partition would extend beyond the last sector (%llu) of the OpenBSD portion of the disk. The 'b' command can change this limit. Sorry, there are only %llu sectors left partition to change sizeThe letter of the partition to change size, a - p.Partition %c is currently %llu sectors in size, and can have a maximum size of %llu sectors. Starting sector for this partition.The offset must be >= %llu and < %llu, the limits of the OpenBSD portion of the disk. The 'b' command can change these limits. The offset must be in a free area. partition to modifyThe letter of the partition to modify, a - p.No space left, you need to shrink a partition The letter of the new partition, a - p.Partition '%c' exists. Delete it first. Starting sectorThe start of the OpenBSD portion of the disk.Size ('*' for entire disk)The size of the OpenBSD portion of the disk ('*' for the entire disk).Changing device parameters for %s: What kind of disk is this? Usually SCSI, ESDI, ST506, or floppy (use ESDI for IDE).label name15 char string that describes this label, usually the disk name.The Number of sectors per track.The number of tracks per cylinder.The number of sectors per cylinder (Usually sectors/track * tracks/cylinder).number of cylindersThe total number of cylinders on the disk.The total number of sectors on the disk.You may want to increase the size of the 'c' partition.Not enough free space to shrink by %llu sectors (only %llu sectors left) partition to resizeNo such partition Cannot resize spoofed partition [+|-]new size (with unit)new size or amount to grow (+) or shrink (-) partition including unitAmount too big Partition %c shrunk to make room No room left for all partitions You need to specify a type for this disk.can't run when there is partition overlap.No 'c' partition found, adding one that spans the disk.Label editor (enter '?' for help at any prompt) unable to get default partition tableThis option is not valid when run without the -f flag. PAGER/usr/bin/lessgunzip -qc|%sunable to execute %sIn no change mode, not writing label.No label changes.Write new label?Write the modified label to disk?unable to write labelResize only implemented for auto allocated labels Free sectors: %16llu - %16llu (%16llu) Total free sectors: %llu. FilenameName of the file to save label into.cannot open %sOriginal label and mount points restored.Last change undone.EnteringExiting%s expert mode Unknown option: %c ('?' for help) /tmp/var/usr/usr/X11R6/usr/local/usr/src/usr/obj/homelfsadosntfsudfsdrzwdFLOPPYxdhdCCDVNDsvndar_revar_drainar_nextlistextractcopyarchiveappendbcpio_wrvcpio_wrcpio_wrcpio_endwrset_crcnode_creatls_ttyls_listabcdfiklnoprstuvwxBDEGHLPTUXYZ0rep_namemod_namerep_addsig_cleanupadd_dirchk_ftimeustar_wrtar_wrCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specForward positioning operation on archive failedCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Reverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Tape drive unable to backspace requested amountUnable to backspace tape over %d pad blocksUnable to backspace tape %d blocks.Failed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDUnable to truncate archive filecould not pipecould not fork-dccould not exec %sFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed chdir to %sFailed stat on %sCannot write an archive on top of a directory %s%s: Waiting for tape drive close to complete...done. %s: unknown format, %qu bytes skipped. %qu blocks %s: %s vol %d, %lu files, %qu bytes read, %qu bytes written. Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Ready for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again Cannot identify format. Searching...Sorry, unable to determine archive format.Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot chdir to %sCan't fchdir to starting directorydirectory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sUnable to open %s to readCannot mix current archive format %s with %s%s: Reading archive to position at the end...User specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUnable to append when there are archive read errors.Archive read error limit (%d) reachedCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Write block size %d too large, maximium is: %dWrite block size %d is not a %d byte multipleWrite block size of %d too large, maximium is: %dWrite block size of %d is not a %d byte multipleWrite block size of %d larger than POSIX max %d, archive may not be portableUnable to allocate memory for group name cache tableUnable to allocate memory for user name cache tableUnable to allocate memory for group id cache tableUnable to allocate memory for user id cache tableFile is too large for bcpio format %sCould not write bcpio header for %sCould not write bcpio link name for %sBcpio header field is too small for file %sCpio link name length is invalid: %quCpio link name read errorCpio link name is corruptCpio file name length %d is out of rangeCpio file name in header is corruptedFile is too large for sv4cpio format %sCould not write sv4cpio header for %sCould not write sv4cpio link name for %sSv4cpio header field is too small for file %sFile is too large for cpio format %sUnable to write cpio header for %sUnable to write cpio link name for %sCpio header field is too small to store file %s070702070701070707TRAILER!!!File changed size %sFile %s was modified during readFile rewind failed on: %sFailed seek on file %sFailed write to file %sFile seek on %sWARNING! Major Internal Error! GNU hack Failing!Out of memoryCould not set permissions on %sUnable to set file uid/gid of %sAccess/modification time set failed on: %sUnable to close file descriptor on %sUnable to copy %s, file would overwrite itselfUnable to remove directory %sCould not unlink %scannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCould not create: %sCould not access %s (stat)Unable to link file %s to itselfUnable to remove %sCould not link to %s from %sUnable to link to %s from %sA hard link to the directory %s is not allowedUnable to create %sIgnoring unterminated pathname at EOFIgnoring too-long pathname: %sCan't chdir to %snext_fileFile system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %sWARNING! These file names were not selected:Invalid file name argumentUnable to allocate memory for filenameUnable to allocate memory for file name buffer%b %e %Y%b %e %H:%M%s%s %s %s%2u %-*.*s %-*.*s %4lu,%4lu %9qu == -> %s: unknown option %c %s: %c argument missing Invalid option nameUnable to allocate space for option listInvalid options formatusage: cpio -o [-AaBcjLvZz] [-C bytes] [-F archive] [-H format] [-O archive] < name-list [> archive] cpio -i [-6BbcdfjmrSstuvZz] [-C bytes] [-E file] [-F archive] [-H format] [-I archive] [pattern ...] [< archive] cpio -p [-adLlmuv] destination-directory < name-list usage: tar {crtux}[014578befHhjLmNOoPpqsvwXZz] [blocking-factor | archive | replstr] [-C directory] [-I file] [file ...] tar {-crtux} [-014578eHhjLmNOoPpqvwXZz] [-b blocking-factor] [-C directory] [-f archive] [-I file] [-s replstr] [file ...] usage: pax [-0cdjnOvz] [-E limit] [-f archive] [-G group] [-s replstr] [-T range] [-U user] [pattern ...] pax -r [-0cDdijknOuvYZz] [-E limit] [-f archive] [-G group] [-o options] [-p string] [-s replstr] [-T range] [-U user] [pattern ...] pax -w [-0adHijLOPtuvXz] [-B bytes] [-b blocksize] [-f archive] [-G group] [-o options] [-s replstr] [-T range] [-U user] [-x format] [file ...] pax -rw [-0DdHikLlnOPtuvXYZ] [-G group] [-p string] [-s replstr] [-T range] [-U user] [file ...] directory These format options are not supported %s = %s Invalid block size %sbzip2compress/dev/rst0/dev/rst1/dev/rst4/dev/rst5/dev/rst7/dev/rst8b:cef:hjmopqruts:vwxzBC:HI:LNOPXZ014578-IUnable to open file '%s' for readProblem with file '%s'-Cwrite_opt=nodirTAPEUnknown -H format: %scpio: Known -H formats are: abcdfijklmoprstuvzABC:E:F:H:I:LO:SZ6Destination directory was not suppliedProblem while reading stdinInvalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multipleError count value must be positiveab:cdf:ijklno:p:rs:tuvwx:zB:DE:G:HLOPT:U:XYZ0%s: Invalid combination of options: -%cbcpiosv4cpiosv4crcustarFile name %s/%s, too longWARNING! These patterns were not matched:Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Removing leading / from absolute path names in the archive ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Pattern select out of memoryPattern list inconsistentEmpty pattern stringUnable to allocate memory for pattern stringEmpty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sCPU time limit reached, cleaning up. Signal caught, cleaning up. Can't open current working directory.TMPDIR/tmp/Cannot allocate memory for temp file name.LC_TIMEUnable to set up signal handlercan not gzip while appendingEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [[[[[cc]yy]mm]dd]HH]MM[.SS][/[c][m]]Unable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryCannot canonicalize %sUnable to store mode and times for created directory: %sUnable to allocate memory for directory timesCannot allocate space for directory access time tableCannot allocate memory for device mapping tableCannot allocate memory for interactive rename tableCannot allocate memory for hard link tableDirectory access time reset table ran out of memoryDevice map table out of memoryUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedNo interactive rename table, links may failCannot update rename tableInteractive rename table out of memoryHard link table out of memoryFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sUstar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sFile is too long for ustar %snobodyUstar header field is too small for uid %lu, using nobodyUstar header field is too small for gid %lu, using nobodyUstar header field is too small for %sTar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sInvalid extended header lengthInvalid extended header recordInvalid extended header record lengthExtended header record length %j is out of rangeMalformed extended header recordlinkpathwrite_optnodirUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.%s: /dev/ttyFatal error, cannot open %susage: ping [-DdEefLnqRrv] [-c count] [-I ifaddr] [-i wait] [-l preload] [-p pattern] [-s packetsize] [-t ttl] [-V rtable] [-w maxwait] host patterns must be specified as hex digits%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0x%02xVr HL TOS Len ID Flg off TTL Pro cks Src Dst Data %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %s TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Echo ReplyDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set (MTU %d) frag needed and DF setSource Route FailedNetwork UnknownHost UnknownSource IsolatedDest. Net Administratively ProhibitedDest. Host Administratively ProhibitedDestination Net Unreachable for TOSDestination Host Unreachable for TOSRoute administratively prohibitedHost Precedence ViolationPrecedence CutoffDest Unreachable, Unknown Code: %d Source QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect, Unknown Code: %d(New addr: %s) Echo RequestRouter Discovery Advertisement(%d entries, lifetime %d seconds) Router Discovery SolicitationTime to live exceededFrag reassembly time exceededTime exceeded, Unknown Code: %d Parameter problem, required option absent: pointer = 0x%02x Parameter problem: pointer = 0x%02x TimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask Reply (Mask 0x%08x) Unknown ICMP type: %d --- %s ping statistics --- %ld packets transmitted, %ld packets received, %ld duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/std-dev = %d.%03d/%d.%03d/%d.%03d/%d.%03d ms packet too short (%d bytes) from %s%d bytes from %s: icmp_seq=%u ttl=%d time=%d.%03d ms (DUP!) (TRUNC!) wrong data byte #%d should be 0x%x but was 0x%x%x %d bytes from %s: LSRR: 0.0.0.0 %s (truncated route) (same route) RR: NOP unknown option %xping: sendtoping: wrote %s %d chars, ret=%d setresuidnumber of packets to transmit is %s: %sbad interface address: %sbad timing interval: %s%s: only root may use interval < 1spreload value is %s: %spacket size is %s: %sttl value is %s: %srtable value is %s: %ssetsockopt SO_RTABLEmaxwait value is %s: %sDEI:LRS:c:defi:l:np:qrs:T:t:V:vw:unknown host: %s-f and -i options are incompatibleNo audible output for flood pingsbind-R option and -D or -T, or -t to unicast destinations are incompatiblerecord route not valid to multicast destinationsping: record routesetsockopt IP_MULTICAST_LOOPsetsockopt IP_MULTICAST_TTLsetsockopt IP_MULTICAST_IFgetsockoptsetsockoptCannot set the receive buffer sizeCould only allocate a receive buffer of %i bytes (default %i)PING %s (%s): %d data bytes PING %s: %d data bytes ping: recvfrommakeentrylinkupfileerroriblockckinodemainpass2pass2checkpass5setup$pop catchquitNO SPACE LEFT IN %s (EXPANDED)EXPANDUNREFDIRLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED)ADJUSTUNREF %s (RECONNECTED)RECONNECTNO lost+found DIRECTORYCREATE (CREATED)SORRY. CANNOT CREATE lost+found DIRECTORYlost+found IS NOT A DIRECTORYREALLOCATESORRY. CANNOT CREATE lost+found DIRECTORY SORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu NAME=%s %s=%s DIRECTORY CORRUPTEDwrong type to dirscan %d lost+found%d %s I=%lluBAD STATE %d TO BLKERR cannot find inode %llu bad inode number %llu to nextinode Cannot allocate space for inode buffer bad inode number %llu to ginode blk %d < cgdmin %d; blk + cnt %d > cgsbase %d blk %d >= cgdmin %d; blk + cnt %d > cgdmax %d LARGE FILES UNSUPPORTED ON REVISION 0 FILESYSTEMSSETTING LARGE FILE INDICATOR SET LARGE FILE INDICATORTRYING TO SET FILESIZE TO %llu ON MODE %x FILE I=%llu OWNER=%u MODE=%o SIZE=%llu MTIME=%12.12s %4.4s cannot increase directory list PARTIALLY TRUNCATED INODE I=%lluDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDSCLEAR (CLEARED)-%c flag requires a %s usage: %s [-dfnpy] [-b block#] [-m mode] filesystem ... Alternate super block location: %d bad mode to -m: %o ** lost+found creation mode %o b:dfm:npystarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system** Phase 1 - Check Blocks and SizesINTERNAL ERROR: dups with -p** Phase 1b - Rescan For More DUPS** Phase 2 - Check Pathnames** Phase 3 - Check Connectivity** Phase 4 - Check Reference Counts** Phase 5 - Check Cyl groups%d files, %d used, %d free %d files missing %d blocks missing The following duplicate blocks remain: %d,The following zero link count inodes remain: %llu, ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW *****EXCESSIVE BAD BLKS I=%llu (SKIPPING)CONTINUEEXCESSIVE DUP BLKS I=%lluuDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%lluINODE I=%llu HAS DTIME=%12.12s %4.4s (CORRECTED)bad size %llu:HOLD BAD BLOCKbad size %llu ndb %d:bad direct addr: %d bad indirect addr: %d LINK COUNT TABLE OVERFLOWINCORRECT BLOCK COUNT I=%llu (%d should be %d)UNKNOWN FILE TYPE I=%lluROOT INODE UNALLOCATEDALLOCATECANNOT ALLOCATE ROOT INODE DUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYFIXBAD STATE %d FOR ROOT INODE DIRECTORY TOO SHORTDIRECTORY %s: LENGTH %lu NOT MULTIPLE OF %dMISSING '..'BAD INODE NUMBER FOR '..'BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'CANNOT FIX, FIRST ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '.' BAD TYPE VALUE FOR '..'CANNOT FIX, SECOND ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '..' EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEUNALLOCATEDDUP/BADZERO LENGTH DIRECTORY%s %s %s IS AN EXTRANEOUS HARD LINK TO DIRECTORY (IGNORED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%llu ZERO LENGTHBAD/DUP%u: %2x summary info for cg %d is %d, %d, %d,should be %d, %d, %d SUMMARY INFORMATIONS WRONG FOR CG #%dblk_bitmap:bbmap:BLK(S) MISSING IN BIT MAPS #%dino_bitmap:ibmap:INODE(S) MISSING IN BIT MAPS #%dsummary info bad in superblock: %d, %d should be %d, %d SUPERBLK SUMMARY INFORMATION BADstrdup failedrealloc failedmalloc failed/r%s (%s): UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat rootCan't stat %s %s is not a character device ioctl (GCINFO): %s %s: can't read disk label %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: NOT LABELED AS A EXT2 FILE SYSTEM (%s) BAD SUPER BLOCK: %s MAGIC NUMBER WRONGBAD LOG_BSIZEcompat 0x%08x, incompat 0x%08x, compat_ro 0x%08x INCOMPATIBLE FEATURE BITS IN SUPER BLOCKsuperblock mismatchesoffset %ld, original %ld, alternate %ld VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATECan't stat %s: %s %s is not a character deviceCan't open %s: %s ** %sNO WRITE ACCESS (NO WRITE)cannot allocate space for superblock LOOK FOR ALTERNATE SUPERBLOCKS%s %s %s %s %s %s SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO FSCK_FFS TO SPECIFY THELOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ext2fs(8).USING ALTERNATE SUPERBLOCK AT %d state = %d ** F%sile system is clean; not checking ** File system is already clean IMPOSSIBLE RESERVED BLOCK COUNT=%d IN SUPERBLOCKSET TO DEFAULTWRONG FPG=%d (BPG=%d) IN SUPERBLOCKBAD SUMMARY INFORMATIONcannot alloc %u bytes for blockmap cannot alloc %u bytes for statemap cannot alloc %u bytes for typemap cannot alloc %u bytes for lncntp cannot alloc %u bytes for inphead returning to single-user after filesystem check bad file type 0%o cannot allocate buffer pool INTERNAL ERROR: GOT TO reply()%s? no %s? yes %s? [Fyn?] (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %d CANNOT %s: BLK %dProgram terminated SEEKWRITETHE FOLLOWING SECTORS COULD NOT BE WRITTEN: %ld,PARTIALLY WRITING %sZERO'ED BLOCK %d TO DISK UPDATE STANDARD SUPERBLOCKSPanic: lost %d buffers MARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEANcache missed %ld of %ld (%d%%) READTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %ld (%ld),deadlocked buffer pool %6d usage: %s [-benstuv] [file ...] benstuvtx8ȀԘЀԘ؀Ԙ tt(( x x(0<LHX ` Duh|uЏpHu`|tآȝ<hȁvuԁl܁  (08@LTXP`hp x@ؓؓĂp̂(i i@C4CXti ixCXF Ԃ `T(##$#,#0$8$@$H$L%T%\%d%h&p&|''(())**̃+ԃ+,,,-- -..$/,/80@0L0T0`1h1t2|2233344Ȅ4Є5܄566677c$c0d4d@e,eDLPTX\dhpxąȅԅ܅<H L X\dlt 4  ``Ć̆؆ ,G8,D444LLL$8Tdpxrandommalformed link-level addressSIOCSIFLLADDRSIOCGIFXFLAGSSIOCSIFXFLAGS[#%d]SIOCG80211WPAPARMSSIOCS80211WPAPARMSSIOCGIFFLAGSSIOCSIFFLAGSSIOCIFDESTROYmedia mode %smediaopt instance %d"%.*s"0xSIOCGIFGROUPgetifgroups groups:usage: ifconfig [-AaC] [interface] [address_family] [address [dest_address]] [parameters] invalid channel %s: %sSIOCS80211CHANNELprefix %s: %sSIOCGIFMEDIA%s: no link type?only one `instance' command may be issuedmust specify `media' before `instance'media instance %s: %smtu %s: %sSIOCSIFMTUbad hexadecimal digitshexadecimal digits too longstrings too longSIOCS80211NWIDmalformed BSSID: %sSIOCS80211BSSID%s: bad value%s=%o%s=%xSIOCGETVLANSIOCSETVLANvlan tag %s: %s vlan: %d parent interface: %s SIOCG80211ALLCHANS %4s %-8s %s chanfreqproperties %4d %4d MHz passive scan%i%i: bad prefixleninvalid vlan tag and device specificationinvalid %s %s: %s%s not allowed for the AFvltimepltimenwid chan %u bssid %s lladdr %s %u%% %udB powersave %uMESSIBSSCF_POLLABLECF_POLLREQPRIVACYSHORT_PREAMBLEPBCCCHNL_AGILITY SPECTRUM_MGMT QOS SHORT_SLOTTIME APSDDSSSOFDMDELAYED_B_ACKIMMEDIATE_B_ACKCACHEBSSAUTHASSOCCOLLECT no permission to scanSIOCG80211ALLNODES none restoreunknown %s media mode: %sonly one `mode' command may be issuedinvalid media mode: %sunknown %s media subtype: %sonly one `media' command may be issuedmay not issue `media' after `mode' commandsmay not issue `media' after `mediaopt' commandswpagroupcipher: unknown cipher: %sstrdupunknown %s media option: %sonly one `-mediaopt' command may be issuedmay not issue both `media' and `-mediaopt'only one `mediaopt' command may be issuedmay not issue `mediaopt' after `instance'wpaciphers: unknown cipher: %spsk802.1xwpaakms: unknown akm: %swpa1wpa2wpaprotos: unknown protocol: %s ieee80211: nwid chan %u bssid %s %u%% %udB nwkey persist%d: wpakey wpaprotos %swpa2 wpaakms %s802.1x wpaciphers wpagroupcipher powersave on (%dms sleep) (auto) %ddBm%sHIDENWIDNOBRIDGEUPBROADCASTDEBUGLOOPBACKPOINTOPOINTNOTRAILERSRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTTXREADYNOINET6INET6_NOPRIVACYMPLSWOL rdomain %i metric %lu mtu %lu lladdr %s status: %s %s: no media types? media: supported media: physical address inet%s %s --> %spersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEYunsetifgroup: group names may not end in a digitunsetifgroup: group name too longSIOCDIFGROUPsetifgroup: group names may not end in a digitsetifgroup: group name too long SIOCAIFGROUPSIOCG80211NWIDwpakey: invalid pre-shared keywpakey: passphrase must be between 8 and 63 characterswpakey: nwid not setwpakey: passphrase hashing failedSIOCS80211WPAPSKinterface index is already filledgetifaddrscould not determine link local address inet6 %sSIOCGIFDSTADDR_IN6 -> %sSIOCGIFNETMASK_IN6 prefixlen %dSIOCGIFAFLAG_IN6 anycast tentative duplicated detached deprecated autoconf autoconfprivacy scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime inet %sSIOCGIFNETMASKSIOCGIFDSTADDR --> %s netmask 0x%xSIOCGIFBRDADDR broadcast %sSIOCIFCREATEinvalid carp demotion: %scarpdemoteSIOCSIFGATTRSIOCGIFGATTR carp demote count %d%s: no such interface SIOCGIFGMEMBprintgroupinterface name '%s' too longcreatedestroyinet6'%s' requires argument'%s' requires 2 argumentsSIOCDIFADDRSIOCAIFADDRarp-arpdebug-debugalias-aliasdeletenetmaskmtunwid-nwidbssid-bssidnwkey-nwkeywpa-wpawpaakmswpacipherswpagroupcipherwpaprotoswpakey-wpakey-chanbroadcastvlanvlandev-vlandevgroup-groupanycast-anycasttentative-tentativeeui64autoconfprivacy-autoconfprivacypowersavepriorityrtlabeltxpowernwflagrdomain-inet6descriptiondescrwol-wollink0-link0link1-link1link2-link2mediamediaopt-mediaoptinstanceinstlladdrinetEthernetetherFDDIIEEE802.11TDMCARPautoselectmanual10baseT10baseT/UTP10UTP10base210base2/BNC10BNC10base510base5/AUI10AUI100baseTX100TX100baseFX100FX100baseT4100T4100baseVG100VG100baseT2100T21000baseSX1000SX10baseSTPSTP10STP10baseFLFL10FL1000baseLX1000LX1000baseCX1000CX1000baseT1000T1000baseTX1000TXHomePNA1HPNA110GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10GbaseCX410GCX410GBASE-CX42500baseSX2500SX10GbaseT10GT10GBASE-T10GSFP+Cu10GCuSingle-modeSMFMulti-modeMMFCDDIFH1FH2DS2DS5DS11DS1DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72t1t1-amie1e1-g.704e1-amie1-ami-g.704t3t3-m13e3e3-g.751e3-g.832e1-g.704-crc411a11b11gfhmasterfull-duplexfdxhalf-duplexhdxflag0flag1flag2loopbackhw-loopbacklooprxpausetxpausedual-attachdasadhochostapibssibss-mastermonitorturbohdlc-crc16pppframerelay-ansiframerelay-ciscoframerelay-ituno carrierno networkbackupactivekeepalive downusegroupwep40tkipccmpwep104displayprintlong %s: %s: %s: directory causes a cyclefts_readCOLUMNS1ACFHLRSTacdfghiklmnopqrstux%*llu %*qd total %llu %s %*u %-*s %-*s %3d, %3d %*s%*qd %*s ls: %s: %s usage: %s [-1AaCcdFfgHhikLlmnopqRrSsTtux] [file ...] usage: sysctl [-n] name %s=kern.osreleasehw.machinehw.modelhw.producthw.disknameshw.ncpufoundwarnmsgrtsol_timer_updateifconfigmake_packetmainrtsol_check_timerrtsol_inputsendpacketrtsol_inputsendpacketsockopeninterface_statusinterface_uplladdropt_fillinterface_statusinterface_upget_llflagdefrouter_probedefrouter_probesendprobeprobe_initmultiple interfaces foundreallocprobing %s<%s> %sillegal interface state(%d) on %sstop timer for %sset timer for %s to %lld:%ldfailed to get link layer information for %sinterface %s was already configuredmemory allocation failedlink-layer address option has null length on %s. Treat as not included.memory allocation failed for %susage: rtsol [-DdF] [-O script-name] interface ... rtsol [-DdF] -a usage: rtsold [-1DdFfm] [-O script-name] interface ... rtsold [-1DdFfm] -a adDFO:adDfFm1O:kernel is configured not to accept RAskernel is configured not to accept redirectskernel is configured as a router, not a hostfailed to open a socketfailed to initialize interfacesfailed to initialize %sfailed to setup for probing routerstimer expiration on %s, state = %d%s status is changed from %d to %dNo answer after sending %d RSsthere is no timerNew timer is %lld:%08ldselect: %srecvmsg: %sfailed to get receiving interfacefailed to get receiving hop limitpacket size(%zd) is too shortinvalid icmp type(%d) from %s on %sinvalid icmp code(%d) from %s on %sinvalid RA with hop limit(%d) from %s on %sinvalid RA with non link-local source from %s on %sreceived RA from %s on an unexpected IF(%s)received RA from %s on %s, state is %dsend RS on %s, whose state is %dsendmsg on %s: %smalloc for receive msghdr failedmalloc for send msghdr failedff02::2inet_pton failed for %sIPV6_RECVPKTINFO: %sIPV6_RECVHOPLIMIT: %ssetsockopt(ICMP6_FILTER): %sunsupported link type(%d)ioctl(SIOCGIFFLAGS) on %s: %sioctl(SIOCGIFMEDIA) on %s: %sioctl(SIOCGIFFLAGS): %sioctl(SIOCSIFFLAGS): %schecking if %s is ready...socket(SOCK_DGRAM): %sgetifaddrs: %sioctl(SIOCGIFAFLAG_IN6): %sget_llflag() failed, anyway I'll try%s is ready%s is tentative%s is duplicatedlo0ioctl(SIOCGDRLST_IN6): %sdefault router list contains a non-link-local address(%s)probe a router %s on %sshutdown: %snigrouppr_iphdnsdecodesummarypr_rthdrpr_icmphpr_nodeaddrpr_packmainXhxFusage: ping6 [-dEefHmNnqtvWw] [-a addrtype] [-b bufsiz] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [hops ...] host ff02::2:0000:0000-%uVr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->\%03o --- %s ping6 statistics --- +%ld duplicates, %.1lf%% packet lossround-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms path MTU for %s is notified. (ignored) NodeInfo Supported Qtypes, compressed bitmap, raw bitmap???nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu HbH Options: Dst Options: Routing: sendmsgping6: wrote %s %d chars, ret=%d IP6HBH DSTOPT FRAG RTHDR AH ICMP6: type = %d, code = %d ESPUnknown Header(%d) No Route to DestinationDestination Administratively UnreachableDestination Unreachable Beyond ScopeDestination Unreachable, Bad Code: %d Packet too big mtu = %d Time exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option Bad code(%d) pointer = 0x%02x Listener QueryListener ReportListener DoneRouter SolicitationRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sNode Information QueryNOOPSupported qtypesDNS namenodeaddrIPv4 nodeaddrunknown qtype, subject=%s(%s), oldfqdn, no subject, subject=%sDNS label(invalid), invalidNode Information Reply, %sBad ICMP type: %drefused truncated no address %s(TTL=infty)(TTL=%u)invalid peernamefailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!)extra (%d bytes %s)refused, type 0x%xunknown, type 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPTTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luinvalid socket buffer sizeMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %stoo small interval, raised to 0.01Must be superuser to preloadillegal preload value -- %s-R is not supported in this configurationinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %da:b:c:dEefHg:h:I:i:l:mnNp:qRS:s:tvwWtoo many intermediate hopsgetaddrinfo failedgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface namecan't initialize rthdrbad addr family of an intermediate addrcan't add an intermediate nodeUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP setsockopt(IPV6_RTHDR)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> pollrecvmsgnew path MTU (%d) is notified IPv6 addressIPv4 addressSuccessRefusedusage: %s [-aju] [-d dst] [-r seconds] [-t minutes_west] [-z output_zone] %-*s[+format] [[[[[[cc]yy]mm]dd]HH]MM[.SS]] illegal time formatUTCcannot unsetenv TZad:jr:ut:z:settimeofday%a %b %e %H:%M:%S %Z %Yspecified date is outside allowed rangeCould not get local time of dayadjtimedate set by %stoo many arguments?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for data?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?m(%T %i of %m) .?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%tCannot allocate memoryLESSSECURE-G-L-XLESS--WARNING: terminal is not fully functionalLESS_TERMCAP_DEBUG<%s>LESS_TERMCAP_krklkukdkPkNkh@7kDLINESlicoTERMhcxndadbsgpcticdcmsomdmbvbbc|^srNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketseek error to 0ch_ungetchar overrunseek errorread errorESC^%c*s<%X>less %s(P)+Non-match First-file EOF-ignore Keep-pos Regex-off &/Pattern not found& [Press space to continue, 'q' to quit.]There is no %s optionCommand not available(N-th) No %snext fileNo %sprevious fileNo such filemark: goto mark: Brackets: [Press 'h' for instructions.]Warning: some edit commands disabledWarning: some commands disabled"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)LESSMETAESCAPE\LESSMETACHARS; *? '"()<>[]|&^`#\$%=~%c%s%c%s %s %sLESSCLOSELESSOPEN...skipping... Cannot seek to that file positionDetermining length of fileDon't know length of fileCannot seek to end of fileCannot seek to beginning of fileCannot seek to line number %nLESSANSIENDCHARSLESSANSIMIDCHARS0123456789;[?!"'#%()*+ Line numbers turned offCalculating line numbersInvalid mark letterMark not setUse "h" for help-" must be followed by 1 or 2 charsquotes %sTab stops and then every %d spacesless Copyright (C) 1984-2009 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less #Invalid column fractionInvalid column numberHorizontal shift %d columns.%06dHorizontal shift %s of screen widthjInvalid line fractionInvalid line numberPosition target at screen line %dPosition target at screen position %sValue is required after %sNumber is required after %s--%s-%c (--%s)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric option-%sThere is no %s option ("less --help" for help)LESS_IS_MOREBe less helpful in promptsBe helpful in promptsSearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenAssume intelligent terminalAssume dumb terminalDon't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numbersprompt: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directlyDisplay control characters directly, processing ANSI sequencesDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linesDisplay underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file namefakeInvalid patternNo previous regular expressionPlease re-enter search patternNothing to searchmain8D,PT\hpxTX`l @t| @h|usage: %s [-23bcdilsTU] [-a maxreadahead] [-g maxgroups] [-I readdirsize] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-w writesize] [-x retrans] rhost:path node hostname too longno : or @ speccan't resolve address for host %sNFS PortmapCannot MNT RPCbad MNT RPCcan't access %s: %s-2 and -3 are mutually exclusiveillegal -a value %s: %sillegal -g value %s: %sillegal -I value %s: %sconflicting version optionsillegal -R value %s: %sillegal -r value %s: %sillegal -t value %s: %sillegal -w value %s: %sillegal -x value %s: %s23a:bcdD:g:I:iL:lo:PR:r:sTt:w:x:Ubgconndumbtimernfsv3mntudpresvportnfsv2acmainUSER_print_diskUSER_modifygetuintask_pidask_numask_cmdMBR_pcopyunused DOS FAT-12 XENIX / XENIX /usr DOS FAT-16 Extended DOSDOS > 32MB NTFS AIX fs AIX/Coherent OS/2 Bootmgr Win95 FAT-32 Win95 FAT32LDOS FAT-16 Extended LBAOPUS OS/2 hidden Compaq Diag.OS/2 hidden OS/2 hidden OS/2 hidden AST swap Willowtech ThinkPad Rec Willowsoft $NEC DOS 'Win Recovery8Theos 9Plan 9 @VENIX 286 ALin/Minux DRBLinuxSwap DRCLinux DR MQNX 4.2 Pri NQNX 4.2 Sec OQNX 4.2 Ter PDM QDM RCP/M or SysVSDM TOntrack UEZ-Drive VGolden Bow \Priam aSpeedStor cISC, HURD, *dNetWare 2.xxeNetWare 3.xxfNetWare 386 gNovell hNovell iNovell pDiskSecure uPCIX Minix (old) Minix (new) Linux swap Linux files*OS/2 hidden Linux ext. NT FAT VS NTFS VS Linux LVM Amoeba FS Amoeba BBT Mylex BSDI NotebookSaveFreeBSD OpenBSD NEXTSTEP MacOS X NetBSD MacOS X bootMacOS X HFS+BSDI filesy*BSDI swap Solaris CTOS DRDOSs FAT12DRDOSs < 32MDRDOSs >=32MHPFS DisbledCPM/C.DOS/C*Dell Maint SpeedStor SpeedStor SpeedStor BeOS/i386 EFI GPT EFI Sys SpeedStor DOS 3.3+ SecSpeedStor Xenix BBT XwriteXreinit[[S~UWf)_pvHv9!LRFݞV7[KRlLjc鋴7)ou89Z'/z%ߩD-tv`Pqkky/_w+b0A]Βs|et2K2]&U,\yiӕWi&2K%giYRe #`A Mr0L4]^y <&Nsӵ%Z< b5r腔MQfRqna=jr1 uE`Cn @JEgu—7w2NUhW 2ҫ4:Zu"uJ̆^DIENTzJ3Q)̶viİxz2O3/y:8h =0 TͶ`/^ UrDXp\ fB݊38 :OEfK6  zbbrJ"d4/bb\lluN >ԏnڛC"IzNx%Fyq5{0S㙧̅S:Hzg-U,![[hMmv i`mb窈.,4⠈Kuch/Nެ Jr ƪ!g`%͹h_rnT*Ѻx₝#T8ҦC` T+OpipL6l7gmQY+u|cNV] y$fKâ 7Wg`kw`T\MT˩x?גoz*^5[EAuoUӳYw)(aDq '}(ⴏ?,ڂ"725$!5; ;uq䑊! FdR[1KA5|H,aZE+FiBa_v׸SH֒Kc7 {'yG/K$ <> .< ī=% "h1k$ :ɣ̺n~ :g-%[/ sGBmE^CV*Q n]ϣ D֡W*^J{NfhXF `K+ HsLby֪H=e Yq-ya@- DoCeŸB#D ƺ\)[Xun>0.8BRŴ&yM;PrZxiD@o%d?Yņ2H3gUX9Ykw5E!fltqf=k ˗ eH`j)8XG)-0K/6MS6m? OT{c8I) dzjI WPxeֱ>5톟j/D J}/[VWx7Y ~'m4Ģ&$v,zv%ʟjvwO5;dBqF48xlhفeos!=;o6xNtG>P˷//~OB®s%;y,ݍ-?- 7Y郢J|AI 9Ga_~GHx|2wQ׷ []Z?|9vYXr8:9&9O'Cq]k*?_՛@t_&{;noillZi\(9Bgl&Khz-efeԝ%2:F0="_&GtQkfU`S zv_ŐlkW:]]?@: ̶0:DFRJ#]㱊\M᳉v=M^T}e/nLs mǤX +oʰL)uUB~GaF=}.eQҬ+D #Hfҗ)FY a>,J#Ӿ&Qٖ#L \*~Dxl/,wwDZp?3Oqp`[L8~xrs%&3훗΁i;Gv3—@sH,=W4@L-[naϨ[v)a9$2K*9G[-"Ò+GkvUߘϣ7jFYLQ,3E9]̋$^6qWot)3=u$=Pː >%_ȻNñjXk^߯7迺;9E"FMFz> Ǔd>tynzV/hcS^ˏd7`;@Tj|ts/jQ#HTpѰ^OW˱ZRolkB(e/[>Wvrn~Kgj~?? GD/4Q|29eJ0ӳdh8r#FITZ@if1249LItl8uf0>;φ%p|r20:I NN߃͢-Qh4:@.fyцRIat6[&h@L\)ݡ.'NM>/͵f2NAwK0<$iz0g rԱ<YTT޸hr' l9e pN#o;qZ蟕؝›*ٓ[m&^S~od({jMRƷᾙZ~d\ sS& vTW*w_|R8{>:YW15?<Ȧ2usage: %s [-eiuy] [-c cylinders -h heads -s sectors] [-f mbrfile] disk -i: initialize disk with virgin MBR -u: update MBR code, preserve partition table -e: edit MBRs on disk interactively -f: specify non-standard MBR template -chs: specify disk geometry -y: do not ask questions `disk' may be of the forms: sd0 or /dev/rsd0c. Cylinder argument %s [1..262144].Head argument %s [1..256].Sector argument %s [1..63].ieuf:c:h:s:yPlease specify a full geometry with [-chs].Can't get disk geometry, please use [-chs] to specify.using builtin MBRUnable to read MBRerror initializing MBROffset: %lld Enter 'help' for informationfdisk:%c%d> Invalid command '%s'. Try 'help'. Aborting changes to current MBR.Do you wish to write new MBR?Do you wish to write new MBR and partition table?Command help listShow entire OpenBSD man page for fdiskreinitRe-initialize loaded MBR (to defaults)setpidSet the identifier of a given table entryEdit current drive statseditEdit given table entryflagFlag given table entry as bootableUpdate machine code in loaded MBRSelect extended partition table entry MBRSwap two partition entriesPrint loaded MBR partition tablewriteWrite loaded MBR to diskexitExit edit of current MBR, without saving changesQuit edit of current MBR, saving current changesabortAbort program without saving current changes%s: [%u] %s is out of range: %c%s%c %s is invalid: %c%s%c %s [n] Partition id ('0' to disable) [%X - %X]: [%X] (? for help) '%s' is not a valid number. '%x' is out of range. %s [%d - %d]: [%d] %s is %s: %s. BytesSectorsKilobytesMegabytesGigabytesDisk: %s geometry: %d/%d/%d [%.0f %d-byte %s] geometry: %s is not a character device or a regular fileDIOCGPDINFOdisk too large (%llu sectors). size truncated.Signature: 0x%X Start of partition #%d after end! Starting Ending LBA Info: #: id C H S - C H S [ start: size ]-------------------------------------------------------------------------------%c%1d: %.2X %6u %3u %3u - %6u %3u %3u [%12u:%12.0f%s] %s Warning CHS values out of bounds only saving LBA valuesChoose from the following Partition id values:%02X %s %02X %s %02X %s %02X %s partition number is %s: %s. flag value is %s: %s. Partition %d marked active. Partition %d flag value set to 0x%x. %s %s Machine code updated.partition number is invalid:partition number is %s: %s %d same partition as %d, doing nothing. MBR contains more than one OpenBSD partition!Write MBR anyway?Writing MBR at offset %d. error writing MBROffset: %d Partition %d is not an extended partition. Loop to offset 0! Not selected.Selected extended partition %d New MBR at offset %d. Change disk geometry?BIOS CylindersBIOS HeadsBIOS SectorsPartition %d is disabled. Do you wish to edit in CHS mode?BIOS Starting cylinderBIOS Starting headBIOS Starting sectorBIOS Ending cylinderBIOS Ending headBIOS Ending sectorPartition offsetPartition sizeIn memory copy is initialized to:Use 'write' to update disk.invalid file type(standard input)(fd %d)usage: %s [-abcEFGHhIiLlnoqRsUVvwx] [-A num] [-B num] [-C[num]] [-e pattern] [-f file] [--binary-files=value] [--context[=num]] [--line-buffered] [pattern] [file ...] ^\((%s[[:<:]]%s%.*s%s[[:>:]]%scontext out of rangegrep version %u.%u binarywithout-matchtextUnknown binary-files optionCan't use small fgrep with -wbinary-filesmmapline-bufferedafter-contextbefore-contextextended-regexpfixed-stringsbasic-regexpwith-filenamebyte-offsetregexpno-filenameignore-casefiles-without-matchfiles-with-matchesline-numberquietsilentrecursiveno-messagesrevert-matchword-regexpline-regexpunix-byte-offsets0123456789A:B:CEFGHILRUVabce:f:hilnoqrsuvwxyLine is too big to processBinary file %s matches umountfsusage: %s %s umount [-fv] special | nodeumount -a [-fv] [-h host] [-t type]%s: not currently mounted%s: not a directory or special device%s: unmount from %s Bad MNT RPCafh:t:vmain8D,PT\hpx@usage: mount_msdos [-9lsx] [-g gid] [-m mask] [-o options] [-u uid] special node invalid file mode: %sunknown user id: %sunknown group id: %ssl9xu:g:m:o:stat %snot an MSDOS filesystemcheckfsfsck_%snostart %s %swait %s%s/fsck_%sexec %sCan't get resource limit to max data sizeCan't get resource limit for data size-b %sInvalid option stringusage: %s [-dfnpvy] [-b block#] [-l maxparallel] [-T fstype:fsoptions] [-t fstype] [special | node ...] dvpfnyb:l:T:t:%s: unknown special file or file system.Can't open checklist file: %s/etc/fstabpass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s: Unknown pid %lddone %s: %s (%s) = %x %s: %s (%s): EXITED WITH SIGNAL %d THE FOLLOWING FILE SYSTEM%s HAD AN %s UNEXPECTED INCONSISTENCY:%s: %s (%s)%susage: sha256 outfile usage: %s [-m mode] fifo_name ... usage: %s [-m mode] name b|c major minor %s [-m mode] name p node must be type 'b' or 'c'.non-numeric major number.non-numeric minor number.major or minor number too largemkfifoinvalid file mode.m:sodumpinet6_makenetandmaskgetaddrprint_rtmsgmonitor,G8,D444LLL$8Tnetname6routenamep_flagsp_rtentry0123456789abcdefUGHRBD M@dmCXLS1@2 3cPTdefaultconnectedstaticospfis-isbgpbad label: %s is %sking bula sez: set_metric with invalid keyset_metric: %s is %sinvalid table id: %slabel too longprefixlen is not supported with af %dprefixlen %s is %s%s: link %s; %s: inet %s; %s: inet6 %s; 128internal error%s: resolved to multiple valuesmpls labels require -in or -out switch%s: not a network%s: bad address%d: bad address familybotched keyword: %susage: %s [-dnqtv] [-T tableid] command [[modifiers] args] commands: add, change, delete, exec, flush, get, monitor, show setrtable sockaddrs: locks: inits: route to: %s routing message version %d not understoodmessage length mismatch, in packet %d, returned %dRTM_GET: %s (errno %d)destination: %s mask: %s gateway: %s interface: %.