ELFa( 4SL4 (   X#X##DD4(4(4SL4l4lsۣe0/L0l0l$$ / /;0&00Qd;0 2 @00Q8$/ // @ P`D  B00 R Р -L⏥ 04l&s4lmain() returneds   ),@@(TQ 0/vl$s -LM  0 $ 0 $ -LM0  T  T p-LMH$,$HP0`@ 0x -LM0(  -LM0(  -_ LM" 0 -LM4\ ,00,0 200b104 0 ,00 200b10> p-LM0PS P ,  4 ` ,  0P,00,0xx 0 $Px@0D PT0T0S , , -LM0P@p8`  R   0@ 0 d -LM0P@p8`  R   0 @ 0 dMЍ -LM_Œ @x`0 P  'H0!@ 0',0 0` 0 0' M-LM0'XX @X0 0 %X 0  ( "('$' ,  pPP( 0"(X )%( 0 0 0 0'(h@(K 0-_0LM2@P 0@ 0'8@-0@ M 0S  4000$ 4 @4Ѝ@ -LM40S @440S -LM 0  -L M40S  3 lH0 ,P- K 0 Kh-(@@ p-LM@`P3PUOKp3e H0 P-00 h0 \8-3 @-89-3  : --<@`@At@@L@ -QLM@-0 -蘿@@ -LMPT4p`V$ 4! ,0 t0 a-^-[-,0 000,  ,  0hxPS@0D PT,0 0,0eAA@Ŀ@п@@@ 0-LM0P @ ,00,0 R 0$ 0 00  0 8,00,0 R$ 0 0 00  0 @8  88hLpMЍLp -LM@0  0;0hh$ꘔp -LM` @c;0 M Ѝ%ꘔp -LM4PSp `00  08#8<8#8000 08#8@08#803 08#8 08#80  0  !q4S0=0Sh&K^4S 08#8 00L$H@0@@000 31C 0 -1L?rcMWP`S mV @ 0DPT0`T0d  D0PT0C4Q -LàL0L0ϠM@blpP30 0S PVd00P0,0 00P 03Q -LM @p`R0 0 PP 00 0 0008#808#80\4SX 03g4   -LM@pX00S20W6  00` 00P00Zpd3 00X3  #0W  -LM0pS0@00`% 000PU00S`U \*+    8 +U ++hDr@A$@0@ -LM8@Q0z2>0 p-LM8P@@`4 00 00S > S 0 x R  B  h* 000 P*Xx 0 00 *<@@t@ 0-LM@LP< 0( 0( 8h' p-LM@`! PUP00SOXP ?dp  000PS x 0U 0 0 0P 0UPx@x -LM0PS 0S" 00 @ = p`Z8:Xo`Z6 @ 3S `V N0@ C0TTPPQ @Lf@ %00000@TP303N6P060 0 308#83 R 00  ? @00hhD p-LM@: P`dU  000PY YR`xx 0-LMP@P 8 dH@ @0XP' 0H@ 0K 8' -LM0` Pp @20S3  0.P.0  |0*0,0K0,0 Kh ] KhIQ0S L08#808#80KhC = 0P00 0S  0P3g4 Kh -LM0`10#P8p@P@ 00 0000  0 0, |0| 004 P`0  @0@  090   < @ -L$M0PSp 0S` KDK  _PS 03K 3[8#808#83K0` P`h3[8#808#83K 3[8#8<8#83K0@0 8 DKC0K@K?K>@K04K@0<0K=0KmP00  R4P  #0 4 Ԏ`D0[S^0D0K ;#P4 ` 0 3[8#8- 3[@ ; [00 0  C0[@ [?[>[;[0 4[0 4 $`P 3[ 00<MQ Ѝ0 ЍMQ -LM⤓08 ,0 pP00`0S4 00g R@0 ŕ0őURK&@3R  @ 0S4\ TH, 0R(K0  0 0 0S0 000S00Ņ0 @0 000  p pR000P0B"0 00000   ,  R00 0B$`000 R000ŕ0Ņ@000000 1 eP 40Sf@DtHQ 0@08#80 00 @~0S4 00 0 S1 00 @ 50T=@T*6 @0S4 000S& 00~ v 60Ts@T*v0OK000 A,]P000>x0   PXiL0@ P0 0 0   0lPD ~> p-LM@P04`Ke@(x -2LM PRl2   ``0KST2`0 60 S<2004 plPRd0S| 3>1 :`@ 000S3033 T] 3dp0p|14 P=303@To3 `3`V㏏H0"S3R1  K0 0pK ]3 0000K00K3 f @4  0/@K.K, \#t003 P3,00,0PWlPD  hDr M Ѝ⇽ 0-LM|P@T  㱽 P00 K0H 0@`@ , $0 00D@p Lpl p-0QLM@`  `嚓KpR P 0P ,V p-0QLM@`  `孓KpR P P0\V p-0QLM@`  `xKpR P P0XV p-0QLM@`  `,KpR P 0P (V0@- @@  P M@   0 0< 4("4!̃,<,$,W0U VTЍ0-  00  0M0 0 <4("4!  < $ W0U VTЍ0@- @@P  N  M    0 00@ 0 0 0< 4("4!̃,<,$,W0U VTЍ0A-M0P pK Q,@ 0@0ll 0$ (, <4!4"<0cT$0 0!$` 0@0ll 0$ (<0cT$0 0 0 $@ 10ll 0$ (, <4!4"(00c0c$0Ѝ10ll $0 ( p-LM @0P0  00!010!00?@0p?<000 A40 P!0p20A 0?A0S 0' 0! <4("4! < $ +0) *(@! 0 T!0#40 TW(K0!0R0>0U;0U8! P 0 0S0S40@ P"0!B20T1 0U>0G0D!010?0p?<0!0 400000p40Ġ0U0V0, 0TW0020!0100?<0!0 000Sf4Ib0 ! (0 ! 0~> -LM p0@ 05 $P i"0$ , P0 * 0, 0 (0 $ @ 00 10P@ T`$00  0(0 00 $0` 00c0 " $;#;c 0 $ @ 0@ -LM`0 R @p  x"0 ! 0W0U V T$K0PS  "0 (0 0 0^W0UT0UQ< 0RP \ S 0S]0A@0!0?30P0200 >0!0?<0040!000P000J! 0 T!0#4 0T!0 T 0|P!0S  P 0H!0 (00g ~!z@@~>@$@l@ -LMP0 RpẀ` @H 0S0800 0300#0! < $ +0) *(0! 0 T@00 @@ ""  0! <4("4! 0 000 # 0S/000 0300P 0! <4("4! < $ +0) *(0! 0 T0800 S0 0 00 0 p 0 0! 0W 0U V T0 000 # 0!000S0  x@ 0-LM0@ $0P0 Td0 T8 p-LM@P40B $C $`P Uv x0R $0N $ PR R @R [ xtV 0N TxDJ  00N Tx꠆@@T@0@x@ p-LM0@ $00 TPFx0U 0 $PxD 0@P T`$0 x@ -LMp @0T 0T@ 0T 0T@ 0T 0T@9 0T@ 0T@A 0TN 0T@O 0TH 0TP0@00 T%020J T0 0!0; T0;W 0O $0PM T0 <d@ 00O TM 0T@0O T0 4 EU0R $   0 S0C1 00KY0R $  M T0  0P@" T`$ 00" 0  0@PG T`$0G 0  0T0 T0f -LM0p 0 00 H QF 0㊁8 0 000 < 0lppl 0P`$@(,(0 c 0..p .̠p0 0((< 4("4! l0.̠..l l j!l(KoU(K芁 0p llp0@P0 ,< $4.4,$  0 $  :4PP  K PB?P0`  0 PP! `:PP 1, : !0` , 0~>~>@,@@`@@ -LM04 (@T ,0  c =K -LM0) (@T : K -LM0    1 <4("4! 10!, -LM0@   <,$!$.!0\ 0-LM 80"(,#@(P 80,#(8h -LMQ0p @Rb8` 0 0S[:01!$C0A0bA !!\L|!h!!A' A10C0  101 . 0$N)` .0  !< 4("4!,Q 0$\!! 1! a 100 Q0 $K0 $Km$0!00|؄> p-LM1@`$  8Q 01 xhɲ -LM04p@0aA@ 㹲00 P0U Sd 480@P8 1080 08噲1Q0C1 -LMP@ 㿲pP`( @0 0  B0 P` ,0K0 0 *,P 1 ^`$K0 0 , 04P 0 P 1 81 0 -LM1! 0SP@# *AT R0001 0 K MpP 0  a .0 < 4("4!, ! 0A \!0  ! 1/< 4A!4",/0!1 0 101@! 0!080|00 1 !?\ꨄ>pD -LM0p`Q@4P @T^  48 1 40! T 1@01P R 0S 000Q0  PU@0i@ -LMp4`0A张TP 1@ R (K ┱P 0 < ㆱP0   0P@@0<80P8  \ 2  0Q0 0 0!ZP@@(@ -LM0 @p`10! P0UQ@,PPK G/P$ 0 @ -L$M` P @ 0ᰱP CP0  P;P@ 0  00s0 00  0 P@ T0@ # 0 4 0 0 0`  40 0P O  4,3Cp p0 0$ 0"0 0 0! U0V0WT0<<0 (48 @0 (  4Z [XY00@! 0?<=0>00 <4("4!  (  4B C@A00! 0GDE0F00 <4("4!   ( 4HJ KI00 <4("4!  (  4R SPQ00! 0ge0f0d0404 < 4("4!̃, ,,4kj_ \ ] ^ i0h0, <4("4! , < $ a bc0`4 <4("4!@0.̠.$.T  0$0 436("$ 4$#  4  (0 0<0 < 38("$$# ( 4 0 08 "4 8 "438("$$# ( 4 1!0@ "8 @ "838("$$#  4 ( ! 10# < 4("4 ! 10...̠ 0" ! 1.< 4!4" 10...̠ 0h" ! 1/< 4!4" 10...̠ 0 "< 4("4! 10 ...̠0p! 0Q1R1SP ]p0d0 d 00 0 0 d100 S@Qp\10\!\(Ko, <4< ("48 $" @ s   (Koڮ(Ko tPT@@GR J0!0 PU@@DZ(wh>DDDD`@@@@4@ 0-LMP@B $ d10d!@dA8h 0-LMP1`AT R000d1 0  $ r8 -L M` TA(P0T1040 hQ00 U  0 10! p0S PU00SpQ000 0 $0S (00 1S X 1SX $0,S 'Z ʊ0(@'Z@fP(Z X 00 0 00< 4("4!< 0Z\S0@ 1Y>0 1Y>0 ,$!$#< \10 I L$S @ < 4("4!, !10\h @ 0Z? 02|R@ 1 Y>!0@\ T0  @Dh P2@|P".02@|!.@2|0 S0Z/C1!PZ/B1! R0001 0 .Pg?P1pPA TP 80P80 IpP0) (\ 00: 1>, \K  @0  !< 4("4!,10\ " @LXP @0  !< 4("4!,10\" @>dD̅>ԅ>(@ -LM8 lx880%40KR00 4 :8Q1 10pW# 0`00P0 @T 000@0@ 0妱 J0 `PR00SZ0S80% R8 hAT$00 0P00  @0@ 0y @PU08 l10 0P000@0@ 0d 80pAT$00 0P00  @0@ 0Oh@PU08 t10 0P000@0@ 0:4@T, (0  0(0P( 0B0 %$ $00CS00$0$00$(  R00000  0@ _U(K008000!  080%e0@D@l@@@@ p-LM@`T0 <0bP(00(0xh@ -L,M0` $PD D0SM 0 ,X\ 0 ,Q::Q\:\ 0 < 8 4 p @l3 Z0B (0P $@  Wm 8傰 (u(K!0 T0S 0CTTZ >ΟW@ 0 @@@@Gd.`#43p :W  8 0 <0 , 0 0< 14 0@ 0 $<0@  @A , , 1@c , L W5 0) !0 "$#(, <4!4",  @LgVd Fa B0t033 W  0 $ 0\04 $@0@ R R , `@10t03%5 W 0$080 ( 0  0!"4# 8<#L8TB@ 1p0, \0 A 0 , \WC! 0"4#8,o@  ` P> T< Z =0@P, \`,0@, *7T( 0CT  0T>04 $P5 $06 p$10!Rh 10P AT 0G?, \gRM H` 0 ,@, , 1 c@0W 0$08 ( ?b@6T 0T05 $0<0 1p0, \5T |0T0, , !b8Q0(0U~|` R\ 0B< 4("4!̃B,<,$,O0M NL 1=, \U05 $<q@)0 $P` #P 8P 席0h\ 00 ..ZVd1t!l \0`apahaXaa嘱d0@`003Ta[T @K}~D00 .Kptc ,c Dhf7 -T0LM   80C 8(R2 d #8XDp$( -T0LM   80C 8(R4 h #8XDp$( -@ LM8000\0  (@ ,p$(@-9;90M9 0 0@0@Ѝ0 0@0@ -LMA0P` ` 00K "[P1RC R $K3[mCX#X8`+p@  1 R0C8 p (K"[p0 R2K"[0X00@ 0   00   *0Kt t0 00@0@0[-s=@  (0x'p$,D$$ 0-MLM@P90000& 1 R+ 1 t!0Sd1 KX!0KL1AKA AP(1K R000K003X000 K  0C,K AK=A AP K00C S񟗼H 8 (  000000000000\Rx'D -LM00)0 0 bx' 0M 0  Ѝb p-0LM @+P-` Kp0 00> `P0 R0C  (P01Ł 0PP9 Kp+r 00a=C4`#hh 0` 0S 40< `*  `0:0Dx'8T'@ p-0LM P@x0`   000h媨2  8R` ^P00 S 0pPV@xD##ps# -LM@1P H0 `p 1 R 0 0< S\  SN  SL  SPS000H1  R 4 4 4 4 И ( 1 9 0 R 0 0 40| 0 R0 R S 0 p0 `0 P0 H0  0 0 00R^h$\x'D -81LM` Bp R l t | 0GS \ D d  0 0JP @ P l0l pᲀ\0 R    R\^ -L`M8@KP @03K/P3#K 8#c[Qr Qn 0S3Q  ?2 3K2#K 3["[d0 3[h l0  ?2 ㌂#K3K0[[3 1C 0"Pr0!2#[0<P#KKK 7 Py Ps r2 ">?DFcà.L !2c N"10,ϠldP!PhP0PlPc 0` P@ (K T1   D1`  T!T1QQ^@K&l?05K015K P-Z0[@S*X0[.S'U0[-S$R0[S!Y0[W[#!BV[ S[3 A 1C "T[05A1!1 00 `p[#[2[Dx'>h$ l$@hQ@@v'N$@@ 0-LMP;p0  L0@D0!0@ 9I=9K0DTx' -LM9@@, 000 000D 0-LM \3@RP H3R $<3R Q03R 20RB R3 80CR "2Rg -2Rv 0R- 8hV0CRt 72RD >0R@2@ 0C 8h30CRI l2Ry 0R X2@@80CR0 0R( 8? R2 8h,0CR> 0R1@@80CR 0R1@@81@@8 1 81@@81@@8|1@@8@0 C> ?>841@@8$1 8h1@@8 1 8 8h0@@84D >8 "8h 0 8R |80 8 # C^\`nhd#VZbfRj#X#d@ -ML M1 4 p 400CSp(KBKII4 D X4T `0S` @ T =mpP@VP9 -LFMA0S, T x!000hh1 R\10 S<0 -LTM5 0 6 -1S" V9pP% p`KD<4K 0CR@- 4e KP&6 #31S 0q BW 0S*(K (u 1 0RX!\!  10C1 RH 3RE RC 3S@ 14K3 R3 RZM,@ 0SB3D 0 D B0000 . LP  36;#60 0P ^K ;20St0 { tQ2 R 0 RPXK ;0x0 BK ;<K {;0H"0C4K#KK x0 B("(S04"43K@BK0 6[Z94K0 6K_;Z.K6 Z;ZM ,@ 0 B2$[4[Q04KD 0 D B0000 < { ZM,@ Q0 B2Dx 0 0 0C0D 0 ^6[T N0CT T>Tx >T*t 0pq\ >Te !0CT 0T  t0p0&\ 4X0 \0S  | 8|\  1. 0:0sd(K=T !=Tv =T5 =ThP 4X\ p 6@ | |Ah=T` '0CT 0ThПP0= R   t \ ,gP4\ 0 S <R  R 0CR L= \t0\,h t t0\ `,|gP p 6@> < R: \-P ehゟPt_\ YhvP ɘt \ \+PgP\0 \U;Q= ;Q 2 Q9  Q K0\P\Pp 6 0 0t  * 0*0005K?5K T;$K RK:Q !0Q;Q :Q :Q |:Q t:Q \:Q\ L:T D:TF <:T0:T# (:T :ThPtk\ 9T:t \ 9T 0Tp 6D = S @S 9 p0&9 t \ 8 Rt 010    ,\ \0/ D9 \P\0 8R t 101xp 6 8 RA 4t8\ 0\ <08 \Po\ 0 Sk !ϗ\0 | G|t  ! f|HhePr !⸗t0!  | >fP |\ 3 Q:|7 R፝#@` ]"P | @R`K@&@6@,7@5KEK dG$K LK6 p |6 0| hP(\6 R p 62 6 R  $al6\ 0\0)   6 \Pn(6#L(@ V   6!l%0@a @ # 20C$%5p 606t0 0S/ 5 t)\ h㻝P4 R  (5\ 0\0, <5 R 05 \P\ 0S >0X0 t \ 0X 00bYt 0S\ 0 P` h0 x UY x0 `9  @l 5 ld `x0 0$30 R0S   505 %<0 S  S  7S  nS  0t B02 R B000 C B0 2 R00 l5P000t0`  ePt0 X0 t0 \ 0X 00b St 0h  Sh :0B`0 tK\ hP [t \ \!dPr\ I(2\ 0\0, <2 \@P\ t0 ͒ \/1\ 0\0, 1 \P\0 t0!h㿜Pt 1S ?\ 0t 1\ 0\.P!p 6 1 ~1 t0M@ psD@ii i5i i i iiii R81-71#%Ci8i6i(iii8i i b#A$#D gfff@BH#PDh$x't\ 10t0 "! d\ $U  a0  e 0 Rf 0 5K05K0$K RKY |P 1Rc 0RP 0CRi PB \Dp4fP1  8 0 R9 l1 5K05KM\0 s (\42 0X \ 0Y1>,0\ ꍝ@# | 4|P \ 00"0\ 0S00' 4\D .4!H2 RM\0 s (⯑0\ 02\ 0000 \ 00200\0 T 8 4\ +002Q' D0CQx >0QBt 3Q. 0Q;,3 R}\ L3  h\3 s +p3 n h3 @i `3 d X\0 J3  W 3 R 3 \81>,0/ -L@MG0 `0 (Kd 9@s6`7`05K?`KK5K ?;5K$7K05K 075K6K05K 06K05K?5K 6&5K K%K 6&5K 06K%K `6`&5K K%K 868&5K 0%K6K 00 @ @&@)3@ ]5@#P ZK@5KKFK3 0 pW T5 R L0SlU@&@3@P5@  ZK@5KFKK24 5t05K0KT6K0@&@2@4@ @ZKKFK5K2043K03K0O 26K 2 :K3 R 9 45K05K3K 3 G3PtCP! 00pK0  Pl0 3  h P]20 0C R@ d9 @0;9<RX&a2 @0Ÿ00ZK 6KKEKX2 0\06K20K5K 0x2x"5K K%K 00D2K05K?5K 00 1QK5K0HA5K 1!5K %KK01!#004 h1PL 0SI P H1H!5K 06K0%K 905K0K5K0)0 Qʀ0KK5K0DVx'R^X\Z b fb##`A#T:< n-j#<@@ ####h$*hl$! -L`M@LtPi@D'te q쁟0 ( TXA 8R  #8X PR 8  #8X PR8  #8X 8#8 XJz/ pP 0@R0 ` (  0R  ( R4 h 0X Z9 T<9  00<<L,(p$`@@ -L MP00 60  Pqa00> R6 l h R6 l 0X @R6 l 0X 60 Z@P R6 l (T0P R6 l ((0P(K,(p$4xV -L4M`P? QC D3P 83QX Fd0CQd  80P/ @sR8 p 0X R8 p 0X\ RL8 p 0g2  0lP (K0SD22`K0K2K03K(2Q: 0Q0SX2K?3K2`K03K00C SK 8 8 8 8 l 0!03K0#K2`K2K 10S: x10S. S08#[2`KK}H!XK0@20pTK&0W?D  K5K/0 P@T0 R08#P 0H3K2`K0"K3KC      h$p$,(x'!P'#((h##R p-LM`80@APP 880 R0C8 p 0fKpp$, -3LM PR@v"0 0!P$ 80P8 娂 0rR8 p (0`P 0R8 p (0S (K`0\ RL8 p 0@f0? SD 1 R 1R 1R 0R d0CR< 0RP P 0AS@` p h H H H H H H H H x (1Q% 0Q0S? 2PK3K#Kt0\ 0S80 00 000 2PK3K#KV<8# h$x'p$,( #RP'(( -LPME0 P5 0Rx5 RN &`P ; '1 &0 0@0@(KDp0p P <C42 D@F Q000P@ @|P  vT4 RH4Q G&Dp0KP7[p6[t0 &`P ; &1 t0 00pC bp b3 R 7[* RV  RT  RR $[Qy0H# 00. Px$3 P  6[  2 R 2 RpK IP dS z%T0 0S Sk S2< @>h<@0 fPc%=  A$[P& BK -<K - .K - 0  0D P 0 0@0@%.%괤[>0P 7[T"% pK-0 <0< P r%9 <00 0pK AM0@ 0$p GeP 9 N%00 @0@B= G0 ( =#Kx'P\'R##@@@$@x@@ -43LM  9sc @SR2 d 0X R4 h 2X謢b r0R2 d X 0R0 ` ( RP4 h D2Xsc 0R" D ( R4 h @0X1 Rh &4  1 R0C4 h :Xdd1 R0C2 d T1XU 1S?1 R0C4 h 0X0 R0C4 h 0Xu R4 h 0X R4 h 0X~0FVDp$,(p< -L$M8888H}/` `P, 8 $K4K JKpP , 0R(K豯 FKK,: jh @,70P9$ t! 0|p1( |! ` " P DD7D'p0C 0'00(7 ' <07 pp0d '006 &6pp ?$K3K@K0P66#[   6Q Q) Q +>3K ,6$K P3[ST&000  , 8T+$6:@K3K 03K5 P5  [^5ࠃv5  P J @%5 0l 00 @e0y_0@  'm$000Th$0f10S4 4@ Q 44 $}.  x42Q t4Q @$0 <0,4D   @4Q $0;0,4  W3^ʎ04\`0@  03\0003@ 0|c 00  0x 0rc 0Ll0 20p 0]b 0W0[R J20Y 0H 0bC03L (0D  05: 0"/01 0(0(2(2 P0À 02 P 00 01 00 00 0 00 00 0l0 0T0c 0<0Z (0p 00g 00^ 0D 0lLx'@$@0@@D@+ XTZ\V^jhn#`h$Dl@ AL@l$'(j)P'_eNa>-0 x0M"32C0cP P 1S!0S!0SЍ~H -LM0@P` 00Mp@P 1Q;0 $> -LM@P 18 0-LMP@0@@ )00008 -LMP\`@0Sp\@0^ )00g0   -LM9(`P"x lZM,@u)T0 _ p)  l) h) qh@@ 0-SLM@ P 4+P 101 8 8h9 e8h4@ -LHMES, `Ph l0 (ھ0ᲀ0 S0 Nh0 l & l@K`pK!hK 0kPaK hK @0KaP 9\Da [0R 9 8D, 0R(KR0 Bh0 l ͆0#a[ nh #(Pp 4@P  Y:<$ @ @ 000CS                   :0 0:0<  P2: < : :P;Uq9[Z],P(2@@O0 h0 (  ( (h0hKⰀh 0h0 岠h0h0 ,2岐h0 0h0 }040K@@(0K {0 0B@(0K t0 0B@(K i0@ 0B4 K0& 8R:00:0:0< 0R:00<0ĕ:0< 0R:00<0L9 0( ,0S㶃 9  0 R  9   0S 㴓 9 x01h0q9 Hw 0lb#@`@l@@>@# @x@,'@@ -LM9(`P"x lUZM,@'T0 _ '  ' ' qh@ -LMP@ `p9?!R 9 } s!1S?!R둍4 RPP 1 9D  `10 30P8PD !1R:0O  1  0 0@0@@0!0 1Sq@p10q!9  !0p% O`P 0!pP 1<1101@@,'8@ʚ; -LMPD p`P pE 1‚32C0c0QA20`><@ ,=A?0C @300  00S 0 0=<0h 0 0P0 00@ &8 00 p)~HH&x$|$D&!,' -SLM` 0 ʴ9b(K0L 0  0A 0  V@K0KPK P0SK 0KPP 4 NpPQ 3Q> Qb 9 Z],P`&2  O[&  W& S& 0Y$ 2ᲂ $ ڬ K0 K|& _< X 02 R@ 9 =  1!Q ʴ99p @pW|1 R0S( S Y@PU 0  Q9 A 0R  R1ἐ0 1\ X@PU @@P^FD@T 9^  A㳆PP@101A q0@0,'d@@h,@D&@@@ 0-LM9]@4P %0 R 8t0-P00d0T0 qP ' x +>4 0 8hF Rx$t$|$!T@ p-LMCPID@D`C0 #DB@@0 00 R 0h00 0   R 0 0 0 @P    00C0xH&x$D& -LM9pş@`h5P, ph P5MQ4@| 0CQ 0CQ pş, 0R(K4Q :4Qpp]4 @T  0S㰐KⱯ 000@TI 0儀SE:pH $ Kq  KmL4K0 7K34K3] K#4^0Kn KK:00 m0Kn K:0 n [(0K0E0AnK:0 n [(K 0E0AnK:0 n [(0K0E0AnK  TpP OK  TpPD3 @T 0S`K@T 0`S:pF $K K3=KK:00KrTpP WpPSK SpPM 0 000EpPAЀK SpP:P PX p.=K =Tp%`K SpPPp  K3,' 0-SLM@ P 4P 8hH98Ѿ8h(@ -LM9@P0  0 mzl -LM`t2@T_ 1  [ W0 @20  ,1:100 @@X00W00S6 !@ 2 00p5 9PR X1P01 0t10  `1:100 81@@甿X00W00S0@T 1 * m 9P) z!001 P0 00  1 :1 PPi' 0wPZt$x$,'@,@MЍ -LM9)0: P04884#8 X -LM9  84 0X -LM"0@R "8p 1?0c4X \804H \9;984T ;\tgfff -LM"`0@R 840X \9;9840T \9;9t -LM7KP, ~Z 804R $[7804S $84P 0T`@p804 $Z 0S00000008 `4TV84P 0T$K(>\@@ -L4MP P0T 00 40  90 ""4 040100 40 0 T <0 2X0  L#,4L P PH 9L( D 8 X7D0aS<(\ L L$0  B L0( R\ @ < ՈL@0<0 *4 ,0Z0 0 00D0"!`70C S0A! S"<  <(\ 0P 0 0 ` }L (0 S W<TG( r\`@ 0P 00 <@(\ 0P 00 TLZ`j|T02 <"(@T0 PZ70H0 <0L$H(KP0*Sl000D 80 hd'(0  04 0 40 C80S% T4  t),0 ;0 P `70C S+a00 <(@T 0P 0 0`|< @T'212<(\ 0P 0 0 X P0H< P#DTX'\ aX'T T00/"-0?00b0 _ H @@ -QLM  Q Q T0TT 00H0Q 82 00 900)   @* p-LMP`@U 8 04< XV V Vxh804< XVxh xh @ p-LMP`f9@!;9P6=6ᔡ847 0T8@4< 0X84> 0X P 2ii@kH3S <0L$H$0H3@T@lt7S <0x$t0t7@Tx -LMHP b0HPe 0 0@0@0/"-0?0b b0H#RO <0(PC\E 0P 00 <T7(r\ 0P 00 W2@X7T#<0X7(`V L $0  B< L$H0H3 0 0@0@0 0@0@T7rW;X`';Q;0H;š (K8)4@0T 0-LM@PⰠ20" 8MЍy -LM6P+`A9 > L7p$0 1S" VPP& $020H#RH$ KbP> P@1S$ V:LpP  j1S0  BPr0CW $08L7)@04T06K 00S: BQ  10RX!\!  10C1X'`7R 6;61S V00 @0@ 00S: BP  10RX!\!  10C1 0-LM@VP)  2998hY2 20S 1)S) PJ 0-LM`'P"T0  @@RHC0<(\ P; B$0   `7\GX7LGHGK0 -L MP ; @P7 0!0 0 y<凁0xg 1 P v7(K<(\' $0 <x( \0  0t 00 < (\ 0t 00 Z x9000 0tG00@,00 ?WA0 @<(\ 0t 0 0 010<(\ 0t 0 0 0/"-0?00b94@ 0-LMP& @@P@T f7P90d98 -LMP P040 P|s d3 0)R1y01)ypy0/"-0?0Qb[ <xI( b\pO 0t 00 <(p\0p  0t 00 X=1@tw尩t9<0C9(`V x $0  x@ -LMP@p`"0R  0iSVT,!x,!,!,!,!,!,!d 884#8Xi< 0 f h j {b t@ p-QLM@ xlR 884` \PP U 804` ,`PU  x804$x@ -LM`P@៾"@1pR  @H$TUU* f U XU  νUɽU Ud 804(@ẽj 804 $804h (@804b (@@t@ -LMp0 6H804P@T`$00P dr804@PP T`$00P `804@PP T`$0P dOȀ P 804@PP T`$0P  -LMp0  804@PP T`$00P d804P $ 08#804@PP T`$0P dXʠ00尐(K -L M8pK@4P4 P T`$<<0P dݾZ*804@PP T`$00P  . K804@PP T`$0P 0"[4 X 804@PP T`$0P (K -L$M80 "Kp@ `4,+ R" ;R> ;R >3R R7  Q 0 Ru R}  R R%98 !R_ jT;R R YR } R R   ;R R9 ~  09 F0}099)2*S!02 }02 9@ P @4PK80 4$@T",:R $:8 9)`)N g9\ "0S \Q "( u `< Q)vnw>`@` 0 `@,0,P; H (K02.K0C"[9:@KR020 4PK 40[S30[S20[S10[S00[S/0[SZx  /0[ 0/0K<`7up'2 4P ,g<0p'08@ 9)`m`<u>  0 P) G<0`'"T8804S $0!0@2 SL T-!02909""("N<`7PT'2 P@ <0P@Tx 2<? 0 0 P@ @[L@Q <0T<0P$B02  S 9  R R R9 5R /:3R9 ~ R Ra R R R R 9 R R MR R~R Ry  @5Rc &Rp`<$噮>0?@D0 0@ ,,P y<>0) 0l4 4P Tf<0 )0h<$>0  0 P N<0x#8<0 0  0 P@ 8@\x@Q <0T<0t$804 ,B 804,00t Pp9" 2+1"2!1"t2P<10RA,1 R R0,1,1@"9,1!   9.  0_ 0Z1!21_@"2!1姷 0̠轙BT/  㣸 e 804@Po T`$<<0o 2 S804@P T`$0 9t "0R"k|DP@@t?8>@@(@)pptpT@x@@@@@|*@@<@h@@E! ! E!X!"!-!+!! !\ !@ p-L M8P4D ,;!8#8  +2S><8#8; 0`$0 ` 0 9" 8 <(4"4!<4 \$8 <(4"4!<4 \840D \Kp84$0 \8@4 0\$K`eP @@ѱ P$0 0 @  01$0 0 T -LMp她8 0) )0i0 00888#8#84 X)4K 084P 0T8@4 00\84 40\8@4P 0T5t98P,  04 \8t),04 \P'8P,0@04$ \P'8,04 \9^847 0T8@4@ 1\84 0T8@<4D \)98@8#84> X8L 04\"0R 84 0X⒗804@PR T`$ 0R 068@0;6?999 (K804@P \`,7 t? -LM`PʸpD00 @0@6G h@ -LMP@`p媸D1T% 0CT-  0P@4T 0T 0T0/@4T6@ @ҷ6 @ ZǷ@608#8@6 0 RP-@@ @@i 5i 6i( -LM;@@`84< 0X804> (1PP P`PpQ5 W 1S<8d!04< X804> X(%7Pp` !00" 00p -  ℱ`9  }hpd`pr`  804H \b"`  -LM@QPppU@ppW?`0OOP$ 2>AB?AsPP``0O?0@@ cAQaQ p-LM@` 0T 0TP$ U  $8P xx -LM0400 T -00LM8l02 0HD6l -00LM8l02 0 HD6l0 M8ЍHD0MЍ -1L MpQKP$0K 00`P$}0@$ T 0@`\ ڔ 0S 00 S R0Ġ T 0$ 04 000ĠdDpulpblm!|pMЍ -LM04Pp008@ `T0 T0  00G  0Td $)d0 T0@@P*P 0T 0T 0T0 T $P 0T0 T -LM0`4P 0T 0T 0T 0T 0T 0T0S0'0 Tp0 T}N@T f $  T 0pWdV}~@ $ pW G0@W}~ $0P0P@0T @@ 0-LM@ ޵04 00P T8h! -LM∠04p0  T64 Qi  $  0PT  0T  0T  0Td@T T! 0  T0Sq SPV!T!\V!U!U!V!(V!hV!V!  $ P7 P%00<<0  T  $@P90  T  $P000  TP00@0S<< 0 T !0 T  $P  0T0  T  $P00  $0`  T  $Z0P  T  $0@  TZTU000c 0} 0 S0 00  0T  $q0@  T@0  T0@ 42P ("(Ÿ0 S[00 SY QT &< " ẟPlf 1 R0  01Q000pdQ 000D<40@000 ~m  $0 r0$ 0440 0S0 呵0 @0 0 00\Q댕p@ulblm!@c!J!<_!@@8@T@p@@@@@sdDp'@ -LMP `p@ 0TG@DD0 @T0 T 0T 0T 0T0 T $i2 -LMP@pP 0`P  0@0@@ <0@` 00 ( (0p$K耕pslDpdDhDp`D 0-LMhPd0d@ @0P @0S000,0 0K0hn댕pdDpp `D@ -LM8p`W4@P t0  0@$00C S|\!|\!`\!Z!Z!Z!Z!Z!Z!Z!Z!Z!Z!0@2Ÿ 0 Ki6 @0TP 00 T0 TH40 T0 T0) 0KSpږ SpGpӌ0SY p0 Tdh $ 0Td[ $0S2 0 T0 T 0T 0T 0T 0T 0T 0T0 T $<<0 pT`Dp -LM@`pᵲ}^PU  $  0 T00 0 }^PU ۳ $   Kiر0 MЍꌕpp -LMP `vp $  $@ $ᱱ0 MЍꌕpp -LM@Ot0  0t0 -LMPPL 0RH 8p9@堀`T Q):W0  t0 os0 0040 TcT*tt ` x p0 0Rp0x <T l0  2@ 0X6l|> -LM80`S4@删  $8 0 8  $PP 0  00 zPy0  0 0  0 t0 0t0| R00H^0 0l08"20  $R  $p lP 040 @0S^ 4#0@ 1 R4  $p*  $0U :x t0 0Rt0x T<~0pP0UP0 0 0 00 TPuM5(K00 l0 200Pw 0 00  Tl000 00声l0 200^6ld5l -LM@0pPtpx0p0t0_<<0W ``U 0p`K@@0@ -LM⬑P1p ,  A4`pt0 0-/, 0R/(K|0Sʤ0 0 tH0S t00t002 000 H0S H@TP0 00 T HR #KPP @ D 0@ TTK4 00 T0lHDp> -L M#p0`0Q(@0P400 $0S T @(K0, R@pp  Rp  R*    p0p pYp# 0S $0R 0Y0! t@H"2d |@|@|0@P0C|0 8WApp0000 T0 0T0 0Si $0KS000 T0000N 0N 00$0(  0 9S0&6R l0d!20P  0 000 T@n00 T0  0TI400 T00 T0000 T 000 T00 T$0KS0!00 T00 THD\@6l -L MŸa48@0 l ሠpPP(K0 `P`2Wh T2W4 @0CW6 42W I1CWd ;1CWsP 00#3000000000 0 0 T0 00 0 0 0H1WG 0W0 @000 0 T1W 0W000 000 000000|0  @@0@@@0  @ LD 00@$P@@a0 0HD6l]t@yt ktzt lt - LMA8P4pt0`  0  l0 20 㵮t0  t0 0t0 000 T<㭨HD6l - (LM(" P8 <0 0qW 〮8P@U ʭtp5p% 0 px   <rPIi 0 R; t0  0尭@(K$ $ 0  0 0 0T 00 T $0  0tt8  0S 0q@\$4 ťt{@P t  t0S  0Nt@́t p3 0 0@>K 0-LM@PeT T$ 00C0S 8hh -LM@pKT` T``t0tP A QR` {L@0W/,080W/\h$( -LMHSHCpT 0`\ϧT 0\ƧT 0\㽧T 0\㴧T 0\㫧T 0\㢧T 0\㙧T 0\㐧T 0\㇧T 0\~0T , PPZEa夁@AT 0\f0T \]PUZT 0\RPa0T \E0T ,, Ŋ@ ȠT 0,PE\0uT 0\%T 0\T 0\T 0\  $( -LMp  à  AU0 Ƞ!H,Ƞ.P$H P= @Fm 0 @`@@ 4#T0`E]8P@ 4*T0Ph -LM@0#`P00V0ST3PF#0Pp1p#S,d!!!!(!!<#83!3yDp V #"2!~ z"v<8S @8S FV  Fkl2l" ,L2!T\ 0"N "J2!E#)D ?!!91!4#@ /!*1!%#)D VP! -\!X1!#@  ,1!#)D 1V  ~  0!#)D  f -8 <0!  -Sxh>ԋ>$(D>|>>,>d> > -2LGM2px2`p 2P AC81 , \Ÿ4!  00 PP`~G=Y tP0 P \0Ċ0@40C -1LM` 0CS 0-LM0l 60PS0CS006 8h!000 @0@8`@9MЍ0Ѝ -LMP@`pq1T* 1T2 1T  ,4P@2 ᭠X10SL1T; 0@4Tᜠ@606 0S. 6@ @@ 3በ@ 4P@<8S 6A0AS@@ j0@0O6A0ASt4@Di i i ϖ1i 9M@Ѝ0Ѝ -LM0p,0 L! 00@D   DkP 0` L!\Q 4! 4 <8S 0<1 V7 P,X 4Q QL8S, S 6&x0CP 2`B͠\1 AC0 0 PP00`U@@TSG=PU @P0@414&t0,6 0̇0640C @<7P"2`0T1 2@@B͠X P T! 0 H P1PPT@8  d  44@DO @@H$Do8a  @00@0 01@! 0PPS@!ŝ]L000娞L! 0P T  X`8,PH,,5(\ P!T1` $0` (@T 0#"B` 00`x0t Q 0 0 p-LM6`=@SP3 Kp@8S1SS V^P l2 .R{ʤ1SR VR@LP  ~ K@P lP  r Pd1  060 Q Br0C  BQ C= RZ0G@T/0S*,0 0 lP  F P  1ASq B 00S:A BT  10RX!\!  10C1 10R'|'  70C7,0 0 lP6p;6   k Q00 0@0@^6;6   V`\ -00LM`40 N TY0<4 8< "0""(0 00(@qJTP 1!0#0"B,0  (\ 00 $0  B 1 @$@4x\@ 0C 0/".000bA 0$!10p3Pj1(0\00 @ 0  00  04 8  0S #00S0 R40 C= R`0C  R L 0009;94(Ko(Kh@ \ -0 L M`0 WP P8@080   048< ""0"(ဂ0 (@T `2`"0#0"B,0 (\  $0  B 2 @$@0Q@1!/!b32Cc@1!p`0(3@jx1\P 0C  00   048,+ )' 1JpP}(8 0(80 0@0@}!0 0@0@q(8 08(l0Q40 R`0CT 0009;90(Ko.Q(K l*@\ -LIM4 , 0( ,4 4b $`00V< D1   PP ; 1 Xd(\  $0  B 0$0p 0p;P@! P,  -00.  /00D@1 048<#8@!:#:0 0G= R; Tcds0D ,0@@ ,PP0G͈  3t# 0 "0 n0m0C 0C@1G͈,1 @ -LM0qP ,p` P 0\@0 \9@   @  \0\eTl$( -LM@ #⓺[@Q \00HS X00 0R B0HSQ -LM`PJ,@Ax冔ᄔZ '\!0@818!9t!010!p10@|!0` hqQ$ 0 0(2 0"2 VG  X0u 0 D0C @<0D BD0t5 ,,!!$(d@h4@\@|@@@q>>h!p!! (!!!!ܾ!,  @ -LM0@S  # 0 30 S<0(\  $0  B 0 0$0K  -LM(R0000M 000CS!!! !!8!(!0! P P@ 7P,@ nPX@ Ѝl`0 $H0AMhSu!,!,!,!,!,!,!!!,!,!,!,!,!!,!,!,!!,!!,!,!,!,!,!,!,!,!,!,!,!!,!,!,!,!,!,!,!,!,!,!,!!,!,!,!,!,!,!,!,!,!,!,!,!,!,!,!,!,!,!,!,!,!,!,!!,!,!,!,!,!,!,!,!,!,!,!,!,!,!,!,!,!,!,!,!,!,!,!!,!,!,!,!,!,!,!,!,!,!,!!0Ѝ 0 R 0-Q QLM@P  -O  8@#OT  08#8`08#8@MjPj!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!Ѝ    -LM@8Ơ#Ȍ0 Ƞ,<.L p(8H#8""l$H"X,Ƞ.0@P`p@ J0Y Y 06 04Ƞ8,Ƞ< * 0"*#"#? ## 0Q @1 0 0 @ ("<8 #8"(T-0, I NY Ƞ ,4Y 0 ,8000P0Ba21C0aX  Q  R ,{0 0 颋.@MP!!|!t!$Ѝl@ @<@(@ @-0 02M `0^  ^J@ ^Z@ 80^  ^V@ ^d@Ѝ@@h04 -LM0pS4 10 0  0 P @0S 40(`V $04 0$00 0    0  Q8H04(\  $0  B 0$0 0,0(0(K  -LM@Q  ╳[@Q \00HS X00 0R B0HSQ(MR  Ѝ⁳Ѝ 0-LMP@8@S 8hH0 0-LMP@ TR08 R  080 0   0   B * 8h9Q -`LMeVpP ȓX0QP 0@S 0SPTP p-LMP㨓<0`Q 0@S Txh p-LM@P`0cS$ "QPP ㄓ\\ 00 0 `0  0PĒx0cSP 0-LMP, P@P 88 p-LMPN00`Q @PTxh萒 -LM0S LA(\  $0  B 0$ #80 0@T1 0S(@Q`0S  0(pW $0h 0$|Q <0 0 S@ (KoGP(K  -LM0S \A(\  $0  B 0$#!B 80 0PP3 0S+ pP@0S  0(`V $0p 0$0Q0 <0 0 p S (KoO(K  -0(ML0@  $0 0 S0p`  0 @P 傸4@ 4(K "00K0 0 *,@P |h 0 0  04@P  0 P4  N4@I0@,  0 UPPk @Q4 8 /JP ;P ;!O  l  8 <3@P 8 D< @@@ 80@ S,00-  .00/   180チ P0@P A0 <  @P  ix0(\h  $0  B `hܷ @WX׷ @RDҷN<η @I @@`@@@@@@@@ -LM@0 ! 0,0(0$0#aB0p  0 PP 執(K|1!00K0 0 *,PP D冷,!0 0  04PP0 0  PP kg0,  0 sOP X`ʹV d00 0  0 PP` 0>(: P @@`@@@@@ 0-LMP ,⍊A 0@≊ữ&@AA8@TE( F0P  FN8l -2LM"`QB 2QB 0@2"9t!2"p10@|!0` hJw_1!18!1(2!1"2!夬I  X05o1  D0C!@<0D BD0`AAA-,0 P <0Khv  Jp@$P㗪1P/DU=0@@ P㉪0P U=0@@|0@W.T=0pk\P@D@tq>>&"x"%" !D!!l!"p&",\@h@a>n -L\Mp0l Ph 7(Kl hp0 dK  @e   : @@ ,a,qP 0 ;C*@,0 T0Zh Z p@P0* `, + 0pT Wh.p0 R,8lP :0l-[0<S0#0Q0 00@$(,6?,D -LKM00 H! ,0 /0 0@0@ 048<0#, ##$0(@T ll4 00 #<0@4  ! ?  a 4 `( 0CPC0\p 0C  @0  0 48< @<L1 0PD1 ;L!"D1 a(\<   $0 L! 0$D1  L1000 ;P@ <D! , Ÿ -00.  /00H10 048<#8:#:0 0 RH XbXr0*,4",0@*,",PP@AI͈0  @!  1!1 .0*0CtI͈@1$ K(1 1L @ p-LM`AQ0*, ,@0 F00P 00 00000 0@0@S  \!0 0@0@P 0 00 x$(0@ -LM<8`S @P0*, 0\@P0*,| ,p(<3T@2 8Q0xw8P0*,0 \$(h0d0 -LM`p,8@* ,0P ,0P*,P0 \$($0 8MS Ѝ 000Ѝ` - LM0000"0峠Z (KPp8`tpx0*@, 0T@<0 0 00`6$(D -LM|p0x`@*,-,9V 0*V,0-\$( -LM⤠@ 圀0 pHDP`@* L, 0T \ 0@*H D, 0 \$(0 0 -LM⤠@ 圀0 pHDP`@* L, 0T \ 0@*H D, 0 \$(00 p-0LM0`S! S @P0*, 0\x|@|P0*,X >\x<@ -LM0QHX`,P8P (Pp`p @ _ 1 R[ 0 @P1  `h Q \1 RM K V X  #Q a b@0*,-,@0P0xx*,0-\0   I= Q P0 R 0 @P  0 R (L$(, -LM@M`P0*,-,0p*,8-\ E MA0*,0-\$( -LM`0pᶦ82P  \^22PPP \ 0P0\0!àA0 S p [ W PA Q0 %Kk E A   ;0 %5U / +  &0 % [p 0SS Z  ^0 m(u>>hvt -LMpJ,@Am`XQOZ *<""""T"@8pB 8@HS uK ' (RRA RC R 1  ^0}㖂  0@8p@8pあU@P0*,t ,0`*,4< \a (- (8 $(d0 -LM Ip, pQ0P@L `1 PQ P PƫPB 0\E Q8 8 <8SP 0\D1 T\8` V0,X@1 p0  @ -2LJM8! 8 2pp, 0C`  B >C ADP0 pŸ  04 P`H2P <"z?C0!,2J͇ 0 "0240C$  p-LM6P=@S`4 Kp@8S1ST VP @2 R|ʤ1SS V@LP  g K @P lP  g 0P`1  060 Q Br0C  BQ l1 RE0G@T/0S*,0 0 lP  g P  1ASq B 00S:A BT  10RX!\!  10C1 10R'|'  70C7,0 0 lP6;6n Q00 0@0@ad -LM(@p0< =`  0(P8U@ (#!B14 (PU 080$0`1 $<(@ @ 0T(@0C@ 0(@3(aCZ 800 P     A 8 ""80"(4 l0Q0C R40CL0 R @)0+000)<(KoQ(K ` -LM`R`B0p*,0 \0*,0!,\0*,0!\0*,0 \0*, 0\\1\!Z 4Q4a0* @,)0T X@P0*,0 \0*, 0\``Ą}V `@`P0*, ,d }V$凩$(!pl@ -LM"pp6R=6 v0lB0*,8@"\0*,-,0`*,8-\0*,0!\0*,0t!\0*,0D!\0*,0 \0*,0 \0*, 0\AA8pEWE(?FZ T0 R H@00 00d$(040l4h4` -LM< l7 H0C0S P 8寨(K '000G<&0}P 嚨<000FVp6*`,0&\p6*`,0 +\pT6*`,0,&\p 6*`,0%\p5*`,0%\p5*`,0%\0*,l5d%\0*,@58%\0*,5 %\0*,0$\0*,0$\0*,$0\td萆t0 *0, 0` \ V< O0 ;0 *,0 #\0 *, #0\@@΂T Sc0*,P#, T0咧<P <t8p(Bp000*,-,<8 Sh < S6gf fAQ0*,0-\M8pKQa0*, ,1 @-BT0*,0!\0*,0p!\0*,L1D!\0*,0 \0*, 0\< 06;@06<(R  9 3`@@$(44 4x4P4 4 4@T4,444X4>000iBh0h4l4 0-LM0l 60PS0CS006 8h0娦00 @0@8d@ -LM@᠞4P 6A0AS 4@9MЍ0Ѝ -LMP@`pS1T* 1T2 1T  4P@2 X10SL1T; 0x@4T~@606 0S. 6@ @@ k@ 4P@<8S 6A0ASd@@ ZL0x@016A0AStp4@Di i i ϖ1i -LM9@@ 0| 000` -LMppp`0@*,T0 ,*,P 0\$(! p-LM`P0@*,8 \0*,0 \0*,0X \0*, 0\1 xhX$(,04 -LMRB0`*,",0p*, ,w  p0000*,0 "\0*,0 \0*,0!\0*,0 \9@ /RKD=61, ' "AQ0*,0 \0*, 0\E(B\1C,B('A8"%$(h4l4 -LM@U@E0`* ,0 %\0*,0$\0*,0$\0*,0X$\0*, 0$\0*,0#\0*, 0#\{0*,0h#\l0*,0,#\]0*,0"\N0*,", PPZEr唂0*,@A0d"\+0*,0("\PUZ0*,!0\ Qq0*,0!\~0*,`!,0#28@8*#,!0\H~x0*,0 \~0*,0 \~0*,0X \~0*, 0\~ $(p4 p-LM` 42 42 42    E1 Ƞ@!!,Ƞ @j?.0 q 2 8HQHA #800Mb0S!<C<0NY0S <C<00S /0#@0C00G]S P00C0A 48#(R0  0S03@ 46T0PGM6@P&0@8sP 40ĕĕ#U@xt,(04uv -<2`LM L0C 0A   u , uK=! 0p0p}W AQ0*,*,@P W墢.At`噢\1p 0D吢@AA8 P(@TE](P P w@DAA8l@TZF@ P 0@T \ pXdTN0LH ]V\!.\L0L >>.\$0$ 0>.\6$(_ -LM`0P@p ,0 \W 0p ,8#8:H \00 ,0 \$(,( -LM0 `@8`Pp4 P0<4 \ 04 \$( -LM0 dp@8T`4 P0<8 \0 84 \$(  -LM@PPPp`D ,70 00 \$( p-0LMP@ 0P`` 0/\7 Ph Ph$0, 0 -\x$( -LMNpP @l0T TH6T8 404 \1`V@>.z4 6.02/\>.x4 6.02/\>.y4 6.02/\`0`  08".\<0< @08.B\$(| -LM0`p @P*,0 1# 0*\H@`@P0AK ,0 \$(@M P C"C"C"C"C"C"C"C"C"xC"C"xC"C"\ЍTPLHD@<840,l@@@@@@@@@@@@ -9LM9I)Q 5|I   42  42  42 M8@xP8 P 4U0D@8(QH  48#(P8R 0  l8 X8  D8(8 ,8P 8 ( 0G  48S7'000S 7' 0 B07 m#`pO@@)$W 0@ 4@0  4X706p 0 S00ƅ60S060ƅR`m1`pO@@<|V S@ 4@0  4(X706p000S00ƅ6000S060ƅ(Q`5 0S  p 48# R  k$`oU  @ Ȅ 00(x -LM0@Sp Q(\  $0  B 0$ +80  0Q 0 `0儀S`  (PU $00 $ @Q 0 V K  -LM0@S Q(\  $0  B 0$ +80  0Q 0 p`@tT`  (PU $0 0 $ 00@@Vp$K 8 -LMp`@T㌠  (PU $0 0 $y <  00@ @X`01 11(K 8 p-LM@t`0P  0 = 0` fa @ x0 0=0@PT0  fba @ xP0000 ԗ ԇ bbfa @ x'''' -(LMp"h@@udTx 1!!,dTk AWQ( (40! \`0 0;  0L!\W(K@1!!,0 S  Z@duTP` 0\@ 0\<T x`xp0| ,@\ 0\P08 \14C@T$(ppp(0Ƞ M ,((P"(0Ѝc( -LM6P@a!@@6q=6F 0da0/\404!,P 0!\ 0\P0 0; 0 \0@3A@TZ `0 R T@0$K000P'$(X'09M@Ѝ0Ѝ~ -L MEUh&h 00` \`p ;p t 0\` ;p t 0\` ;p t 0\` ;p ~t 0\` ;p mt 0\` ;p \t 0\` ;p Kt 0\` ;p :t 0\` ;p )t 0\` ;p t0 ,0``00ԢSF r@A0 \ P ; s 0 \ @ ; s`VZ  0\ @ ; sIpQa 0\@;  s0 ,<ʠlj@ Ƞ 0,\ ; pGsw 0\@ ; s 0\@ ; |s 0\@ ; ks 0\@ ; Zs (K$( -LM@P8`-#, 08 10-\@@6s}T! Pp0-,0}T ?0?S Y.b0 ("(, 888## $(? -LMlalQp+8\L!A@0  *t+0\@0 0; +0\@ 0\ 0\@0 0; @@rT H0H +, T 剗<K$(<(pp@ -LM4Q0Ap$!0\`0 0; PPrU `Ѐ0/,@ UR< K2rr%0/\<Q0 \ QX00D`'a'_'' -LMP@@pdT l`lp0d ,PdT  4&#51 \me$( @ -QLM`q 1p0S01 1R0S S0-=Q 0 T>`'a'_' -LMP@@pdT9 `p0 ,dT,  4 8 \@0 0;  0o@odT L0L *,0@$K垔$((p8@ -LM1Pp8p @1<1'0@@0P3):ࠃ3A1 | 1!`\p0 0Z'`(p0 -LMq0`!S*@P0 \0!S) 0S0,0 \ K [@P@T 0A0S @ZT g/x ( 0\\'$(4'8 -LM P\? p ,R $ @@dT> In79`P dT1  @@ d00T /n70`0S  T0D@@    < -LM`,, @m 3##,3 R 0C !R 4CS#\0t#, 0X#\L3L#QDS@ 0 @&T @ r0S) "@=0@ 7  H ex"/=0 A 0<2 !R\BR0E/,0E/\1 Rj b0SS 1 R 01 R Q 1 #I BL1 !R0 R 81P00 , % 4? P@0 @>TS00S`0 S@0`00S SP$('Z'r5>5''\'^'`'a''ڕ> -pLMM@ `7 b> P 7 b ? @7 b V {V3 RoR qKP m\3\#/, 838#Q R Y3 Rs KF Q2"/, 20"/\2"2"P\N VA2@ |2R @\y X2\y @2@"0,\$24"Q@ V(2Q$" "0Շ0՗00.0  Bh^lRb KF 1Q? =0! 20 1@ t1R@\RDPKP R }1!,B,1 0 V :0 0,B\0=0! "0 RD H0H 0,\ | V'$(Z'r5'a'5`'p0'VUUU0 0-LMP0և @P00T0Sh0h QAT@TT8hk{8Z'p0 -LM 'L2 p<@ P@  0 `Pb !00K❍0 0p *,`P cQ 睝 p0  ;4`PI  ;`PC (\ 0 0; 0,p 0 p 0Z 00p  BAD0m 0 0 0 ~  L<@`P L L(K0$ 8@<L@@@ -LM` `p 00 @p  0 PP X$K ,0K 0 0p  ,PP ȏ ,  ;4PP  ;PP (\ 0 0? 0,  $塏坏 @@@@ -LMß6PA0, ASu 0BSx """"""Ȅ""""""""Ԅ"080 0022< k< iR} H3H# 0 00t00S* 0SS   S .4 <30K2 K4K.x. x ,4,`1K0pK/K.K-0K2"<0!0*040Kt0p( TBTR0*,0 1#8 3*\, 0Rw(K080 8 8 < QA0aK ,8000 \PqP0 00t 8S2 @P 0Pt P0tl0P00 S̀ ,#,430K2K1 K0K4K-K.K/Kw.4 <_  3 K40K2K^@P 0Pt P0t9f0l$(> -LMp: 0C0S P p v`w\*000T: RrHZHj08*\0/,@>/\+9\@0 0; +<\U`P8O0 C"hIh 0 s@ 88 \49T@@?idT h0/,0 dT <` (K|8|(,B,t~>/\@/@8\+8\@P ;P +<\@'0\'0\@ ;P  0t'\lG4W4g @\T<7<'Q00 , @@hdT 弦0 ,,PdTpp&000/,@0}0/\u-B;\ D&0\@ 0&0\ r0nhP`PF\ 0P+@; )00 0P*@\E 0P+ 0P+@0 *00Am`^ЄФ $1\@ @0\ P 0\)U@0 \ /0\@ /0\ P$P4\@@gdT Sc0/,0 dT >/\@0!.\ [M7@P0A0S u@T3 A  QR `3R 0L3S 083C 0TR0S0#001 0S2 0S  S 4}2\ L2"Q` #(2("Qp(t8p0tA 0r~밁0","0 4!\,(10P `P',0\@/1\0  l1 0G6;@06,( <8S   \00 \00 @21C! c.  @GT0@'$((@@@?ܔ>Z'p0@(pp ^'(( (a'`'5D|4b'9MЍ0Ѝ -LMP@`pe1T* x1T4 p1T  <4P@4 d<10S01T4 0]@4Td@606 0S' 6@ @@@ =  4P@<8S 6A0AS+@0 ^@0f6A0ASt4@Di i i ϖ1i 0-LM0x PQ@AT@06 8h<"00 @0@8P'@ -LM` p` 00 P`  0 @Pe "00K 0 0`  ,@P T p`0  ;4@PO  P;@PI0, ` !갹P;B  L @  2@P/ Z, ` -00.  /00@* Ԑ!  00 0  @P; 哊(Kl劊`冊X₊7@ (\ 0 0; @@@@8@ -LMH `0,0 H1@9L! 粔D 0SZ P 000S@ 80 < 00U0S 9 R0041 8pZ 0U0L08P0H(08#,(^"(#80 0@ 0 Xq 00 $ (" @3#0041 ~U 300 < 01 <1 @ d3<   @`0 S,8P0 $JPH7@ 0498#,("(#80 :L80841 ?H1 R<; R13Hζ̶7@` _H¶v"1t  0 0<1!0!0 0= K0L$1 H1KK L,1 ( DUH 0H(HP00H 0叶   0@P 00! #0P 0T! 0( 1/0  ?P8! 0 $i7@H M T_0l86>|L< d\DL'<'L$8T'X'>@<<<< -LM6P=@S`0p2 K@8S+ 0@ BTX0S*1Sc V@P LP  ED$ K⓺@P lP  9D$ >P*x1  06h1 RR > RN G0T B0S:G BT  1R0|' '  770C0C77,0$0 $׬00 @0@ 1R0' '  880C0C88 00S:A BT  10RX!\!  10C16;6qP'8 -LMP4 240"401<0 40/3@0 ,<@00  41!0000 Q8 F p01ᄑ0 @Tt ) (`V $0 0 $j8]!00@ 0@010 0  00/"-0?00b 0 AR 0<@ 04t 01\ 0?Q4 02D0   98;9(Ko$`\ 8dP'X' p-LM<8@S0` \P,8 0# p,80x?S?0C0C??z?S᪥4 -LJM6 , 0P/,6 @ @ *00T@! D1 9 0|6 R D剰@D N?K0 4 mDὫ 0498#,("( #8 &0(@T 5 00# 0%@00@Q@ 50H1 (\` 5  0  03 0 48< { ;P %(\A 5A  $0   Ԥ0@ $4 4 0p;P< $ p,0H!0-  .00/  @D10 048#8:#:0 0<8  @@  81081  0 4 H3QR 0RࠓࠃQD00 X3 ࠁR? t 00x#0l3 0 L3 0C 048#9l  S| 3@D0CͅD0|> ͉00 @0@w0S"Ь""h"T1   D!0000S~`"P"@"0" """"0  0  0  0l  f0`  b0H  ^00  Z0$  V|0  Rl0  N\0  JT]Lȅ0l$4L< $<8a'Z<\<^<<(Y<X< >@ -LMR4 P |1@TL@2  }4 [0(S5#,q0 0 P\0 2S P UZ$4X0#- 0@ \@DJ0NS` 2"0 P`40 [0 S0 (K20  @H=40!0+0!0td> -LMH`Tp` X̯""""8"TAQ0!,8`!\] @1S@8pg 8S @'x (RR' R) R }3@8p  '@8p;@8p6T  (@ ($( (2! -  M Ѝ$} -0LM PR `p0 ,<8S!  0Kh | 0\@0 0; ^4 0\pKh6$(t"@8MS S ЍЍ0Ѝ -LMlq0haP,,p@ P,0\   @" %(+ .       @       g$( 0-LMP@{4P 8xp 0 |" 20 2S Q <0 6A0AS 8_86>8M ЍY 0-LM0@Pr{R@3A@ET0P  8< -LM`<A--P| 2 2RR<@088 QAvA@PO-U   @Pvl1P2.UN>0@L1 D!D1)t1@>q>>H("T"" @"ԭ"9":":"?"@""`B""t",<.<d@ -2LM P `0@@]dT \2\"( B,0@s dT$>>F>> <<nO),'>>>5 >5$TTPPIڣ>aq -LM@   ("( ("(,hM,Ѝ p-PPLM@ 8`("(  xhsQM 0 S0#8R#( Q0  Ѝ_b> 0M$("(("(Ѝ -LM@h 0-QLMP n? 0m/00m?@C J0d "\0R 0S 8m8hRSn?p "("(R-P 8#8 0 M Ѝ -LM`00000 ("08#  (> - PLM   -LM00  㰐Რ\Ppp` `0eS0cS@`VP0(KV ( 8B(C62 ~0P0 P0-:MC@,S 0C8:0?S?0?0 QЍ p-LMP!h@O("(f("((B(R ("((0B(R (B(@'@Tx 0-LM"41PR 80 ! ,0S:0C *0b10 0?A2c>S@>@OH$D@ H$( c,0S \t Xh T\ PL L@ H4 D,8h?P gfff  8(M c31 0P @PPЍ p-LM0` 0   XU@0@8#Xt t0UPPh"* (P"(xh(@[%X XX%X   0-LM 0PS X@ @00\T@ @ 0tT8MЍ -LMp&@0P`  0S 84#(#  #("(X 0S3 X " 0S& ("(, ("(0Sw |, ("(\{0SH tXP T  L$H=08#8T " =08#8" b/=08#8b/ 0S@ AQ4,\0SC/4\封0DS;#HMH- ("(%8X#P`0@ /  a 0 P@^ X`(08#8^ $ *("( K~a',0+ -(LM`"X@p ,R00C4 0@(T"X 0 S R10lAC 0CS? 0 CMm@S@ЍMP @Ѝ -,0LM(0"(*(, -LMptP@`T@ @P P,@ TT 0-L0LM0P@0 ,$0 0 $#20 8,0M!  r 3R0000088##Ѝ0 M Ѝx -LMr@@0@P00000 Q0C @R000 kN -LMp`!HPk04 4 0P(U"H -L0LM0@pPK/\`,0K/, -P0LM0P`@K/\p,@0K/, -LMp倀P`@!1 $O\H@0 \0@1 0C\,0M-ЍM-ЍM-ЍMЍMЍ p-8LMx#8 0@h 8P#8.BX`8 04 8#8` XVx,0"MЍMЍMЍMЍ,PM+@ P PЍ -@LM31Cp`PP PP@0AT  008#`08#L0Ba},0 R 08#Mb -0LϠ̠M 0( 0@0l 1 \,0MЍMЍ -D0LM 0( ,  P, 0-LMP808 @ B,H@@T8,06M@ Ѝ0Ѝ -0LM  -0LMP@ ,pK` |&K x@ 0! Q @ TK p-LM@cPO2U  80(0PP  @xxTT -LMpA`@ 0#0PW@ @p P@D  O @O0@ OTT p-LM`@Ph OT  O@ (O, P U hx蠯 -LM@!X<p#X`' ("( ^O ("(VO ("(NO,HO-`Vp 0\0,8#(1OL  ("((O--("( -L M0D  .KH0 l .K H` 0@ 80 Y`@ @I@I``T@V`F.K0K P0<0 T0 T@@ D00[  / [ -LMR P N*@p8 R#h N@WpT p-`LMP@,$("(* *("(*("(fN-0Px -L(MΩP@PK@T-@DL620D@T,)"))("( ("(%  ("(%x ~t ("(\uT@%D m0 ("(d}$ \u ("(Sl ("(Jc0 ("(|AtZ0  ("(X7Z-3YH$/ X+ D*("( "; ("(2# *` @ ("(,0S RC ("(C p '0SDD# +?  ("(++?,+("(+,("(" 2   0Szz Wp`,8#H` CPX`VX0 ("(@FTp pT0G8#xP@ @0 @zTm?@D0120D @YTD[ ("(c L ]$[Y%[U$[Q10C1C 0C /?(KVpڨ @SC (pCPR+("(40,I)("('kꊠ>>)  -LM "Q2p@@0  XpRpb0.,L"0X@-0X00"X@"0X!0X@!0X0!X@!1X,0X@t!00X"\1RA Y@6L T 1 !$!(@ @0  ( @ L T@0 .B( @  L T"0R (K,0S Q7 (KoW,0S Q P0>D>,0h  Lj&P  -LM0h!Sd1`ppP@U00 08#88 #(!@T@DU8 #(!@TU@Y 0q' !8'#("H8#XJ0)@  ("(J h%)@  ("(H@)@  ("(iP@@ -0LMp0@ 0\`Px0x  ,: S:P^K U@4p,0,  0\ U,0@0M 0ЍT -PR0LM00@`p T0 R %pPU00p $0 @ o@ -l1LM @P* P!00C0S$<1  B$ KPU% aq0 ,U 3*0 0 \$ KU 0 \l0l  ,  0S : \,0 -LM@h 0-LMP@8h -3LM BRp0C"Q' 0 K@HP (K"04$2"0t2`"Q( \"0000 &@B@R0<",0 KP0@P!\`,? 0!! 0@PB/\`, 0B/d10S S 0d!P@B/\`, 0B/ 0 !@P B\`,!20 0 B P{ 0.B\ 0 .B, @x0T 0\ X T ,P 0q  Pk RTT ,0 0-LM@l0 BB K}PP @0@ 0l \ nPK0,0 -LMp堁!0P@.B\`,9.0\!@PL!X`(08#8(! 1 !1Qo%0 BB0 K)P0 @Pl \`, 0 0l  0(K0 P@@ X`(<8#8 ,0 C -L Mp`h Qn H2 \1S_t \ ,R00CP1Tc1@S1ų!QT \^@j@P*K0P8U#H2[08SL2[08SG2[08SBp ^R0<08#0S>0@``1@T  4`P@ m KQ0@11SʸmJ01,R00C41"0R 40`1p@ ` RP{m`<0R4 `!4 ` Ch@ @P >D@> -LMp2"Q? Rb0"X0/(HL"0X0<"(@8.#8ʠ",ʠ"$N 0R10% R. R &m!1P\E m0@T@ T0@@Rxh10d1P \1PE Pl81P* 4l00 110!S1 !1 1 !111!11010,@0T@000 10!10 S000! 10t0110p 1T0!1| 01!C,00@` @P S @@2## ""##T#""""4"#" MЍl>L@ 0-LM@1!P.B(,R00#$R *\F Psl8R 8ll8\( 0 S 0 S9 0 S8  Xl8\ Pl810 ^0$ 0 *>R00#608|0 $0t0 1G.0!2X0 $0r01s01t0 2,0l@@>@@#r " p-\1LM`P@% P 414!Q xQà 0e010   0S  R kx kxkxR 0e01P0  B  X0@` 00 0 RP 000x8 000x$C(>,@ @@X -LMp`P  k(K0K - K3[ S 2"B 0S 0S=*P k`BR0 ,t2-[h"0`3[ B0 8 #X,3[(" SZ 2U  0 S R Ok`!1 B PU 0X 1   @t0C!! PX0/0"0-[0P!P1 @@T 9`P - K!V[ 1 !PP 1P- [k-0[S4 #0  j`Q jL|0 j`CB `l@,0CD>@@@@@ -LM@`p0P.,1 010P,00 X |0 R lj,8\0,,0000,0@ -LM@P0p.,`43.\.,0S@@EdT @ 4P dTTj<,00@ -LM@p嘀0P`.\,0. 0J/\0.,J/, o,0 -LMp@P>.(0`@.\P,7.0S<8St1 011 01,0 -LMbP p0@P.\`,0.0., @D`0@T H0H J/, $0Ti< ,0'H@ -LM0S<8Stpt0P@.\`,7.0., D1 01,0 -LM@ -LM;A S )#h)#h)#h)#)#h)#h)#h)#h)#h)#h)#h)#h)#h)#h)#h)#h)#h)#x)#h)#h)#h)#h)#h)#h)#h)#h)#h)#h)#h)#h)#h)#p)# f @5CtB|5C@ -LMⰁ0Qp!,@ g`h!8\@@TB <10&088#8#8ESF0C8#Ƞ  0b8#Ƞ\ 08 #(^"(0S)48U#( U cx9S:0C8#Ƞ -S.0C0C88#Ƞ #Ƞ U 0U08#xx08#x0   P98#48U#( U`008#x U 80U=08#x(x=08#x@  -LM 0PS 0@R`p R0Sp0"R 0@`p i0S 0`00@ p@0@`pVcP @ p-d0LM`QL[@P0S 40 $寐00 @TxT( -LM!Ȱ`o6b* =R?006$ᘠp 99 B1 0t 0Ph0h@ `$y Q 0i Q(09;9@(T -LMP`p0.,@P]/ 0, 008#80$!00 @0@9 0p,0 -0LMp0(`\P $ $0  B 4@T , 20 !g0/"-0?0@bV4`K(T -|0LM p`0p0hP ,J$JA1 \9 0pT,0 -LM`0p@Q00 1 , &00R0S R @y< T xNa T \!TT00 0\@$$00 1 ,  @R< T 'a T G<00 0 0\ 3 $0 01S=(0@P0PS `0 $e000S U00U@T,0@@( -LMQ`0p%3$001S=,0@P0PS 0 $3Q&0 @U XYx0x  QL[@P0S @0 $  0 @T(T -LMp0 0 03$00PPU0 "10 0ЁS=(00@`0`@  0 P 0 0k`U S=$0@`1 `V@0 j (K0  R0 ;00@ 0 P P >`0P@U 2 1CQ<00 `0` 0 P l "`U QL@@0` V0(  (,@X@@T -0LM`,|0(\ $ $0  B 0(@40P0Pp@ p@U@P0(\  $0    00P KT( p-0LM @P@<@@T  0`P  p_Kp`0(\ P0 $0   404 0@nTTT@(TTT -$300"1 0LM 0 0(\ 0 $0  B t0tpt@Pl` 1 1\$OH 0\(K,T($T(T,T0 -LMp@ṕ00S* S0  ,P` 80UaP@ 10\0\ .B, a00PPP `@`,0>T 0- LM0@'PK0B KPP$Kl0l >-B,41C $c<00(0 P,0" -!LM0p0KB$ KP1!Q |1  0 R'c0CX!@P.B\`,8#87 $ o00S/ S0 ( 0\,K5(000" c`P@#9 \(l 20a #9 \40, ( ?\!C0,?BC -LM0@00 p㺔|㷔H0 88 0  @R00<<O⩔81|1 -L4M0`@ZD@T@D70D@T(())("( ("(  ("(d{\T&L s0Szwp ("(zTzn ("(zK8P; z^z =i ("(G`% ?dX ("(L6DO ("(,-F0 ("($=0 ("(Z-Y.X 0S %*("(  ("(ld`$T  ` @ ("(z ("(z6@Kē03K0K3K}C  ("(CU8 p  {0SPP@0ZC @ T @D0 ß0C @Dt ("()("(80SU@ᤢPFKp 0 @|TPں%[u%[8q(%[m(K0"gb @FK @^TP@DFKp@T. L/ H D @Y,("(x7pP@ ("(X.`G@ ("(`%>,("(qP {7  HPW$HPEpUW  BpP {7 p HpW$HPpUW  (ž>֞>)>"x -8L#8MPD0  .K@ 岒0<0 80 40 4"p0"烀@9@`J8 R Z  !.K 㘒XaX0<0 X00<0 C)(@2R  &72D<@008#(zw14  !V.K 0pW8040S80 4 <(K)h =@GP .K K CH41Z 0<0 @BR> 6 D C)(10R , 6o D0 @<0 .KZ)(C l0< 008<@#()H .K  C0<` < p>8>> -2@LM0`CqwTP pP("<8#8"(0p 21C0`0gSp 0- LMP@P8 p-LM@P`P P  xh xh\@ -LM< <  @ D 5, P0p81  {0! 8041 凑Y xqI 4 "  200<X6 4$`V p$p@P0@p0U̅p 60 40C t@ -LM0PSp`0@PNO  H } (0"(0`SP $Z1O  H@ p-L M$`K@P02K02K02K01K[0t _P 0S00  0Kp -LMN -,4LKMP P!0Z,0 00pL1 H  H (  0 48#80$S("HPP  TY'Y00 @0@ ႇ0/"-0?0bP1 S H3(\ Q B Q B(#0e0 $0  B 3 R 0eŸ0  B P 0 0@0@"0e0 50+Ċ7P0 0@0@K M0D 0L!0 %0Y 0_@ 1`V0  0U48!#80@P10@1pȗ 0p1 p.0,0CDU̇0^0$ KKK 1L1L , (1  @Lᘂ0P41  O?KČ Ƞ ,Ƞ` L8 vmL} PU0@!H  D0@ l0PX (\ x0 $0  B $, 0HR(K<0T0l@(QQTUUUUlTp> -l0LMd \pP ,J$JA ` 1\T,0 0-LMP1@8@S 8h110⁁ -L@R MP㬆`P7000 D TE ;φ;X 00 L0t03  P0 6TqB9 !0g0 `   A,0g`@ B0(\ 0 $0  B   0 0C 0(K ;㉆TqB qB 0 g  $(TQQQT -@RL MPp8`P7@. T/; \;㇥ 000i@1`, 0 0(\  $0  B 0 0C @(K ;*;T i0 0LD@ ㇥ @P ᔅQQQ(T -LMp\$\4X1P$0P 3$00APPU% "100$S=(00 `0` 0 P VU S=$0@3 `V@XY0 '  X SM@PP0#$35U (KVU @3 @T`0  R0 # 0P3$001S=$0@`PU 2" 0% 0 ;P@ Y$2 "u$2P&V0 @1 @!1T uV  B@1 @!t1T PP@U7 2X!1CQ<00 `0` 0 P $IVU QL@0` V J@0 @ 0T0 x0U @@TQ  P@ dV '@00 @ 0oT\D>?>?(@$@@P@ -LMP@` 0PU p(KԠ 00 0 pP Ut t05  pp0pP0@, 0U 0>?\D>?t@(@@ p-0LM`PV p@ 0$ 00$$  0 xhxT( p-LMK[`$@P0S 1 $0 00@T@0S 00$0 0000 R xSM@PP\ P H0 00U@@@P 0 00x(\D>?TTT -LM@P  d01MЍ -LM`@4 8CNl@ $F`2V  p   0 @P  "0K0  *,@P T 0, $  @ 0 @P) T(K 00  04@P  0@@ @P 0T 00 0 T 0P 00   ,@P T ,00  :4@P T $, @@:@P$0, 40( 00@yT 00 0(T@@X@4@@@@ -3LM`P #00Q- g1dQ2Q Q\ Q:U"9 "0S2 0"0 02"0|2| 0t"0ClZ 0 &@\2*0pP\@TP*< pPEZV1 R` gpWA!1 0! 0 !T1 0!0x 08!0d 0\!0T 0CL!Z0 @ 0!0C, 0$!@0 S62 S* pP SwpX@b#TB#;#TA#X7#`#2#T|2#`#$"@#TL#h:#""""" ""|""""(@@H@ -LM  -LM@A <#L[@Q \00HS X00 0R B0HSQA M<#-ЍL -LM<8@S 0$ |wA $}h'ps# -LMpQP2 9@$1$!!(RM9@` Q Q  T0W0  Q+ * R 8c`V@0 0 XR ^&R [&\0pQ W W Q Q  0 R  ,0x6 0-LM@ 4P7&A 4&U0P8t 0-LM6 @P& ` 0S 0CS006 8hG8(R00 @0@T@ -LM6P=@S`0 (KL3 4 p180 8  0,#0Q} 00CQbs B@8Sp1Sd VOɆPh 1S @ 0 Sp@P) }P0 LP  0 K-@P lP  0@GXP 00P 0Q w0 0@0@  0  S p`\ 14 80 0G@T?0S*,000  1ASq B40S1p 1   &f0  K ]O@P] X 0Jw000  00S|:A BT  10RX!\!  10C1l 10R|''  70C7,000 x*6 ;6p((T -LMhp0dPd`@ (R= 0 X0R h%,0 -LMP@pR=` ( 0` X0 0 0 ?/à€,R ( 0 0m$,0x -LMQR=0@ 0 0@0  `R0 0R^ ^ ^T 10 h0"R(0 0p|Tx>h@lp p-1L M @R a 0S] ad<S  B$fK"K <S  B$R̈́K!K:$PK R00L 0\00L00L  \ 0A0QS 0\Q00L00L Q00LR-0S PR  #R | Kph#008000 \ H 00?00 10C 0`>>y#"T -0LMQp1 "0R ,0S Q00  0@PX`D>@8#8?.+\0 0P@X`D>@8#8?. igPP ,@x> -L0Mp "NKX ׆RK3"胟R0T0  *"3Rd +#@ ("(R@T`tS@ ("(RP#@18#8S!h1P1 T ("(R`@T<8P#X/ 0"8#h@18#8 S11T<8"#X, ("(/"H2R $[w6(K+,"n* "j$[ e$[*a$[5]$[Y$[U$[0Q#[C:"[z6RP#[ ("(R+X h1X0`!T0/X K*KG5KCK?K;0K7CK!zK@XK0P/(RT 00 3KX/h0X4[X  52[  z P ,0?? -L4M,0pS (('W G0'(\ 0`Pd'X@(98#8<'@0720D@T@D 7@0D@TFV0&(X 0/(T 0SCzp ("(z8Ke ^03K0 3K03Kzsz R0S${0 ("( Yr0  ("(OzV ("(z3)z8#Gz &0S O` @ ("(,454%@P/X`(:8#8/z  ("(z$ 0S"0 ("(0 ("(x ۄ03K03K 03K,0S R ` ("(RC ("(CZ-Y.X S) X H8C8DQ80 c00tZǡǡSӜSLH#< ((# @220D @TRb\0"X@X0"XT0/X@x2@0D @rT/0 ("(d z)("(X0SZ @PPK` 0 @GTPs(K褑@PKT@T. 0 ,0SS) S' SS9 `<@ ("(`3,("(쐟@PK @T0UC +,("(@ ("(0L  ),0>>0>x -L(Mp@42D@T@DBK@TCS0#(L 0#(/(H 0Szz LS0 ڞ>,0??0" -L@Mp@2PK:@T@Dʟ:D@T 0Sy 00Sf@j@FPK@ T ("() z((r) j` \ 0S||)[ W\ P0SD9  84)EX d $$0 @P)X`(98#8(5H5h D(5 #0 ((T 0 /(P 0S S)@ ("(0 P@/X`(:8#8/L 0S 00S3 '+'00ST p'Q ("(Q,0S RC ("(CX P@Z-Y&X 00Sڠ` & &00ST ~8&z &00S k%g%-~XP ]00Sڜ\ P@x%KT0 㣤%X A`P  x " %@Z6-.Y$*X &00Si $ %00StV4 X$ %00SC $ |%-XP 00Sڼ(| @#T0#TZo:`Vt3/R00000#[@L3@(K/B00 c 0Ÿ ST@D0Ÿ:C @TBRT0"X0SHh 5Q 0S1 00S60P@,"X`(88"a@FPK @n T` h\ (Kob!^Ld 0VX0/X(KP0/Xl1 0!XL 0SGx& !BC }` \ d X  %0X0 d0 0:Pd 0@/(0X 0/X0\0 `0 \>T>H>)  ,0VUUU " ??"40MR 00 /xЍЍЍ` -1LMQ@p- 8#8 |TI``! 0 PX`@N=>@8#8?.Z 0aP@/X`(00/} *$0 R! @0P` f0 P@/X`(;8#8/ 6@0P` D,0$ -0LM  -LM`PA}$p@U! @8p?P! 8S U%  1U0 U A   0? ~H@'m|0Qp0  (R R H8s}>80 48  (4lT@tT -LM@)3+0    h -L,Mp0"NKT0 ~0EdEdU0\%(98#88%X0/(*K5K`KCKzKRK0K 0 Cj0/X. o(x k4[$ 5e2[$z L+#[*#W09@ #M[s0@ L$H,@ ("(|:" ("(\@1H"$(8*9@m.#!0c /#Rb 0/X$[ *$[ 5$[`$[C#["[zC[R@CK008#8 R3K 0"X0 #[#[#[#[#[#[T (K! ("(/!|1^#[ ("(D3[T! 0pFzMX ("(z*, 0BSSR @FP 1 !??`aˆh,0@ + -LM0`Sp 4$Q 0$Q DP P{LU@5,,("(5mTD2S 00S?ڸ2S $4$$0$X p,("(Ng*("(E#AZ ,("(75P d ("(5-]F ("(]#0S &3+0 3# 3/X0Sh  "0SW  PB+2S u y P P# 2Sd [{  \z ("(z  2 *!O2S8 1!P@/X`(?008#8/X1X!/:X L!&,!,!" !#!$!l] rP mZp i8 w z~P ("(z[zt ("(zQQk ("(QH !P ,0+j"?0>c7~g p-LM0@S`  R% R` 0T , R@ B RRw<PPPPPp R0Rx ,0S 0S0,0S3#Q "3R,0S Rn?  ("(R0S83 N .$#0SN/ #00SmK"2 B 00S:s{ ,0S< /2 2(R@ x00S``"TT"U H ,("(( y."0S/!0j F,0S!s1 1(R! cX|P((xhZ6q0*&("(6Lg{E+D @ aO ("(-F ("($> "("(R3~P uxC02)> 0-LM@t0p .B,  0S 008PUzu ,0 -LMp2"`2/X "& 0 >,XBP PLDU@DR/:X0S A2S u y P {P# w2S;  2 2SK 5h!x&3+q2SB </X*!c2S 0  i* LP 4Zp 0[{ ,\ (z $8` 3x2 ,&,',0"?0=<P  ˆw -L MH 40 `P@D 0K w0 <(4"4!<S  X R00 4 PpL@00S  X RH@' HwH w /xPPp@@< (4"44 !<0D <(4"4 !<0 r(K@ -LLMsQ0U 0 @`t 1S 1SA 1S] 1S 0RK RR R0B0S@0`PKS0#@`"@!dKs?iP d0!u0P  0@ 0`PKS00@!@!dKu?BPd0!p0P  RR 0B0S0D@8q/$P 1@Q0`PK@ Y@!dKw? Pd0!i0PPj l`PK@ 0:@!dKy?Pd0!i01PN M0l\@@@@@@h@4@|>H@ -LMp"(  P PP4 R0C R h0C#P@ B\`,20#PP  @c吣 .3\PP:PPPPPP00 0,# X$d0S 0"X@ a.9X0 "X@ "<Xx2h"J/9\@1$PwD4 0 \8"@T?C P7 Tg 0 @P!\`,6! !0 !X 0@x1PP>@TX1PP:1 81@P50 !P0X!P0㴾}? 対101; b/1\@ c/4\x 00000C xB? l>?`:?P0@,VUUU"TTT@@@ 0-LM0@S3DPP 8PP 0S- 4PP5PPPP000l 00d0\ 0X ,0,  B,,0 -,4LMP$100!0$0#?A3c0B=@ 0CA @@$  4 A  `P $K`Pd3  `P`P`P`P_3 Rp,K31C01B=0@ R`PJ`P ,H`P2p R`Ph2h"t1p!`2`"|1)  0Phiu<1\N,B P A00R"C40Q` '? @0S㠀8h 088 4N@pJ2p12.Wᰀ@OH 2:X >T1  0@!0@8810@0(N-B<(2 61!"1!2( 3U  X00  oD0C @<0D BD00T _2 o  |=DMbTs#`###\v#u#$(@q>>@TP"T؝#s#r#4#,PUNU@ p-LM1`P+0@@0T0000000` 000T0L 0X 101x0TT,0T -QLMPD 0 9@@H1 R(IM@ `$1` R0zO 31C01B=0p, KP ,0` RZ# 9@=< BQ@9I$K=9@ L0@<0< K/,pT,0 -LMP@P10SBm`a P mypPOO0 L Ƚ0!00 $1 R3 mP`9Z@0;90@) <8S,  m@0@,T p吀0.,]/T`<㎽@  T4lXg0,0<@ -LMm -LM@o44P 6A0AS 4@ -LMP@`p+1T* 1T4 1T  V4P@4 gL10S@1T1 0@4TV@606 0S$ 6@ @@@  V4P@<8S 6A0AS@0@06A0ASpt80p0p(4@Dp 3i i i ϖ1i -L M9`@(KSs0J/,p@ 0K/, 2P0DKH0 PU 2唂%A@r@!U 7KwK,07 1  PP;UJ/ 0\@2 0 0@\TE @V P@(cD0PY808@OIR= R9 U< R5 0T0U  ' H1H!0QE|AQ0-,-0XH 1 <;:_SRU V+;H'@d0@P0P<;,0VUUUX@g0lp@@TT@ 0-LM0@P3 `0 R @@B ,0@ R\ 8M0SЍMЍ<M0S<<   Ѝ<M0CS,<00Ѝ-,00M0Ѝ-,00M0Ѝ@-,00M@0Ѝ@<M0Ѝ0M00Ѝ -LM0@40 0 MЍ0MS 040 R000 Ѝ- 2! 002M02ЍMЍMЍMЍ08 $MQЍ Ѝ -LM800="R    -LM@>@P 0h@-4@MTPp 4`  !00\;0 #;^0 <00d<00 0Ѝ@`@\# 5 )\  0;-R#;  '\v Q  Q0 00000v 09000 0-LM80P@  0 < @@8h 0-LMP@z<0L8h p-QLM`P @Vx p-LMlR@`pt2 ` l” 0pXdGlRpt2 ` l” p0XKp -LM0P@ ra00B@0U0 0 j0"2R0CB200] -LM0P4` 0pSS  4@0T0 1* **P\^2|?h6 p-LMP`:0 L@0U0 0 <SLx00 p-LM 80RP` 0@S  0@4 xh7x p-LM0P` L@0U0 0 <SLx00 p-LM0P` L@0U0 0 <SLx00 p-LM 80R@`P 0S  080 Q 4H0Sx0 xh4 p-L MPBL`T 0< oKp $0K DP$  ,0 0  ,  ^ @< p-L MPL`T 0< nWKp $0KCP$  ,0 0  ,  ^ @< -L0MPD P T X0 @a 0%  @  8 0 8 < 7(K00 80 @ T0 C TpQ08#h L V0(0(00 pG0|! x1Q0p  00D "D SG00p i `4 H @Q< < 844i0 079 @ < @0pW, 0 0 04 #J(`P^@P" H0 0`0D0W0 H T }PL R 0@T qPpX0P @ -LMP804@`Tp <0 0P0  0$Q  R 0S  0K  $0K(K0( T040$ (0 0 $ <0 $0P  00 -RLMp0 7(KR@@#gP P T`9 U  0"100"P V `^U"`00 `V" tP  V1@`F4BV g 00<4P`0 <4P @`0 <0@NT@ -LM0@g ` P p11$$00WW@44(40@T KPPT1Q@CRJ40PU@DZ4g Q@P4 0  ^ 0@ 080< i 0-LM  P0 0@S P P 8X1,08L1,0800Sl#\#8##8( 1r,0 8h0,0P480,08hm0,0P4 P@4|8PD4r@[8 80AP 4c@LDI8DDDDDD -LM0@p40 0 Q50DP`•40\ PP 0S0 0 ` VP4g i5i @ -LM04Pp`zU@<0@3TC@<0@TC<g i -L M8 @ ^,+0P8 @ D Dp4@`<  0004K  00KGPc400 p40 80H <% TD @08 6Ǡ-0 0b 80< 80f,0 0 0 D00%0 000S 1 100  0 0`p< `0< 080` R < G<S0,00\ >0R0 <2S 00(K< ;l@K ,400 i# -LM0@SS P 0 P0! 0:0::Q:\   l0P"5h -LM8 P`p=2S5X2S00h!R, np@l8P5 R 050 R BW0@<P4d 0 I@:h 0U5?p@lP84psL@$@MЍMЍMЍ 0-LM@!P8hj -8M0=\ Ѝ$0 `\0d hPЍ4# 0-LM=2PSX20QX2 @=T<SX20CX280< 0MЍ+ꔕp0M Ѝ!-ꔕpMЍ -QLM` Q  $Kl–Ppt2 P l2p (l–@pt2 P \2l–0<8#8 pXdBl–pt2 P l2p (l–@pt2 P !l– (1"(0p Xdl–pt2 P l2p (l–pt2@ P 41l–008#8p X 2Al–ppt2 p l2 p(P (  lBpt2p l–00p XXc l–pt2p I=l–08#8p X0 T40W0  (/ K@@@ 0-LMlBP pt2  B l•p 0X@=dT l• pt2  B l2p (@K0 K0h~/@ -LMlPpt2 P l2p $lB pt2 P l˜p 0XS@T lBPpt2 P l˜p <T ?:pP|"0lB0x2pt2 P l˜p 0XlBpt2 P |2l˜ ,0p0 \PP ppp p@P Pp00LPP 0@00 p\\@P 0P00 pLLy`Pv 000@ pllP@hP00TQ_0$00  0 Z000 HBB  x"0 Q0 ZP@ L 1lR`L 004 lppt2 p l˜ 0p XlRpt2 p l˜p 0X$Kmh PDp. p$Kp( 0@C(ꔕp$D@@ p-LMlP pt2  B l2p (?0@' s0=2 <S ;.Kp``` `-. `'.  =2S 0=2VlB pt2  B l•8#8p X\20\2-. @8@P@t@ -LMl@ pt2  B l2p (?KKh -LM`0Vp0P`VJ<=2 SlBpt2 l2p (? \0S K00Kh 4 p-LM8 P`=2S04  R40 BAy@@<S0,00>0\0<2Sxx x 0-LMP3P@8T0 -LM8 P`@=2S p0D 0%00080 (K $0KEpP K( 040&$(  40S $<0 $0  40Sʴ<@S0,00>0\0@S<2Sp =p -LM@73P 0h 0-LM80P@="R 8P<2S88 -LM@3P 0h -LM8 P`=2S  K4@ (K $0KP( 040$(00 $0  p<S0,00\ >0R0 <2S @@<2S l@ p# -LM@2P 0h=2MS<2S ЍЍ -LM=bPVO|WL <0@ `lBpt2  l•p (0 0S 00 0lBt2p l•p (00S 0 00 0S (Ko 0 0 8 @X20X228 X20CX2(KoS(K -QLM`P] QU Q Ki<20<2pl•pt2 ` l2p (l3lBpt2 ` l•p 0XlBpt2 ` l2p (l•pt2@ ` @l•H$8p X2:<2l0C<2 K]p<2l0<2ppt2 p l2p (l•pt2 p |2l• ,00 p\lBpt2 p l•!0p XlBpt2 p l•p< TlBpt2 p l•08#8 pX9lBpt2 p l•00p XlBpt2 p l•p 0XlBpt2 p l• 0pX2q9<20C<2 Kiy 0-LMQP 4lB@04 pt2  B l•p @0\K04lB@04 pt2  l•p @0\MЍMЍMЍMЍ0 M0 Ѝ0-#204MS0$0 0A>0 0Ѝ!2010MPP 0SЍ(0-#206MS,0&,000a>000Ѝ, MR000000 Ѝ!2010MP,P (0SЍMЍMЍ80M0="R$ ЍMЍ0 M000ЍMЍ -LM 0p`@80S@ t1)X00090.0(Koap@lP8(.(KoRpsH@ @MЍMЍMЍ 0-LM@P|8h5 p-L M H`T  X@ 0 8^040 0:Kp $0K3PPP@$  ,0 0 ( (@ ^ 8 -LM800@0 0< =P}80s@0"0080<04 @4 ,04@\^j8 PL@&j0 ;0 p0 00 8R0>@ʅ0 S0000 08 0PLCJ 3( 25 < ( 4800 ^00 P80@ B40p*0 W!`@apP- 0#(0L",A P p4080< 04 80< `)(0< 04p090(Koo(K@0$(Ko9'@  (Ko3'P@ p-L MP H`T 08 ]0$00BGKp $0K2P$  ,0 0  (0 ^ @8 -LM`80$ @R0p4PP 00$1l00< @0, 00 00C 00$@202LP0040004 -LMD @ D b 0%  4 <00  @,04 `00R ' D"0F0< D <0R68 <0 p2 D@@]:#:zc>0PP8*3 S R t`` `0F 0< XP"$> @ 00C 0 市< 0pDP2$40S (K0 0040 0D 10R0S 88@P@P <0 00 0B$@Bp -LM80+p` ,P4@0Ppt 00 Pp $ 0040 0P  00K D00pP 0 j044080< % 108< 0, 0 00 P22$`D0L@0%0 P0,!0Q 10000P000 00 P0 0200R0 $`04 p04lB pt2   lš0p \0S <2S p(Kl@ < u  U 0R(0-$ p-L MPhH`T 08 :\00Kp $0K01P$  ,0 0  (  ^ @8 -LM P=b@Vp   0S P1,0 P1,0(KP Y0F P0 < 400p 0P  4# 800 0pS0000Y ,$d-$,$<-$1,0 @ )8 80,  0PP& 00S  P 4(p0` "k j( l0r,0 (KoL0,0(Kom@ DD0DDDHD-8M0=\ Ѝ$0 `\0d hPЍx% $ -LM=BT (KX20X2(8,X,H80 (HU(Z P% $`V 0SS lP8%0S 0C0b20000#><0 s2/Z P80S`  4P$0U40 W 0SSQ 3N 4 <00b<0 L0 0 倐3. 0 p#> 00Y R00`V00@ 1@*C6"*0S8# 00V00000 3 Y@ 0L0@*=4 R8S?X20CX2[$pW@$0S 0 00lB pt2  B l˜p 0\<0S 0 000@K*=0S<00@=*R08N 0MЍYꘕp0M Ѝꘕp 0-LM@PPK18 -L4M☚08 ,0 p=2S =,+ )0*T d<0@ %0& D('$Ry .$:R <R R R 0lB pt2  B l—p <\00?@), 0R"(K Rk  R zT9R 0RU80R _9R 0R 0 R H8R} RV8VUlB t2p  B l—!pP ,0 L#Ġ# XK WKVKU@KX0KV8V!0NPPS񟗆7$8$2$2$2$2$2$3$2$2$2$2$2$2$2$9$9$@9$8$ 8$7R RmU000zx7Ru 0Rr 0sRn 0o|7RWVU8VR!0NPPSL7$L7$2$6$2$2$2$T6$2$2$2$2$2$2$2$2$2$2$2$2$2$2$2$2$2$2$2$2$2$@3$^Ǖ= 0=lB pt2  B l—p <\)lB pt2  B l—p 0\@d0=^l— pt2   l2p , @TlB pt2  B l—p 0\lB pt2  B l—p 0\lB pt2  B l—p 0\lB pt2  B l—p 6\l— pt2  B l2 p, HlB pt2  B l—p 0\lB pt2  B l—p 7\lB pt2  B l—p 7\lB pt2  B l—p 8\lB pt2  B l—p 8\8l— pt2   l2pH ,T`K@( ᭵8 R0K$40#  $<@Q KO0KP@Kl— pt2   l2L p,P 0  @P ! 0 0R@1@!  T0Kx^ 0N4S= S* S@(U@1@# @8 C4  0\U00U  WU0 0 uU 0R0* R# R  & U`1 `#@f TP1 P#p@e "T@# t P X & .&0l#  #D`Dh>T@rD{DDl@ -LM@'P 0h5 -LMplBP t2  B l2pP ,Z9 <0 @1pCWp!rWW"@T`l• pt2  B l2 p,/.00 b` T!0,!@W 0 0 $Km&$K 0-LM=2PS 8\$@X8h -LMPP "R pW; 0``K00v0=2 VKlB pt2  B l•A0p \4` X2\"0 X2\"ypjT@GX2V0CX2(l• pt2   l2p ,` "pl• pt2  B l2 p,"`lB pt2  B l•p 0\4 04 $ @`lB pt2  B l•p 0\l`P80P8%P`| $P(`0P8t@@@|@ 0-LMlBP pt2  B l•p ,4K0K0h -LM`0Vp0P`VJ-=2 SlBt2p l•p ,4 0S K00Kh% -LM80="R<2S  0-LMPd%P@8nT0 -LM80P=b0V 9  0 4@pP1 $`D00%0  0 0R & 170<0@ ,0 00C 00 2p$PL@004p090!<2S(K Z( -LM@%P 0h -L M8 P`p=2S  $K0 0 0 4@ 0,K,P060, 060,202, 0,0 $L@,0T   $P,0 S00, 4090lBpt2 l–0p \0S <2S <2S l@ E-$ -LM@$P 0h 0-LM80P@="R 8!P<2S88 -LM@`$P 0h PM =2S<2S ЍЍ -L Mp0  R0 0Q6 0Y@To /<  <0)P8  8(Kx2|"8,T[04gP0 80 L 090\P  8 > 090QP8 1 0@9P02>U 0 <P@<0E?01P E 0R904 0 @RJ1?P5@TZ 8 { xu<(~A PD 8 43 2 \!l—Ppt2 P l2p ,l—@pt2 P l2p4 ,l—pt2 `P l2pH ,0 l—pt2 P l2pL , L4@ Hd+lBpt2 P l— 40p\dx+lBpt2 P l—p 0\@ Fl—pt2  l2p ,@ T @P@T 8 OlBpt2 P l—p 40\l—pt2  x2l— |,00 p\lBpt2  l—$0p \lBpt2  l— $0p( \lBpt2  l—p 3\lBpt2  l2p ,lRp t2O  4l—@00p \lBpt2  l2p8 ,l—Y %Ypt2@a  FN.B Bl— c0#1A80p4 \lBpt2  L"`l—1p@ \lBpt2  0l—:pH \lBpt2  l—P 8p\p*lBpt2  l—pH 00\lBpt2  l— 0pL \0@ L*PE*l—`pt2 ` l2pH ,@ T0@@ 004  HHDH3lRpt2 ` l—4p1 \< 0@ꘕp@D@@%I$̸D>$@ -LMl`ppt2 p l2p , H H81S\ l–pt2 p l2p ,lBpt2P p l–0p \@)l–ppt2 p l2p ,@dTP ,lBpt2p l–p 1\KlBpt2 p l–p 1\  DHlBpt2 p l–p 1\@ p-LMP/l• pt2  B l2p ,h Bd0 @`0T T @0`2KpV0`2 <@@@@T@h@ -QLMp`H Q3 Q Ki<2l–0<2pt2 p l2p ,DHPT9 lBpt2 p l–0p \2 )<20C<2 K]lB pt2  B l–p 0\<2l0<2pt2  x2l– |,00 p\lBpt2  l–$0p \lBpt2  $l–0p( \H8SDHT lRpt2  l–@@ 0p\(lRpt2  l–@0p \lBpt2  l2p8 ,l–LH pt2P  10CN>C 0Cl–0b "!HQ0p4 \lBpt2  L8p! l–p1@ \lBpt2  l2pH ,lBPpt2  l–p:H \lBpt2  l–P 8p\%(lBpt2  l–0pH \2(<2 0CD(<2L(H( Ki^l–pt2  l2p ,@?lBpt2  H(l–00p \*l–DXpt2 p l2p ,l–Hpt2 p l2p4 , L%I$0U0U 1303 22a0S10MЍ0 M010Ѝ 0-LMl2x"Q@P@ p,l”x"*0 p:\8MЍMЍMЍ80M0="R ЍMЍMЍMЍ 0-LM@P6S\0&\0`0V`@8hE 0-LMP@640F8h8 -LM`PQp 4@T0000 L008 SM 0S R06 0 ЍЍ 0-LMP@6D0F8h -LM@P 0h -LM@pT`; 0S8 `PU# 0 0l0t#\0\0\0S `Pd@TQ d@T Qqd@TQj000x&\01x2 x0v#\0Sn@ -LM80@PpO80`0C80 R 0S R06 0 h -LM@T`p\D 0@#\@0P0 ;0C7# 80 0 , $(\LpC 0&#\Q 0PKh# p-LMT`@P\ 0#D0 D0T\0HP#D@D0 SH@P0\000Kph" 0-LM80 0&@0Pe8h -LM0`SS3 0 00S8 @T1 Pp4 <D 0" 0S P%40S %%88 8pc4@T@p +%20# 0 000i#"888S@P @000S8c$0c$(c$ c$@T% pPtl 0"40U01#.#8*"*8 #Ƞ00PpP40Sd@T00Y@ p-LM`P0CT0S@en0D000C! `0$x 0-LM=2PS 8@8hh 0-LM0PU 80S @ tl 0" 1S Rl0P8h$Q8h@ -LM0S9 p 0D<  !0% PW@S4PW D<@ 0!D`0 !&888 D  0$Km!l90PJmm@0M 00S ЍЍ -LM8 Pp`=2SC0 00 @0! 000l8Pt\  1R11d\c0@6\ t 0@00 hJ`@lP8h@@H@MЍ -L MP1l2x"p ,!BP x0S QE\P*,0K!Pk~p`4,0(, 3  h ,0Kl0p@t6S\06\ ` ^``pV\ R`0`0`0 \ Llt 0 0x0\0`0d0* KP -L M`FT 4064 L040 K?*,0K!PpP,0( P,@ 8,0K<0@@Dp6*W40@&P -LMpD @ 00 % @< 0, @@1`1 F04  .X0< <0T2-6-0P8 <0   yp340 Q8 @!8 PP^ T<00 e p><00c S@1p301 :J$JJd T@`pW000 RP @7 8:#: \ &0^ 0408S804E I /TP8 !8 W00S 0p D<4 0 ` P(K0<90D4 0 0P -LM80P+p ,@P@| `P@t 0` 0pe408 % 4 01<048 0, 0 00D400 05804 000D00%0 x!0Ph1000  4D4 <`匀`S0S@@& 6P00(K<2Sl@ e4K  00K@P  i f@4804 90404`44D<^vX$ -L MP<FpT D06D K0H0D0}K (0K P`(0$@, à   P (0KT0X@\`6 VD0@ -LM p@="PR ` ` R0  0SP2`,0(KP `2`,0 Q Q Q0  000 P Y8  l` 0 8P= < xP4 <` 08 004Ru 0\4898 R001; 84;!   40T04 ?0\0D 40008P񟗞r$Tr$@s$s$4 H!, 00C0SE0 40`80404 R `4{ 40@`P0,0\@4Qi(`0v,0`N @4`Yl0,0A@46`M 0 4(SDDP@p@XDd@D(D@D8@ -LMQP0 <0 @1p`CV`!IV@x"l•1@  p,/.00*b T!0,!@V 0 0 i 0-LM@P l2x" p,?p P 6P80=28l”x"0 p\X2\"0 X2\" #+$X2U0CX2 &00l”x"6 p\ h8\X2 0CX2="8 E PmPP@@ -LMx"l@ p,6h -LM@P =2S <2S l2x" p,?0hrl”x"p \ -8L0M08 ,0 p=2S >,+ )0*T d<0@ %0& ('$RD9Rh -ڴ9R Dڣ R 9R 09R 9R +R R RT00@[ , 0R((KA?CR< "8R, RU0008R @@ -LM@P 0hI 0-LMl@px"0\PdU$ l2x" p, P l”px"0\PdU l2px",P8  8@@ p-LMP0U`0@PUJ=2Sl”x"p ,6?0 R0S x00xh -LM08 SpD !=2S D 40"! B0AR0q03Q0SQ4  Q040  Q 4 4 @7P< @ Ջ0@0 P00 80 @ Uh0d0@ 80P<0@ , ʠ0:#:0d0>0.S 0!C60,ʠ 80004 80 80QM4 PU< 0P*@0, R00@`>  0^$0ʌ@ 0$ 0 0 4 0$0 000(00 0< 0Q $::5 0%(0 ,0   , P @(K1910d0nD80S4l2x" p,2P0C" 0 00C3 R PS0Q< R&@0S@@E\C 2 @ 0S00h01&0\0&\0xS`0`02<Pc TdD 804080@0嘠060&@p$@\<2S(' @ @ -LM@6Ph -LM8 P`=2S @  K 0p,K (0K:@P @d,0( 0 (0S <2S 00& 6@P@<2S Ll@1 X$ -LM@P 0h -LM8 P`=2S @  K 0p,K (0K@P @ ,0( 0 q(60S <2S 00& 6@P@<2S l@ DX$ -LM@P 0h 0-LM80P@="R 8EP<2S88 -LM@_P 0h -L M=BT (Km.4 妦 0 l2pBPxb \p,@0 D 0?00 P Z024(Ko^DT@ -LM80 `=2PS0paX2Sm0 Q 00 @0!Z00@00Pl6P8H \T@ 0\@00 ;0CPU D<@ 0D@00 ;0C4PUn06@{  | 0 00ikP@lP8 00 p @H@\@MЍxMЍtMЍp 0-LM@FPe8h-8M0=\ Ѝ$0 `\0d hPЍ  $ 0-LM@P\T 03HD0 D0D0 SHH \0T%8h -LM00`@pPL0 ?00h8MЍMЍMЍ 0MЍ꜕p0M Ѝ)꜕p -QLMW QO Q i<2&0R`<2@6Sx"l2Q@  p,3@0Sx"l˜@ 0 p\6Sl2px",l˜00px"\@dT l2x" p, @<20C<2B`<20<2l2p ,w2l˜x",2 0p\&l˜P0x"0 p\6S!`P6Sx"l2A@  p,=SPx"l˜@ @0 p\6`SVDl2pb@xR \p, 08 10l˜x"@ p0\@dTL ~l2x" p, @l˜x"6p \2i<20C<2il˜p 0\2W6S@6Sx"l2Q@  p,=S@x"l˜@ @0 p\ @  @@ 0-LM@PPmBK8 0-LM=2PSX20QX2 @T|2 6S m6SX20CX28 066 -LMl2p $l™xp ,l2p ,g0`2 P^D0S l2px", Pt$$$l$<2奯 * 0)P@0"0R2 2 !Q l™,0x"0 p\e ¡P  #j>060 <07 ` @40&@T P? L(Kl™p 0\,  ;2<2@:!0=C 0Lp@Dp @@@\TD ;0C`@0P1T*pD 0 P@PD PPLp\TT"P@Ue:@TP!0  k@P P :0@00 ?0C 000LT\H@D@D 0Fl™P0x"0p \m pmhJl2pb@xR \p, 08 10l™x"0@ p\dZl l2x" p, l™x"6 p\K "P001"P ۠P<]  00 04꜕pD@c$@@@ -LM08 S@ 0S R60 0 )D0 0%0 0<0 0S00Kh -LM@80$ PR`$0S 0S R06 0 D0 0%0 0<0 0S00KD0 0%0 0 0<0S00 (K $0K0@P(0$ 0 $pn0S <2S l@#$ 00X$ p-X0LM@`TP @T 9S  @TxԕpMЍ -LM04 10@P  >00t*R90  0@-qMP) HT L) 0!"4# 8̓ t\0S \0S  RJTPP \0SXЍ0M P P Ѝp0: p0C*:p0: _0C*:0Mp3Ѝ0 PM Ѝ 0 0 @-MQ 9SL$0$$$L$0@9I )QЍ 0@ 9I) 0@ 9I)0@ 9I)9MSЍ Ѝ -LMb@VpȐ\P RU00S ʜ\PQ 0P'S% 0QL 0! "4#8<V+*t9X ",0( 4;2( +>`P >VX ",0( 4;2( +>$0"` >405 6478`:p ?;P L<$+4"2L)540674 8<2L)! 0"#4 8̃ˆL405 6478L.@ >PR,0( 4;2( @$0" 2" - >. >0S022LS0 $0@9P8p @0 @@(<0=|:`>;P@ $?:P(; W 00 04808@V0 :0*:1 0C*:00 0@ p,H`P0@pDP0` p0@ L#D <P`0@(!(Dp#L480@@@@@ 0-L$ML@! 0Y"4#8 4 K00SPtɔ0X R1X R0K! 00P 040SU\p 0(ɄK0p 0@`@ 0-LMP@r00P0@T8y@ p-LM@P`[T0S @ 0 0 0 8 80P8 xhZ@ 0-LMP@=T0S @ 00@0@0  8=@ 0-L MP~@# ,0  0   l (00(0 ,00,0$00$0K00t   0@@ -LM0 4 8<Sd@ 0-LM0PHT JT LL  a:P88 -LM*@R XQ\0\0\0:X\0*R*R XQ\0\0\0 :X\0*R*R XQ\0\0\0:X\0*R P ` Rd0d0d09` d0 PPM Q00090)R P  ЍњЍ -LM@h -LM@ R 0S0S PP 0S00 㦚 R0  00ԕp p-LM`P `R@ 0S0S  R  㸚P00xxԕp -L\M@ %㨚0  0H P`p4 %8 < @ D @4 8P `p$<, (@4@,D0H80(K@ 0-LMP,0U@   8h,@A@ 0-LMLIPP @90< H 0 48  -L M@p`nt91XPU UV t)1L)p 08`mX`p 0di+ Ki@>$ 0RM*ЍH <Ѝ p-LM@P5` xh} 0-LM0PS S 0X0 *X\ :P T0S 4@0TT0 \@T0T08X R\0\0\0:X \0   $@ -LM`p Q9 Q7 Q3 Q@ : Q, @00S"  0R& 0000S 00S0`X0:\0*X`L:PJ 0@L:PJ 0S\0 Qi 0R\0 Q<@ p-LM 0"# "@P0``9H:UH D0 20l'#PP0`9,xPt@D -LM*M 088 0SMЍR !Ѝ8 -L@M܀0P$0  `R00p- $ 0R$ K^@K:7W [ 0 Z0KW K[K^pK]pK\KL @VKs8L HNKn8L X>Ki8: 0l> -1L MP U$ . ,@K7 7P$ xW! \iV#`V P0 48<S@@T (T }7P < 7$ 0R KzW >렕p0lq> -LMp)(0! *@@"`+P 48#\, @ n 21C0a1 @   ,7P0 48Q Q QD H 0 $ (,7  77 048 <   6Pa0 48<@(0) *4+8<SL, 0RM(KO0 0 PP0   З0 $ (, B6 048<#,##Ƞ 00 $(,0"̠""N 800PPPW00PPP ]0l@|@> -LM Ly@W ßX9 "10 0 0 wP $̠$$$H  @ 0 P$ (< L  "\!4!!̠""HP 0@00 G6 !" 4#`8 ,0 W9 * Ʌʅʅʅ ` @`9`d0)40@ 480<(0|`PW$ 0-LM@P YU 89 Ac 0 r)> 0 9Y @9l@9 P R880MS880Ѝܔ --L M@K8 0 @/K -LMh@uP , P  A$A -LMHpT` +^JT L p E2Pd:S +^ <A -LMHpT oJT L p 2PPL9 h P PPQo <A - 1LM` hpP( @`0o/K\@8P ( 0R)$K_K #11 S h ^0$0K 0RSJ/K 0``p` @p@`pW`p$Vps0ledAPAԦ> -LM@`p  PݑPL w X)R䁟`  0np)t R t9 RX9"100PVp P Q0p9  0S00Qp p V#t9PP 0 S0 S RQ  PU p t9PPUpp P t9 P2T!   lPP ( DAtA --L M@K8 0 @g.K --L M@K8 0 @W.K 0-L0LM @ PhP? P P8q -LMS8# 0 0K cmP`XI 0ȐK:0 . 00h0 00 0h!0 T` Pp 00 L H P P P l0 0l04 嚂 I0 + 0 S ?04X@ `p XP1X#\ /  /?04X@@0Pi(K 00T@K006@0@psAA -L,Mh,V0,0 . +^jV* L p [0P4K /4@T@T  I0pPP (0 @  g/P p@+^  X@@T, 0R7(K @ _/L)04 8HAdAAA 0-LMR0 K0h 8A 0-LM@P90K0 p-LMX9PS ix  pI`TL . ֎x\.@T \ 0PA 0-LMɠ@P 00K0 -L(M0P ,0 P0 0 L0 ߎ`P <K-PpyW H D @ \q P 0P048 L2 $(T\= pWH0SZ  @Qx Pp9St \pq $0( 4L8T\s P t9 X WW \q0y pP 0P L1U% $0&'48 p-L M`R@P !# P $88#Č@ a@0,  @,KpA -L{ME0 , ! , 9SM S D, 0Ri(KL)! 0"4# 8  t@X RpX0S pW` P @p`X R 7AX0S3  RL K 0 yKiP   ß@ h1 }Ph.K0z}@P ` h1 }f0  ,!1 S L K(K022 1RS L KSKL) 0 "48 < P @Q  ! }K 0!R  ie !1R[{K}OK0@TPT[D0 L KP PP 0P0Q0S`L)000000000K +!LK\ 1 `0L 1002@3 48PAdAAAAA<$A -L MLɐ 0!"4# 8  tpX0SP  qX0S  Rp (KoPW ?40 \bVF 0S`V> 0S> L)000 p h0Q@ @4 R 0 S@RXQQ 4 R 0 S@RXQT 0 xY0h 4(Ko0S*i0P@ 8?)\ P2"0CR202 0S00 㭋Ǎ ADADAAMЍS -LMe\pK 0, PP P  x @, 0R(K  L@@x}Kg@P $@U h17{P dP@ h1 ;{dh.K0@{P 1 S  02(K (RQ 0 T h1{dW/K 4"  @  ! 2  "<K@K  !  A \1`02 h*K"00B@(,"042 *B<K8 (*H0 @X@ m0a 0 0 0 /0C B0 0C B0 <K     = B)1#4!2 1",,(##Ƞ0702>? ;90: =!"#0123456![8 1[ <0@h*!1H0!X 崊LXɀɀ` P*\ ᤊt 2"0p) P&Oᚌ"R, 0S0202k@X t P  F BZ  <x  Q "0@ ‰0lAA,>ApsedAPAdA@@$A@ A 0-D1LM PR "RE HT P0S J0T8R R R w8 8hEp)R \0S \0S R`]8 lxP L)p L88h$PApA0A -L8M0pXK@`P 0( Xɔ\048 L1 $(T\ ( 0Rc$K"1   P dX1U8@K `0` (P 0 4 8,R* R R 004 80 0 @00 @ @ @Xh 04 8,P00 $00lmarcA DACRAMAA@8> -LPvM0,0 ! %((0"4#2r 40  $yKeP t ! `ß, 0R(KHß@ h1xP Ybh.K 0-yPcŸ h1x@PDb1 S  `P  P !>KXIA 1 1K01 <Qp_ 0S%40$ $yK! 5ePKŸ h1sxP@0 @PJ048 1 $(Y !h1 dxa` h1[xarLvH1ZL K 0 0P& h1 Axa VVQ  PLh1@  (q@ l q'100 $0@0l$ApsedA marcL>CRAM|AAATA -LM0  <0 GpX "10!P080 SpiV4` + 0㨀40 00  0 \ 8P0\X0048 L 1 $(T\ `V X0S\`V ҇Y  ̇4(K0U \ 0P0\ \ &4\4 8 . <nL &000 040 DmarcCRAM -L0M0RX ,0 `S Rp@T  㻇T0p900p APt0\@X0, LK 0PKcP4!Ph1 6wP2 h<'P0 `0 0S @00$@S p TqT  XpW@d, 0TR(KT0P T 40T0 P`T +0lps DAh> -L0MOp \, P T0 F HPQ8  J& <0\9 PH r ?bPg/0p #18#hV*@ P@VP# )P L@K 0   Y`  UP ` , 0RE(K  "pX 7 " PP2 P dPPp@ P! L)540647/8 <S `  ` ` `}? 3I2Tʘ0\T9 x9|I @ P:0 x |&- P R0 10:(*8\`P@( L 0 4 80P 0#,##8  0L" 048 <  " "4"Ƞ 0 @} p9S 3#V 0@@ T0 TU T * <%1A p |`P |t`TQ PaP0ST9V L) p ,L)0^\IT x:S P r@TXʘ\m  T0 Pe `#V#`F 4` t/`L `+@ L$ 㞅L p hps%hP69`SW 09L `@  {p QQL) p ` , 4S PL @p0SP&$<$$$301 20@L  p&%L9p0 /P  L) p w'Pp .%PL  L9 p0l L 0l A`A\ A@AAxAx> A@$$( A AAAA A A A| A A A<$@ A -LMP08p@`6q"81TH ,1T6  1T. 1T' 0H0/$$0T, 0TP00T 0T[00S0 0\ B&B"B!B%B'B(B)BݽG=!40BSM 00Q 1Q Ѝ-4Ѝud@ -LM{P0U ,0 L $# 8S 4S 0S  0# 0#R$ 0$0S {0Sx  Rqs  㘄`P $00@ ]$P  W$PP0c L0@ᆆL8!$/KL^P0c U$3S 8S `4S $S$   $0S$% $0&'48<04 506$7(,r{ 8#RP'XPU$  >#PP\f 0S `0S$ RQ$ $`U 80X080X $3`P\ "pP 5406748 <0 1002@ 423P<0! 0"@ 42#<0 0@ 42<0#80\P0 0S8 0SX RQX Xp8X8s P\$P`4X$4c   0jP@    0bPD  83S (3 (XP( (|P (0S 㫃PH  (# 0P L,# L K,H0LK\0 h>#,0:98T =<ČT>Ȍ?; ,H  P ,#LK09=8< >:; $? (H3 L \(@,P, 09=@8<>Č?:;P|H Ȍl0`4p",H3 8Y"HLH H0LHO0X0HL"RR 0SH0L202(XP( s8< 2K."0s0S ,  "P 00h0  CR @#00D3  @0 QPZ2Q80L@K0C80L 0L 0@z@1 r! 0X @P @DX3 0|Sl : $Z 0@1 r0@嚀P`p@ČDȌ,$Z 80R L#\ /1@6K0p 16K   ` 0CS PL0@ᙄL8 2K0L0p<# <# XYY8cP@XpT $PP  B >U@ 7`W4P @$PP  * &U@$CT $PP   U@0Q0C 0#@ T@3S  D\  P, 0<R?(K4Q @  !P0h0 $@T  !PPu sX 0S5*>L3Ds @s 83S# `< w4 A 0-!LM0PS0 0028cP@ @3 M!⦓+0/3<00, @K u#S υ\ 0 KL L0 < K0蠕p A Aԕp % AADhf7$qp - LPM , L9p89:=@< ;P>$?(<L  %P\ X A P , 0RZ(KL@K L X0X # -LiM  L0 ,0 = <Q0@>?`@9 8p ᔑ唁ČȌ/0P:̌p ! ; a唡! /T`Xl 0O| a  .K Op 夜q ȁ b?KKAsSO<@  !  ʃ|kK  ഑ 尡 mKcP\  |Q xa X ڀ!@xX Zz(|Yv$ 0 ATbK~KpWP`P`B2MP`.K W~c0`Ap X P P` `8Q 4a c|( $ ㉓,q 0 \ (|P @X`@A HQ DA A @h ?$(Yt p [K]KpWP`P`B2MP`]/K /}c@`(!\|Q0T0R d  0 P`\A 嘡9S@ N?K0@81 4A ~KP`0PU`@p0q , JK( $ x VFژL9L) 0!"4# 8̓ t 0X Ra 1X R[  Q<P 1AL)p xJ`QX, 0RO(K$axqVꘁ們L)p 4u| U(|Pr$!x1Rnq封p !""4",H1 @  < D! dXO@b0  凮 !tꀡdW lQU 0 30l AH A A A Al A A>@-L)@ 0!"#48 <2M9ЍMЍ -LPMd 04K`0 @#\@ 4P` L)! 0"#4 8<8  P L  ?@ <0 004 L@4;T$T0 X a`0T@t 0 dkVTn 0H D0 XKpT0S[W `H0t L 0X$(^ ,K@PK`VX`XKWVDA $0 0$+44 00 `8@\@H` rPo @KQ @ < d@ <0pk XK X T L@8 T 8 Q 0 H D0 XKT0pSʦX@T(KUP`5 0@H0 D@ XKp0HK@ H D H@P YR1 0T@ TdpkXuXWT0SpLD QT0Sh}U{xXUUPQG`0,L)p d A A M-RLM0 (KL9R ? 8 9 : ; < = > &L ty908 :=<;`$>0(?P ČȌ<L "l!4!Ƞ!"D"X Z?`90:;=@>P8< (Ko$ A - 0LM@ 00(0 :0 9 0X*T:D A%%%%\)%-0 4 8<SMЍMЍ 0-LM,08PS 0(0<@iᆾ8 -LM L ?P@ D0HL`P0 0@ GP 0   (K04 0@D0L)p T 0,0 A 0-LM,08PS 0 ( @08h p-LM`P  2|hHLp" !]PB0@pPqIT P R 0<0c`@Txhq(+% -LM2@P 2S P P %|"`JpP P {0S0 (  R(00P2  -L MP0l0p 0h0 ` Ph 00040 0@ $ bR00S40V<4 0"?110AOHL( 0h8p 0 0(0 40 0-LM \@ P S  FL) 0!"#4 8<98q P82 Q " R%IP0#2  P  0-0LMP0 0 0) 0@ QH8LH@0@ \:*808 X:T*000 `:d*(0( x:*8 A?%0%5%(H%,%E%*%0% -LrM% 0L K@, PPFyKVPP ? 4 ("(2H;0"X6 x(8Ly01`X99  \Ɇxt   pq7 x @ 8x00!   08   B\90L)\)(0*+48 <0# #Ġ#+)*(0 PY  ]xV@ t P  Tx Px@W  Ix`GL KTZ !A -LFM@`KO_Kp@1 , @KWT\QM  @!  \, 0R(K0l> -L{M@`TpP@K z K胏K,1PU @ @>U@ -LM ( h9i)Pj 4k8|WN@ P -L(M⨢0 P,0 P04 8<S S `, 0R"(K<$0 0@ QH8LHdA[P  <$0P  8mPYU<00`PU 0h0㑵P TPK$  $L)P L 98:p<= ;P>`?< L#?1SDOpPP0U ! 3(00  D0 {`P HLp !]P0@pPqr05mqi0l AAA0>A(+% -L{M@`TpP@K zX K胏K,PU @ @⬌U@ -1LMp@, h9i j4k8 XP` @P@K) & #, 0RY(K  vP 0! "#ČȌ̌h  ;tp7 @K  ;+@K q@P,P!0 "# ČȌ̌h  ;~p 0hkIiIjI ( @K;@K o   (vP@@P0lAL> -L_MQ‘0\$0 @ \% goKpKcK@$ 0RG K2S " R.EP@goKpKcK P 2SgoK DPP 1SpKcKpK DPP 1ScKcK DP P[@屶0lh> -LM@ (p0`0@@@w40#@ !@"@^!0 " #ČPȌ̌ h;0 hkIiIjIΌ; N0  @@@ K M-RLMp0P`  K u@ upO0 0 \90\IL))(0*+4 8<0###Ƞ+)*(02s- &P2P000) 22s# @$ ,$̠$@L9$`$H:? 9;=>@8p80<@(Ko$ A -0LM@ 00n(0 :0 9 0X*T:tAJ%lN%xN%@-L)@ 0!"#48 <M9ЍMЍ -LM,0@SP` 0(00  L |pT0S ppPL8p  0 (0 |AAA -L(M4K$"`YP=L)4K0P 48<@4 0  .  <   0LY@ty80 !0 "# n00@1X R#X ty 1X R02I *(KLY 0! "#48Q< 02A 0O4 K  P  <0Y! 0"4#8 8<S 8 L)p iAA A 0-L$MLI! 0Y"4#8 4 K00SPtɞ0X RO1X RK0K! 00P 040S/ S 0S(0S00S= U`T%T%T%T%T%`T%\0<' \Ɏ$ K0\0<&p 0\0<\0< p 0($0K0h @`@>A -L MP@`Ṵt)q0X@T& T U%8V%U%HV%`V%U%U%V V t)0L)p 0PV0X`p` 0d9+ӱ Ki׳0FSV ViV V@> M-LMR0 TOKL9',&&Ƞ&'D'X? 9:;=@>P8`;p?P4 (8N  0]@^`\` \0 Č_@ȌlmP05 eLQ\pET ` E0LRQr5BTPXp tᄋ4UP L0 jx t  | Pt `x0;4d ? 8 ́,Pp @l vhKppKpWP`P`B2MP`p K lcP`HU 0X`K@0@pSZ .PIHP 9SW0K@ | 40K<K X@< 8 P L|PT`ULL) 0!"4# 8<P`Utɚ0X R;  0X R3 0@P1QiL)p WP|T9S PR L)Xp (Ko0 8 QX\ l9 A A A -LM04K0 @(&@ &PLP`L9`]!\ Pp"@^ $#_` p( Pp Z 4`KP  0@Q0@5 0H@Px@ tP 娀tP0H x 0c9C  0 Q 8@Qᄛ4X T0 0K0 @ PL0 H@ X0KxK0S@<0 8@ @_`@ \P D @ 凔ᦛᆄ8Lx K PNY\Y@k  L9LK`p ` p KQ p l l0\`( ̂S c_ x K kD K | Kkx K |@ R0Sh d0 ʮ 0`K@`p` |p pP `0K Fp`7NV>F DKT. T X`p0##< K 0`t)01C X R pWh w(K`pQ`Kp l T X0`##02, p`KPp 0 pP``KpK`Vp`` \p `D PP B0p@K0@ PPP h0 PP A  0p@K00PP P>P P  0 0 0PRULL)p ^8 PR 0S 00@0 0 0X @X0`*\ :圠h e`AAlA 0-L$ML@! 0Y"4#8 4 K00SPtɔ0X RM1X RI0K! 00P 04 R- @R 0S(0SR4U hm%Lm%4m%m%m%hm%\0<& p 0\0<' ɄK0\0< \0<p 0 A`@A -L MP@`Ꭾt9q0X@T% T `n%n%pn%n%pn%pn%n%V V ǭt)0L)p 0PPVX`p0 0d9+⩫ Ki譭VA> -LML9@] \^_  Lp*`AMЍ M-LMR0p`  KL)0_^0\]LɐpG] \0^_48<4@s ǏP`7"#@$#$#\$d$x?9 :;P=`>p80<@ KiA -0LM@ 0h2 `0 p: 0 B9)D0D X:T*<0< t:|*404 :*,0, :l*8A l%Xo%do%W%P^%e%Y%X%m% MЍ@-BAM 0 0#^0ЍE-Bt MAp `P (  0 8 , 40<`. VPЍ؜p-d0d  M 0"  P1 0<0Ѝؙpؕp 1 0cMЍؕpؙp-$1 0 MЍؕpؙp -LMl`@QU   jP 8p8 10!  \@؜pؙpؕp -L M `0 4 V@Pp+  40 `X@P&  0  S  jP"   00 0(K P  `P   ^ -LM 0@ P`,0S (0  L pdppP L(p  0 (0|A4A -LM`@P岬p0S  U R P D8 P D8 0 i000 D8 0D0>i֫ -LM 00 0X0 *X\ : 4@T @T -LM04K0 @D.@ PbP`L9P]!\ "@ $#`( ^_` X Z 4`KP 6 0@R0@@ 0H@P@ P ȀP0H ㈐ 0c9C  0 Q 8@Q㣔4ˉ\0 0K0 @T0 P@ 0K0 @ ` P刀KL0 H@ `0K0S@D0 @@ @_< 8 h@ dP 凔ˉd ` `>@ VB K QFQPg븐`L9pTKK   堀K KQ p l l(d ̂Y ʁ K gL K | gE ;0  ? \ `@0##D K H0SDڸ`@t   1X R02 X x R PU  @H  RN P Q ! `Mp)90 KTXp  H^&`@P\ K ` X p@K00XPˠ PPH@_\ hKp0KQ h d   PK`P`P ` X``X` L0SP  pP ppP} L8@zP uXp  0Xp  K PPpPK```K` @pPWx K pPK`` @poPG` K ` @``P8pKX  K  MP%p0K K @px@  @:PpPK`` K `` @'PY \f  %(KY@ x Rt0S@ PU|`V@|\5 X%Y#0hQzhKp l u\ `P0##@@P Px@ tP zL^ P`@P ` pK K X L@TP`@P ` 8P )  0 0 00X`Wx^OFK p@0ipp XpPK` K `X`ˠ  @@@`pPiH\`0@X ( xP* \- ; 0p0KX@S   @@ K  lPD`H0O\ʗL^X Y xPtPU \|^@K0@ŸP 0@$p p XNp@K0 K ```X`0 [ P`p$P Pp@K00 K P x`PPH`VL`0@X- x^/ Q2 PU5 pK+X0 !0000 K P`HP0OUL\XY x^tP Q| R PU\LPL\L^*뼀X 0 0@ 00X 0帐X*\ :张* y(r@AAAAؙp`AALA -L$MLɐP! 0i"4#8L< K00STt 0X RM1X RI0K! 00T 0< R- 0DR࠳ $0S0pWT4V ꀆ%d%L%%Ȇ%%^0>& p 0^0>' K^0> ^0>p 0Hj@uT `t9`X kTYA`@AA A -L MP@`7t9q0X@T% T 꼇%<%̇%%̇%̇%%V V pt)0L)p 0PP*VX`p0 0d9+R KiVVA> -LML9@] \^_  pHL) 0!"#4 8<0S039`AMЍ M-LMR0p`  KL)0_^0\]LɐpG] \0^_48<4@s ǏP`7"#@$#$#\$d$x?9 :;P=`>p80<@ Ki A -LM@00 TP0  H p:09X*808 T:t*000 :*(0( :l*@A8%%%q%v%du%t%T%MЍMЍMЍ -LM 0 !g Kd''T% -LM)0 g Kd''T% -LM`ePp< (00p04S80,0d0804p 00 , 0@07< w٫&((0"4#220&$ 04$@ 0 Ki?iTDHATAWEVT% -P L dM&@ ͬpP` 1TJ x1T) *`ᑧX1T* P1Te/a`010S ` 0 ݰ`P `P0T% Ȱ0 00" 0`0 eEd@ 0_e/E d 0Q %40$ ( `h`llrdAhdsd edAk~gdT% -LM@!88# !SP1 含p" @0020p(P00`t4Q!80,@aT@!0   D~`800d<0G@ !ᒥ o, 8+000, <6@ o耥D _`llTDXD - 88#TLML%p`P 0@* ū ¦ll - 88LM#@(ޫPPp 0`pP ᦦ0S  0rp0 pPll -LM@{0⮰(%0L0M0Ѝ - L؀M`p0pcP$  Lc@P P00 `(pPp 0P,p0X@P00 @, ill(0( 0 MЍhl\l`ldl 88#4M P00Ѝ\lMPЍკ(0M / $ \Ѝhl -LM@4 R00 0S00hAll -LM1@s $0<0 00@-lll -LM|p0PṢ\\0`@ L 0?V0C0hldl`l 0-LMDP00@K0 P  0R0K00l\l> -ALM 0 R hlll -LMp0PS  @ 0RK8`K0HD PP ~# 忡0l`lA> -LMp@W `P L @?V@W00 hdUX0 R LP@ ,0?S?0C00ЏAhl`l`lll\l$Adl -LMD@0 ( $K,0  L,K 0RKg0l> -LMD@0 ( $K,0  3,K 0RKN0l> -QLMK 0K 0SB$ ' K p-LM PK@` 7'TCJ |4QZT00V0S 10C Kp M00Ѝl40 MPP 0SЍlL MP P 0S00ЍЍlHAMЍ -L LM@T00 ((0 R00@ll8pTA p-LM`P@P @xhP , P @``00x xhlAl|ArMЍ -LM\@0S P@T <0 E,@ThlAA(AAMЍ -LM@ +h\ 0-LM@P0S 40@T  @T008ll p-LM`pPP @0 0` @0#xA|A 0-LMTP0SH0@T  #@T008ll0@-M\P@ 0R R R  0R RT@@\Ѝ0@@ 0M Ѝl -LM ( K($0MQ Ѝ Ѝ"q4AA p-LM`Q 0R x 0 S0\ P  \ 0S@@PP   \ xh qa0 -LM孟 X -LM妟H -LM域 H -LMI 㘟 -LM咟I -LM ㋟ -LM P -LhMa0@K 0 Ppm 0RMK@p P& @lPK1@0 T0\0X 0 T0P 0 L0H 0 lK@ <K0@ <lPKP@@  P / P @ P  TH x Tʺ,j l 0lA4AAAШ>A -PLM Z 0Pp;BLpMЍJ(MЍ_~(Q0 hMЍ/bps( MЍ✺(MЍ MfQЍ1( MfQЍJ( MfQЍI( 0MfQЍv2q(l* 0MfQЍi5q(m* MfQЍ[1( 0-LM 40fRPP@T  2@T85q( MfQЍ1(MЍB(MЍ.]( MfQЍQJ( -LMQ @b N QAMЍl -LM`r0`@ 0 P# PP P 4D 0RpKTH PK P7 P1  @T; P  !0@ 0K\ 0K0   h1 R`1T1X!P!@10!0U $Q @ 0w0@@a P < @KKeP00  00@@ O P * 00 0Mx͝@ P h KBPL yKx 0lA p@plDATA -0L4M0@ 0 @K D |0 R l0 d \\2D0 R P <0D  KDp@pLpBTA -LM @ Lh (A 0-L(MQ  0S!!00a0CS%%x%%%%%%%%%%%%%%%%%%<%%%P%%% 0A^S6 0R1K0 4K0@@  | 4K0 @ L <4,ܚ0l4lAAp;B(AAAAA> -L0M`0L P ,0 PQP ZJLp P@T@ KP I0DP1S44%%%%%%%%%%%%%%%%%%%%%%%%%(%%Թ%%%%%4%%%%%%%%%p%%%ܸ%%%%%p%|@PTIY iY``P \jPQP Z<,0 <S`(K H@K 0  L  C   :|P PPt 0@^S t+ PPg 0@^SD H@K 0p SpP  G  > 0@^SP2p/-t  lh0`*d`l0P8֙0lAA@pAA,AAA4A$A(A

0-LM0PS@t   8hx l -LM@P P P P P# P P3 P& 0 0 0  P 0 |0 liP  P D^ P UpDp8p p8>AA -L,M 0sS  T `PPKV>  a0@S( K( \R0S  0S0SQ+0@a(0Lx U TA00 01 (KT0SK |1 ` ^|!0S PPB`aTU p4K8 4@ x40cP  4 n0U`&0S@  @ 0a0C0S0@SV T0P000 R  a0B0S(0K +00B R0:S 0:S_0PE(0L000C ST0 ZWTpPpAtl% 0-LM@QPJ @TZ8 -QLM`ሀp@00fT*P 00fS 0c00f000f0pp p-LM<@<`04Pc0`000xppp 0-LM@QPJ @TZ8 -LM0@@~S~%<%h%p%%%h% %h%8%%h%8%%h%X%h%%h%\%%h%%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h%h% %xx6 Q 0@^S)\V Q0q0 R:@0 00$ `N0aU 0R 0 0CR0:E%0S 00C0x5l%0Q*LU@0Q* 0 RE5 Q* 0004$0Qd帄0\ᔔ $0ST t吤T000 0 S\4T00S0  0 0 @04#0S*cC3Q`3 b`#C0 0Sn0RR0B Br p 0Sm 0Sj } S0R SU G 0RLRr 0Gb 0SQ P000B Q6br00CS0吢% G"8:|R0B0 S C R0!H"010Q< 0$RC 0 0R "p쑟000 0 1R R 1 1`/蠡 G0000R010 0QH L!<000 0 41R R0 0R0 0p Đ P* Q% 0Sp0PQ 0S|0\^0SRL0 @ pppp<lDl@lXp8lAWp -LMP@@PpP`P0P @D@PPPq P  00`pppp0 M00Ѝሺppp@ MP00 Ѝ 0 Q4#5Hlpp 0MЍHl 0MЍLl -LM 000LlHl -LMt T8 !0@]S@00@ SE0P03P0cp0 QR`TWpD@T7pD0u" @/TA DaDU9070T0pDU A D00DR Sa0D_TS0PoPOPP tPTP P xPXPP 2P}@A @a0@SR2\T( 2@P2@U kA @a0@SR@0@_P Q:P\P00 \TYp P@80 0bJp P@\P_P 0?SC%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%|%t%%%l%d%\%T%L%<%$%%%%%%%%%%%%%%%%%>P 徻 +@<P*@.P @  hlpA ppAAA$ MP 00ЍЍLl -,@LMx0P 00@舺ppp 0MЍPl p-LMXP`V LKph@<@4 ,(0k `Kp|lAA(@4A -SLM@ 00S S l0Ph  0^0?l 0娺K000 P  0 P hllAtALATA\AdA,0, 0 `RMЍ ЍdlPlA -LM℠儀p`Wt0@MVW@@ T0g0C `pW` zpXlPl\l -1LM `Rڴq B0R !0F]S& VT V1 VK VZ tQ-@W@TDcP: qP8 PP@ 0P0C0(ADPU :@0 0 S 000P@XM00CR 0  0P0X 000 0@0 (0 h`lTl|AAPldlXl\l -DL4M088 S, 2PLKHpKPKTK ` 0L @@ 7 L  <TQ 0P PL0P #P Rd P0Sl0HH, 0R (K0@,$Ul0lTlAlAA(sAD>rD0  < <0pQ$ $0MЍpp pHpp<0404 @pQ 0M Ѝp ppHpD0< <0pQ@$ $0MЍpp pHpp cR00,0] B   0 0MЍp pHp -LM4@P 00@P 00plll 0-LMH@P C Q 2l 6S Q X0X 0S 2H 8S T $008plll$ M0S Ѝ00Ѝp -LMp0@SSHP S 0S i `0 Q00 2| 6S Q 0000SXP 0  iip p -LMP`{Hp@P8 00CS0 @TRU@0S S' S: SJ 0S 00B 0 00C0 4 S 1!0S 2!8S 0S 10S 0S x10S 0S HpX!00CS0D1 R 8壸J,埸 _0Q/ 2 8S* 0 RT T U 0Q 2 8S0{00 CR@@DrT`l U\ 000D 00CS0u pplllppAA pApA -LM\  p -$0LM0S p -LM\   p -鄐@L0 Mp`4 00 P \ 00K 00SP11@5@T40 P(Kptl -LM\p -LM@PP`@ Lp $0K PV$00K0'p 0-x0LM RK0K L@P0S@ {P UP0Tltll -LM @K@ 0S0B :00A0 R 0 Kll -LM$\   Kp -LM(@0 0Kp -LM\  p-0 M  Ѝp -0LM0Sp -L1L`MD0 PP(0 `pl KtKx KDtP 1l R*x0S@ hK0@@( 0R$$Kl RW 0pK| KP p| T@hK0@@$l0llp;BAAT> p-LM@P`P 0S xx|p3x -LM `RP; R :R0p0E@2S _P @T:00E` RZ p|0"P@0pS@ _P WPT:00E0PptlAp -LM@ 0P  KK -L M PR@ ` R :R0p0F@2S P$ @T:00FIP RZ `4P 0 0"@P0`Sh A\4 KV@P(KT:00F`4 0 tlAA@% -LM\p`@2 RP P @T$h0 tlA 0-L\M@PP " 0 S0 08 8tl<A -LMp`PU0FS to׵@0@S S P 0@S o輵hA`A - LM0@ hkTT p0\ dpPb`\ 0 40IP$p$00hN&sDAlAlppA 0-AL MQP  0K0 qP 0Q#0SoH0@00 R0 R P][d 00K0lQdN0S P D0_8@(s"q pADpWl"qAAAA(@A -LM0S 0  -LM\    00R0 0 M0 Ѝ p-LM`wP xP0S @0 @SlP@xTPT0S@0 @S }P@x`A ll pUlTl -L M@PlKP 8 P@K=P 0P0K `AAtA -L M KP K{ K -LM@KP ]K M00Ѝ,l0 M Ѝ$l 0-LM`P0ST0@T . . ,0<@T18008$l0ls -LMH@0S <R@T ( aK@ThD0lAAAMЍX0 MP 0S0R:0SЍ)00Ѝ0lHAMЍ -L LM@T00 ((0 R 00@ ,l(lпpA p-LM`@PP P 0S 0RHxhP 00@0 00 xxhݳ0llA$lA 0-LM@KQPPPKK0 -L,MD @, 0hS ?lSC pLK@# uHPK@ \` 0@P\垳L 0PS啳L Ep@ PTl| h0h hp, 0R (KS bS s0lA((A0A8A p-QL M@P00CS% %(%D%`%%%%a K rP0S 0S0Kp- rl zrT sr< lr$1 R? 's0 R s Or0S 0 R 0 h1Q D0 |00S , 0 pP }00 0i`d5lhldl`l\lp`5l4lpss -X0LMPD00S 4 40àL8lsbl -\0LMPp@0P 40à$ L  8lsblMЍ -l0LMPp 40#D"B ,0S 0P 8lbls -(0LM0S s 0-LMHP0@S P8 T0  8s 0-d0LM @R PHD0> 4 0 0-8 40<80 (0 $ ,M< Ѝ -LMlIS@1 08 ,0 < 9 P8$Q `8! a p81q 8A 8Q 8a    $ ! (00 ,@@ 0PP 4`` 8q88pp < @?\\lK lK<00@ R < 0!@0 0 @ 1 $0 Q! BK@p0 0041 ( 40@,001 0#1 1 c81 `0*dH,a n`0lȠp (q p,(1P,&4 #'a01 ` 0eZ0 0 ( @#1b*,1 c̠1 c<1 ,1*00 (1n00 1dLp0'P#0  #0\00 0,00 10(1 0`#0&@#1nc81 `0dH00 000 0 &#0` P#0eZ00 0 00 b*1 *lȠ0(1 p0'a#0 @# *1l̠c<p`p 1 p0` ndL`p0& #0P'#p0,0Sp0  \U00 0 $ 1 t x 倀1  1|   !P `pP  ` `p Pp Pp @ P p @ tx |0!",#<  D H! L1 @P`p娀嬠 0$L%\&l'|(*,̠. !",#0A?@P$P`(`p,pԀ0ؠ48<@q@@pG@q @?P P8A4P`0``, 0R(KP p  00@1Qp P8A4P`0` 0lp>G-QM= 0`p0Fjj hq,f>0-: 3:*fA*Q 0, ::,!,,,\V0 !0!"Y!0` 0Ѝp`p0l>MЍMЍ1Ms$0<0 s0<0ЍdlTlMЍ@-;@ 0$@MЍ@-:@ 0$@MЍMPЍკ - 0LMah)ꌬ>HpԿp -L M师00p̠`0@(P \(, 堀000 , @先0KJ\嘈 P@P\0 0S@0%050%\m$K]@lpPlLlppp -#LM0pŸ @ 800 :Bq PPa 00 0bC2S0c0S U 2@8P 8< X-(K`0H"\B"\$t \q 080 : "1  1b @ < @ P`@P`P`}p=@K !\!P@PD` $@qD$A00SA ݇ 0 0c bo"oFS0c aR bV00S0 "^08PP C4PC2P C1P0PPUhȇ 0XXeP0@0P 04 8K!vD~pp@lLlPlpp -LlM蠟0P`(0 $UpK8K pK8K*]X*ZU@1@#&[ }0dPU`<X( 0R$K #0ll0l> -L8MD0L`K(pX@K$0 u 00#0 QW8@ ;P 00#0P(U0,k c0 +x\0@ll0 W Xw$ 0R K,$Ȃ0l0llPllpjltl>MЍ -LM`Pp  APP  P@1J# ^pP  00 RAPPpX ' ~A -0LM R/  00 0  X UR00 R 0  0llh dS|XX hL|L !-0lp}> Dqa0lHp&&Կpp &dA -LMtQ@pe0SI \!0Z0j005@*ZD `.44 ;0,}( u?V0 0pS PV@1@!c =` `0`d0dS0 V0  @0X  o,<44,E 10ltlll0llPl0lp -LAMtp@0 Q 0 `@ 0RK^K|@P@@嘁0l> -LlMh@0Tp$0 $ 0RM K  @ T`P1Q%  Q@1J#U 0K  ]@P U _@4 ]@PQU@ K@˂L@KPK(,0,K(P60l> p-LM4A4t0S; $!0S0C02a0S ;0,( ?0@ a K<P` x0@L \ # Kp,<44,b 10ltlll0llPl0lp 0-PLMP `~;@Tx;88C-0 pR 00PMU`%  \00 N @ l3)^Q<0PU TX 0> n1 ^2t. K<0PpH"[0R  a>\ \ R l@\0O0 |@ 4`S< tl P26B 0bC  R7AQT7Rx 4PD4K K0Pl d@<04 j D0p0 K48h R 0D@PSPT00S40,00@<V` w0<S x0\@pL8 K0T0@4 TV ^@ x[/H06080L0H 0  L0x 4PH@0 :D^^ dP`p4P8`2@8P 8< h UP 0.S"$@DT@ P X t\ 9P PG=<jLx TN<jt4@ x.H060<x \@L0T08 K6@P>V UF80L0`1@0P 04 O4yx0x L y`@ ;tp0TP! Pp0*4 t04P\P 4l 4K 0Pw T0Sl*7x@ d/PH0`@ 60 @ xX/@PH060t?\ 8`@ t7<dp MR 0S  0ЍG-M0 v~ L1 pW0@  Ѝ1 PN1a@E1 0LOBd g@  e g  0P n0R @ABA21C 0#!B0 031CdQ ;0S9@0U5:0S\ \ 0S 0S 0S4P R @ R 0@8 R(K0S  R P`0OTS/0 0OR 0 C, l5.)0S#Q 04KP4 D00@PQ -L8M  (0 0@0 DK;   1KB Kl -L8M0D ( DK @0 3 Kl 0-LM(0@ P b$p !0S(0 K0S   00 $ (0!i(0 dAM ЍD p-LM0@`P5 P pM0p0d0p0|000xp0P d0P |000xP p0p0d0 |)p$PdP 0-LM@Pt 8h A p-0L8M"`@0Ph P 01`0D P <PK( 4P L0 p  KpAl 0-L*V2S/00@0 S\<&<&=&=&,<&=&=&=&=&=&=&=&=&=&=&=&X=&=&=&=&=&=&=&=&=&=&=&=&=&=&=&=&<=&h@`T   0P00pS(0$p@0`4 0S000 (K`@T (000 $00a$0 `ᐐ@`p@`d0\@`0pd `㰐 @` pd@dAApp0@- 0P840 ul p- 1LxM1haPP0@PP Kp KPP  0K(P PP 0   B   :2 0h@P 0  00 ,  guulps0plpAA A5q -LM@ pP@@`,0@<,0,   ;tx 80,  P D@!P 0S S 0P@`UVP,0 ;,0(K0 $B Q0BP( 8  0^07<@`0@p P:0p0`007\0 (Piᾋp 0 @0 x0 PAWEV MT0s 0s0s,0s Ѝ00s80s<0s0s 0s 0P 0"$0sMЍMЍMЍMEЍMЍMЍ0M0CS -L4MTKP@p80 )("0+`"0^+"P0Ca! ab@!2n10!0\#3n20!0\ 1VTt!<2n10!0\J3n20!0\B ,1`c 1VT!<2n10!0\/3n20!0\' T0S `c0 S Ϡ0l $ "Bbl0a `31Cc   K$00P0 D>Q$IQmnų-P0M\@@ 0S 0P1 Q Ѝ<lp(l T0MR 0D 4S1(S0S Ѝ2 SELF0MPЍM000ЍE-`0Pf 0@ 0 @ f0`p M 0 Ѝ -LM@P 0`pAP 0 00AP0 KhA -<1LM,@pK(1pP@!, @+00B`@ dW, K P , 0R'(KD| K0x t |@ PIK Pd| K0|@ x t Pp P000 jl0lhA`At> -LpM0Q|,0   @K|Ah Xd 0h 0  00!| 00!x 0, t 0 ,p ,1F l ,1 0S0h0 , h 0 0d0 ` 0LK\0 X 0T0 P  h  K1@ 4@P , 0Rn(K01 P0K0 @=10 @ Q0`K PK ` ` ؠ Ƞ 0 P @P0S@ 00 0 K 0 @@P0 00 @@P 0!  0@@P 0! 0100 嘠K  `@PP00U` U   P0`PU `@k0lhA> -"LPMx "d0K, d SPP  ~*H, 0R(Kd0 h Kd PP`@K4  2'\K[KZKK(4K[ 0D K xRKYPKXPKHP @P -LM@0 0ps` \0 @l .0a 0 cA 4 0 .0#10    00000 n08 < h X T*"!Bp2P@@04 Y R800 00 X T*40"!B2P@ hY@0 68 00   0 @.>0 00 0^nP`U TG*AT1 @f0P  000<0 (KT/*. A.0P @@0 4 Y 800 00@ 0S0c@0la4 0 LC@?@;@b7@y꜐&&& -L$M0p`@P $K00` paP$0SK -L M@00  0)`   0PP022 V2*@ @T-*0S 0 PP: (p 0PP  R0S0 P P ( ((Kp -L8M 0 0 3SP`'UP#10C8S1< R (K  0?)   0eP  ](?01 1\$ @pP 0 Sj*.  0BP_p\ @0SYx SPPP P 1S H  <4 410 0 S  4@@4P 3\0 @0pK0  P\00SP2S@ L p@ D 8@ <@ R R7 @ 2 S@ @ p8@ <@ RYz 2vRL 3RDT Q: 0R_*21C   0 @DHT aD  @@@HQA P W P 0@ c4  40K8K0>0 1!H4 8K 00b>`0a 1 d{gz a0A 0 a01 1S! Dġ L(K10!   ! h !t.  .  a0 S1Q>2=12>303h0 5ZPP``0hK@ P 1SaD11  h0Q a.0C 0b 001 0D1! Rʴ#[Rm0kP1 a 1 1Q8 a P`Ra ]h l QlK\ 0`c!`d d hK d0KQ P`H\3:h0\d% * d b0a 0b$1#[0d0 `P:!0Q$*"!B00  0 001#[0f1 hd p 110l>ۣe& -LLM@aD1V@(0 p 8Q(K 0{PP  %օ K v%̅U0h0  0`0 d 0X0 \  0T P0 *0H0 L  0D 8 < @0 0<hK7 , 0 40 @4q -LM@P @1S<@ -L(M (18 D `@ 0SL .P 0PSU *0 S   0 S  R:p(K00@ T T@ T T TL@ P@ H@  0T0S" T P  0P0  T PP @T TT H L 08#8;40 0 80  < 0! 0  1,'0K.Tp,&W0@0 x(10 0(1000 $00 0 (00(00 00CS 0  c00P (1P 0 @(1 0? i%?@ $@p hH R L0? @ $@ H pY?  $(10q l"01@00 0lpP(10(1 D(帄(1! 0(1@0,140 001<  40 9 1850D 8 (10(19 0(1,x&0?,S&0|8匄@0S P @? )$P@? "$  <00! 4@ s T8 < c 8 < 8 00!+@m0 00 S S0 S S S 0L0 LL 0SH 00 8 00!xP0 pA;ltA@4q 0-LMPPP  PP #@ P #8 p-LM R 0.>0 0` Ȍ. qΌ@P 00 `Kp -L M pR`$K0.>0 0`. 0 @P`0 c`P@0  0P``0 `P  . . 0`r` -LM @R`@" 0:#:S%0:#:S z'zW QP @  @ Ȍ PqΌ00p @P K0@ 0-LM@Q P21C 0 P  QP P \  ?"00P8 -LM0`S@ p2PC@0 0 000 p@P00R00S p-LM@P0? #"`!B 0P ? "`x p-1!LM1!0@(!00>0>0P 1/*"`!B ` 10a 0`0PP PPP0P:"!B00` 1 0 10a0P PPx&MЍg 0MhЍ/ps 0MhЍ$ps -0LLM00 0@ P0 T0( , XK BT X0 &P P $ KDAAA -L4Appppppppl<A''p$Dhmr4pss D0l&ppqPA1l A,lXA5q4qpc3ApT&A`&Ax&Aa3A$1lpAlADAAAAAA0T00T M Ѝ MP T0S0 Ѝ0MST0T00ЍMPЍ0@-@MTP" x0tS T R x0S\ RT0T 0TЍ0t0St0ST@T0T@0 0-LM@PT0PS00 0U 0S0e08 -LM0@S ^ x x0Rڨ00C0 0T0 T0 0t t0S -LM @R T0S0@ R0MST0T0 0Ѝ0MS Ѝ0SM Ѝ M Ѝ -LM 2P 0 0  -LM !P00 0-LM`(d\0PU @!d0$0$NdPU 00N8hc/l/l`p p-LMP@`d0$ 0CR0 S 0S  0R:c0\0x Mc0\0xM 0-LMP@c,0@c8 p-LM`@Pc,0xhc 0-LMP@c,0 @c8 - LM0 c(@0c T4 Qb0epP , 0c(0 S@4P 8`  "140 0c8 0 @X 0eP00e0,0p(0_c84 0b0(K耫> p-LMec 00xHcx0@T PYc0 S$ `H0 1O0S/c@TKp/l`p/l0A -LM`@p5c$0S $PT0 O$0S\@000,0Khc8A p-LM0@SKpP c 0R: `  80N 0 BQ *Kphb@A p-LM` ,0 ;0 ,08`@_PPx 0-LM@,0P00|b0S l0\\ N0SH R00 0S00 K0hb`p/lHA/l -QLMF hp0OO$ Bb!R^V *ڀP@pmb21C Pp, (P" P{b0S 0|| VN0Sh \00Pb(K RPpPpU 忆x1q>`p/l|A/llAPA p-LMZ" 000X00SZ0PZ 0O Y,@`PPxxYx `0ST0 P0Bc&0@0@?Px0YDD@Bc p-LM t0Ϡ`(P $` Al31C0R  D0 R 0P@`$ (P $`  (KKpMb?B p-\0LM`PP0PHH0@^ 00K,P (@ 0` $ M;KpDhpD Ddp -PbLMHP0 @ShQ RP L N 2`00S. U 0D  EL00CSL01SGU|00|040 0@408@0UL0 H0!0H00S000i]pD0 7L0,0CSL0t00t0 ,P@P 00 0R0 K]pP 00CS 0W  (K p 00p~p -LM@`4  nPP  (!0S p(K0S1 T*YG 0,0 00T1 0 KpP 00CS 0 W  R W 00T5$0T$@  1s 01 !0  ! 0T 00C04  0p40p@0  #1 01 %}$DA -LM@p(`KU' PP||1 Q,@($0^$  1s 01 !0  ! 0^ 00C0|P K0  #1 01 00 u0(0 R 0S00 0( 00 00W00X(00 00 0 0S0p$DAHpp -LM@pPaV3 0 0 0!$0Q$1s 00!0 ! 0U 04 0CU0ha0 #1 01 -LMPp,`@ 0T  0@S* -LMP`,p Q@@Q 0   @Qh p-LMP@`P P ,@pPx 0M0 0Ѝ -LM8 018 s$0$<0 M Ѝ/l80M$ R00 0S00Ѝ8$0M ? S $0 Ѝ R,0M8 @ R0@0 0S00Ѝ$ 0M0Ѝ@-0@ 0$@MЍMЍ1M0S0<0Ѝᰫ>MЍMЍMЍMP ,0 0 ,0!PЍ 0-LM@ PgT R 0 0 00  0 ,  , 00C08hS 0-LM<0P@Q 08 1 Q000S00,0<0 R 8 00CS 0 D8hq0< #4#0@1 8^p p-LM@`TP <0 @Tx0!8MЍ 0M0CS 0 ЍЍqp p-LMP$`l ð0*O  D0H@T x -LM< `0PS<\4 0@ #4#0 1000`,04@0TLS* S4 8!p 4 `!ተ8P  4@8p08 1000`,0@ <0-<@ -LM 0@  h%0 0.@ 0 0 0h虈 0-LM@ PqS00  0@,00,0   R8h 0-LM@PT@T <0 P ,00,0@T8 0-LM0P@@ 8h,0M0,0 ЍЍ -LM0 4$pQ8 1@0T `0PS`- U@4Q<Q q @ 1@0T `0PS`# U@<0S00@$@ 00 0S(K<08 00CS 0 <pP<0pP 8p -LM$P @pRA@ `V Rⵇ 00 0Q@ -QLM`   h S3 @5 ?L3c 8 4 00 ST00 O㠠  0PI R@pTOQM 0F0 00,%@ Q0S78 40 00S DKCDpK80KW T R80KPK<0H PK cPRP L H L0Sl$43C" cb 8@KwEP  0(K0唀K0 P Z0K0K $P  , 00C0Z@ @ R 0 0 00  0X l , 1= 1H 0> ,0 $ 0,000C0YJP:Q  Q00Qp0 ZP嘐 R00 000 QY40j<0 P,00,0  B 00 0 @,00,0  B P<0 M QpP0Z. 8  <"!B$70 j[40SHڈ!43C" cb DKB8pKD0K0< p@!Q8p 4 0 0p=)A@ -B8p 4 0 0@80 4@ 0 S X< 00R  P 0R 0@=9 =P L H0 8 d0R 00 g[s a 0#SP ]{P@ ZMbAD?BQ -LM0`A8@|ZszJ 3Zu 0S| pP - 00 040PP#)*80QU$PU! 0S!0S 000 - <0  0W 00CS 0: (Kp0 U\ 000 4 0(0 P<0@ P% P  ,0 P,00,0P  ,0 P,0@ R0,0+ O ,00,0<PpP @ .4.0QUPU 0^0S1ASpoP  8p@<0@00 04 0@  PxP p   p/lp -LM0p2`S" S PK 0@(P,0 (@ ʌ18K 8 K0p $P 3KP, h0 08, 1Z/0@ 0$@@ R 0S000@0 -L4ML P PH  0S @ @(K 00 0P <@K P@ H 00CS 0HL@H Q$L0$D0 T Q"!BT0 P@ 0\) p2BAD:$@@2L  P Po 0DSD 7 0P4`92 : 0 0 B 0 0p\2 l1C0R 0D\P  vH 00CS 0 L0  0K@ h00P 0z@ HL -L M`p,@(K, K?PU  K(0 (0 (0t  ln@P(0$2,004 R4P( `(00(0( 00CS 0(a/lp -LM@@H x 00C0/l p-0LM `Q %0040O(KBCd31C0A#!B !_(@ $P I1P 01   @(UGH@@Kp/l/lMb& p-LM,0@ 0P ` $ ,0 14\0O(KBCd31C0A#!B !_(@ $P @LHKp.Mb p-LMPR`P( D@%0h V  00P P18` 08#8 1 40!O 0$@*00!@00@Pxx x ps 0-@MLHPH 0@P`n0 ,D0P@WnK0@5lApAp -LM40@`8 Vc>0p `4a@<@0M @P0` P @@ (K @>0`0`0K@0 @P0` dP 40?00 Nl -LMp8 < @P <K` P*<40 @10@0!0P00 P@< 0K 0P< 400 B0R00 P<  qP'40K@ (K8K  cP`@Z`J0K 0P4 00@T0P00 ` J KP'40K  AP -L(M"0(0, 4 p`P 0Xr X `l8;k J(K40 0!`PL0$0! 0@;04@0!0`P1 I 0!40`P4  P0@ 04P0K  `P @P;0 0h0b 0 R@0P`4P41<  V V (1#20@0 S00S 0S V ` P ` 0S* @M400! %8dj`~V@$1 !S@#@3R4 0!( $0S ThD@4q<l$l -LMl p" 01h2 0 `2 pP (K`Dt lJc0? 0 T pp lp p h T ʟL" 0K P D2 @" ?KC/K K,q Hr q q 0#6`0D1t0@!0. "&h0d 41>0#6l040SC0, RZ D@0Z/pD@9 @ D #4/,tk 0#  fh0Sh* eh%0 @N4 P R 0Tp 00,|0S   Pp  pR'$ >npphmr,A ApA -LM  -LM@Q 0K 0 P K @-@@ M@2 1 0!0 c@ЍlQlp -LM@ R 0 SuPPP0Q  ,1S 0S Q 0, Rlpp -d0LM RP 0@@<6@P /@Ppl0Mh!,Ѝps -LM0@D  Ph -LM`pe@0P0@0 @T1`` p,@FJ, J0! 000(0004P4}Y( >D,10D Q0 DP' m 8' I0' D0< ' D0D<DD@ɌD Ȍ8DD0p R0 0 Px 80wD0<  tp'p -L(MD H0 ` #>!S  = S 0!X7XwP @U@0AS00S ,,9P# l#(KQ0Y066 0AS00S 9P0#0C0P8 1Y 0 0C0ld&00C0QH00T  (1p0QP 0 B0C#0 dP0 )0$ 8^E4 E0!P000 =Y $T1 @0T1800< D0  @ D0YD001H0S \4^8D H0< <   d0l 000D0  < R040 rhğ, `R0 0 P ,p  P100S!00400 0Q,0 010Y400S0 00, 0R0$0(0D0$  , @( ,@ 0  , Q\  <^ 4dd0d 4 d ,00d ,00H R ,0=9 =0K 00 tPY z 4 R * $Y@ ,Y"@0S000000000^P@Q  D0 B R ,04"Y  0  "0+2D0  @P    d0l 000?00  0PH R L0$0L0s * 4 /#$eMdD@^D[ JD0@)0`000CuV3>DTh b  h 000T  d0l 000 D,0ll00lAD(0ll@Ap'dj6pppphmr@BHA -LM  0  K -LM@`0,(  0@ @K ' p-L MP0L S`@Kp0 (K 0 (0 $0 @P(( $0 @P`@ ' p-LMT`@P0 T  04PSP0 @Tx<0l p p-h0LM@`TP x  ,P $ `P@0xj p<0lPA -@PLM8Ph P0hF, ipspA p-@ML K`P 0D/@ Q@P F 㔠V 00Kp4p -LM 000@0@0h? -LMP  P P  0-LMP @8h`M0SPP 0LS900S 0C1S0!S0%5ЍH0lP0lvlL0l P>0 ÃM 0Rl PR 0Ѝ -LM0A -LM`@ 0$ 6P$K( K @$0(@|0 @'```0pCAD0@P@$U<`KNlH0llpD0lppp -LMPP* 0 0cC61@H`DHB04 Spڲ d0&|hA#D0!B  %0#.hAppD0lp -82LP(M`@ p w B6Pu(K0X papR@Xp!31C>B X>00 Ã0ɃQ #0@S00*00zA0T0a  88!>0 C6 40 6P@80  08 0P @@@PP  Y0 0cC61p40@8 0ii00S00#00!P0 00A @h 4g(hpX0lpOlD0lppAA, A -QP3LM@P`p:P U hK  hP A -QLDM40S' S -$K 0P l Q0P 0d@K@< % Y<  0@T   0=P P pp0 09`P@05f@ 9gᮞPU`V0 0 CpT0l$pp A0MS Ѝ0M0Ѝ0M 4 h10S Ѝ0SpsMЍ 0-LMP @8h p-LM0P`@V0D  Pxxh-<0 h RM Ѝ00CS0 Ѝps -0L(!(M10 ph  `@0   PP0S (Kp-@<K" 0P- op3<K(.  #<K- _p3<K.<K-P ps> -L0LMh  R@0 00P00ps -LM@  ha.P -LM@ hR AP -80LMh!  @Phdps -LM@ hW P80MS880Ѝ -LMbp@0 P @2Pp< hp (K)4 @ @a_2`00@p,00P(P\?0Sprp8P 8 10S ,0<,0, 04*  40 , tx00S88080@4 8PR000K  pPA00SD0O <0?,0@ 0H!b-,0  ,00,0 ?0P0 0  ,0; 0pWpW<8  `0b 0R0@ b0 @ ?0@S>TF]e00D080S8 pps2q!Cet APM Q 0, RЍD0 <0 MP0P ,0 SЍppX0 P0 MP 0P ,0 S$0 ЍppD0 <0 MPP 0 SЍlpp -LM Qn00 mQ |R  RmRRu X2nRP wRy aR<Ÿ<<"<2<[eUP 0 @ T<wSI aS FH1 Fe@T- )0S 1h, Q *8e0nSZ0,!,L0R S)p0$D, h R`( Fτ H@` e@T0 P0"U00S000 1PU(KL0FS0! hP d`ddd(Kod\ 0d4 q(xx x0xdw| Apd!AD!AL!A\!A !A"Aps "A0"Ap\"A@ A A A A"A!A!A!A!A!A!A!A!At!A p-LM)P0A0S`< !100F,  $0D  <1! 0H! 0l@ DH 2  @`@dtTKp!@K04 c0>t"A\#A"A"A#A$A$$AQH$At$A4A -LM@T )0S0) R Q L H@T -LM 0@,1PSp ` 0S ,@T$@T ,P 0SD0W00000CS0$@TR00000CS0 -LM 0@ R |0S0|0 R000 00CS0 <[ h8[(pp -LM @R000 ,0S 0,10,1 -LM`p&PP' ,1UQ W  [x [ q ,m R000 ,0SA ,Q0S0 00`PW6 @ PPP,1 ǙD? p00 !P R00 !  0 0 100W 8Z0Z[,1 000(pplpp p-0LM 0 !@PT`@T 0Sx) i@T P0@0S0`x@T 0S) xppp -LM@ 0@T @c$A p-1LM`P ```) p1@hAhQ0S 0C) H10@AS 0 C)$10!S8 0S5 P3 @ 0[@@g\ 0_@@_\ 0P@@W\ 0`@@O\ 0@@G\ 00@`>\Kp`Lc DppppDplppppp@5l$Ap$Atp$Ap$A\p$Ap$A(p$A0M,Ѝ,0M=9 =0ЍM 0,Ѝ0M,Ѝ0M00Ѝ0M00ЍMD0 0000Ѝ0M00Ѝ0M00Ѝ0MS 1 1 0\ 0S0S  \Ѝ01 MP.0 00ЍMPЍ0MD  0"RЍ0M,1Ѝ,1M0Ѝ 0-LM0P,! @P0 P?P80,! \ M Ѝ -LM00aS0p  pT  @U  W@T@ -LM00aS0p  pT  @U  W@T@ 0-LMP\0 A\*8! P@81 08-000 00M1 !Ѝ+M\ Ѝ%0M0CS0 ЍЍX\p 0MR 0!000ЍЍ -LM  Z00\p 0-LM@` P008 0-LM0PS ` @00P8 0-LM@QP ,1 P ,00880, Q CP 0,!, 0P 8 0-LM@QP 0, Q (P 0,,!  0Q 8,0088 -LMPVP@,YTp,1@ 0S V 0,` 0Kh0, R @P P ,1, P @\W0, R P ,1  Q@D0 @p -LM@0|,PTYphPY,1` R P 8W,W 0P(pp -LMPup0A` W 0ST 0S 0S 0S PEv 0S 0S 0S P5w 0S 0S 0S P%@\ uPv`w p@Du P w 0Sv 0S u -LHM@pP`Vp(KlPK pP0@\ p0  8#81@D^pZ -LM` p00S 0S 0S zP\P@\ b`@D84 -LMP p00S( 0S 0S 0S MP/`@\ 50S >PPPP@D0U0U -LM` p00S 0S 0S PP@\ `@D -LMP p00S1 0S 0S 0S P"`@\ 0S PP PP@DP 0U 0UP@D -LM@t`0Q I 0SF 0S 0S 0S P7v 0S 0S 0S P'jpP\ pt@v`t0 0S @PD=P ur1v 0`Sv 0S tt 0Sv 00QPD -LMPu`0A G 0SD 0S 0S 0S $P5v 0S 0S 0S P%p@\ uPv`u 0S P@Du 0Sv00Qv 0S uv0`S -LMPup0A` M 0SJ 0S 0S 0S P;v 0S 0S 0S P+w 0S 0S 0S P@\ uPv`wp@DZVw 0Sv 0S u@- 1p 0^M0@t   t0 @  P`x0@P`P`|0@  Ѝɚ;6e -LM@l 0 0|tx -L$M` @0<@ 8P @P@ P@4 0 H L0  S0 @ @ L @(K(1( R1! 0OD0 @@  0 0@P  0<HD K 8X% 0@PH0  0L@HPT 40@D K ! 0@PL  0Lhpʚ;D -L(MSp 4K@ KL0K@KLPK`40K,8`D 0PQ/N`LaD#b $K4K@ Kb@PK`,8 01240K/LaN#b` Mb@-0 p \M0@ =9L =C0 P` 0P`Q P`0P@`=9A P` =C00 S 0 L0|0Ѝ?B0M0CS0ЍЍSp p-LMh`@PT XX0 PPU004(U@ }00KpDl%A@5lp MRЍ0"( Ѝf p-LM@ `5Pxh5 p-LM0Q@P`h0S- P @T [@Tl 0xS s xP  0xP xP Q 0-LTMhPK@ PP K0 -QLMP0S ` (q 0S* P`(A0S (KY @0S@A(10(!@0JST'T'S'S'S'T'T' 1QB 0S: Z  1 ?Q 00SZV, W&#  f0a. .  ot0 ?h0 `0 0S:0SPV a 0fW$DDl0ld0l p-LM@,`KP P VKp p-LM01PQ \0R00S0X!00X1X!RЍpMЍ* -LM@ 0@Ll|p -LMX0,0X0!00 @dd0$@d@X1  0-LMP @0l0p 0CRl00p0 0S008 @!00CQ 8h0 p-LMP @0l0`S 0 R0@p00p@810@ S00l00l0xh/p8 8R P8  R P@ @0@0 @80S@@00nS -LM@ }0P P00CQ0000S00/hMpt0ld%A 0-LMP@ \0^  00@00/h8hLT0 R 00aS0 @ 0@0pt0ld%Ap@-0M`V@0P S ^ R D0 T0 SЍp S V V,!, 0S D0  $00S 0Sf0 M$10$1Ѝ 0M Ѝ-H0M!0Q0""!A0 !!Q0 1Ѝx0l 1M0Ѝ40Mh -MML M , D00q; @`D0 d(l0D 06R: Ad30St S> B^KPEPEF?04#Q P #'*X< 0 P  0 0000q 0 00  K@0c@-4 T `D \D Xd YP$ x, 0R(K B^KPEPEFφ@"@2oQ0 p0 @0SO^KtPEPE  0P00S4S"  . 0 B^KPE,@PEFφt!l1@9Q  0 o46 4S*@0P D T .000  4D 0T @d < 8t L  0HP l{]Ph D0. T 0S* 00CSk$@n)CKA01A00l1l%A%A%A%A<> 0-LM@P$0p 08#801  XQ0S  PP 8hy0Sx0l  @0-rLMl1hA < 0`80 0PCX1!S4 d1`00 <\!400 < S> *$0010  !1 !00V1 0!10101 )X!0R000\1X1`1d18 401<  00 0 0 (K$T(Koppsx0l -LM@0D@)0Ppye$b|0 Wh{)#X0@P `,0S ,000 0@@0)xpp -LM$0p3P0#D !0@3PD ņ 0@CC`40 1D D + =  SD !1R.,0S45 D ,1 R8#8Z/Z0W )@9)D D   !0@3P`R OD D8#8Z/0Z/B~Z )@M),D  Z?P  @0`|@0 2.Dmx0l%A -LMDP~R0 Hr{ X00P4h!R 0 S  R $0 11P R@1#@a_D0 }0 1O1000 10   <1S0<1ʅ ,1 R9 000 CJ 8 F040 I$00Y00S @T T @T0P ))0`SA Sy S@R c(T (Ko80S )0S (KY1l"@a N<0 8 C3040 C$H0SPC(KoC0@ D0L XC 80SN4PGL0S $0(Ko($0 D  @20p38P00S,4P00S@ @@C8#8Z/070 $0 !11P($12S201Ņ~'oC$@0P 00S@ L0S@ 0)0'XCpsx0l܌p -LM  N -x0LM@T@T D0  Dg 0 1  @T pM Ѝ -LM$0@@ 60D  10 P N Q$0  11!D $' T1Q13 Q 0D  10 P$0$ $$0 -L MP@DA ~`01`d\XaD0  0! 11  (Ko"!0 000 0 10! !1 1 0V1 0!10101(Kx0l p-PLM`P @T U  D0 @Tx -PLM@9P  h -SLMp ,1@T< P,0SD0 h 0S  P X*@TZ# R& P& @T @T P,0SD0h P X   0,p -LMPp`P P U 0 R Q 0S U U U  hXlP @T0P \ 0S U U U @T U 7 -LM@` T "R"0R = B @UPP  0S  JPP $0s nP  T r R0Kh* 0Kh b0Kh@B0M$10CS$1Ѝ000Ѝ,Dp 0-LMP E0J/@0$18p 0-LM00P$!R @0@8 -LM`00P!R p0 @ ! 0 !1@ C T101L!0R1M6 1P 0R 10P0x0l -LM<< 4@0 ,J 0@ FKxp'@5l&Ap p-LM`P0S @ T0x P@T R0000 0  MR0000 0  Ѝ/ -LMp@` PYP W` P 00  00S00@ 0-PLMPP@@@T: 0P T 01 R0D08L&A 0-LM0PS Q@ R  R 0A@S0@ K00SK KP  0 B0 00 0@@ 0 @S0 -LMpQPT\Q 0 0CW .\, @ R W`1`!P$0 70S( ά^ 0 f0 0 0pf0@ fW0 @P0S    $ps -L M5 K -LDM 0P@, H0 D@ PP #0S c@T0L0 P PPP P@PTPLP |ßP  dP  Hß@D3@4ß` 0@  *#@pWl =KB2 LR h20"_J`с"PP ᭁ', X 000@8 @0$0(@H,0 P0408@<d0Hp0TP&p`W @  T @HK 㺀P A @0 B C  D! EFG@@JXD00pC,00, 0PR=(KU 0pW P P P`A&, X 000@8 @0$0(@H,0 P0408@<d0Hp0TPo&p`WU(7"0l81lqq@1lD1lq@P&A$&AH>-PM  0S 3:\ Ѝ^  ЍTQM Ѝ0S :P00 (Ѝ0ps -QQLMp`2Q2 ,0K`P* D, P,0 $0, 00,00@,0 84,0<08,@<,DD@ `$K0K`P l00@ 0⃀0T p00 lhl0l ` -LM@Pp`ကT  0R U T  h踯  M-PLM0 0S R K P ✯ -PLM0  0S R K P Kℯ -QLM@LQM PP@E Z: @0@ D0( \>0 00P @P/@ Tˠ@4 T"@%040 80pɲ ;P0E00 00E4`0 K0@P ٺ (K@0  ` #@ -QLXM Q0JS-@P P D 30S0JS<@ p@ P00P0 @=1`d0 `@ 0PLK\ 8 p@3, @+p,1lpWlpH1llvlphmrppppqD1l@1l@ls -LM\, `p @ D 0B?S񟗒l'''''''''''''''''''''''l'''''l'''''l''l''''l''''''l'l'l'l'l'l''l'l''l''l'''''l'l'0BNS*''''X'4''x'''|'d'L'('('('0''''<',''''''''''''''''''''''''''<' ''('x'\'8'''l'L'(''('('|'X'4''''''l'''('|''''', 0 R(K 0 0 0˟0 L@P00X00S :L 0@ :o |:0 d:) L:"L 0@ ʟ 0ʟ 0 QV OKi ͣP,s{ɟ 0r͠ d9JiT9\ D9R5 _4490Bn  ?KHB DR @ -LL 0@Dȟ 0D}>P}>h5lGl1lpqa0pMb8q<5la pppp$D}>,0l DD|6qs4DVl8D2q4'qp3qlppslGl(0l<D4l0lH:lGl$(qx6q'qp;ll9lh9l(DX> -LDM0PS0 ` 0B S@(K!`K❠@P`00C S 'd'p'|'''''''@P -@\0q S P 0K {@PP( Ta@PX <10 H  a R=* @q qqpppp00 0K0 A `\K 0@Q X dT Q  㭠@  0 @P yz'01lhmrh 3tl*4p)'Dq6@%L*$ M00  RЍpL0MS RC400 0100 0 L Ѝp 0-LM@P Q PK P00 0 ZK0 TL1l -LM -PLMh`hA @ pH4< 010hp`Lp`  @@psp -LM` P{F4 01pPU L0@S  PUiT0L00000 0PE ) RNpMЍ -LMU00 u 0@T `@T @0S`@0V@0V0 00Pl 0-LM@ L0PS )0S /$8h\ p-LM@0PhQ`x`P P Q 0D  10 P  @00  ``x `xps 0-LM0QhAP8$֫ H0S L0S0 )0 8 Q D0 10 ~P LPps -8 LMh$0K $㸫#P psQMЍ 0hPЍ) ps 0-LMQ0  S  `0RPhA Q 1D0$8h苫0 0) 0ps p-LM`\P0 R O0@Kp,@K0 bP(P00U00SWl"qvl -L MH `XD p@ V0@0 B < K@P0<KTd Q LPI R D@0@P#@(K40@TP c ZPt!0l!O SA,J` Z?H @D@@PP 0K P00S@ H 0@0 H @0S xH0@ 0 H@tH 0@@0U 40R  0@k yDDPl2p&A -LM0@SpP ,`K 㠝P K`H -LM4@K`P [pF @ t3WP K0MЍXl -LM @000 @ P`p0 c5F$0@X0 @  0 R @0S(KW0@ h1l -LMp0K00K$ P5 0`@0Kʚ; 0-LMP\ 0Q 0 P0@  8\l -LMp0K00K$ P5 0`@0K@B0@-4PM@@40T @0SЍ0h1l0@-4PM@@(0T @0SЍ0h1l0M Ѝh1l -\0LM0P@SL }?’D0?< A3c 0 0 DP1lMbplp@-MRRP`!ژP`0Q @0t$0@Ѝp rP`<0Q*0P`Q 0QpP1lx@-PM 40$\  $0(@ЍP1l -L,M@0\,0  p \p 00@PT 0L`K   5 m @d0T0 @ J$, 0R(KAd1l0l@|&AAd> -L,M쐟, LKP@`p m  05PP , 0R(KlP h0@T @T lP0@P 0lP1ld1lx>-QM  00CS`'|'''-Ѝ \0Ѝ D0Ѝ0 Ѝ0 Ѝ@plll 0-LM0@S  021C 0`0Q U! 0 0@ RP0R d@8 0R 0R000 $C5@5Dd1lP1l0&A&A -LMp0K00K$ P5 0`@0K@B@-PpMHP@0$ 5^0`@0 @0SЍh1lʚ; -LMp0K00K$ P5 0`@0Kʚ;@-PpMHP@0$ 5^0`@0 @0SЍh1l@B -"LMp`D@ @0@0 @`Ok@匒P0l^D`  D   1 P` A$ 0@ V 0$@ <`K4K00@R40 0@  <KU0 0@0@Q0<K@ < 8  < 8 (0@cT@PTP@DT<K(, 0P5쀟0@T0; HPKPTpK8P4V4YOR<KH D0 @0S ^H0K 0S)%  N 㢙V0)0 !000™ 00n KP0U (0S000S% 0S0@ 0S0S0%@k) ,0 , ( psɚ;6eĄshmrxs 0-d0LMPhQ /1 1) @I000Q8hn0'ps(A 0-H0LM hA1 P1) 00078hTps -h1LM`!`0VムP1`H1@T: )A p-LM`` @0P0 P $0S7P0 Pxq -LM0p@/P`b 7PPa 0 0( @0S+ 000p!n#PK$p @RTR 0㭻pP? T+p 0!R40,0 K0Q0S Q0!R 0S S0 R 0Sʴ!Y 㢺8O$4M$0K$(H$$0T  B$ *A)A(*A)A*AX*AP*A`*A -LMPQ 0 Qp0S" `0S 0C8S 08J@08 J 5RZ 08Z `0SB D -LM0@S`p50S&0S  0PS)0U 0S P  *Pp0S00S0|#0p"0S X"p0 4" i"4l*A*APMA*A*A -QLM0P4 8 00 ,  0 Qp0 ( R$0  `0S 0C8S  08J@ 5R 08Z `0S`0 R 0 R (0DS 000v"0K8Kam" D4l+A+A -LMDp@40 @0S $2 0S00Wc 0 QP @\ ` 000 Q0S00Z 00 P WT @l &"40S  D!0S  0S V 8CR0S00 S00 0S r 00 0 R {00CS0hu d[(KPX 8CR00@ !q5l)Aq<+A DWl0+A -LM@P` pP  0KhLV 0! 5lp;B -LM08`0 J|pP8 , $ 4 ( 08JE00C8S0jXP8Kr08Z0K D D p-LM`@ PP  0Kphc!xH+A8M20P#* 00"8Q#(Ѝp@-(0 S<3(057<@ @00@09780<SM") ; @@0@008< 7P`@ :00;0@$TP7Ѝp<7P`@ + -L M80PS@`= tpX98Y (@Ġ 04 00 帶 ,0 ;0 ,0<(K ʳP020P`40 @$"X W Y 4POT 8SD4K80XW$0  0M ЍqqqQM S 8Q20 R  \  \ | 00 Ѝ0|  | 0!|  RM  R | 00Ѝ010|  01| 0 | D MP 0S 0 S PЍvl -LMP @0 R 0P 0P Rq -LMa/, pP@!VP , 0R\(KIWP?= c080 4K  V 00B0 S??( K Q02\ 0A1@T (0 P @  DVP- @TZ \ 080 WP0.S a0B0S8 a0B0SW0B$Z0lqhB@+A> -LMPp`+ ((0"4#220 $04 D0KWP 0 @J(K0 h1另Ph 00P 0t /` 0h1 ㉦00<   h10z0 p+ApsedA+A+A -LM`00PK  0 `VP 0RK00[S  00C0 S00•0SLpQ @@Q VP10\0lvl> p-0LM`@K Kd0 ]PP#0 K0 @@0@0  K0\S Q`0 QX0 QPL0 0RKp,%$ l0l8T&2,,A'1>p;B,A -LMPQ`. 00S`S%p0@T@T 0S UP00SaP020$ 0440apCWPE@q -LM@P TP0@T @T 0S$@T{\,Aqp,AA -LM0x,0 ` P@T $0s (0u @TU 4@K Ux TP RVX HTD00<(8(0000Q[ 0#4PP0 7@PK$88@#D0a'$BUU 0KA@P VPPpT00S 0S V 0Sh 0SO @, 0R(K R 0S(0 @ kT&P0&^0T0U0StƟ0s0Sh @pPP0೼0  " 40 $@ 020$ 04  6 %ş00a6 0W 0S" |$ 0#(("#4@!| ,40T,((0 "4#Q r  H0R<5 (p 5 "88 #$0a0""dp 4 "88 #$0a0""RPPpKLV G0Sx B|@ @4kRP.ka@TP 0u03V0STU@E( K0^*S@ K0 PP 0S$ 3\#    @jiRj)`SP X,0S] S7 @#002TPPp㸀K 0N=PP STPa 0K(P 0S \ @ X@T@T $0s (0@T@fP  ((0"4#220 $ 04ă\ l L`@P 0pP@ P`n "S RP pW (0 P @ RP @VPP|@ Z6`@P 0P@ P`(0lqqq,lplA-AD|,All,AD(h-Ax-AA,A,ACALAh,A,A@jC,AA,ArA,A8-AЬ>,A-AMЍmMЍ∵MЍ 0-LMP@,00S,0 8hhd -0LMp<0 @ r,00Cs,0a 8K8PK`d00l PU`QMJx0pL1 Ppt x0@ =9@pt =Cx0d0Y*@0S /PP`P`80 0@80<@PPT`< *o(K /HP`P`00 0@004@HPL`@0 0@@0D@0=@P` ~?B-A -LM⬀0`S Pp@0@S 0PSp0S P`p@00@S 0PS  0܋  0֋uldWlulbl -0LM0@S y PR 0D00  0 (0 BR qqqq-A p-0LM`@ T P@T $0S {(0 0 (0 0RKpd0K KHP(0,0 Kn(00(0 (q0lج> -LM@ zB(00(0.A p-LM(0@P< e ;P8 X``00 U@0 000@ 0$0 P YP 020$ 044$0$0s L `D00S KpwqqqlT(q.A -LMP@ 8|8#@T"p 8 `4 0  44"-0200 ,0(" $28  @4 a00 t8  R lV 0O  0 t8 ?0 R0Q4O0@ @0|  RD VD0(2 0P`0p0 @8!@P0ᔯ08KP  (`80d0կp,0P 0z 0ů 0@l 0 (K80(S  004(p;B@t(D.Ax@BL.Al.Ax.A.A.Ad.A -LM@ 80D S< 0 (0S- [[U) r 82R#@0SQP@<8 D 80!+ )Y00p@` pP`W (KXYyᔐ`0@ Pp ` V- 8  8 0S0S008 R@04pK@`0 B@40 0@ OP @@@ @e/<c0 U|aoPUPU 0S @ OP OP e/=WEVqq -LhM\D @0 s  <( 4"4&, Pg< ,$ !$*,R^04!48#8S U20Y *00!8P#QF < 080 (@LT@ ,(X 00, <`0 4 l0h 80\<4 p0 < 8,x X <0, L̠H  X0|,T0dX0T`0Dh0p0Čx00$<0p80t0H0 (080 ,08\0 008d0 408l0 808t0 <08|0 H080 X080 0#d\0#Td0#Dl0#t0#Č|0#0#0#$<0 H #t80$L #$P ( ,0"l0 #\"L408 #"̌<0H # "0X "PC P8 0 @TRE `U 0  |0K 00  \000 @0T00S_ tx 0@T(n|0 x@ lSP0@TSp 0S 0Spw  P00SR2 0@|K  0 0K0@ 0 @ R00S0000,0S0?0,080S,00 8\| S|0 x@ P P Pu0t|x | 30 R08PW R ( 1@$Q(` dpF\% 086, A$,t0x@(@, ,08@90,0  YfP0p  @ \%0DT DP`0PpP@P 0 0p wD 0S S0S 0 48#8,C(R;;S@Tp nP;`@T G?E?C 1MЍ( -,0LM@T @Tl( p-LM0P`x @P00x P @ 0T R000 q /A -LM0@  0  00 R 0  0Xh 0 0S0 0  0 00h q -LM@`PppPA DQP 10T' TU4 5:Q$ T U:TU R000 W 0 00U*00>X 0PL@ 0R 00 p p>(/AD/A p-LMS`P@/ 0 0S0 0Q  0S P0N0Q 00@@xP 0R 0000 1xh-0Q  0S 0N0 00S00@@Pxxh -L$MAjlD pP `D Y8 D Q  V0@@0 0S* RQ@ 0S%0 0j 0 @ {:R  W3 #4 5< 50 54 %< %0 %*o0Sj @ Ph>*\< 0S!  0@  i0 0H cH0I  Y8  0LS@0!