*s if address: %s mpls label: %s %s priority: %u (%s) flags: label: %s use mtu expire%8llu %8u%c %8d%c sockaddrs: [rtm_type %d out of range]: len %d, if# %d, name: %s, link: %s, flags:, metric %d, flags:, if# %d, name %s, what: arrivaldeparture, priority %d, table %u, pid: %ld, seq %d, errno %d flags: use: %8llu mtu: %8u%c expire: %8d%cso_dstso_gateso_maskso_genmaskso_ifpso_ifaso_labelso_srcwriting to routing socketread from routing socketmust be root to alter routing table-mplslabel requires -inet or -inet6-in requires -mpls-out requires -mpls-out requires -push, -pop, -swap-pop requires -mpls-push requires -mpls-swap requires -mplspriority is %s: %snetmask missingnet: gateway %sentry in userouting table overflownot in tableroute-sysctl-estimateactual retrieval of interface tablesetsockopt(ROUTE_MSGFILTER)setsockopt(ROUTE_TABLEFILTER)got message of size %d on %sno such interface %sactual retrieval of routing tableExamining routing table from sysctl(address family %s) write to routing socketgot only %d for rlen %-20.20s donednqtT:vrouting table %i/dev/nulladdblackholechangecloningdstencapexpiregatewaygenmaskgethopcountifaifpjumbolinkllinfolocklockrestmpathmplslabelnojumbonostaticpopproto1proto2pushrecvpiperejectrttrttvarsasendpipeshowssthreshxresolveRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics or flagsRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_RESOLVE: Route created by cloningRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_IFINFO: iface status changeRTM_IFANNOUNCE: iface arrival/departureRTM_DESYNC: route socket overflowPUSHLOCALPOPSWAPlink#%dillegal prefixlen%s/%d%u/%d%u.%u/%d%u.%u.%u/%d%u.%u.%u.%u/%daf %d: %s(%d) %s%-6s %-*.*s %-6u/esp/ah/ipcomp/ipip//use/require/acquire/deny/bypass/dontacq//in/out%-*s %-5u %-*.*s %-5u InternetInternet6Encap Protocol Family %d: MPLS%-18s %-5s %-18s %-5s %-5s %-22s SourcePortProtoSA(Address/Proto/Type/Direction)%-9s %-9s %-6s %-18s %-6.6s %5.5s %8.8s %5.5s %4.4s %s In labelOut labelOpGatewayFlagsRefsUseMtuPrioInterface%-*.*s %-*.*s %-6.6s %5.5s %8.8s %5.5s %4.4s %sIfaceLabel%-6.6s %5u %8llu %5u %5s %2d %-5.16ssysctl of routing tableRouting tablesspd-sysctl-estimatesysctl of spd Encap: KMGTPftp://http://file::/Can't allocate memory for URL decoding <>"#{}|\^~[]`receivedCan't allocate memory to parse URLurl_get: Invalid URL '%s'No `/' after host (use -o): %sNo filename after host (use -o): %sNo filename after directory (use -o): %sCan't allocate memory for proxy URL.Malformed proxy URL: %serror in base64 encodingCan't open file %sCan't open %sCan't allocate memory for transfer bufferWriting %sReading from file(unknown)Trying %s... r+Requesting %sCan't allocate memory for URL encoding%%%02x (via %s) GET %s HTTP/1.0 Proxy-Authorization: Basic %s%s %s User-Agent: OpenBSD ftpGET %s HTTP/1.0 %s%s GET /%s %s Host: HTTP/1.0Can't allocate memory.[%s]:%s %s%s Writing HTTP requestReceiving HTTP replyError retrieving file: %sToo many redirections requestedContent-Length: Location: Relative redirect not supportedCannot allocate memory for URLRedirected to %s Reading from socketRead short file. Auto-login using ftp URLs isn't supported when using $ftp_proxyImproper response from %sftp_proxyhttp_proxyCan't allocate memory for auto-fetch.Invalid URL: %sCan't connect or login to host `%s'*?[]{}NLSTRetrieving %s/%s mget file fetch aborted. http fetch aborted. Extra `@' characters in usernames and passwords should be encoded as %%40Forced abort. The connection will be closed. local: %srunique: can't find unique file name. receive aborted waiting for remote to finish abort. acceptsetsockopt TOS (ignored)%c%c%c421 Service not available, remote server has closed connection. Lost control connection for abort.%cABOR No control connection for command.QUITRETRSTOUSTORPASVproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s use of scoped address can be troublesomeEPSVwrong server: return code must be 229 LPSVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u%c%c%c%d%cparse error! setsockopt (reuse address)setsockopt IP_PORTRANGE (ignored)setsockopt IPV6_PORTRANGE (ignored)listenEPRT |%d|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dlocal: %s remote: %s REST %lldnetin: %slocal: %s: %s%s: short writeWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sftpgatehttp%s: bad port number `%s'connect to address %sfdopen failed.Connected to %s. usage: %s [-o output] ftp://[user:password@]host[:port]/file[/] ... %s [-o output] http://host[:port]/file ... %s [-o output] file:file ... %s [-o output] host:/file[/] ... FTPSERVERPORTFTPMODEpassivegateunknown FTPMODE: %s. Using defaultsgate-ftpFTPSERVERNeither $FTPSERVER nor $GATE_SERVER is defined; disabling gate-ftpdumbemacssukeep alive amount is %s: %sretry amount is %s: %s46AaCc:dEegik:mno:pP:r:s:tvVnmap: unbalanced brackets. CWD %sCWD command not recognized, trying XCWD. XCWD %scan't get cwdSkipping non-relative filename `%s' a+winternal error: unknown type %d.TYPE %s %sTYPE %susage: %s [ | Using %s mode to transfer files. %s: unknown mode. asciiimageebcdictenex%lld byte%s %s in %.2f seconds (%.2f %sB/s) ETA: %02d:%02d:%02d %-*.*s%s %3d%% %3d%% |%.*s%*s|************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************* %5lld %c%c %2d:%02d:%02d --:-- ETA - stalled -%02d:%02d ETAUnable to determine real path of `%s'%s: not foundunable to create temporary file: %sftpXXXXXXXXXXLISTcan't find list of remote files, oops. can't find list of remote files, oops.anonymous%s@Name (%s:%s): Name (%s): USER %sPassword:PASS %sAccount:ACCT %sLogin %s failed.Already connected to %s, use close first. gateserver not defined (shouldn't happen)PASSERVE %sConnected via pass-through server %s non-printstreamSYSTRemote system type is %s. 215 UNIX Type: L8215 TOPS20Remember to set tenex mode when transferring binary files from this machine. SIZE %sMDTM %s191Y2K warning! Fixed incorrect time-val received from server. %*s %04d%02d%02d%02d%02d%02dCan't convert %s to a time. mainusage: %s [-dn%sq] dlnpqhalted (with powerdown) by %shalted by %srebooted by %s~SIGTSTP init/etc/rc/dev/consolerevokesetsidopenSIGTERM processesWARNING: some process(es) wouldn't die(can't restart init): main8D,PT\hpx@`usage: mount_ffs [-o options] special node filesystem must be mounted read-only; you may need to run fsckreload5Ȁ0"0000L1%LI 11(1'01 ) D1&T1ج\1#d1$l1t1|111 1 1!11 5[5|5L5556565(65465D65P65`65|66<666|6666777<,7T<7T7l7p7<77|7777|878(8<8T8Td8|888585885859T9$95495H9|`9p9T9T9|9999<9:$:<:T:`:l:|:5:::5:5:5:5:5:5;5;5(;5P;\;h;t;;;;;;5;;;;;<< <,<8<D<P<\<h<t<<<<<<<<<<<<===(=4=@=L=X=d=p===========> >>$>0><>H>T>`>l>x>>>>>>>>>5>?? ?,?8?D?P?\?h?t????????????@@@(@4@@@L@X@d@p@|@@@@@@@@@@@A AA$A0ADHCPOFFERDHCPNACKBOOTREPLY%s from %s (%s)%s from %sno memory for info stringpretty_print_option: bad code %d%s: Excess information in format string: %s%s: no size indicator before A in format string: %s%s: garbage in format string: %s%s: expecting at least %d bytes; got %d%s: expecting only %d bytes: got %d%s: expecting %d bytes: got %dUnexpected format code %ceof in string constantstring constant larger than internal buffernumeric token larger than internal bufferappendbackoff-cutoffbootpdenyethernetfddifixed-addresshardwareignoreinitial-intervallink-timeoutmediumprependrebindrenewrequireretryselect-timeoutsendserver-namesupersedetimeouttoken-ring%s line %d: %s%*c^ RTM_DELETE write: %sshort RTM_DELETE write (%d) DHCLIENT DHCLIENT %dcreating route label: %screating route label: label too long (%d vs %zd)default route socket: %sRTM_GET of default route: %sget default route read: %sno data from default route readdefault route read rtm: %sadd_address: imsg_compose: %sadd_route: imsg_compose: %scleanup: imsg_compose: %scleanup: imsg_flush: %sdelete_address: imsg_compose: %sdelete_address: imsg_flush: %sflush_routes: imsg_compose: %sflush_routes: imsg_flush: %ssocket open failed: %sSIOCDIFADDR failed (%s): %sdelete_addresses getifaddrs: %sRouting Socket open failed: %sfailed to add default route: %sSIOCAIFADDR failed (%s): %s127.0.0.1routes buf malloc:sysctl retrieval of routes:route cleanup failed - %s %s (msize=%zu)opening socket to flush routes: %ssysctl size of routes:%d bad IP checksums seen in %d packets%d udp packets in %d too long - dropped%d bad udp checksums in %d packetspadsubnet-masktime-offsetIAtime-serversien116-name-serversdomain-name-serverslog-serverscookie-serverslpr-serversimpress-serversresource-location-servershost-nameboot-sizemerit-dumpdomain-nameswap-serverroot-pathextensions-pathip-forwardingnon-local-source-routingpolicy-filterIIAmax-dgram-reassemblydefault-ip-ttlpath-mtu-aging-timeoutpath-mtu-plateau-tableSAinterface-mtuall-subnets-localbroadcast-addressperform-mask-discoverymask-supplierrouter-discoveryrouter-solicitation-addressstatic-routestrailer-encapsulationarp-cache-timeoutieee802-3-encapsulationdefault-tcp-ttltcp-keepalive-intervaltcp-keepalive-garbagenis-domainnis-serversntp-serversvendor-encapsulated-optionsnetbios-name-serversnetbios-dd-servernetbios-node-typenetbios-scopefont-serversx-display-managerdhcp-requested-addressdhcp-lease-timedhcp-option-overloaddhcp-message-typedhcp-server-identifierdhcp-parameter-request-listBAdhcp-messagedhcp-max-message-sizedhcp-renewal-timedhcp-rebinding-timedhcp-class-identifierdhcp-client-identifieroption-62option-63nisplus-domainnisplus-serverstftp-server-namebootfile-namemobile-ip-home-agentsmtp-serverpop-servernntp-serverwww-serverfinger-serverirc-serverstreettalk-serverstreettalk-directory-assistance-serveruser-classoption-78option-79option-80option-81relay-agent-informationoption-83option-84nds-serversnds-tree-namends-contextoption-88option-89option-90option-91option-92option-93option-94option-95option-96option-97option-98option-99option-100option-101option-102option-103option-104option-105option-106option-107option-108option-109option-110option-111option-112option-113option-114option-115option-116option-117option-118option-119option-120classless-static-routesoption-122option-123option-124option-125option-126option-127option-128option-129option-130option-131option-132option-133option-134option-135option-136option-137option-138option-139option-140option-141option-142option-143tftp-config-fileoption-145option-146option-147option-148option-149voip-configuration-serveroption-151option-152option-153option-154option-155option-156option-157option-158option-159option-160option-161option-162option-163option-164option-165option-166option-167option-168option-169option-170option-171option-1 08`VQ<  VQP̌`[~ [~VQ`@@<@TU QcbQccAVQ/E:XQzԓXQzԓ` $oAVQw;VQw;VQw;a YAWQuWQ<0WQ(b D AWQuXQ ]9XQ ]9c AWQ<0WQ<0WQ<0d 3SAWQ(WQ(WQ(e ٻCAWQ';@WQ';@WQf h< ~P*dPa+\4GI36[ѱm.|r2˨x.oe2ȋӀ(i_AþF?}aՐpTpno&Mٻt C>&"<xE)"- $B5 be ֝!"&1=oMv5u@m n@ Cv >PkS =}p@}W7 t )Q5쥗wcIq(ێmF18n2T-υ")Kmbji^Ѣ1 3{ >(Eh1`L8'Fqf'ry-+E7k6qb!'{ǃ z˹X>Q(x: !mdB#2:hJXhX\f_7!;Ԏ~d&M,vL[6]y.W!vI]d,bqLjq &3rJQ}Y%7ss3El@UsrHvlڛY Hcѫʋ@ . ..archN catdateNchmodchgrp cp dd df edexprNhostnameM ksh sh ln lsmkdir mteject mv pax tarcpioN rmsha256sleepsttyN|syncNA ...B . ..C binDmdec7&sbin7&share&C .B .. ftpgrepNfgrepegrepgzipNgunzipgzcatlessNmoreN\sedD .B..E ...F ...root:*:0:0:Charlie &:/root:/bin/ksh daemon:*:1:1:The devil himself:/root:/sbin/nologin operator:*:2:5:System &:/operator:/sbin/nologin bin:*:3:7:Binaries Commands and Source:/:/sbin/nologin uucp:*:66:1:UNIX-to-UNIX Copy:/var/spool/uucppublic:/usr/libexec/uucp/uucico _dhcp:*:77:77:DHCP programs:/var/empty:/sbin/nologin nobody:*:32767:32767:Unprivileged user for NFS:/nonexistent:/sbin/nologin 72option-173option-174option-175option-176option-177option-178option-179option-180option-181option-182option-183option-184option-185option-186option-187option-188option-189option-190option-191option-192option-193option-194option-195option-196option-197option-198option-199option-200option-201option-202option-203option-204option-205option-206option-207option-208option-209option-210option-211option-212option-213option-214option-215option-216option-217option-218option-219option-220option-221option-222option-223option-224option-225option-226option-227option-228option-229option-230option-231option-232option-233option-234option-235option-236option-237option-238option-239option-240option-241option-242option-243option-244option-245option-246option-247option-248option-249option-250option-251autoproxy-scriptoption-253option-254option-endtime string too longinvalid time string%w %Y/%m/%d %T UTC%w %Y/%m/%d %T%u %Y/%m/%d %Tunparseable time stringtime could not be representedBogus number: %s.Bogus number: %s: digit %d not in base %dvalue %s%o exceeds max (%d) for precision.value %s%x exceeds max (%d) for precision.value %s%u exceeds max (%d) for precision.Unexpected integer size: %dExpecting numeric lease timeno space for numeric aggregatenumeric aggregate too short.expecting a network hardware typefilename must be a stringno memory for string %s.dispatch_imsg: imsg_get failure: %sbad IMSG_DELETE_ADDRESSbad IMSG_ADD_ADDRESSbad IMSG_FLUSH_ROUTESbad IMSG_ADD_ROUTEbad IMSG_HUPshort IMSG_WRITE_FILEbad IMSG_WRITE_FILE (%zu)received unknown message, code %dcannot close temp fileinvalid address/tmp/ed.XXXXXXXXXXw+cannot open temp fileline too longcannot seek temp filecannot write temp filecannot read temp fileunexpected end-of-file& no previous commandinvalid pattern delimiter\  \abfnrtv\cannot read stdincannot write filecannot open output filecannot close output filecannot read input filenewline inserted newline appended cannot open input filecannot close input fileshell access restrictedinvalid mark charactered.hup/ed.hupno current filenameinvalid filenamefilename too longno matchnumber out of rangeinvalid command suffixunexpected addressunexpected command suffixinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioncrypt unavailableHOMEcrypt unavailable ? p:sx ? interrupt? warning: file modifiedscript, line %d: %s usage: %s [-] [-sx] [-p string] [file] unbalanced brackets ([])trailing backslash (\)no previous patterninfinite substitution loopnothing to undocopy_link%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).HLPRfiprthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too longusage: %s [-fip] [-R [-H | -L | -P]] source target %s [-fip] [-R [-H | -L | -P]] source ... directory lchown: %sutimes: %schown: %schmod: %schflags: %sunlink: %smknod: %smkfifo: %sreadlink: %ssymlink: %soverwrite %s? [\\1,/\,0\ \\YY\4\D\      A@!  @a`10  @`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O @@ !1Aa  0@` #+3;CScsT\d\[p\|\\\\\[usage: %s [-123456789cdfghLlNnOqrtVv] [-b bits] [-o filename] [-S suffix] %*s [file ...] usage: %s [-cfhlNnqrtVv] [-o filename] [file ...] usage: %s [-fghqr] [file ...] OK %4.1f%% -- replaced with %s %lld bytes in, %lld bytes out method crc date time compressed uncompressed ratio uncompressed_name%-7.7s %08x %s %10lld %10lld %4.1f%% %s %10lld %10lld %4.1f%% (totals) .-_tgztazfchown: %sfchmod: %sfchflags: %sfutimes: %scompression not supported%s: won't read compressed data from terminal%s: unrecognized file formatcrc errorzcatzipunknown program nameGZIPoption -a is ignored on this systemillegal bit count -- %s-o argument is too long-o option may only be used with a single input filemay not mix -o, -c, or -t options%s is a directory: ignored: unchanged%s not a regular file%s%s already has %s suffix -- unchanged%s: unknown suffix: ignored%s%s: name too long%s: input: %sdeflate.gzZgzz123456789ab:cdfghLlNnOo:qrS:tVvcfhlNno:qrtVvfghqr1.2.3need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible versionusage: %s [-R [-H | -L | -P]] %s file ... owner[:group]usage: %s [-h] [-R [-H | -L | -P]] %s file ... %s [-h] [-R [-H | -L | -P]] :group file ... group is %s: %suser is %s: %sHLPRXfghorstuwxthe -R and -h options may not be specified together.invalid flags: %sinvalid flag: %smakeentrylinkupfileerrordirscaniblockckinodecheckfilesyspass2pass2checkpass5setup$pop  @ catchinfocatchquit?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@%lld %s I=%llubad size: blk %lld, offset %lld, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock.fs_fpg %d cannot allocate memory for inode cache cannot increase directory listbad inode number %llu to nextinode %llu cannot alloc %lu bytes to extend inoinfo CG %d: BAD MAGIC NUMBER %lld files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %lld files missing %lld blocks missing %lld,conversion levelcannot do level %d conversion usage: %s [-fnpy] [-b block#] [-c level] [-m mode] filesystem ... dfpnNyYb:c:m:EXCESSIVE DUP BLKS I=%llucannot alloc %u bytes for inoinfobad direct addr: %ld bad indirect addr: %ld INCORRECT BLOCK COUNT I=%llu (%ld should be %d)too many inodes %llu cannot realloc %zu bytes to %zu for inoinfo phase 1, inode %llu/%lluphase 1b, inode %llu/%llu%s %s: LENGTH %ld NOT MULTIPLE of %d%s %s: LENGTH %ld NOT MULTIPLE OF %dphase 2, directory %d/%dphase 2, parent directory %d/%d (REMOVED)phase 3, directory %d/%ldphase 4, inode %llu/%lluDELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCREATCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS UNKNOWN ROTATIONAL TABLE FORMAT %d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %ld MARKED FREE ALLOCATED FRAG %ld MARKED FREE BLK(S) MISSING IN BIT MAPSphase 5, cg %d/%d%s: NOT LABELED AS A BSD FILE SYSTEM (%s) NCG OUT OF RANGECPG OUT OF RANGENCYL LESS THAN NCG*CPGSBSIZE PREPOSTEROUSLY LARGEILLEGAL BLOCK SIZE IN SUPERBLOCKILLEGAL FRAGMENT SIZE IN SUPERBLOCKoffset %d, original %ld, alternate %ld VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN LAST ALTERNATEINFORMATION; SEE fsck_ffs(8).clean = %d UNDEFINED OPTIMIZATION IN SUPERBLOCKIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE NPSECT=%d IN SUPERBLOCK (FIXED)INCORRECT BMASK=%x IN SUPERBLOCKINCORRECT FMASK=%x IN SUPERBLOCKINCORRECT BSHIFT=%d IN SUPERBLOCKINCORRECT FSHIFT=%d IN SUPERBLOCKFormat of filesystem is too old. Must update to modern format using a version of fsck from before release 5.0 with the command ``fsck -c 2'' INCORRECT MAXFILESIZE=%llu IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%lx IN SUPERBLOCKINCORRECT QFMASK=%lx IN SUPERBLOCKINCONSISTENT CGSIZE=%d INCONSISTENT INOPB=%d INCONSISTENT NINDIR=%d cannot alloc %u bytes for cylinder group summary area cannot alloc %u bytes for inostathead cannot alloc %zu bytes for inpsort cannot alloc %zu bytes for inphead inoinfo: inumber %llu out of rangeCANNOT %s: BLK %lldWRITING %sZERO'ED BLOCK %lld TO DISK UPDATE STANDARD SUPERBLOCK %lld (%lld),   delete %d: %sinsert %d: %ssession database close: %ssession database open: %scannot get kernel security level: %scannot change kernel security level from %d to %d: %sfatal signal: %scan't parse getty for port %scan't allocate windowcan't parse window for port %sport %s changed utmp index from %d to %dcan't fork for window system on port %s: %msetsid failed (window) %mcan't exec window system '%s' for port %s: %mcan't fork for getty on port %s: %mgetty repeating too quickly on port %s, sleepingcan't exec getty '%s' for port %s: %msome processes would not die; ps axl advisedcan't open %s: %mcan't get %s for controlling terminal: %mcannot disable lid suspendcan't exec %s for %s %s: %mautobootcan't exec %s for %s: %mcan't fork for %s on %s: %mwait for %s on %s failed: %m; going to single user modeinit: %s on %s stopped, restarting %s on %s terminated abnormally, going to single user mode/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bincan't exec %s for single user: %mcan't fork single-user shell, trying againwait for single-user shell failed: %m; restartinginit: shell stopped, restarting single user shell terminated.single user shell terminated, restartinginit: %s init: already running initial setsid() failed: %mrootsetlogin() failed: %munrecognized flag '-%c'sfignoring excess argumentsusage: %s [-b block-size] [-c fragments-per-cylinder-group] [-e maxbpg] [-f frag-size] [-i bytes] [-m free-space] [-o options] [-P file] [-s size] special node usage: %s [-Nq] [-b block-size] [-c fragments-per-cylinder-group] [-e maxbpg] [-f frag-size] [-g avgfilesize] [-h avgfpdir] [-i bytes] [-m free-space] [-O filesystem-format] [-o optimization] [-S sector-size] [-s size] [-T disktype] [-t fstype] special ioctl (WDINFO)%s: can't rewrite disk labelinsane maxpartitions value %dP:T:b:c:e:f:i:m:o:s:NO:S:T:b:c:e:f:g:h:i:m:o:qs:t:%s: invalid ffs versionsector size invalid: %sblock size is %s: %sfragments per cylinder group is %s: %sblocks per file in a cylinder group is %s: %sfragment size is %s: %saverage file size is %s: %saverage files per dir is %s: %sbytes per inode is %s: %sfree space %% is %s: %s%s: unknown optimization preference: use `space' or `time'.file system size invalid: %snewfs_%s%s/newfs_%s%s not found%s: getmntinfo: %s%s: not a character-special device%s: can't figure out file system partition%s: `%c' partition is unavailable%s: `%c' partition overlaps boot program%s: no default sector size%s: maximum file system size on the `%c' partition is %lld sectorswarning: changing optimization to space because minfree is less than %d%% setblock bad fs_frag %dclrblock bad fs_frag %disblock bad fs_frag %dwtfs: write error on block %lldrdfs: read error on block %lldcg 0: bad magic numberfirst cylinder group ran out of spaceinternal error: can't find block in cyl 0ilog2: %d is not a power of 2 fsinit: inode value %llu out of rangeinode table does not fit in cylinder grouppanic: cylinder group too big: %d > %dpreposterous size %lld, max is %dpreposterous size %lld, max is %lldblock size must be a power of 2, not %dfragment size must be a power of 2, not %dfragment size %d is too small, minimum is %lldblock size %d is too small, minimum is %dblock size %d is too large, maximum is %dblock size (%d) cannot be smaller than fragment size (%d)fragment size %d is too small, minimum with block size %d is %ddensity reduced from %d to %d bytes per inodecan't honour -c: minimum is %dfile system size %jd < minimum size of %d sectorsreduced number of fragments per cylinder group from %d to %d to enlarge last cylinder groupcalloc failed%s: %.1fMB in %jd sectors of %lld bytes %d cylinder groups of %.2fMB, %d blocks, %d inodes each can't get physmemwarning: fsck_ffs will need %lluMB; min(MAXDSIZ,physmem) is %lluMBsuper-block backups (for fsck -b #) at:cannot allocate I/O bufferfsinit1 failedfsinit2 failed%s: initializing cg %ld/%d checkrm_overwriteusage: %s [-dfiPRr] file ... "." and ".." may not be removedremove %s? override %s%s%s/%s for %s? %s (inode %llu): not overwritten due to multiple links%s: malloc%s: is a directorydfiPRrusage: %s [-t] device usage: %s [-f device] command [count] %d: unknown tape drive type %s tape drive, residual=%d erblocksize: %d (%d) density: %d (%d) ioctl MTIOCGETf:no remote support%s: unknown command%s: illegal countbsfbsrdensityeomfsffsrofflinerewindrewofflretensionweofWriteProtectMounted76543210usage: %s [-p] [-m mode] directory ... m:p\ can not be used as a string delimiternewline can not be used as a string delimiterwhitespace after %sundefined label '%s'RE error: %sunterminated regular expressionexpected context addressunexpected EOF (pending }'s)0123456789/\$command expectedinvalid command code %ccommand %c expects up to %d address(es), found %dunexpected }extra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandfilename expectedw commandread commandbranchempty labelduplicate label '%s'substitute pattern can not be delimited by newline or backslashunterminated substitute pattern123456789\%c not defined in the REunescaped newline inside substitute patternunterminated substitute in regular expressionmore than one number or 'g' in substitute flagsnumber in substitute flags out of rangeno wfile specifiedbad flag in substitute command: '%c'transform pattern can not be delimited by newline or backslashunterminated transform source stringunterminated transform target stringtransform strings are not the same lengthextra text at the end of a transform commandunused label '%s' ..."usage: sed [-aEnru] command [file ...] sed [-aEnru] [-e command] [-f command_file] [file ...] Eae:f:nrustdout: %ssed: %lu: %s: first RE may not be empty\ %03o\%d not defined in the RE\abfrtv, 4@ 8d h D P T ` h p  h t x  $ ,   N c_umaskp* t xD: |0  0 #     Ș И, ؘ@ x" * P$ D:  >   ؤ ܦЫ-a-b-c-d -e-f-G-g-h -H -k-L -n-O-o-p -r-s-S -t-u-w-x-z===!=<>-eq-ne-gt-ge-lt -le!-ef"-nt#-ot$ܙ ptfcdsȚlܚmnpx_modex_search_histkb_addx_bindx_emacs[ n  0( Dh T| ` | x,| { v l Ĝn ̜,d 8H | ܜTb lZm @v u D{ z  $ 4|[ @hz Hj Tj d$l x>= &= ^= |= <<>><=>=<>&& || */%+-&^|? , ~!():hist_initj_printĨШܨdoppromptyylexIFS= ${PS2=> } ${PS3=#? } ${PS4=+ }Сgmatchgetoptionsa cp 0e8@LiXk`lhX؆mtCnfإbupr$0Hsh̭vԭܭxdo_phys_pathshf_vfprintf<Ȱаذ      4E{}    "]]<>!let||&&()str_val X`: p p h t|@(#)PD KSH v5.2.14 99/07/13.2 AAA  Q AA A QBafree: %p not present in area %punable to allocate memorylmmissing options argumentmissing name argument%s: is not an identifierc_getopts: no argvarguments changed since last callOPTARGbad signal `%s'ls:usage: kill [-s signame | -signum | -signame] { job | pid | pgrp } ... kill -l [exit_status ...] %s: arguments must be jobs or process IDs%*d %*s %s%*d %*d %sjob control not enabled%%lpnzno argumentsadtdprtUxalias: -r flag can only be used with -t and without arguments alias %s alias not found L#R#UZ#fi#lprtuxonly -t, -u and -x options may be used with -ffunction %s %T %s() %T %s: not identifiertypeset -i -x -r -t -L%d -R%d -Z -l -u -U exportreadonly%s[%d]pvpvV is a reserved wordexported is an %salias for alias %s= is an exported traced undefined (autoload from %s) function special is a%s shell builtin is a tracked %salias for not found%s is *GOK*Rnprsu,-n-p: %s-u: %s: %sLPcan't get current directory - %srestricted shell - can't cdPWDOLDPWDno home directory (HOME not set)no OLDPWDdon't know current directoryCDPATH%s: bad directory+alias+cd+command*=export+fc+getopts+jobs+killletpwd*=readonly=typeset+unaliaswhence+bg+fgunalias-tainvalid file modeusage: mknod [-m mode] name b|c major minorusage: mknod [-m mode] name ptime: -%s unknown optiontime: -%s requires an argument:p%s%*lld.%02ld%s%s%*lldm%lld.%02lds%sreal real user sys user system fv%s is read only%s: cannot %s%s: can only %s %d level(s)%s: bad numberugorwx%#3.3o augo=+-rwxugoXsbad masktrap -- bad signal %sprsu,nothing to shift*=.*=:[*=break=builtin*=continue*=eval*=exec*=exit+false*=return*=set*=shift=times*=trap+=wait+readtest+trueulimit+umask*=unsetmissing closing parenmissing argumentexpression expectedmissing second argumentmissing expression operatorunexpected operator/operandinternal error: unknown opmissing ]-t-aunlimited unlimitedinvalid limit: %sexceeds allowable limitbad limit: %susage: ulimit [-acdfHlmnpSst] [value]ulimit: %c%-20s time(cpu-seconds)file(blocks)coredump(blocks)data(kbytes)stack(kbytes)lockedmem(kbytes)memory(kbytes)nofiles(descriptors)IFS"#$&'()*:;<=>?[\]`{|};|&()`+@!fileglob: substitute errorFPATH nothing to yank yank something first I-search: duplicate binding for %sPOSIX%s = %s %s = '%s' cannot bind, not a ttyauto-insert%s: no such functioninvalid return codebeginning-of-historycomplete-commandcomplete-filecompletedelete-char-backwarddelete-word-backwarddelete-char-forwarddelete-word-forwardkill-lineredrawend-of-historyeot-or-deletegoto-historymacro-stringkill-to-eolkill-regionlist-commandlist-filequoteyank-popbackward-charbeginning-of-linebackward-wordend-of-lineforward-charforward-wordnewlinedown-historynewline-and-nextno-opup-historyprev-hist-wordsearch-character-forwardsearch-character-backwardsearch-historyset-mark-commandstuffstuff-resettranspose-charsexchange-point-and-markcomplete-listexpand-filecapitalize-worddowncase-wordupcase-wordset-argcomment*+?@! substituteexpand(NULL)%Rfunny $() command: %s%s: cannot open $(<) input%s: parameter not set%S%s: bad substitutionparameter null or not set%*d) %sdbteste_error: %s (offset %d)shcomexec: %shere document missingcan't %s temporary file %s: %sherein: yylexerror writing %s: %sPS4%s%s %s: restricteddupcannot %s %s: %scould not finish (dup) redirection %s: %scoprocess already existsPS3EXECSHELL%s: %s: %sbuiltin: %s: not a builtincommand -p: restricted%s: can't find function definition file - %s%s: can't find function definition file%s: can't open function definition file %s - %s%s: function not defined by %sCFUNC %d%s: cannot execute - %s-rend of expression%s: unexpected `%s'%s: bad number `%s'%s: expression recurses on parameter `%s'%s: %s requires lvalue%s: %s applied to read only variablemissing )zero divisormissing :HISTFILE%s.%dno history (yet)%s: not in history%s: invalid rangehistory functions not available-%c%se:glnrs0,1,2,3,4,5,6,7,8,9,can't use -e, -l, -n, -r with -s (-e -)substitution failedcan't use -l, -n with -e-16%.*s cannot create temp file %s - %serror writing temporary file - %s${FCEDIT:-/bin/ed} $_cannot open temp file %serror reading temp file %s - %sno coprocess%s/shXXXXXXXXbad file descriptorfd not open for readingfd not open for writingillegal file descriptor name%s[%d]: internal error: shl_stdout not validtoo many files open in shellcan't create pipe - try again RunningDoneDone (%d)[%d] %c %5d (core dumped)%s%s %-20s %s%s%s%s%5d %-20s %s%s %s%sremove_job: job not found (%s)notifyj_async: job not startedj_async: bad nzombie (%d)zombiejobsstopped and runningYou have %s%s%s jobs j_waitj: tcsetpgrp(%d, %d) failed: %sjob not job-controlled[%d] | 1st tcsetpgrp(%d, %d) failed: %sfg: 2nd tcsetpgrp(%d, %d) failed: %scannot continue job %s: %sjw:resumejw:waitforwaitlast: no last jobwaitlast: not startedjw:waitlastexchild: XPIPEI and no last_job - pid %dfork failedcannot fork - try againchildexchild: execute() returned[%d]jw:last procj_init: getpgrp() failed: %sj_init: tcgetpgrp() failed: %sj_init: setpgid() failed: %sj_init: tcsetpgrp() failed: %swarning: won't have full job controlcheck_job: job started (flags 0x%x)checkjobno such jobambiguousargument must be %job or process id\%c%a %b %d%l:%M:%S%r~/%sPS1\$PS2missing ] no closing quote here document `%s' unclosed MAILyou have mail in $_shell: %dUse `exit' to leave ksh include: %drshrkshrpdkshpdrkshSH_VERSIONPPIDUSER$ -c requires an argumentCannot determine current working directory/etc/profile$HOME/.profile/etc/suid_profileENVtypesetKSH_VERSION-xOPTIND=1evaltypeset -i RANDOM MAILCHECK="${MAILCHECK-600}" SECONDS="${SECONDS-0}" TMOUT="${TMOUT-0}"hash=alias -ttype=whence -vstop=kill -STOPsuspend=kill -STOP $$autoload=typeset -fufunctions=typeset -fhistory=fc -linteger=typeset -inohup=nohup local=typesetr=fc -e -login=exec login-tUccmailmakeprviwho |&;<>()*@#!$-? =-+?#% "#$&'()*;<>?[\`|0123456789ABCDEF%-*s%*s'\'%s%s-%c: unknown option%s%s-`%c' requires argument%-*s %sA:o;sCurrent option settings -o %s%s: bad optionparse_args: `%c'allexportbraceexpandbgnicecsh-historyemacs-usemetaerrexitgmacsignoreeofinteractivekeywordloginmarkdirsnoclobbernoglobnohupnolognounsetphysicalposixprivilegedtrackallverbosevirawvi-show8vi-tabcompletevi-esccompletextracealnumalphablankcntrldigitgraphlowerpunctupperxdigitshf_flush: no fdshf_emptybuf: no fdshf_write: flags %xshf_write: nbytes %dshf_putchar: flags %xshf_putchar: no fd0123456789abcdef(null %s)shf_ungetc: flags %xshf_fillbuf: no fdshf_getchar: flags %xshf_getse: flags %xshf_read: flags %xshf_read: bsize %dshf_sopen: flags 0x%xshf_snprintf: buf %lx, bsize %dshf_reopen: missing read/writeshf_reopen: bad shf/buf/bsizeshf_fdopen: missing read/writeunmatchedsyntax error: unexpected EOF ?%dsyntax error: `%s' %s unexpectedtoo many <<'s too many redirections for%s: bad identifier %s: invalid function name thenelseelifficaseesacwhileuntildo{[[&&||;;((|&too many varssetexecsig: unset signal %d(%s)ERRError handlerEXITtimed out waiting for inputSIGwdscan: unknown char 0x%x (carrying on)%S #no-vars# #no-args# ( %T) %T| %T%;%T%s %T %S ]] select %s for %s in %;do%N%T%;done case %S in%N(%S%c%;%T%N;;%Nesac if %Tthen%N%Telif %Telse%;%T%;fi %s %T%;do{%;%T%;} %T|& %T& function %s %T%s() %Ttime %T< <<- << >> >| <> <&>&No controlling tty (open /dev/tty: %s)Can't find tty file descriptorj_ttyinit: dup of tty fd failed: %sj_ttyinit: can't set close-on-exec flag: %s%0*s%.*s%*s%.*s%s: subscript %ld out of range%s: is read onlysetstr: %s=%s: assigning to self0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789abcdefghijklmnopqrstuvwxyzOPTINDPOSIXLY_CORRECTHISTSIZEMAILCHECKMAILPATHRANDOMSECONDSTMOUTLINENOM-grabhist: bad history arrayy$%s %dfc -e ${VISUAL:-${EDITOR:-vi}} --derive_key_pkcsbio_diskinqbio_createflagsbio_parse_devliststr2locatorbio_changepassbio_deleteraidbio_createraidbio_blinkbio_setblinkbio_getvolbynamebio_setstatebio_alarmbio_inqmainInvalid keyInvalid saltToo few rounds: %dcan't specify passphrase file during initial creation of crypto volumeinvalid passphrase filecan't stat passphrase filepassphrase file must be owned by rootpassphrase file has the wrong permissionscan't read passphrase fileinvalid passphrase lengthunable to read passphraseRe-type passphrase: Passphrases did not matchpbkdf2 failedinvalid KDF infoinvalid KDF hintKDF hint has invalid sizeunknown KDF type %dnumber of KDF rounds too low: %dDIOCINQ%s: <%s, %s, %s>, serial %s invalid flags listinvalid flag %sinvalid device listcould not open %scould not stat %stoo many devices on device listduplicate device in listNew passphrase: invalid AOE dev list: use nic,dsteaddr,shelf,slottarget not specifiedunknown errorBIOCDISCIPLINEOld passphrase: BIOCDELETERAIDno devices specifiednot enough memory for dev_t listunsupported raid levelnot enough disksnot exactly one partitionioctlPassphrase: BIOCCREATERAID/dev/bioCan't locate %s device via %sBIOCBLINKTarget %s: %sBIOCINQBIOCVOLBIOCDISKDisk %s is not in an enclosureDisk %s does not existinvalid device %sBIOCSETSTATEinvalid alarm function: %sBIOCALARMalarm is currently %s %-11s %-10s %14s %-8s VolumeStatusSizeDevice %d%% done %u secondsScrubbingInvalidOnlineOfflineDegradedBuildingRebuild%s %u%14llu%11s %-10s %14s %-7s CRYPTO%s%s %11s %-10s %14s %-7s CONCAT%s%s %11s %-10s %14s %-7s RAID%u%s%s FailedHot spareUnused %3u%14skey disk%u:%u.%unoenclunknown serial%11s %-10s %14s %-7s %-6s <%s> %7s %-10s %14s %-7s %-6s '%s' usage: %s [-hiqv] [-a alarm-function] [-b channel:target[.lun]] [-H channel:target[.lun]] [-R device | channel:target[.lun]] [-u channel:target[.lun]] device %s [-dhiPqsv] [-C flag[,flag,...]] [-c raidlevel] [-k keydisk] [-l special[,special,...]] [-O device | channel:target[.lun]] [-p passfile] [-R device | channel:target[.lun]] [-r rounds] device Invalid RAID levelNumber of rounds is %s: %sa:b:C:c:dH:hik:l:O:Pp:qr:R:svu:need deviceneed -c parameterneed -l parametermust use bio deviceusage: %s seconds do_movemainusage: %s [-fi] source target %s [-fi] source ... directory /bin/cp-PRp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status/bin/rm-rf%s: remove%s: set owner/group; not setting setuid/setgid%s: set owner/group%s: set mode%s: set flags%s: set timesrename %s to %scannot resolve %scannot rename a mount pointcan't remove %s%s: destination pathname too longeval5syntax error|&=<>+-*/%:()non-numeric argumentdivision by zerousage: %s [-M core] [-N system] M:N:sysctl: KERN_MSGBUFSIZEcouldn't allocate space for buffer datasysctl: KERN_MSGBUFmainusage: %s [-s] [name-of-host] sethostnamegethostname/etc/networks/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxqg jgrn<:ORQhك[0.0.0.0::::1/etc/group/etc/spwd.db/etc/pwd.db/etc/ethers%02x:%02x:%02x:%02x:%02x:%02x  0123456789ABCDEF0123456789abcdefnanNANinfINF(null)bug in vfprintf: bad base HOSTALIASES/etc/hosts;#nameserverlookupypsearchinet4ndots:RES_OPTIONSoptions LOCALDOMAINsearch lookup bind filenameserver 127.0.0.1ASR_CONFIGlookup file %d.%d.%d.%d.in-addr.arpa.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.ip6.arpa.no spacebad domain namedomain name too longbad dlenlogout/var/run/utmpimsg_readmsgbuf_writereadlabelfs[[[[[[[|[[[[[[[/dev/diskmap%sr%s%s: not a device node%s: couldn't read disklabel%s: bad filesystem type in label%s%s%s%c%s%s%slogin_protect%s: %s: %m/etc/fbtab/*%s: chmod(%s): %m%s: chown(%s): %m%s: opendir(%s): %m%o%s: bad entry: %s@BKMGTPE0B%lld%c%lld.%1lld%clogwtmp/var/log/wtmphmac_sha1pkcs5_pbkdf2\\#tgetentTERMCAP/usr/share/misc/termcapTERMPATH.termcap /usr/share/misc/termcapOOPS5MS7) longjmp botch. inet6_rth_reverseargument buffer overflowunknown/invalid errorno errorinvalid value for ai_flagsname or service is not knowntemporary failure in name resolutionnon-recoverable failure in name resolutionno address associated with nameai_family not supportedai_socktype not supportedservice not supported for ai_socktypeaddress family for name not supportedmemory allocation failureinvalid value for hintsresolved protocol is unknownfstabscanxxswinet_net_ptoninet_net_pton_ipv401234567890123456789abcdef/usr/src/lib/libc/net/inet_net_pton.cn >= 0 && n <= 15n >= 0 && n <= 9assertion "%s" failed: file "%s", line %d, function "%s" assertion "%s" failed: file "%s", line %d %u.