*P: 0E80R\!: d0 R00S04R0#03P0S@0<  0 < 4 00j0 @R 0 q 3P R] v D000D0!ZPb (K@8@ E>* W?: R e 00 R0S804R0#03P0S@0<  0 < 4 0@ 0  i0 0H cH0I 0Y80\@ * W %0 :8 S R!*0 <4@@ D @0@8@@ < 4 0 D#84 < 0 /AA-M,p @p0 @$P(`,p0ЍA -LMpP`@P    0  K -LM` QPpA:0A @T<P  \A  T>: U 0  T: 0U Q )$K  0 U: 0S)P0pe000 0hP T T0S*@B0ep0 R000 ] V# /A 0-LM PR00 @E @T0@:Q00 0  88h -LMDBPpUp^0 `F WT  EH,0FS@0$P(` 0@ F,@ ,0 0 BS0 0R 0 0 000  0000 0 ;T R H00  @(K 0S0 000 !  0W0 0    ᫨P 00p 0@000 0  ~PP  0S00P0P0@W  N@lll\/Aq-0M0 R Ѝ0  R 0 Q R0S0S0000 0qa0 MP00Ѝq@-@M 00bO 0$@PЍ p-0L4M@`T9P 00 0< 8  $0K$ D0 , @ 4 0 (` $ 0 D KAN 0P0CS 0 Kpᮍq -LMH@ R 00CS 0 $0$ 啍qqq -LM@ K4 R00 0S00hq -LM1@s 000 <00 @0* 00@u$5lqq p-1LMQPK l1Q d1Q \1Q` `Kp 1Q* 41Q,1` 0`00000  1`P0 KT`P@ R 00CS 0 00` 0 @a#T0` @@PH D 0000``00}flvt~fwt@qqq -p0LM RX@0 D 80J0000 0qqq p-LM @`A@P <0 S x@xqq -1LM @Ph`p\ 0+`P  000^  S 0El@Q@1@!T `P0Q 0Q`#`qqh/A 0-QLM@0PA 0R  Ex0 0 PR0 R 'P P0008 0S0SU RUqa0qq0@-PM@ R( 0S%\ * \ ^ \A 0 0\0 S 0  0S R 0 0Ѝ00@ 0 0  R P,  R/ 0\ 00 S 0  0S0S 0P@ 0S@@0  @0@ 0 0 0S00S0@ 0\@@  @0@-M R 0S^ 0Sl0 0R 0SI0SD \  R0 0 \0S0  0S R) ^ 0Sn R 0S 0R 00 S00 S0 0S    R 0 0Ѝ00 0 \0S0  0SR 0S@0T 00 S @0  0 S 0R 00 S00 S0 0S    R R 0SP0U 00 S P0@  0 S@ x -LMpX5 PU?P0S`X`V  0S@ W`RP 0WPP 0RPPV 00SZ  `X `V 0S` -LM@P' ( 00 S\   R (0c\0 0lS0P 0 \)0 0-MP ( 00 S00S P (0c\0 0lS00Ѝ@-MP (@ 00 S00S@ P (0c\0 0lS00Ѝ MP0SЍP 0S 0S P MP0SЍP 0S 0S PMPQ00SЍ0MS000Ѝ 0-QLMP <@D᝟48@-HMP  O |0@0xL0ЍMЍ 0-LM@PT ($ @T8p/A -L M0PS`p ppS0pS(`@ $0X@T,L<D H0W 0S0S0SdP (@K0/A/A/A0A40AX0A0A0A0A0A0AMЍ -LMpX0  $`,@V P0  P 0U@XPU!  0,@02$` 002 TV 0@ 002T 0 `F V 0PU(K -LMT0T 0 MЍ >?0 MЍ(>? p-LM@,@K`PT0 K$P  0 sKp >>? p-LM8,KP`@ 0  @K$` ]Kp@>(>? p-LMP@HT0`0 Ɓxh>? p-LMX,@K`P K$P .T0P 0@tKp0>>? p-LMP@`  T0PxT0Px -LHMRp0 S`, : S3 S $KZQ@1PU ,  , P0S*, P0S& P0U $0P0U0SP P$ P ,Kfq@ZQ@0z03Q0S@PX B0 R XIql@K@ zA 0l0 T  h <0d0 0` 40\0 LX H0P0 DL 0H0 D 0@0 < 080 4 000 q45l -LMT0p (@\`X `0 .001 P\@\001@P$<@0S!  0A@j  e (0X 0^ (K `X X (0T`@Q  X  0  0 AC 1A@<1A0A1A p-LM@PT` `< @`T@T  @`T@T  |@`Tx -L8M⼢ ( pWaWW "2B 2`Vkt0Sd 40s 8Kd" X X. P@_e @' @@@Od $ P@P_e  @@@Od  P@P_e  @@@Od  P@P_e8  @@@Od h P@P_e0 H @@@Od , @a V `V aWX T0 `V( 0R"$K L 0 g8K & qx p0l2AVAA2A45lYAA 3A3A3A$3A,3A2A2A2A2A2A2A2A2A2A2At2A|2AL2A3A02A > 0-LM@PT `P0S0S 080S0S -LM0$S(00P 0@ p0._ 00# 0 (pT0` $`0 `0 . pl 0 Q0pp`X0 0h,0>0S! ! wP11"p"l00pp0SV\60D D0D0D 0 0 F0Jqq4>?45l3A@5lqq(\(`((3AM 0Q PЍp 21C c Ѝq -LMtptP`@F ` 0 04`V pPKlq3Ad>?M 0P \Ѝ| 2 1C cЍq -T1LMH1\@1Pp  U00S`@! 1 Q X00S@Pp PVP$1 VV$W 0X0Q0S U   !PW \ 0U00U <000 R iJ"q"q8ll5lq -RLhM  !h @ |@ , pH@ H t l PL t%PP00mP{ d0  @t h0 ` \0 p tt p 0AZSJ꨸(((̸((((((((((($((((((((((((((((((((((P((((((((((( ((((((8((((((((((((( (ĵ(\(((((\(((((8(,((((D(P(D(((((l(t Z t  H@W00 S}  zM, 0Rc(K> mh  h h0   `0\0  `@T `00hQ00,Kh l  R\ ,0K2l0 51:R_ @ :8L``Pl@ \0U  SP  P h@PP hx dP @bTZ H W00 S 00   @DT\Q Z H W00 S\@@ 0  xP @eTZ HW00 S000  z @Dhh h  J 00 ` \ h00h0 h   `Vy-@Pu`\@ td @ bd t0hh hPh  Mh0@J 0@8CXo@ 1A l>0 ` `@Pl h ` 0Rl@l 000d bl@  d``P_h+h (h@% 0@8#X`@ h!h h @ 0@8#X`@ p00Lt!0000L Qt p d0 t*P 0@ \p ` t00P!0p 00A 0 \?`0 t jt h00h0 `t0+\ [0PC K@l PP C0K`@ \` th @ h Jt0lPhh t0 h h >@@ *0`l0 l7\Q@l  ` 8P l `0PbU`PP P h`ǟ L Y  `h 00h 0 h   \ \0 h0 \ X T  ` 0S S S`T@X0CK&@@CD Rd ZV H W00 S   R @0h PƟ@x\ P` L h @ p Yt h0 0h0 h& L h h0 h@ 0@8#X`@ thh pP PCKl PP CKM\ Rt0t \ t h00h0 0\d t@0@Po@ 0@P`@ 0@P`@   @DDH@W00 S   ll PU):l0Z dP @bT=Z H W00 S000   @D0 @D(0 @Dh d P0@cTZ H W00 S 00   @DTP  @Dh Z^ HW00 SI  } \ xV U- K,Kl (, Kl %2L> &BP l0`cl0  c0,K @ 0 i0d 0YQP` @Dl@ l00 a0 P0@P`@ 000H0S  Rp @ (  0$p h h  h@ 0 8#8@X0 T@ 0 X T  @|Q pX0T@0q `Pu  P@ l@2A \@QXK<@00` !0@0^S!0@0^S^<,ZD HW00 S   !0@0^S0l3A3A3A3A3AP>3Ad.AH@W00 S   !0@0^SZ l7PP T@X0CK @F&`P?P0  TX0CK 6^ Z~ HW00 S>00  jt 0?@`0 t -L@ MQ  0( K K 0 K(0 --0 LM0CQ0  0( K  K0 K( 0 0-LM@LP 0Pu,0@ R xK0,T5l"q --L MP 0 X,0@ R [KT5l"q -LM@A -LM4A -,0LM \0( K4l --LM00 K --L M 0 K --\0L Mh!D0 ,1 Q @@ ,1  0@Kps p-LM`0@< 3PK0 0\ 63[P @ vP >o 0RKp0l4AX> -p-L M `0 0@P P Pu00 R0P P fKpq -p-L M@ ` P 0@ @ @P,0 R0@ @ AKpq MЍ4A --pLM0PS0 P `AO hP TP0 R \9C0@ 0@L"qh5l(4AA`5ll -LM@0 H@00S S S  Ch\hC04Ah5lP4A -LM  0l4A -LMP`RD0#40#00S H!RL b1D!#88P$H*@1"pK@ dP2[0 2K eP yK -LM0̓0S  c1 #880S$H:D1@0D1$Rq0 ܌p p-LM @PT`Tyx . @H! 0L1 @!0D1yqxxE-鸠M0S㬀 p圀` @00 q0 tP A8Pq 0S2  0S 0N0Ѝ Dx5lt5lD|5l4 4040Q$0 M÷ Ѝ5l5l5l#q-808 M\$0$   Ѝ5l5l#q5lp@-M-\PP0\` @3 0L0 \S5\3  T! 0L0 \S\ 00La L ^ W0LRA0L0S7 LTЍp/0 S a X\x\@@0 @-paLQMP`ࠁ@@@a0L0S*\0 0@0 S008C8!0000@ 8 R#8 P P PP@0Ѝ -t0LME `N0S(((((4hB,h?$h<h8 Dp;B4AX!A4A4A0SM @00S S (Ѝ$Ѝ Ѝp5l4A4A4A -1LM@XU aU_!00UCUڨhaUʐ!2px@0sJ `0|8s0Sx(x(x(D(D(0!0 Pq0 `@Aqh`@@! 0S0c!00c10 Rڄh|hph0s Lt5lx5l D 5A D(5A05AA45ADD<5AD5A D D4A4A4A4AdA 0-LMP@x}Hlyh(1\0 S S SSK0KP00`T5A\5A'qd5A 0-LMU0SM PM3 P@@E T 0D0C2S2h((((((((t(((((((((((((((((((((\(P(D(8(,( (((((((((((((((((0S8xph`XPx5A5lp;BA7AA7A7A@7A 7A6A6A6A6Ah6A$6A5A5AH6A5A -LM0 S S0 D SB S@  R R  08 R R#Ȁ0S+8@㴐pChP08#X(0BHT2Pt0  =38P#08#X(0BHT 8C8s 0 0(K|5lD 0-LMtPq h0 Q 0088D[+I0@40U@0QTqT0085l5l7A8A p-LMTP0 L`S @8080@SP 00x|5l5lD4A -LM```P0 Xpr00 J@0 0S8P@C 00 Dx5l5l 0-LM0` (\T72PPP0@ P *0.24 q1'208A"q5l5l#q 0-x1LM @R ` 0S38(\(8(((4QT(1 T0`!10 0 0c0C1 0S*8h8h8h@I@>e0 0 0c0e|{t5l Dx5l D DX8A D08AA 5A<8A(5A8A 0-x1LM @R ` 0S>(D(P(`(`(4QT"(1 T0`!10 O0 0c0C1 0S/0cd087H8h<8h98h50 /@d 0p$0 L@@8t5l Dx5l D DX8A D`8A 5Al8A(5A8A08A8A -LM80p0S0 @h0 0'00 @(r 0! P (r @BVW 0Rj0eQ! sQ dQ 0Y l00(KT 0 SP@@?t5l5l DD8A p-LM0P S S` S S S S 0 S S S S S STKp @KP @ z0 S S x8Ad5A -L M R R00P R R P R R  08 R R# R R R R  P R 0S?8@!Cx`4 08#h(0BHTn0P0  08P#840 08#h(0BHT4 8CHt Qs (K0`K.Ps |5lDd5A8A -D3L M `R#,SP 3 P8CxnTNT F@yTYTYTyT| (K(Ko8C840 nTNT F@tyTYTYTyTcL2 Rp @P* p Wp 0S$ QYb P0 sp p0p8s 0㟐PZ @! /0@ x0 8s dPCl08s<cY0 g4 c4(KoF(Ko[cON@aA00c10@0 0c10 @%(KoDP! 0. P0  0pL(Ko)t5lx5l D8AA9A DDD9A(5A 9A 5A D49A D<9A8A -LM8cY(Cx02B  $"0`S/ @P 0PS( 04/P0  /PW WV W0S (B(00R0S nPc0ISF((((PQ0SD@0@S x/PWc0ISl(T(<((cY0   0@00'|00SS P@q~5l D D DL9Ax5l8A -L M`pk(,@0 S SPP S@S(K0KtP00 R ڜM?P QPqP |D2p 0 .P000aZ<2f 0l9A'qt5l 5Ad5A Dt9A -L4MȠPK8 LȠ`CxX -#3 Q W ß0SأP @$0 @S 6.P0  .$0PPS @U 0PKpa 0Pl0@t H# X0(i PKtKX00sq aX0"0p RT 2"TP@ PE ŊU @D2 |B@T`Ÿ 8C8s S<2 P(2\ 8C8s S1 PT!001 R$ @p 0S# 0-P0  .P0S S0WpT](KHY@V0@80S @P 0S 0}-P0  -P0S S0UP p0@S 0S 0^-P0  -P0S S1pTAt5lx5l D9A:ADD D D9A9A9A -LM0 S SPpp0 S S P S S{ Sy Sw  ` S S `0 S SPᐆ0S @@0S -P ~-P@0S@ T T`` TPz9 0 D B2R@ (((((((((((((((((((((((((((((((((\(((((((((((((((h((0(0 Sz4` 4$K`MS040 n040 ğ$00s03S0`040 TpD V040 T4@ qBT040 T4@ 040 T 0`KW@P064@ T 0KLPq0  RR@@ Rv34 Th 0`KV@P0e g4@ TZ 0`KH@P}0d Y4@ TP 0`K@Px0@4@ |TY4@ vTI4@ p0`KP)0S 00B0 0B0 RS 0B0 RS Rtl R R R P000(040 ;4@ 7 4@ 34@ /1040 *0KP0 14 0K* K,0K@P0"[2[k4@ @P,04@ * K,0K@Pf"[2[0]4@ @P#04@ * K,0K@Pc"[2[0D4@ * K,0K@Pd"[2[044@ * K,0K@Pe"[2[0$4@ 5lH:A;A4l:AmC:AD:Ap5lx:Ad:Ad5A:A:A:A5l -LMH"B<(4)P(P Bh$;A8;A"q@;AMЍMЍMЍMNЍM-ЍMЍ 21C MЍdWl 32C MЍbll0 $\MЍH0 \<0 | (0("404 ulvlul-0 $ RMЍt0\h0S 1S  Q0Ġ 8 8#$ $ ulvlulMЍMEЍMЍMЍ -LMP@p`V `P@ YP -LMR00 pP ' `0S` VP 0 S00űp@P 0 0 00 0 00CS 0Zp00(K -LXMß(ApP!P3x |0 l 5:A TdKt   xt YPl t Q  Rl(KW 0t 10R0| Rh P` 8KԽ8PK`|000P0h0 h2`PQ 㨝 p $2 @e0t e0SQ|Q% 8K⨽8KQ\ V0U 00S@00h Uc\D @ < Y@0SM!43C" cbp $0@@ 0 S  d Kt x tXPl u @e8!Fp00l l R @yel0#S _s. S[x tl UU0R00hP00ӠD 0RDKlp 0 @ D @ < 10e@P6 `h \x tPl l %$Dɚ;4'qD;A0'qQʚ; -LM0@S`p 4PK +XP K(P P (PK XP0p -LMpw0 WX0_BSeo1ǏF$8pW8P 4` 80K0 P(KMb@B -LlM Qp@P  Tㄑ  Tf 00CS 0 n (KT 0PK0 WP< 0TpLP H@ 4 8 00 < p -QLhM| 0 @Y0| P0B!R| p P\@K 'P KL0KHK@ XPKT`Kd h0 l P p Ѝgfff-M\  )0l SS\Ѝ0 M Ѝ(q'qRM  Rx0x0'' Q Qx0x088 RЍAЍi -0LM@( 0a0Q p00  (00H >1>1>1t00  |0S0 0 0l0$0(Q'q(q p-QL M@`@00CS$)$)$)$)$)000 Pڝ@Kp-@l0d0\0 KL0 2 0 @ -~ (q'q'q(q'q 0-LM@> T~0PT;:h0h0h b(h ^Hh ZD00 8 P0$0 0P 8(q'q<') 0-LMP 0N$P.8CR8 -LM@`^uVpH h1 0RUV hp t0`0t00H0U h 10 XH ៿ ᛿psD;A 0-LM@?t0P0t08h膿 p-LM@/P`H0St0t0$ 0  0S H0St t  0  0S 0t0H$ $0qPP OKp6l p-LM`@p 40l#"B PH L00bO 0$@H >RPP+x1P91xbl 0-LM@@p 40#T"B P㿿 R00 0S008h8bl 0-LM@@p 40#T"B P㜿 R00 0S008h޾8bl p- 40L#tM"B @`!r r x<0P<0@`q00@彾x0P<0bl6l6l -LHMP(K|3 "  1ˌ\3ŠT"10A0 0c0S |P @T 0K`P@T 4KU P 4 00R:0 `@PTD0l<0@K 0L K0P%8x2x0S80 @0K 0@P@0 <@ 8 D020SD0 mQv )0l SSp0 Q )0l SS\4 L P 00R:l0p00 Q)0S㔡 S㌡ h1Z31C0!02d8D8!;5@><ϠF/,0@lEnb @@K00L@K0 @P` JP4 z4 00Rvg:D0dqP00R:$0 hL0K 0@L0 H@ D PD8lrQ;A@KLɚ;@D㟽pH n P``0O0@d  d ܼ>V0 H>{  0@d 0 d  H P 0>eHb 08#(08,!#8 Q0A8#(}zA0H\XSNP 0@d \ d Hg Pj ;^P!P(P'P)X)P0 l 0@d 0 d  LHE PH>SB >'qt>+B p-LMP@ t0`   U PNx0 Hx 0-LMt0P   % "20#0 P0S  @@T 8h8@T00 P0S P ^T @^? -LMPP 㰼(`(pK @P ( @P` @P ( @Pt0:t0ۻ0>0> K p-LM`Q@ P_ \PXUx -LM2@0 SP $K50 ^ B?@0CS+1 ? Rr  t0 ! S0N>J2n @ :t0\ 8CRt0 :t0>%`,pKⰎ >h PP , 6 PP0t 5*0t J.8C8Ac Q.PPQJPUZt>H b .` . 0O0@d P d p`l?ʨ0H0X VR  ^NMP)0p`FH0XZH0@X#82Tt0!0t01H R`1l#OK P@4Vpp4b ŚH0C6H0@X\D  |0P| 0y @w00!s1Fp0S7  ㊓ 0@P< T  4QK, 0 R(K M 4 Q 02R#A #}<LM4K  o0l6lpst>'q6lq6ll> M Ѝrt6l p-LM@Pź` (Q+Q%t0 >;.t0.sGxhp0t#40#"Bp0t HQHP E= (: Q HP3 bl -QLM@ t00t0t0 0t0 0) P P ِ -LMt@  0R'0 t0! 0)P P 㴐uQ  p0̌#40#"BH0t 0t0 h!w'q(q - LM0@S00>0 Q>|  00CS0 tXt8l(p -LM`pp30 㨀價@θ  0@D  D 9@P ✠% !,t 00S t PWP|@$ q 20P=j t {RyW  b @h0(PTh ?R](0Sڜ0  P HJ Pt0@ts0 0S Pt@tt  p [ t|  0S- 0S  0S 0SI 0SW~ X!| Zt p 0@$  $ h0 t@0  th0@t t    0R40,50t o pG0 #Y!   A0GS p0S P 0S 0SM @T T   't@(0 h0S&  .H0S_tp  0S 0SWt W W@ p p(0 S|PPxPY T 0S 0S 0S >08#8S>>>t  ^G0SpSn l >(B8CS@1@#Td@D T]0p  x t  (Wt{pp !W|pl 'W`pi ,W X60|S W 050;#(0 0S050,| StW tW   ^tɌt z Tx 0>(!PxW 0S (@tWW9 tl 0W6tW   >Rs kQe0>t>tW  |@  P0 P p p P P 0 @Pp0 P P W 0@0S stt/1 W   t}\WˌtxHop0̌#40#"B0t )W}p ^W~p . R @0SR&| ~z(q (q'qt>bl p-L M8`K@P0t2Ɍ0tW Pt09t0Kp -4L Mh1p80 0P40 @ D 0S<\, ls < B<l<0S0 ~<c0p #ppppsDgfff6l6lq6lD/) -LM0@  (0 P0S0 p-LMP@p# 40#"B `ふ@ $ɴ0 t0191x$0Sx191x 0Sbl - 40LàMLP@LAp&0`  VW ዴt0`.H0S` 2z + tPʤ0  `t0`bl -LXMP|0 U`' J:U# :U J0U :Un F:U s:U h:U 0Uu h:U. p(KP:0S, 0 S D |0^ @001F0S 5 )9@+pP 9U'0CU*0CU9U[ I0CU 9U_ 0U㠴t @   5,0t p 9U 8UㇴA? ѳp8Uh 8U :80Sq8x 0S$0Sx崳p|x8U= nl8U d8U \8UnH0p0kOt @p0,#40àL8t  P} W0S Z t0(0(SpJ  @0l 'H0 @0CtKp0 t L@ D i@pP; `c00!`nap `b`^LW(D7Up 7U!01 R |0A ,1 RkD0h l0&20 p 6U 6Ul0p0Q0CUU 0Uݳt0p;t0(x6U? 0Ut,1 Q-D0* Pp 0Qp| p%0Zp pp  mp,1 RL wP|pPp , :p -p Wp㊳t0p;t0ղ@  P  m| p4@ p`Tp#*l0S gl0T20|   pP   l0 ឲgpP x_,1 @T0S0 RzR 00CS0 ,1 D0p00,! 00,!| ,1 0L;,1 QD0| 0p ,-x08x0 @8x0  x07x00@x08x00 x07x0g0St0t000t0t0\@ >7p(0S{0S  pPyt  0    00C 0 00Ѝ003!0 !0l # B,0 00-0S 0 0 MQRЍ BP0R 0P R 00c!0R#<0$l-P0PM  R 00c!0R#<0Ѝ$l p-LM@ヱ`Q@# 0 R00B0C 0 0 0A00P0Q  00b0<^,00\00S0 0@ᨰx 0-LM@PN0S US 0S\ a aR QPb0bU00S0 08h{000 0 -LM@`p^P V  0 PbU0Pb_ 0 b PP 0eS0 1S00PS0eS0 0PS3 p-LM@ڰ0`SP!  0P0Q  00b0<^,00\00 0S00000CS00 0x -LMP`ᦰV@.Q@*pQ% 0S `0 `R@@ 1  e  P 0am0 0S00`dd0Vp@hQ   -LM@P j > mP 0SB] > m000 p-LM@`P >mV`0 0 0P  xUB> m -LMpQP@p1  Q( Q* `0Q! 0Q a a0RPP `P  0a 0 0S 00pe 0W@ R 0   p-LMP@ׯ `R4 R0S) 0 0 0P \  a 0 10 0 P000  0x0 #0 00  S0x -L Mpᓯ0S" 0S 0R ֮p$K@DKPDK $Km蹮<0Mh! D0 ,1 P Ѝ+]ЍpsMD0 ,1 0S Ѝ ]Ѝ p-L M`PD , @T \Q Q 0 S DLHKp`\at -LMPp `D0 ,1 @T  ^ 0\ `]` -LMPp `D0 ,1 @T  m^ 0l\ `]` p-LM PD0` ,1 @T  K^0 [ `]x`x40 MPP 0SЍ(q -LM@PP*0S( BT 4P: 0-PLMP@8P QT 4Q08C(R0S T0SR\ 8 -l0LMPpU` @T * \4@0  ^PU(q p-d0LMP`U @ T*$04@S  RPUxh!(q p-d0LMP`U @ T*(04@S  RPU}xh(q -L MQP@#P P ?P U Q4Q0S0\ E 0 $K*A$Km 0-LM0  0P0S@ T* 04@S  RPUt t0pS00d0 \0 LL (808h4(qlAl9lClQl/q@lDo) (q*q(lo)0 M 0 S*0RЍ*q/q@-@PM Qࠡ  \00 a0 0l 0^Qʲ1 0 a0b0Ѝ`0 SQ1 a0 0a01 a 0S *cP R 0 0 R -QM ^0n\  S ^ 0n\SЍ1M  T0S   D00ccЍD 0b1M  T0S  0  bЍ D P0 0c 0-@LMPTL1!D8 ( D 1 DP HL X T8 0" ( 04 8#t>h h`?@ 1A=A>A>At?A?A?A@A@At@A -LMpP`A @A1 00100 P1D00 -LMT@Q X0X0X 1T 0 1P H0S L DP1 01P 1$AA1M  DЍЍPDЍ p-LMh0`PU @ T*,04@S  RPU 000xh8(q$(q -QLM`$ pR!$ KPP VU $0 @@cV@1 l`d0$0 VpPK AAHAAxAA`AA -D0LM00@10 0@0 0-LM1x00!@ B!1P  J8D8r1cU1:11$(q@*q 0-LM@P pPP@8h跪8 0-LM@_P@ᩪ8 0-LM@P@0SU 0  00 0PP 1  T0SB 0S P88MЍ p-LM@`TPtb@P h 101^D0001a0 0@0xMx@*q$(q -LM@Pi`Tp U/PP 11P 01DP 0X P0H L`X@T@pP@WN@{) p-LMP@P. `PC  R'000 0/1  *1! D Dd1! 0D !XPTP1 0 1 $x0 17xD dv@37x p-LM@`dTP\@P P 101ᤩ0 a 100xᙩx@*q$(q -LM`P PQ@ @ R*@PbTp(K1e.Zp pP 0j0!8 DDT0!T01TpT 01X@XpR0 0 P0 pP  P&0!0h0000 Z 0j0 }0 P@d00p0Lp -LϠ MϜp4 Q14 K0 `P{ W000 0@K*lDD4@000㝩T0!T01TP T0X`1XP40W  pl 040 S0`40 WEVA @PP> Z& 04 0bW1! & 0S  ;j pW1! 4  00b\! 4 c  Pd0Wp04 qcW0(K0GE Cʚ;AAAAAA -LM` K -LQӻRMQ`pP PP 0 \@ @ 0S*@cTS5X V 0!0 00P0000f0yPP" 1 `000 0X0j 0    0S 0S00P 0PX D -LM K -QLMp@`8W 0 0g 0 1000*P% 1 Q PQA @@AQPQ100D00 0g0 `` p` BA -LM@P  ; -T@LMN^H`Hp P <0@T0h*q(D08l@*q -@ML 0@50< 0@&`嘠p嘀P0@ @#5  00PU`$Km(BA@*qd>?,D0BA/q*qXl8l0D8BA -PLMp0 [ 0  0Q`&0` P`U0@TpcgP @P0W U1S   P P@U`0X#@gT@!  V0X PU X`p0S P P0gX@cTPP P0 1 0Y(KpP XPp 0 177 7 -LM`RPp/Q+U" 0Q*U 0ScPPV`dVP U 0@`T@! P $P NJ GhBABATBA@BA -RLMp`@(K000 PP V@`;0K⼠00S PP3 젠 jR"00S W gpZ @1@! @`d *aVPx0Z0 c; 100 1:10Z/q -LM1`Qu 0,0Sp* 0Xcp`!Q@@T P 0D P0 S`:X4,`9X  `V00S 0 X@1@! 1 d 00dS 0000 X  V00SR``  pP T)1 Q PQA @@AQPQAD00X@@X 0Xpc`0 C10M0 202Ѝ2MЍR0S P0M0ЍMЍMЍ -LM@Q 00Q02/q -LM @R00 0S008 R0 0 R8#82/q 0-LM@QP 4T R(P P@88/qBA 0-LM@ PP V8 -LM@p`@T PU00002 P02@T P|7 -L MPp0 40 0 KT@P P P T0PTP4 0RX \ 0`h 0%`hW00S Z004 0(KW#VgXg0PUSUY  0Z `Q 00 0P@0 R  0 R0W8\fEW3PP00W00SU& `00  0 0f 0 00  00 000P0@00 0 1 q@PP  }P0 XU( 00S 00S VU 0S:0f 000 ` 00f 0@0P V0 1e 00 00 0(? $@CA -40 MLh @   0Kps0MS R$   0S$ Ѝ0-80M$ @P @$P0  191# Ѝ0#R 00 40Q 0 ?SRP@-8 M$3O 0$@PЍ 0-LM80@$P0 R00 0S000S?0?8hm 0-LM80@$P R00 0S000S<0<8hQ 0-LM!80r@$ r 8P0P<0,  3,@03780P00<0<0X9l89lH9l 0-L M@ӣ0P9@ %@ 80 h 0@K0ps p-L MP@Უ@0`h 0 @Kpps -L M0@P`-@ K㐣0p 0  8@բP,0Ph!  0@ps -L M0@P`-P Kc0 hP0p PP 0S000VH 0V`< 0V003ᒢᏢ `psh9ll9l -L M`P@/ p0 @rK -LM@<@ D0|h1 -,LM^P` 0S \  0 (K*0 V 0f Vc ?V` V] |*x2V"0CVA `8pK⾟ `@2 P\0O 80 4@ [2 00 \1V\ U0V= 0V 0 R] E- V @V V 0 0000CV 0V 0V 0  V  V0 00 0 0 0  0Sy  Rv  Rs \p 0 f3 003 0 V Vm 00 09M $DD -LMXp`80 P" 0S \ 80K0 0 @$Kd3RO R} R  R  R *@U  R8  R R_ U@R R RUT 0S%0 R00 0000 0S \ 80K0 0 @S5 0S00S S0@82hf@P Rk2R 0S  R  R \ 80K 00 @R R R@S 0S0 R-@U 0S0*B BQ@@R񟗛ꀢ)X)D)0)0T@00T@00 xP 7@c0nPP@u 7@SP@m 7@KU 0 S4@K [AP!@<00VX V U@1ps!MЍ -LM@ 1S   -L@M<@@08#8<0P <0p < 8#8 ,&``K< 2[0<400G0 00SD Kx 0<⏍ p-L MQ@P ` Q Q KpT $ 0h 0ps -QL06ڃh -LM0@08006ʃh -LML H32C0bC^ (K#0 0Rx DP 0 A0 <^00 A@@0@@D0@D0@0C C<Qaq0 @P(0 0??<PXP <  90 h!  @ 0PX v6\000 0f 4 ^*qQ0qps 0-LM0P; 00U@0 P64J8hC A68h -LMpRP` 10^ V@ @@ 0R 0 `0aR \^P 0 0 T`pV`0   0 1SS 0001P00S 0 00!RR 0001P000$0S $ CAM810Ѝ -LM @S 1 !@ "PK "K 0-LM0@81PS S TᔞP 08A888ZP -LM@8P  0S 0& 0  0 -SP;0LMSp`p3*9V@ ; 137p ` !pP U@0S0#S0` -LMp`( K@P(0$P 0S  00CS 0(89@ K,K !@P (  00CS 0   @p0@P,0<@(w8 -LMp`( K_PP  K,K J!PP (  00CS 0 X (0$@  Pp0PP,0P(88 p-LM0`@ K$0 PP* 0S* (K !PP 0$ $0KPP Q ( R $0S R ( o!PP  00CS 0 $PXKp(P  7(K W!P -LMp@$ KPP%0 SP 0S` ,0`SV  PP!0 0$0 $0GP$  00CS 0 K$77P; w1V 7P$  00CS 0 p-LM`@ KPP Kp 0$m P 00CS 0 7 -LDM` `0 K8 4 jPp 0@ T0 P@ `0\\ X H D @0 L  0SL0 ~Q{L00SL0 v\  00R@$ @8K04K\ KLPP@BpPL0r 0c0Qp 4Pp<  0< R ! pPJ<0X0 <K pP@Q& X" 8PU  0X05! 0305  p P0U @@X00P0Sp U0 cW0,0 0@,00@00D0/0@D0H@p0  00CS 0 4P8P(K`06L0S wW #W -L,M0`Sp DK P02,K `H @ H K< ,@ (P 8 0`  KD0 -LdMHKPp y@P< P(@P`K0P00  0@p@` @P Y < !P(K!@S@P P`<0P㈐K00  @p @ -L8Mp`( K, =PP8  0@\8 H0 D@ P L < 4p @  0S@0  R@00S@0 \Q ,K 0&PPQN  RP(  00CS 0 ,PU K(60K0 PP(00$P K,0@`~PP@  @ R uU #U U   i0( b 40 0@408@0(L0/0@PL0P@0 -LdMHKPp @P< P(@P`KP0 0 @` R@Y < !O(K!@@P O`<刐KP -L,MP 0@ D (KD K@P < 8 ,@ (` $p 4@ K -LMp,`@Q0K4 K<PQU $K00 00 00 ,K *PP, 00$ 0(00(00  00CS 0 400Q4405tQ0/5X6l -L M@`8K pPP (K<K PP 8P |, @KoQ0K ;PP <Pn EQ@00 H0 0000 00d 800$4K;PP>40 4 004040< $ @08<D0 PP$0S HK <PP0 (00(00 00CS 0& 4 (00(04 00CS 0 P<8PP Dm44 50<0 He405080 4404X6l -L M0p@$ K(0 PP$ $`0A?AS  00CS 0$4%PK (K0PP 000$  00CS 0 (PuP(PP0A?AS$  00CS 0 ($P$R4$N4 @06F8  0\~PP MU0S3CA -L M0pS`D   4KPP0K PP (K0ِ00< $@ .  7 3S PL0,dP 8 K:P,=PUHK@ 3SE:,OP830W4,'P0P< 00CS 033SP0 0F6!(~PP <֏ 00CS 05 5#03P<ȏ 00CS 06|  PB =00 0 00  00@$PP  R 40@KPP ,O8;303,O@ #P5P0 (00(00 00CS 0 80D 00e37CAX6lCA p-LM`@ KIPP Kp 0$ P 00CS 0 B3 p-L M`@ K+PP Kp $K04PP  00CS 0 "3 0$$ P$a -LM@P' Q 1S 0 Sl0 R0S0 0C#qW P`Z0 ` 0WP@TPM  ЍЍ,)PM (  0S 0 0  (0(Ѝ`1qPM 0, 0C0 00C0Ѝ'3Ѝ\1q -LM RhrR@0T0  (0 ( @T@T ( f  ( 00C0( 0 S( J @T@T1& 0{M `R3 P  Q 0Q(0  00 0P pLW@P@T J P0S$P @TZ@WP2@TPZ& lL00$Q d0 R0 D@ Q 0Q@P1qp`1qp9l)PM 0S  0Ѝz  Ѝtt9l -LM`8 0PS 2R P(K Q 00\H2H D2 A0!/@!b0SP 0< 1pm 6L @H; 1 ` ` H K  @l@T < 0Z0 P 00@Cp4PK 0sD 0sA 0SSB 0 p 0Z0 00@D000  0  4881\0K 0 ` PW0pK„@ 0 `F 0V0C 0000C0  B pPnK7Pi` PPd`P$D\1qgfff -LM<  28 Q Bh 0A"q#Wk 0=L804  000 0S Wk8@PW P0@S$00Sy S  X=Pq W ,MWP84P@`0 `0W!@N {4P PVJ4 1`60PUZY(PN ,;M,WMU @0 0@00 #W,)M40S  K(K8 , 0 8MW0(P40 (P4 ,-MA 04G80 @@< P @X 0 W B A ,MP h2Pps\1q0M0S S ЍP P Ѝ -LM@T 000S S S  00h0S00 S  R  R 0S00  000 6CA p-LMP`0S @@ xhoJx -LM@ 0R )  0S S S4TR00LCA -LPMp0PS/@ (K iQ0@0̗jQ@h >P 0D L0 H 0 BtKt@ l0 p DP @P``00S&@ #@0!0:@PxX 0R)@ 0 / 0=@{P  x P  001  $ 01 ( 0 ,  0, x $0$ x0 _@ʚ; 0-LM @R 0x00$0S 60P0PP80 R  I8h8hI\1q -LM0S@80C hR3PU/P,hP`* j0p 0 GF 0 pK00D0 l0ChP HP l0 p @ NPP\@T XHK:XP "G$0P$KPw:$@K 00 0 ˠˠX\KH K 8PP\0px001  $ 01 (0,@ ,@: -LM0@S 0S0S S SlŲh0h P D @IP @8z$0$ |7 DA9l9l9l9l -LM Q@p`5 PXP Q00S0v03Q0SQ<))) )x))`)H)))t)p))))4)))p),) 0S -X Z  m- 0Sr `K M V8]TPE PC 00 0 3@P  80@ 0$@80<@,00@( @ 4 00 @5U80(B8Sf S7 S5 l0S( S S Lxv R 00T0P 4 0 a00400 0l 0{Z˱PU0p 0"PI UPIRN 40 0c c 040 0 b0b0 PXP0P0Y0( %W 0S80 P@Q 0P7WPXP0Y0P90 aP u 0DAT1q(DA DADAt9l -`ML Hp`@000 p@0h0P` @00P@ @0(0P  $Kx1qG(qP03! 00a&0S0@00R 5 .0@ R00C10/0 @L Kd 00?2c, dS0d00Vlhmrvl4D8D2q 2q1qt1qDAfff2ql1q2qp1qQ 0-LMLQ0P0  0@\P 8 8hSx1q2q p-LM@㍈,0` ,0;,0,0 A 0S `10S,0,00,0P ` ,0   0S10S 0 @_Q t0S'0 0txh蝇0S*,08,0tz,0:0,0b,0 ,08,0t00tp0S1q1q2qp1qx1q 0-LM,0P L,0\<P,0&0S 10S,0 *   ,0  ,0  ,0 # 0 0@ 0$@,0@ ,0 8hT,08,08ht,0@0,0|8,08,0}(0 0@(0,@߮1qx1qEA -2LMh!2 徇pxWQ Y `2 0PoPVyv 8KxpP= 2 0PoPV>; q,0 E0S ,0 !0S  P@0#6pǏ P`P?`VUt@P3 }P ` P`0P`OV t0S\ڼ0 ?V6ڬA!0"A qx1t1 RU@@P\1\!h0Q L1 Q @A,q4!0r0|p,0@;,04@@f =rtl|Ѣ0bpgUxU &P0p Rq80p R0KpP4 @ 2q!Ce9lx1ql1q2q8Dp1q1q EA2qps6q2q2qEA,EA -LM@ 0P  -LMp` ,0 &  0PP㿄K` Xp T PP ,0 ,0 8,00l Jr@T P(KD@0 0@@0D@, , rLEAx1q -L Mp,0  Z00Sx0LP Z p0 0@p0t@$K0 0@0@,0\9 0,0P(` 800@(, 80<@3 h000x1qps -L MP @Pp0 Z `@P` P U (Ko0 1 -LM@Kh| -L,M@PL `u>0~pW h(K8K 0L 0@K@2 PE008 @r0@ T=P@  0BPH @ PR/JH 1`PU'J0O U 00LP`F@@T H1P @,0;,0@ TH A0 @H0\ 1D > H< 1P(`80 p0@(, 80<@ /,0dP`90,080K tx 0`4p8p<  0< D0 0O`0@<@d0h@D\, 80K)D t0x@, 0H |00H P(` 80X0@(, 80<@ 2< h000640sK/x1q*ps p-d0LM\` @T0TP0 Q00cR0bc00cUxx 2q8D1qp-,0D 0RM,0 L RP P0\0P0 L P0L pP` P`H0 0@H0L@pPt`Ѝp3qx1q -LM40PC6/`0`00 R0dp`0dPh` ڌ6@ 0D000]J00 @0 @4 0PB&@`?S (KRQx1q -LM倐@P0@P0 0I@(6@0@ 0 @d`hp4` (K2q 3qx1q 0-LM4 PR@D0aL!,4@8s 0-LMLPQP0P t0P0 LP dp0 0@p0t@D@0D04)!(,,0 83qx1qs2q p-LMD`0VPD0 ,0D4 !La,`0SGVJ ,0D` ,00,0 R  6,05,0 RL L0L0P00PPp0 0@p0t@xL RP0P0P00L P0| 0p@ pt LH0 0@H0L@00nxs2qx1q3q -LMD0PS 0H@ pHL Lp p`P 0@P0p L0^0pt ,00,0pVn,00,0x1q3q2q -LMD0S L @RP P01P0 L P0 1p0 pt l!H0\0 @H0L@DD1 Y$*(!p00 @p0t@40#6 vP`d0 `gC 8 +40CX:D`@圐XnhQtp Uh 0 `U 0t\p^3qx1q3q2qsps6q2qTEA2q,0M0,0Ѝw -0ML 0 0 `p@P0ʠ @ @S8PT0T` P'HH0P h@lP`p@tPKh?Nl3q3q2q2qx1q 3q`EA0@-PM@ R( 0S%\ * \ ^ \A 00\0 S 0  0S R 00Ѝ00@00 R P,  R/ 0\00 S 0  0S0S 0P@ 0S@@0  @0@000S00S0@ 0\@@  @0@-M R 0S^ 0Sl0 0R 0SI0SD \   R00 \0S0  0S R) ^ 0Sn R 0S 0R00S00 S0 0S    R 00Ѝ000 \0S0  0SR 0S@0T00 S @0  0 S 0R00S00 S0 0S    R R 0SP0U00 S P0@  0 S@ x -LMpX5 PU?P0S`X`V 0S@ W`RP 0WPP 0RPPV 00SZ  `X `V 0S` MP0SЍP 0S 0S P MP0SЍP 0S 0S PMPQ00SЍ p-`ML<@ p-LM@`TP@P  R0T 0@ PPP@x0@0@@P -1LM`pPP* 0S'ʼ弡 0R1P 妛W0pH0@40H0 9,0(`8|0S; |P 8m(1POW,  W @0@00 00S 0Rڼ0P m8 RR:0.S 0  $0@7 TX p @0 0 0R 90.S9l(4qD84q3q04qEA3q -LM0@0a10 4  +z90 Z0 0P` 00  p 480 0Pp@`Z !0400 0(K M-LM p00 4 `0@P`pG 2 P 40 Y W ,  OZW00S (KoCW(K0 40, (Ko(Ko. -L`MT lp` \0 X TP X 0@0@0 @0@ X0 \ P@h@ dP P`P`U T080l0 T 8 l PPL04p [4p@\0 1l` 0OS"U`U T 0KtP 0)PPT@t0sI 0X\ :TX0p TPXt00@(KlX 0O8 4 X SH D "80`@H`U`L P LD@l H0Pp @TP8PlP XpT\Vx0sTXP Tt0p 0@V T@8@l@ tTT 8Xl l0t$ɯ0 QdTx0 S`X  0O 0 @UE T}\V@8 K P 0R@ <0 SLP\XT P 0` B1PP)P< @UU+ 7XT0x t L@8 @@@K0@ PtP0PPT8l V 0Pl TP `h0K0@h0 d@ X@0 0X hK(@U:U*+ 7@KX  TPt00@@- MR00 RP00ЍMЍMЍMЍ M10S0<0Ѝ9l 0M0ЍMЍ@-@QM 0@ 0$@Ѝ!001 -LM 0; S 列@4qMЍ -LM@$10 hqR5 40 $  \k4P$V x 0P P x 0S00 T00Q0Sr4PkV<40<40P 0$gxP PU  q0P a$psEA p-PMLddd 0 PfgH0H `VPP@P# U$@Kp@5lEA@4q9l9l -LM@ P ( R,0,0,0,0$0 00e P -LMP0  @0=   0R 00P0 ^00  0R q0 Y t/ W8 X. WDʁ qm to U:7  Xt0  0 0S(Ku 000rtuXYTUVt0 0STY# t7 q< R Q W t0 00嶟R( qrXY VruuXuVzrQEA p-LM0@ 0 `K$PK0S $0S  0P$PKp$ -LMpP01 0101 P`u 0P@`PU`P `400v0@0 @ -LM@08;00C0hڕ4q 0-LM@P);UT004V0P8T$0 0   R84qH:l -LM0S 0R& 08 p2 P` 0S@ 0@ 0p $0( 0S 0 0@ 0R0 @  -LM0P@T(pK$`K(0   0`s@P $W0DS J*lJ*HJ*J*I* 0 0$@K 0$@ 0@$ 0(0 @$0( $0@O$ 0S u $0 $0( $= 0R 0 0@ -LM0SPIJ@PN d @ 0@ 3 cLQ h0S\  0@  0S @ K  `V $ (0@(, P$0#0d0@S (Q,0, ,0, $ 00T 00F`( `@(K,pK 0pP , `P L*L*M*XM*$N*M*#@@T (0@P,  0S^ 00@T(0P, 0 0@,t@0SL P ( R,0,0,0,0$0 $0 ,0( P,(0 $0PT& ( 0P, (0  n@ 0R:  0R& `P,0 @ 0@ ,( 1@,0( ,0S $,0S  0R(0P, 0 0@+@'D:lL:l -LM80 1\h14 00 0<0 E\A0U@ p pppU2T 4 P9 0Y01; `PM@$ 0 p8  40 0< 0@$0  < 0 00 ,0Y40% Y Y @\ @(K0@P(KoY0@10 01+@ @Tps -LM((@ $8 0@ʕKEA@5l4q -LM 80@ `;%0 R\ 0 [  "P|0P0C0P SP%0 00S 0 [$(KxP [ 00WL0$  P WL0$  0  R  0  00S L0$  $ geEAEA -LM,( 0 0<0 R0 0`(80 S P< 40  , $<@0/S D 0S/S 0S/S0dS@0 c0/S ,,0SɌ,<0SɌ,,Ɍ,@0S , ! 0U D0U 400P L0P  k$0Sy 0Sv 40 ,  00,P !@PD R,Z, 0 jb, D@0,SɌ,P00 Sx@T$  "P, n#0K0 pW^ 0P,P00 S SJT30 S ( @<@ <@ D 0S/SY0c@ 0/S^0/S ,`jnj ,WPP,  (00CSP  z80S,r @Q p!0.SM0.Sʌ,HIS,hR < @0! RN T+ 00(K0/S 0 db<00@S@ p0S8 0p03R0S@,PɌ,p@R ?@p "pt,@4 R1L0$ ,  4p "- , 40S L0$ 8 Rs L0$ o p@0 0 jȌp,0 @p4q@  -L,M0,00! 4 p(P 0S 8+0w`V/ R+ ,0 80CQ 0S/S0/S{L Q0$0 R3  0/S dq aP81 ``8+00(K P8L0S < P `Pu,0n 0`"\ RU $0S0$0o0S8$㏒0`4K4 PT 0TK@8` L0 H@ < @P D 4 0 PP !`P[D0[s_  0 S^*R80`× 8ِ8000 8P0/Sl0` 0 8(P08SX8+0`W !P80$S' 8姐`{ ;,0w8垐s囐`o>`8l啐#  00d R8刐 `?`00PS8Z4q@4q0@-PM@ R( 0S%\ * \ ^ \A 0 0\0 S 0  0S R 0 0Ѝ00@ 0 0  R P,  R/ 0\ 00 S 0  0S0S 0P@ 0S@@0  @0@ 0 0 0S00S0@ 0\@@  @0@-M R 0S^ 0Sl0 0R 0SI0SD \  R0 0 \0S0  0S R) ^ 0Sn R 0S 0R 00 S00 S0 0S    R 0 0Ѝ00 0 \0S0  0SR 0S@0T 00 S @0  0 S 0R 00 S00 S0 0S    R R 0SP0U 00 S P0@  0 S@ x -LM`@V3 ^=0S`PVPU p` 0S`` TPR 0T 0RU 00SW `PV p PU` 0S``P p MP0SЍP 0S 0S P MP0SЍP 0S 0S PMPQ00SЍ0-l@0l SMЍ0 UTR p-LM@PT `P`@@T@x 0-LM@PT P@@T8 p-LM@`TP@P  R0T 0 PPP@x0@ 0@@P0M ЍH0MP P 0S 0RЍ5q -L M 0 `0p00Ġ $ R 00@4l 04 0Q(0 (PK @(00(0 08P#8@(00Kull5q@-0@ 0@ 0$@\0`@D0H@80<@,00@M0l0 0P T L @ 4 X (    ЍL0MS X R\0\0\0 QL 0SX0 X0\0\Ѝ80M080Ѝ@0MD  D R80SPTPT0T H0T0 PT 0P0 PT 0D 0D0Ѝ5qp6qD0@ 0CMD0 S80SPHPT0T <0T0 PT 0P0 PT 0Ѝp6q5q -LM@p`\ L0S XPPU L0S \ -LM0   K0 P K輈*-2T?0M\ \ x 0S00SЍ6qxM0S Ѝ40  0 R  R x 0\0 00R0S R 0-LM$@ P R 0S   80S P 0$8$0@-MP@P -Ѝ0AЍ0@0M@PЍ -L M@,P(0@pl x` @Pt@0\0DH@|P48P@ PKXFA FAFALGA -LM`0P1p ^0Lx@10P @Dl@8 <0@WKd@T  @T\h@T < @T:lGA:lGAGAGAHAHA -LM pt ,0S+ 0 ,\`0h h0dx<0@@pP`0LP T0X@DPH`Z BZ YNZ  eh i -L$M$`R @0", Px  0PXP 8@0H @`4 00 ,04 04`KP `p PX``@000p @0 00 x@0h0P @0p0P| YϊB?0 \ T @TP P01Ps #X 10CR c. \P X@T ,^$K @T 0Xe\"!10C c RP X@T\ \ L LHA HAHAHA8IA`IAIAIAIAJA JA(JAA0JA@JAHJAyA -LMp@T P` 0 `@S SPQ 00 R 0 QR09l9l p-0LM@`T  P @T &P xH0@Q @`0(0S xx9l9l 0-LM @R R000 ,0@ dP h0S& 0S0 00@P8@0hP00S S t0(d 0?"x0 R <0< Cp0Q@0t0t0t0!Ce0;lVUUU -LMP  p R R000 @  h0S 00hp0\@0t0t0t0妓!CePJA 0-LM0PS@@000CSx00 @0@ d0S0d 00dP@8冓`JA -LM@jlD@ 0tt0P \@ 0P0 PT 0@hk0SP0 P0P0T00@Tp6q5q -LM@p`Pll\ 0 @@YP  -LM`p%lh@PT! ,0  R ,0@,0$ [k0WSlh@PTW 08 h0S Ckh -LM̀0p$0 `:@P $ 0R$ K@PK @P0PF@ 08KD K @PPK D@DTl t@0W0l> -LMß0,0 P 0p0 0PP  00 ` L P,, 0R(K, >LKT KPPL@  0T 000H@K PP L0S TzL-PPK0P 0@KP K PPP P00S-P  SP{20S P00SP  0PPP PP  @K4PP 0@@ P PP P0nPPP <00<0L00L L00! PL0$% 0 @d0 `@ l0 h@ 0K5K P @0@UKl0KPL @6P0PP0 } PL (00(0 PT L (00(0L  00CS 0pL*lFP^(KV 08PPV|0l;l> -LhMp0`$0 @PP $ 0R* K0D cKP `P \  0 X@ PPt@@K ᐴL08K < @ L 0$PtU EPV0l> p-L MP@P $`K f\ +P Kp/#\ Pdd. -LMPp( K+@P ( $0L`V  00CS 0(@ K,0 ( @ 00CS 0 T$048,0 @(w -LLM@0p P<0 hK0C` d0 h @ 8P kP KTL@k,`0 P$048,0 r -LM,p  @0K4 K`P*00 P4 000@0" h0 A0C` 吐 唠 80l` dp K0"0 K`P V v`40{ L(K0 8`倠 0000 00 $/ 0 @D0 @@ L0 H@  0#K3K @0@cKm 0 L0K@@P 40F`0[ 0 (00(0Y$ 00  ` L0$ `00S< `PBOK^ 0 0 00 0`P  * %4 00 (00(00  00CS 008 Rv04`Pn040 0o` ;l -L MP @0  @!K -L M c @K -LMpP  0$S00PS  $K* @0!0SPx@ T P,K0 `V,P x@T P) ` -L M10 ΄ 4 P夣Up1$048,00 !`P+PT @PW X*Y,`0 0P PTW X40`(K4`}k:5q -0LM p@Tl@V 0 `hP$P@0$0@00!@$0@0$05q -LM80`S% x $K0 P10PUp p@0S 0S PU@0S W @@}T$K$L$0p 0$F$0p0$@$0p0*|p4qLA -LM$0@@0$0p`P 00$00!0PP5 0PUU  $00#X00S% R0 00  0 P 0x0 00C0PU  $ {5qLA -LLMD0 p@0 lK0Cd h0 l D PUK0!0PP.01H!R pPP$kP  0L `$0`0!00PP00S P`0x@` lhRL` X $ \! -PP01` Q )PP$P  \```PP`!8$$`$`$"2 0`!$` 0 `p0K PP"`0@`$0H x`!$$`1U$\$9`0S` `8`1x0U~X000`P `1 0`$ A`$0 `g``!0,  ` 0PP `P8`!00$0<K &PPH 10SX1 QX \X L X1<KPGPxPd  P P ` "X`1  0`4$ 8$ ◰`01$ d1\1 A;l0l>^T1l5q9l -LM,0 0S-K K -LM,0   <0S-K K -LM,   0 $0S- K K -LM,   0 @0S- K K -LM,   0 D0S- K K -LM,   0 0S- K K -LM,   0 0S- K K -LM,   0 ,0S- K K -LM,   0 |0S- K K -LM,   0 T0S- K K -LM,   0 0S- K K -LM, 0  0( $ 0  40S-(K K -LM,0   L0S-K K -L M,0  0S-K K -L M,0  p0S-K K -LM,   0 (0S- K K -LM,0   h0S-K K -LM,0   80S-K K -LM, 0  0( $ 0  l0S-(K K -LM,   0 t0S- K K -LM,0   x0S-K K -LM,0 0$   0 0S-$K K -LM,   0 X0S- K K -LM,0   \0S-K K -L M,0  0S-K K -L M,0  00S-K K -L M,0  d0S-K K -LM,0   0S-K K -LM,0   0S-K K -LM$  ,0 0( 0  0S-(K K -LM,0 P0S-K K -LM0AS****************,0   H0S- K00 K<0;0 -LM,0 0$   0 0S-$K K -L M,0  `0S-K K -LM  ,00S-K K -LM  ,00S-K K40M040Ѝ -@ML̠ 0 @PK$MЍJ p-@LMP@` P4< > 4  0PxMA$MЍ -LM$P@0`\(  00 pP00V00S 0,! @PVT {  X Q P00S pp$K0!KpP |00b0at f@ -LxM00!KPnPC l ݬ0K0 @  000CS6*d*l*t*|***D0K4;DL0P@0KtPK`D0H@hK\0K P$`80<@,0 0Hl`T@xPL`Pp 0(4@@TPX`\p (K  $MЍ -LM$pP0 R3 ``L0S $0 0 @ 0 @! 0 C `00c@  4  0S` ` -LM$p0 80 R4 000 !P`Q VP! 0 0 @0 RP 80  P400c@ 0 (KUP -L,M`4 p4KD0 00 T P L0 H@ @ PPH K ` 00SP< PP8 0jPP1  00Sc  0<PP%40 H<00<0(K  0,0@0,0(:PP0S (u0P#  00l PPSPPK 40 040 @ 0( PPk  0PP@;40  0 0u  @KP 0@@ |P PP -L MPhp0 @P t S000(K`H0 40 > @P00H04\ 800 @P 000 @ ps -SLM 1 ! P  0K0!`P} <0t0 X2@d0 0l x K` x@ p0 h@ \@ 4`Po!PRP t 0 S  ` @K0 p`0!D T 8`KXK00KP L X` 0 8p 4 H @ < pPK `RP  0 P!H0 c\(ڰPG0S5  `\ ڰP;0S0S 0@b1S"`#':$0 5 (K 00S `000@@0S0`@`dA -LM `PQ8 4 0 p0m 88 @P#X08 40 R@0<0 p 00Sj0 '8 400 UR L0 8 D80SM 8 @P 8 08 W400Q/8P,(K<0!0@P*8 =<0 408K0K 4 K0p@ T4Q0A/ 40  A000CUS8 00@  PUh0P00@ 4 K0`@0@4Q 0A/ 40  A04q -LM0` SJS"`@?à @p0D00 pD0P0 K0`>`P  E (K0 ` ~` -LM 00S 0Ex0(  40àLbl -LM0x 8 40#"B ,0S -bl 0-LM@0@PS <00S%40"!B 81qdWl0M0CS$********************* 00Ѝ 00 $00 00 0-LM@ 0x  x.$ àL*PPx  !88#!$  x@ E0 00|8bl -LM  -LM`px 0#((0"4S@)@\' Q  R1@\00 x,K "88# "$ 40@P x00   $K@ x , 0x #40CBD * 0| @QT ,, 40940Y00,  ,0x `40;40bl -LMqMA 0-LM0x 0 PQ%4@ Q \q LL K0à L0MAdWlbl -LM @xP P@K -LM (x0 "88" #$pN 0C"(40 0ȁV000W 0@P` < B2MϠNl尀00尀(Kh0T,\0S0 S0DZ17q7qQ7qnmĮ>ܮ>7qk_k0@-@PP0  U0 M  R 0U 0  P0` R.00  \@ R ,0U $0  Q00Ѝ0>>E-P Mp 00 Q.\R00S .0W@@0 ЍQR J \.\ 0 S.SQZ@0.SR.0W@@00`^ J0 S .SS \ ^ZX \0e h cR@@0S  T@@Q 0 0L@R00 \0SR@H\ᘡ&`0P S  T@@R 00A@\00Q0S\@Q 0S0C0T W@\_00WP P0'!000c00 Q 0l ^0#02SpRs  B0 S 00l bS0e ~0 U0O 0 U0I0 s R .R @>0@-@M0 S0C R .RN21CP 0 0 R 0e0@ 0  @@  ^@&J 0p 0 ^ BJ0r0 ^J0 BR0 000@00Ѝ0  E- @@M  0S ~Ѝ? 21C0 CPbUP U`p@PEupG8 0`P0@Sw@pPUpG&J 0`Pᐠ0@SwPU@J 0P0SU@ J 0P0S 0S >p@-@?0|03\0SPM`@ 2 1C 0 0q  ? >1C0 0C 0S0 00n 0C0 0S Ѝp/SN 0S~0S000n0C000B/SN V:0S~0S0 00b0C0/S 0S0S0  /S 0S 00LM 03 0A0qЍQM P@ R .RQ$ 0?AcЍQON -LM`P@p`@0!0Sအ0 <P`lPh1 X!X10QP4!<1>A Q  0PP 00C0$#Bb2 0a 0>'R2 !0@~`l"`  Bp@31C#0 ` 00 @# ( i7q7qܮ>nmĮ>QD NA0@- P$@ 2 001M^   R 0\$0T0U00S Ѝ07q7q MR 0S  0Ѝ -LMS0@ h 0-LMP@ P 0 0= 8 -LM@pL $0P PK4`K1   4 00     S0  00S$K( Kd PPH( (P S (0 (0 T (0 ( 5( #40( 5( #40( 5( #40( 5( #40( 5( #40`( `0( #40S(0d   S0( d00#400S0( d00#800S0( g0004 (x0s`00#8004 (x0scW $Pm z V XT0e s0^\ ^S0 0S0e$帺U ZS -LM@4 4pSP4` x0s $ h gP(K X,d0WlW;`0 40 0 `pdX01fY0dp$00W 00 r 40KPPX0 G2#0p t4Q= x0000s7 PdX0A1A 00K8PPdX0A1 \00<0 Y `X 00H `0Cd08K "PP 8奸 JPPX0` 70bd0,80dD<0c 8:8p c @SPQ0t `P2t0s D8彖Z0<0Px0s"a0t 80u@Pp00 Pg p@ X00K@P8 Op W0@t0x@8 0 8@ BNA8qNA7q -LMP p 02@(p  0 !P  0P:0RT0S(pD0 X1$^D   !T00T01 01(pP0S5:0lP`P00W0S W, K00K,(K 00lPP(px~D 04 0 0, (p۰P K(հ -LM4p`P8K,K 06@P$0K,08K3P0,0D R:S 0S Q0S$K袰P꟰0噰 -LMQ@`PdX 032`DnP6"\050@0 0 PpPX 0\ D  K`X H0N a 0P۴pP _00 -LM$@ 40  K -LM04`@0  @0IPD p0K< K0PP44K00<K壴PP.40 D0P*0@SD0 @0S0S 0 6P 40 D0 @0Sp(KUP4@\PP4@00@0 -LM4p0K< K0P@P84K00<KMP34P0D0P *@04PD0 @0S\ 0` \ ߔP d ٔP 4宯᪯p᦯(KT4坯OAOA -LM00( 0C4Pp00 @8K0KX @D4 0`P1,K008K`P-,\0D0 R (0S  @000 A @D\0 0S ,`P 0\ 00T00S$KL,I -LM0 , S0 S0 p],0S$K``0\p \H 4`x0sA 0K`X H `0Ld0 味pP@0D0 @ 3  4P,0x 4qP0 40X`0S( U$ q@0S ,0V0 ,0K0p pP,S0 `@0\p0p\ ٮW00pOAOA -L,M(PdP ^p4:dX0  a<à  00 `PX0d 0(#d X8K>@ K00K`P( 00L S\04K L 80@K `P40(\ D @H P ⽓S0 0 T0 0% 5#40% 5#40% 5#40% 5#40% 5#40`  `0#40S dS0d00#400S0d00#800S0g00040x r`00#80040x rc000,0SKFH  D  H 0 D P: ,0 @D0CS,03(0\ C(4ʯ`P@ K0 (8K A(X>|`P4K80@Ky`P40\ (D @d 0(K44圯`PP R S0 `0 x0s P0L0  L P00`@0P0` L -4LhM0,0  H x @00 T |  d 00 4| ` dS0t , 0tR/(K@ 0Pt | lPt @40p@ * 7K0P Pb P0t0 \ X  `\0 0R   S R\ q T `m 0Y 0R S .SY B0l0 D0 h0 p@KdhP K<0KPB`HK@0PK幱@P4@PHHPD 0@ s 3S00S9 \0S`lp R PP p"hh ; \ X V\ `lp V0fl2l Q 0\0"'t V |  0t0 N\`\ 0\`S  P X0S@H` 0 0  H@7K Pd(pd0,0`0x 4r` <0SPZ V<` PRH嶬 v 3`x0s00 @`Rw T 00R00SS  Q u  0Pt d`0S  Z Rt ` <D0KpPt p D0R |0 0;0x tj3\ X d\(p\ 0B,00.S  R R0.St`R <` T d`0S  Z R=  | 0  |  OT0  u  0Pt |d`0S  Z Rr  | m0 40@hQ`K0t0 aHt@ ]P t Y` <D0KPhp0S T x L060D0| T   d00S  0Pt 1\d 0A,0l0(0p0\;0t #x t#0 6t 0x 0`60 <D0K@P!pQ T  &D0 |0 m` <D0KPt p0|SD0 x t060x P0t@ 6t@ 0x P060 D0t 0l>MЍ 00 M $00Ѝ 0-LM`P @P004  0 8 -LM0K@`8P00 0 K -LM"0K@`&P0  K -LM`B`0(0 0` , $ h0PSp 0S\0 K'U  2 0P(  h(KZY+DOA p-LM00PS@0 0< 0S  `P  0oP Axh0S 0S p-LM``Pd0,0d Q L0@ 0@T  T0@0 @0@ ,00@$( Z BZ  ex  t 㷐x -LM  p`P `R x0`@0Q a`< y ;u$0 :$0`" -L8Mx0Pp @P (KPڌ7 U@ s`0!0``@ T$0080  0 @P0K :0@ 寮@P# x0``0P. D8 0R  yZ P <  ; `b00; KD@9 `0 4 !0 4 !0 4 "0 4 "0 4080 0$02 0$0<  24 \ 8#8R$402@SQP  0 400 0,0 0 @400 0002SL0 $PP80S 0 40S0 x0 0 40,0080 0$ 00020^z < 0Bv \t:0L q0Qn 8^k 40@@0 Te,0@!@0@@D0 x rH 0,80<4@ L 2D?!04 H @D000H4`T 80H 4t0LP QT 3R#0H  0 H0x02tQ0 08l0l00P S@CWP@l0 4p0X4@4 C`\ d0Od @0RX O@@0 40,0P 0 L0000 |QJP0 0B P< P P @P$00108P0010h0 0`刐 x0e"0#4X0 D0!@.X$ 0,00@0H&0%@ 40| e0  x0y40+#130K @Pn00D@ čP 0|000, +, 0哨000 yX 㳍PD 㭍P, 㧍P p\OAOAOA> -LOMTWOKd px , P!`P$0 ` RG-` R7\P K Z 0㷾`P , 0R(KK\ Z 0㧾`P KZ 06p @0,00C 00K(` 00`PP00S`(   Pz010 0$00!0$00  $0(`P ! $0x t 0 #40S`P $0 lm0!0` 4V$0I 0S`V`R0 0  00 0 0CAx0s00< KmP,   `\V/K\`V KZ ٌi. ` `00!`} ` `Vr < 0`0吀P밀B_Z㩌PdZ CZ㡌KZ Y_;Z㙌 Z 4x 㔌 0lul >MЍMЍMEЍMЍ0  BM40R,`i+i+i+xi+i+i+`i+i+i+i+i+i+i+i+i+i+i+i+i+i+i+ 00Ѝ0    00 005w-` @!0@`$lP#r"`` 0' @(?0# O $ Y$ `@&0#M@Ѝ8^nCCX좙N M1s s s Ѝ$0<0@00 0<0=l=l@M R00 0S00Ѝ@QM $ 00Ѝ! 0?A0100M000@Q 0 S Ѝ1 91 0-LM Pd @0 80ƸK0 p-LM0`@P` $0.UP4%(P%(P 0 0"$UxOAOA@OA -LM0 pR 040`V  PR00` X0@0b4` c SPQ 0PK -LMp 00匀0CSDl0tP`S u+  x 0@0,  (Kp0S40@` X0b5 ` PVQt @|P 0@t0x@D87tP`0<0v.@g-t0sx0sU PA0M<Ѝ=0M< Ѝ 0M <Ѝ -LM@*- -LM@- -LM00 @R`Pp p0V x -LMPPpWhp KP 0@ BpTpP 0 (pܯ p-LM80@SPP Kp(`K$0 00 4 0 00 000^\ KS0 0S0T0XV B00Z<0 -LM0@(eK0 Bn@4q -LM0 ,0 @P`0pS( d0R`# :DKS, 0Rb(K謐K d K`P 0 !0 04开KY0K00 x L` H` 0 00 ,x0 "0.00  K0`P0  0  0TKV KX0K0PJ0NKP KY0[ 0Y0K0 RK0+0l@4qP> -LM0 ,0 ``0S4p( d0R# :J, 0R(K@K 0@PK@K≉00 xp ,0 00 x0  000 `X 0H `0Cd0 PPPd@DdD@ c D 0#40%[ 5[#40%[ 5[#40X [ [5[#40$[ 4[#40%[ 5[#40x `r= !4 0 0 %[ 5[#40%[ 5[#40X [ [5[#40$[ 4[#40%[ 5[#40x r ᒥP d KP)  b0#80 [ `0#80c  @0S 002y TKV KX0Kr0NKP KY0[ 0Y0Ke@ PK K 0H YKL @ P P0  0  0"8*0 RK0I0l@4q=l`> -LdM@0 P,0 H L h7`LL h1L^|0 `p }H0U HPr4L2Ɵ, 0 R(KP L0^\ | VPL x S0` T  0S x0Q 0 0 x0@x @0` 0T M0Hp0 Ppt (0 d p,L | L] ``0P TQ   \  Zt0SHPpxPf0 N HK ᲵP]HPp Tt t   \ t R S0oT\atp)P\H0 Ht 7 KfPJ00 0 0 \QZ  LKvLPX x X \l (0h0 Z T\vQ@L L|  fx 0@00L])Z | xj)0 .R=| tQ HA00 \0 0 kPB `0S Ҭ | T R&0S8!x Hp BKp7K lp0 ,0d 0( xp X@P BK [0SLxl00h 0( 00lxy@P 0S | eL}|  _L儬`\Xd x2p 0g@P QLclQx  0S\0d 0$0XQN | 7 R@G X0`pW9 `X H `0Gd0PK @@P'P '4D0px0ps` 40  0x0s ','8  0P\@P L@0S 0P圡L AQ?Q=Q0lpsp>HPAlPAqA$PA 0-LMP@QQ8h -L M@p0`SP40s0s0s (K0s(0sX0s\0s`0sP0sTq L0$  0R )PT!88S(-S0 0S00 00 z L0$ z0  00 s 000 0S P0 S 00 S p 00S~ S  0P,0s L0$  0R P l0  0P00S 0  ,0sp 0,00Z080sb 0800^\ 0S0 0 S0 0s L0$ X 0S PQ00S 0 S0S000S0S0S0 0S0 0(KoS0 0S0dZx 00 S JPsnL0$  !qvhPTA0sMg00sz80sw<0st<0s00s -LM00@KP4p`90 004 0 0~ 0000S `K Pl S0hd240 S0 0L004 p 08@04 0Xp 0d0 $T40 S,0DTS0P 8T04 d0(04d \0 00@\0`@ 000 Kd0S 0S`X H a0C$0"@(2"(@1<@00 !!   x0s@00!{ T0XV 0t ,0T D0\ 0^S04 0S00 0\0Z0m -L M@ 0S4p00 0 <@00 !!  0 0@@dKm -L\MP X 0 ST 4 @0UP TS00\0 Td0 0S P(KRX0P4c cb SUaQUs<` 8p P0T l h0 \@\d@ dPQ`P L dH u` X0@P0b# c8! S Q3T@ D0   0V: X`d0 ` `6, P4K.QX口PT<0K0@4Ud <0jl@LH0cS0! ddPS0!` lDS@1@!P IP4UCP0ST> @0Wd0X@Pt@ pP L l8B \AQU<&`d0 ` `6, PDK.QdX4@K @P0KT< K00PP`4K00<K-PtPU\^OXL0$  JT 000EꠞC -L^M < 0 ,0 |!  |Ax! S04`a  QKF㽃xx!h d  0S! 1  Z?K0@zaxA`1|q2` 8#8R1 dAT@ 0`! \1 @ x1\ |qh!d0baZ_K`>KPU`X@X\0d A ՞50pa `2 PV1Q 0t! p1 0 W p!l1 |V/KS?KROK@P KH1VK垢P PH!<0X! cQ!D! 0S> PR `Z?Kp`p Q  ha dq t p! l! D!A0 P0S 0@ `pR Rh d t p ha dq l D!A0 P0S ҝxa\} |!ahAd0faZ_K`.K PU`XX\0d 50pa `2 PV1Q W p!zp!rx1^K`PX`x1ZK Aq 0x0g0|d PQڜ1 00e, 0R#(Kx0s  ` \ !0x p40 40Ȍ< \ p@0D @ 021KtlPR KK )1K1[ 08$0(@K0 -LTMh hT h\ 00P hX 4SL P Sv K\  PXd0@0 @X0ReXPa 0@0@TZTX\ 00KPSPXdH Z 0MJ XpǏ p X8 RLPd`0@X0@031@ a< QT>QH @PTA 0CP0PP` ] P\PV \< UA H< 0PX80l@Q  00X0`0(KY  PVP` *P X0d H 01 LHd0X0C03>` 0Cd D @ \< 9^ 0nSZn@ ^ZRQVt p0 X 0`0 8 ^h0 d RPHd0S*h0` R \0P L` \0b@ 0l5 \ Ql0 |tXp0tP` P `5>VNP1V0lR3Q ʧ Pd0 0SXU L d0Tppp4 8D^40l -0LM@ TpP ` @T 0S0S`   0V*P `` 8qlM\p0p0p0 Ѝ 0-LMX0P@CTX@ 8    ( , 8h p-LM@0@#0 EP"` `R0`0 0S00xhV! -LM@*P t P $h@0Sl0 l0p0p8q -0 LM0 P X0$ 0X00H0>l -LM@ b  ]000 -QL MP P- K@K  TP0S0H@K  DPQ0 Q>l>l -1LM@T7 W@2 0pS0pQ+ڸ 0SP$00S PU R `0S l0S Sh 0 R W@0L0P 8qulbl+8q -LMp@` PP <@p ` 0 0 0e02H 8qPA -LMpR PP` U @W@1 }pWP`HPAM8 Ѝ} -0 LM0 @pPP@ A`@ 0S @. :0S 0S 0s $0S0 $ \Up -LM0R,(SpP ` VA M լP  @T ZP,@(  iP  Z@,( 0-LM80@SP0S  R00Q0 0088 P PP qGoGPAPA p-LM ` 0S t0 PUPU 0S 0S? @CQxx 8q -0LM@pTP) `0S8 %}PV 0R`@TV 0S  0@S S N& 8q -0 L0M @`;0pS, 6T| 6T <6T 5T% 5T 5T P5T <5T& g5T= 5T* 5TL0P0P 5T :0CT ,h5T `5T X5T PH5T ^<5T ;T (5T0S i24T0P;0 44T 0T0P00 0CT0P04T t4T `4T P4T PP ^PL4T 0T 0CT@0P00CTK 0Ty0Sv E80@SP m0CTt 0Tk 0CTc0P:0`3T 0T 3TV PL 01 P 01 T MiQ0PP 0 A iB i=0P0S0<01@JP(H0P0$0PD0 0P0=0"0OS$,t2`P 0S0P 0PP 0P00P0S0@0 QPH=0P0<0P00S i.0S1 0R 0R 00 P 0@S0P@@41 @P  1 0 P 4000T :00SP0T L0T P@0T <0T P0PP080kB @~fmB fB{BlB sB@f@oB@nB @wt@|B@vB fB@hB yB}BzBjB@xB@gBvtDD>lqB@pB -LM@ D0S HQ\PS0\0L \HS0\0 -L MS00 Sp p@`0\P0 40  R400404 0@0 @ @`0 h0 封 040:0`S$P d 00S* P 0 0 $  (Ko(Kp -LMQp3 0Z P 0 PR@T& < @T! 00= 0 000 (`P <00S<0 8K 0 q<0S101@T(K8K + 0-LMRP  ,@K$  K,P U 1[!0 !K0 -LL̠ČM.Č!̌0@0K  @K0MЍ+M0ЍMЍ -LM@TPp<@ ' 0<0 @T 00= 000  0(`P X8K T0  <0S<00<0 @T<(K8K G 5 0-0 0LM 1@0PSzI8 -0 0LM @0PS`  0R` X0 0rpX0: $0S71 $ PQE :0S QH p P!$00S":`V. 0  0`   h`0 @ 0  W0$00 2 pP` #P0S?P 7`0 0 0 0 pQA - QLM`p Q -iQ Q p(KQ/ (*00@ T q 0iTP0 @P pP p;8q17p Q00Q0000 0iT 0YY V  = 0 0i 0   %vP p `up 0K&0 <4("4!<0 -LCMq0  0 $ P @RP `62P PP$ 0R) K,IK J/K0VPP(p 0S?p(P0(0@ R #1[S0#1K @(08P0l>0@-00 M\ PllP \@0 SP 000< 8P 000nSЍ0 n00Q Q 00 84 04 <-00 M\ PllP \0 S P 00 0Ѝ00 048#@-0A SM2*Qg 1@ 0S't+t+++++\+\+0@S 3S L S 0S0S Q0B0@S/ *ڀS S* `S Ѝ0S0 S 0S @S00Q00Q`S pS SS SS S0S:00:PSS 10 S R>l -LHM@hKP@pDwT@D` @0S񟗾+++++|+t+l+++++d++++++++X+@+++++++8+$+++++++++++++++++++,++++ ++++++++++++++++++++|++++t+\++++++++++++++++++++++++++++++++++++++++++++++++++++|+++t+++l+++++++++++++++++++++++++++++++++++++++++++0 W*W( K@(0S; K W0܇0a2W 0\ :0S b0 bS \* 00a``000 0 0 K10H`0 K10H00WW 0P :0S b0lS P*0 01@0 WG*W( K(0S 001@0P:01V{ w0P:01nWgWj 0P:0Sc b0lS] \P010W:0 $("0P010z0S2 0< 8mP 01ff0S 010c][`Y01@S0P0 K10H`J0 K10HD`B@>0@-PM@ R( 0S%\ * \ ^ \A 0 0\0 S 0  0S R 0 0Ѝ00@ 0 0  R P,  R/ 0\ 00 S 0  0S0S 0P@ 0S@@0  @0@ 0 0 0S00S0@ 0\@@  @0@-M R 0S^ 0Sl0 0R 0SI0SD \  R0 0 \0S0  0S R) ^ 0Sn R 0S 0R 00 S00 S0 0S    R 0 0Ѝ00 0 \0S0  0SR 0S@0T 00 S @0  0 S 0R 00 S00 S0 0S    R R 0SP0U 00 S P0@  0 S@ x -LM`@V3 ^=0S`PVPU p` 0S`` TPR 0T 0RU 00SW `PV p PU` 0S``P p MP0SЍP 0S 0S P MP0SЍP 0S 0S PMPQ00SЍ44 0M0S0000Ѝ$>l8q (R0M00  B Ѝ8q 0M R0 Ѝ<>l(>lMЍMЍ -L$M@0Q0  &2 H00SH0<6  0RKH00CSH0ʴ6@ 8#8 & 6 2K4 KD 0li >$0$ 0McPЍp8q p- LMP0@0cS`#P  0P @0 S*cP!00xQ0 0R 2 50SP:x0p p-LM`P @s0 P ` `xp -L M(pK@P `TP (0(@ T1!Q ŢK2! $形P -L,M⌠P`KPp( ( @rU  ?s-< <04 0cS, M000Ѝyp8q8q8q -L$M⬡0P(0 p8#(`HK908#83K6d D@T@T 0S 0S@Th01@T! V 6 8#8 #K& D( 0R%$K0HK03K6 D~P ,pP nP tY0li Ql> p-LM`Wl0P@T &0B8R#8 S6L1S@T0xh,>lD 0-LM2`@PQ \0000  h00h0@Q8hh4>l -LMЀ 0R$0 $Q   Q$ 0R  K$@`T RP4pK`q -r ㎡P@T PEUB0lIJ> -LMЀ0` V$ ! P0@T PPPU4pK@T PU `Vq q RP $ 0R K 0l8q$>lв> -LM`p3qH0PU ,0S @A@PUh(q 0-LMw,0P@T @T8h,>l 0MP cЍ Ѝp p-LM@PT `P`@@T@x 0-LM@PT P@@T8 p-LM@`TP@P  R0T 0 PPP3@x0@ 0@@P -L$M@@KP`p p00` $0 P 0S@ 0S  @TKT00 ,1TQ >l48q 0-LM PR0000 0@  6 P  8h8 -LMpP|@2 `0hP 0pn@P 0S@0S` @hZ48q>l 0-0LM00P0 @6 P  8h8 p-LM`@P ] 0Rp xhi:QA -L(MP R0P,0 1Q  R P 0 0S0CPR PQP P, 0R](KP0@l1ZS RLKO8  opW60cPU   㴟P@$ 0X@p PEW U`0S <K, 㛟X @ Z UP0 0eP 0@ 凟<K~o  ~P PEZ @P 00l,>l>-QM 0P P P- ЍH0 ЍD ЍV@0 Ѝ p-0LM@`T$@T oP 0 RP U 8D1 SPUxxx>li$ 0-L0LM@PT $@T koP0088>l -1LM@ T$ P$@T PoP0SP 00P$ 0R! K@`T SP4pK`n 8bo ÞP@T PEUw>l0l> 0-@0LM@PT@T 8oP8,>l p-LM$@`TPC@T@ nP R000(0 0 PP 0S R000 0 0 ,00CS00$ R( (0@0(0 0 ($ xx>lP0 P MЍ 0-LM P,2 P@ @ n 40$    0$ (0@ 8>l -LM0PS!$@T @T snP  pP%  `P"  n@E0/Sn09S@P   0@T$@T 4nP000@ 00 ` `(00( p(>l 0-01L0M(Q@ T $@T  nPP @T(@Km0 (0K'K@P <Pe@PD@K hm @P <P<R@P 0RK0+>l0lLQAA?> 0-0PLM @0 PP K,P,00 C0P000 ;4P4008 - LM@ RX! \!  110C0C11e 10XP RZ -LMP`p@QT 0@SpW@0@Sp@0 0C@0 dH0T0H0P U p-L$M<`KP@ l,P  PKp>l 0-LM@5P\@P '0&8hw -LM6@06Q'h0  hu -LM6  Kd+ 0-LM6P060@T a@T1S Vuj{'8hJ 10XP  RX! \!  110C0C11\d RZ p-L$M`00 0P@T@T 6 6l8D!#8R KH< KD@T 0RKp0l,>li > -LMPP<` 40  @T@T  lPp0Q  0S 0 40@ ;P< 40 | 00 0@@0S Q8q -LMp`#WP,PU) PU7 0SXQ 60@^)*0 0# 0 0#^ kP Q  kP PUP^ p-PLM`P x@Q Q P @P 00 0@@@ R 0R x0+ -LM`0pPUPU 0W6 @T@T 0 R0S LkP@,>l -LMX1`V9 `V4 0Z@T@T  0SPU 0 pR*0 0# 0 0# WY  P  ,>l -LMP0@S  PP  $ 0P0ah+DQ -LM0pS 00C0 SP@ 00BR0 SQP@T`U 0S U0S; 0`V`V qkP wkP0gS"\ 00L0 S0gP ^0P@@00L\0 SL0!l/@!b00RPXP0S $>lgfff p-LM@`P PP  R 6x @  x-xxx p-LM K`c@PP PP Kp PPP  -LtMԫPU, `p@ ;U ;U^ ;0S`P ;U{ ``, 0R(K<;UH 0UM (;UF JP` ;崖U D:U }P0CU0CU*0CU 0U 0CU \ 0@ 0`0 6 0#80S ( @s ``Px``7``9Ux &N0CUW 0CU 0Ue 0CU`` 少A`&h06  @5 L G H9U5 @0CU 0U9 0CU61`` 09U :0CU  0U 0CU`PQP` 6ȕ`J8U] 0UG 70CUn`P<D1Sh  0`0 k@8UQ 48UV0`` 0_8U 0CUJ`P`P D` G7U v70S1`PLPK 0K8`P 00 .t0`` 0)p0`` 0$p@`PD1S  p0`T WH00 }`P6  &qi i i i$i i$~i ?qi i Fi@6i(Kii -paLM0d!0S0X0T0@ PT 1S 1 RP= T &0S T$0@(0$@0Q!R<10 Rm!T00PP  p@P !f  p 31@>l<>l(>lA(qTQA -LM@P400  0@h00h0h,>l -LM@:00S0 0000@hn,>l p-LMTaPV  @ gT01T1xh& x p-LMP 6!;6@!1!D1L!`45ᲅN|5t2l/ R 0X10  0 h  R0 (10  0 $Q@T 0 0@T, 0 4 0@T 0 R 010Q@T< <0 !xh+0+@+;qqs,>l4>l(q(>l -LM1`SX8fm 00S0C0 p) H 0(@P(00 epm0060l000TQ00 `@A00+ p-LM\@XP0T` P @ ) 8{4 wKphhQAl8q48q++ -LM0@S S 0SQ 0S 0Sh< ]ePT 0S  ReP @? p-L4M`00 PP% @ P' P% 0 8.@T Pr.0t 8.@ThPP@ 0R KpJ K.0c.0l>l,Ap;B(> p-LM1!S0#R:6 h0 P0 00   h00h0@xh0  x0h0 0 @0 l@`\0@P ` 0S xh 000 0@@04>l8q8q-LLM0#" A0: 0 A  AQ0A0AЍlȳ>0@-PRM@ 4 0!\!""0"!Ѝ0舳>@-pRM` DPD@ 0 ,>#!^ """!1# Ѝ8>x> MЍ MЍ -LMH@\  ^0 0076H”\ p-LM@`TP7 T T   x/x0S 0S0S @T   x3000 00   00x@T  ld x@0^  0@000X B00xV>l\>lJ>lP>l -LM@a.PK4pK `P5HBT+@T(  cP cP0 CR Q04`007L20CL2 cPP2 0CP2y v`$K p -LM@p.K4K` APP.0[YP$KS40[ HBT@T  vcP  pcP00077 |@P!    00 pH2 S0H"00/HB L2 0L2HcPP20P24P 7P- M\  \:6S0Ѝh0\-P0P0p080\0\ Ѝ'Ѝn2i 1i i i -LM@ᴃ0@2< D0CB2A" @00/00 C2 EDl 0-LM@2@0tSp0 Pm 81l pnP  0m 0H20L K0h , -LM0pQP`(0 68#(^ 0!  0 bPP  bP11<<88#8#8110 0@0@00@0@0@t04 !48#H) 1# 6  $3Td # TQ 3T00S 0Sj hZi.  \bP i\Zݞ1 2T& 2ThОp2@P ph0St KHB@ D0RW@ 1 00Sa@`10`@  @ 6:z㦞1@P p>0S? !A6t㓞|1@P p+0SF \A0S H1R0T4W \`P  ᓿ kpWH00H0YP0Spm000 0@@0000 0@@0cW000 0@@0D>l8q5݆8qsq;q -L Mp@AAP`2@ VY(KT# 4 PE  `Z 4   PD @  h3@0< 8 SD\ZA@@@ Rh,x,,x,x,x,x,x,x,x,x,x,x,x,x,x,x,x,x,x,x,x,x,x,,x,x,x,x,x,x,,( PP 804 0C@80@2K 뼀 [PP7@ @2K⼀ Ҿ  ξ㲁`Qd V_@PL/00@ 0@ 0 0@0@ @g8p*/@_02K  zAPD@V2K  0yP 1  6  ?Q  wP0 P`+ 4 GX7@1 01, 0{[P  0N!1R@10\!RXQ@P10\Q! !A@T1ltQAʚ;Q9M\0Ѝ p-0LMQP`0CQ:xl0Q x%0CQ6@@06?V 00x0p0x2i i , -LMp`P LP 6AUp 4 20S00 0@0@0O   R R 8)6X/Q`@ D0RH00H0&X 7LQ`X40 3A0 @ 1 00S၁@10@  @ 傜0P` @0S P`0@  0 OP`P`000 PP]*tQAsq8q8qQA -80LM @P b 8q p-LM`@  PP(  08) 9p0&0 D18!0 Tl0n m L 0x0@Pz xQA,,8q -@LMhd>l- M0 Ѝ M\   \ 00SP \ЍhM0S S S 0S Ѝ21C 0|>l p-LM` PP0#U T u@R0000 0  Txx -P`QppLMW@ iTg 1R' 1RP  0S[0PS000000P 0S 0S 0S @P @P fP5   R02 Pp`PP`p \ P1P!p PU00@  01 PU@PP  p @P0PP!$壎P5i 6i( -LM@`p  PሿP 0` pP0  0(QA 0-LM @PP 8  T'0P P 0 P(QAQA -LMpR` @PPU@ -LM  0P ( ",8q RA p-LM`@T P @T H坚P >v x @T xh4x8q-M0S  0 00SЍp@- 0@PcUe\M6*0   0`Q  ^ T 0SQ 0S Ѝp?R00S eQ 0SP 0S r3 0\à@-0@   M @ @0Ѝ -LMP` p 0  0S0@Q :* 0 RQ /  \0R 000Q ^f 2 @ 0  @PP0S:  0   @ 0PP00RM  0S 0 S 000SЍ  -LMp0`S0S 0@T  0 0S@0SP U 0Pl P 0 -LM@p `!]0 /pP0@@ 0 0 @P<0 40\ 0, ,0 0$ $0p 0ll:,/,3,D6,H&, 0-LM0@SP 8p 㤽0P 08h8 -LM 0P0 R (0Q0 R0S Kh& t0P h0 l0d P*00PDP K,&(&,RA8q(q9q4RAlll8qhRApRA p-LM@ PTR 0` 0S 0SY 0CS 0 x0R h|&xXw& Q R 0S: ,k&x 00CS 008C8S08C8J\0 S  P RP 0S T T  0Sd8& 0 x0A 0 x4+&x0$0xRARARA SA|RA8q -LM@ T@P0S R 0U0U R0 0T p Q 0 S R 0U0S 0 S @R 0S 00 0 \ 4`P 00 00 0@000``p %`8qLSA -LM⸒`0P@@PRPU%U㈢ڀ2 E eQl*0PSi 0RS BQ:`aU "0S`2 @(Kq RL!``0@ 0  @@0S  [P@TXppW0 P @ 0 ᙸ,10 K 0e00@S2\P P Q0h 100 0  d[ 0 00d0 R 0h1000@%  ㇻ0LS9qll@l8qܳ>hSA -LM P`p@ 0  @@0S  eZPEVP  !P P: 0S PU$KWp0P+^- TV 000S` 0 @ 0V@@0 @@ P  P 00 0Pn@ T0@S@@Q 0S! R0 0 R`V  0V0 0ST@ Q T00S 0S P 00CS 0 0PR 0 @D$SASA8q -LM` @ 0  @@0SPU00  Q *0 R  0R  Q 0P(K0S@0"0S  0S Bf100U80 PPU  0U 08 RPU1000 @PUl08QlPUe 0 p}P 0\ P  S 4 4 0R !\00 0S0!Xp1Z4 0  "40 0p 0 0# ^P 0 R !P0  0R01p Wx0  "0  0 0#\c TP_P]l 0-QLM@P8h%0 0P  @P00T00S80T P8 -LMP0U00 PPp`+ @``PK @ P2 Q4 U Q 0Y P  0R:XPP0T  R   wU PP 0X(KSQ00 n0`S R0#03P@P` P`PPE UP -LM`V0V 8CxW0 08C8J\F0 S  P RP: @T#@T 0W0P Y( 0.0PU% KP  0R:XPڐ P@P 0 0 0000P@ 0 R 00 0@$o^"[" 8qSALSA -LMQP`0p*, K0_, @RW 0 0p  p, R$P,[$K0 00@0 ^pP@ p 0 P @hMЍMPЍ 0RQn n0RQn n00Qn00S 0P  0R MЍ 0-PLM@U @n0S U@ P8@8 -LM@@PA- 2\M \@pQŸ2 00l0a6# a c$"cb!0b0a!6# a c("cb!0b0`# ` a` P%"^0a@0b@7#0lc! c a$"0a0b6#bc#! c a("0a0b#b`! ` a%"^0a@0b@7#0lc! c a$"0a0b6#bc#! c a("0a0b2#bc! c a"^0a 0` 7#0bc! c a$"0a0b6#bc#! c a("0a0b2#bc! c a%"0a0b'#ЍQ0 x0t00b0l6# bc! c a&"0a0b"6#bc! c a""0a0b1#bc! c a'"ly7 p-LMH@0`SP0wP P0  hxl -LM pR` <0S 40 P 40 0 R 0S 0 R 0S P@0H$H`UT0D@`fPP00V00S@U P80080XDlQl -LMnpW`n@P: sP> 0S4 US 0@SPP@@ 0S T  0R0S @T ~npQ X   R 0 0S 0S UPP@0 0RWpPp#P PEU 0T@G SA -LM`p@n00S @P @W PV 0 0RUPP -LM@ pP `P 0 0 R UPPU 0 S 0': S crUP0 Q 0S R 0 S PUX n0n S 0P  Sn -LM @P P40 740 40740 P 0-LM@PP"[ R000  8h0M ЍЍ p-LM@PT` X0X W_P P 0< a!0S00@@x7x@lAl9q0 M Ѝ9qMЍ -LM Qp@`0P& S 0S-` XLU` 7T.H,4H,LH,LH,LH,LH,TH,xH,G,H,H,DH,H,G,LH,H,G,LH,p-` PG @ T` @ b0 ` `f`-` 0S* o````W @T8`0 0 0` @TjZ``)`P`9` 0S  0`TA --`1L M@0 T0 ` 40 A p@T3  0 P!0R!R 0SP 4 -TP P  %TPW  0NP 0 aP Lp@TW 0 `P K(K0V-Vp9qʚ;80M R3: 0 P0 ЍAl9qX;q 0M R0%3 %'ЍAl9qPM ,0 P 0 QЍAl9q 0-LM@PP P0 A89q -LM j,M-ЍMЍMЍ 0-LM@P0P  88D0 MR  R 2SЍAl -LMX`pPu@P 4 #P P%U0pS*Alj, -LM< @R o00C0S 6 40 40 n040n040 -0LM pR㐀` PP%U %@P gP P #P4 #P 0`S*9qAl4M,- ȰM# P 2 S R 2 S,00CS,0  R0000 0 Ѝ䩳ЍAlp@-@` 0 PU1! \M *0 00\: UЍp lЍp@R 0-LM @8PP "R"0  0 ES8 -LM0PS' @T=@T RP,00,0@Tp, "0R8@#xT0W0 o`P S,0T0r,0  @ 0``@00 ``pAlP -LM`p APP# 0@T \ x0$ @TP0S 0Pl 0S 9q(qX;q 0-LMh@PT#-h@T  R 0 0 0 R 000 0 0  0S0C0 wh@T89q TA -L M`hPP!04@ 0P 0`pXP`TpP`X 0S R 0 0 0 R 000 0 0  0S0C0&  \P7 4 0O0 @`$Ph R0 0h 00  000(KT1l\1l9q8TA -PLM R 0B 0 h?\TA 0-LM@P* 80CQ8840Q 0 P| Q00C0?@PH  <8hl 0 8h9q:qxTAdTAlTA 0-LMdP@TX0T( @@0@@ 8,00K0AlTA9q9qlc,TA -t0LM @R  P 0@ 00@ R 00Al9q -LLM`pK@P@`P< 00 \\0 T X 1@L0   0H 4 ` K -LTM0P00 p(pKt @ P@lP 0P @P 0 @T ` 00` 0 0S @P  0lP tH0(K0@ 40 800800 S 8 00Kp`P 0@ 800800P 40   |9q -LM00 Q0A00S0C0`00`SP 0S0C000S<*  pF@P @0 խW  ϭ `P 80S0C80#0`040(K04 OP` X00\ R \R\  0ᠭ -LM`p PU@ 0 R P@Pf@P`PU@0S @T P 804 0C80 0 R @@TGPTAP TA -LM@PT`p 2pP% 40S P. P4P& PW00 SQ  R 00z440S3p\ 00 i4w4P -LTATA -\1LLMp @1X PU 0/ ` W X Kp (KV R 0 0 0 R000 0 0 `V h0S0C0Pl@K@pM0 0h $n \1l9q9qUA -LHMpPU"  R 0 0 0 R000 0 0 `V [0S0C0PU R000  K`@K@%M0 0\ $n 9q8UA -LPpM0p ,0 T `U0SR EP7@ @ `8#H P800C80 @0S PZ DY3@A@, 0R6(K蔀K@ M M?dp ` `P NK Yh 00 v  T0K@S@PT`V W80SZ D0801 0f0l> -LpMt`0 㔀KP,0 T @@ pL0 0 dP M?@ `` NKh 0Ƞ0 ,Ƞ  T0KPP&T@T# 80@ 0CR80 0 @0S @@` 0<0 0 S  Z, 0R(K T0 0lhUA >> -LPM`PKp@d /Ld@ d0K\ T 0 X 40 n <`p@0 01Td 80SK080d -LM<0S 4@P  # -LM40 d0S  -LM @R <0S 40  -LM @R <0S 40  -LXM p x `_@Pt@ 3@' 0 t0 &30#P00S0 5 00 R' @P\ 0t03 R00SI TU000!000pK@KxpK t0l hp d T (K bKP00@0T sP0A@0\ 0S 0S40 0A@P  0400  0P0 `@ pK@` 4 Z4 PD 4`@PD 0 10 0BR0U ` PI@ TXU00  S@7 00S4 00S 0/0S, 0T0 S0 " 8  R R040 վR040 Z4 P P0 M P 0 S@0 00PUP U 400008 @ (K 4hI -LHMhKpP @]I1X[6R XU  R0 T P]0`S @T 0SC0T0 @T3 0S @T, W P 0\0 0 H P80`S P 0S  00$h0 0yP 000@T0P0 H0 \0 X$K6l0? 060倦h0 0 xP000,>l -L,MP@P`0AS`(KLK `H 0`T@0 L H 8 D T pP L0P 0CPS x,x,y,x,(x,H@PAPT``PO 4_@0D X @ : 800hS `300   `P5@`U @%T s0P U`P  ``0h!8qCKn K 00K21C0b ?A1c09qy,psgfff -LlMh0`S( @0 PK@=H< 00 P0   1@x0 t 60l0 JKi0`  `70pS PU 0S ( 0R!$K 404 H n0(0 080@0< 0帠 0wP000000l> -LM 0@4 S|,|,`|,|,`P0P @@P00SAX/ 0 @@  G0Pp @Z `Q 0 70 0BR0`0 CPP+p W@40P00 0 0(KP0P ?U@@P00S ; ?1@?P0P P0P d? 0-LM40@8PP X 0MTP J?8000a8h[400408hxI$AlDgfff -LM`R@pP TU 9?@@TS S *@"@0 0 80@0T@S# S U *@? @0 0 000U 0S @0`v P@ @8`U 0S @000 -L M`@pJTPQ T< T  0p $K <ɧlQ@d h1S p@ pP;h1 Q8180@ Q0001 0  oS0@004 0 a `R \0p40 pU wP Phd00C0 00C 0 C -(00C0000ps|,H;q$Al --L M0 pR00 \d2@TX P@T3 0 !0R1S R SP  3FP P  +FP` R5 0Q 02 0BSMԂ,Ԃ,Ԃ,Ԃ,,,U 0 `0aR  R  40040=(K 0 RP (H=8p240`U  0@P4  0 `0aR  R0 4 RP HP8 r 0Rz 40040R4=Po0Pk9qʚ; -x0LM PRp`P @8V P LF(( (0 pKh2H;q4Al$AlAl -LtMŸ Ÿ @ ,@ ^P@ `, 0Ro(KpPp YK@{EYQ00S p0xp !X  K| 0 p vP B &Y $00  0 0?0\00 S! T*  00 pNK 0 p Kd NP  &0 4 00n 0  0 0 0W@ < 0p0(( (0YH;q0l4Al$AlAl,> p-0LM PRx`P @6l0? 060h0P兢( (0 KphzH;q4Al$AlAl -LM P^@P @00 `p0Z 0尦0嶠T$ 0 @0 0$KmOH;q4Al$AlAl --LMⰨP @ 0U, X0 T@ @  0S2APP 1 0S`V p Uv<, 0R(KQ+p_V V(p tP7p  0;ǟh1P圀 0`, `00V ^PUUApM 0P 0CP>@x 0C!Ѝ` @#2 40P 0CP$0PN=@ 0C! ̇M P P10Ѝ"104 P PP10N  0M\ڛ20S?000S \Ѝ -LM8@S 0CS8 06 d8S06p@-@MP`0"U@T$b0"PU0x0" ^" 0S0R  ^P0,0,P"Ѝp>X0MP0Q00P0S >S   Ѝ-MRP,,,P,,H\ 1 RЍ> p-0LM 0 8@S`) 8PS ꠕ,,,ؕ,,,,,,:0 00CSt,d,T,D,0:0x080x080x080x 8S 000;0@8X 0\<0<07 @8"R -<M1 \ QЍꔴ> -QLM QQ20@S, ,,,$,,,,,7P"  P P nP P,$`0 lH R UA -QLM QQZ$P> 6P? P? PG 0@*Sꤘ,,Ԙ,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,ܘ,HP 0P   `P lP`@ 7n UA -LHM@ğ0@P~`,0 b/ 0<K @p h h0S]h  h #0S: 3 08 Z ?0 "0Ql0 @l @0Sl0 yP P 0 8 p<[\v;0[Sq< K0 R  P(K 0C< K0pQp <0[S%@<0[@S@BL> -/ LMR@`0T T 80H 84n>0Q0bCUAVA -!LM0pS1`o Qo1_AP 00S   R` V0 00S  J? 00S  7 1 7 ^ V 00S  ^DQ D1 GT@# P 1 'R! 1?0DDQ uD1 GpT@Di85 ),0`CL) >,VAUA 0-LM(8P & 08#QQ B0S108# Q t 0S1 0P0Q@@M8)80 @ A8 -LM(X@QS QN Q` Q`  V`!0S6  pP VK  z  P<, P PP@1 R P4H8 S 8H4S U X %00S7<7 K4``V0 Q2 RP7<7P 0S8X p ``PJ -LM@Kcv,T"RX2X2X2 hI -LMp W2i 81 0ܿn =!P0`00` VP O0S DP? 0 `8`  V P`AP1 R!  0@!0(0H1 Rd  d 10b 00ST2 ?X2pX,J@061K6 16 = Sd 000 0SH 000 0S, 000 >S 000-@VAtAlxL@0 0000 M Ѝ0@- 1 @TM^* T)0T^ T00S 0 00Ѝ0008S  0S00 000S8 0C8 @0 R 00 0S0 :[0(0CR 0 8080 0̫8.  0M(?,/ 0 0? 04/8? 00Ѝ0 0 == p-LM(OPT`@@T 0R! ?<P V 7<Px -LdMP,!@0|  ,0 p` !<P.xK  ʙ rKƙ <P&lK 㼙 LK⸙0XXL00 0C 0 x )0C| P, 0R(KxK  㛙@lK 㕙`0lD,,xVA\> -LM 04ab 8#8$0(S( p"hc S( 0R+$KV#NK 0F898#8 >HPK1 T#NK 8KO ; 0r0lt> -LMP0a4ḑb8#8 0S, @!hc/ S, 0RW(KVpfN@H$H"00 G;@D@H$hOK  I!("(008#_ #<" a0b1p    Br@ 000S0 LPK ܘOK <K ט R 0o pb 0l> -LM`V, @ p& 0PK0K`V0[ 0p0K    K V@@Kr ዘ, 0R(K0l> -LM`04 8 $#8(0"(S$ pP# S S $ 0R, KOK  QOK kQOK Z8PK RQ 5e0l> -LMx0Q@4`KPp $0 ! : 9$ 0PR K?0lԶ> -LNMPPP$ `pVOK  c _DPK ZZ $ 0R KVOK  P DPK  Ǘ0lVA> -LM(O`TPp@@T 0S 9PP 㤗00 8S  ? KH P @P ≗0@0,/@D ,?@,/0n@ -LRM`V, h l p!  p2 K0!(KH@^K  `V$ 08 p#Hhl!0(K@ p   YK VL@K 3, 0R(K ]0l > p-LM7`P@9 0K 0 9 Z 0R>:0 "#A10a>0 00CS/,,ص, ,ص,ص,ص,,ص,ص,ص,ص,ص,ص,ص,,,ص,ص,ص,ص,ص,ص,ص,ص,ص,ص,ص,ص,ص,ص,ص,,0 0  0)S0 SCLR0S $1x1S^/xhxhxhxh  048# @(R"!B10b>0 -LM00CSH, ,@, , , ,8, , , , , , , ,H, , , , , , , , , , , , , , , ,0,0h@h[h h -LM0@0CS $,,,,,, ,,,,,,,,$,,,,,,,,,,,,,,,,,h81 f 0M0CS,ȸ,,ȸ,ȸ,ȸ,ܸ,ȸ,ȸ,ȸ,ȸ,ȸ,ȸ,ȸ,,ȸ,ȸ,ȸ,ȸ,ȸ,ȸ,ȸ,ȸ,ȸ,ȸ,ȸ,ȸ,ȸ,ȸ,ȸ,Ը,ЍЍpЍЍ ЍB -LM(O`T @ RD0D0D0,?@ D0H 7 $(OT^ Pp7W 21C! c. QpP@  7W h7 -LHM(0` ,0  00C  0@p$@`P 0h d0 hPK`0@p0 l@ ,p@#$0@`P H#H$8!,pp`\ \` : \  `>0`>/l080S* @4PK | "8 X K0 80VKW0Ko  PKk JKgXK  BD@K} 87P  -`p唀@@, 0 R (K\@ d>0d>/m0l> -L(M0p,0 @0 @00P K080 PNKO0K   HK BK PK 4  B / -P f0PH 0 0 L0P 0 0 B0  `!4 0<@K040 "880 "4<0   7  W Δ 0 0  00 0@0@<, 0 R(K> 0>/0l0> -LM@P  ԗ00 0-LMP @P @8 8 -LXMBP h d0 ^, 0 WK` W0Kl p 0 SV K UK @l OKh IKd0 0S 0C KB0KApK{ 0 S 0 0S00000p 09K 8K90K@d h"$d@0x WKlt0 |0 *|*X*4x[@ <2K.0K倠[h0[ lLXtYKXK1K/PK-0K$$h0pK9@K6Y0 0  J40` JYPK 0 0# 0Q`  = 0 0# 0Q  `/l00 l000h@p `l , 0R(KAK ړ;pK}0 SG0V0K`^^0lD> -LMF 0 ,0 P   0Rc0@0 @a  0SPP  0@0 @ 0@ $H,, #H8P`0@pL#D< P0 `0@D p4R  *0.@P@ (  ,P0Lj\ 0T@K 0P S  b K @DKd@K @ MDK @0@00t K6PK5@K}0 0lS | 0 oڨx@ 儀@ | 0\ |  X< Pa 0| 0aUP!0Up`$@@U ( K L0Q 0#0, QY0#,0AڠTKT K;x08#̠DK#8t K@x0 6K50K.U|eP |  @B.Py 0jR 07 0R@ @ Y TKT KPT0Ed@E 0TEP0#U 04@K|0 ,TK 4PU0K,A, 0Ra(K; p-1P0 0. X>0X>, $ 0S0 10PP ;R-1P0 000S 000010PP 0S: >0>,,00 \>0\>,, ,@ >0>,q0l\> -LM@P  c00 0-LMPz ㍕@P  㠩@8 8 -LtM 0  ,0 00 l-P   p+P 0 R 0 @ 0S p50 P`0P`P`@P "4 <00 `3 00 "8 80 040PP "40  jLK0>B+@+ >0>7+0lt>G-p#00`400(M400 !0 0 0  Q0 @  "$""40  0 4,4 ! 0 0$ ""40  0 4,4!  0$ ""40  04 4! Ƞ,Ƞ0 0$ ""40  04 4! .0 $ ""40  0 4,4! X(Ѝ褷>G-8#Mp0 Q0 B ("( 0!0##4 "0 "  0 4,4 !0 $ ""40  0 4,4! 0 $ ""40  04 4! Ƞ,Ƞ0 $ ""40  0 4,4!  0 $ ""40  04 4! Ƞ,Ƞ 0 $ ""40  04 4!. 040# 0'  040# 0'!h0 08#X 87 ("H0('08# )Ġ87_   `P@0 4#0#00Ѝ褷> -LM7`p (K8 Pܐ 0А 3 `1C cR0 $? XU U757| n$O@ ?,@Z;@0,T;@ 0` dVApD, 0-LM8@SP K0@8 R 1S00 0`K0h -L,M@p`Q,\,4, ,0P>'| $X h00Sh000d`,XX.hE ;X/(1XP0 0pt>0>'X'X V+lxE⠐2ppT>t0T>'X' X 0S:t'X'p@L>0L>dKX t'X to'X@ Ip@t>0>e'0l> -LM@P  400 0-LMP@I ]P 8S0 0 1!1!8 8 -L0MT X p P 9(0PL0  X =&PL0 0 gR L 0S XL @ @ 幌00 @0@L#4@<_  0 03 00 "880 040 @ 40P !R^ \ P`0@0PPCoS <@K9 ; PX@ 0bY[L@0`pH D0 H@b 00gT@! D H D   dP0Y@`p @H 0WpH  0VP'Pg PgY P P U`` P   P P0CoP"88 EP0 1; &1PP P0LD0 $ Pm'P3 0 0 0PPP!0@X D @0P 0@P 0$$$$ P @  P0L 0 0 0 X-&L(KT X>0>$&L"&0L0  ;L&L1LL P0 0TX>0> & -L,MT pPP 0P,0 L T0` 0R<@K ᙋ 9K╋  LT &0PD0 T $PD0 0 BjR vD 0S D  qD0 @  fZTPITD@PH  0@a0h T@! L0H dZH +P@ 0X 0Up `&Pp? jZ RPP`` B;%1P  H P@@K 0 $0L @0S"Ta%, 0DR,(K ;D%D1D P0 0zPT>0>E%DC%D PT>0>T8%D P T>0>/% 0l> -LM@P  00 -LM@ B&P  -L(MP `0P L ,0 0H0 &PD P $PDD 0 iR 0 D 0S P@D P ቊH0\ 3\H01D0, ,400<@K30 p 9Kl  HP0eZHD@`P @  0@a0fT@! @@   dH0Z/P`@ 0V 0`Up %PpN iZ RPP  B;$1P   Dp@ "P%@@ 0 ##Ƞ#\0PH0D 0 0 0 PN$, 0DR3(K00 ŠiJ%P 0p 0LP>0>1$D/$D ;D$D1D P0 01L@L P>0>$ 0l> 0 S00RSMЍS  -LM0.0R >@0#200   N000N "" N04\0N7 t2S0MS = 0=ЍЍ0MS = 0=ЍЍ -LM 8@S KP0  0S00 ?$   0` p-LM Ȑ@\P x8  8S 0S=0=x`@ 'k+P =0=x 0Q 00S:` BV  1R0x 0| 0 0  C B  R  0 00@0!0 7Sg@`10g' '@0xd 0-L M@KP ͈ +P P P K0@K \ᶈ +P00CS ,(,,,,,>ݹ> 0-L M@KP ᕈ *P 0S,t,|,,,l,K0@K |} *P0S,t,|,,,l,, >> -LM@pAP,0 (KP0 Y 0 0帡s:P)0 Yk:0 $("10Y_:`A8!#8S00 P `A @}8# P0 1 PG0SD  Y?: 048#8! Y03:`C8 #X00 P `C@8#8P 1Y: 04Y1:0 $ 20Y :R0Y:.0z(0x0v*0t0\M =(0=Ѝ LЍU0\M =(0=Ѝ ЍE 0-LMXP0@  0S0/00Q 80;08 -LM 0 S`0 $"!@21C0d!P2Sp 2S? t022S  Q o 02 -LM 0pS00 $("8k". bSf@5S 21C0bAP2S2Sbix2SV ㈅mh5S @h5@Pc!0f T0@f@h 60h5 -LM@ h&p;B -LM 0PS@ = Ȑ 0\p`= \  d@8S 6h!b48 #88VA -LM 0PS@ = Ȑ 0\p`= \  d@8S 6hk!348 #88VA -L0MP P =0=(K8S ^ 0$T 4  P } < p0Y80 `: 0Y:4H @ L D 0 SD`  S| `pY: 0Y*=0=L0S 0SH0L  A=0=TP <08$D0@0H2 D0Q>q DPl"000 2 R 3 777 7771Q3#551 R\ 767 !000 do6 `1\XA@48 #8<8@8 S808=0=UL` 2SH` | SyR=0=s/@K ʅ (PhPf0Sc0@ S @ ]@ R HP D 000t07674H @ L D LdlC@ WAԹ> -LM@ PP 8S (K` 0 P p :0P:0S p1:2S P*X 0SW 0 SS @: R =0==0=;'P0S7@8S 0 0  0=00P ` `PPPP p-LM`PQ@ P   x 0@S  6 x -L\M Ȑp\| 0  (K8S @P0"0S@ '5'P=0= x 0Q\0 PT "P 00`` `0 VX  0X5:p h t l d StP  SpP 0P`X-: 0X%:00ShP  2SlP  SR=0=/@K ᝄ &P0d S d p h t l d =0=p0S 0StP 0 S@: R =0=|;&PP|(0BS @P# P 0`=0=aR8 x\ 48#h= 0=00|0` `| HPp l0|3p76|0= h0S 0?d R 0?E(B| 0 :G P 0`|hP KSP|0h05[SC +|0K | S D"|0<0 T0X | 00 c @8|p p ` qP KP|00d0` 0|`|0 |+8=0=n@ȗL0  4[S *dD0 @0Q)[A?0@#[ #[  0@S  ^ H!<0S7 ^( Q& | ]_P7L D0|RR0 @00@#[A? !!60[4P0C0S60K}  |c@PPg60[.׹> -L M `QpP@! = (0R= KČ Ƞ,ȠL608 B#8  8 ` -LpM #R0 (K@8 p !0&`0 " $PX #0T0 'X :% 0X` %p:`0|0 x0 d 0 t0 p0 l0 h0 \0 0 S tP  S |P  5P 5:S P`X: p0X*=0=|Q 0S R 0p Sd1 'R!=0= 8S d` Q=0=d010 / @ 0PP /`P XT (48R# 3  t0S  "HT 0S :Q ;@ :06%  凂 '⃂0@ 0  -x?0$0#ḃp0\ tx0| @f 8S  UR9 h2S6  0R d a0S lP ] *SYR 0\0 T2S xP P SMR=0=G/@K 82 ~$P<0S hP 8 R5S30pSp -8 WO | x d t p l h \ ' 8Sr lQ 0?6h R 0?M00c8SS8SPt0\S ,1 R6 767@8\ t 30( > 0 Q(516pP=  k9 `P P P KPl@]PL00D  @00< A?![767 P KP00hڹ> -LMpW, F`,K,0S(  Q 0 p 0@`W1,PU @P-  PfjU; E1P ,0S 000C `b 0@P  P ,$K, -LM`0 P 2S  p2R 4>04>(Koy (0 0 @R0@ pXG L0P0W0S67 1R3  (Ko 1R 0@,wP 8SX pQ& V4!P4 1 0 1  O0 (Ko*(K 0jpP+ 1<1!1R*@10\!RXq@p10\q! !X 0 0@0@ /00@0@0 0 @0@zꈎʚ; -@LM 04"48#hV1ھ 0R p PP # ,g@ 0S[@P=0=0S0S L`F=0=mꪪ -LM` 0PSp :@00S ,-T-`--%PP=0=#6K 01R0S= 0F0f8#8 $#$"Kd  00 `PP  $K6K  0K  6K6K  0K 6K  0K 0SFK)ꪪ 0-LM@P008h -LM`p!28#8N< 00 @P0M(K2==0Q 00 S PU @0 0@0@`00 S4 00#  !P40  !P8 U < 000 @8`᷾`@P R᤟@\P\o0= >b, ` -LMP p@@T, T%  គP" 0 $aż@8Pp@x 80l  `P@P 0 D0(Ko*8S (K 8S ꜻ>>PWA,> -LM hpV<0  PU=0= X <P  g(Ko>@=0= @ 0R80  U=50 %02=5:0S@@TP4P  80 S00P 4 @0S 8S! 1T4#28#0"=00 80.  0S=0= 8S <0 0 08 hVa @ 80R  @\l \KR=0=F 8S >0 > 8 S@ 6  TT T 6<P  1}@ <0\(Ko8S @`' P:@8 SF l50SU0  0`=0=0 0@X0@F(K8  8S0 u0S0u0"-000 8S+--H--H-H--R =0=R8S ' [ P =0=R8S @`' J P< 00# `0`S 7 ( 3 "0@. =0==0= P P  7O 0@K0@=0=v  P=0=m <P  &2 "% 00 (Ko^TPT=0=00@  gPOu0Su"04"0C0 x0S 0 BQ.0S*@0!0 7S@10' '@0S <0 6 X 0U  P=0=O K 1 0Rx |   00C04 3 2C 0%R &80  0` tP) 00 (Ko fP < 40@ @ P 00 0`PdD>l -  jL Mp 8#840  bY>*"*RX0  P`YNh20\`0 0 h%020/,000bV0 0j0Y.4 h 0R 00 jY΁h "0h00 0 0h*2 0R j  Y.000C:0(K -`rCLM gŞ8\P# &80 0`$K0  A?   - 00c:#: Sʲ00h:#: Sh>0h>@gV @8 00h:#: S  0$KmI -0LM` p ' ^$ 048#N  10^:0BPU @ 04 #2$8#8"&0EPU@ 04#28 #8Khw -LMܢ@` p2 0 S/0  92<0  $"" c("(P58  S4  m 7  A?   %84 040 2`(K!0S8?=  &8 4<0 c1 Q051Մ5Y<  C PbV>V. 00H $H p00 չ0D8S0Y^@0Ł08 0C0- :0(80 0 ~Ph @@2S  P(<  0b0 %00V 0 A?   x 08 0b:#: S80 (KoU@0Q5šh r~%8hEu''- 0MS00\ \ Ѝ0S *Ѝ'0SЍSЍtЍSЍ-MP\< ڰ\6 ʀ\* \% >0>Ѝ \ 0\# @\Ѝ^\ \Ѝ\ \0ЍQЍЍЍЍ0Ѝ=ЍpЍ -LM0 2< 80 cV> 0@p,  Ƞ,4 l- 0 0cʠ,ʠ \Nʲ 0j:#: S; 0bY.:#:SXP`YNh20\`  0 h%020/,000bV0<08PeY.00c08#8:#: cp!  ʠ0Რ,ʠ<80aYN0h00" R 0 0@0@0(Ko0 "40  h54P00 h5" Q 0  1<8 bY΁h "0p0 00 0h* 2 Q<08P e  Y.000C:0(K 0-PLM@ !z 'z0:0; mB0 [0C\g%#53c0t0d D0u & 64 0&,0 l (p08t (788dfh -@LMP`! py' y:0 0;3pp0 0\4[BC&`Rd8-S0T 3535t0c0u 0d 0 6 0&06(l 8p0(t 87 |x 0 0|00|00|00|00|00|00|0P000@8S000dfh -LM☟?\, p #x?\ =l?\ `?\/ T?\%75`0& 000/hN@P 00 `>\ .>\ ]>\) >\ >\  02`, 0R(K>\z x>\ 0\J x>\8@ d>`㳀ᴁT>\1 EH>\ @>\ 8>\=h`P>P P1 'R!| 1?00D888S 8SH @8Dp R 4`=\ 0\ =\<=hт`P80 H=\| @=\E 8=\<h庂`P= RT 8: 7 ;4`7{<\ <\ <\l+J`k<\ <\ <\\M@K! &8S"8  LKM0Krx! J`M<< @R`pF`D;hn`P>ǘ  0S774`4`772h;h\`P,@ P7;7 8S 8Si7  @' P4`:h;`P 8 0S7 <4`77^<000=@00Pp0S `:h`P0SS0`021Cc&  lJ`PpW@P`7 :0 00?000? 0004?004?0004?0004?000`1 5hŀ`P 8SK @. Pk PW 0 `~ (R 7KT  v`rº4\) 0\dPP@P 0S`ԠKP 000Y@PT 0PSP:`E   H`P CP  `:@8p@LK:0; M0KOv`-757 4`# `00CS` PN R4 0S1 R b0a ! c. Q 0S00000ac&00 G`P |`P P R @ 7 B<4`7-0o000?04o0?0?00?S00?0 4/04/4/ 4/0 4/0 4/R04? 0S S S S 0?0D|WA>i .7 ;4`7)H8Ms@( 0\ Ѝ8S8 MЍ@-@[M \0 L \00S \0\ ^Ѝ<>MЍMЍRM ϐ 1 11Ѝ0 #1 01 0-LM@X@ % Rx 0| 0 0  C B  R 0 00@0!0 7S@10' '@ 10xQ RZ0?80@-PM@ R( 0S%\ * \ ^ \A 0 0\0 S 0  0S R 0 0Ѝ00@ 0 0  R P,  R/ 0\ 00 S 0  0S0S 0P@ 0S@@0  @0@ 0 0 0S00S0@ 0\@@  @0@-M R 0S^ 0Sl0 0R 0SI0SD \  R0 0 \0S0  0S R) ^ 0Sn R 0S 0R 00 S00 S0 0S    R 0 0Ѝ00 0 \0S0  0SR 0S@0T 00 S @0  0 S 0R 00 S00 S0 0S    R R 0SP0U 00 S P0@  0 S@ x -LM`@V3 ^=0S`PVPU p` 0S`` TPR 0T 0RU 00SW `PV p PU` 0S``P p MP0SЍP 0S 0S P MP0SЍP 0S 0S PMPQ00SЍM!! Ѝ$ p-LM@PT `P`@@T@x 0-LM@PT P@@T8 p-LM@`TP@P  R0T 0 PPP@x0@ 0@@P 0-LMhHPT ! P@@T8 -@LMr  ^r@Ȕ\ 0p Rn>0p0 -LM&@  0S 00 P0> 0-LM3P @ 00C8#8S0 p0 d 00C8#8S07(6 77788 8S !|z 0-LM3P@ 008#8S0 Pd(0R007673 7778( 00088 !|z - 0`LM00 0C00 p  | 00C8#8S0 X@P0PA?0 000RP^/!~ 0-LM@8PS@B 0 ȕ0)R002! !l80Cl8 R  Rx |   000C0C00  10xP RZx•\ ,0  X86dWA p-LMP`h%R @0@S h% T nt0h50`V0Px 0-LM 8PS@h1 RR u0SV 0S 47Dt1 RR h1  Cl2S 40 9S  "101008 Rx |   000C0C00A  10xP RZx•\ 0  7 >C88{"=  B u dWA -LMt@P  s0t1 -LM@ hs -0PLM00p00 0`@ \1`A00| C 20SS0 hK rp0<0h~ -1LMQp +h1`V?X!^8 9 S02 @")("(0 Pȗ1 2 10S*  h2S 00 `08'0C12$K00 0`$Km$Kmd d -LPM@ p[` \[ oV @[0S  o[00[0 mv = a0=[@ -LM@`Pᗵp@P @Phմ -LMPhP0P8pz@PJ 8S9S7 Ṵ00 0`_X(>J0(>X@, hWl(p8R/0V 0S` Q  q30 8S 6Q !8 K &0W0"! l8 S 8 = (KogW 8S S 8;SR 8S S P 8S S 8S 8;SWAWA -LMl(p8@RT^l(p8R p-LMP״N`@aP@Q xh:x -LM@@Q X0@8P  rP  r" -+ h( -LMPp`L@P 㕴p0S  0S 3 #0S R@׳:0S  -LMpPy`v@@D@³T8S h躳 0-LMPl@P <0p0Z000妳 0d 20@H08av XA p-@LMP! rn02 8  PD嫬 <⧬1`l80l8xhv-<- p-LM@`)PP=0=  @ ''An@8p p x p-LM@`PP=0=  x 0-LM@Pg#-n0t1tP ]8h8M#  Ѝxq p-0LM4!h8010T(X8(!(1\(`8 1QP( 1@p(0 0Q0`0 >BRqPP 8 x0B BqP0Px2   t"  d ` xhPPPD<_X-hN-tX-<<-Al<--g-g-@XAL>`XA 0-LM@H0/0P0000004/0  7 00000S 8/000000001(  A? ` 00080000 hP  Sgm 0<0 p-LM`pPlp1 GgT@(1@$R@ p0R@ 8SFF 't10S: :  (@R :0RD @ 7$ 0/04/0@@ @@)@@0SS S S@@8/0A? @@ 1 S@@8   P@@x @@@@@ 0' @P @ ;7P@ -LM\0p-4K , 80 l4PK`Y @@'0' <0 P/ T [P , 0Ra(KX@8KXP*707  @[@TN 8KIP/08 @\48K;P T1@!P@T P08Pq<8@ h  0`b! \@'8 T<O!xJXh @ P\儰8KP <ߩ8 460l@XAXAXAXA(YAhA@YAXA>YA -LM6P@@h707p@ [ lO08 !'pl l 8S7 k'00'08 :0@ ;l @@- 103037 037 " ϫ̫ d -0/A 4?08/ U@ 78PSPV 0RU`@V(  @\@Hp2'7 0108 (R9   d1s 8S7  8S(P'0S  y07 0C7q707b$ 0RV K d7 D DK `P p 0KQp$@U0@$@E`P\  7 S1 0K $0RS1\ r{-\ 1 ' R! P:Ȯ0lhYA`YApYA> -LM@8n^p`pP`Vo`1*GT@ 7 0  @8p RhyQ*Gt@8* p`d -LM@h+ p-LMP`U@P 0S8;S08P@K" xh -LM'@' 8 S7$>00' .7$>6  . 7XX  P8((0(00 (0607hhhYA`YAYA -LM0 ( @RppTP`> T3 T 00S@X 㥯 p@SPU. 㙯0000PS S R @ ' PJRM 00S@k-Lj-,k-,k-W 0S00 8S@X ?PP@X X 'i@[[ i08h2S  R RR@ ' p34 P@' p3|C>D>l -LM 8`Sp 0 @X000e@PZU 8SS@@PP @[[ *iHh2S  Q|0 8SM P 0~.R P P PЍP>M R& 0S Ѝ0 $(, <4!4"<#Q#:Q @Q `Q Q0 0@SQQ Q Q 8MS S  p0  08#Ƞ;8#Ƞ,40Ѝ00S 000C0MЍ@- 0000| 0t 2M@ 0 0220 0 " 0\#40@Ѝn>*0 0 >  R 0  M Ѝ.0 0.0C M0Ѝ@-800p30C0"\"h"DM@P` Ѝ 0-LM8P @*  0 0S#"= R 0? 0S%@0!0 |0SxP@P10|P ,@8u0S 0 0S8 R00 x 000<8d p--0PLM @?0 ` 0 #40  gL  0#40/ ?#80/"$ ?0/ x 0-20LMP0 @P@D@ g8 p-LM/R9 ϑ0S 0S.Q` R 0S 0qS R0Pf 00?0 ?@S?S00@ hgx`ϑ` 0-0LMP0@PT@#@ Qg8 0-0LM@0@ PCg8 p-LM8`#X@P   ;0 B 0P (gx -LM(p"hPP @  K0 B  0` g  g -LM("HP  0 0 K -LM("HP  0 0 K -LMhHPP&$x 0 $L&  p@帀 -L MSPp" /@Kp f0 0  f00CSx-v-x-v-v-v-w-v-v-v-v-v-v-v-v-2@K fq00P@ `6?J&40`P0`T]Z&40`|&40`A  04"#400<00Pa8 R(K00P @`  Lf00@`  Af00 (@"h  4f08#h&4  0`@0P`  "f00`P  f08  #hP00P00P{ f@? S0C0P 0 0S  eP e08  #hPw e00 (P"hij>g>YAYA -"0L@M/pK0`P <e e00  0d0C0(Kd> 0-00@LM0P00C0d0C08 p-@LM T`DPP T000x; d1xhiYA p-LM0` P@P 00P  0#40 b x -LM hP @P&x 0 .0"(0CT0;8#("4@& 0p 00b0 0 -LM h@ PP&x 0!0 &W(0C0"hpp 8# #80   00b0 0A Y.038# #80% 5C40 -LM0 `GpP( @Q" e0 f0!0C0 03008##80’2 C40  0#40 b - MR0 R ЍS * ЍS Ѝ"SNȠN4 Ƞ,Ƞ0 Ѝ4NȠN4 Ƞ,Ƞ0 ЍT -LM[ R7p p\L@`:Y 0<U $2 PP^L 0 H ;0\ 1 #      pP4 7P U8;8# 40 Z 0 #40N : ;[P[0S@7%1 -7 0  00c0 00  G0   10  Wd0  p0  08#C@ 'c t -LM`pP?0Ȁp 8QA0+ Q00 0 +@P ( {h0 S0  00c0 00     0- @LM=00 @8Pp0  A8 -(LM"x![@0T``DW ;40T 1 #   P `P(  W'40p 0 0#4[@000[0 S@W003 00c0 0p@  W003 /   Gy d -0@LM0p-0 -LMP[:0`2  RppQ@@\L&# 0< 7R 0  440\ 1 #       7pP pP @00 岀b b' b 㶁d#" 3#4!0 7-  [[@G ~ 8S0 R5 [0S*' 0 00,`0c0 0;: - ' ''D>l -|2LM @P R[``pP: @@\LT 0<P 7PI 0 E 4 40\      `P1 @ @8#  @ȕ 3[#4 0]@: ;  8SA 01 RD [0S5!* 0 0c0 0@(0  1@(0 # E / 0 R _ -L MQp`x PX P @ @,PP`0!P21   a a' a8  VV?0B 0@006 8S> @0!0 P7SL@10P'0 6'@$K 8S  PR 0"Ap`mpPt0 80d >V 6 @0 @   P f>>ZAYA -LM@ P 0iSS2 0 S@P>0>! :K  a pP>0> 7! 2S3"[R8>08> TOW A00@(K00St|-T-|-T-08'I0D0 P00`U  ```"[  @P>0> D0PS00`7 @ "!0@ S2 08# @ 21C0b10"R`08#@ 0<<0021  ,2  "[2R P @ D 1 "! 8S}<--(-<-(-(--ptPpPM 08puP00  ``' \`4K X`7  1  0@00 8S pT00' A`4K  =`  9`00  2`4K  .`@' )` P0@0p+@x0005W᨝8 >0> ꈎf,ZA -LM`@AAPPp QL2P PS 0iSSOpW0 8  0S 㲁ᨥQ V!PP 1 018P!1R2@10\!PRXA@@10\A! !/00@ 0@ 0 0@0@6  Ṥ 0$KmA@7P\ZA -LMpQ@P M000噤@UG ڰUJ PU| Ug >P0> KU  U 0U("(`P U8 UH( 0`P> P0>U `P 0 xPPXㄈ=`PH((8"(#8A`P 8S ("("`P 6 !⥜0 8x("(`P 6 !⒜0 80`P ZAZAYA -LM 8SS0 2p1S5  0@,Hp` 0@P DP`  0@  #Dp0@>$K0 h1S* 048#8 ,0 D>0D>00 < bP<  0@,Hp` 0@  PD`p 0@P #D p<P`0@!(#Lp400 ,@hl! 0@0p1 @8 R 1SH>P0H>F E0@$@Ap`D0@#D <P`C B0@!(#Lp4  $Kk -LM 8SS0S (K  0@pH,` P0@40 0@ 4PK` 0@  D` 0@ P #D p< P`0@!(#Lp\!4pR @>0@>`1SPD>0D>70   00C8#8S0 \ 00006 !\ ,80  [AZA -L0M 8S< $K  0@,Hp` 0@P D0P`  p 0@ L#D(0@>< \1S*<0 L ;PD>L0D><@ L P8  L,  04Sa b04S 084.J@"!Bb>00.H 40 0 H H< 0@08@L08F E0@$@8`D0@Ap#DPC 8 p0D> 048#8 L0 P0 Pa b0cP4epX:d d`0X< %@ % *0PpX`*: 0X&:0SR/@K \ bP0S@P  S4P@< <  @>0@>x\1S:@Qq P @08  0Rh@P@@"!Bb>00\ D0 \` HP08008F E0@$@`D0@ApPLC #Dp<P`(B0@!(\ D#Lp4&  (808@@8 [ PD |PH 00 40  HP`18  <` 0@$P`HdP `` @P`d0K [AZA -L M 8`SSP0S KpPD>0D> 1 S p ^O V|X Z |P' 000 8S|200S|2 6 0S00Khv02! L80@fp 0`Kh4[AZA -LMhJ 8S, DJ, 0R(Kd1S8  0@,Hp` 0@PD0P`p  0@ L#D <P`0@(!(D#L`!p4Rp: @>0@>\1S*<9   @C ]P0΃! lPKK? P p@P  @D>0D>@ Y48#8Z0 P a b0cP4epX:d d`0X: S 0PpX+: `0X&:00S0S^ PP Ro@K Y P0SP  S7 P xԝQD R 0S>  Q 1S `@2 tQ  0R  00 0 ` d  P^  KP 0S  0S8[S 8? !  0@p,H`P 0@pDP0  `p 0@ L#D <P`0@(!(D#Lp4 0\`!d1& 屖 \ş8T 0 PPk 帾  04S#  | pP r@K X AP0S0SP @@T@T@ PP K0Sp F E0@$@Ap`D0@ P #D<P`C B0@!(#Lp4p^O `1q匁|1PQ X  |Px3#  `VX I  0R@@"!Bb>00 0 / H0(8008F E0@$@`D0@ApPL #D<P`C B0@(!(pD#L4 & ( (0@ JX  |P@PU\ `0S90 $("H0D8S021Cqpc>00 0 H18  0@`$P`P ` @P`0KP 0@L#D<P`  0@(!(D #L4P` x |(`&}pW  |P@h 000  L0   Q|200S|2r02l0l>0>[AZA> -LPMtP PP, `@p00CS, 0R2(K!00 0CτlK/KP崽d`PD>0D>00`@ WtQ 0 R 00 0`@`奛 P6 $8 0L0lL>[AZA -LM P` 0@lHP 0@p PD0p ` 0@ P`<0 8@ 8`L<!D<`P0@ H#H$8p!,\1S  @>0@>(K`1Sa b0cP4epY;:d d`0Y80% -LdMTCt 8S, x 0C, 0R(Kd1Sna b0cP4epY:d d`0Y# *0PpY: `0Y:0SRo@K V P0S0PpY*X 0Sx0SSjX  txmP x KojVx@!t0x0@>Ox t0Ko Vᗓt L80 <xx \1S>:"0l>[AZAh> -LMP0o0@0@p0P 0 0@0@WM i0bS 0bSB0S<>0<>0SA SC  048#80\a0b $("(c Q00\0S 048#H 0B8S0SS#R 0Q' 4'  4 8  cwpP>0>0S0S1S 0SR^pP   0S   e~  z v r n -"0LM+`K0p?0P0@ +U 'U 00 0C 0 "40040 "880 "4<0 !D  U$K萻> -"0LM@+pK070P0 `4T T00  T$K蓻> -"0pLM0 0+PK00`@ `T T00 @  1S0000 T $K薻> p-@LM T`TPP T0 00x; t1xhy [A -LM`p P PZ @2 0T! }TP0  00S00 00$(SS"(08#( 1S{ 0S08#(u "40 0@ C Cq0CB#4Ac B a0b  47Q: VPPM /00@ 0@J K0S10#$ @ 0S  0 48#800 0 ᏻۙ dϓQ!1R@10\!PRX@10\! !B7P10108#(@ꈎ M-L M00 8 #X80 4@ P, Z c D n;8#(D#< 0 ,o1 0l!"8 0l!"4 0l lk14 0h!l"880h!l"4<0h! Z? 0@h1lA0@&0, ?$Kk804$D@@ #\#pT l#4@[@<<@ FEpDPCB080[A0! 8 ` $K@[A -L M` pPL Pc c1 0`!"8 0`!"4 0` `_14 0\!`"880\!`"4<0\!!D 0S0 c 0 6 ?$Km!⽐ \80P 0#40  002<8#(#< $K [Ah[A -LM0 0S` 02="!Bbo0厎Sp 0 00  0 0P0  00Pc W?0 @\1`A$< 0`!c@"8 0`!"4 0` `_14 0\!`"880\!`"4<0\! 0S\  10, "4F0E04D0 "88C0 "4 `c c1 0`!"8 0`!"4 0` `_14 0\!`"880\!`"4<0\!!D 0S c0  0 0& ? Kig!⑏ @804 K坷@40[Ah[A -L M0 0S` 0pu0S^ S0 0S0    P l Pc l1CS brQW?0 @\1`A$< 0`!"8 0`!"4 0` `_14 0\!`"880\!`"4<0\!!D D < 00cS3 @(0e)$ 0 0&  ?(Ko"!B10b>0!8 0U@ 0@`&(K@( o "4F0E0 4D0 "88C0 "4ld[A[A> -LM X ȠU@p.h, :U (K8VS/ >0>8VS7(Z4 6D@8S808=0=8VS@8S< 000 `608  d@Ȑ000@(@8d@^/  d!ȗ \080m 08te PpP @ ''jL0 0  @8p p "pP EA\A\A\A -LM@480 1Pp`X 2S  21C0d1 0" Ki臋2S  cR@eV @vh5S @h5@Pl0e T0@e@h ?O0h5 K -LMP@`͑V>08 @c4p  ' 0Kh ꫪ -LMP@`屑 0pS0C 0 S Kh?( 0c  ' 0s꣋. -p21C0g1@MLĒo?X t0` %X2X0/:0O00 P჋p 8`(K耖l- 0-LMX0@+;:0?"  7P` K0hA p-LM@P>2`0S2,0,  * xh -LM=pS  21CA@cP` h@8 (&M@D 8  =S  21CA@c PP X@8&M@08$ 0   h> - 0-LMP֐@! 8h p-LM8@S` x0S8P000P 000x 000x -LM8@S7 8S Q`P XU0S K2P 㹰pP 0 p`} KJS J 0<0Khp@-M \SP`0/ S0, S(p$ 00S 100 0P@J0Q@0SA PLZЍpV \0R*@0 -LM @0 0000  0\ T8IP0PL @0Ba$!B30b0@/LP T耖C501M0Ѝ   [0 MR*0S S01000 % !!Ѝ00 p-LM0`00@@LPᴃP 0S S 0 [0Q *0 QR 20a0#20x -LMR pP@pPT @t&  P E` -LM4@ , Kt 0@ @ PK-> -LM0@ (KJ 0 @PK->LM  tQ 0 S"0!B Ѝ>-DMJQ !0 SЍ0>0@-@M !X 0pS  1\Ѝ0}>EN-E8 BS(00"S: 2 1C0 2 1C0>GLM  tQ 0 S"0!B Ѝ>MЍMЍ PM 0 ЍDЍHaA p-LM`P @H8TP42@T(xh- +Pxh&|aA4AA<@taA -LM@P H<0$0  KhaAaAaAaA -LMH@0P`48 0 P 0<pߴ<Q 8\ٴ@Tִ@`D @дD$K(ɴaAaA bAbAbA$bA0bA@bALbA8bA -LM@0崴T   ƍ媴dbA-|bA -LM 0,0 P3 p0@ 00@ :KXH=2K00<0<P m:00 P4KGH CH ?H0 < K;0K1<1< K 08, 0R(K]0lD>l$> -LM$@ , D P6  p  0@(0@ :KH0P2K`00 P`4KG  G@ GD G0 < K;0K1<1< K 08, 0R(K 0lD>l4> -LXM8PK`p@ p@T@0 80K4` BK7KTPP 408 0B S800 RD W$KQ x@K@ G 0 t0 0 p 0l n 哚 p-LMP 0`P p0@T@T 0S00 0 Pxxx,>l -LMP 80S0Q 0S <Qh胝   40040'bA -DLTM0p,0 `04"48#88#( BRp0  , 0R(K 0h TK d0 GPKd GP TQH 0 R<0@\ ` \ <@ X@ OP 0X0SG PPSF X T@(R@@h0 PG YD 0PUA  R<0S L@KPK 0u`lbA@>HcAAlT1l;qcAcA0M $!$("( BRЍPЍ- M^ 04"48S Ѝ0 000^: 04"48#8 S  SЍ p-LM0a4 1@T0 R*xhy\.  @00C@0o 0SP 04"48S 0 000Q: 04"48#8 S  S(@P@00C@0@@P;q p-LM@p0``0P 0PP0 <0R UxhQAl;qT1l -LM@ = 00`. -LM , pPh   ^00 000  00(, 0R(KQ: D`V WVE P00 T0S 66RcPBʬ2 R? BP; Q 0 SA 00C00S0 000( 0`Pp< K0 ' hD 00C0 P000PT B 40040 RT LP\5 P0T@<1 P"40 0400PO PT 0P0  00C0{ P000XrSpl@0   =KI Ra 0D?< K04 㳰A$,0lT1l;q(DdAD>lAlAlcAL> -LM<ß0`SP0Dp<032 D   崃4U? U3 U  0@0S 0s 4 0w03 5 h"0᪕l00060402 PT    00  o0S( !80(KoDW !00C0Q00 40D;40 P Q 00C0 P oF0Sl0W060 FPD: 0 0 0 `40;40 R 0PUxPUu 0 R 0< Q0@P0T@  +Cl0@ P< [  00 0@P@$ oѯ;qT1l;ql-X>@dAx>;q;q;q;q8q\dA p-LMQ@P` KpP * 0< @`o^$ 0$PKphmAl;q -L Mp@`P= 0 0    0; 0T0@0 0@P0C 0@P00P 0 0C 0 qL0 4 04K0K/PKPP& 00 0 K/q l;q -LM@T @T 0 R(0SC \\0 ( $0S,0 Q 0$0 @TA;q -LM.P0 R R 0S00S000 Rhhl p-LMPP0Sx 80 @`T  @TxhM;q,>l p-LM@qP$0`0CS04S U 6,0 R  )xh(P MP  P 0S 0 08Ѝ'EЍl 0-LMlP@P 0S0S P8 CEP 0@0 88l p-LM`PQ 6S0&R Q8 E@P p0  @,@x,0Sx@xl p-LMPp@e0 4S`$  T 6@ 0(0xh褆p  @$@2 0(@;q -l0l @LM@@L0P k00 t0@ @@ 0hE;ql lpdA> --L MP  0 00 @04!48#hdV)ڲ1 0S*-PP000 0p0d 0 PI 0d0 00SW SD S ,((K000_ 0c0 0&@T 00S1#0`AqpV `V 0 R4S  p3R Q$00CS|.....000&000& 0SB 000000& 0S0R 0S QQ 0 R(0 0P P 0 R 0RP| ( 000$0Sy s:Sq0$0n0R 0S QQ 0 R(0 0PW PT 0 R 0RPJ ( 000$ RB02&> 0$0; 4 YP47 0 0R+@T+ @T( 0 R(0S0`4S2 $`0(`(0S3@$@4 z`0(@4(0$0%000gd,0 R;qgfff;q0SM S  PЍ0M 0 BQ0S 0`00Ѝ0M RPЍ0S1 Q p-L$M0`0C S @0  0R!KpnPP 0 (0 , K+K< KTDx R000 0 0 径6 B̃0l2i > -L$M``0Q$0 P Q 0 R 0@RQ000D1S@$ 0R. K06 BpP  0 000004KX?D KtDP@0S 0  0 00 0p`a q6 lB@0l1i > 0-LM0P5 0\@< T& 00@T 0S60\ <00\^ c000D ӔP 0008 R0008q 0-0LM\P<0Q@ 00Q 0\60 \ <00^U 0Q 嘔P0008q 0-LM0P- 0L@T 00@T 0 RL0P0 000 iP 0008 0008q6MЍNЍ -0LM@QL 00Q 0 RL0\0  0P000q 0-LM @PbKp0 R404 <040 0 40 hP q0h00 08hq 0-LMPP T @0S,]T88 -LMDŸp D0 , `DQp "000040`8@ 0-LM@PT00!R00P    adA -L`RM  S 0R,0 P2Q 1CQ 1CQ -, 0R(K0  0S?0S<1SS81SS40 S1d2U0 1CU- 1CU0 %l@K@ f;\K b;1FSY0 ;0K< K8K  0 0pR @K0)1U  p@T, @T' 0 RP 00W1U" PK@ ;K88 ;6`K&X X ;  0p1nLK!;188 :6 FHH :\ 00V@̧`KHH :FP0lii@ii >dA 0-LM@PLt$ T" U0Q^ 0P6 \\ 0 R<0T L0T88,>l!QM Ƞ Q:< 10: 0Ѝ0* 0PR1S@80 P @0 40 080ᾓl05  >P-8BϠ40 `PUPE10C8#8S1j0 Sg: 0AP04$488# 80P 1!08#800 0!XN0@^9PUPEx108#8X1,0 R): 0AP04$488# 80sP@ 0RgPn @0!Qi 0G긁e긁0S,H(KoBh,0, @Xz u|qAlAlAlAl -LM@0$0 P0`S@ l0 @ 0Sp0S/p0S1pK@ 8$KH0@=pP$ @0 @P0p80S 3SP0h!1P $0 8 0(0`chp}psdA -LMdC^ P 㤘P7  83 @ h!0810Iy0 Q R000 03 $#$0("ȃ  10S!0 0 0 #@D"DH$H00 1 (PcpÁ $<&$ 4(!4"H%<@ @@1S0 (@cSp媁04%4, $&8,$#8!8$,000!(@cSp厁04%4,& $8,$#8$,!8000(@sS`s04%4, $'8,$#8$,!80001``0w 0 Q<l0(K 00#R  S N40 単00*Al|qpseA -LM@Qp `V !@TX@0S 0S@U l0P (0V -L M⌠P@8K0`pd ( 0)P00P0#S x( 0R$Kv0l0eA> -L`M \,  0 \ Ÿ, 0R(K|K /0 (K!0 0a T0c1\Tp q@@ R |K1S q w Tp Rq w Ypw YpZKZK`,K 0S WX `V00P0#S w WV4 @T*:0V0/ |KPd -LMP` \\! \ (KQ p04"48#8g00S03#!8@K00    08#80#0@ 8KK2K1K@*P 70 0 @P00 K0P 0@ 0 @7 ("(04"40 - 0LM -jp3ClDl$l -LdMD0`@ DK 0-LMP@P9 04$48# \04"48# Q\00AQ\<0 p0 0QSX JQ :<0p Q\0Q:S\8h0X0X88> - 0LMP R0ClDl -QLM@`Pp@ $Ku0S S *@$ t` `S[봀@P" PU܄P0S@|N @~Z@t~ 04p[@PClDl}qCl -LM Kd KH 0]1Ϡ< A$0/@#b  8#" KQMb 0-LM@0 01@0̌P@@@TK0 -LM0`,0 P [P   0S A, 0R(KUp <P 1@CT0 0p2Y p- pPv 0`S P S PdU`0S S@ U@UT# DSS  /    1Y< 1pQ 0 0 Q T1PU0PU 0(@i}T<Q 0& L0S S DK( 0<K;0K@ 0<KA80 jPD  T00T0AmipP  0 0}H0 0@H0L@D @P80S0C80<^<Z r0lqq> -PULMh#0`000p0S  AR00U0S1 ! @ 0R:0SS S S S S S S S S " 00 0  P| 04"48#8SWQ    0\QP1! 2 R@P 0S!ԑf(0 (0 0b0(Ub!0U00P0 U00 UX: 00 01D 0NSA: 0 0N 000Q 000A ("(04"400  0>0>00>02p 000U0S 0("(04"40 ;!@塚 埚}qeAeA -LM@P  <P KKh --L\M0`,0  0p0 @04"48#XdUp D&000(, 0R(K 0$U$Q  0{P %000j`P%0000(S(1 0  @AQ]. ^.p\.<\.<\.^.<\.<\.].^.\.<\.<\.<\.H\.$5 R 5 R1  000Q4 R U000pxp 14 R 4 R TE#U  10URLK \@K lPK  0 HKK0KLKk0K[0KlK\K, XK,  hK,x0K0P(  0哃xP 3 Ri} CT@ڴ000T<_.<_.<_.<_.4_.<_.D_.,_.,_.D_.,_.D_.,_.,_.,_.,_.T@1O#U0 0U R 00S 0)SCU00Us000T@|2 R1 X0013000tK 0 00Pt @@@@1 (0|xPp$U400 4<@K 0 ;0K< K0s S80  080 W bP 00\  0S 063 LP0  0&`P000  001|qAl p- LM@T`@PK0`0P@8 0T PPh@PK![0(( b!("( 0P0 Kp0l4lDl -L4MСP@( ` p;l0- @TU P<  0Pl0l0`@  LK# 0L ( 0RD$K0 Pl0l0`0 xPl0l0`X@Km`  0jP`HpK 0 H0KG K 0 KAKBKCKRHpK 0 H0KG Kro0lT> -LMQ` 0SP  K ŸA0`*^P 0BS Xe.(e.(e.(e.(e.(e.(e.(e.(e.(e.(e.(e.(e.(e.(e.(e.(e.(e.(e.(e.xe.e.e.f.\f.ld.(e.(e.tf. e. e.-P$R 0 P`WPUP 1 RLP  0P KiV ` 0PA 0 @NV`PV8 (A0S1|q 0 p:V耟P0S p@kyo  0U  0P Ki\U t 0 KiVDp0Sa ]p@`oX꜀qDlpqqhDltDllDl8qq`Dl -LEMß1@l, PgP #(00(0ß, 0R(K0S|s(`V  0R 80S0C80H#000 0 0(0 v3`V KK 1K 1LPQ 00C0< Ri P`"0 S0!0 " P4`"Z$00$0N ,00,0X PG BP P0!0P  0<1 R P 40 80S0C80eڤ!00z!(00(00K$1  $ $("(DRD #0! 0  80Sr(P8 7PX 400 0P 0 RYQ (P@Q ,0 (0Sy4000``PPr0 `*  0`#L00PL0vz2$mrz0lq qqpDlXDl\Dld> p-LM` 0@01PC e Bd) 0!0e 000e0 04"40e8#8  $#$ x -0LM `RP pP 0S PP 0@010 0  00  @)@D0P 0P0 00`Dl -LM@`+Tp 4 PP  (0D#1 p0i -@LM`pPP 0S 80S0C80H0 0 ,`0gzP @y qq -LMxp00@K`P  0 `0 00K/ K,` )^P 0RK<0Vl0lp> -d5L@M ` , 0d 01CXT )@PT X # Tp XpW00W``VDTe =T gXP@TXQ 4 Rx, 0R(KW `R 0WB:<@K 0 < K;0K` 0(80 ]P <  :(000T T3 R `0V\0 i <K;K -LM @pT l` P R0P00@ 届0U0C0 $R000 h袊|DlqLq -LM␀\ p`00S 0CP`P1@ 00S 0CP @T 0 00\ЁqxDl|Dlq 0-LM,PP @000P8Ёqq 0-LMl0PPT 0@0C0S0\ 00 0{T@@P 80S0C80008hkwЁqqq -LM 0p 01 cQ * 0  0Q  0q03R0S %000hd%00C0R R00 \ `0#$0$(!44"S @ D0 $!$("^:@T\3  04 !4$ $8(#8"8PnU#ڲ 04"48#U ᆾ !04"408#8 $#$  04"40a8#8 $#$ T0 `P $ 0 $4,.4("(8!(#8Rcڲ 04"48#(Q PG R0<00 t,#@U00C0Y 0S00pp @T0` 0#$04  04"48#Ƞ\ 04"48Q#h0\s0010S -LMP0`0q}0S 1I2@T @T 0S 0S 0S 0S 04"40g8#8 $#$(!"(  $ $)"(04"48#XQTF 똡C04"4R!`00`0m虾>`PO PHq@D1  Q ;$F Pd00d0 000 `P~`P. @00@0P0 0$q!$ ("(04"40ꄠ40040 |0x0 L 0  d00d0 00 0Ёqq|DlxDlq|qAl -bLM000 @R P 0@SX00X0 i @P 00 00qW000 0W^0<SR 0<SN 2000t00t0!P000 04"48#W000 Q000Ž 0S  bٻWP  ^P%0S$ p P 0 R(00(0  i6p00p0 T@PP000iQ Q 0 R0PQ|  | 04S(00(0cqPDl 0-LMPh 1@hT0 R*8hK>oeAqeAq8qeAlDltDleA p-L M@0  Q0e `N PK  0S S S! S Kp !K 0S08# 0S  0K08# 0S0![ 08# -L M"1P0S; `02K00q 04 @"48g#8!,# $8#$$. ,8#8!8S5 LP"H0 P0 *P07@0@0@c0l> -LM`PP0U0 @T  , 00S*0 0    1TpQ Q 0 W Z00Z0SQ Q 0pjWQ 0,SPZ 0J0C 0@  IOpG -LMP@T7Rp`h P' @P T0TpTz Tw T9*@P @TT-@TATT *@V ္V z@"Tf SV 0Sk @!T$T;#T _0 0 0@0T+R0 D 0!R񟗃ꌗ...ܗ.̗............................t.X.T-@ӆ# 0@ 0 {$T5TVs 0S0 PR @ 081S S\@(mPP@ 0D !S񟗖..И.........................X.0..t..L.$.hl050@+l0#5ql04l0#3l03l0#1l00l0x S(@P&0BS@ Ǖ@Rl0l0@0@0@@l0l0Rl0l000@@l0l0 Rl0l000@@l0l0Rl0l000@@l0l0Rl0l000@@l0l00BS@x Ǖ@@q @Rl0l0;;@@l0l0Rl0l0;;@@l0l0Rl0l0<<@@l0l0 T T=TV 0S0PT PX P@l0@00l0X1T"0 0 0@0z0S@ 0q  0@iVf 0S @000 @y TTd0 0 l 00@B h"l0@ 00l0Zl0@0 0l0Tps! -LMP p04 48`G#8SB*0S010D fP9*@P2 ! 00 A0p! P p  㝿P@ ◿p 04"408#8 $#$  0 0  0 p/q -LMP@ 0p01 cX<0 O((K <04"48#8P0 @8 4 [4 80<`04"4:18#( 0 :08 0 $#$("(Q0Ա80:0ı4c 8#8 $#$ 8 0ȹP @0 S04"40 @0 P0S? !x004x08H00H08 04"48#8S+@,`PJ 1`<0 @@S00!1,(01(S4 @10 0 0|2020 c௴08#8 $#$@0 S  @0 PP <x00x0#>\ <00<0 00pႶW7/ <00<0202%q/q -L p-LMR@ P` PP 0@x@xkS dS6S 0 PKphhmSpS)`1RP9  0 0 0PP@ 0S@ 0 Rl0l000l0l0P@@ T+P( ,@ ޴0 0 l00@0PP 0S0 S Z@ @P ij@-@" --LM0 $0 P@l0 p`-00S,* [@P7( q0y0 ` x("(04"408 P  p0(0 0H  PAQk(KQd`0P 0S 04"48#8QS0S , "\00\004 40q MЍԁq --L ML2pP, 82U r PUF @0 l0lAg@(>gTy R 0S8 RR( R 0RX#  !0㼵@P l 10S@0  ,K 0@< ,0PF,P0,0 PUX$ l 00S@0   ,K 0@ ,0P ò,P @$K0R 0S 0 @004  B4 0 ᢲ@ܼԁqhElʚ;q -LM Q`P0@+ 0t03Q0S pXQkꌱ.а..0.8.0...0.,.Ȱ.$.X.0.0...0.0e Ty p Ki 0`S1 R 0SO 1p-p 0S1 R 0S/p0(0ptpTQ0 p V+p](1@$ pP3pP5 \p#p垄0 V8p( iYp9pz0  0S s MP 0p80iV 0 0w\0y`]p,>lxEl|ElԁqfAfAfA -LM<@`à (1PddUp !@0P0@AW 素ᶐp' tf/b|Q Q V# 01V 4 #tf㪹4<㦹 (㢹Nrq@-H1M    QPM? (19C8# ("(8S 0 Ӵ (B(R bA9C08#8(R00Ӱ0Ѥ =0 0S01AS0#!8#(B8 CP&8!̱P ü&00 Ѝ0 20OrBN|1MS(  S < t0b? S ЍQM Q c0@ P1ЍPp0P 20Sp P(0p S1*(0P!El -L0MY0@S5 S Q/ /(K(0 80 L @0 <0*0S`` P PPѰ pP7 PHP H T08 # R; ;1 ᷰ7 (8 L @ 0 0 (0 Y0S S  D ` P4 0 <  <(4"4!<0H  <4("4!<,0 0 0 D ("(04"4040 0:<#40* 00S D# <4!4"<0: 3 #0T0 <(4"4!<0P <4("4!<0Y Rx R8D0a8#8#!<@ !8#800bYY 0S|RK R8 D0b8#8 $#$(0"0"(`0!0 Y Rf R/L Q<[D0 L  0# `D  D |D 005(P0<DD0 `= >0?@4 0 <0 =^401q  x0 0 Y Y 80 c("(04"40HY `\0P0x 0 05()* 0D 4 0 < 7+,1 D 0S;0L /q EldDlhDl -@Q`RLMQp % 02K R RP VPU00U0SRG R R @00`eV00S R$KU 0BP U 00 ]<( 4"4!<0 Q <(4"4!<0 0 6S-t0TP0d1hbX -LMp Y:: S 01 Q:1@UP TX!1i ca? 0@X1A PEt0P08Pd @0 0@0d (K1|2L |2R(K  T! 0 0$ 0 }P $ vpP| X  t0 Z 娀0\0g  Y10 0a aS0SD0Dt0P0T!= SB `0`S% 000  ! @P |d @0 0@0d K0@cP !}0u [0 20   0 p0R0P000:0:.TT!*Xy ᎫTOrElNrp9l -LMbP|p@P |<Q- Q(+ WP2ųpH20S S03T@!t@T@@3b/  R8 @D#h.8`#hw1 10S> S A !0S01S 1 g\P \ 67Q1 QL  Q3 0n Cw@ Qp0/ 0nC0@P10%Tt h1l1 S 1% A5g0 R0! S 1 !g0 R p00n C PN.n2 2:20Sp pS:0S0 Q020Sp  p S:0S R00n CEl2El9hDl -LM|0G`@p>P PU:EMh0R1ػP @?00R1hɻ"@p9l -LMpPV @00 K`P 0 0R @U (K 0aS0BD 0a0bS .U P @l0l <0 l0w0w000030S S, 0S H 000 0CPP 0 0 LP Po :D@D0t t 0S "2S1 `0 R!t0:t0=t0Px T0prX1P hRT!00 001006<2 4!0$"?08 O000t:Sn: S7 100! 00&?0ND R1 0cS!`S? 0@L1PAXCHDP ũ 0(@0 @ 奩Y =0@_P |!0 80P00ARTH Cl0 4PM 7I oDOrElEl -ALM@J 0\:@T 0c 0bS R@TL{0D L1M0L1  l B\ 00C 00fA -LM6| 8SP@p@T  0S 0 |0 ( NrV%  0@S1 `0V 00000 U | R l0  HP 幼t04t0(t04t0`r -LM`4 sP P  00lSں 00lSpWP0 $ 0! lPU0U4 P` 0O0@0@婨 qM4ᣦ00e0     0/< 8 0 W  1QS P僨 R0000 0$ qUp 0 0lQ4@ @0P尀U㲁 00S00   0R (K R 0` 0R(Ko 0 Y  0R; $!40003 0a1 -4@ @0P尀U㲁0  0@_<@ 8P @P@P@ p 00@ /< 8 0  s R0000 0  0R `rOr --L Mx  0 , p0 x K 1 0#2S S  ̧, 0R(K 0R p 2:W 0@`jTh`  TPP P  2 1@1@0T1 T( h05Q@T 000 0S ( `P   t0KuP t 0R:0p 0h#21S  S R0 000P`eUh` P<` ,  H $0$$@X%4P,̂&.,%    R R > 0P0"!U00d Un 101 < QFP  yh`h``h` 0   (0 w?  R 0S0s4 0S0S 0s* R  0S0S0S 0S 00 40000O0@0@eؤh``e h` 0S T10cS`!0bSAڤP  `1R 0R 0R6 S &02 &'  = #P 00 0P R |0@  @|1Sd SP9A h@@ 0R0%p :W PPE UP  @@ 0S PP  9R      <(4"4!< 0  <4("4!<|0 00 0 00(0PU R 0S:D R  \ 00@0 P1 #  @ 0< 0\41ʴ@T 0K0( 0 PlP |Q PǟX!0 b0b S0| |0 \ P@P a1 n0dPR ?S0 0,1(1\ \ \} Q 0T!R 00bSz0c^0ڼP !R 0B" “ N1ǁ h0^ 0O0@0@00 0h `nh` 1^0n Σ 1DZǡ0h` h`6VSʨ@ 00c0a0PU0U00L0O0@0@ RP 0R P U^t0 0t0P  00cS(10cS$ U = @ 0(xPHKd`KJGQ Q 1P0P 1 h0@|4$ 0 ?008+J70S @0PP0S*Q  T10bS00dSڨ@1990l0 lK  Q101P 00cS10cSN  t0K⹪P t@ 0R0%p D*Kw0 @Pt0PP th0O0@0@t0; 0@@K H@KG0K? 0\K d@KKc0K5 @FK0 ^  ^ ( 啬h 㑬00 0 RC024A@T9 \ 1@TH 0RN 0#3Rʰ@P HKK 0@Pps 0@H0KG K D d0KKcK0`0 K  `0AOr0lElOrEl >DfAOrPPRldarp9lOrElOrElEl|Or`arH?hOrElDElP T!00bS 0 @PR00U0S$ Q0SP `10cS 0\1Հ T!h`V'P 00cS0nS 1S:6S P (PPU (|PQ U 00lS0H00[-@6S7 1Ũt0 U@At@ 0 0bS000e "0<"? 08H@t0`0`SS1R!P1Q!681S 1'0 1h0@S6@0L0  ZB  P 6 Sʠ@4#00S^PQh` VhPe:PZ 8C(RT R ʠ_t 000t8C80CSB.....x..T 0bS R 0bSQ0Qh0S 0 0R@P0U000H0^0 Hጅ t0Ńt4P3CG0 |1S S  @hA <5@5t 0S z@ PV T5P3CG 06 0 ( 0 L 0 00n6 AP )0 00cS@h` h`@6S  " S ʨ0lS|ڨ&6S$! 1S !10cS000`l/0 P  |0S-08\ @ <10cS,l 1S  40d'@0?0GG A$1T'P1#0Q  !S | R l0  HP 0 g@ V*0b޳@? 0 t 0p!0bStŨh1Vha 0 0bS 60CS񟗀....X.68C( R0@S0S ǟh0K @t0tP թ tѩ 0>HK 0PhHK 0P P u p 0DPo v &(@t0t00006@C6  a f00 cR 0\JTT10P\1000I 06*@0*?08yFt0`0`SS1R!P1Q!P1 00C0[\!0$0bST{h/0  0@hA ;Ma@dd& _@P`@Ph`  P >P 0@ ^2 ^ P101[h`V  0R H1 0c0cS000K 00cS 00C0b0SH00@00,L10L1h`8#P 0 0 Vh`}@ c4KP 0R^  P0n aS0V0000 @@h0|OP0@U0@| | R l0  HP 0 ކt8> R  X< 19 0S6 63 t@0 @0S |0S P,!S0b.S:h (10(1 N @t0ăt倪t ,?0Sto lRmt`? R  X^ 1[ 0SX 6U th0P@@h|/0 U @ | | R l0  HP 0 \0  t0ăt0 t0t t0ăt 0tt Q f ⶱ@0f 0Su 5t D0@"Ὗr ,A(Ae0 0R0 |0S~8\   <10cSxl 0Pc/00 S | R l0  HP 0 ܅@Zt 0p!0bStŨh1UhQh0 1R& P40h#0?0qD ? 0  t0ăt傩t0t0S t0o@9D2t JDŸc &%h"c Dt0Ńt 0S9 @T*Pf 2P3CDT P G 1P3CD* T 0  !t!t0 ?0 PC0 @F 0<00 f  @!608#868C8S ڨ  1'0 1qP0 GP!HP$1PC8a0'0 !<\0 0@\0`@<L$!0, 0cS PLarElDTarOrEl -LM -LM0-0@08C8A9Q/h1 !S0 Q xQx<0 / jC&8 S0Һ6 pBElD\fA -LdMt |0`U@x tPhUtPf -400`S:70 10 0l0 3t0VtPr 0\ P1P!R,n| U|0|SP"P3 ! 13^hhX0W0U1!X |0h h @ 0\b0c3QXd . X lPt0 \:0 t0|1S Sd S .0x0 x(K1Sl r0SH1X:S0!0bSdQ Q; 0bd R0a0aSTt 00aS  0Q ^ 040@ x B| ^hhX|UyyB40 @ Voj t aX pʃh X\p I r0 S X RU0!0bS`0ODH0@@)H0L@DᆝpP I\00S; 㧝1 0\0 0ᦛX0\0| ᦜ 00 0| 0S0 (p  X(t00t0MpP 8H\00S 0\0 0\0 00 x0S x0 P @B t0 1R B X40 <(4"4!<0t <4("4!<\0, 0d#P7Pd 1Q!0` a6d2 S 0S0S"("(`0 04"48#800 cQ0ՠ0 ڄ& 0Q 1("(" 0 0202r R 40 1 0cS! 0|0 ( |1S S S ("(04"40| @x00| q0%00|S;0H p@ x xQ(l1pP\l@0`0@0tP 00 0tPP  10cS0P`!tPhQS 0 S   4X00 T ,< $8 #$,,t.X0K,A  d4XK 0T t ,0d00d0ğh00h0t0Vl tP    Ut0 PtP 1 0cS 81!S3 <8!0000@P 0RL `#0?0@40A @F=0P(0C8#,("(#80 0@p 0|F|H 0@ux N0 t XK⤣t 0#10 " 0t0z@T| 00P_ၛ7 x 1@0W0KX@K 0XK4 4 .K2Kv@:tP ' T#R1t < 4("4! >|< 9|1S' |8 1|( ,Ki0 :0X! 0RKphKXPT 00|, | ]D Rr0lQrHarOr> p-LMD@P`P00T00S 40xhux -LMD@PpT Pg 40 X0 00h0W0MP 7S -@ML0  0 @ @2K/A?dar -L,M4pQ, @` , 0R(K0S PPQ 0@SŸ5P: PŸ0 P- U V) 001L0 @ L 0t Pn @0@S D^ < ,$ !$0,0cS10cS 01 RV @ 0@UPH DY <,$!$0$L0cS10cS`F0l $#$("(RD }* Yh1DQ2*t05t0 p10dSmpA0^/t10 00bJC0 R\ 3PAP @PV<@Kx PNr/ -L,M@PQp` (K0S0SJ UU 0ES៕LU UG 1 R VA 0S a  0R:@K"  @0K╘[#[`0pUF P3 @0<S D^ < ,$ !$0,0cS10cS09 0S0S s娐 0pP G10Sl0 R L03PAP @P @ K0PN{6.Sl/A?darNr -LMD@@68C8S S\060ϢhȢ6S,0 R3QAQ @QN 0-LM@PT R0000 0 ka@T88`r 0-LM@CPaC 0008$RrOr p-LM|P@@`t0xPLt06t0 @M=D@oXx0t0(= p-LM6| S@P@`h 000<U8#L00S8C88#xh06 00 0OrN -LM PbPPpN @p81@P0.@7 ;a@@ ;T  ; 0-S00t00| " 0C18#8(BQQ/6ڀQ0ü6p0 $1 1h!l!l  00|1|1 @0@0  w x DP$RrEl'/L>/ElElB?QldDl -L4MğP, P@L0 P T ||0D @ H0H0 0`0lQ@ ƗPN $0D R RK TP \  PP0\  02@0 2P@ 0 0 0L0L  ,<$4  4!$),.

>$> -LM@x|PP`F |P4 P@,  p0:0`0#$##̠  0 LA0(@# 0 0S 0 0 P P1 00 001@ =0+ 0 80 0(  0@!`P |1S S(0 0 S0 0 0H 0 00(0S; y1p`/q 0-LM@PPf 0@@]a 0@Uax0 h0ZdU\ 0;S<00L 0<0S<W=K0h (LhHar|fA$RrfA`rEldar (q/q/fAl l0MS=0X 0S00H 0S=00S, ,0?0c0Ѝ`arLarPar\arDgfff -LMA4@440 (0!nj hE@HarElParTar 0-LM@@t0P6 S `0P T 400aS8h$@, ,0 ?0Pl:TarElDPar p-LM@@t0`V% 40040&(BP1 R|0@  0 ?08@:Kph?<00<<0Kph?Pʄ0^x0l 40`0Q*80 080x0LPPc 0OrXarD`arTarElPar -LM@b@t0p0 h?,00,0&= R P0` [0r00r0p04h0a P * 8(C89H C1S01P:000<00OrBEl\arFl 0-LM@@t0P0t0T8h_? -L4M`0`(0 @t# |^ p!0 RJ70cS608#8(R62 &$  $ 0S8<C=,?( 0R$Kr(0-0(00 t1C1 S01("(8C8S&ƱS0ü6,"0?0R92 R$ |@T! 6Sں6Q@0 R P 40 X0 |1S (PP X0S J6Qʰ0 G P!P 8QPV$1 A@10@1|-0100tL [5t0K^?0 4KLK(0TK<0 8@K1|0 80K7 K(0`40 (0P>[<=0X00lOrNBElDhDlz/dar<> 0-LMP@@@8T8 p-LM|0@@P`ݤP 0`V GPD$xh貤T0 Q`(!10bQ 0 0`V`!xFl Flp9l 0-LM|0@@P媤P l0GD 0S 8h耤40 \! 0 `\!8Flp9l -LM⬢pW`, P P0SR@ Q㖟K"! * @P 0S:QR K /@PW2[S S) @, 0R[(K >W2[\ SF S  KPP <KL0K嘿W X DP @0 5 <K 0P>P  VKLK0H>@P @\=X# @ 0  0X0 T0 \=/ @ 1T0 @ 1X0  KPP T1`< W[0Q00 QOr 0-QLM@ K00LS1/1/0/0/1/0/0/0/0/0/0/0/0/d1/L1/0/1/1/\*0 @2$ ~#0S uO0@" PK  b#P0Q 0p4WP00 D J0@" 0FlXarOrEl`r 0S 0S$0S(0S$ 8Pl0  0S  0S$0S(0S9P 9l0@<8,80^80P00y9@(PP8Un`k(0S8@3P?8 P;PSuPN 0$Kmp%8l0 (0(0  w x ;pFltFlarfA@?QldDl -QL M 0S K0S0S P0@ SAP T \  0 0HP˸0P @0S   0El6.arI/ -LpM<ß@Q, p PU ß, 0R(K`VP0@Sp kPg P 2 R W 0| S 0x0 t | H0KHK0 GPKH`K@K | ) 0 0HK,8P(2p0 Yi |x 0R:l@Kʔd`K0 |x<@\PK⿔0 c0KdKH| X) L 07PXK [&[tHK p0L%0p pHKH K@0K0  @KHK07P| t m @KHK07P _86HK@ Kp  xp tHK p d0X$F[@K&[0,۸P*B0l6.SlI/arh>A? -LM@0@@c@h\ --LdpM0\0p0 ` 0, l0 h 0@#2S S5 hPɟ, 0R(K0 G0K 0 S *:X 0S000 0V $#$("(8#X 0 dR' U00U0S 0000` G0K 0 S` * p0KⳑP p 0R0% *F^b᷉K0Q0 0S 0S0s 0S Q  0 0R 0G[Yy YPH@Kᥓ0HPKGK d@KK6ᘓdPKcK0 6K6\ 0S V 0S ( 7PQ (@ h0@PU 0\h0 l 070S@0   h KOV l 60S@0   hK 0#^ l0  h0Sh@K @0S@ )0ΜV l0  h0Sh@K @0S! 0㻜 @HK h0P 00 00002_  (0V0(0  0㙹0SO 0000S> 0s;0S R00d00dSP U 5PU l0  >@(>T PUm @0 ^l0 #0RQ ,0S00S40S80S0S 0S$0S(0SY; ($0C@P4 \ l 30S@0   h KNV l 30S@0   hK 0Vc@HK h0XhPU 00 00h0 @0  YK ^ l 30S@0   h KNV l 20S@0    hK0&@HK h0P @Xl3@HK.H@KGKdKK 0D0 %d@KcKK0`0 , PAa0000 P5#0R1]0S  0z3@(@  0\@僵P}> $00"!Q$00* ( õPUm000! 000Q!  0 J8 R 0R( R 0R( h輴P@ӓBJK00000 0var0lDfAarʚ;x> -LMQ MЍar-QM  P P* ЍR <00 Ѝ 0ЍnarFl -L MP-0Kp @̈-0[ !#R-K R 0 (0/0(0(K%aVT 5,  , 001S %1S T5,  , 0701S1S1S ,1S Q ( 㼋Pk$700001S41S81S 0SN S 0SD S00S S000(1S 1S  ኋP @ @ 0 000 ("(04"4#0庐(1 0 ! c04 40-[Z Z ᝈx#(0/0(0l00S 00S0 0 0``000I(0C8#8 $#$("<8"( #8"000 03B 03-@[T T` `"(0/0(0/ 00S St) /0K߇@0/ K.K.0Kr  0.[48( <"4!<#,## 0000 1S S0 R0 0(0C@0@0@0 R00C@  00C@0@0@ 1 40K(㎇40,<$"*)0/ K00(0C@   40Kv40,<$"*)0/ K 0嶐0/ K.K.0K .0[0 /0K_ 0 Y 04"48#89C40ardDl -LMl8 <  /0K`=/ ["2S S (00(0堇(K( 0P "2S S Z 0P3`P / ["2S0 8. K倅0S000w 04 8<,<$"*8. Kg0SY )Y( 0S:Y )Y p 0S 653 R1 (n;34 PU)PU& 04 R@T@T W 0S 0R Z 0S P$00$0w080`O0@Y0@ )YuPB< R LP  0 u2@ D0pR@ 1 00Sa@`10`@  @ 8j42@P `50Su 414 t 04 8<̠<Č,ʠ.K- K-KP>  048<!$!0!̠ 0-0[p:("#! !4!(0 Kp.K 0-0K P  -0[R 0 0Q3.`P)000 00 0{ Pt@gH00H0j 00 0.1000 @@O1arfAFl,>ls8q8qq -`0LMP1  0 ($ 00 0: Flar --\0LM R1   00 0 c K 00 0FlarG-@0 0P8< 0#40   0 ! 0 8<0# RM` ' s`BP0 .0.. " A1 "4 " "  " "0,`0 (V 0 Ѝ08 <0#40 (0, "V-00r`F0 0! #0 P0 .0.. "1 A "4 " " "0" 0 `# V  08 <0#40 (0, " V$$q001 !4 0# 0#(0# 0# # , 0 00 P.( 0. .A 1 ! 4 ( 0  .,00!80!$S!L`  [>> -LhM`AT4 2P 0P0 0000 0@DU 0 N4Q 40 0@P.,8P p $( 8 #l!@` < @ p !Pp D P ,!X T X `!a$|,.\ ` p ap#Xl P d qt !< #4P!01DP@,Ġ Q L0 .T0HP !\Ph 1lQ| !$D@1`P dQa@ 0#tq "x  H@`0  L0@hP!|0At0 Qx`p "`!0'0p !4p  "0# W0p  0v4(K>>>>>G-Mhp`@ h@$ P` L$`\,` , .\ p &`PX  ,$,X. .  lH$p th $d0i ̠x|P la !Q`#<`<4P, x0 ` *L#Ƞ0`!|@$0p $x@0P(@%P @,P0|`P#Tx0&D#d<0*!40 "0 #T4,  (8! pq "0. *@P 0p qS`A8` 0#!( !0  "0# l"p0tt唃l l@匓 la"< P !Q`p`T LDPp0`p!L##t0$`!t@0$X$d@ 0@l0@#D0*̠0 0T0l L0!D0, "0*Ƞ #夒  HP QP!$x`@P0Pp Lb@ "*0%PQ @@ a H儀 0# "X !  "0#x!| 0쁟쑟'x h@|P.<b0*( p `FA %40!!x!!,!P*>>>> -LM@P00 -LM@P`pP W0G-Ml@l0p`Q @A 0\0.` P̌pd`0% @l``@ P XP`d$` ., .\$@P ``<#,ɐXD,l  8#d #.@`倀h ph ̠ x laP!Q`#<`<4P, tx0 `*Lp #Ƞ0`!t@$0$@ 0|P(@%xP@,Pt0x`P#T|0&D#d<0*!40 "0 #\4,  (8! pq "0.*@P 0p qS`A8` 0#!( !0  "0# "0!L.l ℓ!瀀 >>>>0M Ѝ@-0@, 0@$0 0 0M Ѝ#EgvT2ܺ -LDM@ lK pl( 0 @ 00# h ,0*0 0#da0"00# `@dȟ0! 00#\@Dlŀ0 0 0#X@$(0, 00# T@ b* 0.0 0#P@0"00# L@ǟ`0! 00#H@̀0 0 0#D0n)+C0,0O B0#  @`G' 0.@0 0#@<@@dE0"00# 8 0$00#4`ǟ` 0! 00#0 ǀ0 0 0#nh@& 0. 0 0#  -T@0" 00#@@|0!00# ` l@\Ɵ0 00#lƀX@<0,00#D@& 0. 0 0#  +0@0" 00#a\@0!00# `H@ş0 00#̀0,00#`@% 0. 0 0#  b)L`E0"@ 00#@@dF8@0$00# d ş0! 00#ˁP0,00#n$ P.0 0#  X0b&P"L@`0"0# ğ@0 0 0#lȁ0! 0#h@d$0, 0#  H\0b. 0.0#P@, 0"0# ğD0a 0 0#8@ā0! 0##l0n 0,0#`@  * 0.0#T0`0"0#H@ ß0 0#ll΁0! 0#P#00 0,0#d@ 4 b( 0.0#l@000# P@Ÿa0 00#lˁ000#X@"0 0 0#  % 000#`@|` 000# D@\Ÿa0 00#h@<ȁ000#L@"0 0 0#  0Ab- 0@00#@@TQdK0P00# PP8aX0`00#``\e000#@|` 0 00#d \lˀ000#H@? A10N@b@P0 P0@ R?W@pG 4 ^?W@P4 W(K (Koi@0 d G00!pc?WP -L,MT  1>?0@0c80 X1"0 @ D <0 08#8H L0 T^!\8 0!pT..l<@ #48 <, D[2K30KT80-KL[ C1PK4KP .KP /K0pKP4K  {U'DP  0#<0 "( 0#40  Q Xc, 0R(K'0lFl>@-@ 0@0@ ,0, 0 $0$ M0 Ѝ#EgÉܺvT2 -LSM@ d lK`dddaH  l! ` HAlp` 0"lQXoH0#@ h4 `e[@̏J " 0%`0# ` flP id`  & 0$0#p苎dKp`ȅ0 0#\ l 4H0`  n (X1 0,\0#pp1 fk{X1P  p1 'lˠPꪉ] 0. Xh0#p1  d0 @  *g{ p1  @0@` !Ta n`TdL0%h` j0# 8nT 0 `ae[ #`P 0$` 0# \䝟0 hc;8p0 Pq 倀Lp &ˎ }PdK0 p靊 0# pX PlT )fk` p|0, 00# lˠ 'L 倠DPY 0.茊0#L@@0nidIT0%0# p1  L0 g{ ( p1 a  !0`j` <`|h`e[h0$ 0# ԐdKPa al͎ )0 0#  D0lc;`0 j4`p *` P \{` 0,pfi0#pL Plˠj[ &<@p 0 .gz "00'@  P0Z48y<0b-h1 LT0dL| n |0fk 0 Ѐp1 h1p0g{T |雊0,0  \0 e[ 0  | lˠx aD x艆\ dʟ 00 D!Da@*P1idK 0P jȇ  ` 0 0x``alDqh n 0  h lYx  0P 0P P|g;Dp @1  P1Xylˠ eZ @p  0 p X 0*fk jp g|༠ @T0 ਟ0 0 @ e[꫎D   00 L1g{ 0 @Ah+ 4TH!   0@0@霌@ȟ\1a`   0  ` L g L0(` 0`฀`W<0 PL0nl0p1 j1 pq P 0dK< pmvmznܼNS @P❀fm 00@0#@D@L0g{  0  Tl TM舂0na0 P0#    P X0` 0fk00#̎00i( ?0@0c80 \1T 08<0 0!D @0 ^.L H0 T0#\pT<!!l##4<30K, 80D[@0-KL[80 .K2K8T N1PK4KP /K0pKP P4K  ~U'DP  0#<0 "( 0#40  Q\ u}, 0R(K0lFl>@-@ 0@0@ ,0, 0 $0$ M0 Ѝ#EgÉܺvT2 -/LaM0 @ lK,0 }1Ahp PaA ad`lnDi4 i80|/0%1  d0 ac 00#l1 p `0(p0 nd-c Hc1@l ` 0(T` 0\,@1 P\0P Q\clD0%X0H@aqbacT\Οc< Ȑ X0' &@0 P,1 T0Q T "aDc, 0% P0H͌@`lcTc< 0* (0X A1 L0 PLx  "d Qc,lDnad<͟H0% &@ H0  "aq@cTcP hAcq͌ 0ᜀ0*L  #@(|O`0 x @ \-&l@`0 ! b @Q? `P0`?SpP`0`@  gonw@@pb hw x?0YP@p p?0Y@P 0 -L M0`P(0 p0K  !62 b1 R<0Q0^ ~?@ Q R W 1  !1P}v( 0R$K 0lfA>>G-@M`  0 0@0PPPPp  `0  0 ($ 0 , @00hP @ ! @ , 0@ f P . 0!f.P @P  0P 08(`,4(0, 04 $ $@P 0 paq! 14f P ,`00P(  0 `P%0#(,`jiH.!.I$0#i!'E$0  $`,@80@Pp0 ( 048@P  (@ 0P0 ,`4 @P 00  @P@Ѝ>G-qM TXLP@D PAhp!(1,AaP`0Q4ap8q<@D1 HL( P!T1Qq0@0XA\Q8``adqf8<(,0!41HLPQTaXq\p0@$H',#H8P`0@ L#D<P` 0@ D4LP`(HQHa.9.WiQa0@,aLQHL4,,'P&Π`Q a(La(g Lqp(1)HHy ਄ aqGo#Π0@Lq,Qt萍%ࠍp(A䀍C(J_`N p'   ણ^`0ܐؠ@RP` P%`& P`P'`(Vp  ,!Rp~ p #p N0p 䐍@)*P`P%`&! "0!p) *@f圑ph pf]` P`!QaGoZVN`qdR_`~@DJ/ Jx|!. !1N?1ARO0AQ^`QaVoaqplqxq|們儡j!堁夑1AtQalllh !t P _!i!wPQ堁WPaQ^iP#tQp(y`ifWq倫$`at(ᠡil ` kh PY ≑ Vᜁ p$P夡Qጔ(媤Rᄠ .PPpP`蔐P%`&p)*  tx3ᘑ}1Ab_`>q弁^fAa0@408@f^P`P`,P0`- $( p!j?p(P`Pb?`0  . 818<4!,00 @$! p$(P,`0Q004@qߍ$> -LMpRP`& @D1>0A W@;@ RpG`@D  Q*H0 0@WH0L@W耀cW.:P s@1@ T@D 9 `phP s@1 0S@DRH0 0@H0L@Pr@1 0S@DRH0 0@H0L@SH0 0@H0L@MЍu -LMR`p. @D1>?0A @c X2:PP r@1@ @D  pj?X@<@H@ ?X@D @pXP r@1@ @D Pzr@1@ @D 0-LMPP 0@ grPar@0@0D@H0L@8> -0L@(M<0 8@ @ @P L @LH< 8 @ p ` P<K 衟 <0K @ 0!D#L"$4%T'\1t4 0 &dp xAP L 4KP0` ੡D 1L N@H@ 40K @ 0!H#HH8%X"('X@x&h0@ @DH0L@" 0 pPP0P@0PP @~q@H00@@@P`P`(KoPPp`q@@pPPq0P0@ `PPq -PL M0 4 . U40@P0` 0 @ $#4!,<p00$Dh@d0dP`` 0@(#8!(8$HP`0^``4(Kop -PL M0 4 . 40@P0` 0 @ $#4!,<p00$Dh@d0dP`` 0@(#8!(8$HP`@^``4(Kop 0-LMPP 0@ 0qP*q@0@0D@H0L@8> -PLM`, M 1A@px1 pA0@$#4!,<$DL1DA @1 8A 0 @q(#8!(~8$H? ⨁@D) 0 8PP0*?PP@,8p@00@0c8( 4<"$$ ,  Q$Ko-pP@8p0P0P@8`pP@@`p 0-LMPP ( pP@p@0@0D@8>G-: @M;0@$P$8$0$$ Q|4q aP,. .`.8.\0.$ a04p Q,@$ @$`$8$\0$$ a3p Q,. .`.8.\0.$ a3p Q,@$ @$`$8$\0$$ ad3p Q,. .`.8.\0.$ a 3p Q,@$ @$`$8$\0$$ a2p Q,. .`.8.\0.$ a2p Q,@$ @$`$8$\0$$ aT2p Q,. .`.8.\0.$ a2p Q,@$ @$`$8$\0$$ a1p Q,. .`.8.\0.$ a1p Q,@$ @$`$8$\0$$ aD1p Q,. .`.8.\0.$ a1p Q,@$ @$`$8$\0$$ a0p Q,. .`.8.\0.$ a0ql A=P0,@$ @$.@Ѝ  $(,048<DG-4@ M;0@$P$8$0$$ QqA= aP,. .`.8.\0.$ a04p Q,@$ @$`$8$\0$$ a3p Q,. .`.8.\0.$ a3p Q,@$ @$`$8$\0$$ ad3p Q,. .`.8.\0.$ a 3p Q,@$ @$`$8$\0$$ a2p Q,. .`.8.\0.$ a2p Q,@$ @$`$8$\0$$ aT2p Q,. .`.8.\0.$ a2p Q,@$ @$`$8$\0$$ a1p Q,. .`.8.\0.$ a1p Q,@$ @$`$8$\0$$ aD1p Q,. .`.8.\0.$ a1p Q,@$ @$`$8$\0$$ a0p Q,. .`.80.\0.$a p0qP*0,@$ @$.