%u.%u.%uSHA256EndSHA256DataSHA256FileChunk0123456789abcdef$(,08@DHPT\`hHp4t|Signal 0HUPINTILLTRAPABRTEMTFPEKILLBUSSEGVSYSPIPEALRMURGTSTPCONTCHLDTTINTTOUIOXCPUXFSZVTALRMPROFWINCHUSR1USR2THR$[:<:]][:>:]]ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ !"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789ABCDEFabcdefNULSOHSTXETXEOTENQBELalertBSbackspaceHTtabLFVTvertical-tabFFform-feedCRcarriage-returnSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBIS4IS3GSIS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoponetwothreefourfivesixseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDEL  08 ,nosappndnosappendnoarchnoarchivednoschgnoschangenosimmutablenouappndnouappendnouchgnouchangenouimmutablenodumpnoopaqueBLOCKSIZE%s: unknown blocksizemaximum blocksize is %dG%s: minimum blocksize is 512%ld%s-blocksx|%m/%d/%y%Y-%m-%d%H:%M%I:%M:%S %p%H:%M:%SESTCSTMSTPSTEDTCDTMDTPDTABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/regerrorREG_0x%xREG_NOMATCHregexec() failed to matchREG_BADPATinvalid regular expressionREG_ECOLLATEinvalid collating elementREG_ECTYPEinvalid character classREG_EESCAPEREG_ESUBREGinvalid backreference numberREG_EBRACKbrackets ([ ]) not balancedREG_EPARENparentheses not balancedREG_EBRACEbraces not balancedREG_BADBRinvalid repetition count(s)REG_ERANGEinvalid character rangeREG_ESPACEREG_BADRPTrepetition-operator operand invalidREG_EMPTYempty (sub)expressionREG_ASSERT"can't happen" -- you found a bugREG_INVARGinvalid argument to regex routine*** unknown regexp error code ***/etc/ttyssecurertsctssoftcarwindowttyname_r/var/run/dev.dbPOSIX_V6_ILP32_OFFBIGPOSIX_V7_ILP32_OFFBIG-lpthreadreadpassphrasetcsetattrglob2authunix_createauthunix_create_defaultauth_none.c - Fatal marshalling problemauthunix_create: out of memory $0LT`t(8Ph$0LT`t(8PhHangupInterruptQuitIllegal instructionTrace/BPT trapAbort trapEMT trapFloating point exceptionKilledBus errorSegmentation faultBad system callBroken pipeAlarm clockTerminatedUrgent I/O conditionSuspended (signal)SuspendedContinuedChild exitedStopped (tty input)Stopped (tty output)I/O possibleCputime limit exceededFilesize limit exceededVirtual timer expiredProfiling timer expiredWindow size changesInformation requestUser defined signal 1User defined signal 2Thread ASTunknown option -- %coption requires an argument -- %cambiguous option -- %.*soption doesn't take an argument -- %.*soption requires an argument -- %sunknown option -- %s/etc/services,/asprintf%h %e %T clnttcp_create: out of memory hb0b1ncdtscsbpxbxfxoxtxdxgetentcgetnext%s.dbtc|:/etc/protocolsSHA1TransformSHA1Padexecvpeexeclpexecleexeclexecvp: : path too long xdr_array: out of memory  (DXp<Xl (@\xRPC: (unknown error code)%s: %s - %s ; errno = %s; low version = %u, high version = %u; why = (unknown authentication error - %d); s1 = %u, s2 = %uRPC: SuccessRPC: Can't encode argumentsRPC: Can't decode resultRPC: Unable to sendRPC: Unable to receiveRPC: Timed outRPC: Incompatible versions of RPCRPC: Authentication errorRPC: Program unavailableRPC: Program/version mismatchRPC: Procedure unavailableRPC: Server can't decode argumentsRPC: Remote system errorRPC: Unknown hostRPC: Port mapper failureRPC: Program not registeredRPC: Failed (unspecified error)RPC: Unknown protocolAuthentication OKInvalid client credentialServer rejected credentialInvalid client verifierServer rejected verifierClient credential too weakInvalid server verifierFailed (unspecified error)perrorxdrrec_create: out of memory   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~realpathؗҜ<3#I9=D2[%Cod(hinityanMD5Pad0123456789abcdefInfinityNaNPX`^[Yy]^[Nn]yes646NONEUTF8(,048<@DLT\ht| $(@l`SunMonTueWedThuFriSatSundayMondayTuesdayWednesdayThursdayFridaySaturdayJanFebMarAprMayJunJulAugSepOctNovDecJanuaryFebruaryMarchAprilJuneJulyAugustSeptemberOctoberNovemberDecemberAMPM%a %b %e %H:%M:%S %Y__stack_smash_handlerstack overflow in function %sconnectlog_r__vsyslog_r/dev/log_rsyslog%s: unknown facility/priority: %x<%d>[%ld]Error %dlibcUnknown signal: Unknown error: _catopenNLSPATH/usr/share/nls/%L/%N.cat:/usr/share/nls/%l.%c/%N.cat:/usr/share/nls/%l/%N.catLC_ALLLC_MESSAGESLANG(<Tp4HTlx$DTd|,Ll $Dt8Tp0@Th|0L`|$8dxUndefined error: 0Operation not permittedNo such file or directoryNo such processInterrupted system callInput/output errorDevice not configuredArgument list too longExec format errorBad file descriptorNo child processesResource deadlock avoidedPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkOperation not supported by deviceNot a directoryIs a directoryInvalid argumentToo many open files in systemToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksNumerical argument out of domainResult too largeResource temporarily unavailableOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not availableProtocol not supportedSocket type not supportedOperation not supportedProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceOperation timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downNo route to hostDirectory not emptyToo many processesToo many usersDisk quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticatorIPsec processing failureAttribute not foundIllegal byte sequenceNo medium foundWrong medium typeValue too large to be stored in data typeOperation canceledIdentifier removedNo message of desired typeNot supported$0LT`t(8Phvsnprintf !#&(*-/14[[[[[[[[[ABCDEF7yACnF?O8M20HwZ?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ inet_pton01234567890123456789ABCDEF0123456789abcdef""too small ((((( AAAAAABBBBBB   !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~%$sniglet^&isatty__put_page%s/_hash.XXXXXXHASH: Out of overflow pages. Increase page size tzloadmnGMT/etc/localtime/usr/share/zoneinfoposixrules,M4.1.0,M10.5.0abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789 :+-._Local time zone must be set--see zic manual pageasctime3JanFebMarAprMayJunJulAugSepOctNovDecSunMonTueWedThuFriSat??? ??? ?? ??:??:?? ???? %.3s %.3s%3d %2.2d:%2.2d:%2.2d %-4s %.3s %.3s%3d %2.2d:%2.2d:%2.2d %s _conv_fmt(,048<@DLT\ht|l@\ $L-0%2d%03d%e-%b-%Y%04d%a %b %e %T %Ywrterrormalloc_initmalloc() warning: unknown char in MALLOC_OPTIONS recursive callregions_total not 2^xinternal struct corruptmunmap/etc/malloc.confMALLOC_OPTIONSmalloc init mmap failedmunmap roundmalloc cache underflowmalloc free slot lostmalloc cache overflowbogus pointer (double free?)bogus pointerguard sizemprotectchunk info corruptedmodified chunk-pointerchunk is already free in free():free() called before allocationmap roundmalloc cachepp & bits in posix_memalign():mapalign bad alignmentmapalign round in calloc(): in realloc(): in malloc():arc4_stirsnprintf[<0̣,ܣ`x  ,04n<LH,wLlXp`h-p{x(jD|ttt4Ȥ4Ф ؤPO   Lx $ Y, Y4 Y<c(3 HN P T X ` Ȫ h $ l p x     unblock and -DNO_CONV?@x[[[в[[7[[   ([4,@@[T``[[lh1м|^t0 Non-system disk Press any key to reboot NB:F:I:L:O:S:a:b:c:e:f:h:i:k:m:n:o:qr:s:t:u:`ت8hT8PH /tmp/EdDk.aXXXXXXXXXX$,08@0HPX`hptx$pop  6 !$ !0 &'d U4L$!$ !&'d U(6nT!!! !&'d U06n !!!  &'d U0(Ľ(SP(S8d86(|THd@8/.? ɚ; S ...T$(,04CDCdCTCChFFFPč.ĈԈ.dA"" e j    ky ( JKYdu f    bv z!w" (F2R r u'g <<p%[)]*())* * ){{}}{}(())()[[]][]#$G>> P30123456789.=:f/?/*?*n+n,N-N.&7m'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !+ Hh VqQ:q:QZZ    l h b  w  i x X      0  $  k  j  is not a regular file (use -f to see it) is a directory  aP(bP@p)PpBPcPxdPA8TePTlfPԮFP\gP@`hPXܯiPP( 8jP+`pJP!hKPLP mP8HXnP"td|pPH$*PP$)qPLrP"$HlsP!`IJSP!uP"ę0LVP\(wP"dxP(&XPA 4yP|TlzP"P%ȴ~P!lԴ?P%#Px*,PA8HPd`P̵... (interrupt to abort) (press RETURN)4444 Ȏмظ11"t €u6Uu|agPtPS[X!Using drive X, partition YMBR on floppy or old BIOS Read error No O/S No active partition OxU`4TP<XĨ`x @ 4<X,`<$4 \tQ@ AB;CܨDE FG,HXUPtVpa<b|~cHefPh\ihL|lnqqrsvwxulh $08؀@DpL l T \ d h،tx4̂X|؆ !X"#$%&'u( )*+,-./0 123$45607[<Pl(Hh ,T priorityrttvarrttssthreshsendpiperecvpipeexpirehopcountmtuUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CLONING XRESOLVE LLINFO STATIC BLACKHOLEPROTO3PROTO2PROTO1CLONEDSOURCEMPATHMPLSUPBROADCASTDEBUGLOOPBACKPTPNOTRAILERSRUNNINGNOARP PPROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD SRC SRCMASK LABEL<NOOP (:L X||F[h&( 0(EHC P E(  0(EHDHC |JH$[ S ... ...dX_X_X_X`I 8D,PT\hpx@@@@%s: can't read disk label; disk type must be specified......\~~~$~   ~~~~~T~~@~~{}abcdDgGhHilnNpPqrs tw xy !:#=2 2 PС`JȀ ,<TlȫԫȀH$pLplP$h++ ,(0,0X,8,@, ,H, x -PH-Xp-] _ xx:xx:xx:xx:xx:xx0000000000000000 ̬[<[ [(t[00[8[@[ [Ht[ x[P[X[[.      ( , 8 < LPTX\`dhlptx|H x !"#$%&'()(*4+@,H-P-`.h.$/4/0t1x2|3456789:;<=>?@ [ \,\<]T^`^t__`{{|}}~GMT4@\hK 4@ \h |  P? (4Xd[++ ,(0,0X,8,@, ,H, x -PH-Xp-\`lp?[x $,08@0HPX`hptx$pop mflTnxppPenkh455@RuneCT10NONEBBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~d0 (08@ H x@PX\@T 4x\ltĸ8:ltĸL; @ltĸ`<\LHHHdLH4RQ8R@RHR0V U0YXlX XWWXVVTWlX XWWWV `` 11P`Ђ.shstrtab.init.text.fini.rodata.openbsd.randomdata.data.eh_frame.jcr.gotpad0.got.ctors.dtors.gotpad1.bss.stack.arm.atpcs.note.openbsd.ident pp ``"tt#`%$9$$PM?ttIxxN|QW|Q|$\Q cQjQs]xTTwheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root bin:*:7: news:*:8: wsrc:*:9: users:*:10: auth:*:11: games:*:13: staff:*:20:root smmsp:*:25: popa3d:*:26: sshd:*:27: _portmap:*:28: _identd:*:29: _rstatd:*:30: guest:*:31:root _rusersd:*:32: _fingerd:*:33: _sshagnt:*:34: _x11:*:35: utmp:*:45: _kdc:*:59: _kadmin:*:60: _lkm:*:61: _spamd:*:62: _radius:*:63: _token:*:64: _shadow:*:65: crontab:*:66: www:*:67: _isakmpd:*:68: network:*:69: named:*:70: proxy:*:71: authpf:*:72: _syslogd:*:73: _pflogd:*:74: _bgpd:*:75: _tcpdump:*:76: _dhcp:*:77: _mopd:*:78: _tftpd:*:79: _rbootd:*:80: _afs:*:81: _ppp:*:82: _ntp:*:83: _ftp:*:84: _ospfd:*:85: _hostapd:*:86: _dvmrpd:*:87: _ripd:*:88: _relayd:*:89: _ospf6d:*:90: _snmpd:*:91: _rtadvd:*:92: _ypldap:*:93: _btd:*:94: _smtpd:*:95: _rwalld:*:96: _nsd:*:97: _ldpd:*:98: _sndio:*:99: _ldapd:*:100: _iked:*:101: _iscsid:*:102: dialer:*:117: nogroup:*:32766: nobody:*:32767: ftp-data 20/tcp ftp 21/tcp domain 53/tcp nameserver domain 53/udp nameserver www 80/tcp http shell 514/tcp cmd nfsd 2049/udp nfs nfsd 2049/tcp nfs / right/Indian/Antananarivo right/Indian/Chagos right/Indian/Christmas right/Indian/Cocos right/Indian/Comoro right/Indian/Kerguelen right/Indian/Mahe right/Indian/Maldives right/Indian/Mauritius right/Indian/Mayotte right/Indian/Reunion right/Iran right/Israel right/Jamaica right/Japan right/Kwajalein right/Libya right/MET right/MST right/MST7MDT right/Mexico/ right/Mexico/BajaNorte right/Mexico/BajaSur right/Mexico/General right/Mideast/ right/Mideast/Riyadh87 right/Mideast/Riyadh88 right/Mideast/Riyadh89 right/NZ right/NZ-CHAT right/Navajo right/PRC right/PST8PDT right/Pacific/ right/Pacific/Apia right/Pacific/Auckland right/Pacific/Chatham right/Pacific/Chuuk right/Pacific/Easter right/Pacific/Efate right/Pacific/Enderbury right/Pacific/Fakaofo right/Pacific/Fiji right/Pacific/Funafuti right/Pacific/Galapagos right/Pacific/Gambier right/Pacific/Guadalcanal right/Pacific/Guam right/Pacific/Honolulu right/Pacific/Johnston right/Pacific/Kiritimati right/Pacific/Kosrae right/Pacific/Kwajalein right/Pacific/Majuro right/Pacific/Marquesas right/Pacific/Midway right/Pacific/Nauru right/Pacific/Niue right/Pacific/Norfolk right/Pacific/Noumea right/Pacific/Pago_Pago right/Pacific/Palau right/Pacific/Pitcairn right/Pacific/Pohnpei right/Pacific/Ponape right/Pacific/Port_Moresby right/Pacific/Rarotonga right/Pacific/Saipan right/Pacific/Samoa right/Pacific/Tahiti right/Pacific/Tarawa right/Pacific/Tongatapu right/Pacific/Truk right/Pacific/Wake right/Pacific/Wallis right/Pacific/Yap right/Poland right/Portugal right/ROC right/ROK right/Singapore right/Turkey right/UCT right/US/ right/US/Alaska right/US/Aleutian right/US/Arizona right/US/Central right/US/East-Indiana right/US/Eastern right/US/Hawaii right/US/Indiana-Starke right/US/Michigan right/US/Mountain right/US/Pacific right/US/Pacific-New right/US/Samoa right/UTC right/Universal right/W-SU right/WET right/Zulu bin*Binaries Commands and Source//sbin/nologin1bintrootdaemonCharlie &/root/bin/ksh2rootdaemonCharlie &/root/bin/ksh3]Xdaemon*The devil himself/root/sbin/nologin2daemon*The devil himself/root/sbin/nologin3nobody*Unprivileged user for NFS/nonexistent/sbin/nologin1nobody vm,'> >operator*System &/operator/sbin/nologin2uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Boperator*System &/operator/sbin/nologin3operator*System &/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonrootdaemonCharlie &/root/bin/ksh1rootQLbin*Binaries Commands and Source//sbin/nologin2bin*Binaries Commands and Source//sbin/nologin3uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucpTFTuucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2_dhcp*MMDHCP programs/var/empty/sbin/nologin1_dhcpn`n_dhcp*MMDHCP programs/var/empty/sbin/nologin2_dhcp*MMDHCP programs/var/empty/sbin/nologin3MPBPnobody*Unprivileged user for NFS/nonexistent/sbin/nologin2nobody*Unprivileged user for NFS/nonexistent/sbin/nologin3a  n}bin*Binaries Commands and Source//sbin/nologin1binrrootdaemonCharlie &/root/bin/kshn2rootdaemonCharlie &/root/bin/kshn3]Xdaemon*The devil himself/root/sbin/nologin2daemon*The devil himself/root/sbin/nologin3nobody*Unprivileged user for NFS/nonexistent/sbin/nologin1nobody ul+&~==operator*System &/operator/sbin/nologin2uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Boperator*System &/operator/sbin/nologin3operator*System &/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonrootdaemonCharlie &/root/bin/ksh1rootQLbin*Binaries Commands and Source//sbin/nologin2bin*Binaries Commands and Source//sbin/nologin3uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucpTFTuucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2_dhcp*MMDHCP programs/var/empty/sbin/nologin1_dhcpn`n_dhcp*MMDHCP programs/var/empty/sbin/nologin2_dhcp*MMDHCP programs/var/empty/sbin/nologin3MPBPnobody*Unprivileged user for NFS/nonexistent/sbin/nologin2nobody*Unprivileged user for NFS/nonexistent/sbin/nologin3a  n}Africa/ Africa/Abidjan Africa/Accra Africa/Addis_Ababa Africa/Algiers Africa/Asmara Africa/Asmera Africa/Bamako Africa/Bangui Africa/Banjul Africa/Bissau Africa/Blantyre Africa/Brazzaville Africa/Bujumbura Africa/Cairo Africa/Casablanca Africa/Ceuta Africa/Conakry Africa/Dakar Africa/Dar_es_Salaam Africa/Djibouti Africa/Douala Africa/El_Aaiun Africa/Freetown Africa/Gaborone Africa/Harare Africa/Johannesburg Africa/Juba Africa/Kampala Africa/Khartoum Africa/Kigali Africa/Kinshasa Africa/Lagos Africa/Libreville Africa/Lome Africa/Luanda Africa/Lubumbashi Africa/Lusaka Africa/Malabo Africa/Maputo Africa/Maseru Africa/Mbabane Africa/Mogadishu Africa/Monrovia Africa/Nairobi Africa/Ndjamena Africa/Niamey Africa/Nouakchott Africa/Ouagadougou Africa/Porto-Novo Africa/Sao_Tome Africa/Timbuktu Africa/Tripoli Africa/Tunis Africa/Windhoek America/ America/Adak America/Anchorage America/Anguilla America/Antigua America/Araguaina America/Argentina/ America/Argentina/Buenos_Aires America/Argentina/Catamarca America/Argentina/ComodRivadavia America/Argentina/Cordoba America/Argentina/Jujuy America/Argentina/La_Rioja America/Argentina/Mendoza America/Argentina/Rio_Gallegos America/Argentina/Salta America/Argentina/San_Juan America/Argentina/San_Luis America/Argentina/Tucuman America/Argentina/Ushuaia America/Aruba America/Asuncion America/Atikokan America/Atka America/Bahia America/Bahia_Banderas America/Barbados America/Belem America/Belize America/Blanc-Sablon America/Boa_Vista America/Bogota America/Boise America/Buenos_Aires America/Cambridge_Bay America/Campo_Grande America/Cancun America/Caracas America/Catamarca America/Cayenne America/Cayman America/Chicago America/Chihuahua America/Coral_Harbour America/Cordoba America/Costa_Rica America/Creston America/Cuiaba America/Curacao America/Danmarkshavn America/Dawson America/Dawson_Creek America/Denver America/Detroit America/Dominica America/Edmonton America/Eirunepe America/El_Salvador America/Ensenada America/Fort_Wayne America/Fortaleza America/Glace_Bay America/Godthab America/Goose_Bay America/Grand_Turk America/Grenada America/Guadeloupe America/Guatemala America/Guayaquil America/Guyana America/Halifax America/Havana America/Hermosillo America/Indiana/ America/Indiana/Indianapolis America/Indiana/Knox America/Indiana/Marengo America/Indiana/Petersburg America/Indiana/Tell_City America/Indiana/Vevay America/Indiana/Vincennes America/Indiana/Winamac America/Indianapolis America/Inuvik America/Iqaluit America/Jamaica America/Jujuy America/Juneau America/Kentucky/ America/Kentucky/Louisville America/Kentucky/Monticello America/Knox_IN America/Kralendijk America/La_Paz America/Lima America/Los_Angeles America/Louisville America/Lower_Princes America/Maceio America/Managua America/Manaus America/Marigot America/Martinique America/Matamoros America/Mazatlan America/Mendoza America/Menominee America/Merida America/Metlakatla America/Mexico_City America/Miquelon America/Moncton America/Monterrey America/Montevideo America/Montreal America/Montserrat America/Nassau America/New_York America/Nipigon America/Nome America/Noronha America/North_Dakota/ America/North_Dakota/Beulah America/North_Dakota/Center America/North_Dakota/New_Salem America/Ojinaga America/Panama America/Pangnirtung America/Paramaribo America/Phoenix America/Port-au-Prince America/Port_of_Spain America/Porto_Acre America/Porto_Velho America/Puerto_Rico America/Rainy_River America/Rankin_Inlet America/Recife America/Regina America/Resolute America/Rio_Branco America/Rosario America/Santa_Isabel America/Santarem America/Santiago America/Santo_Domingo America/Sao_Paulo America/Scoresbysund America/Shiprock America/Sitka America/St_Barthelemy America/St_Johns America/St_Kitts America/St_Lucia America/St_Thomas America/St_Vincent America/Swift_Current America/Tegucigalpa America/Thule America/Thunder_Bay America/Tijuana America/Toronto America/Tortola America/Vancouver America/Virgin America/Whitehorse America/Winnipeg America/Yakutat America/Yellowknife Antarctica/ Antarctica/Casey Antarctica/Davis Antarctica/DumontDUrville Antarctica/Macquarie Antarctica/Mawson Antarctica/McMurdo Antarctica/Palmer Antarctica/Rothera Antarctica/South_Pole Antarctica/Syowa Antarctica/Vostok Arctic/ Arctic/Longyearbyen Asia/ Asia/Aden Asia/Almaty Asia/Amman Asia/Anadyr Asia/Aqtau Asia/Aqtobe Asia/Ashgabat Asia/Ashkhabad Asia/Baghdad Asia/Bahrain Asia/Baku Asia/Bangkok Asia/Beirut Asia/Bishkek Asia/Brunei Asia/Calcutta Asia/Choibalsan Asia/Chongqing Asia/Chungking Asia/Colombo Asia/Dacca Asia/Damascus Asia/Dhaka Asia/Dili Asia/Dubai Asia/Dushanbe Asia/Gaza Asia/Harbin Asia/Hebron Asia/Ho_Chi_Minh Asia/Hong_Kong Asia/Hovd Asia/Irkutsk Asia/Istanbul Asia/Jakarta Asia/Jayapura Asia/Jerusalem Asia/Kabul Asia/Kamchatka Asia/Karachi Asia/Kashgar Asia/Kathmandu Asia/Katmandu Asia/Khandyga Asia/Kolkata Asia/Krasnoyarsk Asia/Kuala_Lumpur Asia/Kuching Asia/Kuwait Asia/Macao Asia/Macau Asia/Magadan Asia/Makassar Asia/Manila Asia/Muscat Asia/Nicosia Asia/Novokuznetsk Asia/Novosibirsk Asia/Omsk Asia/Oral Asia/Phnom_Penh Asia/Pontianak Asia/Pyongyang Asia/Qatar Asia/Qyzylorda Asia/Rangoon Asia/Riyadh Asia/Riyadh87 Asia/Riyadh88 Asia/Riyadh89 Asia/Saigon Asia/Sakhalin Asia/Samarkand Asia/Seoul Asia/Shanghai Asia/Singapore Asia/Taipei Asia/Tashkent Asia/Tbilisi Asia/Tehran Asia/Tel_Aviv Asia/Thimbu Asia/Thimphu Asia/Tokyo Asia/Ujung_Pandang Asia/Ulaanbaatar Asia/Ulan_Bator Asia/Urumqi Asia/Ust-Nera Asia/Vientiane Asia/Vladivostok Asia/Yakutsk Asia/Yekaterinburg Asia/Yerevan Atlantic/ Atlantic/Azores Atlantic/Bermuda Atlantic/Canary Atlantic/Cape_Verde Atlantic/Faeroe Atlantic/Faroe Atlantic/Jan_Mayen Atlantic/Madeira Atlantic/Reykjavik Atlantic/South_Georgia Atlantic/St_Helena Atlantic/Stanley Australia/ Australia/ACT Australia/Adelaide Australia/Brisbane Australia/Broken_Hill Australia/Canberra Australia/Currie Australia/Darwin Australia/Eucla Australia/Hobart Australia/LHI Australia/Lindeman Australia/Lord_Howe Australia/Melbourne Australia/NSW Australia/North Australia/Perth Australia/Queensland Australia/South Australia/Sydney Australia/Tasmania Australia/Victoria Australia/West Australia/Yancowinna Brazil/ Brazil/Acre Brazil/DeNoronha Brazil/East Brazil/West CET CST6CDT Canada/ Canada/Atlantic Canada/Central Canada/East-Saskatchewan Canada/Eastern Canada/Mountain Canada/Newfoundland Canada/Pacific Canada/Saskatchewan Canada/Yukon Chile/ Chile/Continental Chile/EasterIsland Cuba EET EST EST5EDT Egypt Eire Etc/ Etc/GMT Etc/GMT+0 Etc/GMT+1 Etc/GMT+10 Etc/GMT+11 Etc/GMT+12 Etc/GMT+2 Etc/GMT+3 Etc/GMT+4 Etc/GMT+5 Etc/GMT+6 Etc/GMT+7 Etc/GMT+8 Etc/GMT+9 Etc/GMT-0 Etc/GMT-1 Etc/GMT-10 Etc/GMT-11 Etc/GMT-12 Etc/GMT-13 Etc/GMT-14 Etc/GMT-2 Etc/GMT-3 Etc/GMT-4 Etc/GMT-5 Etc/GMT-6 Etc/GMT-7 Etc/GMT-8 Etc/GMT-9 Etc/GMT0 Etc/Greenwich Etc/UCT Etc/UTC Etc/Universal Etc/Zulu Europe/ Europe/Amsterdam Europe/Andorra Europe/Athens Europe/Belfast Europe/Belgrade Europe/Berlin Europe/Bratislava Europe/Brussels Europe/Bucharest Europe/Budapest Europe/Busingen Europe/Chisinau Europe/Copenhagen Europe/Dublin Europe/Gibraltar Europe/Guernsey Europe/Helsinki Europe/Isle_of_Man Europe/Istanbul Europe/Jersey Europe/Kaliningrad Europe/Kiev Europe/Lisbon Europe/Ljubljana Europe/London Europe/Luxembourg Europe/Madrid Europe/Malta Europe/Mariehamn Europe/Minsk Europe/Monaco Europe/Moscow Europe/Nicosia Europe/Oslo Europe/Paris Europe/Podgorica Europe/Prague Europe/Riga Europe/Rome Europe/Samara Europe/San_Marino Europe/Sarajevo Europe/Simferopol Europe/Skopje Europe/Sofia Europe/Stockholm Europe/Tallinn Europe/Tirane Europe/Tiraspol Europe/Uzhgorod Europe/Vaduz Europe/Vatican Europe/Vienna Europe/Vilnius Europe/Volgograd Europe/Warsaw Europe/Zagreb Europe/Zaporozhye Europe/Zurich Factory GB GB-Eire GMT GMT+0 GMT-0 GMT0 Greenwich HST Hongkong Iceland Indian/ Indian/Antananarivo Indian/Chagos Indian/Christmas Indian/Cocos Indian/Comoro Indian/Kerguelen Indian/Mahe Indian/Maldives Indian/Mauritius Indian/Mayotte Indian/Reunion Iran Israel Jamaica Japan Kwajalein Libya MET MST MST7MDT Mexico/ Mexico/BajaNorte Mexico/BajaSur Mexico/General Mideast/ Mideast/Riyadh87 Mideast/Riyadh88 Mideast/Riyadh89 NZ NZ-CHAT Navajo PRC PST8PDT Pacific/ Pacific/Apia Pacific/Auckland Pacific/Chatham Pacific/Chuuk Pacific/Easter Pacific/Efate Pacific/Enderbury Pacific/Fakaofo Pacific/Fiji Pacific/Funafuti Pacific/Galapagos Pacific/Gambier Pacific/Guadalcanal Pacific/Guam Pacific/Honolulu Pacific/Johnston Pacific/Kiritimati Pacific/Kosrae Pacific/Kwajalein Pacific/Majuro Pacific/Marquesas Pacific/Midway Pacific/Nauru Pacific/Niue Pacific/Norfolk Pacific/Noumea Pacific/Pago_Pago Pacific/Palau Pacific/Pitcairn Pacific/Pohnpei Pacific/Ponape Pacific/Port_Moresby Pacific/Rarotonga Pacific/Saipan Pacific/Samoa Pacific/Tahiti Pacific/Tarawa Pacific/Tongatapu Pacific/Truk Pacific/Wake Pacific/Wallis Pacific/Yap Poland Portugal ROC ROK Singapore Turkey UCT US/ US/Alaska US/Aleutian US/Arizona US/Central US/East-Indiana US/Eastern US/Hawaii US/Indiana-Starke US/Michigan US/Mountain US/Pacific US/Pacific-New US/Samoa UTC Universal W-SU WET Zulu posix/ posix/Africa/ posix/Africa/Abidjan posix/Africa/Accra posix/Africa/Addis_Ababa posix/Africa/Algiers posix/Africa/Asmara posix/Africa/Asmera posix/Africa/Bamako posix/Africa/Bangui posix/Africa/Banjul posix/Africa/Bissau posix/Africa/Blantyre posix/Africa/Brazzaville posix/Africa/Bujumbura posix/Africa/Cairo posix/Africa/Casablanca posix/Africa/Ceuta posix/Africa/Conakry posix/Africa/Dakar posix/Africa/Dar_es_Salaam posix/Africa/Djibouti posix/Africa/Douala posix/Africa/El_Aaiun posix/Africa/Freetown posix/Africa/Gaborone posix/Africa/Harare posix/Africa/Johannesburg posix/Africa/Juba posix/Africa/Kampala posix/Africa/Khartoum posix/Africa/Kigali posix/Africa/Kinshasa posix/Africa/Lagos posix/Africa/Libreville posix/Africa/Lome posix/Africa/Luanda posix/Africa/Lubumbashi posix/Africa/Lusaka posix/Africa/Malabo posix/Africa/Maputo posix/Africa/Maseru posix/Africa/Mbabane posix/Africa/Mogadishu posix/Africa/Monrovia posix/Africa/Nairobi posix/Africa/Ndjamena posix/Africa/Niamey posix/Africa/Nouakchott posix/Africa/Ouagadougou posix/Africa/Porto-Novo posix/Africa/Sao_Tome posix/Africa/Timbuktu posix/Africa/Tripoli posix/Africa/Tunis posix/Africa/Windhoek posix/America/ posix/America/Adak posix/America/Anchorage posix/America/Anguilla posix/America/Antigua posix/America/Araguaina posix/America/Argentina/ posix/America/Argentina/Buenos_Aires posix/America/Argentina/Catamarca posix/America/Argentina/ComodRivadavia posix/America/Argentina/Cordoba posix/America/Argentina/Jujuy posix/America/Argentina/La_Rioja posix/America/Argentina/Mendoza posix/America/Argentina/Rio_Gallegos posix/America/Argentina/Salta posix/America/Argentina/San_Juan posix/America/Argentina/San_Luis posix/America/Argentina/Tucuman posix/America/Argentina/Ushuaia posix/America/Aruba posix/America/Asuncion posix/America/Atikokan posix/America/Atka posix/America/Bahia posix/America/Bahia_Banderas posix/America/Barbados posix/America/Belem posix/America/Belize posix/America/Blanc-Sablon posix/America/Boa_Vista posix/America/Bogota posix/America/Boise posix/America/Buenos_Aires posix/America/Cambridge_Bay posix/America/Campo_Grande posix/America/Cancun posix/America/Caracas posix/America/Catamarca posix/America/Cayenne posix/America/Cayman posix/America/Chicago posix/America/Chihuahua posix/America/Coral_Harbour posix/America/Cordoba posix/America/Costa_Rica posix/America/Creston posix/America/Cuiaba posix/America/Curacao posix/America/Danmarkshavn posix/America/Dawson posix/America/Dawson_Creek posix/America/Denver posix/America/Detroit posix/America/Dominica posix/America/Edmonton posix/America/Eirunepe posix/America/El_Salvador posix/America/Ensenada posix/America/Fort_Wayne posix/America/Fortaleza posix/America/Glace_Bay posix/America/Godthab posix/America/Goose_Bay posix/America/Grand_Turk posix/America/Grenada posix/America/Guadeloupe posix/America/Guatemala posix/America/Guayaquil posix/America/Guyana posix/America/Halifax posix/America/Havana posix/America/Hermosillo posix/America/Indiana/ posix/America/Indiana/Indianapolis posix/America/Indiana/Knox posix/America/Indiana/Marengo posix/America/Indiana/Petersburg posix/America/Indiana/Tell_City posix/America/Indiana/Vevay posix/America/Indiana/Vincennes posix/America/Indiana/Winamac posix/America/Indianapolis posix/America/Inuvik posix/America/Iqaluit posix/America/Jamaica posix/America/Jujuy posix/America/Juneau posix/America/Kentucky/ posix/America/Kentucky/Louisville posix/America/Kentucky/Monticello posix/America/Knox_IN posix/America/Kralendijk posix/America/La_Paz posix/America/Lima posix/America/Los_Angeles posix/America/Louisville posix/America/Lower_Princes posix/America/Maceio posix/America/Managua posix/America/Manaus posix/America/Marigot posix/America/Martinique posix/America/Matamoros posix/America/Mazatlan posix/America/Mendoza posix/America/Menominee posix/America/Merida posix/America/Metlakatla posix/America/Mexico_City posix/America/Miquelon posix/America/Moncton posix/America/Monterrey posix/America/Montevideo posix/America/Montreal posix/America/Montserrat posix/America/Nassau posix/America/New_York posix/America/Nipigon posix/America/Nome posix/America/Noronha posix/America/North_Dakota/ posix/America/North_Dakota/Beulah posix/America/North_Dakota/Center posix/America/North_Dakota/New_Salem posix/America/Ojinaga posix/America/Panama posix/America/Pangnirtung posix/America/Paramaribo posix/America/Phoenix posix/America/Port-au-Prince posix/America/Port_of_Spain posix/America/Porto_Acre posix/America/Porto_Velho posix/America/Puerto_Rico posix/America/Rainy_River posix/America/Rankin_Inlet posix/America/Recife posix/America/Regina posix/America/Resolute posix/America/Rio_Branco posix/America/Rosario posix/America/Santa_Isabel posix/America/Santarem posix/America/Santiago posix/America/Santo_Domingo posix/America/Sao_Paulo posix/America/Scoresbysund posix/America/Shiprock posix/America/Sitka posix/America/St_Barthelemy posix/America/St_Johns posix/America/St_Kitts posix/America/St_Lucia posix/America/St_Thomas posix/America/St_Vincent posix/America/Swift_Current posix/America/Tegucigalpa posix/America/Thule posix/America/Thunder_Bay posix/America/Tijuana posix/America/Toronto posix/America/Tortola posix/America/Vancouver posix/America/Virgin posix/America/Whitehorse posix/America/Winnipeg posix/America/Yakutat posix/America/Yellowknife posix/Antarctica/ posix/Antarctica/Casey posix/Antarctica/Davis posix/Antarctica/DumontDUrville posix/Antarctica/Macquarie posix/Antarctica/Mawson posix/Antarctica/McMurdo posix/Antarctica/Palmer posix/Antarctica/Rothera posix/Antarctica/South_Pole posix/Antarctica/Syowa posix/Antarctica/Vostok posix/Arctic/ posix/Arctic/Longyearbyen posix/Asia/ posix/Asia/Aden posix/Asia/Almaty posix/Asia/Amman posix/Asia/Anadyr posix/Asia/Aqtau posix/Asia/Aqtobe posix/Asia/Ashgabat posix/Asia/Ashkhabad posix/Asia/Baghdad posix/Asia/Bahrain posix/Asia/Baku posix/Asia/Bangkok posix/Asia/Beirut posix/Asia/Bishkek posix/Asia/Brunei posix/Asia/Calcutta posix/Asia/Choibalsan posix/Asia/Chongqing posix/Asia/Chungking posix/Asia/Colombo posix/Asia/Dacca posix/Asia/Damascus posix/Asia/Dhaka posix/Asia/Dili posix/Asia/Dubai posix/Asia/Dushanbe posix/Asia/Gaza posix/Asia/Harbin posix/Asia/Hebron posix/Asia/Ho_Chi_Minh posix/Asia/Hong_Kong posix/Asia/Hovd posix/Asia/Irkutsk posix/Asia/Istanbul posix/Asia/Jakarta posix/Asia/Jayapura posix/Asia/Jerusalem posix/Asia/Kabul posix/Asia/Kamchatka posix/Asia/Karachi posix/Asia/Kashgar posix/Asia/Kathmandu posix/Asia/Katmandu posix/Asia/Khandyga posix/Asia/Kolkata posix/Asia/Krasnoyarsk posix/Asia/Kuala_Lumpur posix/Asia/Kuching posix/Asia/Kuwait posix/Asia/Macao posix/Asia/Macau posix/Asia/Magadan posix/Asia/Makassar posix/Asia/Manila posix/Asia/Muscat posix/Asia/Nicosia posix/Asia/Novokuznetsk posix/Asia/Novosibirsk posix/Asia/Omsk posix/Asia/Oral posix/Asia/Phnom_Penh posix/Asia/Pontianak posix/Asia/Pyongyang posix/Asia/Qatar posix/Asia/Qyzylorda posix/Asia/Rangoon posix/Asia/Riyadh posix/Asia/Riyadh87 posix/Asia/Riyadh88 posix/Asia/Riyadh89 posix/Asia/Saigon posix/Asia/Sakhalin posix/Asia/Samarkand posix/Asia/Seoul posix/Asia/Shanghai posix/Asia/Singapore posix/Asia/Taipei posix/Asia/Tashkent posix/Asia/Tbilisi posix/Asia/Tehran posix/Asia/Tel_Aviv posix/Asia/Thimbu posix/Asia/Thimphu posix/Asia/Tokyo posix/Asia/Ujung_Pandang posix/Asia/Ulaanbaatar posix/Asia/Ulan_Bator posix/Asia/Urumqi posix/Asia/Ust-Nera posix/Asia/Vientiane posix/Asia/Vladivostok posix/Asia/Yakutsk posix/Asia/Yekaterinburg posix/Asia/Yerevan posix/Atlantic/ posix/Atlantic/Azores posix/Atlantic/Bermuda posix/Atlantic/Canary posix/Atlantic/Cape_Verde posix/Atlantic/Faeroe posix/Atlantic/Faroe posix/Atlantic/Jan_Mayen posix/Atlantic/Madeira posix/Atlantic/Reykjavik posix/Atlantic/South_Georgia posix/Atlantic/St_Helena posix/Atlantic/Stanley posix/Australia/ posix/Australia/ACT posix/Australia/Adelaide posix/Australia/Brisbane posix/Australia/Broken_Hill posix/Australia/Canberra posix/Australia/Currie posix/Australia/Darwin posix/Australia/Eucla posix/Australia/Hobart posix/Australia/LHI posix/Australia/Lindeman posix/Australia/Lord_Howe posix/Australia/Melbourne posix/Australia/NSW posix/Australia/North posix/Australia/Perth posix/Australia/Queensland posix/Australia/South posix/Australia/Sydney posix/Australia/Tasmania posix/Australia/Victoria posix/Australia/West posix/Australia/Yancowinna posix/Brazil/ posix/Brazil/Acre posix/Brazil/DeNoronha posix/Brazil/East posix/Brazil/West posix/CET posix/CST6CDT posix/Canada/ posix/Canada/Atlantic posix/Canada/Central posix/Canada/East-Saskatchewan posix/Canada/Eastern posix/Canada/Mountain posix/Canada/Newfoundland posix/Canada/Pacific posix/Canada/Saskatchewan posix/Canada/Yukon posix/Chile/ posix/Chile/Continental posix/Chile/EasterIsland posix/Cuba posix/EET posix/EST posix/EST5EDT posix/Egypt posix/Eire posix/Etc/ posix/Etc/GMT posix/Etc/GMT+0 posix/Etc/GMT+1 posix/Etc/GMT+10 posix/Etc/GMT+11 posix/Etc/GMT+12 posix/Etc/GMT+2 posix/Etc/GMT+3 posix/Etc/GMT+4 posix/Etc/GMT+5 posix/Etc/GMT+6 posix/Etc/GMT+7 posix/Etc/GMT+8 posix/Etc/GMT+9 posix/Etc/GMT-0 posix/Etc/GMT-1 posix/Etc/GMT-10 posix/Etc/GMT-11 posix/Etc/GMT-12 posix/Etc/GMT-13 posix/Etc/GMT-14 posix/Etc/GMT-2 posix/Etc/GMT-3 posix/Etc/GMT-4 posix/Etc/GMT-5 posix/Etc/GMT-6 posix/Etc/GMT-7 posix/Etc/GMT-8 posix/Etc/GMT-9 posix/Etc/GMT0 posix/Etc/Greenwich posix/Etc/UCT posix/Etc/UTC posix/Etc/Universal posix/Etc/Zulu posix/Europe/ posix/Europe/Amsterdam posix/Europe/Andorra posix/Europe/Athens posix/Europe/Belfast posix/Europe/Belgrade posix/Europe/Berlin posix/Europe/Bratislava posix/Europe/Brussels posix/Europe/Bucharest posix/Europe/Budapest posix/Europe/Busingen posix/Europe/Chisinau posix/Europe/Copenhagen posix/Europe/Dublin posix/Europe/Gibraltar posix/Europe/Guernsey posix/Europe/Helsinki posix/Europe/Isle_of_Man posix/Europe/Istanbul posix/Europe/Jersey posix/Europe/Kaliningrad posix/Europe/Kiev posix/Europe/Lisbon posix/Europe/Ljubljana posix/Europe/London posix/Europe/Luxembourg posix/Europe/Madrid posix/Europe/Malta posix/Europe/Mariehamn posix/Europe/Minsk posix/Europe/Monaco posix/Europe/Moscow posix/Europe/Nicosia posix/Europe/Oslo posix/Europe/Paris posix/Europe/Podgorica posix/Europe/Prague posix/Europe/Riga posix/Europe/Rome posix/Europe/Samara posix/Europe/San_Marino posix/Europe/Sarajevo posix/Europe/Simferopol posix/Europe/Skopje posix/Europe/Sofia posix/Europe/Stockholm posix/Europe/Tallinn posix/Europe/Tirane posix/Europe/Tiraspol posix/Europe/Uzhgorod posix/Europe/Vaduz posix/Europe/Vatican posix/Europe/Vienna posix/Europe/Vilnius posix/Europe/Volgograd posix/Europe/Warsaw posix/Europe/Zagreb posix/Europe/Zaporozhye posix/Europe/Zurich posix/Factory posix/GB posix/GB-Eire posix/GMT posix/GMT+0 posix/GMT-0 posix/GMT0 posix/Greenwich posix/HST posix/Hongkong posix/Iceland posix/Indian/ posix/Indian/Antananarivo posix/Indian/Chagos posix/Indian/Christmas posix/Indian/Cocos posix/Indian/Comoro posix/Indian/Kerguelen posix/Indian/Mahe posix/Indian/Maldives posix/Indian/Mauritius posix/Indian/Mayotte posix/Indian/Reunion posix/Iran posix/Israel posix/Jamaica posix/Japan posix/Kwajalein posix/Libya posix/MET posix/MST posix/MST7MDT posix/Mexico/ posix/Mexico/BajaNorte posix/Mexico/BajaSur posix/Mexico/General posix/Mideast/ posix/Mideast/Riyadh87 posix/Mideast/Riyadh88 posix/Mideast/Riyadh89 posix/NZ posix/NZ-CHAT posix/Navajo posix/PRC posix/PST8PDT posix/Pacific/ posix/Pacific/Apia posix/Pacific/Auckland posix/Pacific/Chatham posix/Pacific/Chuuk posix/Pacific/Easter posix/Pacific/Efate posix/Pacific/Enderbury posix/Pacific/Fakaofo posix/Pacific/Fiji posix/Pacific/Funafuti posix/Pacific/Galapagos posix/Pacific/Gambier posix/Pacific/Guadalcanal posix/Pacific/Guam posix/Pacific/Honolulu posix/Pacific/Johnston posix/Pacific/Kiritimati posix/Pacific/Kosrae posix/Pacific/Kwajalein posix/Pacific/Majuro posix/Pacific/Marquesas posix/Pacific/Midway posix/Pacific/Nauru posix/Pacific/Niue posix/Pacific/Norfolk posix/Pacific/Noumea posix/Pacific/Pago_Pago posix/Pacific/Palau posix/Pacific/Pitcairn posix/Pacific/Pohnpei posix/Pacific/Ponape posix/Pacific/Port_Moresby posix/Pacific/Rarotonga posix/Pacific/Saipan posix/Pacific/Samoa posix/Pacific/Tahiti posix/Pacific/Tarawa posix/Pacific/Tongatapu posix/Pacific/Truk posix/Pacific/Wake posix/Pacific/Wallis posix/Pacific/Yap posix/Poland posix/Portugal posix/ROC posix/ROK posix/Singapore posix/Turkey posix/UCT posix/US/ posix/US/Alaska posix/US/Aleutian posix/US/Arizona posix/US/Central posix/US/East-Indiana posix/US/Eastern posix/US/Hawaii posix/US/Indiana-Starke posix/US/Michigan posix/US/Mountain posix/US/Pacific posix/US/Pacific-New posix/US/Samoa posix/UTC posix/Universal posix/W-SU posix/WET posix/Zulu posixrules right/ right/Africa/ right/Africa/Abidjan right/Africa/Accra right/Africa/Addis_Ababa right/Africa/Algiers right/Africa/Asmara right/Africa/Asmera right/Africa/Bamako right/Africa/Bangui right/Africa/Banjul right/Africa/Bissau right/Africa/Blantyre right/Africa/Brazzaville right/Africa/Bujumbura right/Africa/Cairo right/Africa/Casablanca right/Africa/Ceuta right/Africa/Conakry right/Africa/Dakar right/Africa/Dar_es_Salaam right/Africa/Djibouti right/Africa/Douala right/Africa/El_Aaiun right/Africa/Freetown right/Africa/Gaborone right/Africa/Harare right/Africa/Johannesburg right/Africa/Juba right/Africa/Kampala right/Africa/Khartoum right/Africa/Kigali right/Africa/Kinshasa right/Africa/Lagos right/Africa/Libreville right/Africa/Lome right/Africa/Luanda right/Africa/Lubumbashi right/Africa/Lusaka right/Africa/Malabo right/Africa/Maputo right/Africa/Maseru right/Africa/Mbabane right/Africa/Mogadishu right/Africa/Monrovia right/Africa/Nairobi right/Africa/Ndjamena right/Africa/Niamey right/Africa/Nouakchott right/Africa/Ouagadougou right/Africa/Porto-Novo right/Africa/Sao_Tome right/Africa/Timbuktu right/Africa/Tripoli right/Africa/Tunis right/Africa/Windhoek right/America/ right/America/Adak right/America/Anchorage right/America/Anguilla right/America/Antigua right/America/Araguaina right/America/Argentina/ right/America/Argentina/Buenos_Aires right/America/Argentina/Catamarca right/America/Argentina/ComodRivadavia right/America/Argentina/Cordoba right/America/Argentina/Jujuy right/America/Argentina/La_Rioja right/America/Argentina/Mendoza right/America/Argentina/Rio_Gallegos right/America/Argentina/Salta right/America/Argentina/San_Juan