@ЍD<840,($   -LM >H0@-@MP!0 Q8 #Ƞ 0 ^DЍ0 -(LM0`"x2K@P.K 0 8#X "U 0AM40 2K80 @8pK44 80 0X5@P&8 0 8#X40 U0@X(K -LM(j"x  @0 D "K@P.K @D0 8#X "U 0A]@2K80 40 P {@ 8@ 4@t8K0 40 8@40@0`V < < `5P8@ \ @ 8@ 4@U8K0 40 8 0 8#h40 V0P<00S<0 8@(K p-LMH`P,$H xhI -(LM"x` @P08#XU@ -(LM"x` @P08#XU@ -L MR`* p4K 0(8,< 0$4 40 0 [400 p###Ġ""H"TZ0@P `(K -L MR`* p4K 0(8,< 0$4 40 0 h400 p###Ġ""H"TZ0@P `(K -L MS`4 p4K0 0#0P 0(8,< 0$4 40 0 400 p###Ġ""H"TZ0@P `(K -L0C MS `B4K4 pb`B4K 0  (8,< 0$4 40 0 400 ###Ġ""H"T 0 @P 0 0#0Q0S`F0 8<, 0(4$ 4 00 400 ###Ġ""H"T0@P 0 0#0Q(KG-P0X\P@0T 0c|àE,80a5, ,E尕0q  A `&0`g`0D`&0& as1TE#@##0A$5 nP%0H P%0e as1#A#̠ #ğ0@@$@a 0L@$0 as1#a#̠ #ğ0`&```0P`&0& as1#<##0Q 4 n@$0T @$0d as1#Q#̠ #ß0PP%Pa0XP%0 as1#a#̠ #ß0`&```0\`&0& as1#8##0A3 nP% 0` P%0e as1#A#̠ #Ÿ0@@$@a$0d@$0 as1#a#̠ #|Ÿ0`&```(0h`&0& as1#4##0Q2@$ n,l0 p$ 0cgqA!Q!1!ĠA 00#0` \M`#U0 p0 0cr#|A" "pQ"40  .`40t .0. bs2##̠#(0Q1 A aP&8 x0P% 0c er#@"1"̠ A" 0 0#0a|< p# ` r |@"1p"̠"h@ 0#0l0`#&<&(&' 'Ƞ'p0 `ЍL?L?L?L!?G-0Pp8` <@ W0M tTᴕW< |0 0cr#E"805" "Et1  .c80x .0n bs2@ş#A4# #$( 0! @@$@b40t @$ b0$s2##̠#(0 Q4 .l0 p0p. 0c r#T"1"̠"T 0#0l0P#, l0 e 0cr#<ğ"4A" "4(0  @@$@a(0h @$0$ bs2##̠#(0a3 a`%$0d `& b0s2S## #$xS 0! .a 0` .0n bs24ß#Q(# $C#$ 0! PP%Pb0\ P%0% bs2##̠#(0 A2 l.0X .0 bs2Ÿ#A|# #$p 0! @$@a@0T @$0d bs20Ÿ#Q$# #$ 0! PP%Pb0P P%0% bs2##̠#(0 1 l@$ 0L @$0 bs2#x# #$l 0!, a0H ,0l bs2,#Q # #$ 0!PP%Pb0D P%0% bs2###(0A0 n,0@, a0s1@#( t #A#h 0! n < ( ,,H,T0 @PЍL!?L?L?L? - RL|M0 00@\0Lp ^ p0\L< 0^P`\ L 0 \L8 0^\ L 0 \PL4 0^\`L 0\L0 0\@`p `0P,(8( 0\0TP(($.8  .%<!...Gg0.,A.40 %.( %4,G0!,,, ,4l0a,( !q, %8!HgA0!!!!0$P!!4A0QX0 " "! "VA!< " "0 L < H 8 D 4 @ `` `d` VdX////////////X/<84P(\F($ 8 P0 0 l% (Ƞ $6$& *|aq !80` 0`0 5ap %D q%ȠPQ` P U*d*  0刀 P0!P "0%P@ pUqhE`QX APe " ` !0# ! "0#  d Xw////////(/////408t(,X*̠*(4<x ğ0 (4P !Q*D80h x@| pP !Pq#@4(h<@`  ,p q`Q<` lP 80&\p`t  "#`h0ß!$D0&|`@ q aQlt@0# ! " ! "X[3|#P\[ Q!Q[al#d3A0  0# "! 0  `\ 0  0 0  ` ^` <Kf\KfLKf(KP2"!Q[\[X[aQ|2|" ALH\2T"! DaA<2<",Ƞ=P[ 0 0# "!D=[LH1!!aQ1! ,Ġ A 0  0# "! 0  SHpa(8l 0D0XLP(($.H1  .%<!... Aa0.,A.40 %.( %4,@0!,,, ,40a,( !q, %8!`A0!!!!0hP!!4A0Q@0 " "! "@PA!< " "0 \ < X 8 T 4 P OL ?L?L ?L?G-M 0dğ 0@R$2.  B$,,$ ,8 1, ..4 4<.ğ0#. 0#,? H0죟  ܣ))a.4??0.Ƞ1 0.L? R!?! ?@q !8A?d @?0! 1?Ð 0 7  0@ 0#@##a0$4??0$Ƞ1 0$? !R?@! ?q !8?d ?0!  F1?Ð 0   7   X) "0  , "",$" !!1"! 8!8#8 !0##  2# " 0Ѝx|))a.4??0.Ƞ1 0.L? R!?! ?@q !8A?d @?0! 1?Ð 0 7  0p@t0#@##a0$4??0$Ƞ1 0$? !R?@! ?q !8?d ?0!  F1?Ð 0   7  H X)t3333UUUUL%? -L MP`@p TDXHL\4K 4P 0@ 40 0p0 P`#@#"#8"Ġ"0 (KG-M R? H0|t l))a.4??0.Ƞ1 0.L? R!?! ?@q !8A?d @?0! 1?Ð 0 7  0@ 0#@##a0$4??0$Ƞ1 0$? !R?@! ?q !8?d ?0!  F1?Ð 0   7  X)00 0 Ѝx|))a.4??0.Ƞ1 0.L? R!?! ?@q !8A?d @?0! 1?Ð 0 7  0p@t0#@##a0$4??0$Ƞ1 0$? !R?@! ?q !8?d ?0!  F1?Ð 0   7 H X)L%?$M0 QЍ5? 0-LM8@P :dP@ 0T88GlGl -2LM @Rp`0  @P0ČȌ̌!2,2! ) !0 #,# ,!T"0  ! ""4!4<$"00#"0#  ,8#4 0 0!0)!S0 -ቝ8 8 80( ር)# 3< 0(ˠ @0 <0S)v0 p0 @^ 4 (KT 0SQ/PM GlUUUUL-?-?5?MЍ5 -LMP@`pP DHL.$ . . Ƞ,Ƞ  D,, ,4..D, @.$ @$.`4PK p@$,8  4 0@  v 3 4080!0 0##$ 4# ""# !"!!" ! 2!26:0#`p8 P!@!4 ! $ 0 (K3333UUUUp@-0M `R# 0@Tڈ0 P 0 U 0S 00\P ЍpGlGlGlGl -LMh 0@C 0hcbr -LM00@0 00 @0@ , 0hLbr -LM T0P0@L 0H<@%0 ,80@%K@brfAbrgAbr -LMPPD h0SA 1p\ a 10 ^ 0S 010  \00 P à$L ` 0 0@0@ PfGlGlGl 0-LM< @080K0 @@P@  00$@ @0(K| -1L MQpP KL `@`` ,{$K( Kȫ0P,SU$0 $ 00$0`$ $@( $ (00(0$  00CS 0$ LdcGl -LM 0S000 0S "0#0!0#0 "0QR 000 0(KQRL l%00  0 p202(2h0 0,00S |Q0S$@PP0S@p,00a L ( Uء yP0 P0S@pP0 X 0@0(0@S ,>](L 㕾TL ㎾QR QR 0 P0 0S00 B0T1 ,0P` 0SP`0@0! 塍P0 000 $0 gA -LM -LM8,0, 0,#Q 000hx -LMpH4Q P0 0S Q ֹPm` []3#@0CX@@ 0C@M] 00@!0 3PRlP 000 N RZ <Q4H3  完P0 ;Z  00 00<  @010Y 0 S 0 000 0 00 000$  (0100" 04`@ 00@8PP Y 0 S 0,@ rP0  ,2 P!0(K 0 000 0S <0 \ 00 0 00S Z D0D0 0!000S *32C0bt!10 @ 0S P0  ,@000100@0!0 00 ?00S00S00 , R0 Q 0 倌P0 Q 0D v0 0 S Y 00 0 00 0ct \ h X $0GlGl gAx -LxMlsd, ^@$2 H3^ @3^ , 0 R(K3^ 1C^@P )P  0S,0,0,0+0+0)0)0)0)0)0)0+0+0)0)0)0+0)0)0)0)0+0*0 b0StPK$P@K[$[VL  0t0 p 0R0R-*hP p0Q<[hL 㓼DP L0Q/[DL ㆼLaHaDa@a0>0>0@0P K Wp 4@TWP 00   <K V! 01S !<0K 0S ("(K<K 0 `K  P  0 V  `R1P 8#81  0!dfV!K  1 PR`@e0fT@Q 0N0! 1 `A  0S !<K1 RTP! ("(K  P9   0&1 PU6@e T @\P 1  0P 0( "(K 1  5V! 0 M!  0Q00CS V <(4"4!<1 1(< 4!4 <1 "(K |@KK$\ D U\ 1 <0K 0IQ<Kvu1<K  U!<0K EM 0?M <0K)Q0lGl6? -LM@ \,  `G PK  UYA 0 pW  0 =0SY( 1lKD UP, 0RM(K #,10S. 0S lK$ yUlK  lK$Y  l0KPp 0 KQp   0S   Q ("( lK$lK$0l6? -L\M,ɟ| |@, `x p៱PPxW 0l W x0# b1#  @ 0@^Ѝ 0-@LMP X 0#40 "( 00  0#40 "( 0087? -(0 $ , 08 40<M 00ЍMЍN -LM@z 'O02 -LMT4PK0` p$0 O 4[  Z 0R300%0[0%0K–\@ 4[  X 0R300%0[0%0K 0Q1 0Q11 0#P1@1!@0#T1 zWM$ 0R2 K1 0#P1  0R300%0[x 000#%0K  0R300%0[x 000#%0K0l7? -LMp`P@~Vz_1 0#P1`F V@  ṫb0`R1!~ ௫20VS  21!0#P1z_ `h@M ЍMЍ< -LDM⬀0dPK`$0 p@M!M@0\0#0@@T1  D0,Pᱥ ?`3UL20 R02 0 P\V L#0S0 P| VH0S0X0S@0 D4 0 0 0O44p'X T D<0O ȟ T X K /@@0@Y<0 8@ WQ D00O4 p"XI<WF80@ Z D0 P@D0 0t Mt0H 0 ? SELRB0T R800  0$5@ 0p RT001Tx?>   cp i  0S0X d @JTb001^ pQ?>   cpG C  0`0CW^ Bb   R 41Q 0110l1X140`1$ő\ 1 0R 02S\0 P3Ѝ 1 >0   r  R 14 01 -L(ML P  p ?ᚥ0OO^P`1`>PP 0  BSPaeL P08`0?>   cpH 02ᠢ0!"GPP0` p2RPL `08?>   c 02P!0GPP| 00`1ɯ H D QP,0S PQL 08 bS1<0 10 !1!80 P04 00@0 h1@ PoQPP `0Oς  1>0PO>p@P` Q <08 \4 0S. 48  0 S ^0D 0O QH  RL  0|  ?(KPL,0p S0QJ 0L 0 U Kl9?9?jAjAiAiA -LM ,  @_ 0h<  0b8  ?n40 0V`0 p ϡD 0<P<08@0\ BQLT8 ABQ4 CBĘ00UPT@!4 V@ ᰤx@0PQ`008ౡP`1`#Z 0婡V`!DV`YL#20T 0U04 RH3 VHYD0SJL#20T 0U 04 RH3 Vt\AZD0YL20 <@TD!D`02 0<\Y YPL20 <0SD@2 0<` BVPZ0(K008`=~8e,@T0 PL#20 P\0<`V08`V PT PL#^0<@T08`V P P  -L`MD@ 5 Qp@ D @`004 40 0@@DP(0PpǏtP Dt8@ ?@d_< 8 D <@`4!8P a, QU.QU14P1D 80@Q< 8 @ D0DP @ ?  b<@. _@Pp@ȟP `8 Q < @( D@<`08Q SPQ C` 0Ţ@0 \3R 2@0D0 0PH0 Z= 0h d D娀ȟ 0`DPhK ? 0 <,,p0 l@  @ 0l@ 咢D ` 0 F.pKP֢ ȟ0),D@ ?xH 00C0@00 2R@P@@T0T!00C0D00@0 0<K(KD ɯ 0t P@ `P D0O  \  %` D0| x \ < `@ /P L  ?@0PK0@x X0 T@  x |K 0O R  0O XpK\`P , popD @0PX @0  H 0 DQ0O\P PpK`P, <PU T -L M0 @00_Bd @PR 0 b4Q0 RPQB $K b@P $<D 0S 3SK]$~]U -LM p`,8 Sh#4 4 P0 @ !DP0O0@\1 aR\0?00S:@+ (1R\0?0: 0  00 T 0@5 ;0 @4D40L#80* 0 R0 0^(K 0p =S \   B ?>0S @3CL#420C2 0 T1lU ljAjA8jAMЍ| -LLM` < 0pSPo0@0T<Z8Po0LO P` 0OVʲ <@<4 S?0 @<`40 P8 'D0O0@< ?9<`00p S 0<'8S`0`0`QωX 0 !00`H  D0 D@40R@0 < 0 R,6@^`0?0 0,p0P`W $ 4 $ < b4 D0@4 DL# 00 06<Q`0 80/0cQH0D@@ P0<P0 P1004 R!L \%2R> `2^ 4P1/0 L@040  B ; 0@4DD@L#0 0 Q0C0q 8}[VQY0H 4 K KYG4NP@ L 0x @ 0Ox4K0@/TʲSt0PpH 0(0<0 哛 P  oPOP`l@傛`0d/ , l1 \00.QP<PPe]0 `D?x D0R @b_Px PRLx00x0i   ?> 0@3CL#D000|4\ P10  YH0 0( T1lU 0mAkATkAkA -L(MD H HPAP(KDH P0 D P4 $h0U 0 S 0S P@Q0N 0R P30)Y02SQ0 @_ 0 @@  UAO>@P `P L  Q  P 0@8 S 0R  0P  PU 4P0O0@`0H  `Yp 0@_D0 0YT P8Q800cO  vU80pY0Y %T1lkA -L4M P `PLL PPX T0 00S  P PH D^U #0O0@00S T08U ZO 04 R40 p F0SFp W^ X K HD @ 8 Z?ᷜ `4 0 4 K 1>0 108\` 2Rψ0O4K` 0@1 >00SX 0D @0 T Z p X K pQ< 8 }Z 0 #0P @` ^$  j$ 4 D0S@4 DL0L# 00j 040Z0C40  j! 400400P<@K0AH&YD@ @P DK(K 0D @0 HW@0D0 @@ $0 j0$0/4 D0@4 DLL# 00 040H040XX K H;D @ HXHlT1lU -LM pL< @ TdQ PD @0 W^D0K  0O8 D@@Po 0OT0 ?<  P8 7 "DP0O0@ DK?ᶛT0`pP3Y40 * Q$ 2/P`0 0O0@1>0 0 R#A8W 0D @0 S 0D @0 DK(K800@dYn \^ 1/X`0 0O0@1>0 AR!4 \ `! 400C40 i! 40040T0 RY3 1> 020$  B$ 4 D 0@4 D<0L# 0 ^0C 0  0Rυ0O0` @1 >008 X4@ d! 400C4040 c! 400C40T1lU -LM0<0 00 @P4P @ß 0|n (Kj  V ,0P* 04 00  V H#0S0C0ß4 K 0P`p80 < L00Pl0p 0 R RPn 0   R P 0P`08 H` 0 Rl 0  P  00d0X0 0 QN 0P R R QK 0P  P  Q9 0P  r 3R QM @[P 0 Q P0S st0P0q 04 00 {H#0S00}j ^ l0S sX0l0U0h R 0l  r 30l R 0l  l  0 Bh  0h Po}@Q[l 0 0 (08 (4n9?tlAkAlA0PlAlA8lA -LM $5S. @pd`  t x02 f V@ SQS K l@0@ P 写  10Ptpx7 K X\\v\ (K^8KK|0K=!P0K Po0@@  @SPQP#00d0  c6 0SQxd "t 80O`p X_004K n YP' 0 S@P0(0SK 0TH K@000KXP00 D0@_0 ^0"V4lT4V40D00 f0@000 R0`0Kl -LM $5S. @pd`  t x02 f V@ SQS K l@0@ P d  10Ptpx7 K X\\T\ (K^8KK|0K P0K Po0@@  @SPQP#00d0 c6 0SQxd "t 80O`p X[004K n WP)  R @P0p0SG 0_SD K@000KWP00 D00  Z0T4DS4T40D00 Z(@000 R`0Kl@0M R 0  0S ЍЍЍKl M-L8M00X S@000 0X0 SL  `3Qt 0a0S QARQ< D?@Ğ@c.d 0P%0@0S@TX 0 Ry X1 0ppi @T LX000K  FWPD 0P R000 PD(K00 8 b4ɯT P0 X  0(PD L@ ?ۖ @P 0XPH@ +@ < N X 0 R X0 0 0 @0@X@0\00 L<@d0@s c>rc0 StqQP @X  0W(0 ! (pǏSvPD  L@ß 0\D {L@<4 Sʳ L RLd <@D4@D_@Ĝ0e.L@b 40`S L00ßH X@Q8 4 Xa X 0 VX@ 0 R X 0 0 @0@X0Q00 L 4@d08# c::lA@n9?XmAkAlmA0mA 0 R5 00@0@000 (K#3 nP 0@ 0]P84S 0 ?S h00h0P  0&0Ln9?XmAkAlmA -LFM P 8%@  8?0h1R 0  P4 UR00 0a QUQY00 @QP Pb0b1re R1nQW@Y0f00Y{0K 0KP Q000C!00  0PP ؠ  `Kܠ  pK 004@K@TP `4 D01 0Q0 0@0 ,P P+ @0P@K0  @PP @@K00 00 S8 d0# c4! 0S#Qx d03t08 D8>580<8QP \2(K0 0S!0 0 0 4Qp00P @ @b b3a R`QR\: P0`p 0P0@K@ `uP 3 \" @00 @@ySP4 00V8`Р<0d @2 b01 R2Q4x0d @02t0Z40 0!@0K! p0t@1@@ (KW'  0 0S1   00@@0 @ ^B:EN PT2 S1PSA0@%85L000Z  Z R p 0 Р@K0 P0@ P'P P0@# c4! 0S#QP P030n@0K! p0t@ R 0 PX4Pp Op0a0C   V|@z XQ10tp   Р0P 0@ @b b3a R`QVR   Q  @00 @JSP : N70S*@@5L 0`UP帠85@L 0 0p`VO ^ 00 "SP  08`4N 0`KQS / P0 0ԠZ0 Z y\K 2 Yrd \ P l x0 t A2 oSQS 0᪒0 0O$1 A 0@1 A  ȟ%,AP h @!_0@Pp@ PZ^4\^JO 0 @@@Q4 ,0 OPԠPEZP AP  @00PPPQ4 ,0,0;,04N,0;,04N\0@   00PS 2K@00Q4 ,0P;,04M00@S!Q"@P00`@KР00\PU To0 #00S@0@   00 C*1000 @ 1@0 @g  Р@K0 0 KP @`K`` \p K@00@@OQ4 d0# c6! 0S#Qx d03t04 D8240<@42OP Q `p000ؠXK Ԡ @t Vp 0 P0@@K P2P 408D|240<j0  @K0 P0@ PP  ^@@K00 00 P8 d0# c4! 0S#Qx d03t0y80 000(K20 ! 0d 4Nc `@"(PK@00D4KaQPc40 D! 0@4N LCpsmAmAL Q<   @8K00 >Q@P<80 0+dgР00 rP8 d0# c4! 0S#Qx d03t08 8D180< 00 @XK00`@K 4N @K808D180 < }8L@ T* -LM P8%@  =0h1 0 R P4 UR00 0a QUQY00 @P @ Pb@ 0b1re R1nQW@jY0N00YfڠpK8K 0MP  08  B8 X`V# 0  PK0  @@ `000KPP 00D @8!\@_M R   @K0@ 0 @P @@K0@ 00O4 d0# c4! 0S#Qx d03t04 D8140<4MP ?Q00S `LA 0vMpR[@ @^@K0@_ 0 PUP n P@@K0@` 00 UO4 d0# c4! 0S#Qx d03t0f40 @0(K 20p 0aR 0.M(KW-ʸ  0 0S0 _ 0000 @ 00@@0 @ ^B0 0BRS> 0 P 00DS1 R4P 0L0( 0OT \&0h R"P00  (p, 0 Rd 0@0@0 00 P(K@QTP PPQK @@0<0@@,00@408@ DP 0 S2 0< 8! @!81Rʈ QK $85D01  0 R} 0Q_K`P`0`,a 0OP 0Q_K`@0@3b b\ R`TnQT2(a $1 J/K 0! 1 >K   L H t0 OQ oD @ Q < 8 ,ApKD `@ \u 00L0KP0pt S{N~`FP` 0P@``^ 0 \ 10p A0V\ ! 0@p0t@00 0&DA0 !A `gPP@0A#O 1"1?0P HA`p-8MPP`$ P P 0 r3Ѝp1>0 R! "A@e0 0@A0#O 1#"1?0P01 FA` -L(M p8 P@0 7\ lQRl \D R^Q V4 #80008000K4 EPP@00Q88 085D 0 @00 (K0.A( 0 0S<0 & 0L H 00@@,D^3*.H RL0Q<8 Q0085@0L 0 U0L H MЍMЍMЍMЍMЍ -LMhnA\5`` MSS 0 RD0Rh0 S8PЍ0!RTTcKlC-0 LS03Q% 5p00P5,5 MS ڬ4S9Ӭ4հ4S@0Ӱ4 Ѝ0t0/Oq,,REQ `PNo,P`PLH0` 0`O/0U4e85804 \/4 0\40 j Pod0p8 H4LDP`, l5. 0\#Q0*C @ D/< RA00P000 804 \0 R 0(Kd TS b5 @l8  `\h0^Q^,@@@B @044DPDh L5DsP5,5S8 0054E<0S x>@0P0 SH 00RT1l@-0` SM@T,0 T:FЍЍ@ -LPMH D D@@ TL0 @PHp``)LP@(@`$40K`PP# L0<$h0= W40 ጐ400 4 0`p PP 4_U (KPL@ HK0O<0 8@  0w0P 0Opt0 p@ @_ 0T P0 p 0O\0 X@ tPT@tX.. \5TP a"t` pp p@d ` d@K0pp t`K@P< K HKd@ `P Fx `?9`0. n3 ^,Qd0KdP % e1 0 U,Q0K0BPPN 0 RX  )x @?HK00#D 0:>0@40K qPP5 0 Q$ 0P  r 3R QW @CP 0 RF P0S? s= 40L $000\%01R( 40L0J0l  r 34c]0=L@``=4[]Lp007x @?HK00$D,㪀,5Sʰ 0p00t00P0 l0S s0l0@ClnAKldrPrAKl(drtLlTtcr -LM``D -pRP =S>X@ P]0PDpPP-:L3P#L3P#h |h0 S0 ,0;,00:(5`(0/ O,P  40@{PD L080p ` 00 D|0980D`\ pD0\4 0f0PH4LD/d  `1, 0P#Q0@K0H@Q>P 09r{5$%R ,0PS$% ,0SP0K 8@ K<0 8@ @ 4 RRH  L0oAP1 -L(M8@pTY$K ZP@ 0 =VPZ0 D D?{ 08 4 8O  8$"0@@0 <@ @_@P@ K D@P{x{`0d  , l1. @\$Q00 ,K=@P00xz0,0 D |0 0 0 R0000000,79XoA -LMT `RKh , pMP0$S5%0S' Q ` @P! 0S,06,0媾Y0Sq8P Xh 0S" 0 RᓾP=h `R YIhFx00S $0 u Q01q0pApA -LLM` `X ` \  PD 匐P \00S S S X0@0 UT  45 S:05S*P(K\XD 40K@pPP 0X R8 p 0h d D  <  PH , 0L0 > 7Z 0jSXj Z\XRQvVT 000X <D @a@P0T@lPPu<PoTP0 0Sf45 R 0 0S 0 $'C0t03U0S000X P TX850 p0P0 0cS0!S@0 PHH`H H 0H 000K  @0PP@0 X 0R* 00QRZ 0 0 RO 0\L |D X @0D0$70V700PD 00 Uj 0 \ 0pT00P @@b b3a R`QVRTUR\0T0  85@0L 0G0pP500 D 0 R 00X 0 @ 0 \r 00"X  R R \X@0y 0 TC P045X80P*` 0S 0S 0;0X8 R U D(X400X0\0 L\Cj0 X8Q< R 0 X0PU P` @<0hK@ X08 0`@Q X0  0d d  R X0h d 00q0 j\pAMl P@; ,p0\D K08@haP0 `ph@P ,L0( R10[20[S #[0R8 0R R N,08L ,0K@P , T ,QN$K@ ,@ps..lpA -LML0(\;;D]00s^80s[<0sXqq00ss|<0sik0sp -LMp   0@0@0 * 00 0S00p00 0 0 R00t000 0 R00(0p0X0 0 Rf 0 $0 0 Rf 0 , 00 0 R000D040 0 Rd 0( 8 <0 0 R000@0@0 0 RO 00 D H0 0 R00$0H0L0 0 R00d0X0T0 0 R00l0P0P000S:(0 SL084 (0(  0 R 0 dkT\P``0 \0d0h@0 $0 0 R0 ? h0OdkT0 ?0 ? -LM80S 0-LM^ P 00S \ R 1S1  01S  RZ(@\@ 0@@"80808 -LM0 p ` P4S0@PQ@T@a 0 PP (K0S00Pj\@4S@S 0 PP@ -LM @p0S Q#4 GPA(P\4倢 0$ 00K4 P1(0\00aDPQ8 8000   40* 0 R0$ 10C10(K  =<-0S$0U  =rA0<0:0806(兑gPe.,0l0 '``  40 <0P` P(Kf8   84 0<0 PP   4 0<0`P P  8<04P0 P -L(M` p@ PZf ^ 3: @g `@ PpK 0-@MLP  0Pi 0Pa 0PYxx 0PQ` 0TP@HDD0*0<0 K0@5l\zAirdzA,irpzAxhr|zAgrzAgrlhrX=?MP ,,0 S 0PЍSP ,0 S 0 S00:S -LM !Q 1S 01 0AS 10 ! 10A0zA{A -LM !Q04{A p-LM@ !ƌ\`"S  QP P 0 t- `x Q0S  0  0 00`x廟 幟巟X{A{Ax{A -LM@`$0 0b#6<@ SpTQ&0@ P P;-TP\P<@0!PR00R0S0 !P !-\ -LMP!ƌ@ 0C 0S0 !h2d{A -LM`@VP`PVp$4 0SPP 00 0A S 10  ! 1 A 00CS0 UX01SZP `FfU -LM@b 5P  0R000 00 0 p-LM"f@P  00b0fS 0S 000  x{A{A -L M@p0 0P00 a@T; 0S"4PU(0 ( 0Fe0P 0P(K :0A0C0 ( Q ':00000 PP  0W>PF0 厞T|A\|A |A -RLMP@ᵖPP) $F%6@e40p0!a @ ppf b4PP@ 0 0!"< R$0(0$ (PjrHkr -LM@b 4 0@sb 4hݔjr 0-LM0@1$ R(0(0(0  R 0 P 0S P 0PS0!P 0S 0CS0K0PS0008h8h|A -P1L\M@`TPpF pXK4K℠K( 4@ 0 (0$Q` $ `0K((0$0^\0 $ ^0 !0SU000 0Rp0 P ^4`Q00@(000`Q\0(00P0W0\ S(KlHkr 0-)TK  0^T08(0 HS8(8))TK !0I000 6@o 10 189  0TK45@]#S8zPO)(0GC TK 0S8/((|shmrnA~A~Aps0A$A AqA~ATK`P@@Y00SVI8(8(0 R8(V@@P 0<cHP T  TK0RU((0 9 !(0 -QLM`pP#*@JV  0P T   @- 6(@004@ 5(@80<@ 3(@ 0$@ 1(@(0,@( 0(6@MP0T@Ѝhmr 0M ЍЍeps -LM KP_L0#&R* K0R*0a"!B10bs|r -(1LM@T< Pp`D0! R"Q )00CS ꐒ2@2@2\2\22P p p0R*QP 0p Q*QpP@TV \0 RUQ <0h<0`@TpOlhmr -LM@<0<0 -$0LM@H*=0H1Nl 0-LMXX0X P@h0*L @@P@P K0OlNlnr.  . QM:Ѝ Ѝ -L΂n^P`MUp*S N@ Pe10,0 h  hsNl.  . QM :ЍЍ -L,MD .  ^P U@ p#: (K  P e!fV<  @0K 0 0S0R*@VX 0 ?PP  @TF (1<P  18@K0@ 8 4@ `(P)8 R @Q00040 0J8 8 R|@ e@D P <0<*0$< G 00VlNls -@LM`PN`@ R @ppT .0 > @  Nl -0L M R( 0+ KK *,'k1!/}X0@$ HH 80@$ ?H KhmrlrNlD0l<A -L(MH D Xa 0H#Y*qZp1H`00X<0 N J$J>00>0Sp1x# Z00 W0~Sp8  Wz3X@3 < 00K D*P 0d0S0!H @0 ^>` Z 08PK@ 08@ 4P @ MZ@0cX@ (KNl -LM0`SpP6 0SA0SR8KP80 4 $*@0Kd P P0!&R*<g0R*0`"!B1 b 0 04  404 JU l  W'0 0S(K0O@e 0`S00e O ,)$B 0 0S s|rXA(or>00M  Ѝ -L,MD  pDL 8KT8 4 @ 0 SRSD 0 S: 0R  4< \= \: gP`0K @ <00  00 0P!8@0pT 8 `>0:00 @T D `\ 0 80:00 @Th 8K&(KHA3e0S 001@ Q0S 0Se8K&0C! S0 0 0 h0Q @ T00 OdD 0D `S  D0RV@ "f D0 8K` _&PS xAs(or0`~0^p@0P 0` `P @mP 000 T 0 00 0P  K0 '@P   ''AAA p-LM1P 0 @|`|0 h 0 `0R0 P b 0 K@P0 P 0`Kpׅnnrs'NlHA p-PLMP*@ `Kt UP ` 0#&R*L庅0R*0a"!B10b 4&JUKps|rxA -0QLM@ 00SD00D0p@-x|0M\ @!@1Q$ \ 1 !R`#`3P Q#3Q030 "SaP^ Q0#02SQ#3T0#0 2S%ЍpMP 0 S(0$ ,00\:PЍ -LM`$@0@PS:b V@cp V:EE f@U>0e S 0SR F@5U0P@0F\2 lU" R!0e S9A U R0ST0l0U 0SS1:Q0P@U 00b S9R R0e SYD0S0e SI9@0MS,  `0R 1P `0R 1Ѝ -LM@P`@T `0P -0QLM@ 00SD00D0h0@-D0DMQ Ѝ0$@ 0TT0ST0SH H0RL L0RP P0RX X0R 0 00R 040c@P4@PP80S@Q 0S@ R 0S 0-LM @PP D0 0U:$0U#388< MP00P0Ѝ- QM&:0@3 8P 0Q:0Q:(0Q*00Q:40Q:<P 0 R 0Q:0Q:^Ѝ,0Q*LP 0Q:0Q: 0 Q:Lr$0(MЍ0@-P Q0#03 P 0S @M@1 Q#3PQ8Q 0T # 3P R0T # 3S RLQ T0#03P0S T0#03R0S<Q 0T # 3P R0T # 3S R\004T # 3P R0T#3S(P T # 3 Q ,RT0#03\0S Ѝ0Lr-$ (,(0 RM:,0\3:00R:40\3:Ѝ0M00Ѝ -LMpPU/ 0S,`@T1 T R& @TP @0 Q 0` m0S0@  0S@@@`_P [PU 0 00p 0 0  R P; X> P@0T 0` @:0S0P  0SPPP`,P (0SP0!0S0p  0SppP@P0Pp0p 0 0 z0S@00S0p  0TppPP@p -LMp` R 0SPU 0SY0 0`R 0S0S @TP R0 0@ T`@0S0P  0SPP`PP@@ PRi Q 0S R 0S 0R 00  S`00S0@  0S@@@`9R 0S0Q 0@ o0S0P  0SPPP@aP^@ 0R 00  S`0P0S0@  0S@@@`BP? R 0 00 0@ T`@00S0P  0SPP`P"P@y R 0S0P 0@ P 0S0P  0SPPP@P@ ` -LMpPW8 @TD@0Sp`W`V p 0Spp U`P@ 0U@@ 0R@@V @@TX  p`W `Vp 0Spp` 0-LMP@P" #3Q R  0 S R0P 0  Q@@}880 0@8MP  S P 0S0#03 PЍ MP0SЍP 0S 0S P 0-LM @PP'$ Q00R03SQ PD0$ T(0, 00\ H00SP 0T88 -LMPp@` 0!S8@ T- P $ (0,0 0S*:@@P` $ 0S X:W WP 80P L0P rV@ P@ AP @Lr MP0SЍP 0S 0S PMPQ00SЍ p-LM P$` UZ3@<bLx0M00ЍЍE0M ЍЍ -LM0 @h0M ЍЍ -LM0@  Ap3P 0000M ЍЍ0M ЍЍ M-LM8 080` P @xh 10 Sp!z3S0CD  _0 0 K40K4 PPFY`+0PU (0$ 0TI*,Q $ (0g (0R,T:00R4T*P* 0@P@T :0vP0  ` V(K0g00T0@ 0 K40K4 PP  >80`@y zK0 0P `$0T* 0 s 0-LM0@P!HP 0! 000 E00008?? -QL$M< @0 8  0Q:$0R0 0(K *8 < 0PZD0 D0$Z(0, 00Q 0ZU Z 0 D0@004 40 Xk @ h P2 Rd $0<`Z p1p!Q`!V< D ( lD@P PU @ 00CS2222220S]40S0QO jW ~$0 Z p1p!4 R @0 L0 D0<pl ^0l 0l04P`@p4@ 0A0 P 0 nP Z 8 L[$0Z p1p!8 B0 O8 ;000 H(0  t00S Da500CS0000 OlA -LM @T0000<~Э޸A -LM` PP1 @5 T p* tU $0R P@T,(0, 00,000  0@@ 0-L$M 0@RPP x}0S PK0$0( ,0 0 $ (,@ @}ЭЀAA -LMh (0t@RA>00 p-LM@`P$ 0 q= UxPP+  @PP@ 0/B000cStPPP@H0/B000cS 0x$ꈁAAȁAAVUUU܁AAA -pML`8@0P(,0!0 @04 0P@V (0 .P) \ K& Q QA ,(01 !0B@@0S!0S W@T mP5P W|p \@XLA(??A,AdAAHAAnrAAhAAAȃAnrAȂA -L M䒟p`$0 , (, 04 0 |$0@"Z78X 0s@P4K08"c{P< 0eU@ 0L], 0Rq(KP`d pt x| Z  PP 0 $04@ <@X@H0D0L  P0FT0T  XF T F0T0D(0$D ,FT@PF T `D0FT T  0lPPnL]S0lA A0ATA|ABAAAȄAAA APAAȅAAA ?? 0- LM0 \0\0\ 0d R@P 0xPth 0`dP@tL 0Dd@t(/nK0h>nrn@5l$Ar,APr4Ar -Z%ZLMUp`e    < @$0X+*@0(PS$@d,P  << D05 0P004 48 ,0S      o(P$$ bP!  b `h0@,408@0 dPtu00LMe :T$8 -LM\0@  DhZp8hVpR((\ P1\@0CP1hQrPrnrhmr p-LM01PU yR`P\@T P10P1\Q0\0T0000x0 P q@P \P 0 ]@Pd0. d0d0S0?>?(>?xp OlArA -LMPQ`p0P  ?0 V3 0@U@2 $(0, 00Q\ TP ,0S(0 S$ :(0` '0 R00S 0@(1 V ,000f,0 `YU 0 D(KT 0 ;M@ P f0,408@@ `$`( 0 D L H P T X < 0  0Q 0f S :j(0(0Lr 0-LM@P XP $ ,0PfPK0 -LM@P`] (P,`0p4m -LMt@|0(x`Pp!p1PP1P!\  0`K,0 S00S40S -LMP@pᤀ'0 0JS`!`1 P;P ,0T$0( $ R 11S63bS$i}Lr -LM$0  K p-L*"*MR@` 00 P 0 080<0@0D0H0L00,0(04000 $`l@d0H00AP 0 xxh w܆AlhrA -LM`p PPc` 0@ -LM@QP`p @0S@0A0 0P0@ -L Mp ,@Po 0`0 Kr -LMPpU0@`0 U (0$ ,0 0S PP / $(040 ,0  .  00\ 0@0 U v 4 0 0 0 (K $ X00R0S@ -LMP`Qp < @  T 6 | 0 Kih p-LMP`@ 0KphX -SLMpQ 0$ Q`!`1\ P1P!V: @P $0V* 0V  0  X@P 0U$0U* -SLMpQ 0$ Q`!`1\ P1P!V: d Q$0@V$* 0VTP@P 0U $0U* tP@P  ?t@ -LM$P\@`p:\: 0Q:R*@K $ KP@$  $ 0T$0V :Q 0S @ ` +$ $$0S00S@0SD0 0D0$ @0p$ 48 000 -. ^NP@L MU`P@O 0U@3K:$0TG0P $pU@*D0=P 0T C 0TAD0;$T,0( 00S1 P$0T'Z, T0S 0UHT0S $0T<: 0@<@@$K@  q@ LT0S 0U T0S $0T : 0^@ y t I D -QLM` 0$ Q!1\ P1P!Z#: (K " $0@ZlTu 0U  U$0R D0[L00S]?P 0U X10SW Z:U?:0SH   L`H H`R D0T0ST0 $ 0 T p00V00S3 @P( U%$R D00HpSW Z $U* @ | L0S $ 0P  -LM`$ Rp1 p!Q@!@1T40 :(K k$0PS  Y RO 0TO0U00 : 0W7y3'D0 0S0P  0@ 00S$ D0$0  0a c 0 K40X 0PW $ R 00S W* ]D0 $ h@@`h@^P ! p-LM0`0CS0Kp$PK $ @0$@ P @qE  -LM@PTp`#)@P 0$ < c"&0PD0 000S R0000 0 c@T V ;0 -L MpP,`K @,@ (` E  K -L M0pPA PL8080P@<P`U<`@L @,PKTL`,` (P ' `( 0 (@(0 P 00(00( ( P 00(00( ( @T X X V00 KsA -LMP0@0CSP0 h3jr -LMp<@4K4 0 PPX8 `   08<  (K  0 0$ 0 0tX`:#: S ,0``80 0$`  O -L@M,PK`p ,@ (P  0I 4 K -LM@0 $`< ( 8 ,0\p 40 ^ @0P 000 @0408@ DPTP 4804 P300@ >0>009hmr -LM ʠ,ʠ\ 0R lR >0. R 0^  0iP  K 0-LM@ʠ,ʠ\ 0^+ @l^ >0^ 0T.Ơ0 H R P (4d 6R0  0/P K0`0S*#hmr -LM  -LMQ 00 (` P00 P00S#@-Mʠ,ʠ\ 0R lR >0. R 0^ T33333d3p3Ѝ  0Ѝ@  0Ѝ@  0Ѝ@-M0 #! 0S  ʠS,ʠ\ 0R lR >0. R 0Q  0 0ЍЍ@-Mʠ,ʠ\ 0R lR >0. R 0^  0Ѝ@Ѝ -LM ^0  Kʠ,ʠ\ 0R lR >0. R 0Q  0 -LM@ ʠ,ʠ\ 0R @lR >0. R 0T`V0TK p  0SP S(PK0@ (@ $P @V A -LM00  0 0 0 SpP 0 dd`V`0`0S0 Z > SW UU )YN>0^PUK  i:#:SD0QA0S>l3Q;0  C r600 p  h0(!6@ Q 0@T; p@@(1 `0K0@P0000 R  JZ  0U@(K 0@pW P P @  0S  @S @$ 00SS@@ S R1S``/ 0 5   @ S S x0 P700 z u S0`  XʽW@0 k0K0!@P 0P 0S  @ nj 0CZ p@ O묠 p0 V -L0ML X L T J$JT0H >0 Z@ *2 P0< 80 ]< zP P 8 T XH< 0P8 O8 TT 0 KPw 0P. 0@ R*P00@$ QSf 0Rc:D0@Y!0040 . 0 4 0 R( Y0 Y00P0  0@Q TwL X< rPH< /P 8(KP @ YD  YD 0R0 0 < aP 0S0040S 0S004 @4` @dP _P00 T1L X< , 080 8  -LM`@04 SpP (K 00Q0 KPP40@0S 0 4K FPP4000 R 00CS 00I000 40@SP E4 0M 00Ѝ M-LM0Z0  (KYzpP` 0:p@ Q P`ZY M-LlM00S@ | #0Qx0 pt a p`K Kx\@ 0 剝0 0  00K 0  0 Pt <0Q*@@\ (0 ( h0@\\P@WP  000000  0@Qx 00 Rx OF#J60 K`t(K0@-PM@ R( 0S%\ * \ ^ \A 00\0 S 0  0S  R 00Ѝ00@00 R P, R/ 0\00 S 0  0S   0S 0P@ 0S@ @0  @0@000S 00S0@ 0\@ @  @0@-M R 0S ^ 0Sl0 0R 0SI0SD \   R00  \0S0  0S    R) ^ 0Sn R 0S 0R00S 00 S0 0S    R 00Ѝ000 \0 S0  0S  R 0S@0T00 S @0  0 S  0R0 0S00 S0 0S    R R 0S P0U00 S P0@  0 S  @ x -LMpX5 PU?P0S `X`V 0S @ W`RP 0WP P 0RPPV 00SZ   `X `V 0S ` MP0SЍP 0S 0S P MP 0SЍP 0S 0S PMPQ0 0SЍ0- @0 SMЍ0 UTR p-LM@PT `P`@ @T@x 0-LM@PT P@ @T8 p-LM@`TP@P  R0T 0@ PP P@x0@0@ @PMЍMЍ -LXMD @ dK Kp@-l0 P0UM#F"``D 0T !P01Rb`0^ЍpOl|r 0-LM00@S(0P PR0 00 0  (00C0(0 00 0000008  R 000( 00C0 R 0  0 hmrnr 0-@LMP(8h -LM@(h -LM(0@ & R4 000( w 00C000S(0 R0000 0| 00  0@@ RH0 0 (>$ $00000 hmrnr -LM000CS00@008@0 (000 00C 0nrhmr -LM@PP`p (00C0, 0 0, U ,00,0 `$pP( 000 0-LM(0@ R 000  0( 00C0(0&0   @@(P`0   F(0 D0 8h80  @ @nrhmr -LMr\R2$ RP@L0R P U3 @0Q  Q*60 0 0R0 4 R0B60  B0CR0 \4 `LV`@DPV 0 SAP!@P@ 0R:P UIc\ `LV`@DPVʹ|6c60 0 R \ `LU`@DPVOlnr|rAA -LMhP \0*0  0P 0@ 0P bhmr0n`0gV@P0U->0 N@ U (`KP& (J U` K0>0 0U #a!a$Ol(xp,xpLrsHAtAA -錒L M™4 @0 0  0 @@<^ p80 0b\0 "6!v21C!@cv `ᮖ0SG 0PcW@"#<:21CcT F0 U` ` T 0P08@0D0H0L0 R 0S0!% 0%0" 0%^0 c21C cl0S 0pePcUg` 00 >0>00 04 >00<0h 0 P00C $ (0 0, `\0T(XL(K,r`nrOlr5|rhmrA(xp or,xp OlȊA 0-LM@\ $0X(P 8hNQ(PA (PC A000A -L(MŸ`@0@VPU< 8 @0 /<0@PPOTF` 1@ ?S,) Z 0s ,0 S(0 SH1H!hD0Q>P`4@K  0 @4 0@ PKP @(KR0D0Q Po0RO 0@VUp%4@@ < K gV (@0 Q(S 2qhmrx1qpsnrnr6q -LM0.`p0@K 0@,@  0 0@T P000(H R000,0  0  0 0@PT$KVl p-LMP(4@` T` (@uVn00C0, 0 0, xT?(`A AQ0 x10  Ǡ00C0( BQG 000Ȍ00C000S 0  00C 0 R0ƌ00-& $0S0 (x0S (0``x(`00C0, ( @, Q 0  0 hmrnry` Ol -LMQ&P`  pW& |(0Z`VP @0Ds(0 _$(0 (`VP !( -L MP4KS8 4P 0 :  .0 P4@T( 6P` P ` 8}000pH({ R00000  0  084@T(Kd^A 0-P0PPLM@|090 0P Ed0 $0dE@d#8h9S3 or -LM`\p/@P(0$!  R (c=!P\@P P W (0 # (0 R(!0PX@\((0   0p  !   -L M40 `pP@0 0 \     0 04  0 40 U~ 4 A00`4 0W3 00 x 3X00S140v03 R0S ̠@w@3PVP0 40P (0X 0) X0TU(K0 0 x 3X00S R   40 0v03R0S 0 40 0$# X T 4  00`4 0 40 i -L,ML P0 <0K@0P0p 40K@ 00 PS4 0 80 Sʔ 4K<0K 0S @PoD#Q {x P 0 0S @#6:1Y@   *0H D0 P@HK P`P`Y 00S@Y@ 1@H0 D@ 80SE @ R p(K5 L @P (    Q (p( (p 0S \Y0@*A0HKP0`0D0 (p40S <0SPP`0`0j40`Sf*a<0@SfP` 0O Q 0R0jaZ``X@@0 *W( Z``X@@P ( p0S< T  0P)V <1W0J<1(K 0$# rP (HPP 00(( H40(0C40( p0Q  \ Rnn 2qhmrx1qnrnrnr -0LMph!ԀL `64``V  0 ``V 0I`0d 4,04 0B6C0 Pn1@|0U`<4,04@Z0 (D3psnrhmr ororAnrnrxmr -3LMh!D 0 P'. 4KWi @3 ,0R0SW 0T00000 0R0T000<0 0 438P(3"8p@Wm 0 000 4 3 AQ8 0!@?CSD00D0W0 #0/Q R 0O0S@PoV 0a0c4K⪭W,!,0 ȟ00X@T@0@PoPU`Q- D0Po0Q RO 0@Vm@mUi@iU` 0a0c@\0 p*18p0W1840 0@ PNpsnrhmrnrVUUU 2qx1q@AOl 0-0LM| hD0@QP d 3`0XL/PK0@V:P (V$0 QpsnrnrnrxmrLAlAD(M Ѝ0@-PM@ R( 0S%\ * \ ^ \A 00\0 S 0  0S  R 00Ѝ00@00 R P, R/ 0\00 S 0  0S   0S 0P@ 0S@ @0  @0@000S 00S0@ 0\@ @  @0@-M R 0S ^ 0Sl0 0R 0SI0SD \   R00  \0S0  0S    R) ^ 0Sn R 0S 0R00S 00 S0 0S    R 00Ѝ000 \0 S0  0S  R 0S@0T00 S @0  0 S  0R0 0S00 S0 0S    R R 0S P0U00 S P0@  0 S  @ x -LMpX5 PU?P0S `X`V 0S @ W`RP 0WP P 0RPPV 00SZ   `X `V 0S ` MP0SЍP 0S 0S P MP 0SЍP 0S 0S PMPQ0 0SЍ0@-PM@ R( 0S%\ * \ ^ \A 00\0 S 0  0S  R 00Ѝ00@00 R P, R/ 0\00 S 0  0S   0S 0P@ 0S@ @0  @0@000S 00S0@ 0\@ @  @0@-M R 0S ^ 0Sl0 0R 0SI0SD \   R00  \0S0  0S    R) ^ 0Sn R 0S 0R00S 00 S0 0S    R 00Ѝ000 \0 S0  0S  R 0S@0T00 S @0  0 S  0R0 0S00 S0 0S    R R 0S P0U00 S P0@  0 S  @ x -LMpX5 PU?P0S `X`V 0S @ W`RP 0WP P 0RPPV 00SZ   `X `V 0S ` MP0SЍP 0S 0S P MP 0SЍP 0S 0S PMPQ0 0SЍ0@-PM@< R( @0S%<4\ * \ @^ 4\A 804@0\<<0 S@ 8<0 < 40S48<< 4R 0@0Ѝ00@@0@0@8 R @P, 8 R/ 80\<@0<0 S@ 4<0 < 40S48<880S< <40P<@ <40S4@8@0<8  @0@@0@0@40S<80<0S<0@ <40\4@8@4<  @40@-M4 R @0S8^ @0Sl<0 @0R @0SI0SD 4\  @ R0@08@ \<<04S<0 < 40S484<88@ R) 4^ @0Sn8 R @0S @0R@040@@S<80<0 S<0 <40S4 8 < 4 R 0@0Ѝ00@04@ \<<08S<0 < 40S488<4R @0S4@0T<@0<0 S@ 8@<0 < 40 S484<44 @0R@080@@S<40<0 S<0 <40S4 8 < 8 R8 R @0S8P0U<@0<0 S@ 4P<0@ < 40 S488<@88 x -LM4pX5 8PU?P40S8<`X<`V@ 40S4844<@< W`RP 40W4P8P8 40R 0-LM@T4P$SE^P T40T4,   l00l0qT$P4RP0008 -LM@P <80< 0a c< 00C 000S00SE=0S ,0;,0 0 0 0S T40CT4i6<0S0=ḗrr p-h0ML` @P0 K@ @3P 0,d(4KpF|rA -L0MH PL @t>P LP 080  HQL D0<D0 0Oᄤᣫე@ H LD  ?~4 PD#@0eX@>pL0T, (o@ <0K, P(|2|"D`\tPx`|0 840D\ L@ 800b ccQ3R 3Xሀ L0 R  L@800` ccQ3R 3X᐀ P0 S.PP0SVP 0 00 0呲H0E⊾Hi@\@ " D0OD H L$@D? 4 KpG0C0C+㛪@P+0"D0GKL4  0C@PD p$ t4 xt Hd @P0d0CSX3,33333̵3@q00Sx0! @ \`/P PX  tVP@ 0D@P\ @\P  00@00@Sx00 0000S3  G0\ $0pP @P 00SQ  \ \@H\@0CC0^0l4Olxrhmrl??dA p-LM`QP@@Tx -LMp`0@,P@fTK0(@K0@ ( $@ `PV@P((P R000$0  U @nrhmrVl -70#L0hM)|0 000p  x XP E W0p$80 S,:S &0 80 S!:SQ | x`Q% :PU% R apKg@ pK oxQ  PSO@(K@d3d#hD0Q|0S@#x0  0OF*t#J 6^, 3#`(0 Dxt\``Ĵ@`6Z8040 xPO x2x"hD,|2\@0t"0,0| x@ Pt  @0` l00l0c| R0 0 i Pt@`*6`( VZJ 00K0p t儠 H4R,0|;@@Q,0 80 StW$`Yj ^ *0`SZ P\`p85P t~{pKtQ Vl2qpsnr4p!Ce0p@ K3 -Lp@Mt0q0 t0 pL09LK pP00P00Sp00p0KhmrM00 Ѝ -LM0 S0d @\0!@@@.0P  0x@F:h d0@>:KhD0#P 0EA,CA0pxrhmrA|rԑArܑArulxAA0@- Mx0Sl061cQ*0!a("400@_#& U lЍ0T -LM `P p@P <0 4!Q @P3 @p H0 00 , D0-H0 0 R 0R < $0r80 $040 S140 x0R :l061cR<0 5< 40R*0,0  @ KP $K@NlA -LLML X0 H P T 㴀p(`\@P00p L0 4!Q D@T ዿD D0H0 0 R 02R `$vH P@1A#x0V3:Hl061cV`1TX @f0,$"(+"+(R/ ̠Č!Č"̌8 0@ T@LP8 K4`  @%P00Y00S@X00@0@p@0 <@ 0OpL 10@@K0Z `h@P4  0 T@L P0@P fZ004H p@KXp000D@Tm (K @NlA -LM0 p>0nt`Q70 a(@P$0S, d060>0. V $  b 0$K@P0 P $ ah?? K f$0d 0f#&Bd 0S* $0d 0c#&d A -PLM0 R.  . h`?8A 0M0 0Ѝ -L4M0\ P ` Zj @<0t"0 0S_\P@@ P  Z00SX K0R00n\ X0@0@T4 B? @ġ0 h@ P  @40KT0 L` Hp 0@ < D@ 8 G 0SV 01@ TK`0@H V D T00T00S` X\0 0C0 S V(K S@f X00R0S X0 `t0S Bl`Ph \wX h!01TK ]`XAps -LM? K -LM@H \?pP` 4 \p:@P`0s P0  (0  X 0  0\40 p4\P P(K(㏰0000P0\`p \:@`pPUY   U ` R(0  (0 Z0!0PU (I0PP 0 P R0 PPU 0K 0PPP 0@(:000000 (0 0 ()0pAdA -LM0S0S\ >xpD0 0@`,PXWxA M-LM 0  0 0U@`  | x 0 x\7z|0KpP` P(ȯ:@p Q P`@T 0|@K0`@ P P00 P ` KP a ( a  D0(@㇯( { @V 0Ql :PK`@P`\P ` \ Q 0S @0000$0S0 =0(KS`p00 @P`@P ` VPK`P`0|P x` ڄ0 @ 0qxP  (  0 S0@0   ($0"PK`2@P`P ` Ps' 0 S4pK t`K0 K0 0` 4 |PK``PK` P`P   `Vm 4^\ 00Pq (0S(@ޮʮG @ 0Q# 400^0 =ڔ00Pq0 S@ 0R01 R0Q24 J( F4(@㦮 \0U| QQ`VB 0! T;P;@   k4pKj |@R,AAAA -L M0`p @0U `p KT0 Z 0-L M0@. 00H00 0 PE0S P0000| 0S 0 Sj00    Q$0$0$000 K0K0h <$A0A 0-L M 0@C^ 940 0P405  0   0 S 0 " P0  0 f0S    R$0$0$0  0 0K0hK00 K0hN$A p-L MP88414a@0TH=L0S @T U0 0S3 0 0 R(0( 0@ @T@T|(@T 01 P 0S0  Q$0$0$ 0<0`(@TKphq 04rDr40S;80S89 4 Qz 0@S.0S/+p 0KP" R㲀 0S0s 0S! R 0SJ  0 P 0 1(K 0 040  00 X,  (Ko04(4 S :4  0剒P @0 000 ,较D0S0S /P , sHr -L4M⌒ 0 , P L SP"0S/`0Ss 0S 0S0sj ,0,pSh HKH`K@KP0K @P `, 0Ri(K 0HLK0@ @`PH R 40<0P0 P+w0S$[00S40S5 @ 0P@P0`0S00S 40S80SQ, L@p0@4[p@30 Rᨒ1`00S40s80SL1',<4 4:00p0 0h!0lRl??ps-QM 0`SࠑQ R0 R 0SЍ0S0 P0S0 P Q 0S 0S Q1M\\ R 0S0S 00S0  \ Ѝ0 M 2  0 2PЍ0  6MA0ASЍ-0MQ' "R 6Pp  p P01:0S S*S P P1:0S Rࠁ Q^(0Ѝ0Q,>ldOl -LM@XF      h 0- LMP  @  oK00 08 p-L M`0@P$K 0 tT  0R& Kph6kT00  \a00 PQ K0 S  0RKpz x 0l0A?A???? -RLM@p`p5R00Q kP /.00 S 0bS1 RSA -LM0@S 0P P S T _kPP P0P P P@? -LM@@Pԑ -L M0@PK`@p$0 @k8K0 @0K?K`P 4 00S 80S0C80$ 0R K<0S80S0C80ʝ 0l@? 0-LM@PT@T Q 0S jP8 -LIM0p0C S P0 0R'K%Bf`P KjJOK0 01K/!K-KXD( R000 0 0 n 6 ~| 0l2i @? -LM@P6 l -LIM␡0 0@pT( ` @T 0 R BmjPPT0007DP0P01 86 s@P70P0( 00006 0NKR/KDPP 0S 0  0 00 0@p A( 0R$K6 P 0l1i $@? p-LMP`@ 6 (0PP700  P}P@ x6 P -LM@Po  pR% 0S 0S RQl0S 6` t0$0P X 6x00SD1S X `P  a0S 0`P000!5 i -L4MPq0P 0 @ `H R0 10  0 Q 0@00  BR 00N  0R)K$Z00S 00S40S80S h giP 0N K.0㱔D 3100S<0S3 0l sA?$A4@? -L8M40p (0 .M0 `0S+1@T P0`0 1iPPUʘ@TU P  R000 Pj( 0R$K @P000 0V K.0R$ 80@b3 0l sXAD@? -LpPM 00`Q0S0, 0 P6h0H0SyUSu HPPoHK,Q-0S x |0S^RvL9 RUV H0S |0SV|HG@[T h0s @0@0@0s @0@0@ P 7d00d  \(0@0Y@@gG0[S@0[S?0[0S[P &04"48#P , 0R(K P 7 R00 Y U  X0 ) 0(0D'(00@0@&$ `00 |0 0 p0P0 P  _S<T=P d0 006SCP d0 O0@0@f0@0@W-0S S / K.03 E2#@Kh gP0 000`$ 0 K.0| '2oKg<9KᛐK圀K&04"4$9K  $@K0 K 0KP 0S0 0001 D0KgxKdKကKKgğ\KdKcK&04"4L 5K dK@P   tgP 80S0C80NK@g4( 0 dK0K  ! 1  0 P z  K6P 00S 003 d0K|P [gtß0 d0Kc K04 45KL dK u@P   $gPg 80S0C80ŰNK@8g2( dKK   0 !  0P * K PM 0S0 0010b(2 R DT12 R  K.0 3 80B1w P0 1 R 0 K.0 *180S0C80f`c80S0C80ŮX 1 R  K.0 80  1  KP 0S0 0010QZ 0 R* 0&)d0 R?  K.0ˑ l8002&04"43KK0l4TlT1l s@AT@?lA@?@?pp@?A AĕAA -LM`S, p@ n 8#QP 8Q _*8T!0CT*8T 0T0-P x8Q p8QU\  MBP, 0Re(K08T (8TL 1CTK 1CTF 8T^ w4T, 0CT( 0T% 0CT" 7T^0CTs:Z 7T2 7T 7T  D1S  P`70S-P07T\ 0TZ !$7R/PUPU  0P|P6T :60SQ 0S0S 00S` X6T $0CT86T0CT*%0CT0CT*!1CTM1CT 5T 5TPT5T| 0T{U Zq 0s % S $0s l% S 0s @0@0@0s @0@P0@4T [,0CT14T 1 0CT 0T:0s !P`Q R@ʻ 0A0@0s? PaPU`V@ʹ 0AP0@1P3T 0T@e2.P3T| 0T6`P@3T)L3T& 0T" ,FPd0lLC@ PUP KPd ` P4K K@KKK0P 00 P@0[d0@0K@ [!|x0 K@ KH0 D RP Z 0S00 000T,P@d2 PE(0P0>0@P0@80@0@QA0@0@@RP(RP$UC0@P0@P &04"48#P R 6R00&04"40K KUP>0S.P,0lliHMi iildiHHANi4WiHeiHii "i %i i i>d@?Ii i Qi T1lFiRi Si !i A -LROMğ  Sd1  0R,0 `  4Q 1CQ 1CQ -T, 0R(K0  0Sm0Sj1SSf1SSb R_3X^ 1CX[ 1CX0I d8P P@QJ@0`SE0SBpKc  c Kc@T00   1FSK00K` d1x , p\`K c\P<0X@P80T@40P00  \P X@ T P wcP <@K~c0)P2X  \K scdpWGpWD 0SY L`K _cLP<0H@P80D@40@00 \K LP H@ D @ )cP|1X2 WOK?c  >c(SK( :cd6 ^K`` 1c|| -c` d1 "1 !K cT00   e^Kc( (cd!6 `F` c&00`m-FbpK`b  bK b20liiii p@?A -LM@n@0T0 @T 0 R0 K5J@TK -L M`p3V 83PU0P  4 0 PUE 0SI@ET@T@T 0S 00S 0iSl PJk `2 R 0  P00^00Sd V4 00@ 00S3 0  0S9  0@hl*P hl* Z 0@hl+P hl+0 0 0@+P +0(K 0@*P *1@P ) 0@)P ) PZ00+0` ^RlʗRV 4 0bSPRXWVU P y,>lRlTsؖA -LQMq@R  R$ ` $ 0R` K\a0S^ .S\ T 0  QO .QM Q0  0 n?R0n 0tPK0Kb0[ K T At [R A0B0S 00 R@KXac K [4PK*a00 <0 &04"4  0 qa.0 n00l8A? -LlMp@K0`X 0 Wa*h0 `0PK Ka0 000#0 QK 0lppDA? -LM 0嬐K8 ,0 'a a\@KxPK`KHp0   pK囀KdpKcKpKK40 00 H PL, 0R (K<0 R 0  <+0l@?A?4TlA\A? -LM1@S R lPGPp4 P2 GP 2PUU` `P  `P U" U00 0  00  0 00  00#0 UP#P P `  `PtOllOl -L MPpPDa0S"$K,1@T T P0-@TP0`0S 8 *8 *0S 0 @ P `p pP@ P`p*8`0S 8800 *8 )4Tl,>lAdAAAA -"LBM0PᬠK @8,0 `  `&04`"xr00K 4 KyKK  0  Ts K0[yK00K` 0KHr\`K 0 d0KH c K4 0 H@H  ZH <@qP 6l0S 0 000K_0Q BOKIKKK0 0Q00[A00K [ K  MP , 0 R%(K P/ZKP `0 R L)80 R 0 $)70l@?4TlPAhAtA? 0-LM Ql 0R@0 *p0 S:68J0 R 0R1K00BSp0 S*0 R 8 )8 ) x0 R PL(KPP 0l4TlAAhOl@?A? -LM@~0000#0 -LdM0P(0 =P T @0S,LTDK=^6@D<`K#D 0D0KCKCKpP <0S3 ^6 @D#D 0D0KCKCK `P PEU@ R0 U00UR   bp& 0PcU@$K0@P  Q ,0KWP , 0R:0PD ,0KWP , 0R0%p *$TsDfA0 M Ѝ\r -LMPU'@ 0  DPU `\0 00 pW VQ /PUTQ0 H00  0 00b0  00C0hr\rdr 0-LM 0R@ * \RPP &OCQ878 Ķ 0 0C 0 8 -LMxp0Sd`00P LP 0 0@ 0$@uPj00h0xp\rTs -LM]TY0DqS00PU 90P0C0S90a(0 0@(0,@BUԀP 0R*0S`0 R 00 0@004@ 0% 0R:\P00eP 80S0C8000 oX.0xp\rTsRldr(s -LTMt x 0tx ,0 P 0` Sp C:W0 P@K$X0|0 ( 0L @KG0KHK  PP`  @0S 0`0  80S0C80W0P0  0$ 0`@T2 0 0@0@[ , 0R(K T0KVP T 0R0%p *p "pP.l P)l,0 P00S0U\0 @X@ 0 00P߸\l @  㦵l0 㡵X@\0D HU  P  04 8<0 0h4<1d Q   048l@ <,<$"* <4#:Q  0q03R0S l@\ p @0T 0TPQ 0 00dS t R000 O gl@TlI00 O0@ 0$@l ȟQl@0000l0 l@00 0b 0A(00C0`P " 00@0@8 00@( 0$@GOH00 W`0 0C00@`'Q0@ 2@0x x|  048#,("(04"48#8p0 - +4h0 0@` h0l@R 2@0  x@P04"40e  0C`P 2]0S&00t6QT6 QtH60Sl0 IlPl D  0l@484 <S  VP| VPh p Rl@00I,0 8 0 l$("(04p@,"48(#8i"(Qd (K0 0Ss0I 000RUN c5 Rşğ0R0<0 0刷PP lP 00Sl@l 00@@ P 048 0S; 1 0( 0*m 1RP/0lsQllrA? -L M(0(  @ $(,L<4,4"| W@P`( 0Rn$K1OT0 10SPDKQ0 C0KD K[0[0S&04"45KK0[0S&04"44KE/K  B.0|  ! G?KNP  0R0%P *;4@P $(~Q 4 R \KL K # x@KP0pK \Kw0KxKP( `P 0Q @T! 3 R80S0C80ur3 Rn \KL K  e\KL K    L _PP P3 R E/KL.0 B{\K@L K  0480S0C80L0[S@G LK\K ;Pp300H 2 R) \KL K   QOK(J( (*P<\' 0 a% m0 00V 2 R E/KLK.0 BG{\K@L K mPF 0OK0[0S@@ ` H@!0LK@0H!R;! ;10SP*PK`KOpKOO0LKK 0KK0K0KKKO\KK O K O(@GKH!0@P (0<@KO\KK0 0KKODd80 R` \KL K X W0lQlHRl4TlLs8AADfAlrB?xAPAAAA ARl4RlH4ԛAMЍ& -LtMş/R 0 , pX 00 S0% :Pg   ` P 3V ,+Vm ,V V( 0R0% :PP 3V000011`PP 0@S0% :P= 0$48#8 R`P<V 0Z0#X( dK,O0 S0d0Kc K \@K L dK0iP 4 RF 0 l0KLPp3@P $(ß, 0R(K 0R0%@ ,:T 0 0Ra`Pz0S 0S0% :P 0 @2  0 l0KLP l 00R6:0Q l0KLP l 0R':0@ l0KLP l 0R:0] l0KtLP l 0R :0;l 00R0% \*@@KHKN0 H0KGK" 0 HK 0@P_ 048<:Q0  D0 0HKS㈠ P x  p 匀 p`K 4 21C0$!10\ R dK( 0K J1\@K  Bϫ0 $(, <4!4"IP ( L;0[0S 1@ Pp 0+IP0S " 00@0@0S " <0@1A0S " B?0@1 A{0Sx " 00@0@m0Sj " 00@0@_0S\ " 00@0@Q0SN " 00@0@C0S@ " 00@0@50S2 " 00@0@'0S$ " 00@0@0S " 00@0@ 0S " 00@0@0S " 00@0@ R0S " 00@0@0S " 00@0@@K$K0( XKK0@P 80S0C80TP H0 R PK K.0v0 0$a"0l4Tl sQlAA؜A`0@W 8$H 2  nB, 0 R(K 0@S@ `  H:XV : 0 P, 刪! !=0@@8DH@T GTb T TIW 2@0  @T[,t4s4s4s44t49 R)P(8,H`0@W(8,H 0KHP  0R0% *l  T9@P $(T2 T 6:T T 9 R` 0}PuKfpW 2@08 8< @TY 8H 0@8H\U> 0@084HT TW 2@0( (, @T :TW  2 00@ 0@ Z K.0@t 0X\P\T1T:UTm W 2@0x x| &0!D@Pg 4!{Ty0DShuW " @00@@0D@ RzeW 2@0  UyVWL 2@00 04 @W 2@0H HL @TL%0CP8  /@-W 2@0h hl @T2'U>P%0CP# W 2@0` `d @TU#$0CP  2W 2@0X X\ @TUt$0CP  0W 2@0P PT @TU$0eCP  =W 2@0  $ @T T Z K.0s K.0sW 0DP@$#0-CpPy 1 0P p T@P 0Q PQA @@AQPQA  @( D00 @PZH VH0 0 000f0C0/> ~0( p(000p8X`0@ 4$D8X f ` 0 Y < R 1 K?  ~000llr4TlDfAA`B?ʚ;8A -ࣟLM`0@pA P0`pY 0'Su1   V WV ?(K0S 0SX 0S ) 00K0 #P00:Sb @P |PQ0MSp 0&B P8 r 0/Sj80  0Sk S 0Sn S  <( 4"4)<(##$#(`p 080  0 0@8(0@8 0S0S0S (CP0 0@0@ 0R0% 4:PP 00R  3 0 0@0 @jMc<0CP8 0 R_  EZ 00S0 0 000S000 40KDP 4 0R0% *lO00S St 00S Sh> 0@ 8$H#lr4TlpAODfA 0-LMP @R 0S0S R  㢧P @0$ S00 88 XRlA -LM0$0v0 q0TRl\RlLRlRl -QL M# @P`p0 , @P 5"0 K  pf`00 K $K -LM`;g4f0@!0c48f0!0c4<f0P 0c4Df0 0c4C@@D0@ 00Q0 00Q D gP@10 R 00d  SH,0 0C# L0 upPPoP@ꫪT1l -LM, 0PR*L0 ORsf, 0S*4@pD`@` K@X4<0,0 H8@F00 Qi,T1l -LM Rl(QMЍ0( ,S  3S001 001 R0P -LMQP@PE0L,SEH4Ѕ4Ѕ4؅4؅4؅4؅4؅4؅4؅4؅4؅4؅4؅4؅4؅4؅4؅44؅4؅4؅4؅4؅4؅4؅4؅4؅4؅4؅4؅4؅4؅4؅4؅4؅4؅4؅4؅4؅4؅4؅4؅4(4t4a0 `_pP0S @K-P2\0 P@Px0 Kh\0 KhTP000 PKhfTRl\Rl,SlA?XrTsx -L8Mlr@PP$ ` 1$ 0R KQ<R4І4І4І4І4І4І4І4І4І4І4І4І4І4І4І4І4І4І4І4І4І4І4І4І4І4І4І4І4І4І4І4І4І4І4І4І4І4І4І4І44І44D4І4І4І4І4І4І44І4І4І4І4І4І4І4І440Q:N0K (<VN0[0M0[ 01PڢQ: V0K<%[00SVV0[0(Q:L0K( <VF0[00Q:N0K ;VN0[0M0[ 01Prp5 0llB?A p-LPSM0C`@ PK 0 T  @0FPKp@ -L Mp0 @$("(04"48#8(``V`!3T (P  1T +T (KZP*0V':20K ;00[S! 10[2@[01PY3T0V:.0K ;3T-0[-0[1001.@[PP<T000 -LM&0K@ pe;3T%0[%0[00QQ<@P00U00S ; <<1` T ` `=:U* 0?; P K;@ -L,M0@,0  Ply /  DK)0D 7MPll 0 R 0 0( T @3T 0T6 T PP p3T0000aa 0V 3T T#T00T0 @T;Q;2@P  t, 0R(K<T<T :;+T+Tl0 3  l0 2  )0LT0P0T0 @;@@K 1C@0[S` SS ZZ 0SV l0.  )00 LPllfP@K  ,1LPW 048< ̠<Č,ʠDK= )0D LPllT (@P  00Qwl0 1  )0rL0S:l??0[0S SK?0[0S 0lTsxB? 0-LM00@SP ڀS S :8S80 0@0@ 0S 1  |:8T@00@ P @P80 8Ts -L M`Rp"@3 1:S? S VM*  hp  `bV @0SV;0 `bV(KV0PU:0 =4K BB40 <4("4!<^40 >SM: 0V R.K'B"[04"48#8 00@P  9+00h E`*0p@0@P0h @P4,0T0h `@0p@P@P#,00h Ts -L M@` 0)S0p(P 0 0Q( Q0%(":P*0@P  (K( 00K?P 0 0R:0( 00Kt?P 0 0R0% *8 0 EP00@TsDfA -LxM0 ,0 ! 0S H/9I 00@9I0S @ ? .#= 0@8HX " 0@.P`0@p 0'S!P00`S4 dP0`0@X0@ 2   9, 0R(K (=P 00@X0@ 2  0-10`p  \Pa  R0ST pPh 0Se0Sb0S_6aP0`0@X0@ 2  $ 6S 10@#P (dd,#= 0L@8HY8,'= 0 @9IN ,8H 0@8HC 0S$0S00@X0@d 2  $ ZR0Sj QT P 0Si R0Sh 3S& KP +P0`0@X0@ "800@80<@"00@0 @ 0 P 0S0S0S 0S0S 0S$0Sx P PX Q Q P Pi Q Qw 6 Q00S  PX0 H>0NQ i0S 40h >0@L)p 0S$0S(0s' 0s#KK K0K"PP 040SD%0 0 @X0@ "80 0 @80<@"0 0 @0 @  0 00S S 04 6 00@d$0@ 00S S6 $#$("<8#8"( 000S S6 $#$("<8#8"( 0u00S Sg 04c 00SY00Sa 00SX00SOX " 00@0@@T @T 0 R  B:>PT"00@0@ ŸR` @00@@0D@XM " 800@80<@ p 0)S(KPZ 0`s ,2 R@T  =P#0S  hPX07 0;640S 0{0A 'PX4  4)6`0S 0{0A PX`  `68P 0{0A PXPP8 8 6 -PPpQLMP@  K&T<0S @` T P RT:00S000@TP" T `0 R0RS0)S B 0 yP000@TP -P -LM@0Tp`h, PVP 0S{ O$KX $P  00 yPP@ { 1p{ b@ps -LMP@`p Pm 40P480S0C80f00$K50 00 0X\(V A 20Qp  Q Q: 0X p Q* P 4P\ V<`20^p  p ^*\Q  Q3 33:^*X0 \ 0 X ^ ^:Pn -L8M0p,0 5@W`PT@ h 5 ˕P7' 4@ 0p 0@ 0FST4t4444-0T0 0Sl$0S 0S@T5 l@T, 0R(KU R 0T0 U R`K4` 0 Sr3   U RXK4X0S0ǕU 0S`0S0S0S Q 0SPgP@K$^4(0 L0 0H KG0K@KjPP ^77PPl0l07l03^66PPl0l0,l0(^77PPl0l0!X#R R R& *P>R=Rl;R <RP>R=Rv;R <R) 0P 0 (P @ PR BPPE444h44|40T@ 9P TK0H @{PP#T0L@KS T /T000 ( 0 /w R R!Rp$RnRl #R R PX_ Q0 0PKP pP Pl0|X0 0S 0 0pPm5RjPi@R 1RJp(0 0 P0P0"@R d1RQX 0SY0 @R 081S SPuP@IGPPDX 0S= 00:5R7R1R 0BS")X 0S)0PP P Pl0P00l0l00 0l0l0 00l0P^ P 0lpsA?B?! -(RLMPp( B(0)P @@0S1` 'P  0 0 7[%P 000 0 0 0 -LMP`U'P2 @0 0P<(4"4= < ,K,0 . 000$K"%P @ Z'pP ; '1&77 0 @0 0 000  .0@j&Pp -LM @8 < 8<,$@a8#$@D  X00(@4 |R@y8`&PP@q P  T%@Pl1 (@pp ݋ @ 8 00K.@PZ804("Ƞ0l08#8 $#$("00^!"( f 0 04<8#,("(#8 0 0L08#8 $#$("<8#8"(0  0(P!  R8 00000) 0 )<)04`00<^%&@PP7@(K/q -LMϟ 00  0 <000S U- 0 0   000S U 0< 0   000S( U  0+ 0 0  P P0S|K`P V@ ╊ " B-  L,0S) 0S&0S#0S  P0@ |0K-`0  '|P- 80S0C80(W&U *`P 0SX  X00@ ʟR|KX0\@   W 80S<  % d \ 0 $(:0S    R *8#4"<# #$# 00s 0X@KP,0 PKW0K 0X0K( 0 0K K0 ( 0`PPB H0 0@H0L@  0S " P00@P0T@ R 0S W 0S00  1<1 KR<0K @K@`P0 S 0  W h0S Q 6   R R Q Q Re R QY Qw R 1@0100 K ! B0KxPP`@1 @01 sW l0 0S,20Sp  p S:0Se RcS: 0  P`|PꨀP `P```  `PPDAVƟ0 0@0@0SB 2PX0 0@X0\@000 0SQ< 0 00S Sl0 48#8# Pl  \00@ |K-`P  Pt0S1<<1P " 00@0@6Sş0 0 @P0@P3` 2P 3`X0 0 @X0\@v400  P|@K$+@ @ ]T0SQ8 Pe: 04a 4P0 0S  ,00 0( p`P0S " `00@`0d@P00"U l`x0p0@Px0|@ 2p pt   0 `XP 0V0 "P(`00S000 00S0 0 00S 2Ph0 0@(`h0l@00S S 00S Sv@T @T 0 R BT*PT Q 0S  0S 60S00S;"P 00S8 0 D1  00S2 00S S&W h0S  Vp0 0@p0t@Pv(V `0 0@`0d@70S4 " h00@h0l@)0S 0S ,00  0lTsB?pARl p-LM@P 0`R :P# 0S+ 0 @0@P0f @PKp 0K'P  0R0% *T8D0@P0  0 01 TsDfA -L MP`< /P} Py 0!pPq "P  ( @@0( 0@0 0`0Y0 V 0* BVp  `0 0@<0P0PPPPPPP 0S 00S P P28`K<2 P)<0H!0 0@0@ 4 K8 2@<0P S & S S Y00 @@(K ⱆ2  2B  !2 !` 㐆 lrH|p@? -LM@T @T 0 R40S C R004   ,000 @T|p p-LMPP0Sx)80 @`T  @Txhj|p,>l p-LM@ x04"40 d`04"400 PR xhN }(P 00S SlTl p-LMP0@ Ġ#Č` ^(P 00S 2\I00 40 00040xhSl|p 0-T0T@LMP00 0K0KPP(00@K0|p@|pH|p -LM 0R0%@P` ;:VG  0S  $K 00S0SB S1@0S 00S PU PU 0 R B'PU 040S 00S0C 0 0 ,0K%P , 0R0%` *hcd2@P $(60ST 0SQ0SN0SK0SK 0 $("04 48#8! CP6 $#$ PU? PU< 0 Rpd B'P 00S0S0 0S-0S*0S'X8 40S S{H0 4 0SR 00S6 $#$("<8#8"( 00S?m0i  N'P6 $#$("<8#8"( 0@ 0004DfAlrMbSl|pl0MGS S S S S 5SЍ p-LM`@(P3'0V00@ 0`x -LPMp (t 0,0 x ~ph Qt p00d0 2d pW`p  0`0 pP d @Rl )*x R@0  08R#21C@0` Z ` pWp0S x`t P @3@#h , 0R(K @& @  P[p00| < h0(0l , 063h0sW !`P`Q R@?< 0A 0$@040t =0 x`V ) l0`08V#( 8#X"!Bd 0P:l00@   `08V#(21C@0#~Q0@ 0$@Z K.0QD 0@ 0$@`t0p@u 0lxTlAB? -L Mp4 W0 0`1P`U, PV,`U,$ W,0 Z:,1&0 0  ?*0V(02,200 @ &"P,`UWP 40S P3P#0(Ks -SLM`p@`PQPR00S`RU  P ` V V*` X  㞆 ~`P00X00S U  U` M| Ѝ~ -LM p 0`V 2P@T 0>CS0`VhH@0$E D "F0( #5#3 05s,>l|TlMb -PLM \  R @T 0 S *01 0 S00@ 0(b% 븞A؞A 0-LM@P` 0S[ 0SQ P d1 RMX1P U 0SCP0 Q$f d4Tl,TlsA@A$shAAA -LMAl d`1XLT1P 0P 41T@= U1P|  0a\050305:000U P|  0a\*=U0\ h0 s`pP ` `0Q R  Ui<SQ05sTlsT1l sxTl -LMHpKP`, o$@K0 H0KGKP| 40 /V- 80S0C80U| VZ, 0RM(K L@P K@B$1p 0 K |0K P|Q D0S "|80 0C80|40  R00 R V 0 R .0v KGOZ d080\VD0S Z @0 R V 0l4TlAğAB? -LM؂2\( P@} 2\/ 0\ 0C\% P( 0R$Kx2\Q p2\2$ P'P@2P @TniPhPpPU 0`S" 1P 0@@ 0S TPVP 0@S00S T9P00S8`K^- ^7  p0PP2@P~DQ "0 0(0", 0 0$@m00S3[S&04"43K00S 0lliHOi Ni4WiHsxTl sB? -LM0S/ 0\"\ 0St0 0 ( "0 , "0 0 " 0 4 " 0|P 00S0 $#$("QxTl0MЍꌬ>s -LMp`9Vh0`00c0$0(ǿis0@ 0@$ (⢿DT1l -L8Mp0S, P@ WP` 08@T, 0R(K  08@TG 40`1 ]V@  > D@VT@ "0 00@0@& 28SS C8Ss PD 0   `VR @( {`P 80< 0CR80A A@X )` P@2 Z K.0`M0 `p@0 P  v 0`P@P`P 40 `40@|00"0 0Ba0 `A@Pr`0( P`40 `^p0t 0 28jP8C002< (00 28\0l8TlADMb(TlC?Tl -LMP@* 4 00 S D^ 00S 0S2ST0t 00S 0  <0D  0hQ  P0TlD -1L`MP1 `, DP <@K6 < PG p  2S  V R 4!4 ɯS"`X85 1 ` `< 0 |@K@`.! 0 <x0 p n 0d, 0R(K2S < Wa(Ql0lDT1l(Tl C? p-LM K (K0 PP' \3 RP 80S0C80, 0R(K1 <10 K0KȠ ; r1}@@K w(` x0(0     0 w0Si S~ Q= +"48@#80 @@","0^0K K@@Z "P`00@0@"00@0@1@EP PPT$ 80S0C80Ō3 P m@ 0 @@ 0P 01 0 m @H$H04$48#(@@K 00S0 0 0& 04"4P ,5KP@K4\@K%KXP T0  00S Sz K.0D0 (040l/q4Tllr@AC? -LM0 006  @ K0000 0 -L4MD0P$0 匼Up_ ]`P_ +H 0S; 0RW0 0S0R0S_0!00S\ R 010  0| ypt!00C0 .00R K$D HP80@12ᗻ$ 0RA K1 R 8 !.00R KD P800 m 0 0 0Ba0R K.0 @C8@0 <4d0l4Tl|pXrأAԣALAAAADMbtAC? -Lh4Mdr0\,0 T2  0 `PE  00, 0RK(K0S 0Sf 6 P8| \yPL ^  0!00Q0-P 0V0 0  > @TD1(9 -.00Z KeC P801s090Z K.0 @MC8@0 ].00Z KAC P80t0Otw  0D 0  H0BaxTl0l|pRlXr4TlDAԣAC?8AAAMb -LBM@B POS0SK HL [ \K ! Pp`P`9 lK@.X m0 00S S0S( \K K.0 B Am0 <K P P <0S 80S40S00Su @K$K( 00KK@P 40  00 Rv %Q0S [0[0S&04"45K$O1 R H0SD0S@0[S !<0RPP@SA 80S40S00S`00(&P00 Ġ"Č2 <K\ KKS @1<K @00S@0`0\  0 <K\ K8v<K K.0aA sl ㊩PP 0pa `*0lQl4Tl,sDfAlrA@AAATAAA|AAC?A@?A -LM@@0P,0 0 <K p0 sLK s`V( 7 R7@P  ǟ, 0R(K  K.0 A@ K.0A 80h 0R0%P [:Ui \pK Ls0 \[48\l0 \d &300  L0[Sd @KH eFPnL0[S` PP@ 0PAც0Ph 0? K.0@X  g [0[0S\&04"45K6 R  K.0@ x  0K6P  0R0%P *5@P $(g[0[0S S<5 RQ DMP5 RF yB4 R q<KԩP4 R/ b+U m0 00S t4 R  K.0:@ m0DlH 0{P s DP o 0Xk 2# S =0m @R@U@T] 0m P  0@  " 8#8S240040P @PT8 P 0  0T,  P'Ub 0SV  U  2S022"0  0,U*P  K.0?@᤯08 PU m0 00m m\3 0 0A"0!R00S 4000m 9P  @垷0@P<P$ Z0U00S 0!10 @40  V 2  000 R < <0 0/T0T 0 $0l4Tl4s,AAdADfAlrAAAC?@AlAD(TlAQlMЍxMPP 0SЍ@-0Ms p@0@0s L@0@0 @Ѝ0@0s0@0 @T1l p-T0LM@`TP @T 0S wPxs -LHM0P\p 0S K _P40 d@K@s`4 0P0@ 4 ` \P X` p -LMP@Tp㷶0`S h00S 04!40 L5 -LMlh Q 0 R  0wq |0@0@X0\@| T 0@0@P0T@0@X0\@0@P0T@4TlAT1l -LMh#|@0p<K,0 [PP` TW80K1   K0K 0K00K0 <80 4`0X@  @ ؀ >0 0000 4 0000 8 0000 < 0000 0 0K<K0K0Kl0h 0 0@00 K@ ᎩPNUW K⌧1 R`, 0Rc(K0L@K0 0  j<L08H 4P0`D0P@ P`0`@00 0@K 0K<K00K@ al0h 0 R 0  R2 #310" cb ` l0 R Kz K.0n=1 PP~`8 0,u0l4Tl: QN8AAC? 0-`0LM@PT@T 0S| |0RYP 8xTl -LCMܒt0 P, p 2 R v K.0=|0 0, 0 RV(Kh2@T@T T t0 |0| RP (P_ HK @0K 1 ( 0H0KcP01 `  `FOK@ 01 ` !  0K/PP t00t0P800C80M1 R v K.0<` K.0|@<@KP K.0<8 0P X 0 R XD0 R v K.0<|0 8(_0l4TlpAxTlC?AA -LMtt0 0, 0 P2 R  K.0Z<|0 (kP, 0R(Kݲ0HK0 @p @Kd`KGpKH@KPK (\Kd@KcpK@H0K0 `  0KPP%t00Pt0  <1@T T t0|0| R @T R 80S080S0 R @K K.0;|0 8PP `P P0 R  K.0;8|0 8$`0l4TldAC?xTlAA -LMx@T  0 P DP 2S@T -L8MDSDs@0T 0  @T p0 P @@2 R T5p0 t0O Pt00t0@T 0S00S@T@Tp0 t0PUO p06@T 0S00S@TR@T 0@ P P:@T R 0@00 R 0R`KmPt0t00t0 PP T1 R N K.0 ;|0 ,P0`P 1 Rt0@T 0@ P =P000000@TN K.0:|0 `t0T p0 t00t0@Tk 0S00ShxTl0ls s4Tl0AD? -LM@ `h0#10#PP@0p0p0UP00C0h+oP@0P00 -L4Tl$ApAy0lLD? -(0LM@T @Ts -DLM`0 dKHK,0 pK`  ĀK  @  x@KP0H KHKGPK0 KdKPKcPKh` p 帠 ѯ0P8 0K@P 0 j 800C80T0$0, 0R(K0l`D? -LM㦯1pQ 1 RCil@T `P h0  V9 $00S0U  RPU00S"@TV4 U  0P DP 2S)@&TV UZxC h>0rP DP 2S``ӷU `V`Ql4TlsAA -0LM RPbh0 *$0Sp" R 000  0 @T P@T6Wb00CS0 | hilp; 8 QlsxTl0A -LM0Pr@`PN BTf $0* SB* 00 @5 @T6 R0000 0l @T P@T xP @ 0``00000  0``]@ZT2S 0 R0R,| !lP `H>ǭ`,0 Rh0  s0RlQl -LWM0P,0 š<0Kx |1 @`<Kx hh0  0\ǟ, 0R(KpW! 87 R ,7@P x K.05@ K.058 0<0[S 6 R <K K.05 ;0[0S 0R0%p :W~ ]OKF ^?P 0  48, hK l |`K ş> K 048#8 $#$("(@P@PVL@ HP $KP  <(4"4|%&LT0T @*0$%#5$H @%#3 000 0 4 8  <,$!$ , PhKhpQ% P`Q 01`P:0SQH p4 R  xnPlh4@P $(-`Q 0S p\> 0 A< m0 00T7 3 R% <K K.0/5m0 D> S?KP L 0R0%p C*X@T@3 R  \"P3 R < @ 0<K@ @I0S~ Sx 0 S RK 0 MK;1KltA@RlDRls@?D?hA\A -LMß`@, Sp3h@0  pK3 0 PPp  Z K Ÿ, 0R(K T$ 0S P0S/P0S1P 0S 0S0s 0S 0S$0S(@Tg 8P0S 0SW ,0s0 0 PP7P 0 R(1"(1(0241"4101 #0 !p0p0@  0# #$#8`00 0HQ 40<$ _  _2 02, l0 , 2(0H `,Pi$0S(0S9P` HKHPK0@K t[MPi@0H,K P@ȦPPD3S @K,媣 PP7@Ky0lpsarD?MЍ 0AsM0Ѝ -LMP  b0`0S0@+  @0S00f+cYV 00K2pW0/Sp  _b(K\2 000 SPC/R 0u/S @0 xKP L0  0Ct0 p H x` %1P/00%Y0`, 00 0@fP?p  m1 P 0p@0L0 0CxKPp p t0 x` H 0P p00Kp2pbd<\<@ 0LKP 0 p 吠 0PPdMK0! 0QPP 0jK0!QPP  !1R!1R!1RP 7("B 1@W b`0`WK W300 0 0  0 0 0  0 0 0 0 0 0  0 0 pG0 W `W 0 R 0,8(2C"B0 cbЍR  0 R h0\\0LL'82C00c00 P @@ R,B B[q p-LM@P 0]("( 0$H,8L2C! @\` 0%H c@`R,B BR,B B,0QA>A0AQAAxqMЍD?0@-QM@: R,P0 0,0,! ! 1!4##!#$" " 1"4##!#$""1"4# # !@D#$""1T"#T $P0@T0,0!," Ѝ0D?QM  0 "Ѝ p-LM`P@@Tx -PLAM0@`. 0JK(1  0K0R0pK Pd@0 Pd@0  Pd@0` `&$K` -SLM@P`0 @R1SVPQ00QppW(,0\h0p(S\0 p,00L  P  %9$0( 4`,p$P0p@660% -LM@P$Q ,0S 00$0 -LDMP\ ` d0 (K$pW 0 0,  P0 P`4`@ (4  0AS_5555L5555555555555 U0 `F0P U0 V`0K\0`P@0` 00H0PU8s0 `F0PU0 kV`0K\0`P0S0 8P U0 `F0PU0 V`0K\ `P( 4P1:=4VPT0 # BL !0@UᲠ:00`F00 T 020CL01 @PT粠V`0K\ `P `4d0P =("((8#R  = 0 K0̃"(<  \`d \(PERQh U0 `F0PU0 V`0K\ `PH @< 0 h,̟0 \ 0 Q7h威PEP 0 000Php0T0 S.l0TP X l L T0L L/H HT P0 Pv  \; 0 @ 4  00H,0(8S0b00l0 $0 #4R4$p@0,0% -LM$Pp4@^F (\ 0@c T#*0 ``T*:d R@T*00(0S, 00000R00#3,05$ 02,0(00@c T: lR (0,00 d R`4d R(0,00@$`0 (P4 -LMpP`@$PU 0S0 S P#( T b4`R(0,00 04d TR,@0 S  0P 00 -LHMPX  < <(K$X PL QP  \ 0 @H@ P4P 8p<`@@ < S5T5<5555555D555D55555t5l55$545x555,5555V_ P`F0zP Z0Sp8 ? 0 0VK P `F0zP  Z0\"'`?P  Uh 'w\`Pd JRh? 0 0V# P`F0zP Z'4,<'<$00 0 p80 0Sx  q 8X\aL  H00P@P(08pS<0S @PQ @P`0<` 0F@0 a4  ` \ 0cD0 P` 0`PK`0@ 0@ 0 SZ 0S8 j 18 QD`S@00<`X  \ 00R40 <P< Z V P`F0zZP 0Sp0 e pZ V P`F0zZP R00 '4 0  d  pdP+ 0S @d@ d & @0V@1@!T Q P   c0S0b0P Pd d @0P 0d P `d@0S;0d0 0@0dP+ V0 @ 0PS P@ Q 0@ R0P7@05UT: PUP `d d 0@0dP* V @ 0PS P@ $Q (0@ R0P7@05UT: PUP `d d dP = R d40,0 000 O 08PV P`F0zP Z 0@pSpd d  pW '4/0K0pK0K -0 pd0 JV P`F0zP Z1SM 8 0 00S0 7sEV P`F0zP Z 0 St5H5<55HP Z *Vx P@`F0z PP@ 000C07p@ ` @ X 02@CP01  Z*VV PP`F0z !PP 0 \ @% 020C80 03<1P@ Z*V3 P80`Fz 2,!P @0 S l7|@ l7tDH4 6 0 0H\ @D 0lSZ*0cQ(0`4 4 0a0a@0QOH Q 10b@0H0L0bH0 0Q0L@@0 BSL r 0_HPD  Z *V P `F0z PP 000C07pD ` D @@,0HP00eRp5 0 07@ p@0SL H R01S@1@!T PL >O@0PPHL0dPdPP H L `d@0 0<hd`Ph h@TT0 #BL 010 Z*V| P`F z 01P 0 Q RRy Rb  Z *Vd P`F0zZP :71 a A s0T:R8h#Ƞ 00Qhh@h\Pl35 10:V6 P@`F0zP@ Z  0 Q7hqJP 2  000PPWhS.0L T0l T/Np l0@P< n 2 0 0|0 Z7s V P`F0zZP <2("('8#R/ (2 0 0a^  0SV P`F0zP Z0S 1 0 0G@d@ @d@ < "<  < ^ e V P@`F0zP@ Z41W00 d R000  'Qc0#2" cQ|0S8'r0$ Q0 0J 0PdP @d@ HPUv @0LPEHP 0L  0^#긱AAAhAAzQ?AA0ABԱAALAA R?Q?AAAA4AVK P`F0zP Z@H b 0@  0\ 00 0S^ L0 l80S'4<,'<$0 0 R HP1@P 0 01HVQT '4/0K0pK0K 6 p 06 R'4000 p 010d d    p 08'4/0K0pK0K  < `L00H@@PPP<8p\2 S> l@L0T l0 T/^p0P(P< 7 0 07 0 0`l0pPX0Xd 0P P< < 8 0 0G-M00\`0 S\ 0 0  2R0 Q2B@P0 RPU0@ @@@ ЍU p0 RpW@0 00SJQS03<X 000Q\ 00 Q@ 4T $D@0 ^U010!W0!P808 0200@(0@L @$0, 840p  0@ , `Tp$(ń0@p@`p0 4 01# 1 l!c0  ll 0S@BpB @0 D4  4Q40A0 04400 2R0C8#(@Tw 00008"C^B4 0@ T< P`0U 0S (aR  00 cRU  0( 0 [S 3 "R< 080 0  0bC1 @000000d0U0P0S PZ $(,80>P00[P030"S @  7 4^)  P0 4 @0S80 0  04L0#04 0 @!