right/America/Argentina/San_Luis right/America/Argentina/Tucuman right/America/Argentina/Ushuaia right/America/Aruba right/America/Asuncion right/America/Atikokan right/America/Atka right/America/Bahia right/America/Bahia_Banderas right/America/Barbados right/America/Belem right/America/Belize right/America/Blanc-Sablon right/America/Boa_Vista right/America/Bogota right/America/Boise right/America/Buenos_Aires right/America/Cambridge_Bay right/America/Campo_Grande right/America/Cancun right/America/Caracas right/America/Catamarca right/America/Cayenne right/America/Cayman right/America/Chicago right/America/Chihuahua right/America/Coral_Harbour right/America/Cordoba right/America/Costa_Rica right/America/Creston right/America/Cuiaba right/America/Curacao right/America/Danmarkshavn right/America/Dawson right/America/Dawson_Creek right/America/Denver right/America/Detroit right/America/Dominica right/America/Edmonton right/America/Eirunepe right/America/El_Salvador right/America/Ensenada right/America/Fort_Wayne right/America/Fortaleza right/America/Glace_Bay right/America/Godthab right/America/Goose_Bay right/America/Grand_Turk right/America/Grenada right/America/Guadeloupe right/America/Guatemala right/America/Guayaquil right/America/Guyana right/America/Halifax right/America/Havana right/America/Hermosillo right/America/Indiana/ right/America/Indiana/Indianapolis right/America/Indiana/Knox right/America/Indiana/Marengo right/America/Indiana/Petersburg right/America/Indiana/Tell_City right/America/Indiana/Vevay right/America/Indiana/Vincennes right/America/Indiana/Winamac right/America/Indianapolis right/America/Inuvik right/America/Iqaluit right/America/Jamaica right/America/Jujuy right/America/Juneau right/America/Kentucky/ right/America/Kentucky/Louisville right/America/Kentucky/Monticello right/America/Knox_IN right/America/Kralendijk right/America/La_Paz right/America/Lima right/America/Los_Angeles right/America/Louisville right/America/Lower_Princes right/America/Maceio right/America/Managua right/America/Manaus right/America/Marigot right/America/Martinique right/America/Matamoros right/America/Mazatlan right/America/Mendoza right/America/Menominee right/America/Merida right/America/Metlakatla right/America/Mexico_City right/America/Miquelon right/America/Moncton right/America/Monterrey right/America/Montevideo right/America/Montreal right/America/Montserrat right/America/Nassau right/America/New_York right/America/Nipigon right/America/Nome right/America/Noronha right/America/North_Dakota/ right/America/North_Dakota/Beulah right/America/North_Dakota/Center right/America/North_Dakota/New_Salem right/America/Ojinaga right/America/Panama right/America/Pangnirtung right/America/Paramaribo right/America/Phoenix right/America/Port-au-Prince right/America/Port_of_Spain right/America/Porto_Acre right/America/Porto_Velho right/America/Puerto_Rico right/America/Rainy_River right/America/Rankin_Inlet right/America/Recife right/America/Regina right/America/Resolute right/America/Rio_Branco right/America/Rosario right/America/Santa_Isabel right/America/Santarem right/America/Santiago right/America/Santo_Domingo right/America/Sao_Paulo right/America/Scoresbysund right/America/Shiprock right/America/Sitka right/America/St_Barthelemy right/America/St_Johns right/America/St_Kitts right/America/St_Lucia right/America/St_Thomas right/America/St_Vincent right/America/Swift_Current right/America/Tegucigalpa right/America/Thule right/America/Thunder_Bay right/America/Tijuana right/America/Toronto right/America/Tortola right/America/Vancouver right/America/Virgin right/America/Whitehorse right/America/Winnipeg right/America/Yakutat right/America/Yellowknife right/Antarctica/ right/Antarctica/Casey right/Antarctica/Davis right/Antarctica/DumontDUrville right/Antarctica/Macquarie right/Antarctica/Mawson right/Antarctica/McMurdo right/Antarctica/Palmer right/Antarctica/Rothera right/Antarctica/South_Pole right/Antarctica/Syowa right/Antarctica/Vostok right/Arctic/ right/Arctic/Longyearbyen right/Asia/ right/Asia/Aden right/Asia/Almaty right/Asia/Amman right/Asia/Anadyr right/Asia/Aqtau right/Asia/Aqtobe right/Asia/Ashgabat right/Asia/Ashkhabad right/Asia/Baghdad right/Asia/Bahrain right/Asia/Baku right/Asia/Bangkok right/Asia/Beirut right/Asia/Bishkek right/Asia/Brunei right/Asia/Calcutta right/Asia/Choibalsan right/Asia/Chongqing right/Asia/Chungking right/Asia/Colombo right/Asia/Dacca right/Asia/Damascus right/Asia/Dhaka right/Asia/Dili right/Asia/Dubai right/Asia/Dushanbe right/Asia/Gaza right/Asia/Harbin right/Asia/Hebron right/Asia/Ho_Chi_Minh right/Asia/Hong_Kong right/Asia/Hovd right/Asia/Irkutsk right/Asia/Istanbul right/Asia/Jakarta right/Asia/Jayapura right/Asia/Jerusalem right/Asia/Kabul right/Asia/Kamchatka right/Asia/Karachi right/Asia/Kashgar right/Asia/Kathmandu right/Asia/Katmandu right/Asia/Khandyga right/Asia/Kolkata right/Asia/Krasnoyarsk right/Asia/Kuala_Lumpur right/Asia/Kuching right/Asia/Kuwait right/Asia/Macao right/Asia/Macau right/Asia/Magadan right/Asia/Makassar right/Asia/Manila right/Asia/Muscat right/Asia/Nicosia right/Asia/Novokuznetsk right/Asia/Novosibirsk right/Asia/Omsk right/Asia/Oral right/Asia/Phnom_Penh right/Asia/Pontianak right/Asia/Pyongyang right/Asia/Qatar right/Asia/Qyzylorda right/Asia/Rangoon right/Asia/Riyadh right/Asia/Riyadh87 right/Asia/Riyadh88 right/Asia/Riyadh89 right/Asia/Saigon right/Asia/Sakhalin right/Asia/Samarkand right/Asia/Seoul right/Asia/Shanghai right/Asia/Singapore right/Asia/Taipei right/Asia/Tashkent right/Asia/Tbilisi right/Asia/Tehran right/Asia/Tel_Aviv right/Asia/Thimbu right/Asia/Thimphu right/Asia/Tokyo right/Asia/Ujung_Pandang right/Asia/Ulaanbaatar right/Asia/Ulan_Bator right/Asia/Urumqi right/Asia/Ust-Nera right/Asia/Vientiane right/Asia/Vladivostok right/Asia/Yakutsk right/Asia/Yekaterinburg right/Asia/Yerevan right/Atlantic/ right/Atlantic/Azores right/Atlantic/Bermuda right/Atlantic/Canary right/Atlantic/Cape_Verde right/Atlantic/Faeroe right/Atlantic/Faroe right/Atlantic/Jan_Mayen right/Atlantic/Madeira right/Atlantic/Reykjavik right/Atlantic/South_Georgia right/Atlantic/St_Helena right/Atlantic/Stanley right/Australia/ right/Australia/ACT right/Australia/Adelaide right/Australia/Brisbane right/Australia/Broken_Hill right/Australia/Canberra right/Australia/Currie right/Australia/Darwin right/Australia/Eucla right/Australia/Hobart right/Australia/LHI right/Australia/Lindeman right/Australia/Lord_Howe right/Australia/Melbourne right/Australia/NSW right/Australia/North right/Australia/Perth right/Australia/Queensland right/Australia/South right/Australia/Sydney right/Australia/Tasmania right/Australia/Victoria right/Australia/West right/Australia/Yancowinna right/Brazil/ right/Brazil/Acre right/Brazil/DeNoronha right/Brazil/East right/Brazil/West right/CET right/CST6CDT right/Canada/ right/Canada/Atlantic right/Canada/Central right/Canada/East-Saskatchewan right/Canada/Eastern right/Canada/Mountain right/Canada/Newfoundland right/Canada/Pacific right/Canada/Saskatchewan right/Canada/Yukon right/Chile/ right/Chile/Continental right/Chile/EasterIsland right/Cuba right/EET right/EST right/EST5EDT right/Egypt right/Eire right/Etc/ right/Etc/GMT right/Etc/GMT+0 right/Etc/GMT+1 right/Etc/GMT+10 right/Etc/GMT+11 right/Etc/GMT+12 right/Etc/GMT+2 right/Etc/GMT+3 right/Etc/GMT+4 right/Etc/GMT+5 right/Etc/GMT+6 right/Etc/GMT+7 right/Etc/GMT+8 right/Etc/GMT+9 right/Etc/GMT-0 right/Etc/GMT-1 right/Etc/GMT-10 right/Etc/GMT-11 right/Etc/GMT-12 right/Etc/GMT-13 right/Etc/GMT-14 right/Etc/GMT-2 right/Etc/GMT-3 right/Etc/GMT-4 right/Etc/GMT-5 right/Etc/GMT-6 right/Etc/GMT-7 right/Etc/GMT-8 right/Etc/GMT-9 right/Etc/GMT0 right/Etc/Greenwich right/Etc/UCT right/Etc/UTC right/Etc/Universal right/Etc/Zulu right/Europe/ right/Europe/Amsterdam right/Europe/Andorra right/Europe/Athens right/Europe/Belfast right/Europe/Belgrade right/Europe/Berlin right/Europe/Bratislava right/Europe/Brussels right/Europe/Bucharest right/Europe/Budapest right/Europe/Busingen right/Europe/Chisinau right/Europe/Copenhagen right/Europe/Dublin right/Europe/Gibraltar right/Europe/Guernsey right/Europe/Helsinki right/Europe/Isle_of_Man right/Europe/Istanbul right/Europe/Jersey right/Europe/Kaliningrad right/Europe/Kiev right/Europe/Lisbon right/Europe/Ljubljana right/Europe/London right/Europe/Luxembourg right/Europe/Madrid right/Europe/Malta right/Europe/Mariehamn right/Europe/Minsk right/Europe/Monaco right/Europe/Moscow right/Europe/Nicosia right/Europe/Oslo right/Europe/Paris right/Europe/Podgorica right/Europe/Prague right/Europe/Riga right/Europe/Rome right/Europe/Samara right/Europe/San_Marino right/Europe/Sarajevo right/Europe/Simferopol right/Europe/Skopje right/Europe/Sofia right/Europe/Stockholm right/Europe/Tallinn right/Europe/Tirane right/Europe/Tiraspol right/Europe/Uzhgorod right/Europe/Vaduz right/Europe/Vatican right/Europe/Vienna right/Europe/Vilnius right/Europe/Volgograd right/Europe/Warsaw right/Europe/Zagreb right/Europe/Zaporozhye right/Europe/Zurich right/Factory right/GB right/GB-Eire right/GMT right/GMT+0 right/GMT-0 right/GMT0 right/Greenwich right/HST right/Hongkong right/Iceland right/Indian 08`VQ<  VQP̌`[~ [~VQ`@@<@TU QbQA VQ/E:YQK/YQK/xY3)AVQw;VQw;VQw;aAAVQw;YQcYQchUAWQ<0WQ<0WQ<0cXAWQ<0WQ(WQ(dAAWQ(ZQafZQafeW5AWQQXKQXKf'SZQYQYQpj !YQ E*YQ E*YQ E*Dk!YQ E*YQ E*YQ E*lYV!YQ E*YQ E*YQ@h3A;!YQ E*YQ E*YQa!4}!YQ E*YQ E*YQ E*35!YQ E*YQ E*YQ E* !YQ E*YQ E*YQ E*!!YQ E*YQ E*YQ E*Z}Y!YQc*+YQc*+YQc*+pt !YQc*+YQc*+YQ0GS5HF!YQc*+YQc*+YQc*+!YQc*+YQc*+YQc*+raYQc*+YQc*+YQL;s!YQc*+YQc*+YQL;f?aYQc*+YQc*+YQL;rQ!YQc*+YQc*+YQL;aYQc*+YQc*+YQL;0!YQc*+YQc*+YQL;aYQc*+YQc*+YQL;`[68!YQc*+YQc*+YQL;)KaYQc*+YQc*+YQL;E!YQc*+YQc*+YQL;SaYQc*+YQc*+YQL;t|!YQ+YQ+YQL; U{aYQ+YQ+YQL;:K!YQ+YQ+YQL;QaYQ+YQ+YQL;[8!YQ+YQ+YQL;yaYQ+YQ+YQL;`V!YQ+YQ+YQL;F'aYQ+YQ+YQL; ~bp!YQ+YQ+YQL; w_aYQ+YQ+YQL; !YQ+YQ+YQL; fyUaYQ+YQ+YQL; .ͺ!YQ+YQ+YQL; ̔u_aYQ+YQ+YQL; - !YQ+YQ+YQL; ab_aYQ\,YQ\,YQL; ~!YQ\,YQ\,YQL; -CaYQ\,YQ\,YQL;/M!YQ\,YQ\,YQL;|aYQ\,YQ\,YQL;A!YQ\,YQ\,YQL;aYQ\,YQ\,YQL;?!YQ\,YQ\,YQL;ZaYQ\,YQ\,YQL;\S&!YQ\,YQ\,YQL;;aYQ\,YQ\,YQL;wA!YQ\,YQ\,YQL;iY aYQ\,YQ\,YQL;N !]!YQ\,YQ\,YQL;CaYQ\,YQ\,YQL;nL5_!YQ\,YQ\,YQL;ۍ aYQ,YQ,YQL;L!YQ,YQ,YQL;7laYQ,YQ,YQL;1D!YQ,YQ,YQL;k naYQ,YQ,YQL;Q!YQ,YQ,YQL;HaYQ,YQ,YQL;$ !YQ,YQ,YQL;zʳaYQ,YQ,YQL;2!YQ,YQ,YQL;XaYQ,YQ,YQL;ʉ'!YQ,YQ,YQL;y&<aYQ,YQ,YQL;!YQ,YQ,YQL;]_aYQɼ-YQɼ-YQL;g<!YQɼ-YQɼ-YQL;o!aYQɼ-YQɼ-YQL;Ņ8!YQɼ-YQɼ-YQL;=7aYQɼ-YQɼ-YQL;?!YQɼ-YQɼ-YQL;laYQɼ-YQɼ-YQL;G(!YQɼ-YQɼ-YQL;haYQɼ-YQɼ-YQL;!YQɼ-YQɼ-YQL;5aYQɼ-YQɼ-YQL;xXf !YQɼ-YQɼ-YQL;_aYQɼ-YQɼ-YQL;] `!YQɼ-YQɼ-YQL;^aYQɼ-YQɼ-YQL;vw!YQ'.YQ'.YQL;-6aYQ'.YQ'.YQL;I!YQ'.YQ'.YQL;;aYQ'.YQ'.YQL;7!YQ'.YQ'.YQL;t\NaYQ'.YQ'.YQL;!YQ'.YQ'.YQL;W}aYQ'.YQ'.YQL;>*j!YQ'.YQ'.YQL;=aYQ'.YQ'.YQL;b#A!YQ'.YQ'.YQL; aYQ'.YQ'.YQL; !YQ'.YQ'.YQL;  aYQ'.YQ'.YQL; !YQ'.YQ'.YQL; aYQ.YQ.YQL; *!YQ.YQ.YQL; $aYQ.YQ.YQL; cy|!YQ.YQ.YQL; /|aYQ.YQ.YQL; #!YQ.YQ.YQL;  ,aYQ.YQ.YQL;R(!YQ.YQ.YQL;3QaYQ.YQ.ZQdJe?~!YQ.YQ.ZQdJ*!YQ.YQ.YQ36 "=Bu!YQ.YQ.YQY87 ^BuaYQ.YQ.ZQdJel[!YQ.YQ.ZQdJDaYQ.YQ.ZQdJ̤!YQY/YQY/ZQdJ>!YQY/YQY/YQY/?m;!YQY/YQY/YQY/?naYQY/YQY/ZQdJ繜!YQY/YQY/ZQdJtlfaYQY/YQY/ZQdJ{׺!YQY/YQY/ZQdJaYQY/YQY/ZQdJΙ8!YQY/YQY/ZQdJ:PEaYQY/YQY/ZQdJx!YQY/YQY/ZQdJF!YQY/YQY/YQY/<:QH>:gPAQ@0p;Q Q ?FAQ^Q6Q6} AQXKQ4j!Q4j![j?hz >f~}u=]Gkd|x,YOLgh},9-9K1f86576889ae1b034be2871b24cc4d002e28326b09b8c07c080cf8a30ed1bb44  ...d0539e90c2a2c6658495f8d5b5d6341524bdfc9cd9430182b0dc9baca67f583c  .B.. .B ..misc7&Ekeymaps . ..jtermcap . ..k bsdl base54.tgzm comp54.tgzn etc54.tgz2o man54.tgz2p game54.tgz642b3e60158710575ee5acf965d71e3fdfc68e496a65250f0020034f4ff081fa  . ..chowndhclientM disklabeldmesgfdiskfsckN fsck_ext2fsfsck_ffsMifconfigMinitNmknodmount mount_cd9660? mount_ext2fs? mount_ffs mount_msdos mount_nfsnewfs newfs_msdospingNping6reboothaltNroutertsolumountsysctlbioctln1 ulpt0 ulpt1 uhid0 uhid1 R uhid2 uhid3 uscanner0 urio0 usb0 usb1 usb2 usb3 usb4 usb5 R usb6 usb7 ;; ttyU[0-9a-zA-Z]) U=${i#ttyU*} o=$(alph2d $U) M ttyU$U c 68 $o 660 dialer uucp M cuaU$U c 68 $(($o+128)) 660 dialer uucp ;; wsmux|wsmouse|wskbd) M wsmouse c 63 0 600 M wskbd c 63 1 600 ;; wsmouse[0-9]*) M wsmouse$U c 62 $U 600 ;; wskbd[0-9]*) M wskbd$U c 61 $U 600 ;; wscons) R wsmouse0 wsmouse1 wsmouse2 wsmouse3 wskbd0 wskbd1 wskbd2 R wskbd3 wsmux ttyCcfg ttyC0 ttyC1 ttyC2 ttyC3 ttyC4 ttyC5 R ttyC6 ttyC7 ttyC8 ttyC9 ttyCa ttyCb ;; tty[C-J]*) U=${i##tty[C-J]} case $i in ttyC*) n=C m=0;; ttyD*) n=D m=256;; ttyE*) n=E m=512;; ttyF*) n=F m=768;; ttyG*) n=G m=1024;; ttyH*) n=H m=1280;; ttyI*) n=I m=1536;; ttyJ*) n=J m=1792;; esac case $U in [0-9a-f]) M tty$n$U c 60 $((16#$U+$m)) 600;; cfg) M tty${n}cfg c 60 $((255+$m)) 600;; *) echo bad unit $U for $i; exit 1;; esac ;; pty*) if [ $U -gt 15 ]; then echo bad unit for pty in: $i continue fi set -A letters p q r s t u v w x y z P Q R S T set -A suffixes 0 1 2 3 4 5 6 7 8 9 a b c d e f g h i j k l m n o p q \ r s t u v w x y z A B C D E F G H I J K L M N O P Q R S T U V W X \ Y Z name=${letters[$U]} n=0 while [ $n -lt 62 ] do nam=$name${suffixes[$n]} off=$(($U*62)) M tty$nam c 4 $(($off+$n)) M pty$nam c 5 $(($off+$n)) n=$(($n+1)) done ;; ptm) M ptm c 98 0 666 ;; tty[0-7][0-9a-f]) U=${i#tty*} o=$(h2d $U) M tty$U c 12 $o 660 dialer uucp M cua$U c 12 $(($o+128)) 660 dialer uucp ;; st*) n=$(($U*16)) for pre in " " n e en do M ${pre}st$U b 25 $n 660 operator M ${pre}rst$U c 25 $n 660 operator n=$(($n+1)) done ;; vnd*) dodisk vnd $U 19 19 $U 0 ;; rd*) dodisk2 rd $U 18 18 $U 0 ;; ch*) M ch$U c 27 $U 660 operator ;; cd*) dodisk2 cd $U 26 26 $U 0 ;; local) test -s $T.local && sh $T.local ;; all) R bthub0 bthub1 bthub2 vnd0 vnd1 vnd2 vnd3 sd0 sd1 sd2 sd3 R sd4 sd5 sd6 sd7 sd8 sd9 cd0 cd1 rd0 tun0 tun1 tun2 tun3 bio R bpf0 bpf1 bpf2 bpf3 bpf4 bpf5 bpf6 bpf7 bpf8 bpf9 pty0 R diskmap vscsi0 ch0 audio0 audio1 audio2 fuse pppx hotplug R ptm local wscons pci0 pci1 pci2 pci3 iop0 iop1 uall rmidi0 R rmidi1 rmidi2 rmidi3 rmidi4 rmidi5 rmidi6 rmidi7 tuner0 R radio0 video0 video1 uk0 random lkm tty00 tty01 tty02 tty03 R tty04 tty05 tty06 tty07 tty08 tty09 tty0a tty0b apm crypto R pf systrace wd0 wd1 wd2 wd3 std st0 st1 fd ;; wd*|sd*) case $i in wd*) dodisk wd $U 16 16 $U 0;; sd*) dodisk sd $U 24 24 $U 0;; esac ;; *) echo $i: unknown device ;; esac done } R "$@" { echo -n ${RMlist[*]} echo -n ${mklist[*]} echo -n ${MKlist[*]} echo -n ${whlist[*]} echo ${oplist[*]} } | if [ "$eo" = "echo" ]; then cat else sh fi #!/bin/sh - PATH=/sbin:/usr/sbin:/bin:/usr/bin T=$0 [ "$eo" ] || eo= hex() { case $1 in [0-9]) echo -n $1;; 10) echo -n a;; 11) echo -n b;; 12) echo -n c;; 13) echo -n d;; 14) echo -n e;; 15) echo -n f;; esac } alph2d() { local t="$1" local p="0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ" local sub=${p%${t}*} echo ${#sub} } h2d() { local s="$1" local f=${s%*[0-9a-f]} n=${s#[0-9a-f]*} echo $(($(_h2d $f)*16+ $(_h2d $n) )) } _h2d() { case $1 in [0-9]) echo -n $1;; a) echo -n 10;; b) echo -n 11;; c) echo -n 12;; d) echo -n 13;; e) echo -n 14;; f) echo -n 15;; esac } unt() { arg="$1" tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" while [ "$tmp" != "$arg" ] do arg=$tmp tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" done echo $arg } dodisk() { [ "$DEBUG" ] && set -x n=$(($((${5}*${7:-16}))+${6})) count=0 [ 0$7 -ne 8 ] && l="i j k l m n o p" for d in a b c d e f g h $l do M $1$2$d b $3 $(($n+$count)) 640 operator M r$1$2$d c $4 $(($n+$count)) 640 operator let count=count+1 done } dodisk2() { n=$(($(($5*${7:-16}))+$6)) M $1$2a b $3 $n 640 operator M r$1$2a c $4 $n 640 operator n=$(($n+2)) M $1$2c b $3 $n 640 operator M r$1$2c c $4 $n 640 operator } RMlist[0]="rm -f" mkl() { mklist[${#mklist[*]}]=";mknod -m $1 $2 $3 $4 $5" } M() { RMlist[${#RMlist[*]}]=$1 mkl ${5-666} $1 $2 $3 $4 G=${6:-wheel} [ "$7" ] && { MKlist[${#MKlist[*]}]="&& chown $7:$G $1" } || { case $G in wheel) [ ${#whlist[*]} = 0 ] && whlist[0]="&& chgrp wheel" whlist[${#whlist[*]}]="$1" ;; operator) [ ${#oplist[*]} = 0 ] && oplist[0]="&& chgrp operator" oplist[${#oplist[*]}]="$1" ;; *) MKlist[${#MKlist[*]}]="&& chgrp $G $1"; esac } return 0 } R() { [ "$DEBUG" ] && set -x for i in "$@" do U=`unt $i` [ "$U" ] || U=0 case $i in ramdisk) R std bpf0 wd0 wd1 sd0 tty00 rd0 wsmouse R st0 ttyC0 wskbd0 apm bio diskmap ;; std) M console c 0 0 600 M tty c 1 0 M mem c 2 0 640 kmem M kmem c 2 1 640 kmem M null c 2 2 M zero c 2 12 M stdin c 7 0 M stdout c 7 1 M stderr c 7 2 M ksyms c 8 0 640 kmem M klog c 6 0 600 ;; vscsi*) M vscsi$U c 100 $U 600 ;; video*) M video$U c 38 $U MKlist[${#MKlist[*]}]=";[ -e video ] || ln -s video$U video" ;; tuner*) M tuner$U c 75 $(($(($U*2))+16)) 644 ;; systrace) M systrace c 50 0 644 ;; uk*) M uk$U c 28 $U 640 operator ;; tun*) M tun$U c 33 $U 600 ;; rmidi*) M rmidi$U c 57 $U 666 ;; *random) n=0 for pre in " " s u a do M ${pre}random c 40 $n 644 n=$(($n+1)) done ;; radio*) M radio$U c 97 $U MKlist[${#MKlist[*]}]=";[ -e radio ] || ln -s radio$U radio" ;; pppx*) M pppx$U c 103 $U 600 ;; pf*) M pf c 46 0 600 ;; pci*) M pci$U c 88 $U 600 MKlist[${#MKlist[*]}]=";[ -h pci ] || ln -sf pci0 pci" ;; lkm) M lkm c 35 0 640 _lkm ;; iop*) M iop$U c 73 $U 660 ;; hotplug) M hotplug c 37 $U 400 ;; fuse) M fuse$U c 77 $U 600 ;; fd) RMlist[${#RMlist[*]}]=";mkdir -p fd;rm -f" n=0 while [ $n -lt 64 ];do M fd/$n c 7 $n;n=$(($n+1));done MKlist[${#MKlist[*]}]=";chmod 555 fd" ;; diskmap) M diskmap c 102 0 640 operator ;; crypto) M crypto c 47 0 ;; bthub*) M bthub$U c 101 $U ;; bpf*) M bpf$U c 22 $U 600 ;; bktr*) M bktr$U c 75 $U 644 ;; bio) M bio c 52 0 600 ;; audio*) M sound$U c 36 $U M mixer$U c 36 $(($U+16)) M audio$U c 36 $(($U+128)) M audioctl$U c 36 $(($U+192)) MKlist[${#MKlist[*]}]=";[ -e audio ] || ln -s audio$U audio" MKlist[${#MKlist[*]}]=";[ -e mixer ] || ln -s mixer$U mixer" MKlist[${#MKlist[*]}]=";[ -e sound ] || ln -s sound$U sound" MKlist[${#MKlist[*]}]=";[ -e audioctl ] || ln -s audioctl$U audioctl" ;; apm*) M apm c 34 0 644 M apmctl c 34 8 644 ;; uscanner*) M uscanner$U c 69 $U 660 ;; usb*) [ "$i" = "usb" ] && u= || u=$U M usb$u c 64 $U 660 ;; urio*) M urio$U c 67 $U 660 ;; ulpt*) M ulpt$U c 66 $U 660 ;; uhid*) M uhid$U c 65 $U 660 ;; ugen*) n=$(($U*16)) for j in 0{0,1,2,3,4,5,6,7,8,9} 1{0,1,2,3,4,5} do M ugen$U.$j c 70 $(($n+10#$j)) 660 done ;; uall) R ttyU0 ttyU1 ttyU2 ttyU3 ugen0 uge . ..MAKEDEVconsole tty memkmem6null6zero6stdinstdoutstderrksymsklog6bpf06wd0a6rwd0awd0b6rwd0bwd0c6rwd0cwd0d6rwd0dwd0e6rwd0ewd0f6rwd0f&wd0g6rwd0gwd0h6rwd0hwd0i6rwd0iwd0j6rwd0jwd0k6 rwd0k wd0l6 rwd0l wd0m6 rwd0mwd0n6rwd0nwd0o6rwd0owd0p6rwd0pwd1a6rwd1awd1b6rwd1bwd1c6rwd1cwd1d6rwd1dwd1e6rwd1ewd1f6rwd1f wd1g6!rwd1g"wd1h6#rwd1h$wd1i6%rwd1i&wd1j6'rwd1j(wd1k6)rwd1k*wd1l6+rwd1l,wd1m6-rwd1m.wd1n6/rwd1n0wd1o61rwd1o2wd1p63rwd1p4sd0a65rsd0a6sd0b67rsd0b8sd0c69rsd0c:sd0d6;rsd0d<sd0e6=rsd0e>sd0f6?rsd0f@sd0g6Arsd0gBsd0h6Crsd0hDsd0i6Ersd0iFsd0j6Grsd0jHsd0k6Irsd0kJsd0l6Krsd0lLsd0m6Mrsd0mNsd0n6Orsd0nPsd0o6Qrsd0oRsd0p6Srsd0pTtty00Ucua00Vrd0a6Wrrd0aXrd0c6Yrrd0cZwsmouse[wskbd\ st0]rst06^nst06_nrst0`est06aerst0benst0cenrst0dttyC0ewskbd0f apmgapmctlh bioidiskmap$user (cd /mnt/etc/skel; cp -pR . /mnt/home/$user) (umask 077 && sed "s,^To: root\$,To: ${username} <${user}>," \ /mnt/var/mail/root > /mnt/var/mail/$user ) chown -R 1000:1000 /mnt/home/$user /mnt/var/mail/$user echo "1,s@wheel:.:0:root\$@wheel:\*:0:root,${user}@ w q" | ed /mnt/etc/group 2>/dev/null fi if [[ -n "$_rootpass" ]]; then _encr=$(/mnt/usr/bin/encrypt -b 8 -- "$_rootpass") echo "1,s@^root::@root:${_encr}:@ w q" | ed /mnt/etc/master.passwd 2>/dev/null fi /mnt/usr/sbin/pwd_mkdb -p -d /mnt/etc /etc/master.passwd if grep -qs '^rtsol' /mnt/etc/hostname.*; then sed -e "/^#\(net\.inet6\.ip6\.accept_rtadv\)/s//\1/" \ -e "/^#\(net\.inet6\.icmp6\.rediraccept\)/s//\1/" \ /mnt/etc/sysctl.conf >/tmp/sysctl.conf cp /tmp/sysctl.conf /mnt/etc/sysctl.conf fi finish_up 0c8d3e33b951296bd5b7b93739b21433c7bd9addd66b3efaa7b5035fbe9f9309 dumb|80-column dumb tty:\ :am:\ :co#80:\ :bl=^G:cr=^M:do=^J:sf=^J: vt100|vt100-am|dec vt100 (w/advanced video):\ :5i:am:bs:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :@8=\EOM:DO=\E[%dB:K1=\EOq:K2=\EOr:K3=\EOs:K4=\EOp:K5=\EOn:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=^O:as=^N:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:do=^J:\ :eA=\E(B\E)0:ho=\E[H:k0=\EOy:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k5=\EOt:k6=\EOu:k7=\EOv:k8=\EOl:k9=\EOw:k;=\EOx:\ :kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:\ :ku=\EOA:l1=pf1:l2=pf2:l3=pf3:l4=pf4:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[0m:mr=\E[7m:nd=\E[C:pf=\E[4i:po=\E[5i:\ :ps=\E[0i:rc=\E8:rs=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :..sa=\E[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t\016%e\017%;$<2>:\ :sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: vt220|vt200|dec vt220:\ :5i:am:bs:mi:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :%0=\E[29~:%1=\E[28~:*6=\E[4~:@0=\E[1~:AL=\E[%dL:\ :DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:F1=\E[23~:F2=\E[24~:\ :F3=\E[25~:F4=\E[26~:F7=\E[31~:F8=\E[32~:F9=\E[33~:\ :FA=\E[34~:IC=\E[%d@:LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:\ :SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:eA=\E)0:ec=\E[%dX:ei=\E[4l:\ :ho=\E[H:if=/usr/share/tabset/vt100:im=\E[4h:\ :is=\E[?7h\E[>\E[?1h\E F\E[?4l:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k6=\E[17~:k7=\E[18~:k8=\E[19~:k9=\E[20~:\ :k;=\E[21~:kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=^H:kd=\E[B:\ :kl=\E[D:kr=\E[C:ku=\E[A:l1=pf1:l2=pf2:l3=pf3:l4=pf4:le=^H:\ :mb=\E[5m:md=\E[1m:me=\E[0m:mr=\E[7m:nd=\E[C:nw=\EE:\ :pf=\E[4i:po=\E[5i:ps=\E[i:r1=\E[?3l:rc=\E8:sc=\E7:\ :se=\E[27m:sf=\ED:so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[24m:\ :up=\E[A:us=\E[4m:vb=\E[?5h\E[?5l: he root password must be set." done questions user_setup set_timezone /var/tzlist echo fi diskinfo() { local _d for _d; do makedev $_d echo -n "$_d: " disklabel -dpg $_d 2>/dev/null | sed -e '/^label: /{s,,,;s/ *$//;s/^$//;H;d;}' \ -e '/.*# total bytes: \(.*\)/{s//(\1)/;H;}' \ -e '$!d;x;s/\n/ /' rm -f /dev/{r,}$_d? done } while :; do echo "Available disks are: $(get_dkdevs | sed 's/^$/none/')." _ask "Which disk is the root disk? ('?' for details)" \ $(get_dkdevs | sed 's/ .*//') || continue case $resp in "?") diskinfo $(get_dkdevs);; '') ;; *) isin "$resp" $(get_dkdevs) && break echo "no such disk";; esac done makedev $resp || exit ROOTDISK=$resp ROOTDEV=${ROOTDISK}a SWAPDEV=${ROOTDISK}b 5f69288c288617fc5c0b192c0407ef3b24205c0724719d5c0c1d1eed98c517d4 399a143ab8bbda41dfd36715dd7d9da30c69018139897e8336b7c87f94056156 #!/bin/ksh MODE=install . install.sub DISK= DISKS_DONE= _DKDEVS=$(get_dkdevs) _fsent= rm -f /tmp/fstab.shadow /tmp/fstab /tmp/fstab.* ask_yn "Use DUIDs rather than device names in fstab?" yes [[ $resp == y ]] && FSTABFLAG=-F while :; do DISKS_DONE=$(addel "$DISK" $DISKS_DONE) _DKDEVS=$(rmel "$DISK" $_DKDEVS) if isin $ROOTDISK $_DKDEVS; then resp=$ROOTDISK rm -f /tmp/fstab else ask_which "disk" "do you wish to initialize" \ '$(l=$(get_dkdevs); for a in $DISKS_DONE; do l=$(rmel $a $l); done; bsort $l)' \ done [[ $resp == done ]] && break fi DISK=$resp makedev $DISK || continue rm -f /tmp/*.$DISK AUTOROOT=n md_prep_disklabel $DISK || { DISK= ; continue ; } grep -qs " / ffs " /tmp/fstab.$ROOTDISK || { DISK= ; echo "'/' must be configured!" ; continue ; } if [[ -f /tmp/fstab.$DISK ]]; then while read _pp _mp _rest; do if [[ $_mp == none ]]; then echo "$_pp $_mp $_rest" >>/tmp/fstab continue fi [[ /tmp/fstab.$DISK == $(grep -l " $_mp " /tmp/fstab.*) ]] || { _rest=$DISK ; DISK= ; break ; } done /etc/fstab rm /tmp/fstab.$_rest set -- $(grep -h " $_mp " /tmp/fstab.*[0-9]) echo "$_pp and $1 can't both be mounted at $_mp." continue fi while read _pp _mp _fstype _rest; do [[ $_fstype == ffs ]] || continue _OPT= [[ $_mp == / ]] && _OPT=$MDROOTFSOPT newfs -q $_OPT ${_pp##/dev/} _fsent="$_fsent $_mp!$_pp" done >/tmp/fstab munge_fstab mount_fs "-o async" install_sets if [[ -z $TZ ]]; then (cd /mnt/usr/share/zoneinfo ls -1dF $(tar cvf /dev/null [A-Za-y]*) >/mnt/tmp/tzlist ) echo set_timezone /mnt/tmp/tzlist rm -f /mnt/tmp/tzlist fi if _time=$(ftp_time) && _now=$(date +%s) && (( _now - _time > 120 || _time - _now > 120 )); then _tz=/mnt/usr/share/zoneinfo/$TZ ask_yn "Time appears wrong. Set to '$(TZ=$_tz date -r "$(ftp_time)")'?" yes if [[ $resp == y ]]; then date $(date -r "$(ftp_time)" "+%Y%m%d%H%M.%S") >/dev/null fi fi if [[ -s $SERVERLISTALL ]]; then _i= [[ -n $installedfrom ]] && _i="install=$installedfrom" [[ -n $TZ ]] && _i="$_i&TZ=$TZ" [[ -n $method ]] && _i="$_i&method=$method" [[ -n $_i ]] && ftp -Vao - \ "http://129.128.5.191/cgi-bin/ftpinstall.cgi?$_i" >/dev/null 2>&1 & fi sed -e "/^console.*on.*secure.*$/s/std\.[0-9]*/std.$(stty speed)/" \ /mnt/etc/ttys >/tmp/ttys mv /tmp/ttys /mnt/etc/ttys echo -n "Saving configuration files..." (cd /var/db; [[ -f dhclient.leases ]] && mv dhclient.leases /mnt/var/db/. ) hostname >/tmp/myname if [[ -f /tmp/hosts ]]; then _dn=$(get_fqdn) while read _addr _hn _aliases; do if [[ -n $_aliases || $_hn != ${_hn%%.*} || -z $_dn ]]; then echo "$_addr\t$_hn $_aliases" else echo "$_addr\t$_hn.$_dn $_hn" fi done >/mnt/etc/hosts rm /tmp/hosts fi _f=dhclient.conf [[ -f /tmp/$_f ]] && { cat /tmp/$_f >>/mnt/etc/$_f ; rm /tmp/$_f ; } (cd /tmp; for _f in fstab hostname* kbdtype my* ttys *.conf *.tail; do [[ -f $_f && -s $_f ]] && mv $_f /mnt/etc/. done) (dmesg; cat $SERVERLISTALL; sysctl; route -n show; df; ifconfig -A; hostname) >/mnt/dev/arandom 2>&1 echo -n "done.\nGenerating initial host.random file..." dd if=/mnt/dev/arandom of=/mnt/var/db/host.random \ bs=65536 count=1 >/dev/null 2>&1 chmod 600 /mnt/var/db/host.random >/dev/null 2>&1 echo "done." apply if [[ -n $user ]]; then _encr="*" [[ -n "$userpass" ]] && _encr=$(/mnt/usr/bin/encrypt -b 8 -- "$userpass") uline="${user}:${_encr}:1000:1000:staff:0:0:${username}:/home/${user}:/bin/ksh" echo "$uline" >> /mnt/etc/master.passwd echo "${user}:*:1000:" >> /mnt/etc/group echo ${user} > /mnt/root/.forward mkdir -p /mnt/home/ . install.md set_term() { local _layouts export TERM=${TERM:-${MDTERM:-vt220}} if [[ -n $CONSOLE ]]; then ask "Terminal type?" $TERM export TERM=$resp else [[ -x /sbin/kbd ]] || return _layouts=$(bsort $(kbd -l | egrep -v "^(user|tables|encoding)")) while :; do ask "Choose your keyboard layout ('?' or 'L' for list)" "default" case $resp in "?"|L|l) echo "Available layouts: $_layouts" ;; default) return ;; *) kbd $resp && { echo $resp >/tmp/kbdtype ; return ; } ;; esac done fi } stripcom () { local _l [[ -f $1 ]] || return while read _l; do [[ -n ${_l%%#*} ]] && echo $_l done <$1 } quote() ( for a; do alias Q=$a; a=$(alias Q); print -rn -- " ${a#Q=}" done | sed '1s/ //' echo ) scan_dmesg() { bsort $(sed -ne "$1" /var/run/dmesg.boot) } scan_disknames() { local IFS=, bsort $(for _n in $(sysctl -n hw.disknames); do echo "${_n%%:*} "; done | sed -ne "$1") } get_dkdevs () { echo $(scan_disknames "${MDDKDEVS:-/^[sw]d[0-9][0-9]* /s/ .*//p}") } get_cddevs () { echo $(scan_disknames "${MDCDDEVS:-/^cd[0-9][0-9]* /s/ .*//p}") } get_ifdevs() { ifconfig "$@" 2>/dev/null | egrep -v '^[[:space:]]|(bridge|enc|gif|gre|lo|pflog|pfsync|ppp|sl|tun)[[:digit:]]+:' | sed -ne 's/^\(.*\):.*/\1/p' } get_drive() { ask_which "$1" "contains the $MODE media" "$2" "$3" [[ $resp == done ]] && return 1 makedev $resp || return 1 return 0 } mount_mnt2() { local _dev=$1 _opts _file=/tmp/parts.$1 _parts disklabel $_dev 2>/dev/null | grep '^ [a-p]: ' | egrep -v "swap|unused" >$_file _parts=$(sed -e 's/^ \(.\): .*/\1/' $_file) set -- $_parts (($# == 0)) && { echo "No filesystems found on $_dev." ; return 1 ; } if isin "c" $_parts; then resp=c elif (($# == 1)); then resp=$1 else cat /tmp/parts.$_dev ask_which "$_dev partition" "has the $MODE sets" \ '$(disklabel '$_dev' 2>/dev/null | grep "^ [a-p]: " | egrep -v "swap|unused" | sed '\''s/^ \(.\): .*/\1/'\'')' [[ $resp == done ]] && return 1 fi grep -q "^ $resp: .*MSDOS" $_file && _opts="-s" mount -o ro,$_opts /dev/$_dev$resp /mnt2 } askpass() { stty -echo IFS= read -r resp?"$1 " stty echo echo } rm -df /tmp/lock lock() { while ! mkdir /tmp/lock 2>/dev/null && sleep .1; do done } unlock() { rm -d /tmp/lock 2>/dev/null } retrap() { trap 'kill -KILL $cppid 2>/dev/null; echo; stty echo; exit 0' \ INT EXIT TERM } rm -f /tmp/update ( while :; do lock if test -e /tmp/update && [[ "`dmesg`" != "`cat /tmp/update`" ]]; then dmesg >/tmp/update kill -TERM 2>/dev/null $$ || exit 1 fi unlock sleep .5 done ) |& cppid=$! retrap _ask() { local _q=$1 _def=$2 _int _redo=0 _pid trap "_int=1" INT trap "_redo=1" TERM lock; dmesg >/tmp/update; unlock echo -n "${_q:+$_q }${_def:+[$_def] }" read resp lock; rm /tmp/update; unlock if ((_redo)); then stty raw stty -raw else case $resp in !) echo "Type 'exit' to return to install." sh _redo=1 ;; !*) eval "${resp#?}" _redo=1 ;; esac fi retrap ((_int)) && kill -INT $$ : ${resp:=$_def} return $_redo } ask() { while ! _ask "$1" "$2"; do done } askpassword() { while :; do askpass "Password for $1 account? (will not echo)" _password=$resp askpass "Password for $1 account? (again)" [[ $resp == "$_password" ]] && break echo "Passwords do not match, try again." done } user_setup() { local _q="Setup a user? (enter a lower-case loginname, or 'no')" while :; do ask "$_q" no case $resp in n|no) return ;; y|yes) _q="No really, what is the lower-case loginname, or 'no'?" continue ;; root|daemon|operator|bin|smmsp|popa3d) ;; sshd|uucp|www|named|proxy|nobody|ftp) ;; [a-z]*([a-z0-9_])) ((${#resp} <= 31)) && break ;; esac echo "$resp is not a useable loginname." done user=$resp while :; do ask "Full user name for $user?" $user case $resp in *[:\&,]*) echo "':', '&' or ',' are not allowed." ;; *) ((${#resp} <= 100)) && break echo "Too long." ;; esac done username=$resp askpassword $user userpass=$_password if [[ $sshd == y ]]; then ask_yn "Since you set up a user, disable sshd(8) logins to root?" yes sshd_disableroot=$resp fi } function ask_until { resp= while [[ -z $resp ]] ; do ask "$1" "$2" done } ask_yn() { local _q=$1 _a=${2:-no} typeset -l _resp while :; do ask "$_q" "$_a" _resp=$resp case $_resp in y|yes) resp=y ; return ;; n|no) resp=n ; return ;; esac done } ask_which() { local _name=$1 _query=$2 _list=$3 _def=$4 _dynlist _dyndef while :; do eval "_dynlist=\"$_list\"" eval "_dyndef=\"$_def\"" set -o noglob set -- $_dyndef; _dyndef="$1" set -- $_dynlist; _dynlist="$*" set +o noglob (($# < 1)) && resp=done && return : ${_dyndef:=$1} echo "Available ${_name}s are: $_dynlist." echo -n "Which one $_query? (or 'done') " [[ -n $_dyndef ]] && echo -n "[$_dyndef] " _ask || continue [[ -z $resp ]] && resp="$_dyndef" isin "$resp" $_dynlist done && break echo "'$resp' is not a valid choice." done } isin() { local _a=$1 _b shift for _b; do [[ $_a == $_b ]] && return 0 done return 1 } addel() { local _a=$1 shift echo -n "$*" isin "$_a" $* || echo -n " $_a" } rmel() { local _a=$1 _b shift for _b; do [[ $_a != $_b ]] && echo -n "$_b " done } bsort() { local _l _a=$1 _b (($# > 0)) || return shift for _b; do if [[ $_a != $_b ]] ; then if [[ $_a > $_b ]] ; then _l="$_a $_l"; _a=$_b else _l="$_b $_l" fi fi done echo -n "$_a " bsort $_l } showcols() { local _l _cdir=/tmp/cdir set -A _clist mkdir -p $_cdir rm -rf -- $_cdir/* while read _l; do [ "$_l" ] || continue mkdir -p /tmp/cdir/"$_l" _clist[${#_clist[*]}]="$_l" done (cd $_cdir; ls -Cdf "${_clist[@]}") rm -rf -- $_cdir } makedev() { [[ -z $(cd /dev && sh MAKEDEV "$@" 2>&1) ]] } addhostent() { local _addr=$1 _name=$2 _delim="." [[ -z $_addr || -z $_name ]] && return [[ $_addr == *:* ]] && _delim=":" sed "/^[0-9a-fA-F]*[$_delim].*[ ]$_name\$/d" /tmp/hosts \ >/tmp/hosts.new 2>/dev/null mv /tmp/hosts.new /tmp/hosts echo "$_addr $_name" >>/tmp/hosts } select_sets() { local _avail=$1 _selected=$2 _f _action _col=$COLUMNS let COLUMNS=_col-8 cat <<__EOT Select sets by entering a set name, a file name pattern or 'all'. De-select sets by prepending a '-' to the set name, file name pattern or 'all'. Selected sets are labelled '[X]'. __EOT while :; do for _f in $_avail; do isin $_f $_selected && echo "[X] $_f" || echo "[ ] $_f" done | showcols | sed 's/^/ /' ask "Set name(s)? (or 'abort' or 'done')" done set -o noglob for resp in $resp; do case $resp in abort) _selected=; break 2 ;; done) break 2 ;; -*) _action=rmel ;; *) _action=addel ;; esac resp=${resp#[+-]} [[ $resp = all ]] && resp=* for _f in $_avail; do [[ $_f = $resp ]] && _selected=$($_action $_f $_selected) done done done set +o noglob COLUMNS=$_col resp=$_selected } configure_ifs() { local _first _ifdevs _ifs _name _hn _vl=0 _vd _vi _p _tags while :; do _vd=$(ifconfig vlan$_vl 2>&1) [[ $_vd == @(*no such interface*) ]] && break [[ $_vd == @(vlan$_vl: flags=0<>*) ]] && break ((_vl++)) done _vd= ifconfig lo0 inet 127.0.0.1/8 while :; do ifconfig vlan$_vl create >/dev/null 2>&1 ask_which "network interface" "do you wish to configure" \ '$(get_ifdevs)' \ ${_p:-'$( (ifconfig netboot 2>/dev/null | sed -n '\''1s/:.*//p'\''; get_ifdevs) | sed q )'} [[ $resp == done ]] && break _ifs=$resp _hn=/tmp/hostname.$_ifs rm -f $_hn if [[ $_ifs == vlan[0-9]* ]]; then _vi=$(ifconfig $_ifs 2>/dev/null | sed -n 's/vlan: \([0-9]*\).*/\1/p') _tags=$(ifconfig vlan 2>/dev/null | sed -n 's/vlan: \([0-9]*\).*/\1/p') [[ -n $_tags ]] && _tags=$(rmel "$_vi" $_tags) if [[ -z $_vi ]]; then _vi=0 while ((++_vi < 4096)); do ! isin "$_vi" $_tags && break done fi _ifdevs=$(get_ifdevs) set -- $_ifdevs while [[ $1 == vlan[0-9]* ]]; do shift done ask "Which interface:tag should $_ifs be on?" "${_vd:=$1}:$_vi" _vd=${resp%%:*} _vi=${resp##*:} if ! (isin "$_vd" $_ifdevs && [[ $_vd != vlan[0-9]* ]]); then echo "Invalid interface choice '$_vd'" _vd= continue fi if ((_vi < 1 || _vi > 4095)) || isin "$_vi" $_tags; then echo "Invalid or in-use vlan tag '$_vi'" continue fi grep -qs "^up" /tmp/hostname.$_vd || echo "up" >>/tmp/hostname.$_vd ifconfig $_vd up ifconfig $_ifs destroy >/dev/null 2>&1 ifconfig $_ifs vlan $_vi vlandev $_vd echo "vlan $_vi vlandev $_vd" >>$_hn [[ ${_ifs##vlan} == $_vl ]] && ((_vl++)) fi ifconfig $_ifs 2>/dev/null | grep -q "^[[:space:]]*ieee80211:" && ieee80211_config $_ifs $_hn resp=$(hostname -s) [[ -n $_first && $_first != $_ifs ]] && ask "Symbolic (host) name for $_ifs?" $resp _name=$resp v4_config $_ifs $_name $_hn v6_config $_ifs $_name $_hn if [[ -f $_hn ]]; then chmod 640 $_hn ((nifs++)) : ${_first:=$_ifs} _p=done fi done } v4_info() { ifconfig $1 inet | sed -n ' 1s/.*/etc/resolv.conf.tail if [[ -n $_hn ]]; then _hn="send host-name \"$_hn\";" echo "Issuing hostname-associated DHCP request for $_ifs." else echo "Issuing free-roaming DHCP request for $_ifs." fi cat >/etc/dhclient.conf <<__EOT initial-interval 1; $_hn request subnet-mask, broadcast-address, routers, domain-name, domain-name-servers, host-name; __EOT ifconfig $_ifs group dhcp >/dev/null 2>&1 dhclient $_ifs set -- $(v4_info $_ifs) if [[ $1 == UP && -n $2 ]]; then mv /etc/dhclient.conf /tmp/dhclient.conf mv /etc/resolv.conf.tail /tmp/resolv.conf.tail return 0 fi ifconfig $_ifs delete down -group dhcp 2>/dev/null rm /etc/dhclient.conf /etc/resolv.conf.tail return 1 } hextodec() { local _d _b for _b in $(echo ${1#0x} | sed 's/\(..\)/\1 /g'); do _d=$_d.$((0x$_b)) done echo ${_d#.} } ieee80211_scan() { [[ -f $WLANLIST ]] || ifconfig $1 scan | sed -n 's/^ nwid \([^"]\)/\1/p' > $WLANLIST cat $WLANLIST } ieee80211_config() { local _ifs=$1 _hn=$2 _prompt _nwid _haswpa=0 _err ifconfig $_ifs -nwid -nwkey ifconfig $_ifs -wpa 2>/dev/null && _haswpa=1 rm -f $WLANLIST while [[ -z $_nwid ]]; do ask_until "Access point? (ESSID, 'any', list# or '?')" "any" case "$resp" in +([0-9])) _nwid=$(ieee80211_scan $_ifs | sed -n "${resp}s/ .*//p") [[ -z $_nwid ]] && echo "There is no line $resp." ;; \?) ieee80211_scan $_ifs | sed -n 's/^\([^ ]*\) chan .* bssid \([^ ]*\) .*$/ \1 (\2)/p' | less -XEN ;; *) _nwid=$resp ;; esac done if [[ $_nwid != any ]]; then ifconfig $_ifs nwid "$_nwid" quote nwid "$_nwid" >>$_hn _prompt="Security protocol? (O)pen, (W)EP" ((_haswpa == 1)) && _prompt="$_prompt, WPA-(P)SK" while :; do ask_until "$_prompt" "O" case "$_haswpa-$resp" in ?-[Oo]) break ;; ?-[Ww]) ask_until "WEP key? (will echo)" if _err=$(ifconfig $_ifs nwkey "$resp" 2>&1) && [[ -z $_err ]]; then quote nwkey "$resp" >>$_hn break fi echo "$_err" ;; 1-[Pp]) ask_until "WPA passphrase? (will echo)" if ifconfig $_ifs wpakey "$resp"; then quote wpakey "$resp" >>$_hn break fi ;; *) echo "'$resp' is not a valid choice." ;; esac done fi } v4_config() { local _ifs=$1 _name=$2 _hn=$3 _prompt _addr _mask if ifconfig $_ifs | grep -q 'groups:.* dhcp'; then _addr=dhcp else set -- $(v4_info $_ifs) if [[ -n $2 ]]; then _addr=$2; _mask=$(hextodec $3) ifconfig $_ifs inet $_addr delete fi fi if [[ -x /sbin/dhclient ]]; then _prompt="or 'dhcp' " ifconfig dhcp >/dev/null 2>&1 || _addr=dhcp fi _prompt="IPv4 address for $_ifs? (${_prompt}or 'none')" ask_until "$_prompt" "$_addr" case $resp in none) ;; dhcp) if [[ ! -x /sbin/dhclient ]]; then echo "DHCP not possible - no /sbin/dhclient." elif dhcp_request $_ifs "$_name" || dhcp_request $_ifs ; then echo "dhcp" >>$_hn makedev bpf$(ls /dev | grep -c "^bpf[0-9]") fi ;; *) _addr=$resp ask_until "Netmask?" "${_mask:=255.255.255.0}" ifconfig $_ifs -group dhcp >/dev/null 2>&1 if ifconfig $_ifs inet $_addr netmask $resp up ; then addhostent "$_addr" "$_name" echo "inet $_addr $resp" >>$_hn fi ;; esac } v6_config() { local _ifs=$1 _name=$2 _hn=$3 _addr _prefixlen _prompt ifconfig lo0 inet6 >/dev/null 2>&1 || return set -- $(v6_info $_ifs) [[ -n $2 ]] && { _addr=$2; _prefixlen=$3; } [[ -x /sbin/rtsol ]] && _prompt="or 'rtsol' " _prompt="IPv6 address for $_ifs? (${_prompt}or 'none')" ask_until "$_prompt" "${_addr:-none}" case $resp in none) return ;; rtsol) [[ ! -x /sbin/rtsol ]] && { echo "No /sbin/rtsol." ; return ; } ifconfig $_ifs up if rtsol -F $_ifs; then echo "up\nrtsol" >>$_hn fi return ;; esac _addr=$resp ask_until "IPv6 prefix length for $_ifs?" "${_prefixlen:=64}" ifconfig $_ifs inet6 $_addr prefixlen $resp up || return echo "inet6 $_addr $resp" >>$_hn addhostent "$_addr" "$_name" v6_defroute $_ifs } v4_defroute() { local _dr _prompt=" or 'none'" [[ -n $(ifconfig | sed -ne '/[ ]inet .