@00 4P @0 !0084 0@00400@̠$0(@,`Z? Z?X?X?PMЍ$ R 0S-PMЍ$^ 01 0C$ 0 B0-PM Ѝ$P | 0 !400 MЍ 0-LM@P8$Q P*UEU IU[U(0S 0,$D0S 0,$@0S 0,$80S 0,$0,qU0$08gUqU 0UG-p,l A?@0CR0Mx8|P0A?00`0`0, \0 00@ R 40 0 0t%Q!\!  00 RY*PUW  0 ^@ 0@ST@ 0R 0R`  0R' 0R" 0R 0R 0R 0R 0R  0R ` R 0l#PD 0@H08XT0 H4."D H @ H0D 0@@U*0*S -LMPP@$`Q00V0SQ0Sn 0Sh  :TRpp Wb0S *R(0P(@ ES_ IS [S gS. Q TRZ:Q Rt0ST 9QN )21C00@S90PPpp,P~0(0,0Sq00 0S {8 0 80 #4 0 8q000S 8 P T  0y T UP ZB0SlS@ 8080 #4 080 #8 0; 0  0  "4< 0 "88 0 04 0BL0S0c00s3Y) 00 S&0B2l 0ĀRX'  c0#2c aq00aHl0S 8!A> 800SS@SP ?R 6 0S   0p W p  0 S,0S ^* n88 0 \p,0S ^:W0[0 p0$0S   0$ p0 0W p  0 S,0S ^b:r 0 \p,0S ^|:W0g000Se 1 R !"* 0   1S 0 S,0S \#: 0 \ ,0S ^* n8r80 R I00 0\U n8^8 n8W88!`] 0SC{[00hg00kI00+ n868R n8.8z %8 000C 0 }0 0^a , 0R  S $0QPS 000 0 0  0#4 0 0#8 0 0   R  0S[   0 0S  0  0#4 0,0S6 E0 0  0   0   0  R 0 0S!0 00 q00L0D 00pCL   BDO8 ~8RʟR0[?[?B -LMP@P$`V q@0 T00?Uʄp吐"!B 0h 0 P  0 T h 0 @ |P p[? -LM`t\EPPUl8 H 0XT 1#D04 H00 @ H0D 0`p0Xd0x` 0\*,0lpA?C0ChQ 0BSM``0Sxlp\`0 SdTTT4aLD4A  !t@(4, 0! 0A9!0P933;ӗӅ@! 0@D00tx0l#3LPlptxpTlp:8 H 0XT 1#D04 H00 @ H0D 0lpxLQx0NUp0`0hlp= tBPPX[tPUZB UPh0S 28l  @RP 0C!@ 909hP\l P80 `Z00{ l0\00 RtZ\ R80 b0g l0\00 Rh0S( ||18  0@R0`1  @9H!0900CQ lptp@ lpt0Slpt0 @hl0t \l P80 `0 l0\0R0 R S xp00c Sx0`0 lpQ`Z]?[?  -LMPptDQQl8 H 0XT 1#D04 H00 @ H0D 0pWl` ,0l`A?C0CgQ 0BSl```\spDCD3a83L  !3, 0! 0A9!P0922;ӗӅ! 0002 t`0 BQl\t\PZ0L`0l08 `l` 0HX T2#D04 H00@  H0&D0 ` p BR` l``l`^j \ R80 b0M l0\00 RYxx1 8 0@0`1  @9H!090tl` 0CA`Rtl`l`8 `0`0l` H0XT 1#0H0tQX Q!\l P80 `X00l0\00 R XR5Q3l``-X]?[?  p-LM 0!PCUQ@`tP7l0\0 Stl0 P0`Qt08000 al0l0\0;0 R l \,0 aA?C0CR:Q800l0\0$0 RxIt0p03VQS \l P80 `V00l0\00 RVxVx 01P? M"# $P 00S ЍP0SЍ p-LMPPx$`V (0S ,0S 0@0 @0@040  0R b R0q0*0R0,  @8(@7L0D, 00 < @CL   BD`21C 0 0|` H@l@\@t@x h@x [? -LM P\p` (K0@R1S  P(0 S0082(0,0S,2,0qV`f0 V 0 `F0 0HSUV00V0S Y00é?Z00ê?80 0[-(V `@P@ 0Πh14 €4 $@B0 0A 8 TP 0`,40Xp40 L00(8, 0(@L 0(0#`D 0 (80!S  @0S D0S P 0`\ 00$P儐删(Ko404 00 0>_66[? -LM@ 0 0=KMЍiAMЍ0`MЍ[?M ЍIC M0ЍDM 0Q09  h0xQxA L0LQ80 0 00 0Ѝ | d0p@-X0X ;T0`&N,;D0 @P`M B[$0K8;`Ѝp@TlTlTlG-X1p0\;^ M0100110\[`1@ 0T'+ 0 P\[3P`1!0 \[\1!@0T:`P@0 R P0`T 0\+ Ѝ0<0 R0 P\[PXA-\p10  WM@? `P! 0 00P`  ^`  P0EW#10\^ \^ V T! 000@ 000 \, +-Ӳ0Ѳ000²0Ѳ0Ѝ| G-M0@SR 0 0`1V0ಐ Z > VEP 008#88#800 "$ 0 c\ 0C0PU0:0. \e0nPLuʰ 0PU00*Y   Z  0000C^ Zh \$ 10. ⨄pP0gUڔ058#88#800 "$ 0 c\ 0C00`F,4 pP0gUu $058#88#800 "$ 0 c\ 0C00sPUNڐF058#88#80 0 0"$ 0a PA~ VA$3pP0gU+= 0%r0P UF058#88#80 0 0"$ 0a P AMЍTF0 5 0C4Ÿ82 % 2pP0gU/2 %qP UB F058#88#80 0 0"$ 0a P A T0 5 0A4D!058#88#800 "$ 0 c\ 0C0p0P Uʸ F0 5 0+-058#88#800 "$ 0 c\ 0C04p0P USF0 5 0 0@-0@P 0CU0 M0! 9090 0@SЍ0p p 0<010)EQ )<0803ӗӅ1(0  ]?[? G-4@MP '!0t`P0fUڜ058#88#800 "$ 0 c\ 0C00,4 Q*04 0CⲐ Yp 3+ 0̣` P0fUڸ058#88#800 "$ 0 c\ 0C0 0\3QU" 8#88#800 0"$ (0a"(R#A IX223pӗqӅ!0` P0fU}t058#88#800 "$ 0 c\ 0C0 0$2QUq 2  e^`a`0>8#88#800 0"$ (0a"(R#At1  QN:0TkpP0gUF<058#88#800 "$ 0 c\ 0C00 0 Ѝ0 5 0S00 5 00x0 5 0X 0 >0< 0 >0Z 0 5 0]?c? 0 Ld A010 Wdd 0 T0S0`0Yip 0Xp \0@pװ 0#!X R 00" PUdQO G@2 R 0> 0 0 Q0CRA 00 B 000d0 0C BSd0 W> 00P0 # P R 1> 00T!Q@@PE 0Sc0 N!! p^P Y BP pI L K 008#\h0S P@ 0^ `(K 0S08#x 0 ` 0R(K0 rC hPU@(KP=TX< 0@-PM0@S S x0 0"$0C0 Ѝ0< 0 #40   -LMbP@ Uzژ058#88#800 0"$ 0a\à A882(RpgPPŸ+0Რ08#88#800 "$ 0 cZ"0C0 0!a0P 00eS' U:x0 %`Q XLL0>8#88#800 "$ 0 cZ"0C0 0^0  ;㳠 0 0 0 % 058#88#800 0"$ @P0a\à AX 0 >0^?@-0M0@Sp  0#4 0 < <000ЍS0 00 -LM<@ ^pP`A 0>8#88#800 0"$ 8 a#8S2 A00  8#, #808#< U0 0 \  0 >0 -L M`pPP40 @2RU+o&(+jԅ@010> 0 R@DT0ş  5 0 ^ !0S  W R0QS38#88#800 0"$  8 a#8S2 A0,S@ T J048#88#80 0 0"$ 0a P AZ㠂P 30 10> 0 ("(("(  0#40 P0b\à B U  Bp P0 10> 0P U 00P&M C@   40h40S(K40X048#88#80 0 0"$ 0a P A40058#88#80 0 0"$ 0a P A tJ0 4 0gT0H . @4A0 5 0 Qc?^?p3pss -LM@`PPT T pT *p00 p@P0T0P@iɡPPܲA 0- <LM00CP@ S <60;60;60;60;60;6;6d;6d;68;68;68[1??3 0 00K0 90  0   00#2+!  RH<6P<6d<6<600 K0 ~0A10 00  Kp 0A100 0L0 AUU33 -3LMS`p3P:W) @P0@0PU %P :(KQ @ @D l0 K40KP 0 P UJ U 4ߠ$C@$;03$ 466cR <0  "82@<\!l\@  0 R00L @U[ U; T8H"@0S(2@4 :#::cR<0 0D0 00 R !p14P1\ R 48 K48 1hxp00d1 R PpD!0P01\ P,1R' 08 K08 h40D0 R p 4P0\ P0R 48 K48 hplp` 0PL0\ L0R 08 K(08 0h CܲAsAssPc6 -pLM`p P 0 Rx5L l 4 y`@P00000C0yL 3Lp,A(sUl 0-LMPS@2~s 88H00H08 -RLM@-0 -RLM@!0 -RLM@0 -LM8  @0  R uRu B0  tR RQY10P:80@0C`s4 80 * U( @ k x  b`  40 Ep6S 8 Q q U:*P800Cs80 (Ku0 RPE @`04 @D 00` tU: PP p 9P H1T,P @ 4 (sA AA(AADJAPA̳AA8AܳA -QLM@Kh@t=l:d6T1$D,H40&D$Kh!lAA4AAԴAA,AXAMЍ - QLM ʞ<+A p-LM0 `K  @PP  0I|KpE6 0-LM@Pᦞ 8h{AE6MЍq -LM0wp3 0-LM@P> `S  `0$$ L800# $88̵An?xAApA -L0M` ʟPQ 0S @0S @Q9% (K @2S' %.9!  p@A0D0S0 +8 3H 8 T0 D9P <)09 @ 9 )TL < 4 D x #0DWS񟗤O6lK6lK6lK6lK6lK6lK6lK6lK6lK6lK6lK6lK6lK6lK68J6lK6lK6lK6lK6lK6lK6lK6lK6lK6lK6lK6lK6lK6lK6lK6O6lK6`O6lK6O6lK6lK6lK6lK6lK6O6lK6lK6lK6O6\J6O6@P6lK6lK6lK6@K6,P6LO6lK6lK6lK6lK6lK6lK6lK6N6N6N6tN6M6M6M6M6lK6lK6tM6L6L6\M6L6lL6lK6lK6TL6$L6lK6J6lK6L6K6K6 T0spA0A0S Q 0Q0 2 8@TJ%40S %%vD T |h8%0%(0 0@%$%%( 0 8 H1?3  ?#%{ u%odj`@pT 04 Z DW p@T w04p@TC ?%90!1 L*%t$%\O8OSp<#B %$40S 3  Z p%p1?3?3t3t#0JS$Jt %L30St 2t  W @%60S %4<| thKA; @D l DW!p `@0   db^PHYfU\THy<%(as5e'f?Tm?DA@m?m?m?m?m?AĵAAAAA@AAhABATB@A1BXAl CAMЍ M Ѝ+e?MЍɛPA000 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 2 R 2 R 2 R  2P00 R@A0P0A Rbs_notimpl_%s: args at %p-(O ᷛ@mmap@r_1@r_2@r_4@r_8@w_1@w_2@w_4@w_8@rm_1@rm_2@rm_4@rm_8@wm_1@wm_2@wm_4@wm_8@rr_1@rr_2@rr_4@rr_8@wr_1@wr_2@wr_4@wr_8@sm_1@sm_2@sm_4@sm_8@sr_1@sr_2@sr_4@sr_8@|c_1@yc_2@vc_4@sc_8 -LMpH`@PL 8P$1( <0D $00HH!0C00wwww 0-xLM h0 hA $0P  PUs8hK$ @D!M0D1hmrpsxsps2-@tAPr?0RW` `Y6P 0Pjo +1PP0OxPa2 7@0H!t1*4 t t!40L0C0$Ks4psssss}>vlNl@AVlVlpshmr\A -x LM@Q00 n hm8h?0  "!8_ WlAxA@-@QM >0^ 00\R Ѝ0M0$0(000Ѝ -SLMP`% S S 1!p $pU4W @ PH `@H `@P h`bbp@ PH `Z* ` Pj $@L dsssMp@-M0`R 0@PU ^ 0P@PU T0Ѝp@ЍT -LMPᠠZp` @ (0@Z -LMP Zp` @ ,@Z -LMPᠠZp` @ 0@ XZ -LMP Zp` @1@ \Z p-LM ` 0$ $@K P`P @ 0P%$ :8 ^  @ ^ 8: S@21C* "!B 0 :0^ 0 Kp -LM@`Tp*  R $ PR @0PS L   0 P  @R(K @ x -LM@ \ 0P 00c<0 0匢Xpw `tŸ Zy4 K80K + 4 0S 80 Ro >*"*0L0  080@ P @0T> 0\:00Q^ (KP 00b0 :#: :cS1!\0 0<  000`Q!0S P 0pW@21C0,000X ` 21C0 0@T\ <,0 0 S0@ p 0 0 K p 8("(8Q0 "*46*0 (00S 0p s  -L(M$( < R`8 080 4 VR"PpPP%8V@10K0<4K  `V 00pR00SP 04 8 $00( 0(K -L M`$(p Q,0W800  PP p 3U00S 0S  @0K,K QR 0 0 00$( p0$K -L M\@P$(`3*KpȌ( $K(K pP(0 0 $P(0`p. 0 MЍ>?>? -LMȹA -LM>0^0P0@ P* 0Y`p@00T*U U  0 J0SjZE Z p(ؐ >?>?>?>?sA -L M0,KpR,0 ( '`00^*P0.Ơ\|@ : c21C!\ c050:00(00(  ( 0S`V - K|r $ (    MЍ& -LMp@@`  ,P'P `00  000$0(0  0@-P@MP# T!00Q:P  RR*> 00 0 bR !. .0  Ѝ0 >00 >a 0Q00> 00 -LM8 < @@0  < 0<0S 0 Q <Q간66663p(K <0@ R,` T: `@aQ80pPW ^ U:>0 >0 S00P`<@ 0pdWp! @00S@0 @<@0\,` pT: @gpW PV:`e PU8 00Y40   ^e Q:>0 >0 S00`<@pd Wp!0fWp!U @00S@0 w @`<@0P,`k `gpWPU@ePU8 00Y00  Y Q:>0 >0 S00`<@pf Wp!0dWp! @00S@0 2 `@ tt2 0+c4 0 %0 0  sxAAPA0An? A -LM@xPQ $3\ b  S] 2"S0"ƍp1E1@8 1 82XRR0S Z$ t"10@T ``"$KmՍP2 RJ D2D R ,, A0B%@徍Z$K帍1  峍對 0!!dpcPP坍LᚍZ2 : Z18l名1 0\勍T$Km膍H1 1R0 \a0@PLŠB%0P @`f1`c]`Z]WS $KmMA0n?xAsTAغA4APAAss`q?AD}>ss sq?,s|AXA`ADAȺAAAA(s sAܺAA(A AADA 0-@@LM80P 0|1x!8hpss-0M .!  !!Ѝ-0M .!  !!Ѝpssss|sss@@-``6,`t`6 !!@@- ) xp|p`H! 0 p?`H0 !@Ј! P :PP/ U  Q U  -Tp!W R X!P Zp x U W( Q U0  !@Й! p? pG!@- ?e !iDЍ܌pMReset vector called, LR = 0x%08x-DMO- @0lP @!1 ! ,OiDЍN  0O   ! -- -i 0+ 0!0 00@SK0hPpP\ L0R  K< hp0\sssPc6s4s p-LM0!>00P @+.  0;>00 0+. Rp 00PKp\`pP\ @0R  K0  hps@WlsPc6s 0MЍ<s@-`0@MPЍ R 0S \ R<s@-`0@MPЍ R 0S \ R<s10@-0L@ @0 000 0P0P 0 0 0 0 @0 0 0 M@P0?00?p0 Ѝ0pss @sLsDss(stssds6xs6sTss`s\s,s4ss|ssPss(0 R 0a B0MЍs -L MPD H 0 S S < @ 8 \3\#0 @0 P38 0<0 >0>0S40 m @>H 0+ 00)D 02D @RsHH JZQ H0 @46ZS#PP D ): RoP 8#8ZS#;8H )6?> 1@pPU@" WU>0002 R apP\ 1R 0 K0 hPpU@HJȌZH 4(K <)6 H;#;  1 0!@QH0:JH0 QpP\ 0R 0 KE0 hptPpP\ 0R 0 K.0 hp\0\ 0 @0 P08 0<0 7 <刃 4元0僃\s,spsssPc6s4ss|sAAA p-``L M^P @ 0000@^Kp<s p-LM`S@P .:8#*l! #8\ 0"!B Q 00S:#50 600x0s A p-!:LM@ P0S oP\ :#p1L R@# L00P!00SDaHKp$!$1 0S : 00 00S`H`pP\ 0R  Ko  hph`pP\ T0R  KDX  hp异psss\s Pc6s4A -LM>{ 0 pls80M R(0 Q 505055ЍЍulsLWlPWl -0LM0S | 0@T00 KKhvL00.*@ @@@S0@lsPWlNlLWl 0-0LM@P0 0$0   R00 Rt P ` `000@0  0@8$0)$U3lssHp@p\A -p3psLMP00L 00 P U4 0So`a@P E201^ 0"!B  APP0 " !B 000 Q P hP UYZ @: JT * P  JT:bRDB$r00쁟!c 0![ !0S!0N@1CD ?FD@b$J@$B!`!0=21Cc!8!020!01@ @@  0  Piz 0Paz 0@Yz0 @QzD(KX 21C! cL P|N4psAAs0shsHss8p :#5p\8 Q9>0( &#&R+:0R(*0a"!B10b @PP 0T0U 0 D  D 00*H#&R:0R:(K 0a"!B10b @PP 0T0UD  D 00 0L1 R <1p01P1\ 1R 0 K0 0h0p 0j0$  0S@ 0 R0(|0h0p\0PH0\ `@0R 0 K00 hp|rssPc6s-PM# 0!R0P  0S 0S  R00P00 0<   0 000Ѝpss@p 0-LM0@SP 0SP1000T' h1S 0 T 81S 0S 0S  R00l00 0X   0 0 08P$00ssps@p -LM 0@S 0T0000s -LM@PP @ p4Q 0 pR Q 0\` @R^\gTc P^ @D4\ @TV \ 0``` *(":1 ` 0 p^" 2C 0S0 :#5 PL  0S 3 R h3Q d3 R 0RL3p@3P,3\ `$3R 0 K0 hp@T2(K2U  \ R W T*P @ `; ^ h2W^4``(*(":1 `0"\, 2C 0S0# ! " 0L0  0ST !1 R 1Q2 1 R. 0R+ @T :#5 PLj Uhn0S 818 0S 51Lp0SX 08T`p P\ 0R 0 K 0 hp0S t0( 0S 0S/ L0(+80Hp0XpssssPc6|s -LM@PpU`  0S 0` RH  \Q% R U @T ^  \ 0h0hS 5S 0h PPU\  iu -L@M0`Sd T7P L7 R 0R 0S 0\ \ 0dX9* X (!*! (::d 6S 1\L !@ 0"!B P9 0` 5 L0X#T %*:#5p P0 hp T PUj 4P0C4%&Rz:0Rw*0a"!B10b@o  O%R55SSH0SL L R0R01%0ZD0`0óD0D0` d5V  D0`00D0Y; 0S@ 0 0S@@  q000S 4V6 4 R2 0R/ T  T L0hSpP <h00h0 \0S (K10\ \ P  @\0S 0ST 0S00 R DpPP\ 3R P0 KP0 hp\ RTX0R0X0 C DpK0S 0S0Si@0L0 R $3VA 3 R= 0R: \ Zp @T3h! 0S 0SB 0S 0@0S 0Sk0S 28X0S\  0S000\0 `T vdQ(K(RpP\ 2R 0 K"0 hpL1T@1( : 0SI0S@D0<04 P!0S0\0 0C0Z@ 0S= 1880Xa0H0\0 h@pPP\ 0R P0 K|P0 hpl0$ T0T<0T q 0(ss|r0u?pssPc6 *t00t!t t1 $ 0R10" oko1S 0S 0S  R0000 0   0 0 0h@00#! 0dP0  00#!00$00spsts4ps8s\p@ps -LMP<  <0e S030#U40 8 %*8 %!*! %::<6S1\!p 0"!B Pi 00Se Xd:#u@TY W 0S$&Rl:0Ri*0a"!B10b`"000ScV4  0  %R55SSH0SL L R0R01"0ATD0`0óD0D0` 1Z]   sD0`00D04QE8  8 4 ZXpP<0S{4Q 8 0SL 8 0S H14  (K0!00`S ApP\ 0R 0 KL0 hp0Pi0 S  0S x08  ]0S D0(0S 0$00|rs0u?ssPc6 -L M`t PP X "&R :0R*0a"!B10b0@0 @ p@@@@V  Y g (K**(":10"P 2C 0S0 Y : #50P8 <0  8>0S@ (#&R:0R*0a"!B10b@ R8 D0@ 7\ 4  \ D Dp%R5 SH0SL  0R01X'0QUD0`0óD0`D0`] P` @ 0@kV 6 Z4 4 8 R000$ $408S VV 6 RR 0RO 40< 00S @Q %Ry5S@SH0SkL R0R01&0ATd 5V2  @ @@D0`00D08V  D DD0`00D0W@d @D0^ @[40< Hu00S_,5 Z 4 *:$  0S@ 0S tpP\ 4R 0 K0 hp}@0L @ 5@ D0`L R225S&&8< 0S 7 0S4  3L,0SW 38RCp<P\ 3R <0 Kl<0 hp  D DhHu0S- (3((W0P40 4P V 2 Z24 4 \ P D }Dp%R55SSH0SL L R0R01H"0ATD0`0óD0D0` "Vb  D DD0`00D0 P`80 0S\  0S ^ 1L&l@@D0`0D0%D mDPp P I 0!V   4  @0@ @> 0PSt `r80o Wm 0Pg 0S^ 0XX  D D l0HK 0S H0X 00H0uls|rs|s0u?tssssPc6PAp|A 0-LM `@mP0 04PT@:<0q00 0tK0\ptss -PLMPF 1h1S 0Aq@p`T P 0S ` U  \`PV \ 0S- 0S0S 0S 10#U@T% 0LT# 0D0 0 0S t0X 0S T0T0000H0Ppsss -LM0HQ8@8p@x K@,@0S1[ a AQ882r$K`pP张\0 S , K, hx@p0[ Q pP\0 S , K<, hphssss8p!00PQ pP\5\0 Ke 0 hp@T0H6Q0D4DJD5p:#:S,050%$PQ0K)Pw '*(":10"P 2C 0S0 000*"%0㘤0@Q*ux4P :*#:"*S3*X4X$$@Q  0TP< 8040 %*(":10"P 2C 0S0 400*"%0㤣0@Q*8t#0@Pp?t30 P@0 VP3X#$Q0K P p8 0 P 80 @0!*(":102\"w 2C 0S0n @ :#5x 0Q80 c@*0S p@P\ (2R @0 K@0*hp  < 21C @0f!0001 0+ !;0 0P 8000 4K: PMppP\ 1 QR 4 Ka4 hpp8P\ 0R 84 KG84 |0hpp)pP\ L08R 0 K(,0 hpXsssHpsPc6xpnr|s0pps4p0 )Р)0 ) ) 0-0LMp4 40"!B P* P(ڨP0 R00 0l1R0C00p1@C\PU T 6 @^@D H0L@8ldWl\WlvlXWl ss -3LM , 3cD#\0s C0S xC0S ( ("$PoL30p82 #{P@ n 0Sk @P ot OKㄥ2~Ϡ K,2 ( <Po00 @pP_"0S? 0" ~p@g00^0H PU@`D@ (@K(0  N( 403ZUzj KnVlslA -`1LM0800 0(0K 3pP (KK!pP@0(8 P 8 Kp4p 0 0 BpP0@@ 0_  Kp0 0pP0 00GHMЍ 0-LM$ ( $ h ,0 H!P + 0.Hf$0H!.@ H1:40 $4PH1L@E@ 0H!L O(Q, 0800` E`0$0004 K0tps 6A- QQQQQQQQ RA- 0@P`pQQQQ R@-M Ѝ@-MЍ! !P: ZŒŒ#! !P: `B!,aB 0>ZJJJJJJJJJJJJJJJJJJ }J xJ sJ nJ iJ dJ _J ZJ UJ PJKJFJAJ=Q:Q:Q:Q:Q:Q:Q}:Qx:Qs:Qn:Qi:Qd:Q_:QZ:QU:QP:QK:QF: QA: Q<: Q7: Q2: Q-: Q(: Q#: Q: Q: Q:Q:Q :Q:QA ? QA ? QA > QA > QA = QA = QA < QA < QA ; QA ; QA : QA : QA 9 QA 9 QA 8 QA 8 QA 7 QA 7 QA 6 QA 6 QA 5 QA 5 QA 4 QA 4 QA 3 QA 3 QA 2 QA 2 QA 1 QA 1 QA 0 QA 0 \aBC`B0QA 0 Q@-: R (2 R R -PPPP RrPP B PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R- RP1P P1P RrP1P  B P1P B  R010 1  B R0q0`0q0`0q0`\0q0`0q0`0q0` R 0\6 R B0-81, Ġ%̌T$\D#L0P  R0 Ġ01#̌  R R B0-81, Ƞ%ȌX$XH#H0P  R0 Ƞ01#Ȍ  R R B0-81, ̠%Č\$TL#D0P  R0 ̠01#Č  Rp@-@PM`R Ѝp0-@PMЍ00-RM@P \, 0L 0l4 @PЍ00-RM@P \4, 0L 0lRQ@PЍ0QMЍP: p-QLM@P` S 0V pKppS`@rP`&0-@PMЍ00-RM@P \, 0L 0l4 @PЍ00-RM@P \4, 0L 0l51@PЍ0 p-QLM@P`S$K 0V $Kp$  Kp$K@rPp`p@-(Ƞ 8!"(,Ƞ M@P S`b `c0#3 Q. a l^#(8.(030# 803# (0"P@Ѝp.8BA Q ! C2 -QLM@P-S'pU#`S PW0#03d g0U f  e00#2 S06"l P@X t@P` r0(@pP@-` a@M \BЍ@-@MЍ0@-@QMP a0 120^0 010Ѝ0 -L`M@P`p d5^`^0p(KS P  0W p#83K8#8ᾃ[0 X$,8`K("X&3KK0@KsKK3KKSK| t >@K@[X>K | t <@K8[X0[ 3[H3[ 0S H $HxH $HhR<K| t :@K3[t S6K4KbP   40KP0 P PJ0S  j0R A EJ JK 0SbZ X#T p %*T0p p 0  Sp :R t0P-tLp (@T@ t|P`  0x d X l0 ldP\  U4h  HTT|x h8RIT0P:t^|`t@X0T \ a n"88c @.d P0n(#8d0"(  t\0|`tX0^ P000A#Ƞ 8d#8 d00Il\ JK0l 峐dZXd X Q" p R t0ZPp L0n0p 3><AZ0@P0#[[[2[x h[[$[4[xh`Wlp@-c@bP`MT !L2ЍpQM:ЍP: -LMv K -LMKmK K0-@"P#MЍ0<0 $ RM (0("4SЍul<0 $ RM (0("4SЍul0MЍul0M  ЍЍmsp -p LM0S K00LcH0H@ @@@0zP ,0 $hhLpxu?vlvlyl \DtA 0-PLM 1R 1 8xA00hQ 0寞0T!S S00S@ 0S S00SQ00 R R 0 -R R8Q @a0AS$7$7$7$7$7$7$7$7$7$7$7$7$7$7$7$7$7$7$7Xg 0Q00@ @ + DSBOpsvlvlA -LM_POCf0 K40K<f4嬧0`.VǟP@fwǟ$F@`xǟx 0E`PdfD0 T0b#6`P0X7 @T:00C)0k`0*V0c180 ! I@9#9S &@0^:6BAD@L*tI0 1`0b*V0PX} I$ITyƟ0 C\ fs:00C *0)0 C\Ub:0ܥ0C05 *ş 0B10a\0tJ:0 0C0t5*`ş0 0B1\<0a03:0 0C05*ş 0B1\0a0:0 0C04*Ҝğx 0B1\0a0:0 0C0l4*㻜Xğ 0B10a^0:$4L*奜#SA Ez2T PC  pZ @C0pßS@ ^㘣N@PƠ`@&l0@:  0e@0Ÿ: @): @": @": @8 9@ hB{o  @P: TL2 4$\2 0Z<Ÿ0>0>0 a"&2 !A  $ t1!1XH%4T X!X1X T1T!P1  !0 8 " 1 00 =(떯0 @|0 (KeeeAylA s s svlssAsssss sssssp sD?Xs#s tsxu?VlsUUUUs4p6WlȔ6Wlܑ6$WlspHA0AA -PLM0@S  @(?P?0  "!  d|d㥲|㢲ddC4 . }>B?  S VABdWl1lAAA|AMЍ 0-LM@P ~d)FK0`P:zP0c 0KEP$0$dd四vlAvlA -LMq)B 0 h=dAWl -LM@0( 0 ,0 7@@  00KpLP@ W ,0;,0u1  $K(PT00K` 05, A$,t0x@00K80 4@ (P, ,090,08P N@P08K@$0D0e/, ,, ,090,0 1@q -LMPpB@P t0  $K(ɸ0@ `pYL@PV ,0;,0  @q -LM0 -LM0MЍMЍ0M00  Ѝ p-LM@` 0P`@xN70@-M@$T P@  @ 0Ѝ0 0 00bSMЍ- 0 $400`SMЍ -LM  @$B (0  -LM000p p-LM@P㲙0U` U U Kp1 >0 03R0S48 L#ȠR5757575757 MP pP) @P <1Q Q 0RS 0R S  0 b0 b 0 b 0 b x@0@0 bP0 c0\ b 0L ~b 08 xbPpu?u?TAA,AAAAAA AA -LM80,$ Q0 b K8A@A p-LM00P@qT0`  0 bp0D0S 3S@x 0sb3mb20940386<5 0 \1PX!X Zb70S9088;<: 01@კP&>Q @yP xh9b 0xh0b.b20 @ $b!bxbpbhb20,Xb Lb20,PA@AADhAT]A AxAAAA`ALA4AAAA -LM00S S S@ 0TLH @Da)P 41Cc<qA 0-LM00P0p0C0Sࠃ @^   8+820 ^4:74:7p:7:7;7(;7X;7;7P:79797X:7P:7d:7 0$ R0@$0 @@@@X 0SC <0= P$RFD1R;B0CS8h<0= $R2 1R:BSV@< =04R SV@@ *<0= $R@@< =04)7 0-LM@P<00CS000@@b<8 p-LM`Pq<@@@T<Tx -LM`p@P PP V0P ?PP  0-LM@PP 8<P)<0(0S|Q(0S|Q 08 R0000 0 0  0 0  0 ; -LM@;8 0C8#88 S ;h% p-LMP@0`` x;0S000 `@@;xx -LM@yhG -LM P@`;0S00p0 0@@0p;. 0-LM0@$PK00l0p0lP;l0S H0 \'l0SZ;p K0蠉?<7 A -LMp0`( K@(0 $ \;$ lR0000 0  0R00|Q $ P P 0S0SP00000PP P 8P0C8$ 8S P0 &8S:( R P000$0 0( RK>7A -LM@:0S 00 &0S Kh:A -L0Ml8`K@pP(@ P KP@K$ 0,?>7 0-LMPt@U8h s -LMPpX  `AW@P @C0 `P 0tp s' -L8M0 7 -LMpP`@P P 0000 P`0 %%%Ġ_0 P0pPk -LMpP`@P P 000 00P 00Cp0xPK -LMPp`o@P P 00 00P `@0V01#Z 0 pOP" -LMPp`E@P P 00 00P `当V010# 0 p'P 0-LMP"@P P D0U<0 0 0 P0 P80u' 0-LM2P P@P P 00000 0 P0P8 -LMP `pP0@P P < 0 0 0 pNPK' 0-LM@PP@ 0$ 5:9  p  l  h$  d@oK0 0-LMP@P P 00$0 P0 PV8' -LM@ [P  z\h%(A-  MЍ8 -LM`$@S 0Kh!s p-LMP`@S xh_ !s -L Mp`H@PfUP  `@P 0I2K!s8O7 p-L M`P@@KUP  P@ 0@/2Kp!s|O7 -LMx@T K\ 0Tx@@U@U8 4 0@UKhUԌpDA sLA!s -LM0S` Rp 0@ 0SZ" S <00SO >0"0Q] 07PP7 04SP1Z00@ 00S= ;<00S9  R00 0S 0 480 00S$ 08 <04@P(K  0PPP"P0 SP R00 0S 0 480 00S 0 480@P? N -L M0*S$ SD AS S08 <04@  (0, $  S (S S |\08 <04@ 0$ $K0 480 @ P``0S<0S P` 0@0P ,` ,H`P00Kp0@PD0` p0@ L#D <P`0@(!(D#Lp4  0  8 <040XA -LMPp`@P P 000$ 0"U0P  0PY -LM0@S`L}PP `G ^00 R00 @ ` 00  0#40   0 0`P=00;000` P`70:0 0p0 p>00( R00 R 0(PT0 00 0 000000C2Cp UP 0 0  `P ` -LM0PSpF 0SpB`P p=  00 P600;000p PpP0:0 00 @ @[@B Z (0SZ7\Z7Y7Y7 Z7|Z74Z70[0 R 06P uT TP p 0 00[0$ 00b $0[ |Y Y 0(%0[0 Y 0(0[00[0 喿pPp(B 0-LhM\P P1\ H1\00 0`Q! 0$ P 0ă \ #\ @ 0S@ S Q PT $KphQRP P ?8wl -LM0R pO 0 4 P`0  VP- 0`S0S< 0P 8 'P4 4  <8040P 0R 0P 0(K -QLMV(B -LM< 0p,0 @P= 9`P pßp ^`KD PK=@KL \  0$P@iV2 u dV#30 ZVx@T ^ 0S[ 0CS2i7i7i7i7`h7P20  P X{j7 j7(j7i7i7i7i7i7j7j7i7i7i7j70j7i7i7i7i7i7i7i7i7i7i7i7i7i7i7i7i78j7Vx 03 0SP U0S  Vx 0PS@ QQ 0A0_S7Ux P0@S@, 0RJ(K>0P!0HU@V<V0SP$Ux0P @RUx Ux Ux Ux Ux ȠAĠ?=꼠;긠9괠7갠5ꬠ3ꨠ1ꤠ/ꠠ-꜠+꘠)V-0l@*B$*BD*B`*BT*Bh*B*B*BA*B?L*B )B8)BA*B*B|*Bt*BAl@)B)B)B)B)B)B)B)Bd)Bl)Bx)B)B)BԊ? -QLM@xUp;B -LMpe`P`' PP` 0n@00@0@T4| (0|`庠p000 0S P W`` (K0S 2W02 : %P@P 3  \<` : ᦋ:OV W`2 |000 Q <0 @R zR{ R   pwp30@P0S0"0Q`C 202202  202008@KS!2(022003 S2ձ02ű4 8P 2pPY <0S 2 81 - 192`2 `   }X1 -[`Rp0Sl$ P 1!2:2@2<2  mP 0S:^OP 000   뼠 :OxWTxP6 40 Rd⻊P_< : 㥊P` W978wl??d\7j7X27D27h+A0@-@QMP0 2T?\0S 0RЍ0Ѝ0@ -LMQp`@0P02^-?\0S' 0R$@P! 2`,\/`P2 00 0SxPq )`  -LMPQ`0p$2U!2S 0S @ P 0@ P00P00S 0S  -LM0`2pSPP@ P00"P00S@PR@-qrM@ \^  Ѝ@Ѝ@TЍЍ@ -LM P`0p,P  YP 2 L 0S@ 0S P@(K>0 !0Q1NP 0 0iP)08 <041S00  p @00@S 0pS Z "  M M?8wl' p-LM0P`2S@2@Sxq00r M S\ ЍlЍЍЍH0MQ 0Q Ѝ Ѝ 0Ѝ4Q 0-LMP@‡8h 0-LM@P T,P 8h--8 -LM00 PQ`p p@ 000P @pR -LM3PS`p p@ 3P@pS0@-qr@MP \^  Ѝ0@Ѝ0Ѝ0@Ѝ0@0M Ѝ p-1LM` Q08`000 2S020 23 0S0 0*R03S0 @00lR040X>P LRKph4 R00$PRWl8wl*BAu7*B*B*BMЍMЍ -RL,M000 `  P0 \LpP  PP D# 000 p 0@T08 <0$D Y0L H0  08 <040dL>0"0L@Qt0@uP  R  LpPm  PPe 42 0a0 p 0 @ @ @yT KT\s0@00  Y4 080  < 0@0 P 0 8 <040T L 0@,H0 P`0@D40T `  p8 0@ P#D p<P<0` !(@ 0@p#L4P` P`  KD0s PL K `P`(KY0P`0P`KP`KP`K N? 0-0LM@0@PK@2  8 0 S :;;S 0S (0@0@8@0cS -LM@` KPP p# @P p 0 0p00 R0 P0  !40 00pyW00  [K0u -LM`Pp@P P 0000P0 P0VB000%$00@0P0p tPG 0-LMn@P P }>0aP48 0-LMP[@P P  00}.A0 P0HP8 -LMpP`@@P P P 00 00G0P0p`0000%P N -LMp`P @  0L 0'̠''D;0(T @0pP@@  p-LM`P@P P  0, 0f0C P0`Px@ 0M"200 0p0C0SЍ0S 0@ <0= ,$R 0A0 0ЍЍ -pLM@` JPP p @P p  0 0_0C p P0  0#$ 0 phW 4MJ 0$ R p0u -LM@` tJPP p# v@P p" 0 000 R0 P0  0#$ 0 [p.W 0 $ BQ pׅJ0u -pLM@` 8JPP p :@P p  0| 0_0C p P0  03 0 "4 0pW I+㝅0u -LM@p JP @2 PP @) p$00 0` S$777\7777077<7t77[ 0  00 ;0@T0#30I@@\0 @00 30 0  BG0 @:0@T00 [0 0030 0 + @qT #[0 0030 0 + @YT @\0 @00 30 0  B0 @:0h@;T0000[00 0""Ġ " 030 0 + H@Tr03 0 "#  0 #200„b[0 0030 0 + %@TO000K[00 \0#? 0@= [0 00 ;0@T-0#30 !  000  00\00    0 :0@ 0u -LM@PT H`P e @P \ T0 0x10 R0 `0  !40 00XDP@hp60T00 T"" 0T00 T"" 0T00 T""  0T200 T  0T#20 TT T(0T, $ 0T T T8 T<040 TTT(0T, $ 0T@3T 0PT)H0u0MSH7P7X7`7h7ЍЍ{ЍЍЍЍ -LMp P`K@P P l 00 P `à C0W0000&4 0`)P p- ML@`0 PPP0\3 : c 0PKp -LM`S@P VP K Gp PP% T%J 0S0a0a010 @ B Q0B RJ 0 @~P~GP0D@T ;J -L MPp@`(@ GP   (0K `@@@@P (Q 00  00  IG K -L$MP ( 2pL@1uG`P @+ ,K (0K@@@ p@P( R@ 00(000( 0S ,0S T0 @G K0 @ N -L0M@`0@ p-GPP @I 0KN 0@@@@ p?@P70\: 8 0 @ <  4K@@@ p'@P0 R" 00 0@0 0  0<00 080  00 4Q t 0 >@F(K@F(0 >@F N -L$M@`0@ pFPP @( 4K 00K@@@ p@P00S@ 00 0   00 4 R T0 @RF(K0 @ N -LM`epP d0( 008,d 040" Q X ɂ 00 DÂ40 '7<) KF@ #P0 0bQ 00  0  1R0EE'88# '40$ <0 Ki=  w00-BTAWEV7-B 0-LM@P!88#\!*@P 0 8( 40bS80 008h%8Pwl -LM 0 K脔77 -LM)0 K脔77 p-LM0( P,@l` RЖ7777d7ܕ77777 0S0C 0, 8+000, <, $)a0.$@d#xhnp0 0 00Cs 0 xh>80, $)a0.@T0K<0xh000$ 8< P0$08<0 -L(M 8 ,040 0@P^8@2] 40 &PS 4 t@(0H $D0 0H@08 020@iPD@p0DB8H2,  Py6 0W*(( (h(%D P`@ W :;0@!0 D008 ,1 p0,l40. 40 <02 (K (Ko4 2 0@Q  R0@P0 L@ P@[P0@S@0 <@ T W@@[ 000!!0@00{P 4 C(Ko0u7 p-LM@P!88#!)`P 0@ 000,08 ;,0< #@k"V xh9$0"000 (p CGxh&$xq#@K"Pwl - 88#TLM%`>)@P 0@ $0pc- (PU V-#.R0" "2 KC # 2<2Pwl -QLM  Q 0C@00e0S A # - 88LM#DP$(`P 0@ #p(K0 ̠ -pP@0T X0@ @@S 2Tp 00 e(pP202Q ,#2T0-.2 GPp W T .2 02 .pP2T02P 2p02 .p0 )Pwl 0-LMP@J2-\0c-87 p-LM`@`0 S00Ɓ0,( L0Pt2  0\ 0Q000CO@H4 K (00X0xh-07?A7C7 -L MK 0 K? -P L dM@8 &(pP 0@ "@$K 9T ,9T} K0CT 0CT 9T 0S@= "9T '9T Xp9T :c@T 3T D3TJ@PI@ 0@@< QV@52T 0T+  0}@% 0 s@t20S @ 0P4*@P j,@#*(2T 1T $@ 0@1T 1T@@ 0@P00S 0"  04"40  BR !y@@ 0c@00 0S!Q0RPZ!  00002  <4("4!<0^LZPwlc@c Q Q@c ccedA c@qdQ ccc cmhdpd dc c c cQ`dc c k~rdA@-M 0Q0 ""D0@ 0Ѝp@-M0Q""H"T *(,d @P` ЍpA-M0Q#l#x# 0""H"T 0@P `p0ЍG-0MPQ.#L$@( #H#@@. 0@@ "$"h"DL h`@ ##x#T0. 0 @0 @00ЍRM\ \ 0L0_S BR00Ѝ 0-LMP2  8@P  5000 +0C0 P0 008h꠆ -L M\BP@0 R,808 #t'"0R0y0!R< t ` ( 0 Ps04@P  0D g 0 0 ;p8 4 rp@PD0` 0@8K R=: Z? 0@D 0@`p8K`pʌ@ @@@ x@KT 0X  `p< Y1#k0@PP 0 Q(K0 0،pxwl' p-LM@`  >?PP @  0`Q@>Kp p-LMP  `@#?@P P @ 0P6PP @>Kp 04<S-P08 <041 (0, $! -LMP  >P>  0@P`P 0t>Z   >P' 0 @P`P  >(K0S`W S Q 0S QP-` ` 0-LM@PP 8oP8hN -LM0  pL>`P  PP  .@K  z%0.0K  000 0`qDX )> K08 <04@0 @1A 0(,0 $00 ! N 0-LM@P!88#\!#@P 0 8( 40bS80 008h8xwl -LM0@"0, 0p0C0ShI200S70S<0= X$R L0R h7h $ P P  -L4MP `e, ky 1(0!0 1,0!Q8d0804  <00SL H -z5@KD WpKL FK0!pBP yy 7y 0@'<7X@D!*((0 "4#220*$ 04  0H0, 0R(K$ y0l4.B@.BWEV07$.Bl? -L$M000 `[p-@ (K 0P@V=P @D D@ 4K 00K @PPPe@P0\@  1X ! 0X  <^% ^00000S0 0 00000040S 0` 0 j@08 0 s@0Q8wlvdud@ N p-LM@P $<`{xD @L \ $ 0P   $<Kp  xH.B -P L DM$`0!pP 0@ N@  2V -2Vh <2Vm 0Vp R @32V 2V 2V @ @ 0@X2V P2VR<2V8 $2V` $2V0"0 @1VX 1V e/w@1V! :10S @0 J%@P  '@P|1VA 5%  @0S<@2 e@ 02e/w g@} 0#@v Q@o 0 P@h @c%40$ H @xwlrdAud@pd Q Q@qdQ`vdhdtd@AedAmk~gd07 -LM 0 K舳707 -LM)0 { K舳707 p-LM0( P,@l` R77 7 7777 7 77 0SH0C 0008S000,0<;,0, $)a0$@[xhep00 0 00Cs 0 xh680, $)a0$8L0I00xh000$ 8< BP0$08<0pp0 0 -LM< , 8 0@P_<2^ 8  0 P4 R 804@t( @ $04@08 020@i@Pp0L 1<24 , YF 0@Q _  0 U0&!:0 4D008 1 p0,l80$8 0 00 8 0001 (K (Ko8⍹ !;0 4D008 0 p0,l80#< 2 0@Q  R0S0  "0lP 80O(Kop R 8#8 S  0 40  `7 p-LM@P!88#!\`P 0@ 000,08 ;,0< n@HV xh02000000xxp ⾸OxhJ@$xwl - 88#DLM$`PP 0@ 0p<# @T0 !22 022  IO\#  2<2.xwl -LMA@Q 7777770 0 \0   H 8 0O@00p 0-LMP@ya#ዸ0#87 -L MK 0 K茎? -L M0   ,0 L9P * pP  <`K*u@ a0 P<0K0 K2 K1 K;@K/PK |1@0 P@ \@\ @ ?9@,, 0 RD(K 0@,Hp`0@ P D P` 0@ #D p< P`0@!(#Lp4 0 0@ ! 0 8 <04 1 #0000000l N|? 0-LM0@> d0 P\dP 8P1S1S8hT8hr? -L4M0P@0 00 40 80 <0 pPF0F8P Pp`( @DK P <0K @@@PP D0S 0S 202 /  0 + Pp` 8@ 0 0S@0S< 0 Sk d Sh  Se (KP0008P Pp`<00S S| @3<#0S @K 00K@P @P\0P 0?0S @@K 40K P@@@P4P 0?0S@0 S0d P4p@0  0 @0@ S  S  SR0"P1 0 0 0\P0@00W00U ? V0 ` r0SI 202H@K 80K @ @P1PA8\> 0?0S:0 0@ #D<` pP0@ #Hp8!,P`0@0@@P0 P4p`@0  S S%0 48p` 0P - 88@#tLMP'`P 0@ LP(K 2 B P0 PP p0W Z0p ppS 2WP 0 0PQ0"42 02 v 0" W-.N208#82.PP W2"02NP 2P02.K.G0 VPxwl - 8 8LM#T%Pp 0@ p (K P0" 2 p\  * 0P 20 Rp(PT00` @u(  0 *0 2P0xwl -LMpT2pD2@"0 S2<24$S2ס(92ǡ n, 0!0Q000OO;!; I 0" Z 2R PE 2=Y@ aN0 00 00`;0@728;L4@Ky Nr P40S 0 (K0 40  k ^ ` <<h; @0d;8wl7?AD7C7T.Bud@vd.B.B p-2 1C`LM P hR0000 0  000 @TxhT"shmr p-LMP@ `0S R0000 0   xhS p-LM0@P`S<747,77777\;@ pP 28 1C0P `0x@@@.BT"s 0-LM,@P 0 EPPU@8T"sps܌pN  0O   ! -- -i@0IPP JaP P/ P `NAP GP #Ph AP Po H}P yU# JtPs -U .U ,0E@Th@e1 (0E0S-0E0S-U TTxpW ~0S V> P b#P AP.U,U`` /U ,0E@TR.Un =5'P =1'P' VLU* .U2 ='3P =#4P5 T|0,S 0Pn .UU V/U?P{@ mw uUP \Pq,0E0Sm?iPPmi ?`P P> @L10Sar    10S`g 00 S00S`Y "s/B/B1B1B/B/B/B0BX0Bx0B0B(1B0B0B1B1J )1B1B0B0B00B(0BH0B1B 1B/B/B/B$/B/B/B/B,/B0B/B1B1B01Bp0B81B@1BH1BT1B@0B`1B1Bh1Bt1B1B/B4/B1B1B?:Pb5AP P 1P* P,c 4P1@* Ppc @}Pc-@w?sP0c0=hbP8#@dPd3 ^Pd5XP0d [RQP[N@NPVJ PddQ=D0P =@1P< 8p4p0pd ?* P ?%P@ e V@<P(e6G@P~ zPv@ler p=fP'@Peg=hP)@pPe\ PeV>@/P+fX %*% P!4fJ rP@fx 3@PLft qPjXfp?P@|f% /@l phpf b yAuBf ofG0P=fCzPg@ P6 g<\@? g6\@g 4g0$ 0 M,0Ѝgppp -DaLM00 gb0@0P0Z0U@0 T0p 0Sp  RX(  0P@>W : t0P Ud0@z @H0T00S ,0((Ko0(Kp1B1B2B2B2BA -LDM䡟\ 0\ X -0K p!L P T 8 P T < DT @ L@@H PPp TP` 0 00 T2B -LM00( KP@4 p(0@(K"(`!0K!K@@ `P 00 .K002B p-LMPp@.0`00 X04 @0P P0D H0H H08L 8@P`  xh2B8D877t&s 0-L MP @K `PK0 p-L M@$PK `De P@ y00Kp -LM@0K 0K @?K 0-LM@KP0 0K `0K v0K 0K0 -LM@0K 0K @ K -LM00p嬡P`)K @ 0PR|0t1| R 8\ 8\ 8\ 8( 8( 8880|0`VHP00$K* K0P,) [R- R*0[-*0[S*0@h0l@)[ $!B30b 03hl) [31C03Oh0l@) [31C03Oh0l@|00|0*0[S hlxl0G` p-LM0P00 #\ K0a`P6[ !- 0 700@ dp@ <d0HA@Aaah2 2 ?P@o 38@TPs-\Do-00Kpc-2B2B8A$3B3B -LM 9dp31BMЍ -QLM0P@-0KQ0-0K)4 `(-K0"(.Kp 0@` pP &2.[0 Œ4 0("( 0.K`` p00(K Q0 0-0K-0K p-LM00P`V000K0K4 (0K"(@0K @00[0PKp -LM0@`SP  K0P%`K&pK 0%KP P P0 0%Kp PPP -LM0`004@P)K*KU0L00C0HP)0K)0K4 (0"( p 0 p^P P*0[US20T0@808 <040@ D08`(w,00$K 8 8 8D3B 0-LMP @sP8(? 0-LMP 0@g(0( 0$0 0P 08(?8t88h8L8 0-LMP 0@M(0( 0$0 0P 08(?888088M0 ЍMЍMЍMЍ 0-LM@TP(Q*0RK040D d00 MЍMЍMЍ -LM,h3B -LM,3B -LM,3B -LM,3B 0-ND0@@P@LM@eၤׯ0 8h蝢sNl -L M`\XVU*0Q`Q 0`0 . ~N,1@pdPP ? :#: 0T05*JWZ/ Z0K40K *P`4` 0L000S pP\l0 \P 0 hJpWZo(KNlsssPc6 p-LMP`HP xN@@N^P@@e0 xhNl -L Mp@ PO>00>N0@!@`dgPP > 0d 0V05 jVJZ/  ?Z0K40K 婥Pp4p 0L000S pP\0 \h m0 hpjVJZ0(K 00b 00NlsssPc6 -LMP `,p ,@ ,J"1d!Z0 !!@160 !! 0 !PU PP 0@  PU0!! & ?o`sZ|0  , !T 160 !$ 00, 1o#s#sx#shmrd&s#s -X LM0K @K000S  P %T1lt&sd4B -QLM`pEڌ0SJ 8KP 0 *S  R08` 4p 00 =8[%(K8@K0 0 DK31C01D@ @P <0 Z8K Q ?O! "Q R' W# 0 B(` .% p)%0x`Sp8` 4p 00 X%L0PV800Qt&s5B4BE.4B4B>4B>4B 0-LM@ `0P?0d0D!s "Q 0 b 8hh&s&s&sMЍ(1@- @Ơ3 1C 0!02@$!Bb  @130` 0Na3QM0 RT d00 R00C0 R@TЍ&60cQ*d00 R00C0 R00C0 RYѭh&s -LM06f 0bSQ0@l  p 0bSp0 VZP帀 Z00C 0@ c0 ` #0 VJ0L0cR01 S 0 S$0`` 06 06$0`l&spp&sx&s&sp&s|&s -1LM졟d 1!\03 8K P,0  "!< 8`K08@K0TT f 80SG DD!0 fÁ0`S0c!S 1< 0!! A00   0  v0 06 &06&0C6X 0@ 0@ h410*0`PRhA0S 0P  z0 uK$0($L04 P T0*4\@dplpt`0 H`X``h`|`x```$(3 d0l "3*pt`0 L`H`P`T`\X```L|!Dy!<v!4s!,p!&s"s86B&s4xl5B5B5B6BP6B -80LMQ 0GWp3&sMЍ 0-LM@ P P 8  4     4P@8 -RLM@4 0 80 PPEpp W@ 0  P1("(R R ! ` % `Z0  Ph0 P` P  08040S(KV 0 p-LM@ `(0KP K0$0K$ %$ P(0 Kpx6B -L,M` D0  P (0380 5|*0P@0 QWÙ4 00 14 80PUO 0@   00 cp0< #0R40 <0 cp0 WÙ 0K<0  pD 0@00@0 <0\  00p:4 80PU@ \|30|30 @0\%(K8#8@ 0P 8 ~ 8|30|3 8 uxl6B6BEB6B6B6B6B p-D0LM`P@ +0 KphDxlG8 p-D0LM`P@ 0 Kph-xlE8 p-D0LM`P@ 0 KphxlF8 -LM@ `TpP  R T 0j P `0  0 8#8ST xl6B -LM@ `TpP  R T  0. P `0  0 8#8STJxl6B -LM`PV@p  0SPV0Q: 0L0S:1  0S $K0 @ PP`0 0 0P  0H0 , xl7B<7B`7B(7B -LM3#@P `D0@@@( #0 @@@ q08O0 0 0&30S 0S30S 0S00|3 x0e\0 K|PKhDD|,,$x7B7BxlE8(E8D8<8Bl8B7B(8B(0( 00$0M$00 ( ,0ЍLK8K8K8\K8MЍM 0Ѝ - @LM0   p8B -LM Pp 0 4<L`, L00K T0,0K( K$D@(0S 0L< P@,(@ KPP , @ @P 0S P0S 0L<   00L< 8B&s -0LM`PVp# 0S @1@S 0   08P `V\0P @T 84 0$T0 0 yl8B&s2B00~N@1p@dMPP > 0d 0W05JWZ/ %Z0K40K 取P`4` 0L000S pP\0 \h S0 hJpWZ0ԟ(K 00b 00NlsssPc60M0s0Ѝzl p-LM@4P 0 0   P `Kph?`0< `$40P Kp Kphy h9B`!9BRM 0S p 0P Ѝp 0 P p-L$M<`K@P QT0<0K@ 003K3K4 K5 K\0800 JP D<3[3[   3Kp.0u9B:B9B p-L$M8!@0PSKp<`K Q@3@  U003K3K4K5K< KX0800 P @3[3[  0u4:B:B`:B -LM`8P P@ P P0pW  P ,RQJQ( 6H R@00;00000Evv8!00:BB:B -LPCFMHC\P, `<1  8 8ß#*ZpP 88 0 S 4! (@ႭP@ |$0Qg偭41 "0 9P@0@`  0O 0 @TPM D" \0(8!0 01Sz0@@ 0@P`衟P `00A@#T@!Qa ?8#808#8?@ ?8#808#8?4<(08$0q ! P P (1SX8X8(Y84Y8@Y8S@, 0R2(K0!4 d0! R(0#<.0OP`< 0,1KKOK,8 < xth`XH#00zl0lzlzlzl:B:Bt;Bh;BA@;BT;B$;B$? -LMe CP<(00谇(K1T" |1T 8 0 `0 00" 0`0 0`e/` e~@0 ye/~O :`0 `P `P8! 0S000`0T %40$ ( 凴`zlrdAhdk~sd edAgdf8 - 88#dLMx&p{PP 0@ CQ =5zl - 88LM#P(Q@P 818 Q `0pz`P0S@3  0`P a@3`V0@3-p0 P`zl - 8 8LM#Tp% Pp P0 20p(P0T0` @u( *0P p *0P(yPP @`0 q@(zl -LM 0 媱 Kd''f8 -LM)0 圱 Kd''f8 -L M4 @ 0 "00  9ᘀ0 (`dp@F Q%40 t0 X3@S0 1A4 04! Ӹ?/@c004 (80 AสA0@ 0@ R8T ?< 0 ?8#808#8?@ ?8#808#8?4 ,0  ?8#8 08#8?4 080 140D 0$!w8PPP <e(K/q(KoZS ;B -LM8!P804qdV 3, @)0[[hw 0-LM<1@SP<1 0C<1X#H<1SP8 -LCM⤁ 1 4a$ <0(!0P$1KRxd8d8e8e8e8e8?@X3SD80, <)a0h<10<1$ 0R: K,Q  IOK8 <p8 @0 @eX3S0X3ʀ|0Wdp`p,0 ;,00 Dp@,0 ;,00 $0l B=B\=B=B=B -RL(M8 P `x4 "30 < @0 <@00i1 0(K@00 PLŸR00 y00! (Ÿ0 00 c 000< @ 00i10 > 500F 3@C 8^@4@ 0  @@Sd@ 00P 00 00! (\ 80S 0  0@<@00i10 0 >@0400:@e33 0004 \XPH}<,(ȯ{8p>B>B>B4>B|>B>B>BT>Bd>B\>B -L Mp 200l>@ TP 04 @`=Up20 0P( 00  B0@6 0T R P0000r P 0 7000sU@ 0@!0@000\$KP 0  00 00000F000=0$ P` 0 0@  0@$ 000$ bQڰ08\{P000  0 @ȯ=BD?B?Bh?B>B>B 0-LM P0@K8h ȯ p-LMP@8`P+ 00 00000 0 (0 S0$0@00 @ ,00( 40 ,0, ,00 40G0xx}8{8tm8 -LMP \`Qp @t @T V4 0`H @GT,  K zlzl@@ĵA?B -LM 0@00S 00S00 00S 0 0  -L$M@`Kp@ PF0@0K0 :0K@?8 K;@KSK40 9 K P3[8#8 K -L$MDpK0@ `kF0  @ 0= K!D0K0<0K8   PP 0l3K4P 0` P@   K ^0D0K1< K80 = K3[8#8} l  4F09 S" 6 04"40(Q(A 04"40Q. 04"40PA 3(( SS6  'NEFX -LMP@pQA@`  0S I@ -LM0SP@(`/p0\! 0>`P n0 S0%Ll2@l e0 0!rT@2 !  0`00S0 W00P0S@T R@@1 `@4#`p@B -LM@ P  80 0 -LM 0@S 00 0 [  0000M00$Ѝ 0M0s S 0S  Ѝ$0$ M  $ ЍLpDpQMЍ -LM l0p0XM0Ѝ0 SMX0S ЍЍ -0@LM0X@ -D0LM R 000S 0S  0DpHpLp -0LM\ \ DpLp 0-LM0 @@ @ @ @RP t0S pl 0t@8RM Q0 0#0H00 S ЍQ00  000000 S Ѝ  -("H LM8T`P#x. 0T% 0CT 0S :h 0@Sh00 : Sp0Tx0S \0 R00h 9h :k d5l -LM`4 QPk U Rd0Ra0 0@ QP  04KPPP0; S Q Q Q K0<00 PUQ W \P\ 0l@L00Tq @jP ;; S"  0 @0E8 U:S00P 2UP 30E8S0E8#X8UP 00Q108#XQ0 .@K  O ;q 4 9a4 0[4 0U4 0O4 0I4 0C4 0=4 @074 014 <+  0pC p>0Sa00 RLP hWD0W@ ;c 80Q= 0Q1<  p-0L M R3 00S 0S, @P`0S0C00  0AoQ*0 R>;  S0S0C00 K$ K$ 4  0 KpDpHpl{l@pLpPMP 0P0Q \0SX0S Ѝ Ѝ {l-<0 Ƞ Ƞ,1MXP ЍЍ{l -LLM\@`  $,4\ : 40S P 4\" 73\l E3\ 3\ p  0lP K3\ 3\ 3\ |3\@< Sh$0< S<1S\P  P,3\= 2\ 0\o 3\0SIP2\ 0\z 2\2\ 2\I 2\|0P       00  0P0 0 0 0p  0lP!0p  qqPPD  㨢m 0R 1  KiqtPP@Z0P     00 Mh P$010G  0P0  ; S P00SЍ@? -LM@Q 8,8T8x88000000<000000000000000000 -<LM00000@ ! pW`V 0S \ R P0 U*\  0S  ,00 S 0C$0!0v03 K$ R PP0S xx<\D00D0$0S0H R0 0P xh.100$0S,0 0S  D0%0 000S <0@ Dᇿ 0M0C0S 00SЍ Ѝw -LM0@S0S  R000 0  B , P/e  0-LM P00@P 8Pl 8 -LM80@ <0jPD0< 0D0 @0 -LM`@P P*$ RP%D 2pXp0#<10# 0%0 000SI ,0PPD01 U 0 0#PP1D0#D 0 zD00D01.p$0S 0 <2S!l 弿PP $0SsU0000<0@ <WPhDBPDB -LM@pPOP@ 0`HČ <0 `dP@@b K8 0-L M@P0  K 0KKK0 KKKKKK0 -L$M8@#h<PP @pP@ 0Č.0 TPiY0@0P (K`} 06K.K6K5PK4PK3PK2PK1PK0`K/PK` `PFP.0[  @05K `6`K4K3K2K1K0K/K, -L M@0K p-L M0@SP Kp `PPV e ᡎ0 # K$0K0 B"0K! K 0$KPKPK K0KP 0-L M@PJ0  K 0KKK0 KKKKKK0 p-LM 0@S ,` P 31C  嚾 0SxDpDB p-L M@`^P 0S 0S 0S 0S P Kp  0S K0P 0R 0 00  @ 00 -LMp $0K`P@P KPP@  $0` @?$0 P$0$ $0P`0 @$0$@@$ -LM } KMЍ -<0LM 3( 1C@Ph~DxDBDB -0L M@ 0K0KK0K@K@K@K@K@KK p-L M~@ATCd$K#K$K"K!KPK`K @K0KKp p-L@ MPAd! K!  $K$K#K"0K`K PK@K@KKp -L Mp@AT% KGd^(K (K'K&0K#PK!`K$@K"pKK -L Mp@AT% KGd! (K (K'K&0K#PK!`K$@K"pKK -L@ MpBTAd#0 (K(0K'K%PK#`K&K$pK"@K!@KpK -L@ MpBTAd#0 (K(0K'K%PK#`K&K$pK"@K!@KXK 0-L@ MAT 0 K 0KKPKK@K@K@K@KBK0 0-L@ MAT 0 K 0KKPKK@K@K@K@K,K0 -\0L M@A0KKa0K0KKKKK@KK 0- 00B1 0L M8_@#\ #8 K KKK@K0KPK@K@KK0 -L M@ _0K0KK@K@K@K@K@K@KK -L M@ 0K0KK@K@K@K@K@K@KK 0-L M@ KKCT K KK@KPK@K0KK0 -LM@)0 4 R: Q 0 Q05:0!S S -L Mp@AT% KGd! (K (K'K&0K#PK!`K$@K"pKK p-LMP(@`T   00Kp -LM@40(0S (0,0 @,000h l$l -LM$0S h 0@0$0S0 0 0@ h(l -LMP`p1@T(@T 0S0S: 0S:( pR,0,0,0  B @0e @P 0 P` p0  0,P e 㺋(K 04P00 0 P 0P@  8 0 l$l -LM@R@QhB`u@P 0$0@KPp R,@ $0K`@P*$0$@$0 00@S00  P  00@Q 0 0 0) R 0S(lPM 0 S  0 S   S0 S00Ѝp@-0M4 \`P*0 S @  ^:0S ^ 0SЍp0S@@VU  -LM@p`PP 0S 40S P P P S P S:\M  R @0SЍ B -LM0\/ q \ | q \| q \ | q \| q \| q \040MP e ЍfЍ p-LMPP S)4P L0`V@@V4e GLP e AXP e ; 0 10 e< xh1 p-LMPVX0P` `@@X0`@PV xx -LMP`p4e =@PP pP`0 0p0( p00 PP0@ e -qLM@`P 0VDP@   `ំ$K1K 00pP `0[Z. [/0[V  ` 0`P  ᫉` -LMLPp4@P@ 2`@TE @e ljP; L0 T$0P pRS 0S+ S \0 \*S 0S&P e b000S 0S@0 R 00 P T0 p 00@ S 04S!4000DBDBDBDB p-LM8P 0`P@PPKp -L M@A 0 K0KKK@KKKKK7K-<2MSd0 R 0@Ѝ808 0/ $ #30ЍWlD|pMbDB 0-LMP@P 88h 0-L M@A0 K@K0KK KKKKK@PP K0 -LHMß 0`S, p L0PU@@#U4e ㏈Le ㋈0 040L0w/ gK 0PPf [Rd[e0[e㩈PP @ 0PP @T e ], 0RA(K@P0SPP00  0 \-Y P @   0@P P ? _0^0Ki0^KT K]K[KX0KWPK\PKZPKYPKUPQ0[ PPpe =P4P L0W 0@@W  KPP @TJ|@TZVK<PV0[ 0lEBT? -L ! 01 R101 01XQY QP@S G $0+1X P@0Q0U0SU2G? P0U0T R 1\\ T 0\0  0S 0 4 \\T 01[O"H 0KhP!  -LCMXJOKP@D`K p0,P 0  !@#W@ p = p<0d v#@;E0:PD`d  Tdi#@ db#Pep [#@ d T#` 08 , 0R(KO0lEBEBEBFBFBl? -LMPp  s` ;W @T . Qq \qPW  ,q<+AFB0FBFBPA@-  @ 0 4$(8``M"(#!\ R0S(0\ QЍ̑?X(? 0-LM0P@PT T 808h48h -LM00TpW0 44 X0 `0 P@ 0`S P v0 00 XP f 㝂8P f 㗂0P f 㑂 f㍂0 0T0 -LMT p8 040 P54 @0S0 0S-,8  0S'`T00 @B P rP0  DQZ P T0S 8 ` 0S(K P 40 0   M KV YP> 1P 04  0 0?  4`PP: T0S  !0S00 4  0  0S000 4 | 40 `40 L} 0040 ( {HGBlGBGBGB$GBGB -LDM0`,0 @ 0@P, 0S/TpK R[PP00X00SbUX"XP8P f 㓁U 0P f ㋁f ㇁0T0, 0RK(K 94f 㬁P  @f㥁 PP 0T 2TH0S 00S 0S|X K,PXpP4 00S 4 ] 4B<f bP8 <X 40 `P { fs300>0S Sf 5Pc X> P00  @0S}?d0 00  00>0S0 S 1 C00\T P 0uPX  P 0 h0 R0@06T 000l0HBHB9LHBHBHB,?|9HBHBHB -LM@Y0S 0 S MЍ0 MPЍ@l0   @   ,D MЍ -LMt0 \ |0x   -LMt0 \ |0x   0-LMt0@P\ 0x|  0 88h p- @0@0LMQP`' Q 0CQ Q  t0V  xh0 000000x000ltmtMЍMЍ -LM~ 00s ^  0 -QLM@q (IB4IB -LM p0P0a@V/ 0P+$0S ( S ( 090S p pt00S | xP l0< 200S@l6l -LM@@Q LDH04  DP K 9 -LM`Pl@1 RR@p 0P @ D$KT @P 0@K,K  0 t0\  0x| @,00Cs,0 0000 p, ,P  6l@IBTIB -L MR@Pp` 0/P t00t0K@\& T $0K@h0$  c$ t @0t00t0 l0T 20 H$!  $0Kp6l -LMl!p00Q@U 0P K[t0pa`VH0SHP`!P$ t00t0d0P$0 t0\ $0Kx|` 00 X@T $|@\`0  @\`$ N{$\p`0 @ @lx!9 p-LMt0P`\ x| 0@  0 @!Kpl0 206l -L M@l` pPP(K 0 PPt0 \ x|  0 PP(1@W1 1W1 0CW PP0W& ;1WkP0W! 0WqP00S P0P0~P 㱄PP00RP6l]t@yt \tzt  -LMAPTp` 0P PK0000 `0P0CS0@l p-0LMA`TP 0P Px000l<0   0P0CS0@l6l p-0LMA`TP 0P Px000l<0  0P0CS0t@l6l -LM0@   0 KhnD6l 0-LMP@P@P @@PXP XXPDP <0s 'HPD.DP\P <0Ps`P\#\P8 -LM`@pP @0@0XP X0X0DP <0s 0H0D0D0\P <0@s`@\\@q0@0CS0 W t0 0B)t0 ᬾ0Q4 0SP-00S PU@ 0@U 0UW lp0p h!1t0@0t0oyG00Pulbl296lps 0-LM 0PS@ 20$ 0 (080 T 0<0 4 0L0 P 0d0 h ,0t00 x 0|00000 00 008h}lIBA@B"9|9tIBMЍ_~MЍz~ -LMP`t p @l0  ¾t0 0t0@ t00S x|6l -LM|APTp` 0P P000 00P0CS0@l - (L8Mpppğ(" , a\0 m PR7<q 8@0P@ ᭽w, 0R(K4<0l0@ D P0p0T \ h0d\P@` t00S x|@P(00-@FPwt0pp @   \_P  R? t0 00b _@K0C0C @m 'PP4W4 ᰸1 ᭸#P-᩸#P)P*TP TP D0p `L 00S3xG9G90G9F9XB  0D: f v< << p< lŸ@0@ @P <f u<(K0 PXȐH0401L0X  0P 0$0 00!C@b@AD f u@<@HD@ 0P/4 `Pp0YPD8 / Tf0P8#408!2 \0P  0 X@L@484 Z4 `R<f 8u44 4PP40U"Q1Q0PP0R@PJDPU@DZ sTl:999 -L M0@` 50S QP 0S P1 R  @@ $K PA)KPDP ,d)0[S p)0[pS0"P0 KP#0*KP*0[S0@ 0*[ 3à1"0  000@ ^`HIB? -L@M`0p@P2<6T3 46TX ,6TW WJ6TN j6T{ 6T 5T<0= Rq@5TI "5T-0 UP. P@ @$K3"  D   0PL0 0 @L00f 00 K3PP @ q Dt@W 3"  D  0S P 0 000 @@ 0 0x4T 5l4T d4T0 1@P@0 @ 0!@P 0s P s@p= @3T+ 3T 3T0 @P 0s  0P  p 04K0P} @P0  R Ri 2Rf  Zc*Z pP 0@<0 0PT0 P@ 0 =4Q *@$?4S0>48$P0R 0>4=4@4?4B4A4D0\0X0 0$0(0,0004080<0@0 0R` Pm p 10W00  WIU9U9$U9U9T9p`P@HD@ 00S 5*0JSxW9hW90W9V9V9@00`S Z 񟗶X9X9X9X9X9X9X9X9X9lY9Y9xY9h!_ 0R@S Z 񟗓LX9W9W9X9X9$X9000 10,"A @,10,#RA4>>0 0@4A$A4JL 0RP0 0BL04 h n(K0P0T4T \04X00=4( Q0=4ȅ0=ȕ\0!L0 0P HL0,$4  h on0P0T0P0TB4W0B4 0$B4S!??Q/$ (0R+10,"( ,#?#B4W0B4 0(,048<@DW 0?$,?R10 ,?$ȕ,0B480 004P ^0W ! 0^P RN \P0M ! 0PF RD \0`0044<40C R<$21C01 dA`@0 0 4Ĉ!l@d <400S<4@ h m04X04\<$21C01 0z10` !10!` n h 4m`\X #`0 p@-0MS@P S`1 `#01^0P5@10L\!N 1" 0f0#RЍpPM  ЍpЍ p-LMP`@ p@8d0PxD -LlM ` PpK@P @0S SZt0S H0Sp@P$K -LpMp0 x 0  `KP@P D0S@t0Sx0 SZ<0KYZ@Y @(K -LlMt Pp@`KP t0S@0SW0p08 40*rP^g0P$K -LM 0q 0Q  0`0M0dЍ 0-LMPP\0@ @X  @ @X@PK0P; -L M4@080 0<K -L M`R4@ p oPP@   `ml80 04@ o(K80 0%@ -L MpR4` 80 0P(KP o @ p7l80 00P ^o -1LMQP p1Q& 1CQ KP1Q800Q, Q? Q@0$0 ( 4(K$ KG$0( S;#0 $0 kQ Q" Q@0$0  D0$0 $8 0P D0$0 8 $@R@p 0AT` VH0$0 H0$0 $ kUDUU@ -L M\ 0\Q@`pf oPP  kP0p K R R R}@P`p @<8 00@X@`pj^ܕ?lʀl)l 0-LM904@* 090p PBUpP#TP TPXP XP@P @PPP P^PP<P <WCR0S ^MPЍ@ P0M ?S $0ЍR p-0LM (("a@0!P1s s xD0pP<0@`㎮00@ڭx0pP<0xЀlll 0-LM@P@wp R0p0 0S008h蹭 -0LM Ƞ Ƞ,Q@0`P@ SA p@ P0S@᙭lJЀl -LM⬑P0@, `pP|1T p1T& h1T<  0'p, 0RC(K(1T 1T 1TQx xP0x00 xP ,1 Q0K0'P P 80@ S0KyP|0-0|0,:|00|00l}fpUAUvtnU~f? 0-LM` @.Q@@t0@0CS0K09Ѐl p-LM@0`&PD0PU Kp LQP8 L0PgP 0-`0LM Ƞ Ƞ,A0000P0CS088Ѐl -LMx|0@`, p 8 @@R@PK 0PP@ P, 0R7(KCPP0S0.|  | P ӚP0P&U |00|0 yP R@0T0U0S T@#T@!PK Pf χPP $r [#PP0l(KB? 0-`0LM Ƞ Ƞ,A0000P0CS08v8Ѐl 0-L0LM (("APPlLf 8jxP8Ѐl 0-LM 88 #P*0AT 0@P P8PPP bDf Ej|0L0|0xP8Ѐl 0-LMPP@ m|0 lxP  8h0|04lxP8 0-LM90@0Q!ڌ 0 S00 S P0 C8a0P0CS0Pᥫulblu9 p-0L M<00P40@0$K00 K8` 0 $k@ 0 $eD0  $_D 0H@ FKpu90KB`1MS`Ѝ-T1MS 0T0 cB<0K1 0 !t0@ 0 1SWpp# 0P@Iφ  0 p(Ά  0 p Oφ  0 pRφ 0p p(K<0S40 1S8<0K^Eφ0 1 ᆕ\KB p-LM?L`@P€ e 00@0@x -LIM0`S qWHq $ H  L PL!2@  H 0(KP0RGC Q<00H 0W@ !*PA \> R \ 0S0S  QH(K0 0G?C, H \\ P \ 0S 0 S  QH( K00G?CH \ dH1S BT\1S U`HP Q_K0 \  H@Tᒩ(KQK ndHM_ЍU -LM 1PSp @`1"  1 S`@ !Hdb1S 2S a1S 2S i&_ 4dYi蟣_ ,dYi 0-LMa1@SP \PkPP  Fg8X6 0 xKB&s 0-DPLMXa@ (K 0( $P  \K0l8 -L@Mp`PP DW30, Xb10Ya1P TA&sp90 M Ѝ&sQM Q 0SЍ 0-LM@P/ P h1l!PP @  P@T8ܲ? -LM`hl1pPQ @ ,P@T iز?M 0ЍU 0-LMPQ@ 5p08hp~ p-LMT2@SPP`0T2S0L P2xh p-L M@0PPD0SKp`KL P 8 0 -LM Q@pP` - Q `p K00L 0` KiW@ p-LMPQ@ 0LP` L`PU xhjx p-LM1@S`P 3SL xhnx 0-LM@L90PH8QM ЍP Ѝ⤩ -`2LM<00P40`0K00, K80@, 00@, 00D, 00H1 LRpL 00@,@ 0@( @P#t1 R; h1R X0 #Q<\14AS0!S K0 S0At ?1S 0 @?0zSpp0(K0,| @P (0 \0\ WWT03L03 x9SA??l?T9̂9 -L M@K KM 0PK MR00 Ѝp@-1MQ@ 1CQ 1Q Ѝp00S0C0@T)^&Q# R `VPU1T^QRT Q V U 0SS0SS! 10! 1 0! 10! 10A !01 !01 !01 !%W A W@0M0Ѝ -LMP` py 0S`| 3000  000 8 $ 0 4 < 0j4`4 1iSX1S Q ȁAX 8!0ll?`8 ! 0dd9`0S@"!BH  P0D S00 d240@S4 80 0 0 0S 0 S ۦ4@08  0(Ko 00C0S(K1S 0880 MP Ѝ9Ѝ 0-L M0@S P  0S) S# S     K 0 P  K0h   X   H < 0 @@KBKBA(8KBKBKBKBKB -LM` ! 0@000p000 00P0K $0PEP|c(K0 00@00$ D$0P.P (LS E0 0000 S 80 P #0 PP  00< 0S0000#000 P d#0 P 000S0p0W00 W@ -LM@Lh -LM@0lP LP hL0MSЍLЍMLЍQM Ѝ`P Ѝޥ -,1LM<0P p4 L0080'0K`, K$@,0 0@0, 0D0, 0H0,@0  @'P d0R X$K0S0C T0 0l x0 0C 0P9^? -L M@K K P08P 801P K 0'P  Y0MS 0r0 S Ѝs 0Rr0 ZR R0S0w000S 0{ z0 0$S$0w00 p-LM8P00$K^X`%KED`%K K0 @KK`K#`K"`K!PK`K`FP[Kp 0-LMP0@P1S01 1S A8 AT 0 1dP AT10C18 810C18 pLB -LM@0P`pLP  K 8#(T0 0 <0|00 <Q P& p-L M8`0@ FTN!0L0QPSM@N@O@P`RL0@Kp 0-LM@0P P0 00 P0 B 0 R00K0h8 -LMP0p`P 01 s@N=00 00 00 00 00r` v]r 0@P00 <QA -L MP0p`P800@0LL0MpQN`O`PR`S` L0@`=K -L M@0`pPP10@(0<0NĠL0MQNPOPPRPSP L0K -LM@0`pPdP  K0 08#T0P0  x00 <Q P; -LMP0`@8P. 0BS+\9Ԟ99D9t9999 $0K@$ RY0S 0S00S S S 00 b0K`T T 0R0 R \D 0@@{P  RTXpWe  00 b0T T00 6T1 f \^T% Z 0RT\00 TL0Q0  0T800 @ 0  0T5 T 00Q p 0@0 PH 0PP^ QZ   0Sh [c00 04@ 0@G:S 0S dMBLBLBLB8MBMB p-L M`0P@PE 0BSl9Ф989T9T9T909X990S [T00@0CS0000 0PP Kph5 R  0PR 0($ 0,0Kp 4RC@l 0cT\ @`840# <S  j i(h0$k0T P h  -LMP@`@`P@Vᕟ0p0CS00S Q @@0 @ΞaVp @T p \0W1  \pA -LM0@S  !P ]P 0S00CSPPP  -LMp P0 040 8  !r@P 0X0 Y 0\0 ` 0S4%`P X0S 0S 03X05:S PS 0X0YP XQ Q #3Q0@S񟗒9999900CS<9,9,99,9 9T#0LT 0S P0S@ #0P=  X0S 0@S4P|  Z0P<  X0SQP> 0@S<0S =Q X0S| S~ 004 D0PS4< @0 PLX0St 00`@P`@> VX 0BSP2 X RW .:R,1T0Y 0BS7د9L9L9د9ȯ9d!`!}@!{T!yP!w0Y0R0Y0N0Y0J0Y0FP< ]i`iVX@Y@\@`@Y0PX0.BHiKiA>0S=}`0T04> H0P NBNBl@NBOBOB0?OBOB OBD*BxOBLJBLOB0OB$? -LM@0 0 4JS00X0ĵX0ĥ -LM@40S 0 0$ R 0R  R0Y00Y0 0-LM8P?00ED"0KB0"K K!K@K0KK KKPKRK04MЍW -8LMȠ,Ƞ#83 R K00 01 0@0 T0%(KQ( 0 R* 0Q'0(00 (0SP( P0(0 (Ko_`0(00(Ko0}0 0!0(00(0D9OB80MS880Ѝ\ -LM@P4`0bP3 pW00 0R0 0! T@  0 P0(Ko70+ R  RW\0(0(Ko}_T@$ 0AP(KȲ9OB p-L!M` 4 0PS  0RKp0 "K@K PK1Q K1@K L4 K0 jxš0lOBи? p-LMP Y@`@ @0e02408P40012` 902`x9ܱ9Ll p-LM`2 <2 PK0@!2 00004 r00CS0Kphf7 p-LM`022 < ; PK@ 200004 G00CS0Kpqhf7 0-L,M@0_PP=0$K#KP4K$KK6 K0PKP"PK!PK PKPKK0 -LM6`pI $K=008K80K7KC0 * K40K2K1K6K5K3K@=0P8K8K@D00K2K1@K7PK6@K5@K4@K3@KP08 R06=08KP2K\@ 07K1@K6@K5@K4@K3@KP68K0KP6L -LM\ `Rp@P<0PS Ԝ0\ <0R@ -LM0S K 0 Ƞ8,Ƞ#8 P ? -LMP@` P HdA0(K0 K[pP ;44 08 Ƞ,Ƞ#8 6 8 2 00;0P4开K`0 2@BK d \p TP P L0 h H` %P6 A [B0[4S\00\0  B0K 0S/ܾ9о9ľ9н990[S\0w0\0@PxpK [10ERx0 X  !B200 t0 p t0 p !1\ <R@Pʃ1X0 P0t0 xP pP 0S;p@0@S0P  0S00S0@pSWXxK 0˞< \0 S0 00 I0X0 0X0 0X0 0X0 p 0luw To,S+Sj(OBPB?`l8PBeB<99l@PBPBPBxPBPB`PB@-@M0 0 00\#^?Ѝ 0-LM@Px20" 8 0-LMPP 2S BT O{0@Tx8 0-LM@ ?rP  K0 ?cP   \? @PP  T̠ 34/ Pb0PBQBd9 QB9 -2AML@` 3Pp0 S  0 #C40 3O``  2P  4垿aK<30<3'9@QB 0-LMP@P%3S" 61S VP8  P 6;681S VLP {6 ;&680  BQr0C 00S: BQ  10RX!\!  10C18 -LM@P P 6h p-LM@P_ `w3S 2 20S 1 S#xh9x0w -LMP`p`@P ט9W;I9 WW" 0 0@0@ hW i 0 0@0@ 7 p1S0<iXQB p-L MP0 0@0@`X嵾㑘0 K@ 1SϗKp@ -LM`PP 9@ U UUpp,#R 00@`0@ 00@0@P30P3PUhiPCj 0aPstQB 0-LM3P@SSS P P  878 -LM@Rp` D ; 0 0P PPPP(7; 1 7; 00QB -L M`pPkP 9@ U UU(KL30L3P(Ua ̠A0L  @p> 40KP 04 Q40S0 0@0@LC 0ýL/KA Q-0[PU-PK40 0C40 0 00 0@00@傗8  Z7P |P  !z  *8忖0 0@0@9QB 0-LM@P(S 27P 3S P P  878 -LM0S K 0 Ƞ8,Ƞ#8G P |? -LM@VH30CSH3hH3 0MH3ЍV -LM@p`P K@0F@.0K>0CGT.K& K-K,@K+K)PK(0K'K&@K%K*pKP -LM`@epP K@0ND-0K?0CHT-K% K,K*@K(PK'0K&pK%K+K)KfP -LM@ {  h p-LM@`0PP Kp?0F&0KB0&K K%K!K 0KPK$PK#PK"`K4P [0[ p-LM0P`0K @P Kp?0F%0KA0%K K$K K0K@K#@K"@K!`KP[ 0-LMP x@@T T ?  ~$ d& ~`? (8h芗~ T]'QB 0-LM9P=@9 Y@ <⪏P {QP5RP rHP202P h>P02$P 0$3P |03P }03P p03038 4   8RBQBRB p-LM2P%6gdƕ9`@O t00S 0@ύ܋H30CSH3<x-j -LM`  9 8#8  )2S<9 9  h@@ TxP pp0QP@@0$qW -LMPտ@P Lp'n @XT9 1  L7P1 7P3 H > 7 0s2S 9@0;9`h w 7P@ hK,hEP h>XRBtRB -LM`P@pfP@ ۔01T 0CT!  00@4T& 0T 0T0/9@ @ @608#8@6 0 R @6@@@ b@>@0 @5i 5i 6i( -LM@pP`g &k % (@@T ( T h<兺RB -LMP@`ܾpP 8 %c@ (_@@T ( T &@H$TRB 0-LM@ 820S8  -26S%  "x 冾PP? 8 08#8 K0hcY Q  0-LM P # @@T #8 T !8h RB p-LM`@PP@4U0@x -LMP`pR @P 弹 K2"l3#tCxCCCpccNR( Kʾ@P4 08 Ƞ,Ƞ#8G `+(?!^0C p/pႾ0PS00S"0@S(zPf   0P" P"o2SP 2SM 2SJ A.@K|P HU' 414!9t!,1,!p1|!0` hb1!2 1_0p@"2 A 0r( 0>r"R  $ᎌ oI]|Y lT"0" RB9t9RB|?RBXSB9999,999Կ99@SBSBM2SЍ -LM@P GP h褹 -LM2 @S"# P P "7 -LM 3 @S## P  P  7 0-LMV@P ; }1P ; 008@ -L M`8 P@P09@ U UU(K⌾PxU} #"08  8崿8 00KP/0p 0 0@0@  ppOL@|P  t ɋ^0Q -.080 #x$ Q%@ 4K/L[3[ :0: 0#AS0 Qp0: 08#xQ300 5:c0 YPP0 0@0@ ~9lSB -LMP  0 Ƞ8,Ƞ#8" eP  KD? -LM-P h p-LMP9`=9i3P ľP6bP 廾P402P ۽屾P02P 03 P 0 3P 02P 0203xB <zB{ $sBt lSBSBSB -LM->`PB 08#8႒Ⴁ @ j"K3KT0K @@L[K20 <0p9JP j@R 2/.  p幻凾P b(K0K2K0K -KpꂒႡ j 2 p(30(3'9 0-LMP@3S 61S VPP8  P1S VCLP qs6 ;&686;680  BQr0C8 00S: BQ  10RX!\!  10C18 -LMpP`P ⍐V VV& 0 0@0@R 嚶V iÏ9i;9 `1S 0 0@0@i讏0s{SB p-L M0 0@0@P`XhD0 K@;/ 1SKႏKpTB p-LMD3P4P〼P}PzⷶⴶH3`0CSH39@O o]00S 0@&H30CSH3Dx3wI 0-LM@Pn20" 8 0-LMP2S BT  q0@TZn8 -L M`PpEP @0?0,0K,0K:CJGĠHC6 ,K)K'K&0K%@K+PK*pK(KGP K 0-LMP@0, P(#3S  0P  H0P  0K0 0CP  0P< H0P 0P (0P" -LMq0,K@ $0 sIùP $ 0RS K 0.KDd- [.0[48$!#8 -> ("(0! 8#( 2S<8 #8( "h908#h 08 01x08P#h PP 0K Q 0 U AH0l$?  [0[ [ 0 .>P B X嫴׍Kp3#4 ?PP B 吴Ἅ '΄07Pᫍ3 / P ɻ9@0;S9ᕍ3V2 R,[ᇍ dTBTBa,TB9HTB -LMP@`p#D1T% 0CT-  00[@4T a0T 0T0/⁋@4T6@ @K @ @@608#8@6 0 R0@@ 5@@i 5i 6i( -p  0p00LM @9@ 2#0S K0S S# S036->0 A0S  S 0 <P ,Kh谳->  TB p-LM@P P_ w`l3S 3ょxh軌x -LM@LH30CSH3hH3 0MH3ЍL -L MP@pɷ`PX $KG4)0K*pKh 0`g*K 0H` @40`YT @! TB -L MP@ᔷ`PsW K&`K%`K 0`2&K0| + @d0`$T ->%[&0[X   TB -L M`P 0`&Kx 00\ `B[L2BKTR 0< `(?$4Spm <`K @ 0@-0 @K$ 0@ W0 @ 0@ H0@ 04@  0@ K 0`(p3` 0 0 308#8  0 0H`n ( 0`e  " -LM`0Pp2b @P  08 Ƞ,Ƞ #8"強3-X3\S`CdCJ3xSt3|CC/:P |$K!l3 p/p0`<30S@00S"0@SP   0P" P"" 0S;93㼋 9΅0p -N0pr _ .@K@0@ 09΅(ᶱ->0T]M嬱O姱' % 0Ph1!91t!p1!1|!2!1o0p@"2 A!1rz 0j"R*  v:3 , ᛊW hR.@K0@s^[]00P"0."GMpq8>x<03iD?@9TB9RB `0غApUB@99999 999(9TB`dUBLUBXUBUB -LM@P wP hԱ -LM2 @S"# 4P BP R7 -LM 3 @S## P  &P  67 0-LM@P ; 1P ; 00&8!@ -L0MPp`@0P@ 9@ T TT(K⻶PT  P0Ÿ   00K@]0 R 0 0@0@0Rj!88#Ƞ Rp:8#8S<0 D 4@ 0 0@0@< 0B8#8<0 40040 81 00S[0SXD04 `&899V80 `P 080@C 0H0  @ F2 08RR#8202 &D@|P  l@H ᠃5gc Y0 0@0@dWO<H<0@  B<گ9UBlSBUBUB -LMP  0 Ƞ8,Ƞ#8 PP  K6? -LMP hՊ p-LMP9`=9i3P ٵ寶P6bP е妶P402P Ƶ圶P02P 03 P ڵ0 3P 02P ε0203xBm <eBf $^B_ W VBUBUB -LM`2p @傁C4 0 P4KT  @@LLC20  -0@*BP b 2/.|  @嬳zP j(K004 1900   C@(3 0(3': 0-LMP@3S 61S VKP8  P1S V>LP lk6 ;&686;680  BQr0C8 00S: BQ  10RX!\!  10C18 -LMpP`P ∈V VV& 0 0@0@R 啮V i辇9i;9 `1S 0 0@0@i詇0svDVB p-L M0 0@0@P`Xc?0 K@6/ 1SK}KpdVB p-LMD3P4P{PxPuⲮ⯮H3`0CSH39@O fX00S 0@!~H30CSH3?x3rY 0-LM@Pf20" 8 0-LMP0"3R BT i0@TSfP8 -L M`Pp=P @0?0,0K,0K:CJGĠHC6 ,K)K'K&0K%@K+PK*pK(K?P K -LM@GH30CSH3hH3 0MH3Ѝ#G -LMq00K@ (0 AP ( 0RS$K2KD 01 [20[48!#8 ! (  "(2S<8" #8( "h908#h 0z&Ġ 01K2`Kqx"08P#h PP;$0K Q 0 U A~0lh? !,? -LMP `pk!K (0!`K:+7PB  7PD oe#@Kx 0@'"0[#[\Č Ƞ,Ƞ Ƞ, ,Ƞ 0#K"K@; .>UP B K ?D@P B ܬ֬Ь3 d/ @L 9@0;C93ᧀ !VBVBVBVB9 -LMP@`p倆D1T% 0CT-  00@4T ᾅ0T 0T0/ރ@4T6@ @ᨅ @ ᝅ@608#8@6 0 R0{@@ @ @i 5i 6i( 0-p  0p00L M P9@ 2#0S K0"0S S S03M0S<8# S 08#!40KKjK< "0,@PT  !TB6 p-LM@P ^P_ ԅ`yd3S 3xhx -L MP@p>PcV KG4%0K&pK!&K 0,@T !WB -L MP`pPCT K0"KL @T! ["0[W 喫 $WB -LM`%pKT 0p< 0p%0[@003'K &0'@K&@K  &0'K&@Kй 30%KpwdŹ $0%@Kpm C0tg& ['0[48\##8S  4 0pW%[Q Q Q5 4s K 30%KpC 30%Kp;d㉹ &02&0['@[ DH$HJH$̠&0$H`&K'@K!oP30+0KL <0* K)K(0K,K,K  .04P  U0%PKpR T0%Kg@p0 %@Kp 50%@KpUh 0&K'K0PH $0%PKp$ $0f@Dp7 "0'K&@K "0 00   0%K 0V0,0Kg0C*0K _0+K) K(0K0O ,0K0C+ K*0K8 B0C) K(0K|! `WB @WBQ -LM`0Pp2b ᧺@PK 08 Ƞ,Ƞ#8 ޯ"->X#`CdC\SB2|CCxSt3/\@P*!2 p/p$"` 0S:93 R00S"0@SPk   0P" P" $K03S.@K0 @:d->0GH{\' g 0Ph414!901t!,!p1(1|!$! 1 1"!o20p0@"2 0r廀 0b"R  㷁{y!}3 | ܂ 婩妩|壩"0၁"㚁6?:|WB:RB`غA@,:: ::D::::h9TBWBWB 0-LM3@P ; Z1P 8@ -LMP3 @SX#L`# 0哰PP 塰PT P屯7 -LM83 @S@#4H# 0wP8 兰P< 8啯7 -L,M@ < 0Pp匭4 P8 9@ U UU(K6PfUk @0#@  0< 叭<]< 00KPح06=40#(("(0 *B)D 0 / \ j,:0 apP' P0`0@0@80 0;  <㭂PP SeD 8\|0\ \ 4K0 0@0@ᳺ 嫨 娰:lSB -LM@A20CS2h2 0M2Ѝ B -LM0S K 0 Ƞ8,Ƞ#8 P ꄼ? -LM@P 0άP 0h+ 0-LM@P`20" 8 0-LMP2S BT wc0@T8h` p-LM@0 !DP_`(K0 K(0K<0C#@K'K"0K!K&K%K$PK娰@P  'KpWB 0-LM @(,0 $BPP 80 $A8h 0-L M!P0 0 @ `P:98"#8 … <9)7 272 C "K0h2S|:P2 @@y "0K! 0T K0̼? -LM?0!DP^`p0,K,0K$ KD0'@K+K&0K%K*K)K(PK @P  埧$00KWB 0-4pLM@P  KPP1  ((    9PPK0 v q4XBXB p-p  4p00LM `69@3 2#0 S#3 * , KP&1 "0,@@& " 0 000 0  0  PG @,@  h*Kp T$20S S #" 0&%0@ 0 "XBlXB p-LM@P 0hP_ ހ`_3 zxh"x -LMp`P@(K(0 dT   P@  K p-LM P @P PLD ὦ`Kp  o  @P@T P婦(0~@P  @K `P P ᔦ@P厦 0:  0 @8 2c3 CC/(P h K00P R;J<330S@VP 4`l2"91x!t1 0O!2 BB, KP4pL vw ͥ1!21_" @2"t!t1r| 0^"R=  }quy w~00S#0@S哪P   0P# P# 凥A( KP,0(#!$##Ġy"xwvut2"0R}"k}$:TZB+:RB2:.:XSB 5:h4:$#:|:H: :TB -LM@0巩P uhy 0-LM@9P=9Yx P v LP4 S$P m$CP10$3(P c(9P0(3XP 0X3PP w0P3@P x0@38P k08388  4  8RBQBRB -LM0r::qG:P(0 (@K` <80 ::(0 <8<30 @ @c8<3$XP @ @M8P n Kl30l3'@/: 0-LMP@3 61S VP6  P1S VLP a6;686;680  BQr0C8 00S: BQ  10RX!\!  10C18 -LM`@0PP 7~Up UU% 0 0@0@M EU hn}9Y;9 P1S 0 0@0@hY}4v$&XQB p-LM3P4$PS PP(PM0⊤0⇤}2`0CS2r9@O \0{40S 4@us20CS2Y}xJw p-LM@}Pxe7P% }7P(  2>&P ǵ 忣Kph| ?`P  寣Kph|娣Kph|塣Kph| T3P\/ `P9@0;9xwKph|PBQBtRBXRB: -LMP@`pQ}D1T% 0CT-  04v@4T |0T 0T0/z@4T6@ @y| @ 8n|@608#8@6 0 R4L@@ @C@@i 5i 6i( -LMR@Up` {E P F%# EYE P h hxZB\ZB p-LM0@ 0 P`OE P |ܢ[Kp%#EE PF K " ĢF K\ZBZB 0-LM@ ?P  媢K0 ?PP  L团̠ $3,/ P PBQB <: -2QMLP`3@p0 mC#0#C40 3_``  幩P _ 4WK83083',9:ZB 0-LMP@壦P61S VP8  P1S VLP ^6 ;&686;680  BQr0C8 00S: BQ  10RX!\!  10C18 -LM@P UP 5h貢 -LMP`pE@P {9W;I9 WW" 0 0@0@γ hơW iz0 0@0@  p1S0hiz孩XQB -L MP`pP K0 0@0@\唡p{0$K @ g $ 1Sz4@ -LM 3 @S## 墨P  㰨P  7 -LM@Rp` D ; 0 0P PPPPD7; "1 87; 00QB -LMP000 @p`ᅥP 9@ V VV(K@30@3,P/V] ̠A0 L @劥X 00K`ӥ 00 5 0 48#8 S00 0 0@0@@C߲ 0֠@0 0 @0@/000@0 0@z4  \7P |P  ?] Ht4y嬨0 0 @0@ <:QB - LM@,#77P 3S ŧP  ӧP$ 7 7 -LM0S K 0 Ƞ8,Ƞ#8 P l 0-L M?0@ P K 0KF0K0K@K@K@K@K@KΨPK0LZB -LMPp@R ᇰP 8K!1 @/@1!\3x#`sdh|s$ KD@P$0PS00S"0@S$ P9   0P" P"*@Ky`qP ' m0 9t!0 p1|!0@ 0phoFs H'ry 0ΟRBdC:PE:RBXSB@J:7:0::8:TB p-L MQP` ?0@0$0K$0K0@EĠF$K#@K!0KKK"0K PK`K"PKp -L M`pPP KG@0HD ,K,0K+K)K'@K*pK(K&PK%PKP p-LM@`ۣPP Kp?0F&0KB0&K K%K!K 0KPK$PK#PK"`KߧP [0[ -LM幣P i@0``pk`p@_@P@Pm@P@PoP 0 0@0@ p-LM0P`0K傣@P Kp?0F%0KA0%K K$K K0K@K#@K"@K!`K冧P[ -L M@bP K@0  K0KKKKKKKKiPTQB 0-LM9P=@9` Y27rP ޥP4RP եP102P ˥P02(P 0(3 P 0 3P 03 P 0 388螰 4喞꘰ 吞꒰ 办8RBQBRB 0-LM2@5Tx9P@00S 0@eprnw8q} 0-LMP 8#8,2S<9 0@\2  =K0 0@Q2 xP @@p++!0T 8d #8 )@< =V,p;;1" "D>l -LMPcP9@@ wp" N'ngd @HT9`   ?d7P( :7P x$ 1# -" ) %2S 9@0;9vhq@幝hv,峝hvP hvtRBXRB -LMP`@pP@ twd1T# 0T  00p4P@ v6@(@ v& = S2 @S# @ 6@3606`0 R @ v@ y0v@@H3  ` `3 ` i 0-LM@9=PP9Y f<P4RP ]3P102P S)P02P t02P g02P h02P [0288 4  8RBQBRB 0-LM@ +>:P ۮ ӜK0 ?+PP ̮ LĜ̠2,/ PAPBQBDS: -2QMLP`2@p0 B"_ Ϡ,͠0 ?  lC4B0b2\\  ۣP  0y<K202dP:ZB 0-LMP@ƠP61S VP8  P1S VLP X6 ;&686;680  BQr0C8 00S: BQ  10RX!\!  10C18 -LMP`pw@P u9W;I9 WW" 0 0@0@ hW i!u0 0@0@ N p1S0wiuߣXQB -L MP`7pP K0 0@0@\ƛu0$K @噠$ 1StC@ 0-LM2P@SRR ԢP P 878 -LM@Rp` D ; 0 0P P7PPP{7; Y1 o7; 00QB -LMP000 @p`἟P 9@ V VV(K303cP2V\ ̠A0 L @叢 00K` 0 R 6/0  $0 0  R0 0@0@C 0 00@00@ t `7P |P  wW  n t0 0@0@DS:QB 0-LM@PR 87P 2S P P 878 p-LM3PSxt`P f 1029@ 00S 0@lj03sxW -LM0S K 0 Ƞ8,Ƞ#8! P ? -LM@ 幪P/功P d h˨QB p-L MQ8#H`@0?0$0K$0KP$4& $K#PK!0KKK"@K K`K忢Kp -LMp2P6 0 4S 0K4 KP !0((K"0P  ̠8Č#Č"̌ 0P  d  0D1 <̠ČL8 ČD"̌#D!L  0@P P,<4("!4l̠ <($Č"Č%̌ 0fP ǫ P  00 #ӧ;<[B@[B[Bp[B[B[B[B -LMpBaP 埙K$ K⻞@P$刞0PS00S"0@S$倞P   0P" P"`u2S 2S<k ,f )0P W2f1C 0P& %s)N@`jP =' |0| 9t!t0t p1|!0@ 0phIhl03Qr,~\BRB@SBTB0\BXSBD`:,O:hQ:X\B p-LM`P@ RP b!T0 @/H0@ R xhL,xh 0KphLpRB$1l0Z: -(L" M"(@0K K0KKKKKK KN K -L MP 2S 0$!08#8  Kh -0x0Q0" "2p488S@`  ,T` "2p488S@ 0!B! M0,0•)0 0P Kh -L M9P@` KJr@'΅ 0p@9 -  00 00 n@ j7P t7P w2S 9@0;9KhlqL;Kheq44Kh^qIP KhVqXRBtRB -LMP`@p~P@ qt1T# 0T  00,k4P@ 2q6@(@ *q& = S1 @S# @ 6@2606o0 R @ q@ 0@@W2  0L   2  =  ("(  i -RL M R R K0K 停塟 p-LM`PP x0 0@0@xh艗@ 0-LM2P@SRR 实P 弞P 878 -LM@Rp` D ; 0 0P P PPPQ7; /1 E7; 00QB -LMP`0` p@ᒛP(9@% T2 TT 3S% TK 3@!>r3 S03ʤA0  @咛`(Kdk Dc 00K`̛? 0`0``F0` V p *0  R 0 0@0@Ӟ0 0 @0`0@ `p4 Q7P |P  AS Jj4o0 0 @0@c:\B\B 0-LM@PR ,7P 2S ǝP ՝P 878 p-LM@]pPq 2SK 7P 7P  ?˟P l DdKpho,]KphoVKpho =⭟`P N FKphpo2/ `叝9@0;9KphZoτd )> @GP  ,KphAoPBtRBXRBQBc: b:\B 0-LM@9=PP9Y 7 P4RP .P102P $P02P E02P 802P 902P ,0288ͧ 4ŕǧ 忕 幕\BQBRB -LM`P@p P@ o0T 0T  00h4P@ n @ @n608#8@6 0 R0@@ g@ i -邡ႂLM0j`@P2p T/00 \  @00 0! Q " 0j, 0,K  @j@b0"!B 2/LL  崙傜P $K202?'m: 0-LMP@rP61S V]P8  P1S VPLP ~Q6 ;&686;680  BQr0C8 00S: BQ  10RX!\!  10C18 -L MPp`#@P Kn9V;I9 VV. 0 0@0@᫦ 壔V) m(K 0t P `(0S 0 0@0@1S0jm0 0@0@uXQB p-LM 3PSxEn9`@ 00S 0@Vfcd0 3mxG 0-LM@P <PP  0 Ƞ8,Ƞ#8H  ˙P  K0P 0 SS ꀽ? -LJMp`rP 08 Ƞ#8,Ƞ 夙P?<@KṙP pS P 0$S0S? 0SpәPw (0S@(0@SeP$0ϘP 0S$0!"M(0@Sʰ2S 廘02 `R@0Sڌ2s岘P  @ 00S0"20Sʰ噘@咘ӘP0p"@P劘 ""0`S0@0S"0SPg   0@0S"0Sʴ2s 2spW2s 2s DmZ` Q?K4K0C rPQKX 2'N *K2KHK\@ '$8 #44"<0K 00 0u2d@ 91!9t!1!p1|!0@ 0PhIbf0 3Ql Z0Sp $K222SC  0 $00B SAB Qa0B7 BSW B? p2"0 Pp2'N TߒHے<גꀽ?*XSBj:|l:\b:]B(]B@]B@ ]Bp]B]B]BMЍ -LM@,P30CSP3hP3 0MP3Ѝ),PM 0ЍkЍ p-LM`@0PP6@0 ?  #0 0 3S 00xK20" x0"00x 0-LMP0זP?  2S BT M0@T8hJ8 -qLM0P 3@0` E$C;QA40+ @ /0 3 3H   徖P30P3剙P3@0CSP3T ( d 07 K < a<0>yH30H3z:^B 0-LMP@0`P%3S" 61S VHP8  P 6;681S V7LP eN6 ;&680  BQr0C 00S: BQ  10RX!\!  10C18 -LMP`0p@P k=W;M= WW" E? 0@1Aᗣ 发W ijC? 0@ 1A p2SxtijP3H0P3sP30CSP3ךXQB p-L MP0 0@0@`XY5k0 K@, 1S@sjKp@ -LM3 @S$#(# 0hP $vP  冗7 -LM@Rp` D ; 0 0Pz PſPPP 7; 1 `7; 00QB -LM`0pPLP&U& UU h0l0h0PCUK 0Ÿ0BD0  @VP30P3!P30CSP3'(K00K P喕00S 04 C0 0  G? 0@1 A R"A? 0@1Ah@嗢 0厐hP3D0P3凘P30CSP3꿠0R P$00 @0A0 x@ @Ej <7P P  L  c izA? 0@1A }:QB - LM@,<#7P 03S 0jP0 ,xP4 70冖7 0-LM@0倔PP K0P340P38 D0pP  PP30CSP3l4< H0[PP  HP<0D43,/ Pq0?PBQB }: p-L M@PP` 07P Kp@ĠF@0 # K!K$0KK"`K KKKP3 0P30$K7P3P0CSP3 -L M@P`P 0pP KLN@0 + K'K,0K)pK%K*pK(K&KP3 0P30,KP3P0CSP3 -L M@P`pP 0ؓP K@$L?0# K!K(0K%K'K&K$K"KP3 0P30(KؗP3P0CSP3Ῐ -0PLM @ K0@KP[K -LM@PP`p 0嘓PU Ky @ IGĠ0" K !K"pKo  =   6O p-LM@PP` 0kPU KpK @      K0 i$ [0[48# p-LM@P 0=P_ h? ` z@0PbxhgxFG20 200S0#R00S 2 S# x -L Mda0@0 0 PP 0RLKC(pK  G= 8#8  -2S<=* =  0 !0[<<P!0K PPF` K?0 Q0 U Af0l? 0-LMP0夒@P 8 X PSiT @ 8hGi' 0-LM6@=P6VPxaDP IDP+DPHP @HP0H08P a0830P T003$P U0$3P H03038  ڍRBQBMxЍ p-LM@Pg`0/k d0 m7P 嫍fx]7P堍fxD < 4 ?  H0S D0S 6@0;6fPbaxECP fxXRBtRB -LM`P0@pṑP@ .g41T 0CT!  0xf`@4T& lf0T 0T0/d@6 @ |@608#8@6 0 R @6@@@ @8@x#@/i 5i 6i( -LMd0@x`$0l07ifP3p0CSP3T=@? _ dx0S ^\fP3`_ E -LM0S K 0 Ƞ8,Ƞ#8  =P ? -LM`P(p៌0` @P 喌0$K2hC`3lCdS+%2CCS|3, K⢑@PL,0 40 0 Ƞ8,Ƞ #8?4`080@0<0 `R>S4 0@S4VP/ 00S@8<0S80s$ <0s! @0s  f2@K 0pP 5 ae5x.@\&T#]@  xP21!=1!!1 1!!31#x` O3"0 bb/0   0PE"R  c[S_P |4^ eJ"0c"c@RBP:,^B:?ZB_B8_BDSBkBx:X:4{::؃:u:Pv:v:,v: -LMP@`epQ V@P 101d!1R"@10\!RXA@@10\A! !/00@ 0@ d@@1017@d 0-LM@9=PP9Y {P4RP rP102P hP02P 02P 02P 02P 0288; 435 -/ '8RBQBRB -LMP`}P 9@ V VVpp202%PVhB 0rtQB 0-LMP ?MP  K0 *>>P ߜ ׊@. ?@ P@P Ȝ Tˠ24/ @= PBQBP: QBl: -2AML@`Pp 2㑸R2O\\  P  0傊K202@:<^B 0-LMP@ώP61S V⺾P8  P1S V⭾LP F6 ;&686;680  BQr0C8 00S: BQ  10RX!\!  10C18 -LMP`pဎ@P c9W;I9 WW" 0 0@0@  hW i*c0 0@0@ W p1S0wicXQB -LM2 @S""  P P *7 -LM@Rp` D ; 0 0P PmPPP屉7; ㏸1 奉7; 00QB -LMP000 @p`P 9@ V VV(K202噏P?VN ˠ`|!90p h|0@0@p0 0P h1W~Xa4 $RBRB,:::ԑ:@SBTB -LM0S K 0 Ƞ8,Ƞ#8 TP @l 0-LM@9=PP9Y ÎRP 弎RP ߍ嵎RP 02P 02P 02P 0288 p-LM`PP x0 0@0@xhq@ -LMP`ʋP 9@ V VVpp 3 0 3rPVhOBP 0G stQB 0-LM@ +>⚐P ; 3K0 ?⋐P , $ ? @=PP  T ̠24-. P劋XPBQB: QB: -2aML`P"00p2@" • 0•C40 •B( 0"C<02 0ĴB 2o\\  HP  0崆 K202x:X^B 0-LMP@P61S VP8  P1S VߺLP  C6 ;&686;680  BQr0C8 00S: BQ  10RX!\!  10C18 -LMP`pᲊ@P )`9W;I9 WW" 0 0@0@; h3W i\_0 0@0@ 剴 p1S0wiJ_XQB -LM2 @S"" >P LP \7 -LM@Rp` D ; 0 0P P㟴PPP7; 1 ׅ:7; 00QB -LMP0 @`p$P9@ W WW(K2 02͋PoW| ̠A0 L @+ 00Kt0X^084 0LT l ᅅT 0084 0Z0$ rZ   z00 @00@ :_ Z7P |P  A  X w^0 0@0@B@ 047  1.ꤩ:^B^BQBp^B - LM@-"!7P 2S KP YP 7g7 0-LM@bP 8^P7P 7P 2S 9@0;98h^@8h^P 8h ^؄8h^XRBtRB -LM`P@p+P@ ^0T 0T  00W4P@ ] @ @]608#8@6 0 R0@@ @ i 0-LM@b^9P@00S0T]8 p-L M@` ᵔP fKpB$ K⁉@P$N0PS00S"0@S$FPJ   0P" P" ;2S4 2S1 2S.  ^'N0PK 1K᩺' 夺0u2U@ 0 10)t1 0|1p!0@ 0`h'SrW1]@ 0RBRB*pXSB:@::@SBTB -LM0S K 0 Ƞ8,Ƞ#8 gP \lMЍ -LM@(P30CSP3h,P3 0MP3Ѝ6 -LM@P 0P 0hp p-LM@P0`P 6@00"00x.<20" x 0-LMP0P2S BT >0@T8h;8 -qLM0@P ` 3_$C ;R' @ 3H /  ߇P30P3媊P3@0CSP3T I TA07 K <bඹ<ឌH30H3:^B 0-LMP@0兇P%3S" 61S VmP8  P 6;681S V\LP ?6 ;&680  BQr0C 00S: BQ  10RX!\!  10C18 p-LM@P 04P_ \`O;3S 2 20S 2 S#PVxh[xx -LMP`0p @P \=W;M= WW" E? 0@1Aᒔ 劂W i[C? 0@ 1A p2SxJi[P3H0P3nP30CSP3ҋXQB p-L MP0 0@0@`XT0\0 K@' 1Sn[Kp@ -LM3 @S$#(# 0cP qP  偈7 -LM@Rp` D ; 0 0Pv PPPP7; 1 \7; 00QB -LM`0pPHP&U& UU h0l0h0P4Um ̠BD0 L @RP30P3P30CSP3(K 40KP咆 04 40SA? 0@1A h@墓 0(噁h .KA- [.0[4  0 0@0A40 @0Cx40 0 0X[ S7P P  =  U ZP3D0P3aP30CSP3ŊA? 0@1A:QB - LM@,<#"7P 03S 0qP0 P4 70升7 0-LM@0刅PP K0P340P38 D0xP  PP30CSP3t4< H0cPP  HP̠0D43(/ Py0GPBQB: -L M@PP`p# 0>PU?0@0,0K,0K FH0)K' K( K+0K%K*`K&KP3 0P30,K>P3P0CSP3 K! 0-@L MDĠ DKD\0KKPK@KPK0 -L M@ NĠ0KKK@PK -L M K0K P K -LM`PP@p 0ՄPU T T Qt0T 0d d^ThT T4 $ 7|?^BBF -L M @0K@K@KLP [0[K p-L MP0剄P KpA8#8$K@=8#8 @H $(2S<8 #8( "h=08#h$ F B T08P#h @@Q P$0 0 @  01$0 0 T&* -L M@ 0K @KP[K p-LM`PP@ 0PU @xT T Q0T 0|x @T@xT T<P H( H7^B?BF 0-LMP0ރ@P 8L@ ZT @ 8hZ.' 0-LM6@=P6VPRDP D`P+DPHP HWP0H08P 0830P 003$P 0$3P 03038) !# RBQBMxЍ -LMpPXo@ @rT$  i P7P~X7P~ X C:7H0S D0S 6@0;6WPRP W/XRBtRB. -LM`P0@p P@ X41T 0CT!  0xQ@4T& W0T 0T0/U@6 @ J@608#8@6 0 R @6@@@ @H@xt@?i 5i 6i( -LMd0Px`$0~07~XP3p0CSP3=@O 7cUx0S  P-NQWPQ -LM0S K 0 Ƞ8,Ƞ#8 唃P ? -LM`Pp0` ?@P  }0Z$K2hC`3lCdS2CCS|3, K@PO,0 40 0 Ƞ8,Ƞ#8Z?4幂080@0<0 `RCS8 0@S4寂P3 00S@8<0S80s) <0s& @0s# yW2@K`.0`pP } Vꋏ t}@ Tz}Hv}O 0o}  xPℴ1!=1!1 0!3 0Ox`#3T 0bCT  0pX6"R  >UMPP xO cVF"0U",URBt:_B|:?ZB _B4_B@SBXSB0::H:::::4::R0M0Q00Ѝ 0-LM@dPP >d0d0XP 8hZX8 -LM4!00PpABdHD.0K.K!0C& K+K)@K(K'0K%`K-K,PK*K&pKY K -L MD0 Q!00K# "0C KK0K400@@C K@KK0KKK:K -L MTS0^4pS@0NTGd!0" (K(0K'K%PK#`K&K$pK"@K!@KKT0MS TЍЍS0MS SЍЍRM R R ЍЍЍЍ -L MLp@` ѲP@ K4P0ED!0 ,K '@K,0K+K%K*K)K(PK&KԄ@P c -L M(0KC̠C$C0K00K@K: KKK0K  000K0K< S00K  S00K  S KPKS00K00K p-LMP0@`yP ,0T 1TxH00xxU@ 0-LM0@PaPU UU8h0Si0 So n0$R \8h{d8hp P@000X 000P<<08h褔X_B -LM@dP dقP0d0ō {_B -LM`@q d0S Kh80Ld0 @ȄP: -L M@@ 004`K0Pp4hP* T( `P 0S@T 0 S0SxOPx (0S @$0UP 0S (0@S(K$S0S S S00P@00 -L@M0P00p8@(P %0D40( K@0(0$ (0<@0`DD@Ÿ 00 ({XP TP 0S|@0@0ST 0S<P9   0@0SX 0SX0s_ T0sX 0<0 C 0H00@`0d@80`SP0S8@PP 0S00Sz0`0 z0* KS0P<`\ @\K 0H 8P 4` 0 <@ L D @@ ,p XX@0 D0  P Dz8z,z@_B_Bt`B_Bl<99L`B(`B`B 0-LMPP j@kP00T0S  0 $R 0R 0S @K0 0 4S @ 0K$K K0s 0 L4SQ @ 0S0S@aS@0M0RA00Ѝ 0-LM@PP 0 0S00 0S0088 |0 Q `0Q1!P P R 2999꓎¿ _,l,?+8#+ -L Mp0 P`(K 0   K 0 SGT 0T@ T80 0RK9#9 L `P`"1 P8Q0l$?ظ@? -L MRH0H`i@0pATF@0 (K(0K'K%K#PK&`K$pK"@K!@KK -RL M` R R KSppt0@0NFT@0 (K(0K'K&pK%K#PK$`K"@K!@K Spp 0 -LMp0}Pg80Sv f*( K R xʖR KRd0 0`@FT0N@0 8K80K7K3K6`K5PK4K2@K1@K妁PC ;PZ   \\< SP ASPHP0J@0ED ` 8K80K5@K3K7K6PK4`K2K1K偁P0@5K6K 0< 0 @60K5 K60K50K@00@8K 8K7K4`K3@K20K10KbP (KS(0Kp SP  SP(0Kp R ʖ R K R000 000 000 |000 yKR R000 r R 40R 000 j000 g000 d000 a -L8M쐟0`0@,0 |P`K0D4 @p[0K`K_K^K]K\pKZKYKPP , 0R(K=̠X K00 P 00_0K 0C`K\pK[0K^PK]PKZPKYPK߀PP0l? 0-LM<P\@010< \ < 0008 0-LM@ @QP @AD 00C08A0` `0S -LM@DP S0D0 -L 0\0X04`0 1,L KD0CD B@P4K=0K< K6@K5PKС4S ) Sc  SF  S07@K40K3PK44p0PSF@  00Sp0@S94(pP @$ 0R K SP @S S040K3@K;@K:@K9@K8@K7@K 0 30K 02 K10KN n08@K7K4PK0 K/0K;K:@K9@K?0;0K070K` 08@K4 K30K:@K9@K4 H0KQt@P0!rPP*Hq@ 0 ;0K0C70K5 K0 8@K40K0 K+K:@K9@K3K2K1K/K.K-K,K 070K4 K3@K; K:@K9@K8@K040K0C3@K00Kr`P@ CK  H0P@ @9or@PHqpqxBHTs0l8? -@0L@ M 0K ?0CKK0K@K@K@K@K@KsPK -0L@ M0K 0CKK0K@K@K@K@K@KrPK -RL M R KV0SV WV0^8pS@0NTGd!0" (K(0K'K%PK#`K&K$pK"@K!@KrW0S W p-LM0`@LPnPT TT"Kp0S P'jL@ 0 j0 S *S<KphނHKph r 04SU@T@ >0U0U0 0U0 U0<xh><@< 000m00CS0n'XQB'' -LM0`$0 2Pp@iP"T" TT; T9 TB 1QA 0%͠ %L @i000l00CS0%K $0K@*j$ R0 QF Q? 9CS,;,;,;,;$+;$+;l,;|,;9w0 0en@ 000%m00CS0neep|z ) ]'''*;QBeBeB 0-LM 0@0 0PAlPv 0xdh P00CS08P 0D K,, P0P K $ C0?`% V Pq%-c=$K0S2.@KP0RK"K2K2R7 0R0SR2K?2K.@K02K00C SFl5;d5;\5;44;T5;L5;D5;44;44;44;$5;0@"02K0"K.@K2K 20Se 20SY S08#.@KK!TK0`20pPK&㿙W?F K5KᵙtP`V000000 R  B✙h1!  0M] P `g 0@P @ e0 R08#Q 0.@K2K0"K2K@      t'h$' fBP'(h##''');.R -2LM ?Rp` 2RR 0RC BX2"p 0 00@0!P2P"@0]8B8Ÿ   @g- 0@? S+ 1 R 1R4 -d0CRD 0RI T1 @1 $K0S@? .pK2K"Kl1 .pK2K"KT1PH!0S01R 0R0AS8;8;t8;h8;08;08;\8;P8;08;08;08;08;08;08;D8;0 00 00p p <8# h$ '..'');'(RP' -QLM0`$!$a$K1p 0 ?% X00DP\Z+0 @  ZeSPP 0- NfiP s0( La 8%=al?lfB...''''0;XfB0fB -LM?p`0 \`00 M \@1Q  A1(A(Q0  0 10Q @ 0 p0pᴠᶐ00@0000 @0]}@ p  @e _\0@P@(K(Ko>t'..'.''');. -42LM PRc  R 00 0000S^:Ap0P X00`S` 0@ 311 ` BR sj1Q 0A!la \AP 080 10Q ,AP #ggP+00AP ggP,00@P ggP009`9K':`@p0r \`r H`r 4`'.D'..'''fB8RBQBRB -LM@P` pP `K$ KepP8$1!@! 0 `p0C `d!(0CP\1p p p]e0`S @00S1 0@S$SeP   0P0  P0 F`0  P ;` 6`PqP d*`X&`P0  DXRB''D..'''RB.tRBSBfBXRB'H&; -LM0S K 0 Ƞ8,Ƞ#8' eP T?-0MS DQ 0 S  0S Ѝꀄl?#=?c1P20`M<Pr0`Ѝ -|LEMpp, dP <, 0RI(K(1^ pL0p 0 G͇ p0@0 1 800 @0@BM`V@ 0S  0(K$cAA,( `{V@1Sd7R0 p-LM`R@P0PS00 0S 0 00S vd00U@x - 0LMAMP00,@p`pVPt01ePh `>e21CA=,0P4  00 pW@7lp0. p-LM@R`㌌PP ; 㳌1/7xD ; 0 0P Px7x; 00 -LMMĒ0P,0 2@`p bP9A0AS 2ŸB0  @"bd, 0R(KW WW E 4cW 2e>K pXb01S 0 0$ BL 0! |L! 01H 0 0HL~D 0 0@0@57@  r7PB D0S 81ppp 0 p0!0F@0 1 ,K*. *OPd1U@?0t8 0`h414!901p!t1(!(10@|!0_+GT1!" Q0  B0F ` X0F @0 G @00@0 @000h_xd[4XTXSBp؆lq>`C;d;G; M;f;xN; h; ,0fB -x1LMp!phA( $ p0S@ R$K( K⬪P=(0$SP@" `(0`0dS(0   S@ȠK8#蠑ࠁ,Ƞ@ 0PPxPP $ JK8$#H B@ h0@`PP0  0,ZW?CyOi؆lfBfB -LM@03 @9K -LM 0 @K@(P[K -HL M@2 R< 1dh 0R0O( 2K0 PP 0A P 1  @hYZ_[@2K0PP ,0P S@181#Ƞ1K#8!#8! pPT,00dpPP,0  (l (g؆lfBfB0gB -LM <#83 v K p-L MP0@!`0P EjP Yx1`^Kp*4 _P\π PY P0S04!4000 P P 0S PKP0[SSS0  # U? R K 0P 0 R p0 R `0P P 8 0, 0dRBlRB4pU;$1lS; -LM0 @" @K -L M@`P*pKUPD0g P%0[S S X0 K0 -L`M|K`@P  P, p0@A$|0KV0Cy Kx@KvPKu0KzKw`K *@ Ƞ,Ƞ 0@@ P, 0R (KG4s0KtpKV tK (X10l? -LM@Ƞ,Ƞ0@ oK -L8M0TpKP`0 $0 @㯏,0' PKRKT0KQ@KS@K;: JK3: 00*0K*0K& Kp0O0 /0)K(0K0'K%0KP $ 0R  KU KIPU0[S00l? -0LM @RP $`Ktp d0 S$ K U0 $0KP K $[PP -LM@Pe26p=`6vP ^_p\@P ^_pE  4@D60670 R0ǥ= S @S @ & 00  0  h -LM@N4P 6A0AS 4@ -L8M0XpK`4 $0 #(@P00 NKX0KVKO@KT@KS@KR@KQ@KP@KWPKUPKf0(|0& KQt0.PK d0@-K- K*0K4 0C7%0K(K'@K,@K+@K)@K($ 0R Kw.0l? 0-0LMPZPp00S S 8P P/@0~8h:/p8h00M@ 00CSLi;Ti;\i;di;Di;|i;li;ti; P P@ 7P,@ nPX@ Ѝl`0 $H0AMhSu\k;pk;pk;pk;pk;pk;pk;\k;Tk;pk;pk;pk;pk;pk;Tk;pk;pk;pk;\k;pk;Lk;pk;pk;pk;pk;pk;pk;pk;pk;pk;pk;pk;Lk;pk;pk;pk;pk;pk;pk;pk;pk;pk;pk;pk;C,K,0K+K*K)`K(@K'pK&PK%PK[P Qe IS KhB 0-LM0 @$(L"(P0 $("(( 0$("(8h 0-LM0 @$(L"(P0 $("(( 0$("(8h  ,0M R  Ѝ  Ѝ6V p-LMT0,(  Q@P P0@`[ov r xhm6 -LM@\ ap8#H,"(Z<(R -(S<(R  hKfdh -LH MhP$lCt?$H,K,K+K)PK(@K'`K%pK*PK&0K[P d R KhB 0-LMPE-@0NA A K[@Q \00HS X00 0R B0HSQ(0VP 8 $8hT& p-0LM`?0P.L&0K.B0&K K%K"K!@K 0K$PK#PKPKZP[KpFd >RhB -LM0@9$   08 #(hD -LM0@,8$  08 #(hT -LMPp`@  @ThhQT @46%CA($H"(0H$(1 0p@X -D0LM @R ,0 )0 @ h&X\ 0- $)LM("(XPS@MY @T(Q8T J8iB -LMPp`@M; @T,hQT $("(h@ 0-LM@PT T$ 00C0S 8h& p-LM`PV@ V@@|0 A QR@ P@  ("(0(  ("(xh& p-LMP@@Y,dT cP dT8'Qx,`@0 @t@Tx@x? -LM@03H#`P00V0SOp3PFl#0Pp1p#S,p~;~;;};4;~;(#$3!3yDp V ""2! "<8S @8S FV  FN[+iD2!\ (""2!#)D !!1!#@ z!u1!p#)D jVP! -dT!_P1!Z#@  S$1!N#)D H0V  A < 80!3#)D - k -'8 #<0!  -Xh&`???@???(?? -LH MhP$lCt? $H,K,K+K)PK(@K'`K%pK*PK&0K{XP b O K(iB p-LMPK 0@[0 0a[0aKQ[e%%% %`  Ƞ!`0 ,Ƞ  .P 0 P/0E-6  0E-( <0Kp$& 0-LM0d 60PS0CS006 8hD(O00 @0@8<@ 0-LM8P@P U00B]P }008x p-LM@ ``6f=6 0 P x P U`\PP UZV`@PP |URV`xh<D(,0 -LMt00,0 H! 0@D  I  DLP 0` H!\Q4 4 Vh *@! 4H x0Cr  0C0 4`V" @P0@41$p0p47 pZ0CG͊P\02 B4$ PP&}#C B-0 ß  PSdTZ  "{PP@ l$Kpt8p0p(Op0NE-H "X; 0u21C! c.  P0U1R1P@, !ܡ:00  T@P ] KK@1z,p  0T@P@P `~K] LxK@tKP $lK @A!ˠ0A-4 ORP@"<(R B 6RN n  08#(60;@06<(R  @\ B@VT3KO4?"VS(DjBiBjBdjB jBjBx|`;DjB -LMpQ`@tOP@ }O$1PT- |10Sp1TI 0n@4T@ H1T# @1T  e4P@# $0Q606 0S06@ @@ @ re4P@<8S 6A0AS@@ D0n@6A0ASt @i ϖ1i i i -LMȢ0R,0 P` \\ \? "ˠB0L  @ OQ, 0R(K >KQO0!#R0 0@0@0@ TD D H! ypPo ;H!;y1 QJx1KR p00p0pD0T 48<#8:#:0 0$@A@ 0S) 01  D$ 1pp 0 K p0C 0DF=00 $1 1 0H! 1 0@X1X!9t!P1P!p1|!00@ 0h,@1!1"2  !>F , X0 0 D0C @<0D BD0(K(KoG (KoG(KoGkB;HL;\Xq; &$|kBq>>h;܉;4; p;h;T;,,kBPkB@SB -LM0S K 0 Ƞ8,Ƞ#8 #RЍ 0-LMX0@ ! 8T0 $4T0P $84X0Q;+S  ; S88  ;8R 8 S8@@@` M (RT L0RA 0R Ѝ#R! &R #X0MЍ0X0lЍ`LTMЍ- -LMX0@lR 0-LMX0@ TP> \0 D L .  "`0   \ i w E\08L  0K0hL0& \0  L( 0L0& \0L0"~\0  L0# t\0  L0# i\0X 0@ X h00<0L 00WX0L0 h X0+0 BJ`0  LX  0h0X 0C+ :`0  X 0@ X h00<0L0 0(`0 w 0-LMT,0@ 0P 0P Ko0S|0 oP S | 80PP0S -LMTP 00`Rp @$<0 T ,00@h), \00Q0S 0-LM(0P8X0@08X0 T0$4P0T 8h p-LMX0@$!;98 T8}PdU 8 T0$4` PL0S X0  x8;T$8x 0-LMX P@$ `0   @08#  P=8#0T$8 8T$8 <8TDX04R 8\ <C308#(  ;8#(`0 ;8#(0T$8 8X0@ `0T*, <8#(0$8 8T$8 <80 X000 X F8@X}T 8 T0$4 @ @880l@X0 n}8D8lB; 0-LMTP 6& 0 88 $4T0@8$ 4@h d0R 0h Sd0 P0d@?p8 -LMT`@0' 2 1C P ^{DY$8 80T$8 8X0@80T$ 8 $84  X0  h?@lB -LMTp@ P0P,@`8 T0$4T0 P8$4@,0 0,0T0$84  00 P, 0P 00S0P 000 00P0P8 T0$4T0P8$ 4X0@@ ' 0PVP0P(0S  \0P`0  8 T0$4T08$ 4    0PVP0P  0PVP0PP0P 0PVP0P    0PVP0P@ 0PVP0P 0P0PVPP0P0P -LMTp@ 0,@00`8 T0$4T0 P8$4@,0 0,0T0$84  00 0, 00 00300  00000000T0$8 4 8 T0$48@T0$ 4  006000T08$ 4@0000000000600  006000 006000@ 006000  006000 0-LM@8T0 $48PT0 $4<#38T$ 88 0-LM(0P@ " 0ES4;L;;(;0& 8T0 $4V>0$T8 8U88%8 L0"S 8 L0"S 8T0 $48;T$ 88 L0"Sp -LM P `? p-LM`@P~  xA(0pL0 P8 TP0 X0h T$8 40 \xxh`?hlBT? -LMTp@ 0,@00`8 T0$4T0 P8$4@,0 0,0T0$84  00 0, 00 00300  000000008 T0$48@T0$ 4@P|;p;p;p;h;p;p;p;p;p;p;p;T;p;p;p;@;p;p;p;,;006000006000006000006000006000 -LM@y8T$ 08 0-LM(0P@  0ESP;h;;D;0&N888 L0"S 8 L0"S 8T0 $48;T$ 88 L0"Sp -LM P ? p-LM`@Pw  p@(0hL0 P8 TP0X0T$8 40 \xxh?hlBx? -LMTp@ 0,@00`8 T0$4T0 P8$4@,0 0,0T0$84  00 0, 00 00300  00000000T08$ 400000   0000000000660000 0-LM(0P@  0ESꔿ;;;;0&}=88M8 L0"S 8 L0"S 8T0 $48;T$ 88 L0"Sp -LM P ? p-LM`@P  p@(0hL0 P8 TP0X0T$8 40 \xxh?hlB? -LMTp@ 0,@00`8 T0$4T0 P8$4@,0 0,0T0$84  00 0, 00 00300  00000000T08$ 400000  0000000000660000 0-LM(0P@  0ES;;0;;0&o888 L0"S 8 L0"S 8T0 $48;T$ 88 L0"SPp -LM P ? p-LM`@P  pH?(0hL0 P8 TP0X0T$8 40 \xxhC?hlB? p-LMT` @00@,0P8T0 $4T0@8$ 4 ,00,0 0@0@C0@ @0@xX0 @0@ @0@ @@0@0@ F0@0S x6@0S0@8 T0$4T0@8$ 4 00<00x p-LM(0@`P# 0BSX;p;;L;0& 0 8T0 $4T98$ 8.xxx L0"S x L0"S 8T0 $48;T$ 8x L0"Smp 0-LM@8T0 $4T98$ 8P}U T0$8 4 P8 T0$4@ R\ &RZ X0`0B%S&L;P;P;P;P;P;P;L;P;P;L;P;P;P;P;P;P;P;P;P;P;P;P;P;P;P;P;P;P;P;P;P;P;P;P;P;;L; &R& 0T$8 88 T0$4Tp08$ 8@0&S 8T0 $4:89T$ 88 < T0$8 4PT$8 08T -LM hP  ? p-LMP`@Z  =(0$L018P0 0T@?>C2@0 0 X  8@0 SA S P0T$8 40 \ T0$8 4`xhX0  8T0 $4T@8$0 88T0 $4=8$T= 80T$8 8X0 T0$8 40 S@09T$8 8@0 ?hlB? -LM@8T$ 1<8 0-LM(0@P0  L0"SU U U 880& Hp88>nB p-LM@P`=(0L0 P8 T@00X0( R Xxh= T0$84  \xxhnB?oB -LM 0X@sP0 3@50  S R ? 0oBZ -LM$0Tp @0 ,@0`8 T0$4T0 P8$4@,0 0,0T0$84  00 , 0 000  0000008 T0$4T0@8$ 4   ! 000000 UsP PsP8T0$X 4 000 0008T0$ 4 00@ 000  000 S0P0L  :(0L0 T`8 0P X0T$8 40 \xxh?( P 0 3Ld?p?hlBX? 0-LM0BP@ S ,;;;; L0"S0&[8m8 L0"S 8 L0"SRp -LM P ? p-LM`@P  tJ:(0lL0 P8 TP00X0T$8 40 \xxhD?hlB? 0-LM(0P@  0ES;;;;0&4888 L0"S 8 L0"S 8T0 $48;T$ 88 L0"Sp -LM kP ? p-LM`@P]  p9(0hL0 P8 TP0X0T$8 40 \xxh?hlB? -LMTP 0,00@T08 $p4T8 $4,0`0,08T0$ 4  00 , 0 000  000000 0000 00 -LM@$8T 088T$ 1<8 0-LM(0P@  0ES;,;x;;0&]88-8 L0"S 8 L0"S 8T0 $48;T$ 88 L0"Sp -LM P ? p-LM`@P  p8(0hL0 P8 TP0X0T$8 40 \xxh?hlB? -LMTp@ 0,@00`8 T0$4T0 P8$4@,0 0,0T0$84  00 0, 00 00300  00000000T08$ 40000000000@660000 0-LM(0P@  0ES8;P;;,;0&T88d8 L0"S 8 L0"S 8T0 $48;T$ 88 L0"S5p -LM P $? p-LM`@P  p-8(0hL0 P8 TP0X0T$8 40 \xxh($?hlB? -LMTp@ 0,@00`8 T0$4T0 P8$4@,0 0,0T0$84  00 0, 00 00300  00000000T08$ 4 0000000000 660000 0-LM(0P@  0ES\;t;;P;0&-888 L0"S 8 L0"S 8T0 $48;T$ 88 L0"Slp -LM P `? p-LM`@P  td7(0lL0 P8 TP00X0T$8 40 \xxh^`?hlBT?MЍ 0-LM(0P@  0ES`;x;;T;0&J 888 L0"S 8 L0"S 8T0 $48;T$ 88 L0"Sp p-LM 0`@P6 0?.C""6(0L0 P8 TP00X0T$8 40 \ \0 `0  xh4xh6T0$8 4`pBpBx?qB0 3, A5SM Ѝ?>S  @ -LMT@ 0pP 0, 00•_ ,0S,0`0,02p , 2` , Q( "0B0 RSQ20 ,000000000020 , 00600 0060000000  @  \0  006000 , \0 @- 0060000060002 SS2BPp \`,0p 006000\0  006000 00000 -LMTh 0@”R`\p,0h 2R`h \@,0h  -LMT0X p Z @}Ty 2` ,: S@@2R@0 \`,70 2R@0 \`,<0 2BPh \`,0h \0 4—p 1\2R@h \`,0h 2R@p \`,0p 2BP` \`,:` —p 00\X00X0 -LM(0p R RN R+  (K L0"S 6 0X00š0 ,0q,Q0 1 Q QX00X0) L0"S6 @2` ,Pd@d0h 0Sd0X0d@0X0 L0"S 2R@h \`,0h 2R@p \`, 88p 06SV 2R@p \`,C2@0( L 0P80TP 0h0X T$8 40 \xxh ?hlB? -LMTp@ 0,@00`8 T0$4T0 P8$4@,0 0,0T0$84 00300 000 00000$8 0T8T08$ 40S;;;;;;;;;;;;;;;;;;;;;;;;;00660000 5;00@ 005<000000000 0000000000 000 -LM@P0X )  `0> T$88< 0R# C2@0 T` D 0 X02P0yX0 0h0h0X00X0P T$8 40 \ZL0"+X0 P L-+0cP2]L  0$KmbPX L# 0L#,0L&*0L0&!,XL00@ L00-T0$8 4`bP 2#(x0(Rp0P0x h0Rd0P0s \0P0pL 500D rB?hlB?rBW ? W,?? -LMTp@ 0,@00`8 T0$4T0 P8$4@,0 0,0T0$84  00 0, 00 00300 000 00000T0$8 48T0$ 4 ! $ .  0060008 T0$48@T0$ 4   006000006000006000@ 006000 0-LM0BP@ S <\<<< L0"S0&78 8 L0"S 8 L0"Sp8T0 $48;T$ 88 -LM uP X? p-LM`@Pg  t*(0lL0 P8 TP00X0T$8 40 \xxhX?hlBL? -LMTp@ 0,@00`8 T0$4 P8T0$4T0@8 $4,0P0,08T0$ 4  00 0, 00 00300  00000000 0000000000 660000 0-LM0BP@ S   L0"S 8 T048;T$ 8 L0"S 0& P0T$8 400S.)<$)<$)<)<$)<$)<)<$)<$)<$)<$)<$)<$)<$)<$)<$)<,)<0& PX\P>T0$8l 4>d0h 0Sd00d0@ 6S0 0S, ]S% 0$8T 8<$8T 80T$8 8]`T0$8 4  dPM0 +0S, PlC -LM 0P $? p-LM`@P"  %(0$L008P0 0?>C2@0 TP D 0 0h X0 B40 \ \0 `0  P0xT0$8 4`$?hlB? -LMpT08 $48?N T$4$0 0(\P$} 0I+S,-<,<,<-<,<,<,<,<,<,<,<,<,<,<,<,<,<,<,<,<,<,<,<,<,<,<,<,<,<,<,<,<,<,<,<,<,<,<,<,<,<,<,<,<, o %ZZ q8@$PT0 8`4: $P8@T0 8`40 ZZ =$P8@T0 8`4: 8@$PT0 8`40 $@8PT0 8`4: $P8@T0 8`4< b$P8@T0 8`4: 8@$PT0 8`4: wBwB -LMh -LMTp@ P0P,@`8 T0$4T0P 8$4@,0 0,0T0$84 00S0P  00P0P T0$84 R0P@P0P R0PP0P R0PP0P l1$0P V0PT0 8$40 0S  <006P0PwB -LMRpP`$ R5 R  00R , W00R0S L0"S5  L0"S 8T0 $48;T$ 8 L0"S 0& j 0S83< 2<3<3< 2< 2<3< 2< 2< 2< 2< 2< 2< 2< 2< 2<(2<p@6S$8 0T8$8 0T80T@$8 800S 0$8T 8T0$8 4``?hlBT? 0-LM P@| ,0\ 8| 00\08 -LMPp `0  P4 P @ 00?T0S @ 00?T0S 0S $X@ R 00 -LMT`pVM`VJ <0  @P<0 P(U@<0  <0  <0 <  <$K (0K|P <0(  P$0<0(  X$0L0`VK<0(   T<0(  X -L M`p $0K@PBP $ R  $ =S  R 4W$00 R000K 0-L M 0KP@P   K0-RM8.\ 0S0 SЍTM$ 0 RT R R 0S0`0Ѝl -LM$0@S <0#,R R#80S #8 04 P4 0@ &s -LM0Kp 40KP`P( Z)4  13[((1800 4 @T 4 P@0  X p(K -LM0Kp 40KP`iP( Y)3[((800 4 @T }4 P@0 4   X p(K -L M`$0K Pp-P V $   R @$ 0 0TVD<@K 0 ' -LMT`pVC <0  81 R9P@< 0@ (TP<0  $ <@1 0  <  0<@ < 0 <$K (0KP `VK< \ t<( P0 $0 <(  T0<@(  X0< ( L0<(  X0&s 0-LMT@PT@T <0  80 R <D\ < &@T8&s -L0ML `4pD0K0< K@0K  YF (3@*P 00KPPZYU (K4K8KHK00 YP4Q 00S& "*H0 L P 8 0 P L0P00P 48 0 P00P YSL P 8 0 P <K@ D0@0 00 0440 @0  XJX40@$&&Q020a00#80 580 %L04 P Q 8 R 2 *0*Q020a00#L 80 580 %4 P Q 8 Ro$ @2 *0*Q020a00#80 580 %L04 P Q 8 RBL P Q 8 R9 L0 (  @P0Q0U0S5   d02 P- <@ D0\0a&<K@ D0@@X0 00 P0 00=0 P <K@ D0@:$ 00 P <K@ D0@' X0|0 P^ <K@ D08@0 OxBHyBxByBxB p-LMP`P TP @ :T0T0xMЍ -LM< 2ᇓ  40 !20@ 5   1(Z   $0   $ 0@0 R @4  0010 %0"00 @4  0@ PB@( 0P:@ pCpC -`Là p" M P x| $0 #x 00| Tx@! |0\ 0 KiY -遒ၣp LM@P`   0P0 f(\0040    4 $0 0  00100(P@P"!B0,5 0P(P 00 P% B 010(\  $0  B 0 @ 5, d0%4!D00(K0 0t qC-M  ЍЍb -2@001"L$M`5PSp (K00K(0<0K 0,pP  0Tp7=00 0 <K0  04pP=008 0 pP  0p 0p % 0pP  0pp 0   pP  0pLqCqCqCrC&>\ 07 '>>07  06D:A 414!H0Ǡ1ÀH DΌD `VOph0l@ h@L0lD hH0lH h@lD0T (K8d0  \  0)1L  L :Q0:0P  @@@ @ -L Mp00 Pt@`ph0l hl0 0X 0  0  P#0 0X 0  P00  0 0(K$@ 0  $vrC|rC -LM8 `Rp+p@PPLR@"ڰ5Sx0! |$8  3$P8 p $d8 PLR@rC -LM80@S-Pp80PSp$x0 |$0S`3P 80x0 |T80PSprC -1LM@0@ ,8#8@ p\0` ,0` \80 PU@`$PU@` 3B@ @P80 0 80PrC -0LMp@ 0,80 PU@`$PU@` 3B@ @hP80 0 80PrC -LM8 `R4@P5S)#200%10Rp 0 0QQ+ 0Q( <Q% 0Q" 9Q :Q x0! |$8 PLR@P8  4X 8    hMhbiMurC -LMx0|` ,8pQ&@PPLQ@ڰ5!S;2 3P8 $0 8PLQ@rC -LM80@S-Pp80PSp$x0 |$0S`3P 8 x0 |T80PSprC -LM`u hl8 R$@ PPLR@ڰ5pS5 3jP8  $ 8 PLR@ rC -LM`lP hiW plhd8 R$@P 38P8 8 PLR@ ڰ5SU UPLR@ p-LM`0 P$p0 4@0$0 0 P $KphI  0$ 00 P $DKph6 ,0, 0  ,0Kph1|rCrCDl -LM1 P$$!`p0ba p  aX1@!  0 P $(Ko 04 <0N>00 P(4@@0  !  T 00   P@T10 $ X ( 04(K$4(Ko $ (Ko |@rC lsC8sC p-LM4PS`x @(0@TTx -LMpA hl^8 R@ PPLR@ڰ5SX5#20010`P8 PLR@ P P Z8 -LM8 pR@PPLR@ڰ5S5S #20010`P8 PLR@P P X8 -LM@mPh -LMd2P@TH` H2p\8* <\!0@ ,0PS\ 000`@VT330033 0#P P i  i  0T 0 $  $ 0 $ 0` $@PtCsCsCsCAdsCsC p-LM@1 P$+` 0\ $+ 1\t $+ <\dh 0$+,0S,<< 000@XT330033 0#P P i i  0T 0 $  $ 0 $ 0 $@|@PtCsCsCsCAdsCsC -LM 0@p4 PP0`b@ D@ 0SP :0S:  Dh  @ 04  0480 ` -LMP` [㛟2p 4 >04 @L4 84 (+ $ 0@ FP $K00 ~x0t0 S0 4 !A> 000\ 0 506 l1l!<X0d 8 0,K$P9 0, ( @p,  `@1,Pp* W  80S P@ʯ80PLS@P #20010pl5S X\PW @~PtCtCAh0h!2# @00@ 4 Pc@+ 000  :P! d00@ 000 8 0  #4  0$4 / 0d8Q 00B90809008  P@Tό40S x!0 |Th0lX h@l00` (KoO 908 Q 0dж#ѽ 0d d@k@ -L(ML 0 R h0l@ 4B40h@ D l!0201< P0 P 0L8 H0 0 4@ #+ L000 aF003 0S 8P3P#0@02 @ h0l@PH D (6H D 40Z㏏4 0 8 RLL0 RU h@0l@ h@l<0D (K 03 0S 9424"002@4@ 8  0*8 0 RV :1!1 H  0@1Ì< @ < 8 08 x8!0 |TLy0 RPh@ @0lh@l<0T h0lO 010 BP < @ ;80 0@04 "Œ@ U:0 0 @  2<00 @ < 9404 0@04 "Œ@ ~@@@@p@w@~@ -L$M@ h0l@ h0`lD h0PlH @h0l@T L L0@  @ 01H T" !0 0  @P08@ 0 303 -LLMP V(7 4K$P (K 04 (L 0&Q 6Q e0CQ   H 46,p6QK0CQT:  4H   P6,pp0S. @x|0K  0 @@PPtD 0p 000 0@ @@}P.5%00\ 0 405 0t%60X <45P9 [0CP =0CP  l 5\0H ,008080$SH 4$L0P D 8 @ D < D @2001X 0p 0P0 00%5D 䐊 P D08\ 40D0 2`0  `10a8000X0/0 P\` P0DXplU  U !00 @ PP tHD U8 01080` \0!c83 01@a<000X0&.0 PL000X0/0 PT vPux08@CQ1P%0CP*z>CP01` \080!1` d0HD Q q0Q p3Q`3Q T3Q L3Q 0Q @0Q 0CQ 0Q 0Q e?Q >Q q0Q: RxR::<R0 H0v"2QQ:0S0<H  00 j h :X"<0DH 18< @ 80 08 0 3b400`S  80`⏏0 I 8.L9a@  @ 00Q8\:h0l@ h@@0lD h<0lH h@l 0T (Ko&0<:< : 0@ H 00 0Q3@ 9 `8x!0 |T0:0H 0 t@ 9 L 9b@00@0 {%&$vJ$K$$f@ 0-LM@Pp3 0 3 h0 0@ 0 R 408h  @ r  -LMp @㗎x2hl$ P  $ 0A TP  U  Kt0 S01A0\000506 1!`<0X0d 4`8` 0(K$P7 0( ( @P(  p@01,Pp U! 0 R 80SP80PS  P 3B@@A@@4CP \`,7  0\tCuC.BAtCh< U 5 001 `p05 0 5S(K0010@00K4K @ 5S yP U0 4Q  0%($%(pC4pCIX<|wC`tC -LM<@P$Dd`p @0 <00 tp880S@ \80@SwC -LMp`4 ^@P T 0t02 4P$K 0PPPPt' 0  $Q#* 0x|@P @ Pp3t0P0 H0H H0D0P L0D`K0(tPxC| 000!1\ H00401 X0<6 5880S$Pp80p\SP P h0@ l"9 8 %Q80p\SP(K#20010<0  5S @00K4K<  @5S < 0 hP 5S X5S8 h 00l@ tCh<|<<|wCp< -LM<0P#4` t0 S0 C0CS=X=p=p===d=0601X0<x1 R080080`P80PlS`( P #20010pA4K  00K@Ŗ \  0" 5S q80PlS` (, 0 0@Pd `:9d (K0S060060tCAh<<p< -L M0`XH@ PP+ xPA 8P> 8P 9P :P h0lP 8 0PP P' X8P$ P8P 9P :P 8  8 (8PP 8P 7P 7P 9P :P 80 <   < {@000 7R 0RR700t0S 00l'A>000\ @4@5,7,'QQ  0& 7Q# 9Q :Q 6QPPQpp06Q <Q \R6Q00SW6 6@060T&T6QQ H6Q <Q 86Q 9Q :Q4&0&0X  <08 6RR 0CR <80%5QQO 5QL <QI 5QF 9QC :Q@ 80Sp`Ph lt5h@ d5l80pSP0$5QQ0(5x| \x0| $x00| Tx0| $x00| T80SPp<  P 00$,4QQ 4Q <Q 4Q 9Q :Q 4QQ:78 ᇣ 0010@<0 *5S| 0#QQ# d3Q <Q T3Q <Q D3Q 9Q :Q PC4K@< 00K@ ,3,#L0P B C4K@< 00K@ 5Sx 0"2QQ% 2Qa <Q^ 2Q$ 9Q! :Q gP 0`"QQ:78 @ <08 0!1QQ9 1Q6 1Q3 1Q0 9Q- :Q* x80p\SPH0l!h1QQ \1Q <Q L1Q 9Q :Q hl80P (K 80p\SP <0@L80p\SP0CRIF0CQ07' 8)%80p\SPʰ060s0CQt080Q07xthMhbiMibutC3Mh<0M8M<< sE s < p<| 000\ 0 506 D1D!X0080d << P"80S"4`80`\SP! P #20010@00K4K  @5S X80`\SP(K 04@  04@ (\2R:0R60RP0CRH0CRV:00000#20010<80 5S A00K4K<8 @5S< 80Jd1Rz 1R |1Rs0CRp*90CR060lP"5S X5St1R M:=B 0CSI0R 0CRAi0CR 0CR99:h00 l@ |0R 0R'T0R X0R =B 0CStCh<$P(o&$.04B=<|wC&$p<v'$qʄ -LM<0p#4 兀E L@t0 S00A0\000406 0 `<80X0 580`S P 3B@@A@@PP,0K0K  P80`S$KtCAh<<.Q>p3 0-LM@Q4 0\4PSTT4\TS L4TTS 3H$LT83P$3X$ 0-LM@\# Q (PU $0 B  $  8 00 00K0 -LMh"0PTPEL" 2,p\$^P`"0 \2"RB.+0\2^!0 \2P!0C.\2@SE*2p0Cl!S00"A.\2P0!4-\2S00C$QS(%Q 4S4(52 ,"4 \ Q00+\Sp0Sd02\ 4\2&(8$8888 ` ` 8(8 p,80@-@QM9 9 <0! 4S04. U0,Ŕ000!00 0 04AS10 0 S&00 (52 0 0p 8#8 0C8R #80%Ѝ0000 <0 4S04 $& p-LM2`,0\"4P1"B/\Q 4S2 z?\"@0Q@Ŗp"F/2,P\Q0@08"E/\2"R. +0\3#6I@R0A@Sx5C SDH @  SDH @  SDH @ #1R @Q6QF 0AQS Q "0,\2P(!.0\2P!t5J/\x2 ,"4 \2*,"<*\Q2@  0\28 4\T (|((((((,(2MS 0 02Ѝ@ 0@02 0 0  0 202 -LM2@ ,"1 \ -LM2 0\ -LM2S 2 0\2 0\ -LMPp(0` @P8 8  (#8880P  0-LM0@(PP  808 -LM <(08P#8  -LM (@0P0  M Ѝp@-RMP` 0 0  0AS R `000Ѝp 0ASN0@0 @ 0@0`00  -LM2S1 2 ,(2)EU,eu2,,L02,,f v2d,,aN0 20,,fv2+,bN02+,(f,v $2+,HFLV(,2`+,enHL2,+,XF\VPT2*,fnX\2*,hFlV`d2*,gnhl2\*,xF|Vpt2(*,mx|2),FV2),in2),FV2X),jn2$),FV2(,kn2(,FV2(,m2T(,FV2 (,mn2',FV2',nn2',FV2P',on2',FV2&,l2&,G W2&,(g,w 2L&,sN0(,2&,8g@R 0C/000 /  0 3"5`P V# LP,&}CNJ}Cl}C -L$M(p P (K͇  0O PPʵP { Q- !|20S' @S@@'T 4 (0 |DPE·>0OEn   `P囵P L0AS4( ` ;E·E  0O_ 0P`wP 40K$PP D!꜒s0 (0@0  0p1,P  T p2S h(8K 40KP 4 ė 4 (02h 0\2L 0\D}C~Cp$~C@~CloC\=oC.BA2B 0-LM4P( ,ĕ? ,D0( 4b(, \0 6.[P "R,4#80b3 0BS028 Z^\~C 0-LM9P=9I09 @KT?2'8h p-LMPQ0`4 0@DYSOMZx -LM2p ,0 4S 00C0SL1 R00004S% 0S 00iMN@M. u"0S 0P 5`E$ 0@00C0S$0@0@x0x 0S"0BRSR2-,"6-\@B p-LM@Po+% 004S   20CS00dS& S0 S#0 R 0S Kp2&S 00  KG1[ 0<0@]F 0-LM@jP$6uI q8h誧 -LM2 S@( ] 2,,98#8 P2S/<8#8 P9P"0,\2S ( 0RN$K2,,"0,\Z?  |"RxPʯK ʯK` p` Vp|" 0 2,,? P "0,\ " :0l@ -LM2`^! ,58 X# U+ p U' %20 0!X PP("x P0–@h\d  \ Up5EK0 @5Em!88& 0-LMPv@8h -LhM,E,U 0`R _2 Sf %,21C0 l  x 0Ŗ0 @P T 5052 S7 (K@P0Ŗx 0@Px (P$08#80CQʌ2SS;S9 S7 S5 0 K40KI2 %50%05x$27@ S(\  $0  B 0R57@05(\  $0 B 000 40 x%(0URS xl@ | 倠 #%,0@,Ŗ40(%00000 2 @ R @0 0|P PPx (0S ;^ ,hpK0 0Pt $2 R ppP 2 pP R} 5,Ŗ40 ((0"800 1 @t0PUpP @W 0 0 p| %RUC T!00j8#800l 0x000(\ x $0  B 0 400,%|2 S@ (\  $0  B 0 R 2–@\ 0 \ @x0@( 00b8#800l@|0 O@$&88 -LM@p2 0CSؐ=ؐ=@=@=0=8=@=@=@==@== = =(=(=(= 3 S0("0*\ 'PP! h/ #l1R 3#,3 ,#03#5%"   28 <\ 1 Q`P @h P 1h89I@0;9 ⟟U 03hҤt~C ~C~C 0-QLM@P Q 8h09@ 8h)98J8 0-LMPd$0 S 80S=T=T==T=T==T=T=T=T=x=T=T=x=T=x=_@C80| c3 006S`0 00c#e3e36S40 0c#e3e#0 c3/00~CF 0-LM@P2 , 068!5058 C -LMP@p`1TP 1T7 1T(  00#@4T(6@@%0CT* 0T8 @A Wi2S> C @0F.2@4T FP @6 0 R0@U> 0+}@@ !@06li@i 5i 6i(0C p-LM6@=@SP Kp4S 2 S (\  $0 B 1`S VP PK1S3 VLP 061`S0  BPr0C2 S (\  $0  B V 2^| 5 \ 00S: BQ  10RX!\!  10C16;688 -LM2` ,2pSP 9@07 @5059@ 1S2X$P 2P J/t5\IN @PGS2 ̝@5059@ Ob  0)X ( -@LMT ]I  K "R4 0Ó4Ro4, |$<0t4/ @ +cx%„ĄfÄPN["0BS_긜==T=T=T=T=T=T=T=T=T=T=T=T=@=@==@=@=@=@=@=@==@=@=Ĝ=3 3D0R3Dl#On0`2=?0? 0PPD$S^%(#P02>0 0?P= >d4 K2"̠ &0KK 2[ " 2" 3?< 3RD03X"On0`2>0 0 P 0 2 3: 385X5P #X /2SS  * S( S& S## APU'^ ]X) 03vLDP5{2S4 05032 , P\=L=|=l=U03T00 0@p0 `2S0C5<ꐆ=`=&|F$ChCt~C=@CC p-LM@d1PP SV1xh'PaQ 0TQS{Oxhv CM Ѝ6꘹@-7MRQ 7R-7Rk0CR*"0CR [ 0CR 0CR 0R  >\0CR1\7R fB R*0CR*0CR0CR*0CR00#0CR0#0%*6Rl6R0CR *0CR C=B0CS000 \0h0 0CR :000`00 \0ЍM0CR h 0CR .L6R p0CR 0R0 0!q6R" 6R> } R:5R0R 00P!!\5RU 0CR0CR*0CR 0 00CR*F0CR0CR*0CR  0CR*0CR0CRx*C R;0CR*0CR_00004R;0CR]*0CR  4R0CR 0#0%*0CR0CR\: 00{4R 9:0R60 0!0 0CS4=4=4=4=,=,=,=,============4R 0CR000d0J M3RC 0R 0CR00<3Rz 0CR :0R:00.A=B 0CS000 0(H3R S 0 0 000 03RR 002Ro rC=B/0CS0 0P!2R 0R 0CR0 0D!0 0D!0 0D!zp2R ]0CR:0R 0Ri  82R0CR0# #0%* 0CR 0R0 01R:0R1R0CR*:B0CSz0 0U=B;0CSr 00P!!9|1R\0CR*0CR,  T1R~ I* @1RT 81Rf  (1R0R  1R G:0R* 0R R 0R\  R  v0S0 0p S-0 0j0R* e;<L)A{DP'( 3 -LM0@S? 0C QS!0  ,%R R: R7  0 \Q -01R $1R5 1C=B0CSQ!0 ,  0 1 -0R0080CR 80CR00!p00S  T0R 000040R 0R0R@P?DP{ 0-LM0@TP+?JG, 9:0+\0 ,8 -LM0@ ,(0S\=P=D= = 0S0 \32 -0LMP1PP0@`p` ,0S ?Q0d0 0000000 B -LM 0BS0BS0 ,P0MS==̬==Ѝ00CS20 #100CS$0 #200CS0 200CS0 #3 0 #2 0 10 #1 0 -LM p0BS2@@0R,R,aP , 0Qr 0Q,R, 0\0 ,  0DRL , 0R,R, 0\0 ,0 SL\ 0 -LMP0^d@p .00S-a 8^4@0!< \0 ,0@ S @0;! 0\0 ,81S -LM LR0 \㔐Ppq \l X0`\@0;! 0\0 ,0@ S @0;! 0\0` ,V LR` `@\r4B,8 0R0$ $0  R0$0  D0B$`K$00$0 0$0  \0 ,F}a@$0 0$0  \K 0-LM@P*08#XH0U #n 0U88 -LMh0!XS@hd0Sioip0,0 &TpW YP<  0 \\[ 0-LMPP 80 , 0BSR8@TB T4 8 @0 \0 ,0@㣖0 ,30#@0T # 2RS  @0 \<8 0 \z80@ 0\ 0 \8 -LM(\P@!h"x V:@0w03 fW0SP H0S 80SI SN S- @H0S[P W@  0,0 X  1 0\H@P  W #$!P0W 0$KmP 4SVQ #a!$\W `$ 4`4V0@o -LM0PSD10208#x 0CSp9@`&K! 0BP`1"[V"40 @0S 0 0 K #\00S 0 , 00#0L1S0ps p-LM`KP 0@PKp1[80 0 P0![00 0-LM0@ ,0P0CS,======================`=$=$=$=$=$=$= 0 480#0 0 4$440L0H08 R K00S;51K1[ R02)8#8ü#ʼ30 80@0L 3H 08 304R204 0 8020#4,0@ 0#4#4  0 , 0R80;HL3  0    \ 89))90b&0$ 8 6#1R 0 0480 0 0444#0 $L0H0:P 8 0+#V 0\r  0 80$$$ 4L 08 3040RH0ac@030KPY1[;#5S1K01KY@03M -LM(\P!h"x V:@0w03 fW0SLQ' 80SM3@P0S W  V 11p02: \0 *0 000\ 0@P @W@  \7@P0 Z @.H@ 1@P" @P80S@ W1 P8#^4SVQ #P!$J0 "! A08#HKP W@t宓^\W@# ("("$ B("(GW- #!$  3@}08#HT# 0 ,2 T 08#Z# ("($ B("(@@,' p-LM0P@ `K1K![2[?T08#81K  0P@Kp c 0KKP80S S{0 , : \f꺺' -LM `0BS"pK50BS RPP 0@@@[  @P2[@Q08#X 0 z08#P@K0U  0KnxmP "pK"pK0 W2[  # 0M[ Ɍ #0KLV 꺺 -LMh(P@"hpP  8804 \㉒<N -LM℀P@`ipP  8864 \i04 ,N -LM0@" K2K`pP T2[2[002K2K"[pP K<0 ,0P , <@ ;\0 9\ 0 \ 0 \ -LM 0@6 \0 , h -LM 0@6 \0 , h֑("(  B0-RLM0@p ,U! 4$0 $`K$0$066$0 $0   \0 , 㨑PK -LM0@B,, 0B,\0 , 0 \0 ,hq -LM0@0CSL=L=H=H=H=H=H=4=H=H=H=H=H=H================0 ,-1 R46 Q9 9 S0,0  S0,0 S00,0,0 0000000 04 ,0K0 40,  KP1[0?>C20000 00 40, 00040,0Q00,0 00,0 p-(LMQ@"hP50S4 S"x0 :380 \@0T* א0 ,@ 00CSx x xxD 0xd㯐x -LM`pPp;0SS0 ,0L@0 \0 ,儐 0 \0 ,s R R) R 4k0S S5 (K02. L1SV SV SWWd@R@T 0#, 0,, <4<,\ R 0S0 ,#,3PP( C@, P0 ,@DP@$d1U@@ T0 , < \0,,@0T", 0,,2P0ࣇ.KtpPppPl["[@D08#XZf@@H$H 0Y@HpP$00K  O F W\0\!, 00!\08 1P p30 ,0@ 1\0 ,0S~ 0 \0 ,0SL0debTp'IMP[N -QLMP@0(0Sv S& x0:38 \P1Ub 250 ,P QT00CSW0 K Fx ?0 , 6(0  \0 (pK, `P8#h0 ,0 8#h( 0PU0`0D 0dʎ0 -LM@xPp !`02K" K]P K"[00 2KP"[ ("(P+%(0  ("(PV P, "[ " ` -LM Ƞ ^,Ƞx? ppP`i@PV  a@T02 @ (耀CPC -LM`pP/P #28#H2TE  T0#03x0%x05&80  T0@8W# 0 S VW  #@$K @*"(PW t0S x0S0  C* K0K}P  0$@ -LM0P0CS"K`$ K0@KXqP @ 0SS S S( S @"[1@tt0SV(*("(@P V("(@P X@T0ST(*("(`V 40A@(*("(`N -LM@0LSP`0 Ki&\\ YP p 0SSUBS) S p p S0 ,t0SU(*("(=pP pW0SW(*("(+PU p("(pP (*("(P -LM 0@ 0CSK@ K}PP1S1[1[::1K1K![` 0-LM KPe@P1[A=A S K00$ , 1[ 00$ \ p-LM0@SP Kp`K 0P1[UP 0 S S ,PGxA,P  P1[M=I SP1K P1[3;# S1K 0 0PS` 0-LM 0@ S K0PK 1[  P1[3;8#8# S01K_$$ pP +j@ a -LM< K@P1[;8#8 1KSK0` 0-LM0@SP 8PPd ;PP 84 0PP$ *PP $PO$ -LM P@P Kt!@P  @P`"pK l@P f@P2[0S ދ0F8#h؋ @PЋ @Pȋ,@P @P @P` /@P )@P(2[0F8#h@BP 0-LM@ KTPPT1[1[001K1K1[;8#8 1KK0` 0-L M0P),0 ),0 t),0 X),0 <),0  ),0 ),0 (,0 (,0 (,0 (,0 x(,0 \(,0 @(,0 $(,0 (,0 0CS0',0 ',0 ',0 ',0 l',0 P',0 4',0 ',0 &,0 &,0 &,0 &,0 &,0 p&,0 T&,0 8&,0 &,0 &,0 %,0 0CS0%,0 %,0 SK00t%,0 P%,0 4%,0 %,0 $,0 $,0 SS0$,0 $,0 x$,0 S0A,,0 0$, 0 0CS00CS0$,0 #,0 #,0 #,0 #,0 l#,0 L#, ]08#,0 #,0 ",0 ",0 ",0 ", 0",0 h",0 L",0 0",0 ",0 !, L@K         x l ` T H <&@@@@@ @(@0@8@@@H@L@P@T@X@t@x@|@@@@@@@@@@@@@@@@@@@@ @4@<@@@@@@$AAA AAAA A@@@@@@\@`@d@h@l@p@PaQaRaSaTaUaWaXaYaZa[a\a]a^a -LM0@S`PKPP0S4 0( ,K0.,p" KPP2[ V "K @@02K2[02KP2[;2KT"[P0,,H@02K2[02K` p-LM0@SS  `Kp0,P K`P1[+  PPb1[9 S\  S\ 0 \ -LM K@P; 0SE   KP21[ 0K1K1[![@01K1[01K1[ <1K <K1K(0S> >> >1[;1K![P 0S  ![K1[;;1K1[;1KK -LM@\p`0S\?0Ǒ00 PU" 0S> S 0So K0 ,?0@d0 00000 PU0S &K P2[P  P0dS S2[@00\0Sk 0 P2KP0A., ?0 0A.\( KPU2[2[;;2K2K"[Y\00SpKP@ ? 0S `(KT.0S X0S0 K5`P `P嫆-`P`* `P3,`P0嗆 #[`PX`2K4 K`P3[S 0SS S S S SSFK a?L` p@FD6 KP@ቀ3[48#Ƞ0L8oS 0LQ 1(P "(TL  0L 0c0b888#80C?8#0S X0Sv1Xt.K  `Pmp@TdXe(  08`P#xZ.0[@T0X00i *`N0 K`PH `PB-`P:.K@ x`P.2[998#8 2K`P$X3,`PP߅@#[`P006 KRP3[=3S\>>|>t>l>`ꌀ}n{Py2w`1Xu.K@ -0PX2[9#9 2KPZ00\FKD >ဠ@FD6 KP@3[38#0A 8(}S"Z 010!8T#X"98#0j8#8ᑃ (" 0 0C?8##6 KP3[0S񟗖\>,>$>d>>s< `̻@[/ N5@Լ@@Ի@ 0-LM @0BSGR R K00S P0SS0S PK P P1[   KP KP![  1[  |0S! 0(0 K" K-P2[S(D0S; S  S |0SS 1S0 0(0(01[; S0(01[; S -LM0@S0S(0 ,0 `, p0BSPRR1SER R 0BSR PK$K& K1P17S @  0^/0\ @0 \010S0^/,P0 , P"`K PP PP[0 !S@  0 S! 0S 0SS S SS   S S S  0BS0BS&0S&0S 0 \0 , 0 \0 0\0S -0SS)PPV1Sv (K* K"PPM2[S 1Sj 0,, 0,\ QY0^/,PP ̃0-,0 3B1@rP0P0  01^/\0 , A0 \UPP 0-, PR0S 01* KPF2[?0BPPu * KP42[ 020/PPP[ PP gPP CPP  1S 0 1,, 0,\ -LM0@SS[P Q P hJ -LM<@/0S">#>"> 3,\姂T![0 SPK@ 1[  ([p@Q>-0A B8(#8"(p-08#8 1K    ~,z| vpp rh n\? jP f N[/s q!y012 p-LM@PPP  R  KP) PKp026 uP 00CS80S) S- SS0 ,i1[98#8 1K P:P0 P0P0'T[ 0-LM0PS@ K0 0BS@T7 R R 0S @P0 x0@hTl K,@PT [@ 0St00CS+@P+@P Rt 0BSR! ! ! ! h!{ wL!s o0!k g!c _ [ W S O ot 0BSo E@P[ ?@PU R`t0t0S SY--R@PA F1`#$%'5439`1DP` p-LM1@S KpP@ 0BS0 0S@ 0BS`Rc0BS K`PX00CS 0.\0S SI KIP"[40 2K80,, <4<,\ R R} 0BS0.,0S S 0CS 0.\0S Sg  PPK P0 S SF 1[ LR00:K1K R:1K:1K![yPg0Sd X0P`S0XS0C0< Sj   PS![ 0  00VT0 V V;1K![ O>0.,R1[ :1K  KP) KP!"[10 2K)P"[10 2KP3 KP"[t10 2K Pd"[L10 2KPY eP![00 1KP  UP![00 1KPt  KDP2[08#8 2K2 K4P2[08#8:1K![j:;1K![e: -LM0`0CS.@P  K( K@P2[?08#8 2K@P0 ,0SJ @0; \Q QQ QQ Q Q Q01Q 0SS7 S5 SSY SW SU S SS S S)1S&@P* K@P2[#;8#8 2K>@P  a= \p@P@P@T @P~P&pK @P s@P o"["10@1~08#X UbQ00CSJ*PK f@PTp H;R  P2[;2K2[ $R 0K2K R@02K R`02K0"[S0K2KP2[;2K"[@P) 0St0S-p :R)  +@P 0ST 2[t p08#RKD:p R<:0; ,:0<8#8 2K@P 0S S E@Pj0S , K2[08#8 2K Q>Q.2K@P 0(@ ,P* K@P"[(ɟQQ; 2<<K2K2K0A0S2[L=2Kk 0 \ 0SS S SS Sj .K @P"[d80 2K0@P"[*@P~0SI BKP,pK @P r@Pn2[6}0E8#X 0SSS  @PZ @PT @PN2[P 2[8} P@P ;J0E@P86#X 0SSu Ss S U8@P&0"[S00K2K2K2[08#8 U2K@P2[L:8#8@02KU.K @P"[50 2K@P2[92Kf *0K@P2[%9C8#R5 : @P%~@PA 1SK* K@P2[#;8#8 2Kg@P0N}P@P 0,\)1S 0S#$@P*PK @P"[40 2K9@P0 , 5 \D @P}'P2[08#8 2K@Pn z@Ph"[30 2K@P^ j@PX2[08#8 2K@PMSP)@E2[08#8 2K@P: F@P42[ ;2K.K :@P("[20 2K@P*PKU (@P2[08#8 U2K@P  @P2[ "Q "K Q 0`02K2K"[0S0K2K"[@P;@P9t0S @P ~@P 0 @P2[ 08#8  Ki@P2[08#802K @P2[p08#8 2KP@P @P0p R2[2[;;2K2K"[;@P00CS0S0S  @PS4! A A A:40R? -L M0PSD1@0208#H=P`>( R Q ( 9 Q7Q| & p0S6  R4`00CS)0.<\ 00CS(0@0P,Z/0\0P,0.\ K$1S ( Q0x0x00AS R 0BSQQ0 0QQ| Qz 0*@Kx0x00Sx0/ P2[pt{( KP2[p 0 Lt0pRhG>G>HG>HG>HG>HI>HG>HG>4I>4I>4I>4I>`?>`?>dI>H>H>H>H>H>G>G>G>G>G>G>4G>Rp Q00 AR0SQ0 ,0@S S^ Qp0Q2K Q N(0S񟗊$G>F>G>F>1S(  <P14*Z/\0P*<.\TQ &0KP2[:j (00P)Q0#,>  xT3Q t0S0 02Qi 2Qf 2Q  3Q '!>CQ 4p0CQ v2QP 2Q 0 0`2Q 2Qz 0 02Q  0 0}`O42Q" 2Q aP0CQ% @0Q 0 0j 2Qe H 0CQ 0Q1Q D`0CQ 0Q0 0R 0LS0 0M0 0J0 0G 0 0D l1QY t1QV \1QP ,  &0KHP 2[02 \0Q 0Q0Q 0Q7A9>CS|0Q 0Qu 0 0 Sm ( `!h!@_;`?B' T AP A0 A0 T AT AT A AA@M A APT -LM0PS 40S  0BRSR 0 0\0,0\ 0+\0 @, A&x0 , p R R 0BS&RF Rg 3 \\P Rs RP> Rg8w0A S  Q R Q Q Q 0 0\0 , R 0BS0&, 8x&\ 0BSW0BS,K0[,, }  8[,\a@"50Sq 0l@  0\0  3\02  w0 , : \0 ,}qw0A S  Q Rw 0$, :$\ Q Qg|0,, <4<,\QS0T$H4\J ~ %? 1S % 3 \ w0S1S0#,Iw 3 \pw0 1\$v 0BS0,, ` 0 ,\0,,@ }v`V 0 R0*0\0"0\ < J YP% 00CS @ v0ASv0 , v@T=P v0 , : \0 ,40SJ0 6\L1 S03$08#$"0K0 ,2[ 0 \ }P0qS 0D , '0p XP_eeeeT[ Na -LM pRe 0BSRRIPU1S 0ESU  f R 0BS``R`F R` R R `PQ@0;! 0\0 ,0@ S @0;! 0\0P ,U: R% 0BSP P@ R|a>`>`>t^>t^>t^>t^>|`>]>]>]>]>]>]>T00CS0 , 8 \&@K ( K{2[[`0`S "Q: Z0R b, 0S0 \0-,0@+, E4-6e\ 0-\P0ES[0 B, 100  \ 08 0\PA 0,\0 ,s<@  400 ,0H 8\ js 8 \`sU^0[,, 3[,\vP9ҽ 0+0CS0fƓ,0@-, 22-\_0 ,0@ ,0EP5 \ 2 \=0-,0@+,2$2 4-e\ 01 2K< BdK;S28 #8a~{0,, *0KSPPI RB[_ 0D8s0BS11A@2K2K1T38#8 LRc>c>c>c>c>c>0000 00 8 \C(02I 0000 00^c0000 000000 000[,, ?00[,\:T0B[TL0@2Ky?_(9T[:d(8P!FMЍMЍ -LMHQUp J@`!C@s88< \@@AT 2r80< ,PVs?TQs 0$Kmؖ관C -LMHQ0Up7 @`JRs8A8< \@@AT 2q80< ,P!s?T5s80< ,@sT 8# s 0,喖 0 卖贀C܀C -D0LM@T @T ^PqC< M"< S Ѝ"80S"4 0-LM@bbPP Q < 0]t"R8l2ptR8 p-LM@p0`=2fPP  \2l”pt"< 0xhRoPo 0KphQtC48 -LM'N_p@ P` 0  P4N{@P (Kol–0p X\0h2 0K$P l2t"p o0 (0@0  0`\1,P F Dɕ: ` P0`2 P0`2 P0`2`elB pt2  B l–p0 X8{3P<  hp0=2 n3 D I8僕T (~$|$CloC$TAg>EBoC.BA p-QLM`P̐ :lB pt2  B l•p 0XKph+i< M"< S Ѝ"80S"40S 0-LM@qPP |Q x8 0|Xt"R8l2ptR8 p-LM@n0`=2vPP  \ l”pt"x8| 0xh-n+n 0Kph,sC48 -LMp'N_`@ P  0 *zP ۔$Kl2p ,l–Hp 1\x0lBh2Ppt2 P l–p 1\n 0P,K$PT;, (0@,  0`$1,P|"  噔8z3P@8+  VyPxP% l–pt"x8| 0mwT xrtpl2t"pm3@ %0=2,om}< M"< S Ѝ"80S"40 S8@ 8#8SM Ѝ 0!S<0:0CSC -LMl2@p , `/'4`, 6 0Sp Ɣ 4P%oX0U 6 PZX '4`TC 0-LM@PP Q 6 0Vt"R8l2ptR8 0-QLMP@ 8h軇 -pML'N_`@ P  0 P4x@P 墓(KV0h2xml2p $l–x p0X8$3("(RQ A?R 00K$P yl2t"p l0 (@0  @2,P ] `  P:u>xt>xt>xt>xt>xt>xt>xt>xt>xt>xt>xt>xt>xt>xt>xt>u>u>xt>xt>xt>xt>xt>xt>xt>xt>xt>xt>xt>xt>xt>xt>u>1!(R 0RuP 6P Ɩ0P 0`28y3P2J  +H1"R|20|2V@P'  6 0|0`20`20!Sg<00`Sc6H Ɩ2H U l0p q-hΒT XɒTǒL3 @ 儒CtC148oC.BAEB -0LM@Q 0C 0T0 P<0P,0,  <<<$( 0-LM@^l0P  8hk< -QLM Q 0 < -LM8p8!#8S`L !1  1堁  4 uPʆM $($@0P @PPwP <8 K 0(K$P0( (P 0@(  ` ,0P 80! 0 (R R 0Rx P0 l0Rd 40 XT HDl< <Ty>CC.BA88H #8SM 8 Ѝn!8C > >>> > > >>4x5x7r x@t xxxx4x5xxxxx6x 7xT8 t4j 5l@`@`7j @`6j@`4z`<<4t5r@`X@`TT``\\Pdd@4zll5~~4|X4zll5~~X4|r\jr]jr^jr_j\rj]rj^rj_rj|`@`H@`DD@`LLxx5r6r           xxxx(C|zwi_do_hostdecryptwi_do_hostencryptwi_attachX@l@@@@@@@@(@ D@ d@ |@ |@ |@|@@@@@@@@@@@@@@@@@@ @!@"@#@$@%@&@'@wihap_assoc_reqwihap_ioctl 7nVV V@T Tx@0@8@t@4@4@D@$(@D4@H<@\D@$P@$\@4h@t@t@0@8@@8@<@@<@<@H@L@P@@@@@(@($@,8@,H@P\@p@x@|@@@@comstartrt2560_tx_mgtrt2560_tx_datart2560_decryption_intr!?$,dbEaL 8pP-%!T1;? 8#2!U#4@\ 0HP#+ "#P'()`5689:=`>K #(-2>'()*+,-./@ABCF'()*+,-./@ABCF/@ABCDEFGHIJKN'()*+,-./@ABCFMNO`abcdefghik*++,,--../-@@A&''(())**++,,-rt2661_rx_intrrt2661_tx_datart2661_tx_mgt@02D0H0L0\0;51.`0,***|00 0 l(000400000#0  00 `4H< 4s"$4D#(444!,-./0 8  "%')`56<=>KVXZcfk3 3 3 3 3 3 3 3  3  3  3  3  3 3 $3 f`(3 h`,3 i`03 j`43 k`83 l`<3 n`@3 o`d3 h3 l3 p3 t3 x3 |3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3  3  3  3  3  3 3 $5 `(4 `,4 `04 `44 `84 `<4 `@4 `d5 &h5 (l5 *p5 ,t5 .x4 |4 4 4 4 4 4 4 5 B5 D5 Frt2860_set_keyrt2860_txrt2860_rx_intr:: u <<4400$,,0,,H((`((l((,?  04P H ,Fs"D#4 ?LGdthtt@tx@l@tp@@?XD + $3A,B8EF IQ7RbSjTV[\gij5pLJ p eSL#< @p  A ! {X,              $ f`& g`( `, `. `0 `4 `6 `8 `< `> `@ `d f h l n p t v x | ~                    bwi_encapbwi_rxeofbwi_mac_fw_alloc7 dKZ-B"5*#    a.@:4@x}CCCCCCDDDFFFGGG G%G CCCCCDDF G G eS./`xZYXzRC./`xZYX zC0&* ZYXzRC   MLKJJIHGGFEEDCBBA@?>=<;:987654210/-,+)(&%#! MMMLLLKKJJIIIHHGGFFEDDCCBAA@??>=<;:98765421/-+(%!  )ZYXCQR bwi_rf_workaround)ZYX +RCz i )) i ) I i i I) i) I I)i)i(h(h(h(h(h(h(hHH( h !H!!!("h""#H###H$$$H%%&h&&('''G((G))'**G++,g-G.g/G2&5F6&788F99f::f;;E<<===E>>>E??@E@@@EAAA%BeBBCECCC$DdDDEDEEEFDFFF$GdGGG$HdHHH$IdIII$JdJJJ#KcKKK#LcLLL#McMMM#NcNNN#OcOOPCPPPQCQQQ"RbRRRBSSSTbTTUBUUUBVVV"WWWAXXYaYY!ZZ[[[a\]] ^^_`a<1??????????*?7?D?P?]?i?v@@@@@@@@@@@@ @@&@2@?@K@X@e@q@~?????????????!?.?:?GT@<wlbQ@;53-/**'%!!%'**/-35;@Qblwzuqlgc^YTPKFB==========================BFKPTY^cglquz˓dfX&ئ͟8ʴ)ǎi+jlbsCv ViDz#((?-җ1h5u85;5=f>?@?r>e 5=5;/u8h5#1E(?- -(1#4T8;i= >C??b?l"?+=;85&Z2X.dϚ)m$bwi_phy_init_11b_rev2x#з### n bwi_mac_testohci_root_ctrl_startehci_root_ctrl_startsr_checksumsr_raid_inquirysr_map_rootsr_meta_opt_loadsr_meta_native_probesr_ioctl_installbootsr_meta_native_attachsr_rebuild_initsr_hotsparesr_meta_validatesr_meta_native_bootprobesr_meta_probesr_ioctl_createraidsr_boot_assemblysr_raid_read_capsr_rebuildsr_crypto_read_key_disksr_crypto_create_key_disksr_crypto_calculate_check_hmac_sha1sr_crypto_decrypt_keysr_crypto_alloc_resourcessr_crypto_change_maskkeysr_crypto_ioctlbioioctlhotplugclosehotplugreadhotplug_device_detachhotplug_device_attachdb_fncalldb_commanddb_print_cmddb_examine 88888 9 7 6 97 5 9 423 9 2 9 1 0 9 9 \/|\/O|/-|db_show_regsdb_printsymdb_write_cmdchacha_encrypt_bytesextract_entropy_rs_stirsys_getentropyrandomreadexpand 32-byte kexpand 16-byte k n;AvXaM ְdx cd9660_mountQ&C&J&dJ&C&I&C&xI&4D&C&-&(C&coredump_note_elf32coredump_notes_elf32coredump_elf32elf32_load_fileCopyright (c) 1982, 1986, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. Copyright (c) 1995-2014 OpenBSD. All rights reserved. http://www.OpenBSD.org &&&&4&X&ԡ&&&&\&&&& $$$AA 'A@%A %A%Acoredump_tradcoredumpsysctl_diskinitkern_sysctlsysctl_tc_choicesysctl_tc_hardware4l4lconfig_detachdisk_mapfindblkmajordk_mountrootsetrootdisk_attach_callbackextent_print1extent_freedb_show_all_poolskprintflogprittwrite@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@cache_lookupsys_fhstatfssys_fhstatsys_fhopensys_getfhsys_mount  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~!#$%&'()-0123456789@ABCDEFGHIJKLMNOPQRSTUVWXYZ^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{}~Ͼ󨷵ǎԐѥ噞᷵ǎԐѥ???????????????????????????????? !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?Ѫ?????????????????????????????յݯ????msdosfs_lookupUmsdosfs_mount,d+$X+l[+X+(Z+0Y+(X+4X+(*+(`X+msdosfs_createmsdosfs_mkdirmsdosfs_renamemsdosfs_readdirbpfwriteifpromiscif_rxr_ioctlifnewlladdrif_getgroupif_clone_listifconfif_getgroupmembersif_group_egress_buildif_downallifioctlifa_print_rbn; &C vkkMPG&"֊/aK+d 5ӆ1 q^h,`@yFgKrޔԘJk*OņךUfϊDx%K]?!HpcwucB0 mL5&/ᾢ5̈9.WUGz+2ўfD~T; ʌ)k<(yv;VdNtے lH]nCĨ917Ӌ2CYnڌdҜI%ϯʎGooJr\$8WsQ#|!