* broadcast /p') ]] || return [[ -f /tmp/dhclient.conf && $nifs == 1 ]] && return [[ -x /sbin/dhclient ]] && _prompt=", 'dhcp'$_prompt" _prompt="Default IPv4 route? (IPv4 address$_prompt)" _dr=$(route -n show -inet | sed -ne '/^default */{s///; s/ .*//; p;}') [[ -f /tmp/dhclient.conf ]] && _dr=dhcp while :; do ask_until "$_prompt" "$_dr" [[ $resp == @(none|dhcp) ]] && break route delete -inet default >/dev/null 2>&1 route -n add -inet -host default "$resp" && { echo "$resp" >/tmp/mygate ; break ; } route -n add -inet -host default $_dr >/dev/null 2>&1 done } v6_defroute() { local _if=$1 _resp _routers route -n show -inet6 | egrep -q '^default[[:space:]]' && return _routers=$(bsort $(ping6 -n -c 2 ff02::2%$_if 2>/dev/null | sed -ne '/bytes from/{s/^.*from //;s/,.*$//;p;}' | sed -ne 'G;s/\n/&&/;/^\(.*\n\).*\n\1/d;h;P')) local PS3="IPv6 default router? (${_routers:+list #, }IPv6 address or 'none'): " select _resp in $_routers; do [[ ${_resp:=$REPLY} == *:* ]] && break [[ $_resp == none ]] && return done route -n add -inet6 -host default "$_resp" && echo "$_resp" >>/tmp/mygate } enable_network() { local _f _gw for _f in dhclient.conf resolv.conf resolv.conf.tail; do if [ -f /mnt/etc/$_f ]; then cp /mnt/etc/$_f /etc/$_f fi done ifconfig lo0 inet 127.0.0.1/8 for hn in /mnt/etc/hostname.*; do ((nifs++)) if=${hn#/mnt/etc/hostname.} (ifconfig $if||ifconfig $if create)> /dev/null 2>&1 || continue while :; do if [ "$cmd2" ]; then set -- $cmd2 af=$1 name=$2 mask=$3 bcaddr=$4 ext1=$5 cmd2= i=1 while [ i -lt 6 -a -n "$1" ]; do shift; let i=i+1; done ext2="$@" else read af name mask bcaddr ext1 ext2 || break fi case "$af" in "#"*|"!"*|"bridge"|"") continue ;; "dhcp") [ "$name" = "NONE" ] && name= [ "$mask" = "NONE" ] && mask= [ "$bcaddr" = "NONE" ] && bcaddr= dhcpif="$dhcpif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 down" if [[ -x /sbin/dhclient ]]; then cmd="$cmd; dhclient $if" else cmd="$cmd; echo /sbin/dhclient missing - skipping dhcp request." fi makedev bpf$(ls /dev | grep -c "^bpf[0-9]") ;; "rtsol") rtsolif="$rtsolif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 up" ;; *) read dt dtaddr if [ "$name" = "alias" ]; then alias=$name name=$mask mask=$bcaddr bcaddr=$ext1 ext1=$ext2 ext2= else alias= fi cmd="ifconfig $if $af $alias $name " case "$dt" in dest) cmd="$cmd $dtaddr" ;; *) cmd2="$dt $dtaddr" ;; esac case $af in inet) if [ ! -n "$name" ]; then echo "/etc/hostname.$if: inet alone is invalid" return fi [ "$mask" ] && cmd="$cmd netmask $mask" if [ "$bcaddr" -a X"$bcaddr" != "XNONE" ]; then cmd="$cmd broadcast $bcaddr" fi [ "$alias" ] && rtcmd=";route -qn add -host $name 127.0.0.1" ;; inet6) if [ ! -n "$name" ]; then echo "/etc/hostname.$if: inet6 alone is invalid" return fi [ "$mask" ] && cmd="$cmd prefixlen $mask" cmd="$cmd $bcaddr" ;; *) cmd="$cmd $mask $bcaddr" ;; esac cmd="$cmd $ext1 $ext2$rtcmd" rtcmd= ;; esac eval "$cmd" done /dev/null 2>&1 route -qn add -host default $_gw && break done [[ -z $rtsolif ]] && stripcom /mnt/etc/mygate | while read _gw; do [[ $_gw == !(*:*) ]] && continue route -qn delete -inet6 default >/dev/null 2>&1 route -qn add -host -inet6 default $_gw && break done route -qn add -net 127 127.0.0.1 -reject >/dev/null } install_files() { local _src=$1 _files=$2 _f _sets _get_sets _n _col=$COLUMNS for _f in $THESETS; do isin $_f $_files || continue; _sets=$(addel $_f $_sets) if [[ -z $DISPLAY && ! -d /mnt/etc/X11 ]]; then isin ${_f%${VERSION}.tgz} xbase xetc xshare xfont xserv && continue fi isin $_f $DEFAULTSETS "site$VERSION-$(hostname -s).tgz" && _get_sets=$(addel $_f $_get_sets) done if [[ -z $_sets ]]; then echo -n "Looked at " echo $_src | sed -e 's/\(^ftp:\/\/[^/]*\)\(:[^/]*\)\(@.*\)/\1\3/' echo "and found no $OBSD sets. The set names looked for were:" let COLUMNS=_col-8 for _n in $THESETS; do echo $_n; done | showcols | sed 's/^/ /' COLUMNS=$_col echo return fi resp=y isin INSTALL.$ARCH $_files || ask_yn "INSTALL.$ARCH not found. Use sets found here anyway?" [[ $resp = n ]] && return select_sets "$_sets" "$_get_sets" [[ -n $resp ]] || return _get_sets=$resp [[ $resp = n ]] && return shacmd="cat" [[ -x /bin/sha256 ]] && shacmd="sha256 /tmp/h" for _f in $THESETS ; do isin $_f $_get_sets || continue echo -n "Getting $_f ..." rm -f /tmp/h case $_f in *.tgz) ftp -Vmo - "$_src/$_f" | $shacmd | tar zxphf - -C /mnt ;; *) ftp -Vmo - "$_src/$_f" | $shacmd > "/mnt/$_f" ;; esac if (($? != 0)); then echo "'$_f' did not install correctly." elif [ -f /tmp/h -a -f "/var/hash/$_f" ]; then if [ "$(/dev/null 2>&1 && SM_ARGS="-s /tmp/etc$VERSION.tgz" [[ $_f == xbase$VERSION.tgz ]] && ftp -Vmo /mnt/tmp/xetc$VERSION.tgz \ "$_src/xetc$VERSION.tgz" >/dev/null 2>&1 && SM_ARGSX="-x /tmp/xetc$VERSION.tgz" done } encode_for_url() { echo "$1" | sed -e " s/%/%25/g s/ /%20/g s/!/%21/g s/\"/%22/g s/#/%23/g s/\\\$/%24/g s/&/%26/g s/'/%27/g s/(/%28/g s/)/%29/g s/\*/%2a/g s/+/%2b/g s/,/%2c/g s/-/%2d/g s/\./%2e/g s/\//%2f/g s/:/%3a/g s/;/%3b/g s//%3e/g s/?/%3f/g s/@/%40/g s/\[/%5b/g s/\\\\/%5c/g s/]/%5d/g s/\^/%5e/g s/_/%5f/g s/\`/%60/g s/{/%7b/g s/|/%7c/g s/}/%7d/g s/~/%7e/g " } ftp_error() { if [[ -n $(echo "$2" | grep "$1") ]]; then echo $1 return 0 fi return 1 } startftplist() { ((nifs < 1)) && return set -m ( ftp -Vao - "http://129.128.5.191/cgi-bin/ftplist.cgi?path=$FTPSETDIR" \ 2>/tmp/ftplisterr > $SERVERLISTALL echo -n $SECONDS >$SERVERLISTSEC ) & ftppid=$! set +m (sleep 12; kill -INT -$ftppid >/dev/null 2>&1) & } waitftplist() { wait "$ftppid" 2>/dev/null } ftp_time() { local _ftplist_sec=$(cat $SERVERLISTSEC 2>/dev/null) local _time=$(sed '/^TIME=\([0-9]*\)$/!d;s//\1/;q' $SERVERLISTALL 2>/dev/null) [[ -n $_ftplist_sec && -n $_time ]] && echo $((_time + SECONDS - _ftplist_sec)) } install_url() { local _url_type=$1 _file_list _url_base _prompt _passwd _mirror eval local _server_ip=\$_${_url_type}_server_ip \ _server_dir=\$_${_url_type}_server_dir waitftplist ask "HTTP/FTP proxy URL? (e.g. 'http://proxy:8080', or 'none')" \ "${ftp_proxy:-none}" unset ftp_proxy http_proxy [[ $resp == none ]] || export ftp_proxy=$resp http_proxy=$resp if [[ -s $SERVERLISTALL ]]; then _prompt="Server? (hostname, list#, 'done' or '?')" sed -n "s,^${_url_type}://"'\([[A-Za-z0-9\:_][]A-Za-z0-9:._-]*\),\1,p' \ $SERVERLISTALL > $SERVERLIST set -- $(sed q $SERVERLIST) _server_ip=${1%%/*} else echo "(Was not able to get ftplist from ftp.openbsd.org, but that is OK)" _prompt="Server? (hostname or 'done')" fi while :; do ask_until "$_prompt" "$_server_ip" case $resp in done) return ;; "?") [[ -s $SERVERLIST ]] || continue less -XEN < $SERVERLIST ;; +([0-9])) [[ -s $SERVERLIST ]] || continue set -- $(sed -n "${resp}p" $SERVERLIST) (($# < 1)) && { echo "There is no line $resp." ; continue ; } _server_ip=${1%%/*} ;; +([A-Za-z0-9\:.\[\]_-])) _server_ip=$resp break ;; *) echo "'$resp' is not a valid hostname." ;; esac done eval _${_url_type}_server_ip=$_server_ip set -- $(sed "/^$_server_ip/x;\$!d;x" $SERVERLIST 2>/dev/null) resp=${1#*/} [[ $resp == "$1" ]] && resp= if (($# > 1)); then resp=$resp/$FTPSETDIR _mirror=yes fi ask_until "Server directory?" "${resp:-pub/OpenBSD/$FTPSETDIR}" _server_dir=$resp eval _${_url_type}_server_dir=$_server_dir if [[ $_url_type == ftp ]]; then IFS= ask_until "Login?" "${_ftp_server_login:=anonymous}" _ftp_server_login=$resp if [[ $_ftp_server_login == @(anonymous|ftp) ]]; then _passwd=root@`hostname` else resp= while [[ -z $resp ]] ; do askpass "Password? (will not echo)" done _passwd=$resp fi fi _url_base=$_url_type:// if [[ $_url_type == ftp && $_ftp_server_login != anonymous ]]; then _url_base=$_url_base$(encode_for_url "$_ftp_server_login"):$(encode_for_url "$_passwd")@ fi _url_base=$_url_base$_server_ip/$_server_dir if [[ $_url_type == ftp && -z $ftp_proxy ]] ; then _file_list=$(ftp -V "$_url_base/") ftp_error "Login failed." "$_file_list" && return ftp_error "No such file or directory." "$_file_list" && return else _file_list=$(ftp -Vo - "$_url_base/index.txt" | sed -e 's/^.* //' | sed -e 's/ //') fi install_files "$_url_base" "$_file_list" installedfrom=$_url_type://$_server_ip/$_server_dir if [[ -n $_mirror ]]; then PACKAGE_PATH=$(print -r -- "$installedfrom" | sed -E "/\/(snapshots|[0-9]\.[0-9])\/($ARCH)\/*$/!d s!!/\1/packages/$(arch -s)/!;q") else PACKAGE_PATH= fi } install_mounted_fs() { local _dir while :; do ask_until "Pathname to the sets? (or 'done')" "$SETDIR" [[ $resp == done ]] && return [[ -d /mnt2/$resp ]] && { _dir=/mnt2/$resp ; break ; } [[ -d /mnt/$resp ]] && { _dir=/mnt/$resp ; break ; } [[ -d /$resp ]] && { _dir=/$resp ; break ; } echo "The directory '$resp' does not exist." done install_files "file://$_dir" "$(ls $_dir/)" } install_cdrom() { get_drive "CD-ROM" '$(get_cddevs)' || return mount_mnt2 $resp || return install_mounted_fs } install_disk() { ask_yn "Is the disk partition already mounted?" if [[ $resp == n ]]; then get_drive "disk" '$(bsort $(get_dkdevs))' \ '$(bsort $(rmel $ROOTDISK $(get_dkdevs)))' || return mount_mnt2 $resp || return fi install_mounted_fs } install_nfs() { local _tcp ask_until "Server IP address or hostname?" "$NFS_ADDR" NFS_ADDR=$resp ask_until "Filesystem on server to mount?" "$NFS_PATH" NFS_PATH=$resp ask_yn "Use TCP transport? (requires TCP-capable NFS server)" [[ $resp == y ]] && _tcp=-T mount_nfs $_tcp -o ro -R 5 $NFS_ADDR:$NFS_PATH /mnt2 || return install_mounted_fs } install_tape() { local _z _bs get_drive "tape drive" '$MTDEVS' || return export TAPE=/dev/nr$resp if [[ ! -c $TAPE ]]; then echo "$TAPE is not a character special file." return fi echo -n "Rewinding $TAPE (mt rewind)..." mt rewind || return echo "done." while :; do ask_until "Skip how many files? (or 'done')" 0 [[ $resp == done ]] && return [[ $resp == +([0-9]) ]] || continue if (($resp > 0)); then echo -n "Skipping $resp file(s)..." mt fsf $resp || return echo "done." elif [[ -n $_bs ]]; then mt bsf ; mt fsf fi unset _z ask_yn "Is the file gzipped?" yes [[ $resp == y ]] && _z=z [[ $_z == z ]] || _bs=10240 ask_until "Blocksize for this file?" "${_bs:-8k}" [[ $resp == done ]] && return _bs=$resp dd if=$TAPE bs=$_bs | tar ${_z}xvphf - -C /mnt || return done } set_timezone() { local _zonefile=$1 _zonepath _zsed _tz _zoneroot=/usr/share/zoneinfo [[ ! -f $_zonefile ]] && return [[ -n $TZ ]] && return if [[ -h /mnt/etc/localtime ]]; then TZ=$(ls -l /mnt/etc/localtime 2>/dev/null) TZ=${TZ#*${_zoneroot#/mnt}/} fi waitftplist if [[ -s $SERVERLISTALL ]]; then _tz=$(sed -ne '/^TZ=/s/TZ=//p' <$SERVERLISTALL) [[ -n $_tz ]] && isin "$_tz" `cat $_zonefile` && TZ=$_tz fi [[ $_zonefile = /var/tzlist && -z $TZ ]] && return while :; do ask "What timezone are you in? ('?' for list)" "$TZ" _zonepath=${resp%%*(/)} case $_zonepath in "") continue ;; "?") grep -v /. $_zonefile | showcols continue ;; esac while isin "$_zonepath/" $(cat $_zonefile); do ask "What sub-timezone of '$_zonepath' are you in? ('?' for list)" _zsed=$(echo $_zonepath/ | sed 's,/,\\/,g') resp=${resp%%*(/)} case $resp in "") ;; "?") sed -n "/^$_zsed/{s/$_zsed//;/\/./!p;}" $_zonefile | showcols ;; *) _zonepath=$_zonepath/$resp ;; esac done if isin "$_zonepath" $(cat $_zonefile); then TZ=${_zonepath#$_zoneroot} return fi echo -n "'${_zonepath}'" echo " is not a valid timezone on this system." done } sane_install() { local _q=$1 _s _m for _s in $SANESETS; do isin $_s $DEFAULTSETS || continue resp=n [[ -z $_q ]] && ask_yn "Are you *SURE* your $MODE is complete without '$_s'?" [[ $resp == n ]] && _m="$_m $_s" done [[ -n $_m ]] && return 1 return 0 } install_sets() { local _d _locs="disk ftp http" echo [[ -s $SERVERLISTALL ]] && _d=$(sed -ne '/^method=/s/method=//p' $SERVERLISTALL) ifconfig netboot >/dev/null 2>&1 && : ${_d:=http} [[ -n $(get_cddevs) ]] && { _locs="cd $_locs" ; : ${_d:=cd} ; } [[ -x /sbin/mount_nfs ]] && _locs="$_locs nfs" [[ -n $MTDEVS && -x /bin/mt ]] && _locs="$_locs tape" : ${_d:=http} if ! isin "$_d" $_locs; then for a in http ftp cd nfs tape disk; do isin $a $_locs && _d=$a && break done fi echo "Let's $MODE the sets!" while :; do umount -f /mnt2 >/dev/null 2>&1 [[ -n $method ]] && _d=$method sane_install quiet && _d=done ask "Location of sets? ($_locs or 'done')" "$_d" case $resp in done) sane_install && return ;; c*|C*) isin cd $_locs && install_cdrom && method=cd ;; d*|D*) install_disk && method=disk ;; f*|F*) isin ftp $_locs && install_url ftp && method=ftp ;; h*|H*) isin http $_locs && install_url http && method=http ;; n*|N*) isin nfs $_locs && install_nfs && method=nfs ;; t*|T*) isin tape $_locs && install_tape && method=tape ;; esac done } run_sysmerge() { echo "After rebooting, run sysmerge(8) to update your /etc configuration." #if [[ -n "$SM_ARGS" || -n "$SM_ARGSX" ]]; then #fi } update_firmware() { echo "/usr/sbin/fw_update -v" >> /mnt/etc/rc.firsttime } munge_fstab() { local _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do [[ $_dev == @(/dev/vnd*|\#*) || $_fstype == nfs || ! -f /sbin/mount_$_fstype || $_opt == *noauto* || $_opt == *xx* ]] && continue _opt=$(echo $_opt | sed -e 's/softdep//') [[ $_fstype == ffs ]] && _opt=$(echo $_opt | sed -e 's/ro/rw/') [[ $_fstype == ffs ]] || _opt=$(echo $_opt | sed -e 's/rw/ro/') echo $_dev /mnt${_mp%/} $_fstype $_opt $_rest done /etc/fstab if [ ! -s /etc/fstab ]; then echo "Unable to create valid /etc/fstab." exit fi } mount_fs() { local _async=$1 _dev _mp _fstype _opt _rest _msg _fail while read _dev _mp _fstype _opt _rest; do [ "$_mp" = "/mnt" ] || mkdir -p $_mp _msg=$(mount -v -t $_fstype $_async -o $_opt $_dev $_mp) || _fail="$_fail\n$_mp ($_dev)" echo $_msg | sed -e 's/, ctime=[^,)]*//' done 0)) || continue echo -n "fsck -${_f}p $_dev..." if ! fsck -${_f}p $_dev >/dev/null 2>&1; then echo "FAILED. You must fsck $_dev manually." _fail=y else echo "OK." fi done /tmp/resolv.conf for _ns in $resp; do echo "nameserver $_ns" >>/tmp/resolv.conf done cp /tmp/resolv.conf /tmp/resolv.conf.shadow fi } populateusrlocal() { if [ -f /mnt/etc/mtree/BSD.local.dist ]; then /mnt/usr/sbin/chroot /mnt /usr/sbin/mtree -Uedqn -p /usr/local -f /etc/mtree/BSD.local.dist >/dev/null fi } apply() { if [[ $sshd == n ]]; then echo "sshd_flags=NO # disabled during install" \ >>/mnt/etc/rc.conf.local fi if [[ $sshd_disableroot == y ]]; then sed -e "/^#\(PermitRootLogin\) yes/s//\1 no/" \ < /mnt/etc/ssh/sshd_config > /tmp/sshd_config cp /tmp/sshd_config /mnt/etc/ssh/sshd_config fi if [[ $ntpd == y ]]; then echo "ntpd_flags= # enabled during install" \ >>/mnt/etc/rc.conf.local if [[ $ntpd_server != default ]]; then set -- $ntpd_server sed -e "s/^servers /#&/;/#server /a\\ servers $1 " /mnt/etc/ntpd.conf >/tmp/ntpd.conf cp /tmp/ntpd.conf /mnt/etc/ntpd.conf fi fi if [[ $x11 == y ]]; then sed -e "/^#\(machdep\.allowaperture=${MDXAPERTURE}\)/s//\1 /" \ /mnt/etc/sysctl.conf >/tmp/sysctl.conf cp /tmp/sysctl.conf /mnt/etc/sysctl.conf fi if [[ $xdm == y && -x /mnt/usr/X11R6/bin/xdm ]]; then echo "xdm_flags= # enabled during install" \ >>/mnt/etc/rc.conf.local fi if [[ $defcons == y ]]; then cp /mnt/etc/ttys /tmp/ttys sed -e "/^$CTTY/s/std.9600/std.${CSPEED}/" \ -e "/^$CTTY/s/unknown/vt220 /" \ -e "/$CTTY/s/off.*/on secure/" /tmp/ttys >/mnt/etc/ttys [[ -n $CPROM ]] && echo "stty $CPROM $CSPEED\nset tty $CPROM" >>/mnt/etc/boot.conf fi ln -sf /usr/share/zoneinfo/$TZ /mnt/etc/localtime } questions() { local _d _xdmask=y _def ask_yn "Start sshd(8) by default?" yes sshd=$resp ask_yn "Start ntpd(8) by default?" ntpd=$resp if [[ $resp == y ]]; then ask "NTP server? (hostname or 'default')" default ntpd_server=$resp fi def=no [[ -n $DISPLAY ]] && def=yes if [[ -n $MDXAPERTURE ]]; then ask_yn "Do you expect to run the X Window System?" $def x11=$resp _xdmask=$resp fi if [[ -n $MDXDM && $_xdmask == y ]]; then ask_yn "Do you want the X Window System to be started by xdm(1)?" xdm=$resp fi if [[ -n $CDEV ]]; then _d=${CPROM:-$CDEV} ask_yn "Change the default console to $_d?" defcons=$resp if [[ $resp == y ]]; then ask_which "speed" "should $_d use" \ "9600 19200 38400 57600 115200" $CSPEED case $resp in done) defcons=n ;; *) CSPEED=$resp ;; esac fi fi } finish_up() { local _dev _mp _fstype _rest if [[ -x /mnt/sbin/swapctl ]]; then /mnt/sbin/swapctl -a /dev/$SWAPDEV >/dev/null 2>&1 while read _dev _mp _fstype _rest; do [[ $_fstype == swap ]] && /mnt/sbin/swapctl -a $_dev >/dev/null 2>&1 done $/\1/p') md_installboot $ROOTDISK if [[ -f /mnt/bsd.mp ]] && ((NCPU > 1)); then echo "Multiprocessor machine; using bsd.mp instead of bsd." mv /mnt/bsd /mnt/bsd.sp 2>/dev/null mv /mnt/bsd.mp /mnt/bsd fi [[ "$MODE" == upgrade ]] && run_sysmerge update_firmware cat <<__EOT CONGRATULATIONS! Your OpenBSD $MODE has been successfully completed! To boot the new system, enter 'reboot' at the command prompt. __EOT [[ $MODE == install ]] && cat <<__EOT When you login to your new system the first time, please read your mail using the 'mail' command. __EOT md_congrats } ROOTDISK= ROOTDEV= PACKAGE_PATH= SM_ARGS= SM_ARGSX= SETDIR="$VNAME/$ARCH" FTPDIR="pub/OpenBSD/$VNAME" SERVERLISTALL=/tmp/serverlistall SERVERLISTSEC=/tmp/serverlistsec SERVERLIST=/tmp/serverlist WLANLIST=/tmp/wlanlist FSTABFLAG=-f for _opt in d f l m n p s; do ulimit -$_opt unlimited done dmesg | sed -ne '/^OpenBSD /h;/^OpenBSD /!H;${g;p;}' >/var/run/dmesg.boot FTPSETDIR=$SETDIR set -- $(scan_dmesg "/^OpenBSD $VNAME\([^ ]*\).*$/s//\1/p") [[ $1 == -!(stable) ]] && FTPSETDIR=snapshots/$ARCH MTDEVS=$(scan_dmesg "${MDMTDEVS:-/^[cms]t[0-9][0-9]* /s/ .*//p}") nifs=0 DISPLAY=$(scan_dmesg '/^wsdisplay[0-9]* /s/ .*//p') CONSOLE=$(scan_dmesg '/^\([^ ]*\).*: console$/s//\1/p') CONSOLE=${CONSOLE% } [[ -n $CONSOLE ]] && CSPEED=$(stty speed) md_consoleinfo THESETS="bsd bsd.rd bsd.mp $MDSETS" : ${DEFAULTSETS:="bsd bsd.rd"} for _set in base etc comp man game xbase xetc xshare xfont xserv site ; do [[ $MODE == upgrade && ( $_set == etc || $_set == xetc ) ]] && continue THESETS="$THESETS ${_set}${VERSION}.tgz" isin $_set site && continue DEFAULTSETS="$DEFAULTSETS ${_set}${VERSION}.tgz" done SANESETS="${SANESETS:-bsd} base${VERSION}.tgz etc${VERSION}.tgz" COLUMNS=$(stty -a | sed -n '/columns/{s/^.* \([0-9]*\) columns.*$/\1/;p;}') ((COLUMNS == 0)) && COLUMNS=80 : ${EDITOR:=ed} [[ -x /usr/bin/vi ]] && EDITOR=vi export EDITOR COLUMNS cd / umount -af 1>/dev/null 2>&1 for _ifs in $(get_ifdevs dhcp); do set -- $(v4_info $_ifs) [[ $1 == UP && -n $2 ]] && continue ifconfig $_ifs delete down -group dhcp 2>/dev/null done cat <<__EOT At any prompt except password prompts you can escape to a shell by typing '!'. Default answers are shown in []'s and are selected by pressing RETURN. You can exit this program at any time by pressing Control-C, but this can leave your system in an inconsistent state. __EOT set_term if [[ $MODE == install ]]; then ask_until "System hostname? (short form, e.g. 'foo')" "$(hostname -s)" [[ ${resp%%.*} != $(hostname -s) ]] && hostname $resp THESETS="$THESETS site$VERSION-$(hostname -s).tgz" echo donetconfig ((nifs != 0)) && startftplist echo while :; do askpassword root _rootpass="$_password" [[ -n "$_password" ]] && break echo "T|i%o%o%lUBv%u%~o,@&,@',@C(,@D%,@%,@Ѓ%,@8k,@0%,@`}%@(%-@x%-@%ܔ@̄%h@%Dd@%-@%-@% -@%(-@h%0-@H%MA%8-@<%@-@|%H-@L%{A%P-@%X-@Ԁ%`-@%h-@%p-@%|-@-@@%-@@%DIA@%-@%K@(%X@% @%-@{%@{%-@|%-@%-@%-@%4@%-@%LB%-@p%-@%-@%-@|%-@0%-@&,@'-@k.@k .@(%.@%.@%/@,%%̈%|%%%%xxooP,k$r2@k(%2@dk(%2@k(%2@k(%2@k(%3@k(%kPo oo%%%% ER@&CEh&ST8%SL&RR&CEh&ST8%NM(&|%CL &0PL &0RE %@RR&CEh&ST8%PX< &&TF0&$&PN&RR&CEh&ST8%p%&T%&#&)@+&(% )"&((H(&D%"&%&p%("& #&#&$&0&+&%&%(()((,"&$$&%&(p%&T%&#& *@+&ܦ* ) )4* **H(&D%8* *) ****$&L* * *% * *) * *,"&* *Ȱ*H*lS&4 k4&d5x5native5K k&5,6'd5x57@7@ 7@XE'd&p& ( ( v*`&&&i*g*XE'[*Lv* k*V* T*<93~&XE'&8*8~*'&&XE' ) H)h) ) ty) z)\e*dX*(W*z*dJ'XE'&XE'&XE'T&r(XE' 03'<&*'&h&XE'('XE' 4('`F*|h* a* @&0B*x[* x*Lz*dy*k*0&XE'XE'XE'XE'XE'XE'Ȑ2 ,2 2XE'XE' p2'@'& ' 'XE'XE''XE'XE'XE'&XE' l&(XE'xN* ' ) )XE''XE'XE'5 \)|))XE'XE'8((-'XE'XE'XE'XE'`' '{)XE' ( (h' 0P*T*XE'T '8'DN*XE'XE'T&B*4)}))K*f*`*XE''XE'XE'XE'XE'XE'XE' 'DG*XE'XE'XE'XE'XE'XE'XE'XE'XE'XE'XE'XE'q*XE'XE'XE'6XE'XE'XE'XE'XE'XE'XE'hE*C*XE'XE'XE'XE'XE'XE'\''8'XE'XE'XE'XE'XE'XE'XE' b*Ї& d(3'p'XE' 2XE'pI*Y*O*'22XE'x^*\ 'XE' \(XE'XE'XE'XE'XE'XE'XE'XE'XE'XE'XE'XE'XE'XE'XE'XE'XE'XE'XE'XE'XE'XE'4'8'H'XE'XE'XE'XE'XE'ȷ'XE'XE'XE'XE'XE'XE'XE'XE'XE' 2XE' (& Q* ' 2XE'XE'XE'XE'XE'XE'(m*XE'XE'D*B*h&&22XE'XE'XE'XE'XE'XE'XE'XE' t' ' & 'XE' d2|&H2'XE'XE'c*&Tc*l*XE'XE'XE'x'&P'ԗ'& 0'*' XE'XE'XE'XE'w)tw)I*$e*V*PT*c*i* K* A*k*u*a* N* Ph* f*_*^*XE'H&X&&&$&&&<&(&(&d&&&&̝&&`&̞&d0kd0kd0kT0k1kt0k 0k@ 0 )'P)')'1k1k1kd>@?@1k1k2k|'@B?@1kX2k2k2k 3kH3k3k3k3k84k2k @@ <@C@C@C4k,(|+(4kT>(=( % S@IATL@sBS@LBS@v@S@@S@ BD@LzAS@HA .@h@$@UA2@]AS@LzA-@4@S@@S@(>@@@h@<@<@T((T(L(((0((((Ի(T( (0((@)((ttyclsttyopnttybgttyinttyout($(`((`(<((()(((((((()((|(`(<((()(((((((()((|((((()((|((((()((|((((()((|((((()((|((((()((|((((()((|(  $0@Y@8k̠)8k̠)8k̠)++++\Z@)Đ)7k8k@)?)@)?)?)8^)P))|9ke>ffsf>ext2fs=cd9660=msdos2lockf@` |c@c@c@c@c@c@c@c@c@c@c@c@c@c@c@c@c@c@c@d@d@ d@d@d@ L)T)\)(=*\=*|<*(ȓ**|**t*t*L*L)T)\) *`*ܦ* ) )4* ***t*8* *) *****L* * *( * *) * *** *Ȱ*H*`*T)\)****((*(*(**)****x*4***(********. .. +|+l+) -+++ )++%+*+*++*x++$+++-+1++*++)++&+++9+++8++t+ D+A+=k=k=k^^33330@+@+#$%&'()*+ʚ;,-.ʚ;/ʚ;0ʚ;1@B2 T3 T4 T56 T7 Tcde@B@B@KLاO[@T6nQ%l7Jpp@@@@j j j @ @k0Ak ,!,+,,+,m@L ,@k0Akd, Ck..H...-CkC. .!....Ckli.....|.p.Ck?.:.8.<.Ck-:.8.<.--Ckt.:.8.<..Ck)t.:.8.<.Ckܟ-:.8.<.-ܝ-l-<-Ck?.:.8.<.?.|@AkCk+ dXCkCkCkCkCk<8Q @X,hDktDk|DkDkAkAkAkAkDk8DkdDkc>c>d>x0Љ0T<0d"0r00111)*10P0 )x01̺0X0000810810000D011I08011) 1 1 %1X1\1,00111 **1ܦ* ) )L0 *̺0X0008* *) ****0@1 * *80 * *) * * %1* *(1H*d00d0,0d0T0 ... ...111)1x1?1 )x0H1D141P101XV1|11č100l1ta111`11H111X1`1Lh1d)111 *1ܦ* ) )L0 *D141P18* *) ****0@1 * *1 * *) * *1* *(1H*11p11l111|1 Nk OkpOk@O3:30I3A3=3=3@3h2Qk).4`3ȯ34QkCt. .V4..QklD....p.Qk 5T45454Qk:3T4545$ 4343Qk<X3Qk+xx4Qk,3Qk).T445.Qk.T445Qk 5T445 5@OkQk+@a3`3@ X XdRkRkLTkPTkTTkXTk\TkRkRkhTkRkRklTk@ E8(@AAA==(A* Rk,Rk0Rk>$>>>@8r@<r@@r@Dr@Hr@Lr@Pr@Tr@Xr@\r@`r@dr@hr@lr@pr@tr@xr @|r(@r,@$Zo54@$Zox5<@$ZoL5 VkD@05055@055@x5$5,55P555555555 55555@55555t5t5t5t5t55555armish6466t:60:6ʏ(((((((!3((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((7$77777(((((n%\n%m%k%i%i%Ț(Ț(Ț(Ț(Ț(((((((((((((((((((((pJ7H7tG7>7+7|L7Ț(Ț(Ț(Ț(Ț(8777d7 66((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((|%%%P%%%%(%)()))()()66d 6d 66(L(6&((((((L((Ț(Ț(Ț(Ț(Ț(Ț(Ț(((p(Ț(Ț(Ț(Ț(Ț((Ț(Ț((Ț(<+(\+(.((+(((.((8-(~&(((((T((Ț(Ț(Ț((((L((&Ț(Ț((Ț(((L((&((((((L((((((((L((j!i!G!`G!f!Z!G!((p(Ț(Ț(((Ț((T((((((((L((((((((L((7$7777(L((&((((((L((n%\n%i%i%k%(L((&Ț(Ț(Ț(Ț(Ț((L((&((((((L((((((((L((E+W+DX+d\+L+(H+(DB+((((((L((pJ7H7B7B7>7(L((&Ț(Ț(Ț(Ț(Ț((L((&87777d7(L((&Ț(Ț(((Ț((T((Ț(Ț(((Ț((T((((((((L((((((((L((((((((L((((((((L((Ț(Ț(Ț(Ț(Ț((Ț((Ț(Ț(Ț(((Ț((T((Ț(Ț(Ț(((Ț((T((Ț(Ț(Ț(Ț(Ț((Ț(Ț(Ț(u%Tw%x%(u%(w%(`v%Ț(Ț(Ț((Ț((Ț(Ț(((((((L((D%L%p%t%%(L((T%((((((L((((((((L((((((((L((((((((L((((((((L((Ț(Ț(((Ț((T(($/@/((/(T((((((((L((((((((L((Ț(Ț(((Ț((T((((((((L((p%p%((s%(T((((((((L((((((((L((((((((L((((((((L((Ț(Ț(Ț(Ț(Ț((Ț((Ț(((((((L((((((((L((Ț(Ț(Ț(Ț(Ț(Ț(Ț(Ț(Ț(Ț(88x8(L8(8(t#8 "8!8(d!8( 8(P58T/8/8($58(.8(58D68((=8(T((P88888(8(8Ț(Ț((Ț(((T((Ț(Ț(Ț(Ț(Ț((Ț((|8`8888X8(8((p(Ț(Ț(Ț(Ț(Ț((Ț((Ț(888x8l8(8(8((((((L((((((((L((((((((L((((((((L((((((((L((((((((L((Ț(Ț(Ț(Ț(Ț((Ț((Ț(((((((L((((((((L((((((((L((((((((L((((((((L((((((((L((((((((L((((((((L((((((((L((((((((L((((((((L((((((((L((((((((L((((((((L((((((((L((((((((L((((((((L((((((((L((((((((L((Ț(Ț(((Ț((T((Ț(Ț(((Ț((T((Ț(Ț((Ț(Ț((L((&Ț(Ț(((Ț((Ț((Ț(Ț(Ț(((Ț((T((%% %(%0%(L((&Ț(Ț(Ț(Ț(Ț((Ț((Ț(ahGH@$@ $@X@lUB@&@G@<L66664BA8(7T777X@PP7N7M7I7 $@4T7hT7 FA /HNPWT}7Ђ7(JA77JAT7,7JA0d77KAب7LAl07L7`KA̹77MA$PA4yki4PALykvDPA^yk2!pykykyk07X7 QA74777775755505(5P55555 5555 5`55555,5<5L5\5l5|55555555555H7d7QAl0777\7$@<@VAWAWA,WA>?? ' ` ~ ^ "' ,AAA AA'CEEEEIIIINOOOOOUUUUYaaaa aa'ceeeeiiiinooooouuuuyy"A"E"I"O"U"a"e"i"o"u"yA^A`A*A~ACE^E`EI^I`I~NO^O`O~OU^U`UYa^a`a*a~ace^e`ei^i`i~no^o`o~ou^u`uy\YAX8"8p*8`8 88 8!84,8,8L18-8?ZAZAZAZAZA<`ADВ8 88|8`A@aA8488P88ܞ&bA  % 3u Du u <u 8u 2u 0&'u 1&u 0&u     )%uu 0 1 8%u   3 D D%uu < 8 2u 0&'u 1&u 0&u  bA888ܞ&>cAcAfA* "9!9d#9&94hA$kAmApA# # pA@qA8tA`tA{{tAuA( ::l:H :h::xvA:8:\::\::vA#:(:):D%:$:wA/:5:3:2:0:wA8:d=:::,?:>:xAD:hI:I:E:8E:yAO:HzALR:dV:X:TX:PzA\y:t:p:lc:f:h:]:b:l`:Db:_:`:|A}A :5hv1! !vvvvvvv3 P q q2vqqqqCW 2D k"{"{"3" dAdAW 2]\ \ ;  }A,}A<}AP}AQd}Ax}A}A}A}A}A}A~A~A4~AA:: :4:PA:: :4:lA:: :4:A;; :4:A;,; :;A ;( ; :4: A;; :4:TA;; :4:A;; :4:ȅA;; :4:A ;4; :4:A ;H; :4:DA4 ;\ ; :4:A!;$"; :4:A0#;,; :4: A01;X1; :4:(AK;DK; :4:AQ;Q; :4:hAT;T; :4:ԌAY;Y; :4:`A f;Hf; :4:hA,o;To; :4:ȍAt;;Ѐ; ;TKA8;;p;;H ( ( D' ' $;Ю;H ( ( D' ' (;;ܱ;( ( D' ' ;4;u `o:$7%05x>*`'h=$-P/uk ;43K2X,XpHl((x:LD1Px5 l>+*DJ8'=  4pD'`kh?< r#lq0k<kEH9(RP=a;Pn-|;lDk5, /$0[:`&\T8#!d,< g3|$T<04/A 'L$o#4h@$-x0Z86L,1k| :|k8XMqX- 5"$/<980Iz&S-7h_Hk$qTg-|P%8 Lv! t 4! :t`3@  -p:k<#;8370A$r9P$7(_%8o&${v%Txk,PD/$85+c*8x$7;h5@9PDX3P|G'8X@kaD!p̚=@Ak o$":h0 l>tDkK+<) <&p H7 <6`' X6p3 H*E P",U 6pf =kl T'Xr C} ")D +8 4k ,1l ܞ& 6L n( dE! Pt9t *h - Ďk 5* 3< CK T/Z lR:@p @6 @k )' 7&` $T 2l (1 _-\ D{k \)L I*T/ !584 5C ,Y \~%pl 4`z o @# /8 % e/P p>,x 6h ,D "   /7(" HWkA  $R /0a r%8j $7~ ! ; ?` ?  Ok$ D1 4k !0 q .- 058 >? -X_ $N8Hu ;  ~Է4xDB+|K)<! J5t($p%p8 *D9 9p%x:3T4&Dp0Z&Djԗ'z̚6xȿ7T$71k8'd=: ,> CT$r$p(H.%X>{%hR8X^c.p(p;0M7X0-L&('Pkx;8L$x#:($k&-08=*$L6`V8tz|%D>(s%hy5 &P;t:60l&@d$DD2/0Ak4;8F4R,*D\>(Hlzpvh'X7tG7@n(z$2Dȅ!*(6-0k&<270D]8XYh9Nt% C3(4DB`>SGkf9zqh)/<(<7(5.#p+(pf'5 = h(1 +|-'$@y<2!4CD/O%&,[ogtkn@<8n5D1$l<5`(d8(:,+^:tT#4(',r(*l5X_9H$rW88g4sHDk/W+d v8('p:88) DCW9 X9</P9<\l8 Q|Dk[}:0i9zL68l-H&dܼ7o-@j"0P 2d'd# D&98"L40$k:#2JLr8WH8 aHz+\tF+$~|&l:C<6k:'6L/p,!0j>0^"<5Xhq--L9d*@D$Q@;t]t%krz5v+po%<( ;8`8;H,|4 kP PT9 p8"P/4/!A7HLTkU0/d"w",8J8r+#x$89tH7Hmq$h0-T6ا'LB$Q/a4/pm$Tho '0ko/$t`' )Poxkto'0 #,5k#$:`#pAk#L6#d%x# 9$#(r$' $8',$89$8@C$82U$l&pb$ԇ:s$P9$ܘ/T$=@$|:$L5,$-$$B,$l%9%X%%T%<.%8C7%DP:D%kO%t7Ti%U7r%'%tk%&D%&X%&%%D%D$%C%$!%7%'&&&V'#&$D2&d'9&4'E&2#TY&PTkc&-n&V*8{& ;(&5&|/)p&o&}&&ܝ-0&l&&6<&xn$d'!p(' $ '90'%<F' $]'8;,q'4!,'0;h'+'\G:'09'!'8{8'pq ('((#(()&(.D1(#H(DI' P(L6^(;2o(@%|( T8t(,r(5(Mq(>:((Wk(~o` (`iq) r)3$)<81).C)\k2/H)d /k/C/t&;\+/48;/%K/hZ#PY/0"i/p!y/M l/T'/2*/\9 /(/1k/x"/D !/0r/,2$0eq 0P9+00+A0)PI0Db:\V06Ta0\+0p0"0 0<:`0$!d0:0p5 0'%0H7$0d)(1)t1(0'h1&%1(%01ro<1> C1]&(T17b1P1m1k1$'1"1h+1@)16;D1X991 61I02&:d2d}"L  28225J2)0S2%c28l2p&`x2\2d2"2L628+X2؀:82$72|+2x%p2,;62Rk34 3p&X)3=H43.PC38:P3ܞ6Z34rt3po+l3`'%`3;h3p8:`3*H3̍73|Z63Hk3A+X44%4l$h)4]$84 2xG4XM8hW4r c4/o4&=4x;4LOk4t+X4:4 402,4T0k4E&<4T 5Q/ 5~&50&@(5dU695wkD5T2pS5r\5 *g5H"\}575M-5 q% 5F"5$2<5k5t<6$;#!6<=6K*,G6p1\6V!Xg68ry6068/\6|86r6;#67p6$6,C6h4*86!P 700t7D?17 9h=7XTkK7p U7)`7T#l7#P|7p#7807|!r4707b:@7l87,<2X7ԣ*7 )7|'L8C 8(18k%817@48 &,G8\&8N80I3TY8b,Hp8xkz8w;8`2 8D&p8\8x8L#8/08:08+8,$'d9ة;D9`Rk-90p49 E95 [96@p9p99H8@9Tn5492 9*9%'9xC!9+9 )9H7=t:0yk:)2<4:t|<(N:\(Y:0 kd:H$$y:D :^3H:=*:Y:8:L7:$$&0:P<$:(p:&,::@:\8;11  ;pWk;Gk';8;; VkD;J!S; w-0k;H);P&t;@,#;:4;);:;,5;/; ),;2;-| <d5\%<h=<4<Y<$G<7U<Lkf<Fkt<H2l<=k<:*<XL/<\k$,<|9l<5<+x<"&=& =P7=,/(=$;:=d$@K=$ `=H/2o=| *L=( k=k=$r=+1=h%=G#P=l =4;=@%\=d6`>8>(*< >h&+>/@9>8,8X>1f>hp8Du>c3>)>&x>0%p>>,X>P)9>5>*> :k>_:\?`,8?,5?+8@?ukH?H# Z?u<4h?$ 4o?<8}?5?)%?((< ?%5P?'?Ȥ=@?PZ:?> ? )d?:,@T|%t@3`+@H$0:@`:xG@@}9R@HOkY@1j@C@9@:9@DMk@\1H@)@"<@6%@ 10@*A ?<A J8h(A: 6A>CA,)l^A-lAdW#0|A6A2(8A ,AČ*TA!A rAx-A|*tAܱ;\A9B8'B#B54-BI:8;BD6NB>VB`/PaB9hpBi)wB$BrB(1B L8BpBQ8BypB.$lBC(CCCH9$CD16Cu/4>C'JCt5XfC zCX8C+ C%&,C4kC"C@P3dC)C2$C 1xD#D%Dp0DL)| :Dl, PCD,M(LDCVD64hD-${D9DD0Q-D$$D`0D8PDT4 DN5pD,!HDXwkE`34E)!E8(1E,,LE+PVE*d`ElS+`kE(&<yE%$E99@E/8EPDkE0pE'E$e*8EL%0E"EF=dF5F8) "F-t*Ft+P4F,%,MF7\Fw)xjF )tF,%$F12F4*F4"`F J4_qJ8"0J@9J8\"`KX6kKd7K8p2K:4 DKx-\K>krK|'Kh"lKxRkK-XKH1(K-KȚ(K*K(kK,kLkLOkLj6 'L!8L? DLXWk^L,/nLT 'p{L2/XLL8 L4#Ll:L9Lw2L;LD7DL$/MT!MGk!M(%$/M !@M|L74GMB*SM\9aM$&\mMC,M"hM':pMG8MȨ.MCkM$HMd>xM%4MD6M+HNHkN'%N90N;ANM8@PNhkHXN_*|fN&mNkwN:(N0k N<{%Nk Np)|NG!HN$WkNč1(Nl> NX r`Nx5HO1O$]!L!Oro2O\e*8=O=LNO:[O-3 gOr(uOп"O`!OG'OD9lO#O 8O7O-O*OX#0 P7@Px1#P7<.PL;`DPk SP4-,hfPp=nP$<4P:P5P'PH(P3P ,Pt9PL4PkPLk Q/:`QX9 QD&x/Q= 9Qt$rHQ<<cQ:HoQ8Qn:Qx4`QdJ4Qt&QU-|Ql8(Q,'Q-,RL#*LRX""R9`6R4-9T>Rd@0OR,,liRh''sRw%HR4(=R R"R4*HR#R-R)$R%pRk S-ST-(SP"d8S? DS~kQS!5VSX20cS8(lrS|'~S(S\&S9dS!hS&<S ,LS>S8T)xTp&pTX#t+Tl#;l8T08DT (LT%0YTh6k_TX$sT6~TP&T%TX;DT$XT"(T8oTHk$T+\T(>k U(U )U,y-1U" @UN%NUxu+eUhorU:xUq UP$<U8,= UH7U #6UpU\]2`U)U)xV8*Vx%"V@H$6V G'\?Ve$MV,V+\V)`cV5qV8}V\!HVb,,VO%lV̺0`V4,8V7Vؤ8VCk4V|{$W06 W $WT&X(W8O9 5Wl6pEWH"HUW9`W(@oWL7*zW,EkW<.W#PW;24WȰ*0W) W;pWzkW0kWp-X}&4X$%X85Xr@X`8xJX>7RXloZXPM4$jX&XpX;9zX9X;X;4XPr1X#0X2"|XQ Xd-HY<.Yi%#Y<02Yo>YeqMY0 XY4;gY8sYP0d|YKkY9Y5Y 4$Y(Y*lY(.(tY&Y\"Y8Z,%Z( l2Z!rDZ\+( MZ-7aZM,@oZ5Z5@Z4DZ)$HZ9ZX1HZ7%Z$% Z$[9[r[8*0[<'H[oU[d%g[2:q[D<7[,?l[R1L[J<[r)[u;[N:[po[ā!H[@4H \d0k\P%%\()/\+>\(['O\C\\/4i\5kw\`6L\4\@4X\6l\0}p\$1\

4] )<@]9P]h4[]D Tm]>u]H9]D!P]dOk]0x]\n-\]X<`]09D]lwk]{*]k^%^h!(^$9;^c3P^{3\^3o^=x^X'\^-'d^&^t;h^}$^/^)X_ F' _:k_06(_+5_%`H_T7V_rc_u/Lk_&xw_'2_x(p_('_),_ _6h_pm2_._D9d` 7l`8 :'` k3`+A`\TkQ`|1%^`(1Ho`:,`pl($`hK9l`r8`|r0`Lq`%<`pwk`Y*`x5`S;`r`'a5a09"a $0ax!@aL$=Pa,lga`' |ax7\a\$ aqoah9axY)a&tax7a4oap1<al(PbTK$b8p bDp3.b1X9b4Bbh4Nb#&Zbx"mb4b$b,+b@&bЃ%,b:Tb+Db)<b#0cr)cl%t=c(#Nc(:(Yc8)dc+$oc9+}c\9c<5c!\clS&c8J$cT7(clh-dT(d&Tdo-d%6d`;Dd;Pd(ed(`od0t|d"dZ!<d$:dX9Td00d:.d&<d1ddG#0d!e|4e10e0k:e 5?eX8Med$[ev(DieDE2d|e$|e?5eP>(e(pe5&e/xeX.8e4 ;(eEkeL ,fqf+f'l3fD0Dft `Qf(qbf0"@vf5 f|(xf9*f`;fykf,4 fO.lfr*Hf?Hf?H g*gh#gX+x,gi&>g$ Og9hagxc/mg1xg5g&tg1g8Jk(g[<g-(g!gh&`g$\ h# !hX=3h\y:>h6Hh;!OhEk \h<&HhhԺ9shD%8h$Hh ;xh)Dhs%thk>hD*h hi-sitk|i0/*iPOki<-ti 2iCie3ioixHk$i,pj4kj"@jD')jLr%82j:Cj7HRj|7cjDroj84j&,jo+lj0kjP#8j7 jRkj"jD*k|%Dk5k&X$km&@.k C:k!.xGk8_k7TlkPIk${kD#k7;Dk|-<k%8kd0Tk+&k7*k_;k N*8k$dl\= lN7l'l'lH LCl.pRl؂8$bl>)4ilL^.xlxkl;l;lrlo$ lH% l!l&@l& m6mn$0/mO2Em!,| Rm -L]m&Pem&qmkm<mCkm-@mx+Lml(m4RkmȐ2,m;Lnh> n?) ndj(t"n@2"P4nHrEn-Onc2`n,|& un*nk n3n w6n$n +ln7,n|<o,H8|o2,,oxL)7oTs(DIokRo~(`o&,no%\oHkoL.po"o6po&o  o,orPo@L9lpx$rp4p6\/p')HIp")Ypt&zq!8q\0 q& qD|&qp#,q#&q(+xq 39qP58qp7Drإ4tr)r(o%rd) 1r2@rW7HTrĆ+tfrprr*:8r5r6TrB9r(S7r03r*rL%r7Prrr+Hs*sDks+$s ))s*D5s8CLsj-_sT8#ssT <sX !hs0,ds:`s7&ds!sossos$ksԇks(Xt e"Lt:-t$,Bt|S,ZtP6ft0EkmtOktЩ2ttT-tt/tot}$tIk(tpt#1(tj&X u(%%uT7.uu(>u "Mul-pZuH2'juxkxu;LuHGku$A;ur)<u(Kk(uq/$ux'u u`/ vLqv7p)vr:v8kCvЀ;Mv8\Vv,tavI2Lqv%8vR7Dv i-vUkv%v%v2v(v(ovXH$Dv70w> wDow;*#w *9w'`MwpYw=Xgwt"4ww|8w/`w'(w26,w,3wd*<w#w0C@wب7  xx8x'x%xC%7xh 34Ix\,\x+oxp(t~xrx|( x]9|x2 xdJ'(x+xs($x1kxrox*6y|'T|kp| ?0|Q'8|i%d}tC+}l2 9}*-M}܎9|X}XL<i}`5; }6}+}6}8~*}$H}0=:4}M:,}wk}k}h5:`~d3d~,*,~H?<6~4Z)h=~l_#PN~"d]~48k~_#h|~1~:~'`~6#~=:|~%x~%~tp x~;(\60V+tX5"18C3R42i`1w7+~$\T!#l ,Y&ldI+ P!ptkܾ2u% h"$(H&p0$r:1tGp)6Ttr/j#z8`:2l,k ;,h5π5ڀL%D`v%X!r4 |5-)9;l>49dO`s+Y4,q1k$";  6%d5G8.tŁt2Ӂt#`{:T.82|\C64/u/?/pJoSt- c'trA)lo|%8V L@<'x6`<X:K7^(Cgخ:s49k}TV(\T"" |# tCJ3`ʇp P -Hyk XtAkj%+ rAV+I0kR4%4\L2lq"@h2p ;8:<2Ld&2<̈D)p؈(*H3$d Lh1| )x)$"=5S@2xg`kr< t9-8|8Rk=-ȉPr܉8'pI8<:Do"J8(.*8O*F|#]"pG: y@/') #tQ7pk ŊH :HҊ:ۊ.kh%, h '@`;H,,6<;hTkJD.$UXG)^h>gK$wl[.x+l)tL9 (H+lCIk(ϋ41& DWk$Vk,&*, (u;98$*0/0> *TH(OP&pX 5$g"{X.1@.l}&ro!|V*8nj8Ќ 44ߌH2X0H$!, Q9xoro+`K476,A0pxIC;@]$rn<28<H"HDRk\/o΍ 8ݍ06lt2 2t x%4C$R.p4t-TH9kY<:`o6r3  h_/t9!0ŎS$Ԏ ,܎ &*7uk71 0p='d:p: #0H!Y7Trg>hB6(/ -,=kՏ&\ߏ0Ok# l ,kd!8,!p%&-G8;=@Vwo]f#k8 xk )`;,D 3*x̐&4ܐ'48 8|q&5!t0k/:<42H$r!8_o g1$~D./ }p4*H)pÑD04̑")8ӑ7(t*#L0|Y;-,$4;$TL6bomT;zT>(XC-$8)HL(dÒ#& ϒxY7ڒD5!5d#953"x0,l4<=&E2<\8kpm ?HH6g3X+LkԤ6 <93<D/HǓy8ړkL,0k<6p 81-$x@ !)HJTr\2Xxj>\_+h8$*L10'͔~&/)T$@OqX`8 l{k->?i-HX1cD*@l4*4/74oL9&ĕ!@ە% P&`1*Xo% h>8,4<8;Jt#8V*4` n&@m 7 @5k r'h!55J7pTD ,]kpH1,dV:7'<}pT*,:"̝e*םDwk(J:_74,?:4 9r84$\aq5t'$<%`C8|Qp4l]|$tlkt;d 8|.L$r:(D0"l ʞ;ݞt:Ђk $7'Lp2 +\!:( Ed2<b23oĠ$r͠,D8p-T0 9d 50p'؈k1h.,<@#4Nd#cp'`m"{ %5DT('$Y2d%С882lG+:8+ '-*+$7k>9=\S0:6Do`1~PKk(/D H5<A+D))hâ"HѢb9q)&Xi%4.#,- o9t,,U0(`t&qL:\7$ 16h&HdE+H 5#ң6ߣ@+Dp$ l`"TF!&6 -ؽ%>#dU 9<bkkL9xw9 W7P"8 80¤h'ɤ\'8դkXޤ;|b"ԍ7Ek5k ++45% I؇ XWؚ(^H&Lf"#ux+8^# $rpOk$0% ȥx9kХJ"@,*D$I!lo#|G"0e 4A8dV6pk(< ~(xɩN#@שDk$H60LTB*d$T0H2/F"YN(lgop6z 5qt &}'d=*'ɪ4%Ԫ!8t3x(hIk$k)%&pq!;D2D;8Q6b0o0g* {+2c>$Q3@m+4? ȫI8$r 506*$)D ;4$4*15Hy1CV+PP'4V1e/s%<}Ȏ%h\ C 8@0(xh6$HS u(Ϭ\&׬L8L98PT*D,Lt4k `+%,h;z;IDkQ`0<\p*gz+Pnr w)h(;0t8J6/`­:(D֭0p!:#&m,HDtk)$Nk^@3kl+|0pX.p\<9/(96ί,Pܯ*T#,"& !; /s(LAa*8P=;taԢ7z2<41+HPh)p(9̰H63ٰ"=!r7)<R;4*45&<;6D:QԎ:e<*LI8(5X&p0k4"<ϱ*۱%0$@$<`!,P2(k:Df$Q8)]<0p(7<xF6@DI84 l=Ҳ60ڲCkp+|h_E+j*Hq]${V,,7D,60@Fk\-Ln&@̶EkܶD'H&m%X-) yk D6F40&(k:X+P@:&\Uc<g,>o'DXb$4"h1,T!)_;(ķ(9ͷ8<׷ :`5P*@i& `+0)l+72+@D;0T9`^\!j4Okxv*4D%& ? pK8lɸ68ظQk4:5ܦ+d'&0!@A2R"\c 8uDkd%pn1w9+ )LH*\p.,ɺ%ݺl:HbqR,X,,+(<9p%K+$Xka) h$pt<50k7\Rkû B)ͻ" ׻::k$W2 0p6LLWk)84$;+F 8HR/ c$Dq.{Ek#P=p0<,+h(7PüT 7ϼP9k߼<2DL3p$@\6 H9H5)\Z2;+|E%TTHP"`9j,(Xz'4X9kc*(Ի(,;̽D%LܽL0+ p%+H!#C@ *8587 "5H;b:J N8c$0lq=16h40 %%l˾X8)P־7d߾4'5@Hu/L+*lXr M64Ek+4k$7,"&Fv%XZ0"ls0\8T,pfq 0&|ſD0kԿ4'6;D|l8 P5=|)p;985MD)Y-p:{D: h*0p8>Pd-h,K+hd.LS(X+p(P3@ +lX8/T/8>05pI!\H+iH0v5 }-l:(0:Kk%P! `+P$4,p8%T5k68o?8;pN*_p7>  w2"(@ t9pP\k(xo h%dC1X(::kD 20Ve:8e8n28d0T=@,8 Rk5=k#P<'p&C ' -<;(G|5^|5q_3`k*<\ ;B+ؗ"@9)dY2@1Pr)p +!X@:8*<xa$,6'4% ",2@<GR*hR0$hf#hq9:l<)XqĿ20|,x"Tܫ X=_7-|fq@EkU,o,ll840+ 'x^*!L:7tY'H#x < L X-`8> ?lT-2e0ku#8To;-pN<*Ll)0!"<!DV8t<L6-5 /1|*,:|#xKta:[@1h'`x(!kD(pĐ3 $;x,Rk# T/%`0% b#P'xk0't:-tJ,b#(tLql1<x -<rl2 8 t9.t+^& h"0&pl$L+#@h 8`PD7*W+iHCq71&2%h9d3Ď3̵6<xKk( A*,o.</6d<8_qJ'%Z(9lh74pTMk`6k'TX9(l 802Lq?xP0 19lo!> -X> 9T8F f;(R\&5Z`Dkn ;D|o0Rk09Ԛ)J8TD+F(P?T*<D2#x!(pWkw// +$\? 00"(`@:8`%$2t2"X?<x6%80d2.=u*8H)R5eh> n:8{4:P5k|%a8w"$9"0k> D68<,\9`7rC0kPx'`oiԿ"}l6T(P#8$P[2Ek$C@-H<`BD+PP!50L$,l:9H;E\rYKkg,zXV'T6$vk (X%<$9od(:839t.$(D!@z%"0:L6@5L89kSn8 ht 70x5T$P$rc4%(@cq0h-<& Q=p Dxk6)'+D/*@<l'<LCOē8<X5kEky9&t8\$r51.ty+d# M!̧;H(71!Ct ;Q4 Y "9Xh74o@i& t!\h}!t*$k$H8T,4R5k]t}(k$&xvk<&|Rk1̸,(*88,vk@)l &/F'7h- VT'jB8z\#1`Jk(z-,2TԌ:,1p80ȉkp8T<8H j+8=k&NVk^,+,s*6$-K,\q8P5x-H+d2d' @$HPg;p&#3$0; B 'X#0okwD8D'tD"!\#+<Գ; \?)\6@+Tg"r%p~p3d@;LJd+0<ZD#t,R72(.x C@D6<2@EkT4'dX!К("e:("5<-W#CoPT7]0L'f'Pr rz3(L*8&HpG9D\71 $%2< x5,@4)0D6\j>G2<]d(e,34x:(H48-0P$5ht1%(x7C:( p8H q9.x1L=&KG8[X$q <Tp+05kQ tE:3U!;$5Ddr/8*|Px)H' -H<^#I5[9eE.ŵ+pTk< h)0'xX2p%-8k4$kg#"<CH6,"4:+LMq5D!5 ; L7@bHoqr|<+=k\7|D8=k(?\( :(,27p1k(ܣ&4:3$0TLk\,}7l8v1"h&"`<P6kp9DDk'6@f4p)C #("'78\F5\l2LqNkz*@@958P-#8 ,!*`"<L ?=k4"l $! /*' 6hrG.XU\'j|%$}g8T837L04 10ܜ T8ܟ-xoHkT)xܣ;P4k (:6EkB0pN;`̄,q)$4:)!=$Y8 9k$$%5d/85B74(#*.x9x67A*`L$$\_ 29i0x`5Hc%<'*Lkpq%8\8`D+l 1k3p" 5,PI6VH>^\&5dos \3@K.L *03'p$LT*78P%C TN/0k D6(to3r# p;1,rG)PT%&^;4r\5kL:":D8'TL+h' $ $܍9"l|!p .;D.(:x'Fd8PR@8,^ 7p,u)~hk R4k^:PkD3x$0$+oo =4^+p98qH(& ((HH$""<1:@@Đ)L6YX0 eg/w,,X(*l$:$"2p<Chn9`t0$(.*g-`\.p&&.0C7:`A,WdA+fos;pp(/,o"(U:\5Y:h k$plo(5)j;5:@94J 5V+cL(kH ?`]+60-T05$t)4w,, (\*X |' q1.5>h&lY%c74j@6prD&}klk.lrp? `8h *<+DAkC </d-8d?F!4L(k\;j`F4u*lt*w1oȍ7pr;h9ء/),;' b*x̅9*d-6'8C5V !5 Z 9u $P 596c9L7.-+l%<,q"7H/+%dC4$@ Mj!U<hG8\x`Jk(|,<`.pf<!5hT7p "84k99=8\5X&d- 4=1Ne.Xq*bt1n,\}@kHZ!  / (U$/H53O9,4D3Lkd4T.2|9^8TJ9Y0fdDk{q;49$3ě:<xE5!5887L)84:q)D2,=+L,&Ykh"l{("`!/%$d Cȱ%0l" CN(,$r :4)2@+> :PqJ̅,fg)dp5</*,=PL:`( ,Dv/'LLo:x$7@r@`F*:T/d|'0=',HS2]4Nkm0pu&p 0>586 ('81 h-p`&p 7  24=!#5d018F/@S$r`X(jh>q, 5\%X{kT;4:dkw)P/L :PT' d#T7p$*D-`#?0Il 0V]3xmD6pwD''787^&I XkH]8`A8 `0 D!D# )0* >%< X.0G  l&Y ;$g )4u k 8 D2 ,H$ lC.X D%L 8 3 @:L H198 xk $%) 't8 C= ;XO 7k_ |xkm %\u 6x 6 - @+&P d$l $08 T'd $.X  | k Fk 2 j'\ ~&x# ̹7H8 |K%p@ P.R X5kb '0p  " $r 3H HA+ 0xk T3 , '  İ;4 p0 5:( c; -  -H? А+N (Y `)<d $w $2P / (-, @q)D @1) 64 4 h33 Ck @/ ( %H% (!> }$0K \9kS '_ ( l h>x L%4 tr Ek |o` T = 9 8( : 7k % Dod$t$<+3H5d?%8L ^X9tL'h48Љ04kd!T/8Xh*tܦ*@kKk$@k><:  (l/! :2/Bp`!J@CS'T[ )@l07`t6%4t? O:Pd7$/'$,.$'X =p=p!9 /Ԙ7F/8S0k[",n:e8`1% 46l;\`%4 )@k%Q.5ȡ%B #4X8dkpq6H.t*85$t$:&0H/Y'`;6#0-X/$#<D:M6ap1pn$</: *ć*Dȷ'&!Dox+`:4H +X<%!3&6lN C4#0[V#h#~%pp+<#: x*H $E+`77p< ;|n5T(k<rL2p`tIk$ok|@4`&$t6"X`G!D9:1p '؉*TJk(7/4&Lv*01x+%L@y+K odT,Y-q/p~DozkL:(D~!9p8p6$*COk< @k4P=0Q;(D_q!9p38*>|08GL&pU!k 2@t6p,J(d0),H%d;46X5|2G9`4B,d 4(72\+D+P8to?"QX8Z,nD+|~5h:$ 4LH#l55*2D(:((M p8D'-H6:(H;hVZ+aLykv=}q(:d@2pY9Й862!L  pd4p~pP '8&$0TkB.Ni% U.i8Y"G: 4,DkX:7pk"T?9( /*<!4? -27|/ Hx8|R|p)a(0pwkvp"-<X0/(m$H"84?`N:"5/x(l"x0 .@-Cz-p^p&e($q$zp34%,97t`%: $d8k3Lx/`-#L!32hG A)T<7$^0:i@'wa&X|t99 ? (8 P$+L;(Ȯ'@"<%<D%:t;t01@Eس:0Y.bQ,w9A!t Dh2%6<<7`-H% kl59"3(30/?(0kIȧ"(Zr9|n*ti&$<|G:0 (% +tл$6/> w! .!l @;0 O:`< )8B $PM }4a u%n (;\ 36 d' o $ *l ! p# U# 1 q&X r!(# !Xw#`5!@q%@!8I!oW!,,j!,,d|!X7p!1!L)!t$!t+H!"!)\!g> !%,"9`"؆6"/,'" 0"`=p@"kJ";W"1h"*s"1#L"ȴ;"=(`"x/"h'"g*,"%@"5"$+"Ek#6#10!# 1\+#U*6#8}'A#9lR#2_#(&l#xr#O3$##5#~'X#5#p2#9# Q7#T(#? $$0$$xK-4/$)9$6L$g/HW$.k$0%z$@: $$7$P7<$\e8|$P9($`A(|$pop$9$1 $P>$cq$<$%`"%9(%d'2L<%<$`Q%b8i%,z%T(8%8#%,2%?%t;X%0%|w*%$68%d7&0#)&\/#$!&ȡ7t&&"8&8=H& ,O&;0\&)p&8h>~&W &h:&!9&33 &Ek&E9@&%\'&X ':' /T''\)D.'4'D@'HRkQ'/TY' 1)<&D;)7P)00])t"<p)!)<+D)o)!)4)5)t24)8Dk)38)%*%*K*,*U7(*b*2*_&0=* 8I*,b*+q*'*!*k9@*6*Ek*!|*7"t*@7t*3|+:+X6P%+"T5+ 5G+TX:R+ [9[+kh+8z+-+=4+t&+-9`+(+!+,;+ 4+%< ,T<:,;22,h>9,$rK,o[,(d%h,~60}, ,D,7t,l3X,%,r,38,0n9,-,l#(h,\n%t-C+-p-x3*-dy*6-|9(@->I-5\-P,)e-p/l`:K/5[/dU4 m/ y/:/0/l('/i&,/4;/C/$r/:k/"T/ 3" 0:l090 0ܻ9T+0090d>B07X0hqf0/u05:08:0\;8$030X006p0)'80!0~k0p7D1*D1 #%1001AkB19pO1488h]1<1lm14*x1"&1 j21ă<8152P1})x1P%81~$l1;1'L2o2p1T$2#)-2l<;28I20'\Z2ka2) f2h q28;2L=2H)|2Ђ72V'P2462k2!8|20%42|Wk3'37l,3M#C3."Q3hW;`3,l)p38`~3 !3N h3?3k3p035,3.3L/)044k4$58,4,2%54I8 R4hxk\4hDki4Ы%8p40$H4p -h4W8434M.x4k4"5:k58l50 )5(645(4H5j8X5$(e5\ 'q5p#tz5tY!5(3t5)`5k%5T#l5;5.5%5 "526'6T:*65=69|Q6/b64}7w6l,6$a#L6LR: 6U96Wk6K)6lt;X6>@6$6p9d 7D(72,7x7t@7p(L7 @*xW7^8Xn7Mkz7a-7%7i!7yk7,;7+'7P |79`7H)7D78P88 *#8wk*85;DA8t#50H8DG*U8|8db8ؠ$r8t,X8d18ԟ.l88!5 8:,8@Y38T6p8k80k829M'09? !9S+h190=9g% N9Ș8Z95`o989,39jq9Tw%h9059'9k9@%T94> 9d=:(93 :8'x:D1L:x'&:t9x8:8$B:0rR:+^:h6p:f>: 18:7: :t:_.:7p:}%\:(,:,<;\);8L"*;4gq:;:)E;4CU;W#d;;r;:60|; 14;/;;;<,;r;5;,!5 ;$4;0# <.4d<@'x-<7p3<Ю;F<49R<l8`^<|>(g<Pqr<$<p8"<7<72<r/\<8X<'d<Fk<(=L_28=0p%=q8T5=$v2F=,_=%)Th=Dx1<*>52>~%@>п:(Q>p3P\>f30k>+dy>(k>w=>+7> 5>dX*(>yk>3>&$>7<>{;d>D7>(Vk ?4X?8rL?T(&?3,p;?7`L? 6]?$ o?L!L?05?0*D?X^8T?2<?l)\?h C? ?$?M:?0?d$? h @@3@o+<.@'!?@D&$M@ ( W@>^@:k@q2ty@+@&d@8> @Fk@4Fk@x9X@dk@28@04A-8A|.\%A# X/A:k>A8TOAX_3p\A 2hA98vACAy!$A6(A(@A< 8A4Z7DA\>4A, kAxoBX- BI:`B48)B-`8B)BBp!MB c,dBO9mBز:~BH5Bx* B0;PB: B>xB$B"dB7(Bl7"Cl(<Cؘ70Co;Cd5CC̈%XCB<eCX.pCs5|CZ-|CP%\CG!C)C4|'0C$CkCL8TD5D`('DH1d5D5kKD=ZD6fDp!X}Dl/Dp%DD- D<:D8+<D4rDL)D/HD4UE&cE!oEr~E(-E`3E2EE2DErE!E\WkE+ F&%Fl#3F,CF 8dRF(l&hF,5vFi&F6 FroF#!0Fpz-pF6F,4F I!Ft:dFp%G"G: $Gl37G>dCG60LGXaqYGG%oG>7G6tGH2LG+HG6(G.6,G:G,5GoHc$H H;@HAk$H\8d?H/7HNHd-XH&fH!xH=dH=H9`H\;8H:<HГ9H0*HT PH-8H$I$<I<.Ip69M/M\,tN(lN=T,N;4Q U2QP10Q*PQoQ0|+8QC(HQ@)Q5RX1RHn$0+R0#HER%UR <_RQ;kR!(}Rą& Rt5Rd8&RĘ$dRoRx R;R+Ro%0RLP(Sx% S1Sdu&,S̔* 4S$pDSx4`SS-4[S :8jS"lxS45pS ( pS2 S;S1S. SM"<S!$SD: TK,$"T4/,T(5T+AT$<TTr%T_Tt6kTx2P{T)%8T4T10THq<Ṭ'(T@'hToT%&T5U*LU%<#U\U90U7,@U3 LU#cU5qUrUL9kU`r0UkU -@U8.8U(@Uht2@UcqUbqU;PV)6 "V102V:DV;TV5dV3htV*<~V~&V ?0V)HVRkTV8"V7(V7V@L%V)(WH(W8k  Wt*%Wܫ-44W98?W~pLWx#LcWj#lxW$!=|W%WH $0W+:WT9W8W /tW$X$4@Xk!X4)7-XD/:X}%pQX4a D^X(%oX4#XAkXXE' X|#X CXoX4bkX̓$PX5X( : X2hYl1d"Y8-Y28YoGY8UY45@[Y%gY6 yY'<Y(W*<Y2pY8+Y *Y#0Y/Y,'Yo90Y!;Z2Z%#Z $:Z#GZt =cZ>kZ47# ~Z-<Zm9<Z v+Zl $Zl,Zd6PZ .Z6|[tWk[PC2/[>kB[~-a[;r[*[59D[tk[8[d/[ .\[|'0[P5[X2l[0'l[ 6` \7 \6D$\d"03\1$0M\CT\8;`d\N;q\ 8L{\dw+\(+\9t\6<\6p\f>\ ,\o\ ]4 ]\)]И'/]k9]H^:TH]t@%b]P5x]@k]p]М=L]t?*]H/4]-0]@+D]h7|]@>k| ^45k^$ !^"l3^)|<^ >D^8R^dMkc^4",v^1H^(`^o^#0^L;^'^8^'^ ^6<_,$_='_<4X8_? D_d8Z_A,,p_D8x_t,_9X_t1p_xQ6@_(;_gq_+ _x5_0a> `x)` ;$`8d1`)@E`^%\`5pd`9n`h3,|`C)d`Y&|`8%H`\)`&9t`8>`I:X`%`0o`Ek`Dk` a@:ad3ah>*a|7p1ao8aB(Aalc:UaM8 fax2@va+a %ad+a1aq1(a wk8a&$aPb%a|8&b4bDk#b(.bP8,Bb$>Jb-<Vbԍ,0kbHdq~b,b@,Lb,2bt#b=b|%b 2@bP!D c>c:k#c0k,c^&9cpCPcl&0Zc\;Loc%*\cp'Lc('ce#cX" c+c(%c,Jl<[lP5klh)8sll*~l|(lh$HlX llF#lwkls+|lX&l@klX&%mL#-m@, Fm,(Nm LWmwk]ml%ym8=mhE*m<8m6\mM$LmH.6`m0kmh&Hm88n'$n:$ndS9.n,0Inf)`Sn1k]n9hn9tn$/n. nvkn =Lncqnp+Pnt7tnlP8,n,7n1nT&<n oCj o(l:#o *.oH"x@o+,Mok&H`ol$5qTwr ]w0 5Hmw85pww)wx6w>w̋*<wL,8Dwrw.2\wPq w5$w?<wkxkx8 D$xt%2x=LxW(tUx9t_xrhx 'sxp%Px/XxP(xp:xD%Txx9x#x)dx@oy/ y,Q8Hy2p)y)02yܭ$?y:`JyPh>VyD#'Tgyd(3<syy7h|y5yx1py|5yG4y -y4k y46y0>4,y'dy|"\y=3y08 ztC+ z)'z/$P>zEkSzDN*4^zJ%lz$ryzqzpRkz?z;Tzl:Pz+Pz;z5z6l{5( {0<{/p {2 3{5A{X_#O{(x1-@P-X&_("Dl@U-`7'$d&$kL&`(Dh#,͂X/2+ `*Tk V80Ĥ4+?.4h\)=7tIli8Yrj O' q:LH09 %10/XhAkm(ŃP'lփrރ8Mk(9`&Xe-?H3)GT/T/b9m a9z8g>A*!  Ok Ä0kɄk܄ t6/H' e9TT.L)\/6/ C(Q@;Z|;k$<,L7;D8TTk$ȅ%;ԅ7rܠ4lTklRk#T2d/>9KkHd}%,bdz$0zo?xx540\"Ȇ9<؆`5x2/C,d/=G:(h7d:*<Fh6X%otR4}t)ܥ"k- | /ŇԐ6·,9هx^qo$5`9&9xP!(/(5k8y(TF $`X0ld-4n% U<r43tخ/\*d,0͈pC=h< (,C18+(@(B;TL-L]kmH-%58+`pa#::l&(ʉ`'hۉTDk P /,|l+*#d0: > 7H05kVt'dm*o(F%*H7T6`x8pĊl&ъ%2q1|4H4!T*,D: 9o2Jl,^L$j,9s >{k(`(t * Ë,؋p`89 * (#5-#:5I)\ /ior`5lj>.($(k+`*Lˌ0'یp-P"T0_q r6p.'<x &G:RTk\Hk9ln$*}:0o9H$'(0:ƍp0э<`%<_'P%t&l!<;9Q-\d(Td%,vI$̠)\4Tk 0*ʎ`8ێ8C#4P/p<,5j>&4Wk+L%@)Iu)V0k `=ko%1Y800TLk]*C*ɏoԏ !\]2T-k& 6`H5  N')($1 9Fj;S74[!6*p5C @\6<R*\(6l$y9\$r%l(|(L` DƑ01;(ґ309p^*tLk*'0`6H0;T=ĺ1pP|.`]=wl!,k6#6.hg)Ē&3Β0ܒk*Hn9 (L&ty),(",!=07Q~$h d$rLC,lk%X<6xp.dd\+0Ó`9kΓ 'ܓ;Jk( :9@0;2<6/Bq&O8m8^LTkh!x$C$')"(x08<X:t>˔i#ݔ<(0hX; :0JХ:H[V:\r8`\6Xk\k>9×Dk֗D%|j>k)` 8E:r #ȳ>7L5kFoM0+Y,o;(d0Wkw@+C<*|oM5Ř48Ә|1\:k${%P*xo $d%̂9|((7`48tB2_doj@55\)./xAkHI6ę%Й%F987("@? )d790 I{#L ]#`n+(@w? tG:46(5$5(`#"ʚܾ5<ښ"'tC'4,$9*=(9@$80G\7R5Zol  ly=k4k(!|<:›Y8Tқ<rL-o4#h(Q,DF601LDP8&V c.l"P58TX9Dcl1o(x7\9p92To (x 54k ͢80ݢl&8P$6rk);49@20O/_0!lsk}`2%Jk(Gkʣ:k@գ8'\Ek4px[* C k -|>:IL.%ZG$s#Į"Rk Hk$f)`%hϤ ?`$P$Nk$:35+8/ 8D~4C,5Y &=tkH`;2dHk$v#Z"`8<l;$U2tĦ09٦T;(qt%  5 G5t$ (T7l5-$Gr(R8[&ddl;r-@J+*@,6LT.'G$ԧk/Tb%??$MU#b 2rk{xo;L-P<Ϩ;0S-\*@*T d"$r'vk/Ĉk8l8ED' lbXc4q1~8WkN#d Pp*D"18ũ-x֩,H3e:H"&f>'pDk3)T<_2K@.W'4g|9`q8R"܄7H+ I7+8-|̪%ߪ:,5`8d`*l6"r +'D4dU,kJ*uP<\2|=h& $8680t:p9p14J*TVh&p^/hg'|tD(7@T65%(%ŭ!H׭,p|1pS83h"h-:xMqNkX 5k~kzT$4yk(RkTI8ή%@ڮ9<x_78LDk/|%pkP(Y8(7L$E*L T*b1kuN'M= E;HEk[*pʯ%گ\S1H5kk*%T C "lk 1,1tCL%T6eWk}1p8XRk;8K80Ͱm)ذ,X7DL&6$4a/x(  p)'5.4O$h|$u7`}/8@41*7P.78/ұ2pܱ68\:X87L 2d+X&_8T4`3$BT)U+2d,p|H+\|o p;pm-,̲*ղ;k߲ptI$0V*1a̡3Pp+~pܼ*D';*0C ŴE Ҵ.`$@ 9L D)0%,h&;885J40]@5p`,h|*@rL5,5pƵP+յE .5P< -4vkt&X!0:2X7D>h$rNMqf%`s/ `#0r?\t.xi.%X,ȶ'@ж1`Tk\\,<9HH-&?.0 h?4 J4W9LZ7lk~t:K8\5 .9Ϸ\:(4?$@.)Tk0 T1X ;T>FkJ3L_<9kj &sL4Ho5l'}$00`C(ĸa2\Ӹso%T!00&$\G$(l#;\O(F6pRo^(fX<" yȻ+XH+5 u&x$* 89 !ǹf:ع7&HP%p( ԍ:/ (9)@3hM$(>g5dL0;cD;4oh%@I"H@668º4 ,̺*+ܺT{%DhRkH4) 6\+)r;( =,Kx30ax&p $l:(|96&ƻT&0ϻ1l;(:1+* DK;h.I8CykK7LT0(^"3Dg-}Ho T=PD97,--ڼ; P/"w:<-j>(4o6$EHM:8T'`^p)!n,$'$8h580H½,4ؽ0kP;/0kd(  # *p"B4%HUpr),\z%dr0D~g> 0=D(6805$@Ѿ(!B74d0$(xWk ~k+|+($8X'`F#VG3hfP]&dv̊$>(? 0ſTRkؿ$\:(!(k*4" #4t)6DE~1T\&`#w<8" 81? o)-Xh&t)()D;+8H &Ⱥ7!$}71L*<X E\CR 00`!3kv(Xy~$N#60)lC&$+:`:p,8X7 4s)5$(01L!xG9Wt8ct5x)zkx924Mq<L (/uk 3 @5t 3ԁkt")l?$8@9p%C4)f4' u\;Y2$;kswap_onwi_set_nwkeyucom_unlockpfslowtimonanouptimebuf_rb_bufs_RB_REMOVErandomreadehci_device_ctrl_closeem_set_mac_typeaxe_tickre_disable_hw_imuaddr_bestfit_functionslongjmpwi_usb_rx_list_initsr_crypto_discipline_initkdb_trapvfs_allocate_syncvnodetc_setclockuhci_pci_attacharpresolvechrtoblktblsw_reg_strategysys_minheritieee80211_tree_RB_NFINDputcharural_update_promiscuvmfault_unlockmapschild_returnsmsc_cartlabel_unrefHMAC_SHA1_Updatesmsc_startuvm_map_inituvscom_attachipsec_soft_first_usenkmempagesuhci_device_isoc_donecopyinstraue_miibus_readregieee80211_send_group_msg1sys_getgidieee80211_tkip_micdofilewritevwi_inquire_usbuftdi_matchdumpmagieee80211_derive_ptkttyflushsys_setsockoptsys_ppollcomdefaultrateclock_gettimeieee80211_watchdogwihap_sta_disassocdefrouter_lookupinetswbwi_rate2modtypewi_get_fid_usbwdog_periodcdce_rxeofip_reassrt_maskedcopyin6addr_anyVOP_ACCESSusbd_get_quirksem_k1_gig_workaround_hvip6_get_prevhdrscheduler_startdb_logpciide_triones_productspmap_alias_bitsuvm_maxkaddrehci_pci_cansphy_cdumass_io_putral_pci_detachicsphy_resetieee80211_getmgmtrlphyattachipmforwardingmainbusprintohci_waitintrumsm_attachsys_closeusbd_do_request_flagsbwi_mac_attachrt2560_set_rxantennartflushclone1in6_purgemkludgeffs_inode_allocdes_encrypt2sys_setsidbwi_rf_calc_nrssi_slope_11gieee80211_encapusbd_intr_transfer__ashldi3artisea_chip_mapvn_statunp_detachsiop_scriptnd6_nud_hintether_ip6multicast_minumodem_breakusbd_submatchtcp_secretrti_find__mainbwi_rf_lo_writeaue_stopufs_quota_deletehardclocksd_vpd_thinenc_xform_aes_ctrieee80211_eapol_timeoutsr_rebuild_threadrt2560_wakeup_expirewi_read_data_iowdc_reset_channelrt2661_get_rssiumodem_set_comm_featurein6_domifdetachieee80211_get_authvtagssiop_pci_attachmtx_enter_trysmsc_sethwcsumwskbd_cndetachdb_get_variablecd9660_vgethotplug_get_eventpcaled_caieee80211_inputcrypto_dispatchsr_discipline_shutdowngeneric_armv4_bs_wm_2if_group_routechangesys_fstatatohci_device_intr_closebrgphy_disable_early_dacurl_csr_read_2dest6_inputgsignalacphy_cart2560_suspendehci_pci_matchipport_firstautoehci_strbwi_mac_set_tpctl_11bgmii_mediachgwi_txeofaue_devsipsendredirectsbpf_setifem_encapunp_internalizetk_rawcc__wdstartscsi_xs_sync_donefc_lfcemptyvfs_export_lookuprt2860_set_ledsif_cloners_countifnetyieldohci_endpdm_freemwsmuxattachuhid_seltrue_filtopsuaddr_free_rbtree_RB_NEXTfilt_seltruesc_print_addrlogcomspeedsmsc_tick_taskvn_writechkin_ifscrubral_pci_caarmv4_tlb_flushIuvm_pmr_freepageqpdevnames_sizemichael_updateumsm_umass_changemodescsi_mode_select_bigroute_dstsingle_thread_clearinit_execsr_schedule_wuuvm_pmr_size_RB_NEXTuvm_addr_alignieee80211_send_4way_msg4wskbd_cdnamecache_rb_cache_RB_FINDsys_getdirentriesbcmpgeneric_bs_r_1ieee80211_node_detachdb_set_breakpointsnd6_dad_startexec_maxhdrszuhci_device_ctrl_doneblf_zerokeydb_force_whitespaceSHA512Initieee80211_ifattachmmmmapieee80211_clean_nodesbwi_memobj_write_2setjmpsd_read_cap_16prefetch_abort_handler_addresswdc_disable_intraes_ctr_reinitbio_inforicohrtc_clock_readrt2560_get_rfpdc203xx_dma_finishpci_subclass_communicationsurlphy_funcsuvm_deviceopsuvm_addr_align_backlogread_filtopsre_ifmedia_stsvndxfer_pooltcp6_mtudisc_callbackcopyoutstratu_caieee80211_countrycode2regdomainusb_transfer_completelxtphy_servicepciide_unmapregs_compatuaddr_stack_brk_selectswcr_newsessiontcp_attachla_hold_totalwskbd_cngetcbuf_dirtysoo_writesystempageieee80211_align_mbufm_zeropdc20262_dma_startural_alloc_tx_listnd6_llinfo_timervn_fsizechkunp_gcingreaddoslabelbwi_rf_init_hw_nrssi_tablebdevswcalctsruumodem_matchbaddynamicportsworkq_initohci_root_ctrl_closeX_db_line_at_pcural_ack_rateuvm_mk_pclusterbswap16domainnameehci_endpduvm_pmr_addr_RB_REMOVElockinitwsmouse_detachttywrite_filtopswi_usb_devsnd6_ns_outputbpfkqfiltersorwakeupre_ifmedia_updinflateCopyttyunblocksr_meta_opt_loadbioclosehidms_disableremovedeudav_miibus_statchgigmp_timers_are_runninguvm_deallocatefilt_procattachufs_quota_free_inode2filt_procdetachsys___thrwakeup__divdi3pciaddr_resource_reserve_disabledi80321_io_bs_allocallowpowerdownsys_clock_settimesiop_led_offural_txeofwdc_floating_busuvisor_calocnameshidkbd_bell_fndisk_busyrandom_hostseeddb_breakpoint_allochidkbd_belltcp_pulloutofbandevcount_sysctlsqphy_statussddetacharprequesttfork_child_returnsiginituipaq_cdpci_mapreg_mapsr_wu_enqueue_ccbuhci_device_isoc_abortpool_set_constraintsusb_task_thread_procip_sysctluhidev_closemsdosfs_vptofhscsi_mode_sense_bigusbd_clear_endpoint_stalldb_vnode_print_cmdums_casetdisklabelbio_registerdeflateknote_removesii3112_drv_probepmap_bootstrap_pv_page_allocbufq_nscan_createsr_hotspare_rebuilduvm_mapent_addr_insertroutedomainhid_locateicmp6_errorVOP_MKDIRpool_large_freeip_protoxsys_settimeofdayi80321_sdram_boundssdstrategyaddlogehci_sync_hcuvm_page_physgetrt2560_bbp_readmsdosfs_synccheckdisklabelscsi_mode_senseip_savecontrolstackgap_randomvm_map_unlock_lnffs_clrblockusbd_set_hub_featurepdc202xx_chip_mapuvm_addr_linsearchbpf_filterchgproccntip_drainieee80211_tree_RB_PREVdb_map_print_cmdumass_init_shuttlesoqremquepci_class__adddi3uvm_map_inheritsys_getthridcd9660_syncem_enable_hw_vlansbrgphy_reset_bnxin6_ifawithscopebuf_page_offsetumodem_set_line_stateuvm_pmemrange_addr_cmpkm_freeusbd_is_dyingsync_printvnopsem_lv_phy_workarounds_ich8lanieee80211_rssadapt_inputsys_lchownmsdosfs_removecd9660_readdb_read_tokenem_attach_miibusieee80211_regdomain_compare_rnfilt_timerdetachwi_get_idzeroin_addrbmtphy_cdehci_device_bulk_closewdc_set_driveuvm_map_protectusbd_get_xfer_statusuvm_map_setup_mdre_encapprintfehci_alloc_sqtd_chaincdce_devsrandomwriteuhci_device_intr_methodsprelist_updatehmac_ipad_buffercrypto_drivers_numsmsc_miibus_readregip6_protoxsys_recvfromswcr_freesessionttrstrtwskbd_mux_openrandombwi_txeof_statusif_getsysctl_doprockcopysiop_modechangeext2fs_initrtfreesingle_thread_checkre_pci_detachrt2661_node_freecuio_getptrcd9660_linkhostnamelenupl_cdusb_needs_reattachdeflateTuneuaddr_hint_selectem_flowstatusxscale_cache_purgeID_rngttyopenuplcom_rtsraw_ctlinputwi_usb_ctl_unlockbwi_rxeof32nd6_ioctlsched_chooseprocphyslockspec_setattraxe_miibus_statchgpte_l1_s_protousbd_get_stringfill_prlistipsec_exp_allocationsHMAC_SHA256_Finalbpfcloseusbd_probe_and_attachsys_writevsys_setpriorityumodem_set_line_codingm_tag_prependE_abs_script_sched_slot0_Usedaxe_cmdurl_unlock_miiumass_detachusbd_free_iface_dataip_defttlwi_usb_attachurl_rx_list_initusb_schedsoftintrarpintrkqueue_registerpciaddr_resource_managecred0in_delmultirt3090_rf_setupuvm_forkdisk_lookupuhci_device_intr_abortuid_findumass_activatend6_rtrequestuplcom_cduvm_km_suballocusb_delay_msucomparamif_getgroupattribsbpfdetachsys_closefromumodem_closeehci_devdttydefcharssigexitscsi_link_openhidirtypagesrt2560_reset_tx_ringin6mask128rt3090_rf_wakeupbus_space_read_raw_multi_4uvm_amap_poolin_pcballocVOP_LOOKUPsr_meta_readbrgphy_loopdb_shift_exprphysical_startbs_notimpl_bs_c_8ifa_delpcred_poolenqueue_randomnessexphyattachusbd_set_idleserverworks_pci_intrieee80211_find_node_for_beaconemul_nativeaxe_txeofwskbd_inputdes3_zerokeyre_miibus_statchgobio_matchacphy_cdcrypto_getfeatbwi_memobj_write_4bwi_phy_config_agcwsmux_attach_scusbd_pipe2device_handlecpu_do_powersavebwi_free_rx_ring32aue_rx_list_initi80321_bs_vaddruvm_km_pagesufs_quota_alloc_inode2ieee80211_name2countrycodemicrouptimesr_validate_ioaes_xts_decryptsocket_poolsr_raid_recreate_wupgrphashsys_setpgidpciide_jmb_caprofhzAES_GMAC_Updatesr_meta_init_completentp_update_secondcache_enterdb_watch_tablei80321intc_attachedsysctl_file2exec_elf32_makecmdsusb_rem_wait_taskext2fs_bufatoffsys_setlogininitarmamap_listdb_trapip6_maxifprefixesieee80211_node_cache_timeoutthecustcp_do_rfc3390ieee80211_req2nodesys_setresuidsvwsata_dmactl_readcrypto_kinvokern_deletesd_get_parmsiskmemdevstat_rush_requestsrt3090_filter_calibwi_watchdogatu_start_scanipsec_def_compfc_lmdistancench_poolphtree_RB_REMOVEsomaxconnural_readscsi_xs_get_doneatu_external_firmwareipsec_exp_timeoutip_directedbcastbwi_free_rx_ring64i80321_pci_decompose_tag_bus_dmamap_loaduvm_pmr_pg_to_memtypeuihashtblieee80211_node_getrssiumct_activateticks_per_secondsd_buf_doneieee80211_get_rtsamap_initffs_flushfilesubsa_baudrateiq80321_pci_intr_establishicmp_sysctlsys_lseekdes3_decryptllinfo_arpmsdosfs_pollpci_lookup_quirkdatamsdosfs_accessaddupc_intrdvd_read_bcaamphy_servicevm_map_lock_read_lnwsevent_finiip6stathotplugread_filtopsuplcom_set_line_statehidms_enableuvm_pageboot_allocconfig_pendingmii_phy_updatesys___thrsleepi80321_i2c_matchbwi_mac_dummy_xmitether_crc32_lepiix3_4_setup_channeluvscom_set_crtsctsaue_csr_write_1rn_searchugenread_isoc_filtopsipipstatsecureleveluftdi_cadb_consoleurl_matcharpt_keepsavectxdb_printsymums_disablepte_l2_l_cache_mode_ptbinuptimesys_seteuidhidms_attachwskbdpolluvm_map_checkprotmax_protohdratu_tx_list_initcdce_activatedes_is_weak_keyohci_pci_matchural_rf_writedb_access_irq_spieee80211_add_qos_capabilityieee80211_cipher_keylenumass_scsi_attachsr_raid1_discipline_initrandomkqfilterbufpagesuipaq_attachusbrev_strpciaddr_resource_allocateiic_execsleep_setup_signalrlphy_cdprocess_newsys_keventcopyargsarc4_reinitsr_chunk_in_useuhci_device_bulk_methodsrt2560_attachwd_standbymi_switchcd9660_statfssysctl_sensorssr_scsi_wu_puttsleepkern_sysctlbwi_dma_mbuf_creatend6_delayin_pcbinitsys_fchmodatsqphymatchbs_notimpl_bs_rm_4nmbclust_updatehw_prodfdremoveigmp_fasttimobufq_disksort_queueatomic_setbits_intehci_device_ctrl_startuserconf_cmdbufwi_get_pmumass_bbb_statedb_print_loc_and_instohci_device_ctrl_abortsvwsata_dmacmd_readrt2560_updateslotpiix_setup_idetim_timingsrt_mpath_matchgateubsa_stopbitscdce_startrt2661_reset_rx_ringusbd_port_disown_to_1_1uvm_map_entry_poolcrgetuhci_activateunp_bindtcp_delackuhci_device_isoc_closecsignalreaddisklabelvm_map_unbusy_lndb_print_cmdusbd_clear_endpoint_stall_asyncvirtual_availbs_notimpl_bs_rr_2tcpstatuvscom_readstatdma_constraintdb_break_tableuvm_anon_pooli80321_softcicmp6_mtudisc_timeoutfillmapentrytcp_timer_persistsata_chip_mapcpufunc_ifarudav_newbufsys_umaskuhci_pci_attach_deferredpci_subclass_i2o_tr_flush_blockpow2dividesyn_cache_reaperfilt_fileattachsysentieee80211_find_rxnodecpuset_addpmap_alloc_specialsbs_notimpl_bs_r_8tcp_setpersistrt2860_drain_stats_fifoufs_ihashlookupubsa_intrscsi_inquire_vpdsii3114_mapchanicmp_rediracceptmemmoveugen_set_interfaceusbd_get_hub_statusworkq_create_threaddb_boot_halt_cmdural_attachip_outputbwi_init_rx_ring64bwi_bbp_attachbpf_mtapnkmempages_maxfindblknamekue_rx_list_initpool_inituvn_referencebwi_pci_detachuvm_pmr_addr_RB_PREVbpfreadbio_errorpool_putm_copym2buf_alloc_pagessysctl_structbufqs_stopuhci_poll_hubaxe_ifmedia_stssysctl_rdstringuvn_attachlasttimesr_wu_putehci_freexcryptoclosesysctl_disklockcnkqfilterrt2860_alloc_tx_pooldesiredvnodesbs_notimpl_bs_r_2ufs_pollpmap_map_sectionmsdosfs_readlinkpmap_devmap_bootstrapdes1_encryptieee80211_decryptusbd_get_device_statusbwi_rf_init_sw_nrssi_tablenchinitexec_mapdb_qualifysnprintfcomcngetciicbus_printext2fs_readlinkether_ioctlumass_bbb_transfertqphy_servicebwi_free_txstats32ip6_forwardingsr_shutdownural_cdkue_resetarp_allocated_bus_dmamap_load_mbufbwi_plcp_headerwdc_print_capswi_watchdog_usbifindex2ifnetcd9660_ioctlem_initrt_mpath_conflictin6_savemkludgein_pcbnotifyalluvm_pglistallocsyn_cache_addpool_large_free_niohci_device_ctrl_transferbuf_kva_enduvm_map_splitentryvm_map_lock_lnincoreurlphy_cdhzdcphy_mii_phy_autodefrouter_resetcd9660_ihashinsbwi_dma_allocrt2860_newassocrt2560_bbp_initsiop_script_writesched_exitcheckaliascue_activatettyretypestartuphook_listrt2860_detachre_tx_list_initpte_l1_s_cache_modeuvm_pmr_remove_addruaddr_pivot_poolkue_detachrt_timer_queue_changelf_initwi_ioctl_usbcpu_attachrn_mpath_countbwi_set_addr_filterwdc_preata_drivemii_phy_matchrt2560_eeprom_readural_amrr_timeoutzlibVersionsr_raidp_assemblesdclosevop_generic_kqfilterpffasttimoinitsiginfosys_getuiddb_set_cmdcomconsunitcpuidsexec_setup_stackobio_bs_vaddruao_createdb_free_watchpointssensor_detachbwi_led_blink_endifaddr_items_RB_INSERT_COLORbuf_mapbrgphy_adc_bugaue_lock_miiidentify_arm_cpuffs_realloccguplcom_set_crtsctsrt2860_initwskbd_load_keymapxscale_cache_cleanD_rngm_clpoolcd9660_bufatoffugenintrgroupmemberuvmspace_initrt2661_ioctlscsi_plug_detachether_sprintfatu_calculate_paddingfintek_refreshmsdosfs_unlockselwaitpmap_init_l1icmp6_mtudisc_callbacksnd6_slowtimosys_forkbufq_implsip_setmoptionsuvscom_reset__qdivrempmap_deadproc_cache_stateifaddr_items_RB_PREVsr_raidp_initpiix_setup_sidetim_timingsumct_matchspec_openi80321_io_bs_vaddrpmap_vac_me_kpmapswcr_sessionsfilt_bpfreaddb_watchpoint_freesr_disk_attachehci_alloc_sqhuvm_fault_wireusbd_abort_pipekernelstackcrypto_initem_k1_workaround_lvpci_resumevm_nphyssegifaddr_items_RB_NFINDip6_randomiduvm_pseg_initproc_filtopself32_os_pt_notewdc_print_current_modesSHA512Transformfiledescopensys_vforkpmap_vac_me_usercomcnspeeduvm_pager_initcpufuncswinChkNamebwi_regwin_is_enableddvd_read_copyrightieee80211_recv_4way_msg1bio_delegate_ioctlrt3090_set_rx_antennauvm_pmr_addr_RB_MINMAXdb_history_prevem_read_pcie_cap_regbwi_rf_clear_stateem_setup_receive_structuressys_mkdiruao_reference_lockedcom_resumepmap_devmap_tableufs_fhtovpcrypto_donewskbd_translatedumppcbbwi_rf_set_nrssi_ofs_11grttrashohci_root_ctrl_abortmblowatgetnewvnodert2661_amrr_node_free_allufs_inactivepciide_natsemi_productskue_load_fwnd6_mmaxtriessiop_intrsys_socketuhci_detachuhci_abort_xferbwi_mac_fw_loadugenopeni80321intc_imaskffs_cgreadwi_init_usbugenioctlvm_map_lock_try_lnspec_close_clonevop_generic_bwritenanotimere_cdufsspec_writelxtphy_casd_read_cap_10iso_disklabelspooffdfreeuvn_detachieee80211_ccmp_set_keyfintek_capci_set_powerstateuvm_km_valloc_trytty_counthidkbd_detachbwi_phy_init_11gdeflate_globaluftdi_detachraw_disconnectsensor_task_registersis_south_matchip6_neighborgcthreshbufkvmKERNEL_BASE_virtremove_coproc_handleratomic_clearbits_intumass_polled_transferucom_to_tiocmdeflateSetHeaderuvm_pmr_extract_rangebrelvpsensor_attachre_intrmsdosfs_mountfsvfs_relookupem_oem_bits_config_pchlanpcibr_flagsuvm_map_addr_augment_getem_82547_update_fifo_headsys_utracencpusfoundehci_root_intr_startwi_stopip6_sprintfsync_fsyncumsm_activatesetstatclockratecd9660_strategyem_iffuserconf_parserrw_initural_tx_bcntiocm_to_ucomext2fs_allocpmap_cachevivtusercryptowskbd_deliver_eventdb_eregscom_fifo_probeieee80211_delba_requestbread_cluster_callbackfdcopy_bwi_txeofin6_proto_cksum_outbuf_acquire_nomapatu_send_mibemul_findAES_GMAC_Finalb_to_quvm_pmr_size_RB_INSERTin_len2maskbus_space_read_raw_multi_2uhci_pci_matchcmd0643_9_chip_mapobio_bs_allocusb_blk_freelistudp_sendspaceuvm_objtree_RB_PREVifg_headvfs_rootmountallocSHA1Updateehci_device_isoc_transfercue_tx_list_initbs_notimpl_bs_sr_2netintrcd9660_openrw_initi80321_bs_mmapAES_GMAC_Reinitixp_setup_channelsr_uuid_generateohci_root_ctrl_startvm_map_busy_lnbuf_rb_bufs_RB_FINDcmaskbrgphy_cd_bss_end__ext2fs_blkprefdb_pool_print_cmdbwi_encapwi_alloc_nicmem_ioicsphyattachdb_delete_linescsi_activateuhidkqfilterVOP_ISLOCKEDsys_kqueueAES_GMAC_Initieee80211_tree_RB_REMOVE_COLORuao_referenceusbd_kill_pipein6_addrscopebuf_getsys___threxitdb_searchieee80211_ifdetachuvisor_attachbs_notimpl_bs_wm_4vfs_getcwd_scandirmaxlockdepthwi_usb_tx_unlockieee80211_free_nodeieee80211_node_leave_11graw_usrreqnblkdevuhci_find_prev_qhpciide_detachinitiduhidev_detachbs_notimpl_bs_wm_2sr_crypto_hotplugttyinputscanc__stack_smash_handlerbwi_pci_conf_writeumsm_matchukbd_consopsbiodoneural_activatedb_set_breakpointicmp6_rip6_inputehci_free_sqtdwi_usb_txfrmsmsc_encapmaxslpext2fs_makeinodeehci_device_intr_methodscue_startaue_csr_read_2ufsread_filtopsufs_symlinkm_dup_pkthdrbwi_bitswap4sr_crypto_assembleufs_mkdirvfs_getcwd_getcachepci_subclass_satcomusbd_get_no_altsural_newassoc_length_codenamecache_rb_cache_RB_PREVin_iawithaddrbwi_mac_fw_free__anddi3phtree_RB_REMOVE_COLORrt_missmsgVOP_BMAPre_txeofignore_addrsip_dooptionsvn_locksvwsata_lba48_write_regcue_tick_tasktimeout_add_tsbwi_phy_attachrip6_ctlinputubsa_activatescsi_link_shutdowncdce_caSHA384Initumass_cbi_adscsbdropsr_meta_native_attachmsgbufphysuaddr_free_rbtree_RB_INSERT_COLORusbd_desc_iter_nexttcp_debugusbd_transferinpcb_poolohci_pollohci_hubdnextralocsmsc_miibus_writereguvm_addr_fitspaceblf_keysys_setegidbus_space_write_raw_multi_4wdc_wait_for_statusucom_status_changern_matchcd9660_symlinkautoconf_verbosebwi_memobj_read_4in6_setpeeraddrunp_externalizesys_munlockalluvm_faultuhci_waitintrrandomioctlsoftraid_disk_attachsoreceivesiop_iwrpool_getuextralocscsibus_printlinkdb_show_radix_nodeudav_csr_read1ieee80211_eapol_key_inputohci_root_intr_startffs_dirprefucom_shutdownrip6_outputinflatert2661_setup_tx_descscsibus_cdin6_get_rand_ifidndflushcompose_tab_cmpieee80211_parse_wmm_paramsrn_insertspec_pollbpf_wakeupfilt_kqdetachdb_flush_lineaue_unlock_miiwsmux_getmuxipsec_exp_bytesbufqueuesconfig_defersys_faccessatgf_mulbwi_mac_setup_tpctlem_check_for_link_bus_dmamem_allocm_tag_initbsearchif_attachsr_crypto_free_resourcespciaddr_ioaddrsys_setrtablem_reclaimsr_raid_read_capuvm_map_addr_RB_REMOVE_COLORnameibwi_disable_intrsem_read_pci_cfgbs_notimpl_bs_sr_4uvm_map_setup_entriesext2fs_readdirip6_ctloutputdead_pollpte_l2_l_coherenttqphy_funcswihap_initversionbwi_mac_opmode_init_bus_dmamap_syncuvm_pmr_remove_sizelzs_dummybuf_needvakqueue_initieee80211_wep_delete_keyrt2661_read_eepromuplcom_set_line_codingaxe_rx_list_initata_dmaerrieee80211_bip_set_keybwi_mac_set_retry_limuvm_pagezeroin6_setsockaddrigmp_leavegroupcom_common_getciic_probe_sensorre_pci_cabs_notimpl_bs_rr_8mountlistuserconf_histbufcomsoftwihap_mgmt_inputpdc203xx_read_regudav_initVOP_REVOKEconfig_deactivatebwi_txeof_status64SHA256Finalclallocbiowaitbwi_led_blink_nextpdc268_config_readpci_subclass_inputprobe_addrs_sensorfilt_ufsreadrt2560_rx_intrunixswuvm_objtree_RB_INSERT_COLORdb_stop_at_pcsccstqphy_caehci_check_intrral_pci_activateccpupmap_updateehci_device_setintrobio_cdem_setup_linkpci_vpd_readgeneric_bs_sr_1re_pci_activateacard_chip_maphidkbd_inputsr_raid6_wu_donenexttickeventfdinitboothowtoarc4randomnsphy_funcstcp_delack_ticksbwi_get_rf_loupl_stoprt2860_intr_coherentttopenata_get_paramsukbd_apple_iso_mungeip6_randomid_initieee80211_tx_ba_timeoutether_ipmulticast_minconfig_rootsearchrt2860_bbp_initrip6_sendspaceieee80211_countrycode2nameuao_dropswapin_addprefixenxiosys___getcwdcd9660_specvopsusb_cdrnd_event_headin6_maxmtupmap_enterrt2560_iter_funcamphy_funcsundefined_handler_addressRMD160Transformsys_setreuidSHA1Initusbd_ratecheckbwi_phy_init_11b_rev6wi_usb_open_pipesudav_tick_taskuvm_map_findspacepdc203xx_pci_intrwsevent_initcryptoopencomcnattachuserasymcryptodb_var_rw_intrt2560_set_bssidsdsizesys_pwritevudav_lock_miikqueue_scanieee80211_pmksa_findbwi_rf_off_11g_rev5uplcom_breakusbd_iface_claimedtcp_closeicmpsrcohci_free_stdsd_patternsX_db_search_symbolscsi_initmsdosfs_advlockswcr_idwdog_registerkue_attachpdcsata_chip_mapusbd_free_xferdb_varssys_utimensatfalloclxtphy_cdatu_joindeadproc_mutexdb_breakpoint_freeumsm_methodspfctlinputcomcnprobephys_mapext2fs_pathconfumass_bbb_methodssoft_intrqdeflateSetDictionaryufs_lockcomintrboot_eaddr_validsys_accessem_read_mac_addrnsphy_statusuvm_swap_iouserconf_initbwi_phy_init_11art2560_ioctlkillpg1url_tx_list_inituhci_strwsmouse_mux_openi80321intc_attacharpproxyvputonfreelistuhci_device_ctrl_transferwdioctlext2fs_mountrootobio_printpciide_mapregs_compatumodem_methodsieee80211_findrateregyearem_update_stats_countersurl_ioctlpage0setrunnablepool_do_putuvm_pmr_getpageswi_set_ssidcue_ioctlnd6_prefix_onlinkugen_seltrue_filtopsffs_specvopsumct_intrcue_attachelf32_read_fromosversionticks_per_intrem_free_receive_structuresatu_get_mibhid_is_collectionwi_usb_tx_list_initfind_pfxlist_reachable_routerip6_pcboptstvtohzieee80211_get_eapol_keyphtree_RB_NFINDratecheckin_rtchangevfs_syncwaitrt2860_tbtt_intrudav_ifmedia_statusaue_crcffs1_reallocblksieee80211_node_lateattachcansignalhotplugpollem_link_stall_workaround_hvrt2860_suspendmsdosfs_check_exportbwi_fwimage_is_validieee80211_up_to_aclf_setlocknbigpipecue_devsin_controlieee80211_get_addba_respbwi_regwin_inforlphy_funcswsmux_srcopslmaxuvm_pagecopyphtree_RB_NEXTsysctl_quadsys_readexec_process_vmcmdskue_tx_list_initrt2560_update_promisccmd_chip_mapieee80211_tree_RB_FINDi80321_bs_tag_templateucomioctlm_cldropmbstatuhci_remove_ls_ctrldcphy_statusuhidev_intrttyinfodb_flush_lexttyinohci_root_ctrl_donegetnulldevispidtakendb_dmesg_cmdpciide_dma_initsr_meta_save_callbackextent_destroydb_lpenc_xform_rijndael128if_group_egress_buildloop_clonerttsetwatergetcieee80211_addba_requestrt2860_gp_intrsr_raid6_intrifaddr_items_RB_INSERTdb_last_addrural_update_slotuvm_pseg_lcksr_ioctl_volem_clear_hw_cntrscom_obio_matchpmap_enter_pvmsgbufenableduvm_mapent_mkfreeunp_disconnectsys_listensys_mounthotplug_put_eventehci_root_ctrl_donepgsignalehci_waitintrbpf_mtap_etherfirstcdb_read_bytesuhub_detachrt2560_media_changeieee80211_ccmp_delete_keysr_failioffs_fsyncwsmux_mux_openfintek_attachucom_do_openinetdomainehci_abort_xfermemcpywdc_enable_intrkthread_exitaxe_activatescsi_req_detachbwi_nrssi_writecue_newbufdisk_constructvfs_unbusyip_nhopsrip_usrrequhci_setup_isocvm_map_upgrade_lnspec_writesiop_wdtr_msgpciide_unmapregs_nativecom_obio_cdkq_timeoutmaxin_broadcastfd_getfilesr_sensors_deletehidkbd_set_ledsmsgbufaddrucomclosesdioctlutsnameip6_setmoptionsexit2aue_resetkue_open_pipesacer_setup_channelip6_mloopbackext2fs_cgupdateuhci_add_hs_ctrlrt2860_ampdu_rx_startsiop_scsifreeieee80211_send_4way_msg2tcp_update_rcvspacerddumpem_enable_intrcpu_setperfuaddr_rnd_poolufs_lookupsiop_pci_resetugen_attachufs_bmapdoasyncfreeudav_miibus_readregcpufunc_dfarip6_randomflowlabelttpolldegetlogpollkthread_createbwi_mac_set_promiscugen_set_configdb_elf_sym_initwdc_default_read_raw_multi_2current_ipl_levellogclosesd_vpd_block_limitsieee80211_kdfgeneric_bs_wr_4install_coproc_handlernd6_dad_findohci_rhscudav_detachufs_strategysr_crypto_create_key_disksr_put_blockohci_device_requestkue_watchdogphysical_freeendcopy_statfs_infobounds_check_with_labelarc4_timeoutsr_raid1_assembleumct_opensd_ioctl_cachepci_subclass_networkext2fs_checkpathns_scx200_chip_mapsocantrcvmorepci_vpd_writeuipaq_rtsprocess_poolrt2560_update_ledip6_setpktoptfile_filtopssr_raid6_rwbuf_unmapmsdosfs_renamesysctl_proc_argssiop_adapterdes1_zerokeypipe_wfiltops__lshldi3purge_detachedpfxrtr_addcd_load_unloadipq_pooluaddr_kbootstrap_destroypmap_activatebuf_dealloc_membmtphy_resetconfig_make_softcpte_l2_s_prot_kruaddr_stack_brk_functionsunp_discardcue_csr_write_1ip6_outputwi_read_record_iouhid_caudav_rxeofrt2661_bbp_readswap_syscall_lockufs_kqfilterieee80211_newstateem_is_valid_ether_addrums_enablescsi_autoconfcheckdirsexecswsr_raid0_creatert2560_set_txantennaumass_atapi_attachin6_are_prefix_equalin6_controluvm_pmr_rootupdateleapyearsleep_finish_timeoutsys_sigsuspendcd9660_unmountpciide_dma_startehci_device_bulk_abortswcr_authcomputenamecache_rb_cache_RB_NFINDtrapsignalrushjobpmap_devmap_registerrn_inithead0db_single_step_cmdwd_flushcachend_defrouterblf_decfdcloseexecuvm_map_sel_limitsevcount_attachlimcopybio_doreadwi_do_hostencryptscsi_req_probeuvm_mapent_forkcopytcp_timer_rexmturl_ifmedia_changei80321_gpio_pin_writeuftdi_attachsiop_pci_cart_timer_initnd6_useloopbacksr_crypto_rwuaddr_rnd_createieee80211_next_modeputsaxe_tx_list_initrip6statip6_id_ctxtcp_debxcnpollcd_casys_truncateesigcodeacphy_servicescsi_xfer_poolsysctl_wdogarmv4_tlb_flushIDudav_csr_readohci_add_donert2661_ack_rateem_read_phy_regieee80211_tree_RB_NEXTsched_choosecpu_forki80321_pci_initohci_add_edwdc_xfer_poolcdce_newbufsoacceptkqueue_pollcdgetdisklabeldb_call_depthuaddr_pivot_randomdb_printfehci_device_isoc_doneuhidreadin6_ifaddloopufs_creatend6_freend6_optionscd9660_seekbwi_free_tx_ring64nd6_llinfo_settimersr_roam_chunksmsdosfs_unmountelf32_load_psectiondb_show_all_bufsuftdi_writern_mpath_nextnamecache_rb_cache_RB_MINMAXuhci_device_bulk_transferarm_pcache_unifieddb_add_symbol_tableuhci_remove_intruplcom_setm_tag_nextohci_intr1msdosfs_writecue_resetbs_notimpl_bs_w_1rt2661_amrr_node_free_unusedexec_script_makecmdsehci_rem_free_itd_chainiic_matchieee80211_reset_erpfilt_pipedetachcd9660_rootentropy_add_ptrdb_unaryrgephy_statusiophyattachdisk_attach_callbackselrecordffs_validatert2860_intrcomstopatu_wait_completionaxe_ax88772_initffs1_compat_readrip_outputrrw_exitext2fs_accessbwi_ofdm_plcp_headerrt2560_read_eeprommld6_fasttimeouaddr_rnd_insertkthread_qimaxwsmouse_matchohci_free_seduserconf_pdevuvm_object_printitsr_detachinflate_fastiq80321_devmapmbpoolclock_secs_to_ymdhmsaes_xts_setkeytcp_canceltimerstqphymatchrip_recvspaceroute_initswap_prioritylink_rtrequesttc_setrealtimeclockffs2_reallocblkswdc_get_xferuvm_vmspace_poolbwi_setup_rx_desc32stackgap_initpipe_createsysctl_vnodepdc202xx_setup_channeliodatand6_sysctlsyn_cache_putdoopenatpciide_amd_productspci_subclass_multimediavn_openuhci_freexif_clone_createbufq_fifo_requeuesr_boot_assemblycdce_tx_list_initSHA384Finaluao_detachcpufunc_controlmallocamap_pp_adjrefauth_hash_hmac_sha2_384_192apollo_chip_mapin_pcbrtentryrt2560_get_macaddrknote_dequeuesr_discipline_inituhci_root_ctrl_startuhci_pci_activatewi_cmd_usb__udivsi3re_ifftcp_outflagskqueue_statcdce_ioctlcd9660_rrip_analyzeohci_hash_find_tdexphymatchbuf_fix_mappingbio_unregisterip6_v6onlysys_preadvdb_tok_stringuserretsys_recvmsgpipe_statHMAC_MD5_Finalvn_writesr_hotplug_unregistermtdphy_servicehidkbd_hookup_bellVOP_LINKubsa_devsicmp_inputumass_cdvcountvm_page_zero_enableieee80211_get_sa_queryuvm_vsunlock_devicerd_root_sizein6_delmultistathzenc_xform_cast5route_ctloutputwdog_ctl_cbbwi_nrssi_readsched_idlebio_warnuftdi_get_statuswskbd_cnattachwdc_ata_bio_intrvirtual_enduhidev_get_reportsys_getloginifaddr_items_RB_NEXTbuckstring_inituhci_free_std_chainiq80321_pci_init2icmp6_rediracceptbwi_set_gainsdetruncdb_elf_symbol_valuescopyoutpfindbufq_peekcomconsaddrip_ctloutputuhidev_set_report_asyncwsevent_readenc_xform_arc4bwi_stopbrgphy_5704_a0_bugarp_ifinitdb_write_variableufs_dirbadcd9660_readdirvfs_unmountallrgephy_loopsys_renameatohci_allocxcopyrightsdattachsched_peg_curprocwdc_default_lba48_write_regtcp_timer_keepusbd_devinfo_vpsbsynctcp_mss_updateiopiic_cdphison_setup_channelpciide_lookup_productfree_pagesehci_root_ctrl_startdb_proc_print_cmdrt2560_initrw_enter_readdb_show_all_procsvunmapbufehci_device_ctrl_transferuvm_map_pageable_wireroute_outputrti_deletefreepidsys_geteuiddb_output_positionem_clear_vfta_i350icmpmaskreplin6_pcblookup_listenmsdosfs_mknodttkqfluship6_defmcasthlimsys_munmapsii3114_dmactl_writekp_nonefilt_solistenvsnprintfrt2860_node_leavepte_l2_s_prot_urarplookupuvm_map_pageableproftimer_trampolinechainallocuplcom_methodssw_reg_startpmap_copy_page_xscalesr_ioctl_deleteraidifmedia_baudratei80321_calibrate_delayem_82547_tx_fifo_resetusbd_setup_default_xferuvm_pagelookupsoshutdownuserconf_hist_cmduftdi_cduserconf_listproc_cansugidcd9660_rrip_getsymnamedb_command_tableip_mloopbackbwi_rf_get_tp_ctrl2bpf_iflistKQREFwdc_downgrade_modeieee80211_node_leaveip6intrqaxe_newbuftodr_handlend6_rs_inputscsi_activate_buspciide_mapreg_dmasoabortm_free_unlockedem_82547_move_tail_lockedem_get_bufcast_encryptunp_inobwi_default_led_acthidkbd_attach_wskbdlogkqfilterbpf_mtap_pflogni6_dnsmatchdb_extent_print_cmdip6_init2uprintfdb_clear_single_stepsensordev_installrandomiduvm_page_printitmainbus_cai80321_local_dma_initcoredump_elf32rt2560_intrsoftdep_flushworklistsys_issetugidinitclocksbwi_rf_attachcd9660_mmapif_detachaue_watchdogwsmuxopenwdc_ata_bio_startnd6_cache_lladdrcatqsession_poolunp_connectuvm_pagermapiniic_smbus_read_byteif_detached_startpool_serialuplcom_activatexscale_cache_flushD_SEscsi_probe_lunaue_ioctlirq_entryni6_inputvfs_mountedondb_expressionboard_powerdowncputypert_lookupfc_lookup__bss_start__if_downndqbVOP_GETATTRuhci_root_ctrl_methodsieee80211_fix_ratebwi_get_pwron_delaysiop_add_reselswwihap_deauth_reqieee80211_node2reqwi_usb_matchelf32_check_headerrt2661_bbp_initdb_historygf_logeephy_cdinphy_cdttytstamprt2860_mcu_bbp_readural_set_txantennaieee80211_node_allocieee80211_crypto_detachpmap_unwireipaddrip6_auto_linklocaluvm_pageunwirerti_fillHMAC_SHA256_Inithw_serialehci_device_intr_abortauth_hash_hmac_md5_96autoconf_attdetufs_chmodbufq_nscan_resortsr_raidp_discipline_initcdattachuserconf_devicebwi_rf_off_11ain_localaddrsys_sigaltstacki80321_i2c_casii3114_dmatbl_writeDES_versionbrgphy_resetsoisdisconnectingauth_hash_key_sha1Blowfish_initstatesched_steal_procwi_media_changenull_decryptsyn_hash2rttimer_queue_headarm_pdcache_sizeexphy_capcidetachucom_dtrrtredirectuvm_map_printitdb_read_variablesoftintr_initieee80211_setkeysdonedb_regsdb_stack_dumpsr_raidp_rwuvm_pmr_pnaddrttymodemdb_lbuf_endehci_free_itdmtx_enteraxe_devskqueue_poolvntblinitbuf_rb_bufs_RB_INSERTcpuset_intersectionallcftablesem_lookup_gcubwi_rf_tssi2dbmuhub_activateAES_GMAC_Setkeysleep_queue_initpmap_preferin6_ifattach_linklocalVOP_REALLOCBLKSuhci_globalresetE_abs_tag0_Usedtcr1_get_timecountugenwritesys_setresgidsr_crypto_encryptuvm_pmr_freepagesieee80211_input_bamsdosfs_sync_vnodesplassert_failarm_picache_waystty_initaxe_ioctluvm_km_freesys_killrn_mpath_repriouserconf_numberperflevelcomconsiohpmap_set_pcb_pagedirem_watchdoguvm_pmr_addr_RB_NFINDrt_setmetricssys_getegiddb_set_single_stepuvm_objtree_RB_FINDsw_reg_iodone_internalhidms_detachem_check_mng_modeserverworks_setup_channelumass_init_insystemfrag6_deletefraghdruaddr_destroyem_validate_eeprom_checksumdirchkifaddr_items_RB_FINDexphy_resetipip_outputpipecloseVOP_REMOVEpci_mapreg_typewi_usb_activateconsinituvm_pmr_isfreeurlphy_statusext2fs_dirremoveuvm_vnp_uncachesysctl__stringffs_clusteracctconfig_detachmtdphyattachifaof_ifpforaddrcryptop_poolsensordev_listsr_checksum_printhidms_ioctlsc_pld_shminidatacleanrt_timer_queue_destroysr_meta_probewi_cdsd_cduvm_pseg_geticmp_mtudiscipport_hifirstautoieee80211_tkip_delete_keysys_fstatem_read_eepromenc_xform_3desrgephyattachuserconf_enablepte_l2_s_prot_uwext2fs_vinitdb_endlpuplcom_intrumass_bbb_resetffs_alloccgbuf_object_storecryptodevallowsoftsmsc_wait_for_bitsobio_foundgeneric_bs_w_1sa6_anysys_getpriorityatu_radfirmpci_subclass_cryptosysctl_diskinitsr_concat_discipline_initE_ldsa_abs_reselect_Useduvm_km_vallocieee80211_send_mgmtcue_getmacnatsemi_chip_mapbrgphy_bcm5421_dspcodescsi_xsh_delrt_mpath_nextscsi_plug_probesys_unmountsr_meta_native_probeuvscom_dtruipaq_detachbootdvelf32_probesumct_detachin6ifa_ifpwithaddrvgonelpciide_jmicron_productssofreebwi_amrr_timeoutbwi_rf_lo_findnd6_dad_timerbwi_led_newstateuaddr_rnd_destroyinphyattachcpuset_unionbwi_init_tx_ring32uvscom_shutdowndb_del_symbol_tabledb_add_exprsiop_timeouteephy_matchpmap_removebpf_mtap_afrt2860_set_basicrateshidkbd_parse_descicmp6_fasttimouvm_pmr_addr_RB_INSERText2fs_removemtx_initif_clone_destroyehci_close_pipebwi_regwin_enablewdccommandvmcmd_randomizebpf_setfuserconf_historypciide_pci_cauvm_page_unbusyfilt_hotplugreadbwi_rf_lo_isusedtk_noutusbpalockext2fs_mountpmap_collectBlowfish_expand0stateuhci_check_intrukbd_enableuvm_map_addr_RB_PREVdb_symformat_elfpciide_compat_intrgeneric_bs_rr_4cpu_sysctlcd9660_deftstamphotplugkqfilteri80321intc_smaskzlibCompileFlagsip_randomidbrgphy_eth_wirespeedaue_tx_list_initnettxintrieee80211_recv_disassocnosuidcoredumpukphyattachcddumpdb_search_cmdastusbd_claim_ifacetcp_disconnectuvmspace_execuhci_timeoutwi_usb_detachwsmux_createsys_mmapehci_bus_methodsbootnd6_is_addr_neighborblf_ecb_encryptunp_rightshostnamedb_print_llinfodisk_closepartcmd680_setup_channelpci_enumerate_busbrgphy_fiber_funcsem_set_eee_i350em_disable_pciex_masterupl_outputi80321_intrext2fs_bmapuvmexpnextstateventenc_xform_blfbufq_donesr_crypto_dev_rwehci_detachsensordev_getufs_diremptyreinsertfinishduprt2661_newassocsleep_setup_timeoutbrgphy_crc_bugukphy_serviceqsphy_resetsmsc_stopdeflate_decompresspool_destroylogwakeupshutdownhook_listhidkbd_attachip_dosourcerouteieee80211_node_join_rsnsoread_filtopsgcu_miibus_readregieee80211_media2ratedmapoolsbdevsw_lookupdisk_changebwi_mac_resetuplcom_matchamap_lookupsdoreallocblkscache_revlookupamd756_setup_channelbpfread_filtopssoinituvm_mapent_isjoinableem_get_speed_and_duplexVOP_MKNODuvmnd6_ifdetachin6_ifaddrroute_protofilt_ugenread_isocsync_vopshw_uuidext2fs_truncatere_newbufcd_play_tracksscsi_do_mode_senseuvm_pmr_allocpmrvirttimer_trampolineip6_maxfragpacketsdb_errorehci_confdprefetch_abort_handleruvm_km_threadsr_checksumem_rxeofuhci_root_intr_methodsscsi_probe_buslminm_leadingspacesys_fpathconfwsmuxpollarpt_pruneohci_device_bulk_methodsem_copper_link_postconfigkp_zerosoconnect2knote_poolcnopensiop_scsiprobenatsemi_setup_channelscsi_test_unit_readyural_set_bssidricohrtc_reg_writenmbclustural_get_rfsominconndma_freert2661_mcu_wakeupuhci_device_clear_togglesoftraid_cduvm_vnp_syncpool_allocator_large_niieee80211_get_disassociopxs_cdwihap_assoc_reqarpt_downrdgetdisklabelarm_pdcache_line_sizebpf_tapnthreadsdb_lookupuvm_pmr_addr_RB_NEXTrt2860_tx_intrnumnegpciactivatemii_phy_autouvm_pmr_addr_RB_FINDuvm_mapent_free_removemax_datalenmsdosfs_initohci_device_ctrl_startwi_write_record_ioext2fs_writelf_clearlockbwi_rf_set_ant_modegeneric_armv4_bs_wr_2uvmpd_scan_inactivedb_lastsymsiop_resetbusurl_memip_srcrouteuhidioctlip6_accept_rtadvieee80211_recv_4way_msg4pte_l1_s_cache_masksys_setregidusbd_device2interface_handleurl_csr_read_1cpuset_infosusbd_dopollvinvalbufsys_ftruncateuhci_device_isoc_startbwi_rf_map_txpowerubsa_dtraes_ctr_cryptm_splituhci_remove_hs_ctrlsoftintr_disestablishentropylockumodem_ioctlurl_stoptcp_timer_initdb_tab_stop_widthdb_putncharstuagg_unlockedsii3114_dmactl_readscsi_sem_enternd6_maxnudhinttcp6_inputsosetoptkp_dirtyehci_set_qh_qtdtcp_mssifa_addcache_purgeudav_stop_taskbpf_mcopycomconsrateauth_hash_hmac_sha1_96uaddr_pivot_insertfork1curpcbdb_activevfs_hang_addrlistpci_primary_vgacue_tickdead_writeufs_dirrewriteinsmntquettreadtk_canccdb_write_bytesrt2860_media_changeext2fs_blkfreeudp_outputfind_last_setsoftraid0rt2661_set_chansys_chmoducomreadprelist_removeuvm_objtree_RB_NFINDffs_vgetrt2661_tx_intraxe_encapinitprocsr_bootuuidip6_getpmtu__umoddi3bcstatsbrgphy_fiber_statusarm_dcache_alignvm_map_downgrade_lnugenclosert2661_media_changeip6_log_intervalnull_encryptsched_idle_cpuswihap_auth_reqscsi_activate_lunuvm_page_physdumpuvm_atopgX_db_sym_initmaxprocesssyn_cache_timerieee80211_auth_opensolisten_filtopsatu_internal_firmwareprocess_kernel_argsin6_update_ifa__wdcerrorSHA384Updatecdce_detachrt2560_tx_intrehci_alloc_itdrt_msg2suser_ucredsd_shutdownmem_noext2fs_buf_allocbufbackpagesral_pci_matchatu_xfer_list_freeuhci_free_stdwihap_sta_deletepciaddr_resource_reserveuaddr_kernel_functionspmap_free_l2_bucketRMD160Update_intrevarprequestmsdosfsreadwrite_filtopsrrw_enterkernel_mapuhci_device_isoc_enterwi_init_iodumpdevwsmouseioctlcd9660_lockusbd_ref_incrieee80211_mgt_subtype_namegf_powbwi_led_eventugen_do_readdb_not_taken_bkptm_printpciide_unmapreg_dmauvm_pmr_splitvfs_mount_foreach_vnodekqueue_kqfiltertimeout_add_usecwi_mgmt_xmituhid_do_ioctlzeroin6_addrstrncasecmptimer_filtopsatu_tx_startuvm_objwirert2560_encryption_intr__guardohci_device_bulk_starttcp_mss_advSHA512Update_intin_ifaddrnd6_optionwin2unixfnmax_hdrffs_readm_freephtree_RB_FINDbwi_mac_hostflags_initaes_key_wrapurlphy_attachieee80211_get_assoc_reqsr_meta_attachsr_meta_native_bootprobescsi_inqmatchfdesc_poolcmd_pci_intrpool_page_allocsr_switchin_pcblookupm_tag_delete_chainfilt_pipewritecd9660_polliicprobencbadaddr_read_4bzeroumass_scsi_probearmv4_drain_writebufswapdrum_addufs_closedefrouter_delreqfixjobcuvm_pmr_size_RB_REMOVEdb_show_all_cmdspci_subclass_daspscsi_devidin6_addmultirn_newpairbios__udivdi3sys_obreakblf_setkeyusbd_set_config_norgephy_cdieee80211_pmksa_addpciide_cdlastddateucom_do_ioctluvmfault_unlockallsr_meta_getdevnamem_inithdrpmap_curmaxkvaddruvm_pmemrange_addr_RB_NFINDin6mask0bpf_validateusbd_get_string_descvaccessuao_set_swslotsys___thrsigdivertsys_getdtablecountmbinitsr_errortcp_secret_ctxusbd_get_reportabortwskbd_default_bell_datascsi_readsafe_cmdieee80211_set_link_stateamap_allocVOP_LOCKbuf_rb_bufs_RB_INSERT_COLORMD5Finalwskbd_matchcp_timeaxe_rxeofcd9660_vget_internalrt2560_decryption_intrdb_page_print_cmdwi_intrrw_casvgetrd_attachkd_nowaitugenpollieee80211_create_ibssbrgphy_jumbo_settingswsmouseopenwinChksumbufq_requeueserverworks_chip_mapfreeclusterchainmld6_initswapmapscsi_get_linkdisk_initSHA256Updateohci_bus_methodsohci_hash_rem_itdatu_cdrip6_ctloutputdisk_readlabelpciide_pci_writeaue_sendusbd_getnewaddrnd6_na_outputext2fs_fhtovpsr_validate_stripsizeumass_cbi_transferext2fs_createieee80211_gtk_rekey_timeoutem_local_timerusbd_bulk_transfer_cbwi_sync_mediauvm_map_teardownpipe_pollpool_reclaim_allnsphy_cabmtphyattachucomopensysctl_dopooluhub_matchpmtu_expireuvm_mapent_clonetcp_respondsys_readvcrypto_getreqamap_cow_nowroundrobinbadaddr_readuvm_map_createissignalwdprintsr_attachfilt_uhidrdetachin6_selectrouteieee80211_recv_rsn_group_msg1cdevvprt2560_bbp_writeuhci_intrbwi_mac_balance_atten_setsoftintrmsdosfs_kqfilterigmp_joingroupuiomoveohci_device_isoc_donewi_usb_wridrespmsdosfs_startlf_alloccpu_idle_leavedb_loop_countwi_intr_ackpciide_dma_table_setupbpf_reset_dem_hv_phy_workarounds_ich8lannd6_dad_stopdiskmapioctlhid_start_parseuseloopbackinflateSyncPointuvm_waitnexecsbwi_init_rxdesc_ring32mclpoolsi80321_mem_bs_mapieee80211_regdomain2namepmap_referencesys_bindrt2661_watchdogloioctlrw_exit_writebs_notimpl_bs_wr_8ieee80211_eapol_key_micrt2560_free_tx_ringumct_initusb_abort_taskspmap_bootstrapbs_notimpl_bs_wr_2blf_cbc_encryptsys_mqueryarm_picache_line_sizekmeminit_nkmempagesbwi_rxeofusbd_new_deviceuvm_pmr_size_RB_REMOVE_COLORmcllivelocksscsi_io_putscsi_iopool_inituvm_pmemrange_findfillinusemaprecvitbmtphy_funcsums_cdfilt_sowriteuvm_kernacccnpollcsys_linkucomsubmatchuvm_addr_initlog_opensr_rebuild_initfilt_randomdetachuvm_pmr_size_cmpuaddr_free_rbtree_RB_MINMAXfragtbl124userconf_totdevi80321_bs_tagrt2661_tx_cmdxscale_cache_flushIDrt_tablesrt_ifmsgrandomread_filtopsieee80211_plcp2rateumsm_setobio_bs_maprealitexpireipstatunix2dostimert2860_delete_keydounlinkatscsibus_caubsa_attachiic_probe_eepromuvscom_openurl_newbufusbd_delay_msffs_dinode2_poolcrfreecnputcuhid_do_writeip6_lasthdrohci_device_isoc_abortuhub_uhub_capci_count_vgaugen_matchtcp_reaperlastnowpool_sethiwatrt2661_tx_datasvwsata_mapreg_dmawi_read_record_usbuftdi_methodswdgetdefaultlabelmicrotimeuvm_pmr_addr_cmprt2560_tx_datapipeunlockuvm_pmemrange_addr_RB_MINMAXuvm_swap_getpciide_serverworks_productsext2fs_reloadrt3090_rf_initurlphy_matchcsefindelf32_copyargsisochariophymatchuvm_km_alloc1siop_cdcdopentcp_usrclosedaue_ifmedia_stsboard_resetphysmemuvn_flushurl_cduvmfault_relockinferiorbwi_rf_calc_rssi_bcm2050ukbd_attachxscale_cache_purgeD_Eclusteralloccryptof_readsr_raid_syncuplcom_capci_dopmrt_if_remove_rtdeletewskbd_attachin_pcbbindumass_cbi_statexscale_cache_flushIlopagesmtdphy_caudp_notifyuhci_timeout_taskuhci_root_ctrl_closeendtsleeprt2661_resumewihap_check_txstrnlensigactsshareuvm_map_freelist_update_refilldb_set_watchpointuvm_map_addr_RB_NEXTbpfattachuftdi_openif_detach_queuesitimerdecrieee80211_get_delbaether_outputpci_cdem_phy_setup_autonegpmap_bootstrap_pv_page_freeuvm_addr_printauth_hash_md5crypto_kdoneinflateGetHeaderbpfilter_lookupm_copym0bwi_led_onoffaxe_miibus_readregvm_physmemiso_shipdirrdwritebwi_txeof_status32ieee80211_node_join_htrnd_timeoutieee80211_parse_edca_paramspipe_ioctlfilt_timerexpireural_set_chanwskbd_enablepmap_devmap_find_vacd9660_mountrootbpf_allocbufsbwi_init_txstats32set_stackptrrt_gettablemsgbufmappedohci_device_setintrrt3090_set_chancomprobe1cdsizedb_symbol_valuesuhci_device_ctrl_startumass_lookupdb_evarsupl_activatesmsc_attachiic_smbus_write_bytebwi_rf_get_latest_tssiwsmouse_mux_closewakeupgetnanotimeatu_devspciide_matchrt2860_rf_writei80321_mem_bs_mmaptcprexmtthreshkprintf_mutexrt_getifadb_malloc_print_cmdwi_get_fid_ioenosyslockmgrbwi_bus_attachrtlabel_name2idbwi_node_allochidkbd_is_consoleuvm_vnodeopsdb_bcstats_print_cmdvfsconfrt2860_free_tx_ringVOP_OPENcompwroffbuckstringuhci_device_bulk_startrt2860_enable_tsf_syncsiop_scsicmd_endusbd_fill_deviceinfoscsi_interpret_sensesqphy_cdugen_do_ioctlext2fs_flushfilesdes_ecb3_encryptieee80211_send_eapol_keycomconsattachedbrgphy_probelxtphyattachwi_usb_txeof_frmufs_readlinkrdopenin6_ifadddoscheckpathpcbmapatu_newstate_tr_stored_blocknd6_option_initbufq_quiescebrgphy_servicepiix_setup_channelext2fs_setsizeffs2_balloc__guard_localin6_init_prefix_ltimesnchstatscd9660_fhtovpmsgbufpE_ldsa_abs_selected_Usediq80321_pci_intr_stringsys_setgidrt2860_set_keyuserconf_common_attrfilt_ufswritert6_flushehci_timeout_taskgeneric_bs_r_4E_ldsa_abs_slot_Usedmmrwffs_bufatoffieee80211_add_ds_paramsem_init_hwiq80321_pci_intr_disestablishwi_usb_rridrespdohooksgf_invem_pci_set_mwiieee80211_rssadapt_choosenprocessesehci_free_sqtd_chainem_disable_intrukbd_activatesiop_sdpaue_setmultiif_detached_ioctllocnamppsegswi_usb_casch_chip_mapuserconf_showbwi_next_scanip_mtudisc_timeout_qsr_scsi_cmdaddress_exception_entryffs_fhtovpgetvnodefilt_ufsvnodecrypto_get_driveridbwi_mac_updateslotpool_setlowatkmembaseswi_entryrip6_inituvm_aiobuf_poolisofncmpsysctl_emulseltrue_filtopssys_sigprocmaskdb_commandrt2661_select_bandin6_if_upfilt_pipereadenc_xform_aes_gmacsoreservedb_formatrt2560_reset_rx_ringuvm_mmapusb_activatescsi_report_lunsufs_quotactldosymlinkatuvm_map_uaddraroundin6_pcbnotifyifaddr_items_RB_REMOVEbrgphy_5708s_funcsusbd_clear_endpoint_toggleexplore_pendingstrrchrgetdevvpm_clgetpci_mem_finddefrouter_selectamap_unrefext2fs_statfsbpf_mtap_hdrcrdupamap_wiperangecuio_copybackisodirinodb_strlcpycfrootswsmousepollchrtoblkscsiprintsiop_get_lunswuserconf_pdevnamminphysukbd_matchurl_ticksys_fchownatrtalloc_noclonetimeout_mutexether_addmultiieee80211_recv_actionpci_powerdowncdce_cdffs_vptofhvfs_isbusyifunitirqstackbawritetputcharsvwsata_dmatbl_writewskbd_detachpmap_postinitcsedeletepool_print_pagelistffs_fragacctrt2661_rx_tuneffs1_ballocsys_fchowndcphy_attachuvisor_methodsums_activateinflateInit_SHA384Update_intdb_breakpoint_cmdvwaitforiomii_phy_tickcd_read_subchannelflsextendfilelortrequesticmp6_inputbuf_valistuserconf_addohci_device_intr_methodswi_func_iocreatedefilt_randomreaduvscom_closebwi_regwin_nameieee80211_michael_mic_failuresbreleasedb_history_sizein6_selectifmsdosfs_islockedhipagesmax_linkhdrem_dma_freeumass_attachcryptof_statudav_resetget_stackptrsysctl_rtablemsdosfs_reclaimbwi_set_chanbwi_rf_calc_rssi_bcm2060wdc_free_queuesqphy_serviceuserconf_hist_eocsys_readlinkatbrgphy_reset_bgei80321_intr_disestablishuvm_objtree_RB_REMOVEext2fs_getattrrtlabel_id2namesbdroprecorduvisor_activateuvm_coredumpem_write_phy_regi80321_handlerwdsizenamecache_rb_cache_RB_REMOVEacphy_statusip6_sysctlsuserdiskconfural_tx_dataatu_get_card_configvn_syncer_add_to_worklistusbd_get_interface_descriptorgeneric_bs_rm_1tk_ninsysfilt_opspciide_mapchanclusterfreefilt_randomwritesr_warnsr_raid_intrrt2560_beacon_expireieee80211_alloc_node_helperrootdevehci_device_isoc_startm_tag_firstem_82547_move_tailcdmatchpmap_map_entryusbd_get_config_descriptorpfxrtr_delpciide_machdep_compat_intr_establishdumpsysicmptstampreplif_detached_watchdogcy693_setup_channelrip6_sysctlext2fs_fsyncdoforceuhci_root_intr_startsys_fsyncwi_usb_stopuserconf_add_readsr_crypto_writere_pci_probeusbd_reset_portrt2661_set_macaddrifconfsiop_led_onpciide_pci_intramap_wipeoutuser_configcast_setkeytcp_outputnsphyattach_bus_dmamem_mmapi80321_attachupdate_ledsext2fs_updatetcp_timer_2mslaue_openpipesi80321_gpio_initffs_reload_vnodebuf_putmsdosfs_setattrVOP_RMDIRwdog_tickledb_delete_breakpointsr_ioctl_installbootif_addgroupciphy_cdieee80211_setmodeuhid_matchieee80211_add_ibss_paramspool_allocator_freefilt_proceopnotsuppumodem_parambwi_pci_resumeem_rxfillffs_reallocblksphtree_RB_INSERT_COLORrandomcloserootvpaxe_miibus_writereguvm_pmemrange_addr_RB_NEXTugen_do_writeieee80211_eapol_key_decryptuserconf_maxlocnamespool_reclaiminitdisklabelpci_subclass_serialbususb_quirksbpf_sysctlvflushehci_openieee80211_bip_encapcddetachpmap_clear_modifytcpctl_varsarptimerbufq_dequeuetcp_reass_limitruaddsys___set_tcbrdstrategym_copymsystemsbcopy_pageip6_freepcboptsdb_free_breakpointsif_upcoredump_notes_elf32piixsata_chip_mapumsm_catimeout_add_nsecehci_intr1rt2860_enable_mrruvmfault_lookupm_extfreergephy_resetupl_intrucomprintural_matchdeflateBoundVOP_BWRITEbufq_fifo_peekrt_timer_queue_createm_cluncountwddonemsdosfs_ioctlpciide_dmatbl_writeupl_matchrt2560_stopno_constraintsys_opensr_crypto_change_maskkeywdc_alloc_queuergephy_funcsusbd_match_devicescsi_sem_leaveinet6domainural_enable_tsf_sync_bus_dmamem_alloc_rangeether_crc32_be_updatepgdeletert2560_next_scanuvm_pageidlezerobwi_enable_intrswskbd_do_ioctl_scdead_vopsdb_symtabsi80321_irq_handlerieee80211_media_changeucom_detachuaddr_hint_createraw_attachural_set_rxantennahidkbd_cngetcscsi_ioc_cmddb_boot_sync_cmdastpendingifnewlladdruhci_noopphison_chip_mapether_ip6multicast_maxpipe_pooluao_initudav_iffifa_ifwithroutem_clinitifpspec_kqfiltertcp_notifyieee80211_match_bsscd9660_tstamp_conv7ural_free_tx_listffs_dinode1_poolieee80211_set_keyieee80211_bip_delete_keyem_smartspeeddb_print_positionrtflushclonedb_radixgetblksr_raid_turem_tbi_adjust_statsxscale_cache_flushD_rngmaxsmapwdc_ata_bioip6_mcast_pmtusoconnectrt2860_txural_initvtypesuvm_map_fix_spacenobuffers__lshrdi3data_abort_handler_addressin6_delayed_cksumrtrequest1usbd_errstrSHA256Update_intsr_scsi_ioctltcp_identtcp_rst_ppslimuhci_openbwi_pci_activateem_realignifinitsd_cmd_rw10cd_load_tocunpst_recvspaceuvm_map_mqueryget_ifidsr_infoscsi_io_getkue_initxscale_cache_purgeIDuvm_map_kmem_growraw_inputcd9660_reclaimrt2860_stopkue_ioctlfilt_logrdetachtimeout_add_btnd6_ifattachunpdg_recvspacedofaccessatpipe_closeeephy_activatecd9660_inactivesoftdep_mountmsdosfs_rmdirdb_is_activemsdosfs_fsyncre_setup_sim_imcfdatadeflateInit_ffswi_usb_tx_lockusbd_do_request_async_cbufs_checkpathem_init_eeprom_paramspmap_pte_init_xscalepfxlist_onlink_checkdiskmapreaddb_elf_lookupm_tag_findinittodradler32blf_encvputpte_l1_s_cache_mode_ptvector_page_setprottcbhashsizeworkq_syswqcd9660_setattrfilt_hotplugrdetachbwi_rf_set_nrssi_thr_11busbd_get_configieee80211_node_leave_rsnuaddr_kbootstrapufs_quota_initallocpidkqread_filtopscoredump_writebrgphy_bcm54k2_dspcodeusbd_setup_pipexscale_setttbem_read_part_numaue_csr_read_1xscale_cache_cleanIDbuf_acquireieee80211_beacon_allocatu_attachubsa_get_statusdolinkatbioopscpu_classesieee80211_add_htopbpf_setdlttcp_flush_queuepool_setiplmsdosfs_statfslboltpipe_inituvm_wait_plarn_mpath_priousbd_open_pipe_intraes_gcm_reinitsyncerprocrt2560_set_macaddrifa_print_rbufs_ihashinszcfreein_setpeeraddrinphymatchatu_taskwindow_inflatedb_readlinert2661_enable_tsf_syncether_ifdetachsr_meta_native_readieee80211_recv_probe_requhidev_get_report_descuserconf_histcurrndstatscy82c693_writemsdosfs_inactivepciaddr_do_resource_reserve_disabledcurrent_intr_depthpanicstrbwi_set_clock_delaypdc20265_pci_intrupl_newbufumass_scsi_cbscsi_delayext2fs_sync_vnodeif_startunpdg_sendspacesession0bwi_power_offviscpywsmouse_do_ioctlE_abs_lunsw_return_Usedehci_abort_isoc_xferhw_ver__umodsi3copyincomparamsiop_common_resetural_stopudav_sendcd9660_defattrohci_device_bulk_closeehci_reverse_bitsrtalloc1bs_notimpl_bs_sm_8uao_swhash_elt_poolufs_ihashgetdes_set_odd_parityuaddr_pivot_selectsigacts0uaddr_free_rbtree_RB_REMOVE_COLORfindblkmajormsdosfsvnode_filtopsntohlsorflushugen_caiophy_funcsuvm_mapent_tryjoinbwi_phy_config_11gttioctlarpintrqvprintfslpquesr_raid1_wu_doneohci_root_ctrl_methodsttycharssyncdelayuvm_vslock_devicewi_usb_infofrmugenreaduvm_pagealloc_multihidkbd_enableffs_mountral_pci_resumewsmux_mux_closeicmp6errppslimbadaddr_read_2msdosfs_vopsuhci_add_intrconfig_process_deferred_childrenbufq_waitohci_ifcdieee80211_add_htcapsluphymatchxscale_cache_purgeID_Ebs_notimpl_bs_sm_2in6_setmaxmtuem_camsdosfs_roottqphyattachbpf_getdltlistrt2860_startm_tag_getuvm_map_freelist_updateuaddr_bestfit_insertsb_lockem_enable_tx_pkt_filteringohci_root_intr_abortuhci_polluaddr_bestfit_removert_labelscrypto_unregisterHMAC_SHA1_Finalupl_watchdogsuid_clearttwritedma_alloc_initatu_initem_activatebuf_rb_bufs_RB_NFINDbuflowpagesehci_activatert2661_set_basicratesswapdev_vpre_miibus_writereguipaq_methodsaes_xts_cryptieee80211_deliver_datadead_readufs_pathconffile_pooldb_boot_reboot_cmdohci_timeoutbwi_setup_tx_desc32unputcbwi_rf_lo_measure_11gendluphyattachVOP_CREATEcpuset_firstSHA512Updatecdce_stopifai_cmpbwi_rf_set_nrssi_thr_11guvscom_get_statusnd6_recalc_reachtm_intervalpagetables_startin_ifinitohci_device_ctrl_closepciide_mapregs_nativein_pcbhashlookupsys_mknodatem_setup_transmit_structureskp_dmare_eeprom_putbyteural_writeucom_cleanupVOP_ABORTOPehci_pcdcoredump_tradbwi_power_onem_identify_hardwaredofchownatsr_wu_done_callbackuhci_idoneuvscom_set_line_codingdefault_chip_mapsys_acceptuvm_map_entry_kmem_pooluvm_pagerealloc_multiieee80211_wep_decryptbwi_rf_calibvalwi_inquireehci_pci_takecontrolleradm1032cloneprobeuaddr_bestfit_pooltcp_rst_ppslim_countieee80211_recv_assoc_respieee80211_parse_rsn_bodyukbd_detachaes_key_wrap_set_keyif_clone_listtc_windupsys_futimesrt2661_update_promiscsdgetdisklabelsysctl_proc_cwdbwi_intrwi_do_hostdecryptsiop_table_syncinternal_commandpci_subclass_wirelessuvm_map_boundarymalloc_errintvlbwi_phy_init_11b_rev5ciphyattachin_losingsis_chip_mapVOP_SYMLINKgeteblkrt2661_suspendrt2661_detachusbd_set_interfaceem_force_mac_fcscsibusmatchinflateBackInit_crypto_kregistervn_ioctluhci_remove_bulkwi_usb_ctl_lockufsspec_readdb_show_calloutrt2661_set_txpreambleaxe_cdpipespacefiqvectorget_last_resort_ifidohci_alloc_stdcmd646_9_irqackip6_sendredirectsbwi_initcast_decryptddb_sysctlsr_get_blockbwi_startukphy_caitimerfixip_stripoptionsieee80211_node_join_11gbwi_init_statechgsyn_cache_countuaddr_stack_brk_createieee80211_add_xratesnd6_timer_chuvm_pseg_releasecpu_resetudav_ticktcp_ctlinputether_multiaddrstart_cleanerffs_blkfreeexit1ohci_detachbwi_mac_adjust_tpctlwsmouse_add_muxbdevvpifa_ifwithdstaddrehci_cdi80321_bs_mapuaddr_bestfit_selectuvmspace_duseddb_watchpoint_allocudav_ifmedia_changeselectroutein6_nigroupscsi_mode_sense_big_pageauth_hash_sha1sys_mkfifoatuihashrijndaelEncryptscsi_ioh_deltcp_keepintvlsr_raidp_createuvisor_detachcdwriteufswrite_filtopsttybgconfig_searchphtree_RB_PREVwihap_sta_findusbd_printuvm_km_valloc_prefer_waitsyn_cache_poolpci_subclass_mass_storageffs_allocaue_tick_taskdb_preveephy_funcsinphy_funcsucom_hwiflowrgephymatchbswap32ipsec_exp_first_userlphy_serviceplimit_poolip6_defhlimumass_setup_ctrl_transferunp_connect2usbd_set_pollingrn_walktreepool_prime_pagepciide_ite_productssys_chownuvm_pagewirebwi_calibrateem_stoppci_vga_pciin6_joingroupsys_munlockhotplugattachinflateBackuvm_anfreeuhci_bus_methodsdofilereadvipip_sysctlbs_notimpl_bs_sr_1vn_statfilerw_exit_readieee80211_iterate_nodeswi_intr_enabletablefullumct_set_line_stateuhub_exploreupl_txeoftcp_maxidlevfs_getcwd_commonset_cpufuncscttyioctlsys_lstatieee80211_recv_wpa_group_msg1ieee80211_recv_addba_respohci_timeout_taskohci_hash_add_tdieee80211_tkip_set_keyiso_uiodircttykqfilterurl_activatecttyopenpmap_link_l2ptinet6ctlerrmapbwi_bbp_power_onicmp6_redirect_diagdisknamessched_queued_cpusumass_quirksdumploRMD160Updatemsdosfs_mountacphy_funcsffs_clusterallocbwi_calc_rssiuvscom_activatenullcnpollcuvm_km_inituvm_objinitbwi_hostflags_readpciide_acard_productsbzero_pageffs_sbupdateudp_sysctlsys_openatm_clcountbs_notimpl_bs_wm_1vmmapbsyusb_add_taskurl_int_miibus_readreguserconf_histlendb_list_breakpointsusbd_set_protocolrt2860_alloc_tx_ringrt2860_updateedcankmempages_minukbd_accessopsusbclosesis96x_setup_channeludav_matchvector_pagekq_ntimeoutssys_sched_yieldvmspace0bwi_phy_clear_statescsi_decode_sensettywaitwsmousedevprintuvm_map_setuptcp_syn_cache_sizewdc_default_vtblieee80211_add_tieem_defer_attachetextifa_ifwithnetmemchrohci_device_ctrl_doneqsphy_statussqphyattachpte_l2_s_cache_maskcomp_algo_lzsieee80211_recv_barsysctl_cptime2scsi_mode_sense_pageboot_argspipelocksr_raidp_addioumass_scsi_setupproc_pooluplcom_dtraue_intrudp6_inputsys_writert2661_next_scandb_get_valueural_set_txpreamblegeneric_armv4_bs_rr_2sb_maxusbd_fill_iface_datacd_set_pa_immedemul_flags_translatesr_uuid_print__bss_end__ip6_insertfraghdrcnstopextent_print_allihashtblieee80211_set_shortslottimesys_dup2em_phy_resetdb_inst_countdb_read_linesiop_productswd_get_paramsbread_clustersys_readlinkbwi_rf_writert2560_setup_tx_descext2fs_size__ashrdi3bs_notimpl_bs_mmapzErrorohci_intrxscale_cache_flushI_SEcrc32ip6_auto_flowlabelsvwsata_mapchanuipaq_cafintek_worklistdevid_copylf_splitifafreeVOP_STRATEGYtimeout_add_sectzucom_rtsxscale_cache_syncIrip_sendspacecoredump_writenote_elf32uhidev_writeusb_generic_tasksxscale_cache_cleanID_rngamap_addtcp_freeqif_setgroupattribsuhci_device_requestcom_attach_subrsii3114_dmacmd_readdvd_authrt2560_node_allocexphy_servicesiop_maumass_scsi_cmdcdreadbufq_disksort_requeuert2661_get_rfrt2560_enable_tsf_syncspec_inactiveehci_device_intr_starthidms_setupwi_func_usbwsmux_do_ioctlsys_sendtoicmperrppslimgeneric_filtopsknote_dropuftdi_setcue_watchdogin6_selectsrcrd_casoftclock_siem_82547_fifo_workaroundwi_usb_threadsr_ccb_putin6_pcbsetportalldevsbwi_vendor_led_actrt2661_iter_funcwddumpicmp_do_errorvmcmd_map_readvnsmsc_initrandom_startcomconsfrequsbd_get_interface_altindexamap_extendsigpropvmapbufumass_scsi_switchi80321intc_intr_initdehashtblsocketopssiop_pci_matchscsibus_bioctlX_db_sym_numargsnd6_maxndoptuvm_map_clip_startffs_fragextendtcp_always_keepaliverawcbtablespec_readumodem_cdunp_markacphyattachdes_key_schedicmp_mtudisc_timeoutnwsmuxpmap_zero_page_xscalettyread_filtopsuvm_mapiic_printusbd_bulk_transfergetinoquotabrgphy_5708s_statusscsi_do_ioctlrtable_existsdisk_lock_nointrehci_free_sqhcd_resetX_db_foralluhci_pci_cascsi_ioh_addbwi_mac_reset_hwkeysscsi_detach_busudpstatroute_inputsetrootcd_read_tocural_amrr_updatecdioctlieee80211_defrag_timeoutbufq_switchcue_stopuvscom_detachifmedia_addatu_usb_requestfrag6_queuelxtphy_funcssr_matchusbd_set_config_indexlogopenluphy_serviceieee80211_add_rsn_bodyrt2560_txtimesr_raid6_initrt2661_rxratecd_buf_donescsi_devid_pg80breadntcp_hdrszscsi_devid_pg83tcbtableieee80211_recv_4way_msg2i80321_mem_bs_init__xordi3frag6_drainuvm_objtree_RB_REMOVE_COLORdosdiremptyigmp_slowtimoifpromiscre_disable_sim_imip6_setpktoptsfork_returnsys_getsocknamecd9660_lookupsr_concat_initricohrtc_cawi_usb_intrusbd_alloc_bufferinflatePrimemask_rnheadsw_reg_iodonepte_l2_s_protoufs_roottcp_sysctlVOP_SETATTRsmsc_chip_initpmap_kremovesigactsinitohci_pci_caffs2_blkprefdomknodatusbd_set_reportcpu_kcore_hdrexec_elf32_fixuprt_newaddrmsgvop_generic_lockcomconsiotuvmfault_anongetconsttybwi_detachural_bbp_readsr_ioctl_diskusermountext2fs_dirrewrite__ucmpdi2vn_closefilepci_findvendorumass_discoip_mtudiscvfs_free_netcredem_power_up_serdes_link_82575mld6_start_listeningcpu_mainbus_cakue_matchpmap_kenter_papidhashtblaue_matchusbd_get_protocol_nrssi_thresholdpmap_l2dtable_ctoruvm_mapent_forksharedm_pullupenterpgrpxscale_tlb_flushID_SEnull_zerokeycrypto_freesessioncnbellm_copydatabufq_nscan_requeuegetdirentries_internalatu_stopcd_setchanieee80211_get_probe_reqmtx_leavefilt_signalsigactsfreert2560_free_rx_ringwdc_default_write_raw_multi_4ttymallocupl_attachums_intricmp6_notify_errorieee80211_recv_probe_respbs_notimpl_bs_sm_4pcisubmatchkue_setmultimmioctluaddr_free_rbtree_RB_NFINDuvm_coredump_walkmapdb_nextumass_matchsched_choosesendsigohci_device_ctrl_methodsbpf_ifnameohci_cdural_ioctlsmsc_iffvfs_busytimecounterfilt_ufsdetachbufq_initlf_getlocksr_raid6_xorpsolistenpdc205xx_drv_probewskbd_compose_valuespec_getattrpciide_dmactl_readobio_bs_unmapiic_scanl1_lru_lockip_ecn_ingressmsdosfs_bmaprip_ctloutputffs_vtblif_getgroupieee80211_parse_rsnpool_debuguserconf_morekqueue_ioctlmax_processesem_free_pci_resourcessys_wait4rip6_recvspaceamap_share_protectieee80211_bar_tidfs_sysctlukbd_cnattachieee80211_ibss_mergeboot_filefilt_sordetachknote_activatepsignalieee80211_regdomain_compare_cnconfig_pending_incrusb_task_threadbwi_mac_unlockamap_pp_establishauth_hash_gmac_aes_192ieee80211_setkeysuvm_pmr_nextszatu_activateuvm_anon_initffs_reclaimbmtphy_causb_free_deviceusb_exploreifaddr_items_RB_REMOVE_COLORbufq_nscan_queuexscale_cpufuncsif_link_state_changepmap_virtual_spaceieee80211_add_wpaieee80211_eapol_key_check_micusb_disconnect_portpage0_endieee80211_add_capinfobpfpolluvm_pmr_nfindszupdatepriohci_activateciphy_fixupbwi_mac_lockbmtphy_servicesched_kthreads_createuhci_device_bulk_closeuhid_cdwskbd_cnbellbintimebwi_set_clock_modere_woluhci_intr1jmicron_chip_mappciide_print_channelswi_seekfilt_soreadpmap_remove_allrtable_addrt2860_mcu_bbp_writezeropageipsec_def_encbrgphy_bcm5401_dspcodeffs_nodealloccgbwi_mac_calibrate_txpowersoftintr_establishuvm_pmr_removeip4_input6pdevinit__iordi3uvm_pmr_findnextsegmentinetctlerrmapresetpriorityrt2560_set_slottimeenoioctlrt2860_watchdogwi_usb_start_threadflslbwi_dma_txstats_allocsigacts_poolpcaled_matchexecsigsconfig_initskip_fcicmp6_redirect_inputbuf_rb_bufs_RB_REMOVE_COLORrw_enteraue_read_macpciaddr_print_deviduvm_addr_destroysr_raid0_inituvm_pmr_size_RB_MINMAXdb_access_abt_spnd6_ra_inputffs1_blkprefin6addr_loopbackuvm_objtree_RB_MINMAXttypenduvm_swap_freepagesqsphymatchnd6_dad_starttimerin_revarpinputstrlcpyuaddr_bestfit_destroyX_db_symbol_valuesiopiic_attachehci_device_isoc_methodsumodem_setusbd_reload_device_descsmsc_read_regext2fs_advlockknote_fdcloseusbd_get_devcntehci_device_intr_doneem_get_pcs_speed_and_duplex_82575if_clone_detachpipe_rfiltopssiop_dmamem_allocubsa_openin6_cksumcomcninitpciide_print_modesstrncmpcsrc_ptedes1_decryptvfs_shutdowngetsockieee80211_get_deauthbwi_newassocbs_notimpl_bs_c_4upl_startsyn_cache_respondif_creategroupllinfo_nd6sbcheckreservepreemptuvm_iobioattachieee80211_begin_scanunixdomaindb_next_free_breakpointbwi_led_attachbwi_tbl_write_2smdscsibusattachumct_rtssyn_hash1ulminwihap_data_inputi80321intc_do_pendingdb_last_symtabproc0paddrrn_addmaskifaddr_itemspciaddr_do_resource_reserveusb_attachbpf_bufsizeselscanpciide_promise_productssoo_pollumodem_activateuvm_map_uaddr_ertafidx_maxsig_filtopsknote_processexitohci_device_bulk_transferukbd_cdricohrtc_getcalwskbdopenrt2860_reset_rx_ringrt2661_eeprom_readem_startttclosurl_rxeofipsec_soft_allocationssleep_setup_bus_dmamem_mapip6_fragmentnet_sysctlcom_cdbwi_mac_init_tpctl_11bgtimeout_adjust_tickswskbd_do_ioctlxscale_cache_cleanD_Euvm_pmr_size_RB_FINDudv_listdead_ioctlaue_initusb_matchbwi_txeof__wdccommand_startsysctl_iflistvwakeupcmd680_channel_mappci_subclass_bridgeif_clonersrt2860_set_txpreamblewdcbit_bucketvgonewdc_probe_capspmap_initializedtcp6_ctlinputsched_init_runqueuesdb_stack_trace_cmdusb_allocmemsd_sizeufsspec_closend6_prefix_offlinkuvm_anon_dropswapwi_detachucom_lockigmp_inputkmemusageswcr_sesnumlf_getblockpciide_irqackautoconf_attdet_mtxumodem_attachtcp_rttdfltcleanerprocpdc202xx_pci_intrieee80211_parse_edca_params_bodysbappendstreamm_tag_copy_chainrt2661_bbp_writeohci_handoverusbd_intr_transfer_cbsowrite_filtopssr_chunks_unwindstrncpycseadddb_disasmsdreadsys_pselectupdatefatscue_memata_perrorvfs_getvfssr_alloc_resourcesaue_txeofffs_sync_vnodedeflateInit2_sr_raid6_discipline_initproc_stopvfs_vnode_printdb_history_lastrrticks_initbio_status_initusbd_set_port_featurebpfilter_createsysctl_locklockfpoolwihap_disassoc_reqieee80211_find_nodecpu_switchtoucom_cahtonlsched_all_cpusin6_mask2lentcp_dooptionsdos2unixtimesys_sigactionsr_scsi_donedeupdatusb_fill_di_taskehci_ifcdSHA256Transformrndlock__negdi2in6_purgeaddrcpu_modeluhci_softintrsii3114_read_regarm_dcache_align_maskcttyreadcd9660_unlockpciide_dmactl_writeuserconf_cmdsural_taskbwi_set_bssidiophy_statusschedclockbpfioctlconfig_attachsr_sensors_createohci_alloc_sitdcue_rx_list_initbwi_hostflags_writert2661_attachhookbmtphy_statusdisk_unbusysysctl_fileusb_syncmemugen_detachi80321_io_bs_freesoisconnectedurlphydebugamap_clean_worksuhci_alloc_std_chainusb_block_freememVOP_PATHCONFumass_fixup_sonydk_mountrootassertwaitokdb_run_modescsi_minphysauth_hash_key_md5siop_script_syncxscale_cpwaitvattr_nullsys_getsockoptrt2661_tx_mgtre_rxeofumct_paramuhidev_attachfrag6_nfragpacketsdb_linesr_raid0_assemblebwi_cdpool_allocator_largein6_restoremkludgeuvm_anon_lockloanpgvfs_sysctlite_chip_mapcpu_get_controlVOP_READLINKbuf_mem_initumass_cbi_methodsdb_ed_stylemii_submatchuvmexp_printohci_root_intr_transfermsdosfs_pathconfoldpidstimeout_wheelbwi_pci_conf_readbpf_m_xhalfumass_io_getaverunnablecd9660_getattrttyfreettysleepehci_root_intr_donert2860_rx_intratu_get_opmodeunp_disposescsi_inquireufs_getattrBlowfish_encipherieee80211_mhz2ieeevfs_exportuplcom_closesr_hotspareuvm_km_pgremoveex_region_plfscalesmsc_matchffs_alloccgblkip_optcopyvfs_registerieee80211_proto_attachm_livelocksys_dupmcllowatmii_printieee80211_setup_ratesbpfilterattachproc_stop_topci_find_devicetimeout_todoswcr_initdb_lcbwi_updateslotumsm_truinstall_changemodecpu_read_cache_configumsm_detachwdc_sii3114_vtblsr_ioctl_createraidpanicget_pc_str_offsetciphy_resetural_rxeofcue_rxeofL_cksumdatamsdosfs_lockseltruepci_subclass_systembpf_m_xwordscsi_xs_syncieee80211_recv_group_msg2softdep_initializestackgap_allocunp_shutdownieee80211_tkip_encryptwi_resetdovutimensdummy_get_timecountext2fs_sysctlgeneric_bs_wm_4kthread_run_deferred_queuearc4_initwdreadlastdaycheck_execdb_max_linewi_usb_cdtcp_initpte_l2_s_cache_mode_ptdeferred_config_queueciphy_funcsucomreadcbbuf_rb_bufs_RB_MINMAXnetisr_initipport_lastautouhci_endpdsis_setup_channelwsmux_detach_sccom_raisedtrdb_last_commandicsphy_statusip6_pcboptwinSlotCntvn_kqfilterext2fs_syncsched_stoleni80321_io_bs_unmappte_l2_s_prot_maskpciide_intr_flagudav_ioctlcrypto_registercache_purgevfspostsigsys_pathconfcue_open_pipesin_addmultigetmicrotimebs_notimpl_bs_rm_8maxumass_clear_endpoint_stallohci_setup_isocaue_newbufscsi_probedevaxe_ax88178_initi80321_i2c_attachtcp_templatemsdosfs_readdb_object_print_cmdieee80211_notify_dtimrt2860_select_chan_groupfintek_write_regsr_crypto_finish_ioohci_initcomopensata_setup_channelusbd_setup_xferauth_hash_hmac_sha2_512_256ieee80211_tree_RB_MINMAXmtagpoolpiix_chip_mapbcopyiic_attachwsmouseclosewdog_autourl_tick_taskcue_detachusbioctl_bus_dma_inrangekqueue_wakeupip6_unknown_optuaddr_rnd_removetcp_reasssys_getfhext2fs_vgetrt_timer_timerrtbl_id_maxcomcnputcKERNEL_BASE_physSHA1Update_intehci_alloc_sqtdcuio_applygeneric_bs_rr_1ni6_addrsaxe_resetdefrouter_addreqin6_clearscopebwi_pci_cand6_dad_ns_inputuvmpd_tuneusbd_set_addressudav_openpipesffs_setblockipsec_expire_acquirepci_suspendkue_stopicmp6_mtudisc_cloneatu_send_commandinflateResetmemcmpwskbd_init_keymapobio_bs_subregionnamecache_rb_cache_RB_REMOVE_COLORumct_dtrip6_dad_pendingieee80211_rate2plcpmsdosfs_createcd9660_startdb_output_linebwi_get_card_flagsbwi_rf_get_gainscomstartaes_xts_reinitdb_examinecfroots_sizedb_end_linebwi_mac_gpio_finitickadjpool_alloc_item_headeriq80321_irq_mapip6_splithdruvm_map_addr_augmentsiop_clearfifotcp_secret_initieee80211_recv_sa_query_reqsbreserveundefined_initvrecycleem_phy_hw_resetubsa_matchextent_printieee80211_alloc_nodeblf_ecb_decryptcrcopydb_symformatural_newstatewdcloseundefined_handlerssys_revokeural_free_rx_listsysctl_stringsys_rebootuvm_unmap_kill_entryext2fs_specvopsbufpoolproc_finish_waitwdccommandext_dist_code_bus_dmamap_load_buffercpu_forksigonstackuaddr_kbootstrap_selectwi_write_data_iodb_print_ifattylistwdopenuvm_vslockre_initdeflateResetuvmfault_update_statscast5_setkeypci_ndomainsttyoutputkue_caexplicit_bzerocd9660_tstamp_conv17wskbd_calxtphy_statusuftdi_8u232am_getratetqphy_cdcopyaddroutcryptodev_cbumodem_detachcpuset_add_alluhci_root_intr_abortrn_mkfreelistVOP_READbwi_phy_calibrateufs_ioctlffs_freefilein6ifa_ifpforlinklocallastdtimegetdisksys_setuidiq80321_pci_init_wdc_ata_bio_startstart_updatesiop_common_attachudav_cdusbd_clear_port_featureusb_abort_task_threadufs_quota_free_blocks2re_stopsenditsr_crypto_decryptudp_detachbufq_fifo_destroyacer_dma_initcluster_writernd_event_tailhidkbd_decodeuvm_setpagesizeehci_root_intr_closetcp_xmit_timersr_raid1_rwucomwritein6_recoverscopensphy_serviceaue_ticki80321intc_cdsr_raidp_set_vol_statetimeout_add_tvticksvwsata_write_regmclpool_warnmsgi80321intc_cadb_termscsi_preventmmcloseieee80211_get_assoc_respcd9660_accesssr_wu_getffs_statfscpuset_complementrijndael_set_keywdcprobeiophy_cdudp_recvspacekm_allocfill_file2fdropi80321_mainbus_matchgf_initsyn_cache_unreachuserconf_histszsys_getrlimitrt2860_attachhooki80321_mainbus_foundicmp6_errcountbpf_attachdfintek_cdicmp6_ctloutputieee80211_ba_move_windowcpuset_issetsvwsata_dmactl_writeufs_dirremoveumct_setrgephy_serviceieee80211_add_timif_attachsetuppipe_writem_clsetwmssr_set_chunk_stateuvm_map_addr_RB_FINDcryptof_pollin_pcblookup_listensbappendm_copybackscsi_remove_linknd6_rtmsguvm_swap_puticmpbmcastechoHMAC_SHA1_Initextent_print1db_continue_cmdrt2661_mcu_beacon_expireehci_timeoutbufheadconfig_scanwi_get_nwkeykp_pageablesr_raid6_addiopmap_copy_page_funcripsrciso_nchstatsem_update_eeprom_checksumkue_txeofugenkqfilterural_amrr_startnlineswdb_restart_at_pcdb_sstep_printohci_rem_edether_ifattachinflateSyncsr_raidp_xor__wdccommand_doneumass_adjust_transfersignal_initfill_drlistffs_updatedb_print_formatrt2560_tx_bcnwsmuxcloseunix2dosfnspec_advlockmtdphy_cdfragtblraw_sendspaceubsa_cauvscom_breaknullopre_attachuftdi_2232h_getrateAES_CMAC_SetKeycomdiagextralocunsleepvop_generic_bmapwdprobescsi_xs_getX_db_lookupmtdphy_funcsuipaq_seti80321intc_matchblf_encryptsched_proc_to_cpu_costohci_alloc_std_chainipintrgetnanouptimeohci_pci_detachuhci_pci_detachudav_activatei80321_pci_attach_hookdes3_encryptmaxdmaprt2661_tx_dma_intrural_alloc_rx_listusb_block_allocmemext2fs_symlinkdb_skip_to_eolip6_savecontroldevice_registerpciide_chan_candisablesr_raid6_set_chunk_statend6_dad_stoptimerq_to_bmountrootsyn_cache_resetdb_inputcharuhci_device_intr_doneuhidev_opendb_boot_cmdsundefined_entryip_initreaddeprocess_read_fpregsohci_freexural_txtimecd9660_rrip_getnameufs_check_exportdes_encryptsysctl_rdintpdc20268_setup_channelcd_interpret_sensein_mask2lenbwi_ack_rateural_eeprom_readscsi_iopool_destroylodirtypagessr_ioctl_disciplineem_probeumct_get_statusfindwin95VOP_WRITEsys_nanosleepre_rx_list_initstart_init_execifa_update_broadaddratu_detachnd6_addr_addifa_ifwithaddrsr_dumpclock_ymdhms_to_secssiop_add_devuhci_root_intr_transferbwi_dma_freebwi_phy_init_11b_rev2db_write_cmdrootduidif_clone_attachuplcom_get_statussys_getfsstatohci_abort_xferbpfopencdstrategynetisr_intrem_config_collision_distnatsemi_irqackdeflatePrimerandomwrite_filtopsnd6_slowtimo_chuvm_km_valloc_alignenc_xform_nulldb_max_widthip6_pullexthdrmalloc_printitcpu_idle_enterbwi_regwin_disable_bitscomwriteuvscom_intrbuf_kva_starttuagg_subVOP_RENAMEauth_hash_gmac_aes_128cdclosecast5_zerokeysys_fchdirsr_crypto_readsysctl_ifqprocess0ieee80211_send_eapol_key_reqm_cltick_tmorandompidwd_cdurl_initfilt_ttyrdetachrt2560_update_plcparp_inuseuhidwrite_bus_dmamap_destroyvn_polluhci_device_isoc_methodsinet6swrouteswdosdirtemplatemainbus_cddb_uvmexp_print_cmdre_ioctlsys_mincorepdc203xx_setup_channelieee80211_tree_RB_REMOVElastsecondswdog_timeoutpci_probe_devicewsmousedoopenwi_get_txpowerural_plcp_signaludav_stopusbd_error_strslun_switchamphymatchtcp_maxpersistidleudav_tx_list_initspec_ioctlufs_initproc_reparentrt2661_select_antennauvm_exitfc_bmapcallspr_rmpageffs_initcluster_wbuildsr_crypto_createsvwsata_dmacmd_writescsi_ioh_setbootsyncuvm_initaue_attachieee80211_crypto_attachsys_ioctluvm_map_addr_RB_NFINDif_free_sadldb_dotbwi_mac_gpio_initucomstopieee80211_node_joinfilt_bpfrdetachcompress2umodem_openicmp6_initbwi_mac_shutdownbs_notimpl_bs_rm_1disassembleuvm_mapent_free_insertfilt_ttywritepool_update_curpagesiop_script_readhid_end_parsein_setsockaddrpool_set_ctordtorcy82c693_readbpf_moveiniq80321_hdlg_irq_mapostypevndbuf_pooluplcom_resetuvm_page_physloadaxe_iffucomstartreset_entryuvm_pmr_remove_1strangere_setup_hw_imwdcresetwdc_exec_xferip6_insert_jumbooptipintrqtuaggohci_noopusb_frag_freelistip_slowtimordsizerijndaelKeySetupEncrt2860_load_microcodeubsa_rtsip6_nexthdrrtdeletemsg__bss_startumsm_openrt_tab2domdcphy_cdbwi_rf_readpciide_via_productskue_rxeofsiop_attachrijndael128_encryptVOP_KQFILTERukphy_funcssys_msyncdeflate_compresswskbdreadsbappendrecordevcount_detachsd_cabwi_free_txstats64ixp_chip_mapsoftdep_fsync_mountdevinitmsgbufehci_device_bulk_startwsmouse_attachpciide_intel_productsuipaq_dtrmemsetcuio_copydatapipe_free_kmemufs_getlbnsieee80211_get_actionieee80211_sa_query_requestphysiosr_ccb_doneohci_strin6_selecthlimdb_show_all_vnodesupl_sendwdattachdb_symbol_is_ambiguousmii_phy_delete_mediausbd_set_report_asyncin6_unlink_ifacrypto_kdispatchicmp_mtudisc_clonert2661_rf_writeuvm_pmr_insert_sizesodisconnect_spllowerumct_closesys_setgroupsmainaue_csr_write_2lxtphy971_funcsucomttyohci_device_bulk_doneether_crc32_le_updatemtdphymatchtimespecfixbwi_read_spromsr_raid1_set_chunk_stateuplcom_opensiop_lookup_productuaddr_bestfit_createural_set_basicratesip_flushieee80211_delete_keykue_startre_watchdogsiop_scsicmduvm_unmap_removepmap_alloc_l1svwsata_chip_mapi80321_mem_bs_unmapicmp_errordb_hangmanwsmuxdevsbs_notimpl_bs_sm_1upl_rx_list_inituvm_swap_markbaddes_set_keykqueueopsrt2860_iter_funcsmsc_miibus_statchgvholdbufq_fifo_dequeuepciide_map_compat_intrubsa_parityidgen32db_help_cmdrt_if_removesr_minphysscsi_default_getghash_gfmulusbd_no_quirkrt2560_ack_ratere_read_eepromsis_hostbr_matchuipaq_matchm_adjsr_wu_donemld6_stop_listeninghotplugioctlsvwsata_read_regpmap_map_chunkppsratecheckkmemlimitbuf_rb_bufs_RB_PREVrt2560_rf_writebwi_ioctlbwi_init_rx_ring32amap_copybufq_drainphysical_endbwi_phy812_valuebwi_rf_calc_nrssi_slope_11bbio_statusuhidpollsched_wasidleieee80211_ieee2mhzieee80211_dup_bssi80321_io_bs_mapuaddr_hint_destroylf_findoverlapsr_raid_start_stopfilt_msdosfsvnodebwi_txtimelf_wakelockkv_anydb_sym_numargskue_attachhookdumpconfAES_CMAC_Initwi_rxeofehci_pci_detachbrgphy_cahpt_pci_intruaddr_lin_selectdead_badopbwi_dma_mbuf_destroypciide_dma_finishpool_large_alloc_niblf_cbc_decryptcalcrusys_unlinkdb_cmd_listmainbusmatchrt_setgatetcp_ack_on_pushpmap_growkernelext2fs_rmdirufs_chowndofchmodatsysctl_intupl_tx_list_inituvm_shutdownkqueue_closepte_l2_s_cache_modeuvn_initstrlcatsysctl_int_arrbs_notimpl_bs_wm_8uvm_map_set_uaddrcdce_matchsoftintr_dispatchdisk_unlockpciide_cypress_productsufs_ihashremieee80211_recv_4way_msg2or4cttywrite_bus_dmamap_createSHA256Inittcp_update_sndspacesr_crypto_doneurl_stop_taskpciaddr_device_is_agpsdmatchusb_freememudav_txeofpool_chk_pageproc0cdce_initufs_renameaxe_caext2gennumbersr_bio_ioctlbwi_rf_calc_txpowerudav_attachuvm_map_entrybyaddrsr_already_assembledusbd_get_hid_descriptorrt_ifannouncemsgsoo_readbwi_rf_lo_update_11guvm_km_doputpagepciide_vendorspci_get_powerstateufs_opencopyout_statfspmap_modify_pvi80321_intr_establishm_catbwi_free_tx_ring32splxbwi_regwin_switchohci_pci_attachrtinittqphy_statuscluster_collectbufskp_dma_contigsiop_handle_qtag_rejectwi_write_data_usbumass_scsi_minphysuvm_swap_inittcp_nowaue_miibus_statchgdb_trace_until_matching_cmdproc_printitural_bbp_initdes1_setkeyunp_gcsys_clock_gettimeip6_hdrnestlimitcsefreepool_catchupcpuset_clearxscale_cache_syncI_rngfrag6_initsiop_sdtr_negbuf_replacevnodeuvm_pmr_size_RB_NFINDiq80321_pci_intr_mapre_miibus_readreguvm_mapent_addr_removetimeout_setrdread__subdi3ntohsmsgbuf_putcharbwi_media_change_bus_dmamem_freeinet_ntoadb_boot_poweroff_cmdsd_flushcd_setvolext2fs_mkdirohci_openpte_l2_s_coherentext2fs_direntersys_symlinkatmii_pollstatrlphy_cawdgetdisklabelrw_exitpciide_machdep_compat_intr_disestablishkv_pagedupfdopeni80321intc_calc_maskidgen32_initbwi_dma_ring_allocrt2661_amrr_node_freeifmedia_list_addpidhashrt2661_updatestatsrtprefxscale_context_switchuvm_totalencdebugicmp6_ratelimitdb_unread_charsr_raid1_createsys_mkdiratiic_searchdofstatatstart_inituhub_attachieee80211_recv_assoc_reqether_fakeaddrsysctl_tc_hardwarert2661_prepare_beaconsmsc_rxeofscsi_ioc_ata_cmdtcp_mssdfltrt2661_alloc_rx_ringrt2860_updatesloti80321_bs_unmapuvm_swap_freeatu_newbufdata_abort_handlerbwi_tbl_write_4bs_notimpl_bs_r_1umsm_closeaxe_initdb_look_charuhidev_set_reportin_pcbdetachmsdosfs_vfsopststohzaue_ifmedia_updttycheckoutqrt2560_watchdogpiix_timing_debugicmp6_mtudisc_callback_registerdb_set_variableuvscom_set_linevm_map_unlock_read_lnaue_causb_explore_tasksrnd_event_spacesr_concat_rwpmap_clear_referencert_getmetricswdc_ata_bio_kill_xferin6_ifdetachdb_search_symbolcn_tabswaplist_insertsmsc_lock_miiip_forwardextent_createrdclosebpf_freeddisklistin6_lifaddr_ioctlsys_fstatfsurl_txeofkue_devsbs_notimpl_bs_sr_8m_injectem_mta_setip6_mforwardingffs_isfreeblocki80321_mem_bs_freeseltrue_kqfilteruvm_map_lookup_entryhztoicsphymatchBlowfish_expandstatebs_notimpl_bs_w_4ieee80211_get_probe_respdead_strategypciide_dmacmd_readswi_handlergcu_miibus_writeregni6_store_addrsspec_fsync__wdcwait_resetuvm_map_deallocateicmp_reflectieee80211_parse_wpamii_phy_activatescsi_xsh_iohext2fs_reclaimpciide_acer_productsffs_ballocsys_getgroupsieee80211_node_attachsys_linkatuhub_cdwi_start_usbgeneric_bs_wm_1ip6_raw_ctloutputkernel_textumodem_get_capsufs_startsigstkinitbufq_disksort_dequeuebrgphy_mii_phy_autoohci_devd__end__kinfo_vdebugbwi_start_tx32rt2860_ampdu_rx_stopnsphy_reseturl_sendcdce_encapufs_bmaparrayfragtbl8i80321_mainbus_attachuvn_sync_lockaes_ctr_setkeyumct_attachurl_resetusb_needs_exploreswaplist_findufs_quota_alloc_blocks2fc_fileextendsfilt_sigattachre_startwsmouse_cdricohrtc_settimeVOP_FSYNCbwi_mac_get_propertyffs_sysctlipport_hilastautoarpinit_doneusb_wait_taskuvm_anon_pageinspec_closecd9660_closeuvm_map_mkentryem_initialize_receive_unituvm_map_addr_RB_REMOVEsys_shutdowncngetcehci_rem_qhsii_fixup_cachelinetc_adjfreqrnd_statesuaddr_pivot_createm_gethdrem_dma_mallocugen_activateconfig_rootfoundcue_cdputcsiop_resetsii3114_mapreg_dmaieee80211_phymode_namebufbackoffricohrtc_attachsysctl_rdstruct__divsi3uhidev_cdwsmousereadsr_raid1_initxscale_minidata_clean_sizeschedcpui80321_gpio_pin_readbwi_mac_bss_param_initrt2661_attachurlphy_servicesbappendcontrolukbd_set_ledswihap_sta_timeoutsiop_update_scntl3pciide_nvidia_productsugenread_intr_filtopssoftdep_flushfilesdb_access_und_spipv4_inputm_getclrpool_headwsmuxioctlsr_crypto_read_key_diskusbd_interface2device_handlepcaled_cdipforwardingdb_lexohci_device_isoc_transferieee80211_get_cts_to_selfusbd_open_pipe_ivalicmp6_redirect_timeoutsyn_cache_lookuparc4random_statebwi_setup_tx_desc64prtactiveksym_upcaseufs_makeinodescsi_xs_ioip6_process_hopoptsusbd_find_edescfilt_ttyreadsys_getpgiduhci_runcom_common_putcswaplist_trimcache_lookuprdioctluhci_allocxobsd_pci_mem_findrijndaelKeySetupDecdb_boot_crash_cmdbwi_rf_on_11auvm_objtree_RB_INSERTsysctl_tcurl_detachbs_notimpl_bs_rr_1umass_scsi_sense_cbrijndael_encryptricohrtc_clock_writeieee80211_recv_mgmtbwi_newstate_beginumsm_get_statusaxe_detachdumpsizesowwakeuppci_matchbyidukbd_keydesctabsr_raid_inquirysmsc_setmacaddressextent_freeuvm_aiodone_daemoni80321_gpio_pin_ctladdupc_tasksched_syncusbd_clear_hub_featureext2fs_vopsieee80211_send_4way_msg3db_mount_print_cmdcomcloseiopxs_mainbus_caeephy_attachsetsigvecsiop_dmamem_freeurl_iffsys_sendmsgi80321_bs_barrieruhidopenvn_marktextiic_cdbrgphy_bcm5411_dspcodestrcmpsys_quotactluhidev_matchsr_raid_startwuieee80211_get_hdrlenuaddr_pivot_destroytcp_mtudisc_increaseulmaxatu_txeofin6_pcbconnectdehashluphy_cakue_cduvm_pmemrange_addr_RB_INSERThook_disestablishexphy_funcsbpf_catchpacketffs_isblocksr_concat_createucomwritecbdb_stack_trace_printusbd_find_quirkuvm_swap_allocpagesuvm_aobj_poolhotplugclosedb_show_frame_cmdsys_adjfreqpci_cadb_examine_cmdqsphy_funcsuvscom_seticmp6_reflectsetrunqueueudv_attachsettimecdce_rx_list_inituhub_intrarm_pcache_typertable_initscsi_ioh_runqueueuaddr_lin_functionsuvm_addr_entrybyspaceata_set_modemii_phy_auto_timeoutsyn_cache_getnetisrdb_clear_breakpointsttyrubieee80211_get_ratevop_generic_islockedrt2860_reset_tx_ringuaddr_hint_poolm_pulldownbufcachepercentbwi_mac_detachacer_pci_intrpmap_initufs_rmdircryptodevkey_cbrlphymatchieee80211_next_scanpmap_zero_page_funcarmv4_tlb_flushD_SEminsr_meta_native_writeuhci_device_ctrl_abortip6_initconfig_detach_childrenrawcbpdc203xx_write_regsmsc_detachukbd_cngetcz_errmsgtcpcb_poolsr_shutdownhookrt2860_updateproti80321_pci_make_taguvm_map_addr_RB_INSERTBlowfish_stream2worduhidclosetimeout_add_msecipip_allowsys_polluvm_map_clip_endufs_makedirentryusbd_set_configuvm_mapent_mergeieee80211_recv_addba_reqm_defragem_write_pci_cfgrtable_l2setvnode_hold_listlastdosdateudav_unlock_miibuf_rb_bufs_RB_NEXTuhci_add_bulkral_cdufs_linksched_choosecpusys_mkfiforicohrtc_matchuaddr_free_rbtree_RB_REMOVEzcallocdb_cmd_searchural_read_eepromin6_ifinitin6_leavegrouprtlabel_id2sasqphy_caem_reset_hwsddumpiminsys_chflagsobio_bs_tagget_hw_ifidKQRELEdelaypci_reserve_resourcessdstartdb_machine_command_tableip6_hopopts_inputddb_regsselfalseieee80211_media_initricohrtc_gettimescsi_default_putsr_free_resourcescom_enable_debugportpage0_datavn_isunderusbd_get_port_statusuvm_pageoutpffindtypepdevnamespci_subclass_dockuipaq_breakqsyncehci_resetwi_setmultiuvn_clusterifaddr_items_RB_MINMAXre_gmii_writeregcd9660_vptofhwi_attachusb_camii_phy_downuvmspace_forkraw_initknote_enqueueums_accessopsudpcksumtcp_sendspaceurl_csr_write_4db_maxoffuvm_pmemrange_addr_RB_REMOVE_COLORffs_oldfscompatieee80211_add_rsnrijndael_decryptwdcdetachmaxlocksperuidfilt_ugenrdetachin6_matchlensys_madviseupl_openpipesehci_device_ctrl_methodsrt2560_plcp_signalscsibusdetachdisk_attachwskbd_displayioctllm75probeip6_clearpktoptsncpusdb_cmd_loop_donearptfreeubsa_detachfilt_ugenread_intrdb_show_arptabbufadjustcom_detachieee80211_ccmp_encryptaxe_stopural_set_macaddrbs_notimpl_bs_w_2dead_printeephy_serviceinphy_servicemii_media_tablesr_discipline_freebwi_rf_lo_devi_measurewdstrategyrt2860_set_macaddrttyprintfi80321_pci_bus_maxdevsreaperprocsigcodedb_elf_search_symbolhpt_chip_mapipip_inputdeflateCopyieee80211_send_group_msg2db_delete_watchpointcomttybuf_undirtysysctl_tstringsr_meta_cleardb_watchpoints_insertedusbd_start_nextxscale_cache_cleanDfilt_ttywdetachamap_swap_offpool_allocator_nointrbwi_pci_attachsys_sysarchrt2560_disable_rf_tuneBlowfish_decipherbio_validateigmp_initmii_phy_add_mediafilt_msdosfsreadwritecpu_reset_needs_v4_MMU_disablecache_zapMD5Initem_txeofpcaled_gpio_pin_writecryptodesc_poolbus_space_write_raw_multi_2ffs_vfsopssysctl_mallocwihap_ioctlcpu_info_storeieee80211_outputfrag6_slowtimouvm_pmr_insert_addruvm_map_hintwant_reschedrt2661_amrr_node_allocpmap_bootstrap_pv_allocatormsdosfs_mkdirkthread_create_deferreduhci_free_sqhieee80211_ioctluhidevsubmatchbufq_disksort_destroycrc32_combinebufq_simple_nscandevid_freeboot_eaddrre_rx_list_fillieee80211_sa_query_timeoutscsibusactivatend6_timercomcnpollcatu_matchbioopenbwi_phy_set_bbp_attenqsphy_servicein6_ifloop_requestcd_patterns__cmpdi2crypto_workqsr_crypto_create_keyssd_ioctl_inquiryscsi_xsh_adduvm_pmemrange_addr_RB_FINDraw_detachscsi_xsh_runqueuepmap_get_pdeural_read_multibs_notimpl_bs_wr_1domainnamelenehci_pollpciattachigmpctl_varsusbd_get_report_descriptorsd_thin_paramsip_rtaddrfiledesc_initrt2661_enable_mrrload_dsatag_switchurl_ifmedia_statuspciide_pci_readatu_get_cmd_statuscue_csr_read_1vrelewi_set_pmwsmux_do_displayioctlohci_alloc_sedem_set_media_typeem_update_link_statusscsi_xs_errorprtrealloccheck_consoleamap_freeem_detachin6_domifattachugen_get_alt_indexusb_blk_nfreend6_prefix_lookuptc_getfrequencyrt2661_mcu_cmd_intruhci_device_ctrl_methodsbwi_rf_lo_adjustsync_inactivespec_printext2fs_lookupmsdosfs_openehci_hubdext2fs_linkvop_generic_revokeohci_hash_add_itdieee80211_add_erpieee80211_decapfilt_sigdetachfilt_seltruedetachext2fs_renameipsec_def_authuhci_add_loopusbd_setup_isoc_xferttywflushcd9660_rrip_offseturl_startwskbd_default_keyrepeat_datacomcnmodeclosefcomioctlumass_cbi_resetscsi_ioh_deqsoftdep_sync_metadataif_clone_lookupgetmicrouptimerandom_initdisk_openpartmii_tickip6_dad_countem_pci_clear_mwiatu_complete_attachumct_breakuvm_pager_dropclusterfilt_generic_detachuvscom_rtsip6_getmoptionssensor_task_unregisterehci_intrlist_timeoutbwi_rf_calc_rssi_bcm2053pool_print1wdc_ioc_ata_cmddb_breakpoint_listcd_get_parmspmap_extractrt2860_set_channd6_ifptomacwsmousedoioctlamap_unaddural_watchdoguvm_pmr_insertcd9660_printsr_meta_saveohci_rhsc_enableif_congestionnfilescd9660_islockedin6if_do_daduhci_root_ctrl_transferrt2560_amrr_timeoutcue_txeofrt2661_amrr_node_findatu_rxeofaue_detachcryptodev_keyieee80211_iserp_stapipe_kqfilterem_configure_k1_ich8lannforce_pci_intrext2fs_openpmap_devmap_find_papmap_kenter_cacheusb_insert_transferaxe_matchukbd_keymapdatasr_meta_validatestopprofclockbufq_nscan_destroydb_hangbwi_rf_on_11bgnullioctlcertance_irq_mapuaddr_pivot_printcryptof_closepte_l2_l_cache_modeisohashrt2860_rssi2dbmmclsizesparsediskre_eeprom_getwordrt2860_calibwi_set_debugbcstats_printbwi_regwin_selectbreadem_intrieee80211_node_copyamap_lookupipctl_varsbwi_init_tx_ring64apollo_setup_channelpmap_page_removert_timer_remove_allwskbddevprintuhid_intrpcaled_gpio_pin_readrt2860_free_tx_poolwdc_output_bytesatu_ioctlieee80211_classifyproc_stop_sweepieee80211_media_statusiophy_capmap_set_pt_cache_modescsi_xs_exectcp_usrreqmichael_keydb_playsieee80211_setbasicratessd_interpret_senseuvm_map_pageable_pgonuvm_addr_invokeudp_usrreqifmedia_initrtable_l2ext2fs_vfsopsuvm_mapent_freeext2fs_inactivedead_bmapdb_guessesif_getgroupmembersdb_show_all_poolssoo_kqfiltercpu_startupamap_refehci_device_bulk_transferuhci_device_isoc_transferdb_command_loopwdc_ioctlamphyattachrt2661_updateslotfdexpandsrandomcoredump_countsegs_elf32sr_wu_inittickswdc_ata_presentpdc20262_dma_finishmsdosfs_closerd_detachpool_do_gethotplugreadext2fs_setattrsysctl_clockratevn_rdwrohci_close_pipend6_need_cacheip6intruftdi_activatebwi_phy_writesyncer_maskwdc_default_write_raw_multi_2uvm_pagedeactivatecy82c693_initufs_unlocktcp_ctloutputrt2860_mcu_cmdrt2661_plcp_signalukphy_statusieee80211_derive_pmkidMD5Updateblktochrifmedia_setem_setup_interfacebio_lookuppmap_createuvm_map_extractsr_crypto_meta_opt_handlernd6_prelist_addufs_removepciide_activatesysctl_tc_choiceptsignalboottimecd9660_readlinkxscale_cpu_sleepVOP_ADVLOCKdb_watchpoint_cmdaxe_watchdogwskbd_mux_closefrag6_inputuhci_device_intr_closecompressBoundpmap_alias_distunpst_sendspaceffs_indirtruncsmsc_cdieee80211_add_ratestcp_rscalettwakeupuvmspace_freeext2fs_inode_poolffs_ino_poolpci_detach_devicespmap_pageidlezerouaddr_rnd_printmii_phy_statusmsgpdc203xx_irqackcpufunc_domainsswapdrum_getsdpVOP_PRINTfdsharepci_subclass_memoryuipc_setaddricmpv6ctl_varsbwi_rf_lo_measure_11bfintek_matchcdstartgf_premulfilt_generic_readwriteuserconf_disableumct_methodsvrefin_scrubprefixusb_detachipforward_rtuhci_device_intr_startbwi_rf_lo_update_11bem_access_phy_reg_hvdb_elf_forallohci_device_isoc_closeuplcom_attachurl_int_miibus_writereguhidev_activateAES_CMAC_Finalsr_uuid_formatnd6_dad_na_inputuvisor_cdsd_cmd_rw16ghash_updatedb_set_temp_breakpointsiop_cmd_putdb_buf_print_cmdbwi_rf_set_chaninpcb_pool_initializedsys_nosysbwi_regwin_disableat_pollallproccdevswsr_rebuildxscale_cache_flushDumodem_get_statussys_mlockalluaddr_free_rbtree_RB_FINDwskbdcloseuvm_sysctlmalloc_lasterrucom_do_closegetsndiskmapopen_bus_dmamem_unmapdisksortsys_fchflagsnamei_poolrt_timer_countvfs_buf_printuhci_device_intr_transfercryptodev_opworkq_destroysmsc_ifmedia_stsukphymatchuvm_pager_putdiskmapcloseohci_device_bulk_abortbwi_newstateem_access_phy_debug_regs_hvudav_cabwi_get_clock_freqin_canforwardsmsc_unlock_miiifa_item_removeohci_device_intr_abortieee80211_tree_RB_INSERTpmap_destroyip_oursscsi_mode_selectkernel_pt_listuvm_map_freelist_update_clearetherbroadcastaddrieee80211_rssadapt_updatestatssii3114_chip_mapvfs_getnewfsidaue_rxeofem_cducom_attachSHA512Finaludp6_ctlinputitimerroundarm32_vector_inituvm_pmr_size_RB_PREVwdog_shutdownscsi_print_sensewskbd_update_layoutmmopenffs_inode_freeohci_device_intr_transferwdc_cdpci_findproductamphy_statusukbd_intrifa_item_insertrtioctlkue_ctlscsi_xs_putifaddr_item_pluaddr_hint_functionsieee80211_tree_RB_INSERT_COLORprofprocswdc_free_xferip6_inputbuf_free_pagessleep_finish_signalicsphy_cdwi_usb_cmdrespsr_crypto_alloc_resourcesgeneric_armv4_bs_rm_2route_srcbootduidehci_pci_activatespeedup_synceraes_xts_zerokeyigmp_sendpktloop_clone_destroywdc_ata_bio_doneifmedia_baudrate_descriptionsv_putcsr_scsi_wu_getbwi_rf_clear_tssim_getptrukbd_cauhid_activateufsvnode_filtops_bwi_adjust_devideuvm_fault_unwireuserconf_common_attr_valsched_noidleuhci_add_ls_ctrlobsd_pci_io_findsys_getitimerhid_get_datadonicewdcstartcpu_configuresr_rwohci_pci_attach_deferredip6_freemoptionssqphy_funcshidkbd_delayed_decodeieee80211_amrr_chooseusb_create_task_threadsieee80211_end_scancdce_txeofbufhighpagespmap_fault_fixupdcphy_serviceuaddr_poolrn_refinesgeneric_bs_rm_4hmac_opad_buffersockargshpt_setup_channelhidkbd_ioctlvop_generic_abortopsr_raid6_set_vol_statesetregsupl_rxeofni6_nametodnssobindvmcmd_map_zerodb_read_charvfsinituvisor_closeupl_caubsa_paramcnclosedb_tok_numbertcp_do_rfc1323ip_fragswdc_dmawaitmii_phy_setmediain6_ifpprefixkd_trylocklo0ifphostidpool_chkwi_alloc_nicmem_usbusbd_free_bufferuvm_pagermapoutrt_if_linkstate_changesr_raid0_rwif_downalluaddr_pivot_newpivotext2fs_vptofhnam2blkrw_statussr_raid6_assemblecoredump_writeseghdrs_elf32rt6_deleterouteip_maxqueuesysctl_ttyieee80211_chan2ieeeuhub_cain_socktrimieee80211_recv_delbaext2fs_dinode_poolieee80211_node_cmprtallocsys_mprotectuhci_alloc_sqhieee80211_std_rateset_11gdequeue_randomnessuvm_km_kmemalloc_plart2560_alloc_tx_ringcue_casyncer_maxdelaydeadprocstart_reaperehci_root_ctrl_methodssys_fcntlnforce_setup_channelvfs_free_addrlistsys_setrlimitsys_sigpendingbwi_led_blink_startrt3090_efuse_read_2loop_clone_creatediskmapwriteem_hash_mc_addri80321_timer_initeduvm_map_cleanuvm_pmr_get1pageicmp_redirtimeoutworkq_add_taskttyclosewdrestartugen_isoc_rintricmp6_nodeinfocomp_algo_deflatemaxvfsconftimeout_addcpu_cdip6_forwarddb_fncallnumcacheobio_bs_freesr_bootkeycmd0643_9_setup_channelural_write_multiuvm_pagecountcpu_initclocksbwi_mac_fw_alloccue_sendwskbdioctlmii_downrn_mpath_hashbrelseext2fs_unmountpsratiosdminphysohci_device_isoc_methodswi_usb_tx_lock_tryaxe_unlock_miicpuset_delttyoutdevice_lookupehci_device_requestDebuggerwi_usb_txeofcdminphysschedhzurlphy_caem_allocate_pci_resourcesi80321intc_write_steerrip6_inputtcp_totbackoffvdropuserconf_basepci_subclass_displaylooutputrt3090_rf_readcue_setmultirijndael128_zerokeysoisdisconnectedcpu_coredumpxscale_cache_clean_addrrevbitssvwsata_drv_probedvd_read_disckeypmap_clean_pageuvm_aio_aiodonesr_ccb_rwpmap_clearbitieee80211_mgmt_outputcrypto_freereqbwi_rxeof64syn_cache_rmclrbitsdb_boot_dump_cmduvn_putscsi_add_linkpci_vga_tagxscale_cache_clean_minidataieee80211_proto_detachmii_phy_statusuvscom_matchcommajorcrypto_newsessiongeneric_armv4_bs_r_2bufq_disksort_peekenc_xform_aes_xtssoclosesr_ccb_freescsi_detach_targetinstall_coproc_handler_staticwakeup_nsys_connectbuf_daemonskpcluphy_funcsdb_leieee80211_bip_decapbufq_fifo_createohci_root_ctrl_transferipv6ctl_varsroute6_inputbs_notimpl_bs_w_8board_startupsys_socketpaircnreadpcimatchcertancepci_addr_fixupdounmountuvm_swap_allockthread_create_nowhidkbd_bell_fn_argtcp_ackdrop_ppslim_countdb_elf_line_at_pcarm_picache_sizesr_map_rootttspeedtabns_scx200_setup_channelkqueue_readieee80211_add_edca_paramscd9660_mountuserconf_maxdevre_pci_attachcue_inituvm_pmemrange_addr_RB_INSERT_COLORfork_tfmrateacard_setup_channellxtphymatchi80321_bs_initsr_hotplug_registerpv_sizeuvn_sync_qin_proto_cksum_outwskbd_activatewi_media_statusurl_miibus_statchgnd6_purgedb_mult_exprtcp_keepidleif_attachheadnextcdb_listbreak_cmdwi_scan_timeoutuvm_wakeup_plaiszerodevuhci_devdciphy_caauth_hash_hmac_ripemd_160_96ieee80211_recv_pspollumass_caem_hardware_initgeneric_bs_sr_4lf_freesys_fhstatnullmodemohci_hash_find_itdwihap_sta_deauthbwi_ds_plcp_headerprobe_addrs_eepromif_attachdomain1sys___get_tcbraw_recvspacesr_raidp_set_chunk_statebwi_mac_set_ackratesieee80211_amrr_node_initdiskerrwi_startcd_cddb_machine_commands_installieee80211_state_namesys_preadem_media_statusscsi_moveehci_root_intr_abortkernel_pt_lookupkmem_mapcd9660_check_exportukbd_translateconfig_pending_decrqsphyattachaxe_startieee80211_input_print_tasksoqinsquediskstatsums_detachcdce_attachdes_ecb_encryptudp_inputnchrtoblktblehci_sb700_matchihashrn_search_mresettodrusbd_ref_decrpcaled_attachufs_readdirsys_flockiq80321_startpvwi_usb_do_transmit_syncspec_badopbwi_memobj_read_2msdosfs_linkbufq_nscan_dequeuepciide_unmap_chanbs_notimpl_bs_c_1ohci_root_intr_methodsicmpctl_varsigmpstatmichael_finalvn_initialize_syncerdpipeselwakeuprt2860_get_rfxscale_controlcd9660_quotactlicmp_sendadjtimedeltauhci_root_ctrl_donesiop_morecbdcy693_chip_mapcdce_watchdogsmsc_newbufdb_mbuf_print_cmdsiop_ppr_negwdc_ata_errieee80211_choose_rsnparamstime_uptimeuvm_pagealloc_pgcdce_intrsmsc_rx_list_initfilt_uhidreaduvn_wlistuvm_pmemrange_addr_RB_REMOVEsowakeupinsidetcp_autorcvbuf_incbufq_queuebs_notimpl_bs_r_4db_putstringprefetch_abort_entrysigactsunsharetimeout_hardclock_updaterdattach_edatagcu_miibus_statchgupl_detachrijndael128_decryptbwi_setup_rx_desc64ttkqfilteri80321_pci_conf_writem_tag_deletecd9660_ihashrembwi_phy_readsensor_findip_fragmentfilt_timerusbd_endpoint_countsys_statfsSHA1Finalsched_nomigrationsinittimecountersensordev_deinstallrawin6pcbtablepmap_protectkprintfdevice_unrefrc4_keysetupdcphy_matchscsi_startuvm_pmr_addr_RB_REMOVE_COLORin_cksumvnode_poolrt2661_rx_intrvnode_free_listtcp_savetiuvm_pagereallocbwi_setup_desc32iicprobeinitsensordev_countrt2661_stopiic_ignore_addruvm_fault_unwire_lockedklist_invalidateuvm_km_createthreadpool_printitubsa_flow_endpciide_attachdes_check_keyrt_senddesyncsogetopthid_report_sizeuvm_unmaprd_matchricohrtc_cddb_deletewatch_cmdusbd_ref_waitsr_crypto_calculate_check_hmac_sha1pollscandomaininitsii3112_setup_channelvflushbuftime_secondbwi_pci_matchacer_chip_mapip6_forward_rtwskbd_get_mapentryuvm_pmr_initsr_hotspare_rebuild_callbackusbd_read_report_descsbcreatecontrolsys_mlockhotplug_device_detachrt2560_resumeieee80211_setup_nodebioioctldvd_read_structvdevgoneumsm_intrhtonsehci_pci_attachubsa_setdb_show_callout_bucketbucketkqueue_writesys_syncieee80211_reset_scancominitrt2560_newassocieee80211_add_pmkid_kdeenodevobio_bs_barriersr_raid0_discipline_initffs_mountfsin_delayed_cksumm_clticksfintek_fullspeedi80321_mem_bs_allocrtstatttvtimeoutatu_startkd_waitokabtstacktimingsafe_bcmpspeclisthbdwritecpu_idle_cycleversion_to_spcVOP_INACTIVEwsmux_do_closepte_l1_c_protouvm_mapent_biastcp_syn_cachehaltpciide_sis_productseephy_cainphy_cawihap_sta_is_assocsr_raidp_intrieee80211_std_rateset_11akputcharums_ioctlbootargssys_getsiddb_trace_until_call_cmdRMD160Initdisk_gonewi_write_record_usbdb_show_all_mountscue_csr_read_2uhci_device_setintrm_trailingspacefileheadrc4_cryptusbd_alloc_xfernextvnodeidcttypollsr_meta_initural_startkp_dma_zerosensor_task_ticksys_swapctliic_dumpcpufunc_dfsrbd_reqbs_notimpl_bs_rm_2copypktoptsin_selectsrcmsgscpu_exitip6_initpktoptsworkq_threadbwi_get_eaddruvn_getwsmux_add_muxbpfilter_destroyunp_attachohci_device_isoc_starttcp_syn_bucket_limitsys_renamesr_raid6_xorqpci_vga_procfrag6_nfragsip6_log_timeem_deviceseephy_statusinphy_statusrtalloc_mpathsii3114_chansetupxscale_cache_purgeDscsi_activate_targetdisasmufs_ihashinitunp_deferuvm_km_valloc_waitsys_sigreturnbwi_iter_funcsbflushehci_device_intr_transferscsi_link_closeipsec_require_pfsswapdevwd_cakue_sendsysctl_intrcntaxe_tick_taskvn_readnclrunegheadbwriteleavepgrprt2860_set_gp_timerqsphy_cdarmv4_tlb_flushDkernel_pt_tablepmap_get_pde_pteuvmpageropsuvm_page_initohci_root_intr_closestatminsr_copy_internal_dataehci_root_ctrl_closewihap_sta_allocem_fill_descriptorscast5_decryptbrgphy_copper_funcsxscale_setuprt2661_set_bssidnamecache_rb_cache_RB_INSERTpcaled_gpio_pin_ctltcp_timer_funcsipqent_poolif_attachdomainubsa_requesticmp_ratelimitieee80211_rssadapt_raise_ratesr_crypto_decrypt_keyuhci_rem_loopuvm_km_page_initrttimer_pooladler32_combineieee80211_regdomain2flagadd_entropy_wordsrt2560_rxratergephy_load_dspcodeusbd_get_config_descsosenddosetrlimituvm_pmemrange_addr_RB_PREVrn_initieee80211_set_timuvm_objtree_RB_NEXTsr_scsi_probecmd_channel_maploopattachsiop_update_residural_rxrateieee80211_save_iewdc_input_bytesusb_abort_task_thread_procRMD160Finaldb_listwatch_cmdrt2661_set_slottimepci_get_ht_capabilityscsi_cmd_rw_decodechainlengthprocess_read_regsbwi_mac_startwdc_pdc203xx_vtblusb_fill_udc_tasksys_unlinkatural_disable_rf_tunettwakeupwrrn_lookupthrsleep_unlocksr_wu_release_ccbspciide_ati_productssmsc_write_reguserconf_show_attrsys_execveamd756_chip_mapite_setup_channelfdallocprfindrt2860_updatestatsrt2661_alloc_tx_ringscsi_donert2860_set_bssidchkvnlockhw_sysctltc_ticktockbwi_start_tx64rt2560_newstatephtree_RB_MINMAXdb_siftinguhci_device_bulk_abortdb_look_tokenpmap_alloc_l2_buckettcp_syn_cache_limitnumvnodescryptof_ioctlcomreaduvm_pagefreeehci_device_isoc_abortext2fs_inode_allocswcr_encdecbufq_fifo_queuedb_examine_formatin6_pcbbindpool_large_allocicmp_do_exthdrieee80211_inact_timeoutreaperbwi_bus_initieee80211_add_gtk_kdecoredumpfilt_kqueueugen_cdmalloc_rounduppipe_readuhci_root_intr_closeuvm_map_addr_RB_INSERT_COLORifioctlsys_utimesdb_symformatsusbd_do_requestnd6_storelladdrrip_initsocreateobio_searchusbd_find_idescpmap_cache_stateureadcatu_get_dfu_stateaue_startufs_setattrrijndael128_setkeyieee80211com_headlogpriworkq_queue_taskmemhookdoclusterreadcast5_encryptsys_exitpciide_chanfreesbtryuvisor_matchieee80211_send_4way_msg1m_applyswcr_processcryptof_writeudav_startaxe_lock_miiuaddr_pivot_functionsdomkfifoatrt2560_detachwdc_exec_commandudv_lockbufqsdb_watchpoint_listwdcintrcd_playHMAC_MD5_Updatesys_clock_getresaxe_attachsyn_cache_insertrc4_getbytesswcr_authencttystats_initpciprintpci_mapreg_probeem_allocate_receive_structuresbrgphy_ber_bugucom_matchnd6_umaxtriesohci_device_intr_donedcphy_reseti80321intc_read_intsrcpte_l2_s_prot_kwnd6_setmtu0nd6_debugip6_maxdynroutesuvm_map_pieumodem_cawindow_deflatedb_delete_temp_breakpointehci_root_ctrl_transfercpu_cpuspeedpciide_cmd_productscpufunc_iddefrtrlist_updatert3090_rf_writeurl_csr_write_1_tr_initSHA1Transformesymieee80211_defragcrypto_invokeosreleaseubsa_breaki80321_io_bs_initVOP_RECLAIMscsi_probe_targetsr_raid1_set_vol_stateip6_getpcboptbuf_releasert2860_newstateucom_cdsiop_update_xfer_modeHMAC_MD5_Init__modsi3smsc_txeoftcpqe_poolpgrp0mainbussearchurl_watchdoguvisor_initwihap_timeoutuserconf_changedb_panicuserconf_helpsr_ioctl_setstateufs_advlockicmp_initsr_raidp_openingssii3112_chip_mapcdst_pteuvm_growcsecreatevfinddevieee80211_node_cleanupE_ldsa_abs_reselected_Usedral_pci_attachpciide_unmap_compat_intrrt_msg1ehci_device_bulk_methodsether_delmultibrgphy_5709s_statussave_rtedb_history_currsr_crypto_get_kdfmainbusattachrn_mpath_initheadbwi_watchdoguvscom_paramexec_sigcode_mapsys_gettimeofdayipsec_soft_timeoutwdccommandshortieee80211_rate2mediavcleanuhci_device_bulk_doneiophy_servicecd_getvolsplassert_ctlsys_getresuidsys_fhopensr_crypto_ioctldos2unixfnpciaddr_do_resource_allocatescsibussubmatchrtentry_poolbufq_restartuvm_km_pgremove_intrsafeext2fs_sbupdatein6_init_address_ltimesdefrtrlist_delsys_fchmodatu_watchdoguvm_unmap_detachieee80211_recv_authehci_add_qhupl_initusb_dev_quirkswskbd_srcopsdopselectuserconf_common_devvfs_mount_printstartieee80211_needs_authwdog_cookieusbd_devinfosiop_wdtr_negvn_isdisksys_selectbwi_attachdeflateParamsbwi_mac_initbadaddr_read_1vop_generic_lookupcryptoattachzombprocdb_branch_takenin6addr_intfacelocal_allnodeslogreadumsm_cdrn_mpath_capabledead_lockworkq_next_taskieee80211_name2regdomainbwi_nrssi_11gtcp_issphysical_freestartfc_largedistancesys_setitimerisofntransurl_attachnd_prefixsmsc_tx_list_initvfs_unregistermii_phy_flowstatussmsc_ifmedia_upddisk_mapselwakeupumct_set_baudrateffs_reloaddefault_chip_unmapdb_set_watchpointsem_initialize_transmit_unitfill_kproccnwritert2661_reset_tx_ringumass_bbb_get_max_lunin_ouraddrpolloutdb_show_panic_cmdehci_device_bulk_doneuipc_usrreqnd6_na_inputdb_next_free_watchpointvflush_vnodewsmouse_activate_bwi_rf_lo_update_11gaes_key_unwrapem_media_changerip6_usrreqin6mask96colddb_clear_watchpointsunp_scansbappendaddrbufqs_mtxbpf_maxbufsizeextract_entropyufs_islockedusb_detach_wakeupffs_unmountffs_vopsdofutimenssys_pwriteisohashtblwihap_shutdownuvmspace_allocrevarpinputbufq_nscan_peekcd_pausecompresshashinitttstartumass_setup_transferciphy_statuswdwriteipsec_keep_invalidpciide_channel_dma_setupuao_detach_lockedpci_devinfoumct_set_lcrieee80211_parse_rsn_akmrt2661_newstatesdopentcp_tracemii_phy_resetip_getmoptionsuhci_hubd_piixin6mask32__moddi3disk_countohci_confdpmap_page_protectdead_openscsi_detach_lunsr_ioctl_inqkue_setwordpci_vga_countdb_list_watchpointsuserconf_attrwdc_kill_pendingbmtphymatchicmp6_redirect_outputroute_cbsys_futimensexphy_cdreadepcpuset_init_cpuscsi_init_inquirylxtphy_resetuaddr_pivot_removetcp_slowtimoieee80211_std_rateset_11bre_setup_intramphy_cdcd_play_msfpmap_remove_pvtcp_newtcpcbsbchecklowmemswapmountffs_mapsearchsys_fhstatfssmsc_activateelf32_load_filesys_getpeernamert2860_alloc_rx_ringrt2560_prio_intri80321_bs_subregionehci_device_intr_closeehci_intrieee80211_get_txkeydb_taken_bkptdb_eqnamescsi_strvistcp_set_iss_tsmbpfwritedoingcachesys_getrusagepdc205xx_do_resetauth_hash_hmac_sha2_256_128aue_reset_pegasus_IIuvm_map_addr_RB_MINMAXcryptoioctlbufq_destroyusbd_get_cdescnd6_prunert2560_set_chancomconscflagm_getbwi_bbp_power_offffs_truncateuhidevprintmii_attachuvscom_cabwi_rf_workaroundttylclosecmd680_chip_mapwdc_svwsata_vtblpool_allocator_allocsiop_cmd_getwdc_default_read_reghidms_inputin6_ifremloopchar_typeohci_free_sitdusbctlprintvn_closeworkq_createuftdi_readudav_csr_writeuhid_do_readin6_createmkludgedoclusterwriteusbd_close_pipeusbd_deactivateffs_writeieee80211_wep_set_keybremfreefilt_sowdetachnd6_initip6_maxfragslimfreedoutimensatdb_show_regsuhci_reset__wdccommand_intrrt2661_startaes_ctr_zerokeyuvm_km_free_wakeuprootvnodeehci_initifmedia_ioctlpmap_pmap_ctoruserconf_modifywi_usb_rxeof__one_cmpldi2cpufunc_nullopcd9660_ihashgetumct_camii_phy_detachatu_media_changeumsm_huawei_changemodewskbd_add_mux__muldi3umct_cddb_qualify_ambiguous_namesuhidev_caurl_lock_miiip_mtudisc_timeoutrandomopenin6addr_linklocal_allnodesamphy_cabufinitubsa_closebootconfigscsi_quirk_patternsuserconf_lineslimit0rt_if_trackciphymatchuvm_md_constraintsif_attach_commonE_abs_targ0_Useduniqdosnamedb_recoverinflateSetDictionarypfxrtr_lookupext2fs_mknodvttoif_tabdb_delete_cmdbgetvppgrp_poolsr_concat_assemblesmsc_ioctlsd_cmd_rw12ucomstartreaduvm_pmr_addr_RB_INSERT_COLORucred_poolxscale_cache_purgeD_rngcpufunc_ifsrip_insertoptionsdes3_setkeyarp_maxtriespmap_uareacd9660_bmapsr_raidp_wu_doneaue_eeprom_getwordukbd_cnbellphtree_RB_INSERTrt2661_initdcphy_funcscom_obio_attachufs_dirbadentrybwi_rf_init_bcm2050bwi_get_firmwarelogioctlicsphy_funcsubsa_databits_bus_dmamap_load_uiogeneric_bs_wr_1strlenrt2661_intrdb_machine_initsensor_task_workuhci_cdconfig_suspendieee80211_parse_rsn_cipherkue_activatepool_page_freewsmouse_inputwdactivatecopystrsched_nmigrationswdc_do_resetiftxlistwdog_ctl_cb_argsys_pipert2661_free_tx_ringural_setup_tx_descusb_detach_waitarm_pdcache_waysarp_rtrequesthw_vendorbwi_mac_testieee80211_encryptxscale_setup_minidataext2fs_reload_vnodeelf32_check_brandwi_cor_resetudp_initieee80211_recv_4way_msg3i80321_pci_conf_sizeproc_trampolinesys_rmdirem_attachcd9660_vfsopscpuset_copyem_get_bus_infobrgphy_5709s_funcsspec_accesssocantsendmoreproc_zapusb_rem_taskpte_l2_l_cache_masksiop_sdtr_msgcdactivateuvm_vsunlockether_inputlockstatus_splraisequotaoffbwi_phy_init_11b_rev4coredump_note_elf32fs_posix_sysctlif_slowtimouhci_root_ctrl_abortrt2860_setup_beaconsmsc_tickudbtablewi_setdefwdcattachufs_printem_rar_setuaddr_lin_createfatentrywi_update_statsAES_CMAC_Updatesiop_startbwi_pci_devicesusbd_printBCDsys_statrt2661_txtimeukbd_apple_mungein_baddynamicieee80211_keyrunhotplugopenlineswmsdosfs_symlinksys_symlinkicmp6_sysctlclfreeconfig_found_smem_check_phy_reset_blockuhidread_filtopsusbd_interface2endpoint_descriptorfdreleasedb_line_at_pcehci_disownuvm_swapout_threadsural_bbp_writeknote_attachmax_keylenrt2860_ioctlieee80211_tkip_decrypt__assertif_congestion_cleardb_put_valuend6_dad_ns_outputin6_prefixlen2maskuvm_pmemrange_use_insertudp6_outputieee80211_prfcn_devvpcom_activatewi_get_debugmaxfilesupl_devsuvm_pagecmpuvm_pageactivatein6_addr2scopeidgf_mapdma_alloc_bus_dmamap_load_rawffs_mountrootrd_cduplcom_paramrrw_statusuvm_map_pageable_allsleep_finishehci_device_isoc_closeipqmsdosfs_strategycd9660_vopstimeout_delem_ioctlural_media_changem_cltickuhci_alloc_stdrt2661_load_microcodeieee80211_chan2modeif_delgroupspec_strategybwi_rf_initiic_cauvm_pglistfreebwi_tmplt_write_4usbopenums_attachext2fs_readsoo_statwskbd_cnpollckue_newbufuvm_map_isavailrusage_pooldisk_detachstrchrubsa_methodshid_clear_localbufq_disksort_createehci_check_itd_intrscsi_sizescsi_plug_poolrgephy_capci_mapreg_infouvm_pmemrange_use_cmpaes_xts_encryptrt2661_free_rx_ringuvscom_cduvm_pmr_size_RB_INSERT_COLORdb_deleteauth_hash_gmac_aes_256crypto_driversiftovt_tabsysctl_int_lowertcp_backoffworkq_task_poolsys_chrootehci_odevdubsa_cdieee80211_rssadapt_lower_rateumodem_dtrsr_crypto_wu_getehci_device_clear_toggleuhci_portresetrt2860_attachicmp6_redirtimeoutenc_xform_dessoisconnectingarc4random_bufpci_subclass_processorsr_wu_freeehci_check_qh_intraobj_pageruvn_iogeneric_armv4_bs_w_2MD5Transformmld6_inputgeneric_armv4_bs_sr_2em_set_eee_pchlanrgephy_mii_phy_autouvm_objunwireieee80211_rx_ba_timeoutbpf_d_listsr_wu_allocuhci_root_intr_donesyn_cache_cleanupip_pcboptsfc_purge__data_startieee80211_eapol_key_encryptifmedia_delete_instancefilt_timerattachE_ldsa_abs_data_Usedurl_caenc_xform_aes_gcmbwi_mac_stoprt2860_txrx_enableucom_breakpdc205xx_pci_intruvm_mapent_allocudav_miibus_writeregacphymatchicmp6statdb_single_stepgeneric_bs_w_4inflateEndsr_set_vol_statewsevent_pollieee80211_pwrsavesys_profilvmcmd_map_pagedvnciphy_servicein6_pcbhashlookupbpf_detachdVOP_UNLOCKpmap_uncache_pagesingle_thread_setehci_root_ctrl_abortsyn_cache_initcd9660_wchar2charieee80211_find_txnodeip_ecn_egressether_ipmulticast_maxsr_raid6_createohci_checkrevbwi_dma_txstats_freeuvm_init_limitsukphy_cdentropy_input_rotatesii3114_dmacmd_writein_pcbconnectem_free_transmit_structurespciide_dmacmd_writeieee80211_add_igtk_kdeVOP_POLLVOP_IOCTLrt2860_node_allocstatvarsafepriluphy_cduhidev_ioctlwdc_default_read_raw_multi_4ip6_copyexthdruao_swap_offmachinebwi_newbufwi_cmd_ioVOP_CLOSEbwi_reset_rx_ring32uvm_anallocin_pcbdisconnectuvm_vnp_terminatewi_usb_rxfrmbwi_init_txstats64sys_getpiduaddr_rnd_functionsipmultipathunp_dropuvm_map_advicetcp_mtudisctimeout_startupcue_matchrt2860_eeprom_read_2fintek_read_regrn_addroutesdactivatefilt_msdosfsdetachdb_print_sadb_elf_sym_numargsural_detachdb_trapperukbd_cnpollcdoreadlinkatdvd_read_manufactundstackconfig_activate_childrenip6_check_rh0hdrieee80211_input_printdomkdiratem_allocate_transmit_structuresnforce_chip_mapem_mc_addr_list_updateremrunqueueatu_initial_configusb_fill_udf_tasksoo_closesiop_handle_resetumodem_rtstcp_recvspaceuvm_meterumodem_intruhidev_maxrepidpmap_needs_pte_synctcp_ackdrop_ppslimuhci_ifcdsii3114_write_regehci_device_ctrl_donemaxthreadnd6_lookupieee80211_cache_sizeurl_openpipesukbd_countrylayoutbwi_led_durationsys_getppidsr_raid_request_sensescsi_ioh_pendingmii_anaruaddr_rnd_selectVOP_READDIRdomainsrc4_skipsys___sysctlsd_cmd_rw6arm32_dma_range_intersectin4_cksumextent_alloc_subregiondb_putcharrt2661_node_allocieee80211_recv_sa_query_respneedbufferusbd_do_request_asyncin6_ifattachieee80211_get_addba_reqtcp_rst_ppslim_lasticsphy_cabs_notimpl_bs_rr_4wsmouse_srcopsohci_root_intr_doneiq80321_thecus_irq_mapip6_multipathusbd_get_device_descriptorcd9660_initumass_fixup_yedataiicprobeipsec_soft_bytesmichael_initnselcollemul_elf32usbd_open_pipeohci_softintrmsdosfs_lookupspec_pathconfmountroothook_listhook_establishem_copper_link_autonegbrgphy_copper_statustcptv_keep_initsys_chdirdb_unread_tokenext2fs_diremptyuserconf_cntdcphy_casr_crypto_wu_putE_abs_msgin_Useduvscom_methodsext2fs_inode_freedb_find_variablescsi_io_get_donexscale_cache_clean_sizebuf_objectucom_activateip6_rr_prunejmicron_setup_channelusbd_desc_iter_initsbcompressiic_smbus_receive_bytepmap_free_l1nd6_outputSHA512Lastcdevsw_lookuplogsoftcsys_adjtimerijndael_set_key_enc_onlyohci_device_clear_togglesr_ccb_allocwdstartwsmuxreadamap_splitrefspec_open_clonewskbd_do_opensd_thin_pagescryptof_kqfilternclruheadscsi_move_doneural_next_scani80321intc_inituvm_aio_biodonern_initheadusbd_get_descuvm_pmr_printvop_generic_unlockuvmspace_shareieee80211_node_leave_htrt_timer_addentropy_poolpci_get_capabilityieee80211_print_essidroute_usrreqdeextendspec_vopsem_gate_hw_phy_config_ich8lanieee80211_wep_encryptsr_raid6_openingsem_receive_checksumieee80211_recv_deauthsched_init_cpure_config_imtypetcp_dropicmpstatcom_irq_overrideudpctl_varsuvmpd_scansys_getrtablem_prependsoftraid_casmsc_resetinflateInit2_cd9660_pathconfin_pcbrehashpool_walksyncer_delaynore_resetre_tickin_arpinputpmodehci_root_intr_transferufs_accessin6_embedscopeif_alloc_sadlphpoolunix2winfnmsleeppiix_setup_idetim_drvsreassignbufuhci_confdsiop_minphysip_freemoptionssr_meta_rwums_matchsohasoutofbandddb_initieee80211_release_nodesch_setup_channelbs_notimpl_bs_c_2nd6_dad_duplicated_bus_dmamap_unloadieee80211_free_allnodesmsdosfs_fhtovppte_l1_s_coherentbs_notimpl_bs_wr_4maxvnodesether_crc32_besiop_setuptablesinflateBackEndieee80211_add_ssidcpu_reset_addresspgfindatu_rx_list_initobio_attachsoftint_pendingtcp_ackdrop_ppslim_lastloadfirmwareswcr_compdecbwi_mac_lateattachral_pci_devicesip4_inputtcp_inputsysctl_dumpentrydkcksumuaddr_free_rbtree_RB_INSERTnd6_gctimerieee80211_ccmp_decrypturl_csr_write_2iptimerip_inputwi_set_txpowernd6_setmtuaxe_ifmedia_updwdc_ata_ctrl_intrdb_last_non_spacemii_detachusbd_get_endpoint_descriptor_tr_tallyudp_ctlinputudav_rx_list_initpool_sethardlimitpci_subclass_prehistoricip_freefvfs_lookupdb_show_cmdswdc_default_write_regrlphy_statusudbhashsizeicmp6_mtudisc_updatesun_nonamekmeminitnd6_ns_inputdeflateEnddevice_refehci_device_ctrl_abortffs_syncrd_root_imageuvm_map_submapsr_hotplug_callbackscnioctlrt2560_startufs_vinitsys___tforksr_ccb_getehci_noopbwi_mac_fw_load_ivpool_primedevid_allocpgrphashtbldoppollrt2860_read_eepromifmedia_matchget_crc_tablestatclocksiop_ppr_msgaue_activatert2560_tx_mgtwi_read_data_usbdvd_read_physicalrw_enter_writeuserconf_argbufatu_media_statusMD5Update_intm_tag_copyehci_idoneinflate_tablesiop_pci_attach_commonpci_io_finddb_value_of_namert2860_free_rx_ringpmap_l2ptp_ctordata_abort_entryhid_get_itemrt_xaddrsmsdosfs_getattrdb_find_breakpointip6_maxifdefroutersm_devgetwritedisklabelmsdosfs_printkernel_pmap_storeem_write_eepromin6_ifattach_loopbackstartprofclockohci_device_isoc_enternsphymatchupl_ioctlundefinedinstruction_bouncesys_getresgidprocinituaddr_free_rbtree_RB_PREVeephy_initatu_switch_radiomsdosfs_readdirdead_ebadfbrgphy_attachusbd_interface_countobio_cawddetachsoo_ioctlswap_officmp_redirect_timeoutforkstatwi_card_identaue_miibus_writeregi80321_pci_conf_readieee80211_recv_eapol_key_reqicsphy_servicenull_setkeyrt2860_resumewi_send_packetigmp_sysctlin6mask64db_lbuf_startohci_rhsc_ableuipaq_activatesoftclockre_gmii_readregieee80211_node_freetc_initupdate_modifierreaddir_with_callbackffs1_compat_writeieee80211_amsdu_decapdb_breakpoints_insertedpdc203xx_dma_startblf_decryptswdevtdisk_lockuhci_initbwi_rf_gain_max_reachedarc4random_uniformsbwaithotplug_device_attachufs_reclaimkv_intrsafeem_access_phy_wakeup_reg_bmscsi_xsh_set_tr_alignsr_meta_opt_handlerrt2560_alloc_rx_ringsdwriteohci_device_intr_startxscale_minidata_clean_addrwsmouse_cafilt_logreadsysctl_rdquadbwi_mac_fw_inituvm_vnp_setsizevmcmdset_extendsr_sensors_refreshural_cadefault_product_descaes_key_wrap_set_key_wrap_onlyip6_use_deprecatedehci_softintruftdi_paramuserconf_hist_intextent_alloc_regionsys_mknodbwi_mac_config_pspmap_proc_iflushext2fs_mountfskill_vmcmdsuhci_device_ctrl_closeuhid_attachbwi_rf_off_11bgufs_mknodpciide_phison_productssbinsertoobin_lifaddr_ioctlknotelf_advlockpffinddomaineephy_resetwsmux_do_openfreepci_device_foreachricohrtc_setcaldorenameatwi_ioctlrt3090_freqsffs_hashallocswstrategyuserconf_pnumehci_allocxbwi_plcp2ratescsibusprintnamecache_rb_cache_RB_NEXTehci_root_intr_methodssys_getpgrpuplcom_detachuftdi_breakukbd_ioctliicprobewsonewconndb_fetch_regufs_direnterrt2560_set_basicratesudav_csr_write1uhid_detachgeneric_armv4_bs_c_2pffindprotocom_obio_caudav_watchdoguvm_pagealloctcp_saveti6wdctimeoutHMAC_SHA256_Updatenchrdevfrag6_freefundefinedinstructionuvm_pmr_use_incaue_cdrt2860_switch_chanre_pci_devicesaf2rtafidxnamecache_rb_cache_RB_INSERT_COLORcoredump_unmapnatsemi_pci_intruvm_map_vmspace_updatepciide_chansetupqsphy_ca