>ݖa B|qؐ_jiX':'8+3"p3-"< IxPzY e1ƄÂ)wZ{m:,ieee80211_wep_decryptieee80211_wep_encryptPPPPPieee80211_ioctlieee80211_ibss_mergeieee80211_end_scan  0ieee80211_node_attachPP ^/ f ^/ ^/ieee80211_recv_4way_msg3ieee80211_recv_4way_msg2ieee80211_recv_4way_msg1PP\A\A]A]A ]A,]A8]AD]AP]AX]A`]Al]At]A|]A]A]A]A]A]A]A]A]A]A]AHB]Aieee80211_newstateB]AiC38B0 ]AG(,_C9$4B!]A08LhC0d]A40]A`]ARDBUL]Ap]AT]A|^A fA5;AX^AR^A ^A\}B7^A6zC7Xq'Of ɴ:}Jc1`3QESbwdk+XhHpElޔ{R#sKrW*Uf(µ/{ņ7(0#j\+ϊyiNeվb4ъĝS.4U2u9 `@q^Qn!>=ݖ>FMT]qoP`$C@wgB谈8[yG |B| H+2pNrZlV8ծ='9-6d !\hT[:.6$g WҖO aiKwZ *C"< Nj򹨶-ȩWLuݙ`&r\;fD4~[v)C#hc1cB@" Ƅ}$J=2m)K/0R wl+pH"dGČ?,}V3"NI8ʌ6 Ԙρ(z&ڤ?:, xP_jbF~Tؐ^9.Â]|i-o%;ȧ}nc{; x&Yn쨚Oen~ϼ!ٛ6oJ |)11#?*0f57NtʂАا3JAP/MvMCTMўjL,QeF^]5st.A ZgRے3VGmaךz 7Y<'5ah,4$8_@r %⼋I<(A q9޳ ؐVda{p2t\lHBWЧQPeA~S^':k;EXK0 Umvv̈L%O*D5&bZI%gE]u/LFk_眒zmYRڃ-!tXiI)ɎDujyx>Xkq'Oᾶ f:}Jc13Q`SbEwdk+hHpXElޔ{Rs#KrWUf*(µ/{ņ7ӥ(0#j\ϊ+yiNe;b4ĊS.4U2u 9`@q^nQ!>ݖ=>ݮMFT]qoP`$֗C@̞gwB谽[8y |GB| +2HprZlN8Vծ=9-6' d\h!T[.6$:g WґO aKwZi *"4$8,@_r% I<( A9q ؜Vd{a2p\lHtWBQPA~Seä':^;kEXK0 Uvm̈v%LO*5&DbIZ%gE]/uLFk_mzRY-tX!I)iɎDujxyXk>'qᾶO f}:cJ1Q`3SbEdwk+HpXhEޔl{Rs#KrWUf*(/ņ{7ӥ(0#j\ϊ+yiNeվ4bĊ.4SU2u 9`@q^nQ!>ݖ=>ݮMFTq]oP`$֗@Cgw谽B8[y|G B| +2HpZlNrV8=-6'9 d\h![T6$:. gWҖOa wZiK *"$8,4_@r %<(I A9q ޳؜Vd{a2plHt\BWQP~SeAä:^';kEXK U0mvv%LO*&D5bIZ%gE]u/LFk_zmYR-X!tI)iDujxyk>X'qOf }:cJ1`3QbESwdk+pXhHElR{#srKWf*U(/µ{ӥ70(#j\+ϧyNieվb4Ċ4S.U2ኤu 9@`^qQn>!=ݮ>MF摵Tq]o`P$֗齉C@gwٰB8[yȡG ||B 2H+plNrZV8=ծ6'9- dh!\T[$:.6 g WҖOa ZiKw *h8,4$_@r %(I>>>KKKKyyyy xxxxZZZZݨ33331111YYYY''''____````QQQQJJJJ ----zzzzɜ;;;;MMMM****뻻<<<q//^SShѹ,` @ȱy[[jjFˍپgK99rJJLLXXJυkл*媪OCCMMU33fEEPPD<KKܽa ppB>>|ĵqffHHaa_55jWWйiX':'8볘+3"iip٩3-"< I·UUx((PzߥY  ڿe1BBhhAA)w--Z˰{TTֻm:,ccƥ||ww{{ kkֽooޱőT00`PggΩ++V}׵bMvvʏEɉ@}}YYGG AԳg_Eꜜ#Srr[u=&&Lj66lZ??~ÃO44h\Q4qqثs11bS*? ǕR##FeÝ^0(7 / $6=&''Niuu ,,Xt4.6-nnܲZZ[RR;;vMַa}))R{>//^qSSѹh, @`y[[jjԾˍFg99rKJJLLXXυJлk*OCCMM33fUEEPP<!KKݽa܋ pp>>|Bqff̪HHaa£55j_WWiІX:''8+"3iiһ٩p3-<" ·IUU((PxߥzY e1BBhhиAAÙ)--Zw{TTm,:cƥc||ww{{ kֽkoޱoőT0`P0gΩg+V}+׵b׫MvvʏEʂɉ@}}YYGG AԳgԢ_Eꯜ#Srr[u·=&Lj&6lZ6?~A?̃O4h\4Q4qqثs1bS1*? ǕR#Fe#Ý^0(7 / $6=&'Ni'Ͳuu  ,Xt,4.6-nܲnZZ[RR;vM;ַaֳ}γ)R{)>/^q/SSѹh, @` yȱ[[jԾjˍF˾gپ9rK9JJLLXXυJлk*OCCMM3fU3EEPP!KKaܽ pp>|B>qĵf̪fHHa£a5j_5WWiйX:''8+"3iһi٩pَ3-<" ·IUU(Px(ߥzߌY  eڿ1BBhиhAA)-Zw-{˰TTmֻ,:ƥcc||ww{{ ֽkkޱooT`P00ΩggV}++bM櫫vvE@}}YYGG A쭭g_E꯯#Srr[u·=Lj&&lZ66~A??Oh\44Q4qqsbS11*? RFe##^0(7 / $6=&Ni''Ͳuu Xt,,4.6-ܲnnZZ[RRvM;;a}γR{))>^q//SSh,@` yȱ[[ԾjjFgپrK99JJLLXXJϻk*O媪CCMMfU33EEPPxD<<%K㨨QQ]@@?!pH88c߼wuBc!! 0mҁL &5/__5DD.9WU~~zG==Ȭdd]]2+ss``OODf""T~**; FF)kӸ(<y޼^^ v;dV22tN:: II Hl$$\\]½nCשּׁĦbb917yy2CnY77ڷmmd՜NNI੩شllVV%ʯeezzG鮮oպxxJo%%\r..8$WsǴQ#|tt>!KKaܽ pp|B>>qĵ̪ffHH£aaj_55WWiйX:''8+"3һiip3-<" IΪUUPx((zY  eڿ1BBиhhAA)Zw--{˰TTmֻ,:cccc||||wwww{{{{kkkkoooo0000gggg++++׫vvvvʂ}}}}YYYYGGGG𭭭Ԣrrrr&&&&6666????4444qqqq1111####''''uuuu ,,,,nnnnZZZZRRRR;;;;ֳ))))////SSSS [[[[jjjj˾9999JJJJLLLLXXXX着CCCCMMMM3333EEEEPPPP<<<>>>ffffHHHHaaaa5555WWWWiiiiَUUUU((((ߌ BBBBhhhhAAAA----TTTT @6MD5FinalRMD160FinalSHA1TransformSHA1Final؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHG"(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDlɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~[/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxqg jgrn<:ORQhك[ 1Ѭߘr/Ḗ~&jE|,G$l iciNWqX~=t XrX͋qJT{YZ90`*#`(yA8۸y:`l>w'K1/x`\`U%U攫UbHW@cj9U*4\̴ATr|*oc]ũ+1t>\3֯\$lS2zw(H;Kkē!(f a!`|H2]]]u#&܈e>#Ŭom9BD . Ji^Bh!la gӫҠQjh/T(3Ql n;zP;*~ev9>YfCoEå}^;uos D@jVbNw?6r=B$7H ۛIrS{y%P;LylO`@ž\^c$johSl>9oR;Qm,0DE ^J3(fK.WtE9_ ӹyU 2`yr,@%g̣饎"2u<kaP/R=2`#H{1S>W\o.ViB~(2gsUO'[iXʻ]=!lJ[-ySeEIҐK3~ˤAb Lw6~д+MەqՓkю%ǯ/[{AI~-%^q h"W6d$ cUYCxSZ٢[} Źv&ϕbhAJsN-GJ{RQ)S?Wƛv`+t恵oWk *!ec.4dV]-SGjnpzKD). u#&İn}ߧI`fqilRdVឱ¥6)L u@Y>:䚘T?eB[k?ҡ08-M]% L&pc^?kh >\D}W7: P tAu8/;21>8TNmO Bo ,y|$ryVw.?rU$qk.P̈́GXzt}K:zfC cdG27;C$CMQe*P:qUN1w_V5kǣ;< $Y,n<pEㆱo ^*>Zw=Ne)։>%fRxL.jxS<- N=+6&9`y#RnfE{7(2åZl!Xeh;/ۭ}*/n[(!pa)uGa0a4c\s9pL ު˼,b`\ndi#PZe2Zh@*<1! T_~}=b7w-_h)5ǡޖXxWcr"ÃF T0.SHُ(1mX4a(s<|J]d]B> EꫪOlOBBǵj;Oe!AyMjGKPb=bF&[$ti GV[ Htb#*BXU >ap?#r3A~_;"lY7|`t˧@n2w΄PU5ai Z .zD4Egɞs͈Uy_g@Cge48>q(= m!>J=+hZ=@&L4)i Av.khq$j 3ԷCaP.9FE$tO!@MpE/f m1'A9UG%ښ ʫ%xP()Sچ, mbhiHפh'?Oz|Ϊ_7әxB*k@5 ٫9N;VmK1f&tn:2C[Ah xN جV@E'H::SU kKмgUXc)3VJ*%1?~^|1)p/'\,(H"m?H܆AyG@n]Q_2Տd5A4x{%`*`lc´2Of#k>3b $;" r(-Exb}doITH}'>AcG t.no:7`L knU{7,gm;e' )̒9 i{f} ϑ^و/$[Qy{;v.97yY̗&-1.Bh;+jLu.x7BjQ满PcKkؽ%=YBD n *Ngd_ڈ鿾dW{x`M``FѰ8Ew63kBqA_^;Z4ٷ,Q+:Ֆ}}>(-}|%rZLZq)GW;()f(.y_xU`uD^mm%adâW<'*:m?!cf&(3uU4V<wQ( gQ̫_QM08bX7 z{>d!Q2Ow~㶨F=)iSHd$m-if! FEdlX [@X̻k~jEY:D 5>ʹrdfGof,ҏ"W##v215VbuZ6ns҈bIPLVq z2E{Sb%ҽ5iq"|˶+v>S@`8G% 8vFšw``u N˅؍芰z~L\HjiԐ\-% ?2aN[wߏWr:j?$.Dsp"8 1).lN!(Ew8fTl 4)P|ɵՄ? Gy ~tn,fy3jXDD1Zs"*ˁc8:$zi HIĀ@8HުL H_%A@N$A UeQr% 9jyMc@hV 틕Z Vqק)N-fcqw*7 5Wa"ɠBր[t!h!hl iwW~@PճMװx QV$AV ʔUWnྵa$ XK'aU{whkldMDfd~i/IO70j5,s@IvM;B(HDLns) _ɋ}oaOw.+rץ<}+FYYEEهTNoHm| ǥcs_DVj͈prͳ]ny` E`1©\1BN"r\,rN@%/N2g@#x\n܃"ukMxnXO DH?{vw#Vu*F_( +8=6 JRft;QZylu eX&hJpFS(l\v0k)h76*g$ k%ֿh,DUueI40" WIbuU~bڨv^FESGml,gHL|3ەCh\SU2` ߝWc9^28aI37~^b<#NygCHKJf-ۄoH Ja)Yfc(` 0qt&@3/C~A^ l( ؒ0~of˜os*`ژ46K-%#= %IH6Jo8C@TzWOpA:Z„TU|5YŗZ:G:%Sj~=eI&TwQ[P]vlDȨ!帊iX`[ŗY)L;]J5ULkD$5鰽bעT/I18T(q)9H[/u@g+3-fVo*ɛ`( ')dMP˲,\26K_A !PNhذy\CPIMAC8wn\e0Rԋ@+>`xT7}02m-yyS"wuXȃoxkcZ\3]ùzv٣Byqj3ƚ`'PC=+mvN%ύHf6AN( aϩI=߹_d: }+p?PO+Zbbyj.H@,Z@"ғ-ES4n)olIIBr~V>olbfLTq*+9)XLVRf.S9v.i硦>iFt+LVvuOx39]O#2]2=&K/~~<O^?vf)o=E4ӷ+4grN=U"g`k8=ü0}8QcÐӝXyTGָaYwSW-XVcNx.F~eyUڑ0@5㶼P?!@=LXI6QpӱڍyKoqK 0ݻ맕d5w$,ϩ/ tцB*v:-7ޚ, )p@ :$7ѴyN] h1 HZ޻Bf1畏?r 3uQB}\cmd!@ WS1zݨ]3CoFq"8ԚέiGb[UgfN G[oLĎnrWxzdD]Ջ` l_9 ]c2֋~ pIPӻߘ)* mS~H~X.t;/RG'~[!<8zvOB9`55'{ɸ6g {pqT3^-ZId, =4pBwbO&Ҹ$d%FN`7>͕xE_{ ۫v"{.1ן%$r_m L=mPO%os#(ĴyI%4aĘnzn|l6AT޾'VAJJ{` ,8I%vK$%Gv XY f 0NndQ& #Phꃢ@0 /kz%?/?!M@`Iɟ'Կ@uИcnafŽ"o;h(Yy#P_w@CV/|-ҢɡHl4ma/T"2*kT:V"AӢ@f/9/Mҹ-?JDvR7,YQoz Zh{.T"5Y/mKdPIf-徐"3;䎴]4K@E?1.eUʱծ-mԢP @"8On ׿r[O/LVSTIiFXEŅc]ՊSW9j7=T*_}x:vbj Bz)^'rgP8ƌDŽZ*'JkѢ*V`C u\B&Ʉq-ls5&5 M{n0f&%HVV^c ϲc|E pPr(pH# yM;-AB G&LjMG\^ |Y#јr8S#/nqFnEV 9q +A|iCHy}B{BIZݿe\ [ ~iC?9zaz UQry吝5rNcZպ60ę _}֡{/6Y DYD̃Aѱ* ;{ B[A%zzӤ0XޘN?wiy{$[Ĭ%5P_aT1bcKU !h]Yfsc=4·~!+g\ab906;Wd/`:5F- 'zy㠌l0^7%oo;j tE'4:NiOM>dY58EfCr3c%N? (Υ'R¦սTUdpfM w&ۄgC!`X0TroSUGڿ]bVhkʃ;n-Ӧ\= wL3{9+^S_aodC x^c"&gI{ڷ"%-U^7rRyL H[k0 cq/޹ S E!5(T<)c)A|-nRPf4,0P1`sY&D\dwR3A+ٺ|o!PaH?ek«dv&4{^% ;MM1$~I,;jx`]sVz\/1Co0TyXR^/2zj0>՚1B°I #ڸ(0q_`ɣaM/Ǚ."płNؼ40y;'ƸaiH?;(ZC/v7ܱӧßn>ƼB7Q(heRwj-K'5.n\ )^XOX{iT̨g&H`K`8# ~8lI `s5GƱVL>#8d^BFzk Od^AE#\;]>rC|m~ll9`qpsv#E@]%=`GK6DήPQH<p}}d^(O= &g.yr?U+HԼ?^!@WNFRWs3NɷdŸW1O g_?@k{C=K۵cUȗn-J(JqoCCl< _P/~׿PZG.Q>pX.0_|r *,]I鎸P'WIoyR}}Yr@EEt]>uOiVA#. '`vteyvvwHNma}/ 4H<0(Ow Vܒ M"7)}V'|@|硴f^aÝ <є`AFv\;x,WGl"}NC~8<=Q8d{h'فI]j~vh]9K9 ;#Im<Eub'z\aBΒ~Brrp }ȡ[(Ob<51)BSjO[}m(Ki\j#MŌ?,-ҖXRg[HJI \EkӉ7`:SRqDIK @sg4|~q6UO/Т`?mPьGnU?墼38Wg} =3{r3O̫]ňv{{uWBdBc+ri/n+_mazgaq%9̸L!gуb>ܷν8\ =Dmn`I:T`H'W+8$ ږ%Eh;}E `P/(b4 ٠m+1+dZ0RXBA\1>26F3S75 {s{OJWdCQz(~c5_ yCdcdJ$_(͸O@C " 0 O7-{$MgQLq_-_d !S^>'_aB%rqK=;&o~~TLmDl߫I&Ǡ36~?Pa w8Pr.PwWFgOT3ɏ1 i5M\=fȦ[]oڑo/"F}F9mOCCN!и  ?X(>nH&p׋wt|% - y#;(8itb߷@!{7Ȋ@ YVvO@/{U MVi35'#WȯVeka^u˅nwU2?-ɿ[%;з$;mc fÀ(82 Tɪס2Zb,gTzuw11&o6F HjyZVLj~CRv/ t,t* M|k .TA5B=!&|,aRe1i%& !\1cr ^Iy p1 d>>̶Ոî 0rlqn/kءDVÈ9/ű1(x⤣2}o~X$Ū{s0a!-!)۳*)e\,0?Б\,ԩT _w:^VxV޾\!uQųåҶw#)Ei/z毲p[v F98/gsD)k)/Ifingӛ/~p%Q^$Slj>!DYܷ)eyCy9A+MWN )zkS< ~U3rŅ?~                               A@@@A@@A@@@@A@@@A@@@@@@AAA@@@@@@@@@@@@@A@@A@@A@@@A@A@@A@@A@@A@@@@A@A@@A@AA@AA@@AA@@@AAA@A@A@A@A@                              @@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@                                        0 0 0  0 0  0 0  0           0  0 0 0 0  0  0  0          $$  $ $ $$  $ $             $$  $ $ $$  $ $                  0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0                            ((  ((  ((  ((  ((  ((  ((  ((          """"   " " " " ((((((((    """" ( ( ( ("("("("(  ##%%&&))**,,//1122447788;;==>>@@CCEEFFIIJJLLOOQQRRTTWWXX[[]]^^aabbddgghhkkmmnnppssuuvvyyzz||cryptof_ioctlswcr_authencswcr_authcomputeswcr_encdec66666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\aes_xts_cryptaes_ctr_cryptZAES_CMAC_FinalHMAC_SHA256_FinalHMAC_SHA256_InitHMAC_SHA1_FinalHMAC_SHA1_InitHMAC_MD5_FinalHMAC_MD5_InitAES_GMAC_Finalaes_key_unwrap H!x-ML.RN8D( `hz=Skc|j9{Б/Uڅ?AZX_f ؐ53eiEVmv° GJBnI[#Q")yq~ ruo7ӎbwO$26󦻬^lW%㽨:Y*F?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@ffs_mount282zAuaddr_pivot_removeuaddr_pivot_insertuaddr_bestfit_removeuaddr_bestfit_insertNlD0lOlVlVlVlOl$oruvm_map_printitvmmapbsyBUSYWANTEDTABLEDCLEANCLEANCHKRELEASEDFAKERDONLY ZERO PAGER1FREEINACTIVEACTIVEENCRYPTPMAP0PMAP1PMAP2PMAP3\sys_swapctlin6_pcbnotifyin6_pcbconnectin6_prefixlen2maskin6_prefixlen2maskin6_ifpprefixin6_delmultiin6_addmultiin6_unlink_ifain6_purgeaddrin6_update_ifain6_controlin6_lifaddr_ioctlin6_nigroupget_last_resort_ifidin6_ifattach_loopbackin6_ifattach_linklocalin6_ifattachin6_ifdetachin6_selectsrcfrag6_inputicmp6_redirect_outputicmp6_mtudisc_updateicmp6_redirect_diagicmp6_redirect_inputicmp6_notify_erroricmp6_reflecticmp6_rip6_inputicmp6_inputip6_nexthdrip6_savecontrolip6_inputip6_forwardip6_setmoptionsip6_getpcboptip6_ctloutputip6_outputfill_prlistnd6_lookupnd6_ioctlnd6_outputnd6_freend6_storelladdrnd6_cache_lladdrnd6_rtrequestnd6_rtrequestnd6_dad_duplicatednd6_na_outputnd6_ns_outputnd6_dad_timernd6_dad_startnd6_ns_inputnd6_na_inputin6_ifaddnd6_prefix_onlinknd6_prefix_offlinkpfxlist_onlink_checkprelist_removend6_prelist_addprelist_updatedefrouter_delreqdefrouter_addreqnd6_ra_inputnd6_rs_inputrip6_outputrip6_inputrip6_usrrequdp6_output0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-     A@!  @a`10  @`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O      A@!  @a`10  @`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O @@ !1Aa  0@` #+3;CScs 666 65 55 5 5 5HAXA@dApAAAAA@   L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c            (08@P`p   0@`  0@`48686(R6R6(XAl C\Al ChAl ClAA jCjC pAjCtAxA AAAAAAAAAAp AAp 0AAp `ȶAAp pжAA@ضA@`ܶA@P AAP AAP @AAP PAA AAAAAAAAAzCAzCAzCAzC AzC(AzC  PA1BPA1B0A4A@8A4A@ADA HA@ LA@ TA@ XA@ \A@ `A@ dAhA dAlA/pA/CotAxA0/lA/Cp |AXA 0AA AA @AA `AA P;AA AA AA AA AA 0AA @AA `AA AA AA ķAA ȷAA̷AзAطAзA ܷAзA0AзA@AзAPAзA`AзApAзAAзAAзAAзAAзAAзAAзAAAAA mCA0 AA@$AAPAA`(AAp,AA0AA4AA8AAhA>A>A>A>A?A?@$@eaQ@X@W@@0@ w@Q2@U@4@F s%^^uhub_attachD8999D8999ucom_do_open|9+9)9ugen_do_writeugen_do_readL39R9,;9ugen_set_configtl9h9f9g9 uu ; u%5E u%5E     uu%5E )u&5F 2 5u&6F 0 1 3 4u0uhid_do_ioctluhid_do_readDm9w9Lv9=?Rr? ?]*???IZ??J?R?74? ? ΢? ޢ? ?K??@#?????? ??H@? N? _?R??\L? ? ? ?E2? ?mԩ?K?AD?[ƫ?|?0? ? ?j????n? j?J~??abcde f g h i jklmnopqrstuvwxyz1!2@ 3#!4$"5%#6^$7&%8*&9('0)( ) *!+ , --_.=+/[{0]}1\|2\|3;:4'"5`~6,<7.>8/?9:;<=>?@ABC D E FG HIJK,L.MN-OPQRS T/U*V-W+X Y1Z2[3\4]5^6_7`8a9b0c.eh i jklmnopqrstuvwx yz{|}~ mMqQ@zy2" 3#6&$7/{%8([&9)]'0=}-?\./0+*1#'2#'345 6,;7.:8-_d<>| .'`0+*~5^q,?azw&12~ "3#!'4{"(5[#-6|$7`%_8\&9^'0@-)].=+}/0$1*2*3m4%56;.7:/8!d<> bBeE hH iI jJkKlL|,?nN~aArR,sSzZyY2 "3!'4"(5{[#6$7%!8&9%!8'0-)}].-_/0$*2`@#3mM4%5@#7:/\8=+g= aAkK~xX}iIpP& eE ,; c d tsrqQ'?ljbB|oOuUv.:yY{!\"12< 3>!(4[")5]#@6$+7%-8&/9'*0, _-=^.%`/z0w123n4m5$#6gG7h8fd/ 2"@ 3#!4$#6&$7/{%8([&9)]'0=}-+?.|/01'*2'*3456,;7.:8-_d<>\ .'`|0^~2" 3"5%#6&$7/%8(&9)'0=-'?.^/{[0+*}]123@4#5\|6,;7.:8-_d<> 1!2" 3!4$"5%#6^$7&%8*&9('0)--_.=+1#~2#~4'@5``d\|2"#6&$7'%8(&9)'0--=.^~/@`0[{1]}2]}3;+4:*5\_\|-+?\0345d<>| .'`|0^~.\0345|d<>.\`0^~xje.> u i d c htnbrl'"poygk,<qf;:-[{.]}//?0=+3s4-_6w7v8z9: ;<=>?@ABCD E 1!|2"@ 3#!4$~#6&$7/%8(&9)'0=-'?./[0+*]1}2}34{5\6,;7.:8-_d<> q,?azw&1|2@ "3#!'4"(5#6^$7%!8&9{'0}-).-_/[0$*]1`2`3m4%56;.7:/8=+~d<>\ aAD$bB8cCA!dD2eEC# fF0 gG? hH@  iIH( jJ>kK;lL4mML,nNB"oOI)pP7qQ9rR:sSK+tT5uU3vV<wWF&xXG'yY=zZO/#6^6,$7&7./[{E%0]}J*3;:64'"M-6,<17.>N.8/?Q aAD$bB8cCA!dD2eEC# fF0 gG? hH@  iIH( jJ>kK;lL4mML,nNB"oOI)pP7qQ9rR:sSK+tT5uU3vV<wWF&xXG'yY=zZO/#6^6,$7&7.--_V.=+T/[{E%0]}J*1\|W2\|W3;:64'"M-5`~6,<17.>N.8/?Q eEzy1+|2"@ 3*#!4#6&$7/%8(&9)'0=-'?./[0!]1$}2$}34{5 6,;7.:8-_d<>\ -'?.^`~0!]/[34{2"@ 3##6&$7/{%8([&9)]'0=}-'?.<>/+*012345\|6,;7.:8-_d<> .+*/2\|4eE a`~}kj!1@-2_ /3#!;4$":5#,6^$.7&%=8*&[9(']0), -?+'.xX%//.{0wW}1qQ|2qQ|3sr4"5`~6   7fF 8\ qQ@1!2" 3##6&$7/%8(&9)'0=-'?\./0+*~1}]2}]34{[5|6,;7.:8-_d<> 1!2@ 3#!4$"5%#6.=+/0[{1]}2]}345'"8;:c.d\|/? 1IqQ@2' 3^#!4+$"5%#6&$7/{%8([&9)]'0=}-*?\.-_/0~1,;2,;3_^4i05"678.:d<>| /1,;`2,;`3_^'aAcCeElLBAnNDCoOsS[ZxXzyzZ|{ bB{cC& fF[ gG] iI jJnN}qQ\vV@wW|xX#zZyY>1'~2" 3+^!4!"5%#6/$7=`%8(&9)'-./QP01qp2qp3$4506,?;7.:8-_*d< bB{ fF[ gG]kKBlLAmMnN}qQ\vV@wW|zZyY1!~2" 3#^!4$"5%#6&$7/`%8(&9)'0=-'?.+*/a`01~}2~}3  456,;<7.:>8-_d<> mMoOpP1!2"@ 3/!4$"5%#6?$7&%8*&9('0)--_.=+/[0']1<>}2<>}3;:~4{5#|\6,'7..8d /^^[0]4``{8aAcC  eE gG#" iI+*kK76lL<;nNFEoOMLsSa`uUkjzZ~} cCmMrRsSxXzZ1!2" 3#!4$"5%#6&$7_%8({&9)}'0'-/?\.'/0*|1<>2<>3+45@6,;7.:8-=d][ .~/"^4'`eEqQ@2"#6&$7/{%8([&9)]'0=}-\.-_/0'?~1+*`2+*`3456,;7.:8d<>| 4^    9\9@999x9Ԉ9,9ȅ995dd5(I*LCDEOMPJQNRK99p9(9D999ت999l9h99ԡ99 9`9(  v      W 1 Q `  9@  0 2 A@ A   @  @ @   P0 P  A   h }  } } } @  85   (9  L+ L 9L2 D   O  {t9o  A umass_scsi_probed0999fGg ---0000 0@0P010`0p0aLfLLLLiF  @@@ @ @AA@:F:FP 43W  !      @ @ @ @ A n@n n@n @nn@0Df @  * Q k k"k"k"k"k @^z BF 9 |L999axe_iff B  w *w +w +~ W UP  < 1b0 0rk {&"79n= wF@W wn a- <999axen_iff  JK0 r:0:::L(:L0:$$0$0$$$$$$$$$$$$$$ $>:?:F:@ 'W W@ @EEE }WQ  k"BFFeeeZZ Z 0V:\:U:2V{%1" `"'`~%ZP ` o:,p:o:0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-udav_iffЍ:4::hF F hF fF t::0:(:::t:::url_int_miibus_writeregurl_int_miibus_readreg@@9WP P Q@:::uftdi_2232h_getrateuftdi_openL :l:8:`VV !y`V'V%V&V3V4VPVIVVVVVVVVVV}  H(02135HPPQ nY ol\k] ih^_mZ[Xj 2``` ```x     tq?=:>9;<8pq8     JKLIؼټy`ؿۿٿڿHIJprsq"`r``xȽPW8P3 & & & & & & & & & &     < < < l F F ! ========== = = = = =================== =!="=#=$=%=&='=(=)=*=+=,=-=.=/=0=1=2=3=4=5=6=7=8=9=:=;=<===>=?=@=A=B=C=D=E=F=G=H=I=J=K=L=M=N=O=P=Q=R=S=T=U=V=W=X=Y=Z=[=\=]=^=_=`=a=b=c=d=e=f=g=h=i=j=k=l=m=n=o=p=q=r=s=t=u=v=w=x=y=z={=|=}=~=================================================================================================================================0 B9 !PPPPPPPPPPPPPPPPPPPPPP PPPP PP PPPP PP PPPPPPPPPPPPPPPPPPPPPPPP: :  !R R !R !R !R !R R "R !"R "R ""R "R #"R $R !$R 1$R A$R $R "$R 2$R B$R $R #$R 3$R C$R (R !(R 1(R A(R Q(R a(R q(R (R (R "(R 2(R B(R R(R b(R r(R (R (R #(R 3(R C(R S(R c(R s(R (B@  >d lp::\:G W WnPnPA   !^y 4Xhp9{#{{{{ rS#S&@'ah 33.U 1(Ex$ #h:4::0    \@;;(;   &  l! eT| ; ; ;@;; ; B  Q  umsm_umass_changemodeX;;P;=bee;;;wi_usb_do_transmit_syncwi_send_packetatu_tx_startatu_rxeofatu_get_card_configatu_send_mibatu_joinatu_initial_configatu_start_scan A;X;`_; ural_tx_dataural_rxeof8ԡ;ԝ;;JLNPj,SfdZ@0HP#+ "#P'()`5689:=`>K #(-2>'()*+,-./@ABCF'()*+,-./@ABCF/@ABCDEFGHIJKN'()*+,-./@ABCFMNO`abcdefghik*++,,--../-@@A&''(())**++,,-   Pp < PBk?\Bk@lBkAtBkBBkCBkEBkFBkGBkHBkIBkJBkKBkLBkOBkPĔBkQДBkRܔBkSBkTBkUBkVBkWBkXBkYBkf$Bkg4Bkh4BkiDBkjTBkkhBkEċB8xB8B\6C푠B홠BBBB B0ĕB`ЕBpܕBBBB BB $B00B`TBT>`Bp>pB6AB7ABDABEABFAėBGAؗBHABIABJABKABPA(BQA8BRA8BSADBTAPBUAXBVAPBXAdBdAlBpABqABrABsAB7B̘BBBؘBCBB6CB7CBACBBCBEC(BGC4BHC4BIC@BLCLBMCXBSCdBTCpBXC|BaCBbCBcCBeCBgCBhCBiCęBlCЙBmCܙBnCBpCBqCBrC BsCBtC$BuC$BvC0BwCgB@gBAgBBg̤BCgܤBDgBEgBFgBGgBHgBIgBJgBPgBQg$BXg4BYgDB[gB]gTB_gdB`gtBagBbgBcgBdgtBegtBfgBggBhgBpgBqgBrg̥BxgܥBygB{gBg BgBgBg(Bg(Bg(Bg(Bg0Bg@BgPBg`BgpBg(BhBhBhBhBhB hBhBhBhBhBhЦBhB hB!hB"hB#hB$h B%hB&h B'h,B(hBBABBBCBDBEċBF$BG,BH4BI@BJPBLXBM`BNlBOxBPBSBTBUBVBWBYBZľB[̾B]ԾB^B_BbBcBeBhBi$Bj0Bk8BnDBoPBr\BshBttBw|BxByBzB{B}B~BB̿BؿBBBBB BB B,B8BHBTB`BlBxBBBBBBBBBBBBBBBBB B,B8BHBTB`BlBxBBBBBBBB{BBBBBBBB B ,B 8B@BLBXB`BClBCtBC|BCBCBCBCB CB!CB"CTC$CB%CB(CB)CB+CB3CTCDCTCSCBWCBXCBDBDB'GBXBXBXB XB!X B"X(B#X0B%X8B`X@BaXHBbXPBWXBWhBW|BW!BW"BWFBPBQBnBoBxByBtBK@BK@BK0Btcsg B}B} B},B}p8B?LB%XB% dB%!tB%"B%#B%$B%%B%&B%0B%1B%2B,B,B,B,B,B,B,B,B,0 B8(B4B@BLBXBdBpB|BBBBBBBBB`B` B`B`0B7#DB7@DB7ADB7BPB7C`B7EpB@|BBBDB@BBBCBFBGBHBIBPBpBsBB1B1 B$1B11,B21B$B$ 8B$0HB$PXB$QC$hB$%xB$B$B$B$ B$!B$"BtqBtPBtXB]B]hB]i$B]x8B]DB]LB]\B]hB]xB](B]8(B](BBBo#pBB8B? B?B? B?Ā B?Ȁ B?(B?0BR8BTDBXPB'\B'hBxBWBWBWBWBWBWBWBWBsBs BsBBB(B@BPBXBdB6tBBBBФBFPBpBB<B<B<B< B<(B<)0B<0HB<1PB<HXB<TpB<B<B<B<B<B<)B<*B<.B<B< B<!$B<"8B<#LB<$`B<&tB<(B<)B<*B<2B<2B<2B<2B<2B<2B< 2B<"2B<#2 B<%2 B<02B<12B<22B<324B<42HB<52\B<62B<724B<82B<92B<:2B<;2B<<2B<=2pB<A2B<C2B<E2B<G2B<I2B<J2B<K2B<3\6C<3B<3B<3(B<38B<3|B<P3HB<Q3\B<R3pB<S3B<T3B<U3B<V3BBBBBBBB BB B3 (B3!(B3",B3؟B3` C3XSCT0BT5HBT5TB7!`BhBlB|B BBBBB hB"B.B6B>BWBBpBBB BB$B4B$HB\BlBxB.B:B B@HBCTBHhBIpBJBKBLBMBPBQBR BS BT BU BV BW BX BYB^B_B`BdBeBf Bg BhBiBjBkBuBvBwBxByBzB{B|B}B~BBBBB B,B8B B B B B BHBHBBTBBhBBBBB\B\BTBdBBTBBlBBHBHBBtBBBBBBBBBBBBBBB$B,B4BBBBBA BpBqBrBBB(B(B8B8B8BB B8BHBHBHBHBHBHBHBHB XB"lB&|B-|B1B:B;B=BDBFBIBJBSBUBWBXBYB]B^ B_,B8BHBHBHBHBXBhB|B B!B"B#B,B0B1B2B8B9B:B;B<B@BABEB#B##B&#B0#B2#,B4#(hBO(xB0(B1(B2(B3(B4(B5(B6(B:(B?(BA(BC(BE(BG(BI(BK(BO(BP(B)B)B)B)B)B)B ) B!) B"),B#),B&) B() B)),B*)8B-) B.) B0)DB2)TB4)dB5)dB6)dB7)dB8)dB9)dB:)dB<)dB>)pB@)BB)BD)BF)BH)BJ)BL)Bp)Bq)Br)Bs)Bt)Bu)Bv)Bw)B)B)B) B) B)B)$B)0B):<C@:PCB:PCD:PCF:PCH:PCJ:PCQ:`CU:pC`:Cb:Cd:Ce:Cf:Cg:Ch:Ci:Cj:Cl:Cn:Cp:Cr:Ct:Cv:Cx:Cz:C|:C;C;C;C;C;C; C ;C ; C ;(C;4C;@C;LC;XC ;dC!;dC";pC#;pC%;|C&;dC(;dC);pC,;|C-;dC.;dC/;pC0;C2;C4;C6;C7;C8;C9;C:;C;;C<;C>;C?;CB;BD;BF;BH;BJ;BL;BN;BP;BV;CW;Cd;Ce;Cf;Cg;C<CC<C<C<C<C<C<C<C <C <C <C <C!<C"<C#<C$<C%<C&<C'<C(< C*<C,<0CC<<CDPxC?PC@PCDPCHPCRCRCEXCeCeCeCeCeCeCeCeCeCeCeCeCeCeCeCeCeCpCpC p(C0p4Cq<CqDCqXCqdCqpC qC!qC"qC#qC$qC%qCqCqCqCqCqCqCq CqCq,Cq8CqDCqPCq`Cq`CqlCvtCxCCCC CCCCCCCCCCCCCCCC(C4CCC@CĄLCńXCʄlC˄CCCCCCCCCC C C C C CCC C C C C C C C( C4 C@ CL Ch C C C C C C C C C C C C C C C C C C C C C C" C$ C& C- C1 C: C; C<, C=< CDH CFP CIX CJd CKl CLx CN CO CP CR CT CV C\ C C! C" CA C C C C C C C C C C C C C C C C" C& C1 C: C; CA CC CE C$ C4 C4 C$ C4 C4 CRD CTP C0\ C1\ C2\ C8ѸB9ѸB:ѸB;ѸBPh CQx CR\ CS\ CT\ CUь CVќ CWѬ CXѼ C C C C~ C`r8 C`s8 C`w8 C`8, C`8@ CP C @X Cad Cal C C C C0 C C C C{P C{` C{`# C{a# C{b# C{c# C{e# C{f#0 C{h#@ C{#KC{#{B{#C{#HB{#L C{#{B{#C{#HB{#L C{#{B{#C{#HB{#L C.0P CvT Cv\ Cv` Cvd Cvh Cp CBBBTCTC B!BBBTCTCTCTC| C C C C} C}f C} f C C72 C7d C7 C7 CCCC@CA0CB0CC0CD0CE0CF0CG0CH0CI0CJ0CK0CL0CM0CN0CP0CQ0CR0CS0CT0CU0CV0CW0CX0CY0CZ0C\0C0C8CX\6CXDCXPCX`CYlCxCxC CB1C2C%CCCCC C0C <C \C xCCC=CCCCC*C CC@C CACCBC,CCC<CDCLCEC\CFClCGC|CPCCQCCRCCSCCTCCUCCVCCWCCZC C`CCaC,CbC<CcCLCdC\CeClCfC|CgCChCCiCCjCCkCClCCmCLCpCCCCC CPC@P4CAPDCPTCPdC@`tCA`CB`C`C`CaCaC aC!aC"aC@aCAa$CEa4CBpDCK TCK#dCK%tCKrC+C+C+C+C+C+ C+!C+" C+$ C+%,C+0@C+2LC+3XC+4dC+ pC+C+C++C+y!C+'%C+8%C+4dC+C+C+C+(C+@CZ TC`hC`pC`xC`C`ChcC`|5CaBACBCbCCC1VC1VC11VC1W` C4CHCrSshTCWdCWpCWV|CWHCAC@CACBCCCiCiCiCi CiP CiVC$C $CC(C<CLC\CYpCHCS2xC0C1CȔC"C@@C@@C@@C@@C@@C@@$C@@%C@@C C  C ,C \6C  @C "PC (dC +pC -|C .C /C 0C 5C C C C C C C C C (C 8C35\6C3F@C3tPC3}PC3||B3\6C3%B3B3XTC3CPHCQHCRTCSdCTpCUpCVCWCYCZC[C\C]C^C`CdCeCfCg Ch Cj Ck Cl, Cm, Cn4 C~H CT Cd Cx C C C C C C C C C C C !C!C4!CH!CX!Cd!Cx!C!C!C!C C!C!C!C!Cx!C C!C!C!C"C"C0"C C@"C@"CP"Cd"C"Cp"C"C"C"C"C"C"C"C"C"C#C#C$#C@0#CA"CB"CD@#CF@#CPP#CQ`#CRl#CS|#Ca#Ce#Cg#Cp#Cq#Cr#Ct#Cu#Cv$Cx$Cy,$Cz@$C{T$C|d$Ct$C$C$C$C$C$C$C$C %C %C4%CD%CT%Cd%Cd%Ct%C%C%C%C%C%C%C%C%C%C%C&C&C &C0&C<&C, C, C, C, C, C, CH&C`&Cl&C|&C&C!#C@&CA&CB&CD&CG&CP&CQ&CS'CX$'CY4'C[D'C`T'CaT'CbT'CcT'Cd`'Cel'Cfx'Cgx'Ch'Ci'Ck'Cl'Cm'Cn'Co'Cp'Cq'Cr'C~'C'C'C'C(C(C0(CD(CT(Cd(Ct(Ct(Ct(Ct(Ct(Ct(Ct(Ct(C'C'C'C(C(C(C'C'C(C(C(C(C(C(C!)C")C$,)C&@)C'P)C(,)C),)C+`)C,t)C-)C0)C1)C3)CC)CG)CH)C`*Ca*Cb*Cc*Cd*Ce*Cf*Cg*Ch*Ci*Cj*Cl,*Cm,*Cn8*CpD*CqL*Cr\*Cs\*Cth*Cuh*Cvh*Cwh*Cxh*Cz*C~t*Ct*CT(Cd(C*C*C*C*C*C*C*C*C*C*C*C*C*C*C*C*C*C*C*C*C*C*C*C*C*C*C*C*C*C*C*C*C*C*C+C+C+C,+C<+C<+CH+CT+CT+C+C`+Cl+C<+C<+C,+Cx+Cx+C+C+C+CH+CH+C+C+C +C!+C"+C'+C(,C@,CA,CD,CE,CF,,CH8,CID,CJP,CKP,CL`,CM`,CN`,CO`,CPl,CQl,CRl,CSl,CTx,CUx,CVx,CWx,CX,CY,CZ,C[,C\,C],C^,C_,C,C3,C;,CA,CB,CC,CG,CH,CL-CM-CN-CO-CP-CQ-CR-CS-CT -CU -CV -CW -CX,-CY,-CZ,-C[,-C\8-C]8-C^H-C_H-C`T-Ca`-Cbl-Ccl-Chx-Ci-Cj-Cl-Cm-Cn-Co-C-C-C-C-C"-C.C+C.C,.C<.CQx-CRL.CSX.CTx-CYl.CZx.C[-C\.C].C^.C`.Ca.Cb.Cc.Ct.Cu.Cv.Cw.Cx-Cy-Czx.C{.C|.C}.C~.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C/C/C/C/C/C$/C$/C$/C$/C0/C0/C0/C0/CC)(>C90>C)8>C6@>C8H>C9,BgP>ChX>Ci`>Crh>Cp>Cx>Cv>Cx>C BB>C6>C6>Ce>Cf>Cu>Cv>Cw>Cx?C!?CQ(?CR8?CH?C"\?C2l?CC|?CR?C0?C"?C#?C2?CR?Cz ?C3S1V@C3S@C3S@C3S@C3S(@C3S4@C3S=8@C3SD@C3SL@C3SX@C3Sˆd@C3SÈp@C3SЈ|@C3Sш@C3S҈@C3Sӈ@C3S@C3S@C3S@C3S@C3S@C3S@C3S@C3S@C3SAC3SAC3S AC3S!,AC3S"8AC3S#8AC3S%DAC3S&TAC3SdAC3SpAC3S|AC3SAC3SAC3SAC3S"AC3S$AC3S&AC3S*AC3S+BC3S, BC3S-8BC3S.PBC3S/hBC3SBC3SBC3SBC3SBC3SʴBCABC}BCMBC#BCOBCOBCOBCH@zBHCCCH CCCHDCCH CCH!(CCHC0CCH8CCH@CCLCC!`CCLCC`CCtCC|CC CC CC CCJCCJ CCJCCJFCCdCCCC#CC90>C9CC9CC9DC9B9DC9DC9 (DC9 B94DC9@DC9LDC9XDC9dDC9pDC9tDC9xDC9DC9DC9DC9%DC9DC9DC9DC90DC9@DC9PDC9DC9 DC90DC93DC95EC9@EC9EEC9FEC9H EC9I(EC9P0EC9Q8EC9R@EC9UHEC9VPEC9XXEC9a`EC9bhEC9qpEC90xEC93EC95EC9@EC9AEC9EEC9FEC9HEC9PEC9QEC9REC9UEC9VEC9`EC9aHB9 EC9a EC9b FC9c FC9d FC9e FC9f $FC9h ,FC94FC9@FC9LFC9XFC9SdFC9SlFC9UtFC9U|FC9UFC9UFC9qUFC9UFC9UFC9UFC9UFC9UFC9bFC9bB9cC9clFC9%cFC9&cFC90cFC9pGC9pGC9p GC9p0GC9p]C?]Cf]Cg^Ch^Ci ^Cj,^Ck8^CmD^CnP^Co\^Ch^Ct^C^C^C^C^C^C^C^C^C`^Ca^C^C_C_C_C_C _C0_C H_C P_CX_C`_Ch_Cp_Cx_C_C_C_C _C@_Cp_Ct_CxB|5C5C_C_CC_CwGC_C_C_C_C_C1`C1`C2`CB`C(`CJ`JCP0`CP@8`CP@ H`CPe\`CPl`CPZZx`CPf`CJ`CE!`CE$`CSX`C `C!`C@`C]`C]`C]`C]`C] `C] aC]`C]aC]0aC]8aC]DaCsTaCsXaCs\aCs`aCs daCs haCs paCsxaCsBs \aC|aC8aC @aCW`l7C aaC{!aC{!aC{!aCaC=aCpaCWaCuaCaC aCbCbC bC$bC4bC > > >  >> ! >> >8=2\<"8=03=.3=v3=p3=q3=43=q3=ʄ3=$3=!$3=J$3=K$3=$3=$3=$3=$3=$3=$3=$ 0=$ 0=%3=% 0=% 0=&3=o&3=S& 0=Q& 0=R& 0='3=' 0=' 0=' 0=' 0=' 0=' 0= ( 0=!( 0="( 0=$( 0=%( 0=(( 0=)( 0=*( 0=P(3= ) 0=!) 0=&) 0=() 0=-) 0=.) 0=: 0=: 0= : 0=&: 0=& 0= ; 0=!; 0=&; 0=(; 0=-; 0=.; 0= 0= 0= 0= 0=  0= 0= 0= 0=  0= 0= 0= 0= 0= 0= 0= 0= 0=  0=! 0=0 0=1 0=  0=! 0=(P 0=&# 0=# 0=< t-=t-=At-=it-= -= x<@|7=f7=g7=~7=7=7=7=7=\7=]7=^7=_7=P7=Q7=R7=S7= 7= 7= 7= 7= 7= 7= 7= 7= 7=<error %d timeout on SCSI command 0x%x INTRF single step dsp 0x%08x dsa 0x08%x %s: DMA IRQ: illegal instruction bus fault parity DMA fifo empty, DSP=0x%x DSA=0x%x: last msg_in=0x%x status=0x%x current DSA invalid %s: scsi gross error %s: unexpected phase mismatch %d %s: phase mismatch without command parity error %s: selection timeout without command %s: unexpected disconnect without command %s: unhandled scsi interrupt, sist=0x%x sstat1=0x%x DSA=0x%x DSP=0x%x %s: script interrupt (0x%x) with invalid DSA !!! %s: command with invalid status (IRQ code 0x%x current status %d) ! error, DSP=0x%x %s: reselect with invalid target %s: reselect with invalid target %d %s: target %d reselect with invalid lun %d %s: target %d lun %d tag %d reselect without command %s: reselect with invalid tag our reject message was rejected scsi message reject, extended message sent was 0x%x scsi message reject, message sent was 0x%x unhandled message 0x%x %s: extended message too big (%d) MSG_IGN_WIDE_RESIDUE: bad len %d invalid retval from siop_iwr()invalid retval from siop_wdtr_neg()invalid retval from siop_sdtr_neg()reselect failed %s: done without command, DSA=0x%lx unknown irqcode %x != NULL%s: siop_intr() - we should not be here! istat = 0x%x, dstat = 0x%x, sist = 0x%x, sstat1 = 0x%x need_reset = %x, irqcode = %x, siop_cmd %s %s: unable to load data DMA map: %d siop%s: %u (%d dBm) Unknown PRISM2 chip%s: Firmware %d.%02d variant %d, Symbol %s: %s%s (0x%04x), Firmware %d.%d.%d (primary), %d.%d.%d (station), %s: unsupported crypto algorithm %d %s: wi_do_hostdecrypt: iv mismatch: 0x%02x%02x%02x%02x vs. 0x%x %s: wi_start: dropping unassoc dst %s %s: host encrypt not implemented for 802.3 %s: wi_start: xmit failed %s: wi_cmd failed with %d %s: wi_scan_timeout: %d tries %s: invalid data path: %x %s: failed to allocate %d bytes on NIC %s: device timeout %s: init failed %s: wi_mgmt_xmit: xmit failed wiiocwiscan%s: tx buffer allocation failed %s: mgmt. buffer allocation failed %s: wi_cmd_io: busy bit won't clear %s: timeout in wi_cmd 0x%04x; event status 0x%04x %s: received packet of unknown type on port 7 %s: received packet on invalid port (wi_status=0x%x) %s: oversized mgmt packet received in hostap mode (wi_dat_len=%d, wi_status=0x%x) wihap: failed to copy header %s: oversized packet received (wi_dat_len=%d, wi_status=0x%x) %s: Error decrypting incoming packet. : unable to read station address address %sWaveLAN/IEEE nodeIBSSwlanwiLucent WaveLAN/IEEESony WaveLAN/IEEELucent Embedded WaveLAN/IEEEPRISM2 HFA3841(EVB2)PRISM2 HWB3763 rev.BPRISM2 HWB3163 rev.APRISM2 HWB3163 rev.BPRISM2 HFA3842(EVB3)PRISM1 HWB1153PRISM2 HWB3163 SST-flashPRISM2 HWB3163(EVB2) SST-flashPRISM2 HFA3842(EVAL)PRISM2.5 ISL3873PRISM2.5 USBPRISM2.5 ISL3874A(Mini-PCI)PRISM2.5 ISL3874A(PCI-bridge)PRISM3 ISL37300PPRISM3 ISL37300P(PCI)PRISM3 (USB)Sending deauth to sta %s wihap_disassoc_req: unknown station: %s wihap_assoc_req: from station %s wihap_assoc_req: bad ssid: '%.*s' != '%.*s' wihap_assoc_req: rates mismatch. wihap_assoc_req: capinfo: not ESS: capinfo=0x%x wihap_assoc_req: WEP flag mismatch: capinfo=0x%x wihap_assoc_req: polling not supported: capinfo=0x%x wihap_assoc_req: already assoc'ed? wihap_assoc_req: returns status=0x%x Sending disassoc to sta %s wihap_data_input: no TODS src=%s, fctl=0x%x wihap_data_input: incorrect bss: %s wihap_data_input: dropping unassoc src %s wihap_auth_req: station %s short request wihap_auth_req: station %s algo=0x%x seq=0x%x wihap_auth_req: new station challenge: 0x%x 0x%x ... wihap_auth_req: algorithm unsupported: 0x%x wihap_auth_req: returns status=0x%x wihap_init: sc=%p whi=%p wihap_ioctl: i shouldn't get other ioctls! wihap_deauth_req: unknown station: %s wihap_mgmt_input: len=%d MGMT: assoc req: assoc resp: reassoc req: reassoc resp: probe req: probe resp: beacon: ann traf ind disassociation: auth: deauth: unknown (stype=0x%x) ftype=0x%x (ctl=0x%x) wihap_shutdown: sc=%p whi=%p wihap_shutdown: free(sta=%p) wihap_timeout: disassoc due to inactivity: %s wihap_timeout: deauth due to inactivity: %s %s: power management is disabled, cannot do WOL %s: no auxiliary power, cannot do WOL from D3 (power-off) state %s: can't map mbuf (error %d) %s: tried to map busy TX descriptor %s: unknown imtype %d%s: tried to map busy RX descriptor %s: reset never completed! %s: PHY write failed %s: bad phy register %x %s: PHY read failed %s: unknown bus speed, assume 33MHz : unknown ASIC (0x%04x): %s (0x%04x), %s, address %s %s: can't allocate tx listseg, error = %d %s: can't map tx list, error = %d %s: can't create tx list map, error = %d %s: can't load tx list, error = %d %s: can't create DMA map for TX %s: can't allocate rx listnseg, error = %d %s: can't map rx list, error = %d %s: can't create rx list map, error = %d %s: can't load rx list, error = %d %s: can't create DMA map for RX %s: no PHY found! %s: watchdog timeout RTL8100RTL8100ERTL8100E 2RTL8101RTL8101ERTL8102ERTL8106ERTL8401ERTL8402RTL8411RTL8411BRTL8102ELRTL8102EL 1RTL8103ERTL8110SRTL8139C+RTL8168 1RTL8168 2RTL8168 3RTL8168C/8111CRTL8168CP/8111CPRTL8168F/8111FRTL8168G/8111GRTL8168GU/8111GURTL8105ERTL8168D/8111DRTL8168DP/8111DPRTL8168E/8111ERTL8168E/8111E-VLRTL8168EP/8111EPRTL8169RTL8169/8110SBRTL8169SBLRTL8169/8110SCdRTL8169/8110SCeRTL8169S%s: probed fifo depth: %d bytes : unknown uart : ns8250, no fifo : ns16450, no fifo : ns16550, no working fifo : ns16550a, %d byte fifo : st16650, no working fifo : st16650, %d byte fifo : st16c654, 64 byte fifo : ti16750, 64 byte fifo comattach: bad fifo type%s: console %s: can't establish soft interruptcomcninit: mapping failed%s: %d silo overflow%s, %d ibuf overflow%s comprmRT5222unknownRT2522RT2523RT2524RT2525RT2525eRT2526%s: could not write to RF %s: could not read from BBP %s: could not write to BBP %s: timeout waiting for BBP %s: could not enable device %s: could not allocate protection frame %s: sending mgt frame failed 0x%08x %s: sending data frame failed 0x%08x %s: could not load old rx mbuf%s: could not allocate beacon %s: could not create desc DMA map %s: could not allocate DMA memory %s: can't map desc DMA memory %s: could not load desc DMA map %s: could not allocate soft data %s: could not create DMA map %s: could not allocate rx mbuf %s: could not allocate rx mbuf cluster %s: could not load rx buf DMA map%s: MAC/BBP RT2560 (rev 0x%02x), RF %s %s: could not allocate Tx ring %s: could not allocate ATIM ring %s: could not allocate Prio ring %s: could not allocate Beacon ring %s: could not allocate Rx ring ralRT2529 (MIMO XR)RT5225RT5325 (MIMO XR)RT2527ral-rt2661ral-rt2561ral-rt2561s%s: error %d, could not read firmware %s %s: could not allocate beacon frame %s: timeout waiting for MCU to initialize %s: could not load 8051 microcode %s: timeout waiting for NIC to initialize %s: MAC/BBP RT%X, RF %s %s: could not allocate Tx ring %d %s: could not allocate Mgt ring RT3053RT2820RT2850RT2720RT2750RT3020RT2020RT3021RT3022RT3052RT3320%s: timeout waiting for DMA engine %s: could not read RF register %s: could not read from BBP through MCU %s: could not write to BBP through MCU %s: timeout waiting for BBP to wake up %s: can't map DMA memory %s: could not load DMA map %s: radio is disabled by hardware switch %s: timeout waiting for MAC %s: could not allocate Rx mbuf ral-rt2860%s: error %d, could not read firmware file %s %s: MAC/BBP RT%X (rev 0x%04X), RF %s (MIMO %dT%dR) %s: could not allocate Tx pool %s: reset rx ring timedout %s: can't select regwin %d %s: invalid max txpower in sprom %s: no tssi2dbm table for 11a PHY %s: bwi_rf_calc_txpower failed %s: only BCM2060 rev 1 RF is supported for 11A PHY %s: only BCM2050/BCM2053 RF is supported for supported for 11B PHY %s: only BCM2050 RF is supported for 11G PHY %s: unsupported PHY mode %s: %s is not implemented yet %s: unsupported 11A PHY, rev %u %s: unsupported 11B PHY, rev %u %s: unsupported 11G PHY, rev %u %s: unsupported PHY type %d %s: too many MACs %s: %dth MAC already attached %s: MAC rev %u is not supported %s: can't select regwin 0 %s: no BBP id for device id 0x%04x %s: no number of win for BBP id 0x%04x %s: bus regwin already exists %s: no MAC was found %s: no bus regwin was found %s: MACs bus space mismatch! %s: config PS failed %s: can't stop MAC %s: invalid IV image, ofs %s: invalid ofs (0x%04x) for %dth iv %s: invalid IV image, val32 %s: invalid IV image, val16 %s: invalid IV image, size left %d %s: load IV failed %s: load ExtIV failed %s: firmware (fw & pcm) loading timed out %s: firmware version 4 is not supported yet %s: invalid firmware (%s): invalid size %zu %s: invalid firmware (%s): size mismatch, fw %u, real %zu %s: invalid firmware (%s): type mismatch, fw '%c', target '%c' %s: invalid firmware (%s): wrong generation, fw %d, target %d %s: base tssi measure failed %s: TEST1 failed %s: TEST2 failed %s: %s failed, MAC status 0x%08x %s: %s failed, intr status %08x COMunknown regwin type 0x%04x%s: %s disable clock timeout %s: %s wait BUSY unset timeout unsupported rate %dbad paddr 0x%lx impossible lna gain %dunsupported lpdunknown PHY mode %u%s: zero tx id %s: wait for TX ring(%d) stable timed out %s: reset TX ring (%d) timed out %s: can't create %dth tbd, %dth DMA map %s: can't create spare RX buf DMA map %s: can't create %dth RX buf DMA map %s: can't allocate %dth RX buffer unsupport modulation type %u%s: invalid rate %u or fallback rate%s: prepend TX header failed %s: can't load TX buffer (1) %d %s: can't defrag TX buffer %s: can't load TX buffer (2) %d unsupported modtype %u%s: zero length data, hdr_extra %d : could not allocate TX mbuf bounce buffer : cannot create TX mbuf DMA map : could not allocate RX mbuf bounce buffer : cannot create RX mbuf DMA map : could not allocate ring DMA memory : cannot create ring DMA map (error %d) %s: can't load DMA mem %s: can't create txstats ring DMA mem %s: can't allocate txstats ring DMA mem %s: can't map txstats ring DMA mem %s: can't load txstats ring DMA mem %s: can't allocate txstats DMA mem %s: can't map txstats DMA mem %s: can't load txstats DMA mem unsupported bus space type %d%s: %dth TX ring DMA alloc failed %s: RX ring DMA alloc failed %s: TX stats DMA alloc failed unknown LED event %d%s: %s invalid channel! %s: can't set channel to %u bwi-airforceucode%d.fw%s: error %d, could not read firmware %s! pcm%d.fw%s: no suitable IV for MAC rev %d b0g0initvals%d.fwb0g0bsinitvals%d.fw%s: no suitable ExtIV for MAC rev %d %s: PHY calibrate failed %s: can't initialize %dth TX ring %s: can't initialize RX ring %s: can't initialize TX stats ring %s: invalid MAC address: %s unknown phymode %d%s: can't drain TX status %s: intr fatal TX/RX (%d) error 0x%08x intr PHY TX error %s: EO_ATIM %s: intr noise bwiuhci_alloc_std_chain: mps=0 uhci_device_setintr: 0 interval uhci_device_isoc_close: %p not found uhci_abort_xfer: not in process contextuhciabUHCI root hubuhci_device_isoc_enter: xfer=%p in frame list startstop%s: cannot %s %s: controller did not reset %s: unable to allocate pool descriptor uhcixfer%s: interrupt while not operating ignored %s: host system error %s: host controller process error %s: host controller halted uhciohci_setintr: 0 interval ohci_device_isoc_abort: early return ohci_rem_ed: ED not foundohci_add_done: addr 0x%08lx not foundohci_abort_xfer: not in process contextohciab%s: isoc TD alloc failed OHCI root hub%s: %u scheduling overruns %s: resume detect %s: unrecoverable error, controller halted %s: blocking intrs 0x%x ohcixfer%s: reset timeout %s: SMM does not respond, will reset ,, legacy support version %d.%d%s %s: unsupported OHCI revision ohciehci isoc xfer being freed, but with no itd chainehci: isoc xfer suddenly has 0 bInterval, invalidehci_check_itd_intr: not valid itd ehci_check_qh_intr: not valid sqtd ehciiawehciabehci_open: bad device speed %d%s: Error opening low/full speed isoc endpoint. A low/full speed device is attached to a USB2 hub, and transaction translations are not yet supported. Reattach the device to the root hub instead. ehci: opening pipe with invalid bInterval ehci: zero length endpoint open request EHCI root hub%s: port reset timeout %s: halt timeout ehci: isoc descriptor requested that spans the entire frametable, too many frames ehci: unexpectedly ran out of isoc itds, isoc_startehcidiehci_abort_xfer: not in process contextehciaw%s: disable schedules timeout %s: run timeout ehcixferehcidbehci%s: unable to start background operation invalid data offset%s: %s: illegal block count for %s %s: %s: illegal cmdlen for %s %s: %s: %s: invalid chunk state%s: %s: invalid volume state transition %d -> %d could not requeue I/O%s: sr_wu_enqueue_ccb got active wu%s: sr_wu_init got active wu%s: invalid target on wu: %p%s: i/o error on block %lld target %d b_error %d unknown optional metadata type%02x%02x%02x%02x-%02x%02x-%02x%02x-%02x%02x-%02x%02x%02x%02x%02x%02x%s%sOPENBSDSR %s%03d%s: %s: %s: invalid chunk state transition %d -> %d %s: sr_startwu_callbacksr_schedule_wu: work unit not in progress (state %i) sr_sync%s: invalid optional metadata checksumunknown old optional metadata type %u %s: no in memory copy of metadata %s: could not allocate metadata scratch area %s: could not write metadata to %s %s: save metadata failed sr_shutdownsr_down%s: roaming device %s -> %s %s: sr_scsi_cmd NULL discipline %s: %s device is being deleted, failing io %s: wu %p not on pending queueunable to allocate work unitsunable to allocate ccbsvolume %s not found%s has unsupported sector size (%u)could not allocate memory for metadatacould not allocate memory for foreign metadata%s: sr_rw: failed to allocate vnode %s: I/O error %d on dev 0x%x at block %llu failed to get DUID for softraid volumeinsufficient boot storagefailed to write boot blockfailed to write boot loadercould not save metadata to %s%s: sr_meta_rw: invalid metadata pointer cannot clear foreign metadatanot enough memory for metadata buffercould not read native metadatanot part of the same volumenot all chunks are of the native metadata formatsrc_dev_mm == NODEV%s%d%cdiscipline does not support rebuildrebuild already in progressvolume not degradedno offline chunks available to rebuild%s: sr_rebuild_init: can't allocate vnode %s partition not of type RAID (%d)%s partition too small, at least %lld bytes required%s partition too large, wasting %lld bytes%s is already in userebuild of %s started on %s%s: no offline chunk found on %s! %s: %s volume degraded, will attempt to rebuild on hotspare %s sr_hotspare%s: pending I/O failed to complete on failed chunk %s, hotspare rebuild aborted... %s is already a hotsparesr_hotspare: cannot allocate vnodeHOTSPAREcould not save metadata for %sunsupported state request %dchunk not part of arrayinvalid foreign metadatanot valid softraid metadatainvalid metadata checksumcannot read metadata version %u on %s, expected version %u or earliersr_meta_native_bootprobe: cannot allocate vnodenot enough memory for fake disciplinesr_meta_native_bootprobe: cannot allocate vnode for partitionnative bootprobe could not read native metadatasr_meta_probe: cannot allocate vnodesrdiscould not create discipline taskqcould not initialize disciplinechunk %s already in useinvalid metadata formatdisk %s is currently in use; cannot force createfailed to clear metadataone of the chunks has corrupt metadata; aborting assemblychunk sizes are not equal; up to %llu blocks wasted per chunkvolume level does not match metadata leveldisk %s already assembledtrying to bring up %s degraded%s was not shutdown properly%s is offline, will not be brought onlineno free target for %sscsi_probe_lun failedvolume %s is roaming, it used to be %s, updating metadata%s volume attached as %sunable to create sensor for %ssdwd%s: failed to allocate boot volume %s: failed to allocate device array %s: failed to allocate ondisk array %s: failed to allocate hotspare %s: found duplicate chunk %u for volume %u on device %s %s: not all chunks were provided; attempting to bring volume %d online sr_locksr_hs_lock%s: controller registration failed%s: bogus rebuild restart offset, starting from 0 %s: resuming rebuild on %s at %d%% %s: could not create read io %s: could not create write io sr_rebuild%s: could not save metadata to %s sr_yieldsoftraidsr_concat_rw%s: %s: too many ccbs queued %s requires two or more chunksCONCATsr_crypto_rwcannot open key disk %s%s has unsupported sector size (%d)%s partition not of type RAID (%d) %s is not a key diskCRYPTOKEYDISKunknown crypto algorithmunable to allocate CCBsincorrect key or passphrase%s requires exactly one chunksr_raid0_rwinvalid strip sizeRAID 0%s: retrying read on block %lld %s: sr_raid1_intr_cb%s: permanently failing write on block %lld sr_raid1_rw%s: is offline, cannot read invalid volume stateRAID 1%s: permanently fail write on block %lld sr_raid5_rw%s: %s failed to get read work unit%s: is offline, can't read %s: %s: invalid volume state transition %d -> %d%s: %s: %s: invalid chunk state transition %d -> %d%s requires three or more chunksRAID 5sr_raid6_rw%s: can't get wu_rDisk %llx offline, regenerating Dx+P Disk %llx & %llx offline, regenerating Dx+Dy +Q singleDisk %llx offline, regenerating Dx%s old_state = %d, %d = %d, invalid new_state%s requires four or more chunksRAID 6RAM diskfictitiousrdattach: out of memoryrd%drdattach: device name too longhfsc_enqueue called on hfsc-less kernelhfsc_purge called on hfsc-less kernel%s: insufficient message buffers %s: %s htplevhotplug: event lost, queue full Not set. All breakpoints used. Already set. Too many breakpoints. No breakpoints set Count Address %5d the kernel did not panic Bad function Too many arguments Argument missing %-12sNo such command Ambiguous Bad modifier Count missing ddb> procscalloutpoolsmountsvnodesbufsallbcstatsbreaksextentsmallocobjectpagepanicpoolprocuvmexpvnodewatchescrashdumphaltrebootpoweroffmachineprintexaminesearchdeletebreakdwatchwatchstepcontinueuntilnextmatchtracecallpsshowboothelphangmandmesg.strtab[ %s symbol table has bad start address %p ] ELFbad e_machine.symtab[ using %lu bytes of %s ELF symbol table ] bad magicsymtab unalignedsymtab corrupted[ %s ELF symbol table not valid: %s ] ELFAddress missing Value missing : %*lx%*ld%*lu%*lo\%03o= 0x%lx %-*s%-*lx%-*ld%-*lu%-*loSymbol not found Syntax error Divide by 0 Negative shift amount () Score: %lu/%lu ^R Bad character in number Bad escape String too long Bad character Faulted in traceback, aborting... Starting stack trace... End of stack trace. -%#*lx-%*lx-%#*lo-%*lo-%#*lu-%*lu--db_more-- %-12s%s %s+%s [after %6d] [%s:%d]invalid symbol table nameSifting table %s: Unable to find symbol table slot for %s.No slots left for %s symbol table%s%s %s bsd[ no symbol table formats found ] After %d instructions Breakpoint at Stopped at RUN AT LEAST 'trace' AND 'ps' AND INCLUDE OUTPUT WHEN REPORTING THIS PANIC! DO NOT EVEN BOTHER REPORTING THIS WITHOUT INCLUDING THAT INFORMATION! Unknown variable No value radixmaxoffmaxwidthtabstopslineslogNo watchpoints set Address Size %8lx %lx All watchpoints used. Too many watchpoints. Unknown size %s = %s Nothing written. /mnt/etc/firmware/%swarning: no entropy supplied by boot loader RRIP without PX field? SPIEEE_1282IEEE_P1282RRIP_1991ARRIP with incorrect NM flags? RRIP with incorrect flags?isoinodefhtovp: lbn exceed volume space %d fhtovp: crosses block boundary %d fhtovp: bread error %d fhtovp: directory crosses block boundary %d[off=%d/len=%d] cd9660_vget: alien ino_t %lluCD001%/@%/C%/Ecd9660_mountroot: can't setup bdevvp'scd9660root_devicetag VT_ISOFS, isofs vnode cd9660_strategy: spec%s@%dOpenBSD#!/dev/fd/%d/dev/consolewarning: /dev/console does not exist warning: /dev/console error %d initexecinit: couldn't allocate argument spaceexec %s: error %d init: not found no initswapperfork initcfpendcannot mount rootcannot find root vnodepagedaemonfork pagedaemonreaperfork reapercleanerfork cleanerupdatefork updateaiodonedfork aiodonedscheduler/sbin/init/sbin/oinit/sbin/init.bakbqquiesbqqueuebqwaitbqdestbufq_init: type %i unknownbufq init failbqinitinitclocks: unable to register softclock intrfdlockfileplfdescpldup2: fdallockqreadkqueueplknoteplwaitinit died (signal %d, exit %d)thrdeathcpu_exit returnedprocessppwaitunable to allocate kthread_qWARNING: thread `%s' (%d) exits with status %d No KMEMSTATS compiled in malloc(): allocation too large, type = %d, size = %lu malloc: allocation too large, type = %d, size = %lu malloc: out of space in kmem_mapmallocarray overflow: %zu * %zu%d,physiomawnusage: show all procs [/a] [/n] [/w] /a == show process address info /n == show normal process info [default] /w == show process wait/emul info PID %-10s %18s %18s %18s COMMANDSTRUCT PROC *UAREA *VMSPACE/VM_MAP PID %5s %5s %5s S %10s %-12s %-16s PPIDPGRPUIDFLAGSWAIT PID %-16s %-8s %18s %s EMULWAIT-CHANNELWAIT-MSG%c%5d %-10.10s %18p %18p %18p %5d %5d %5d %d %#10x %-12.12s %-16s %-16s %-8s %18p %s PROC (%s) pid=%d stat=%s flags process=%b proc=%b CONTROLTEXECINEXECEXITINGSUGIDSUGIDEXECPPWAITISPWAIT PROFIL TRACED WAITED COREDUMP SINGLEEXITSINGLEUNWINDNOZOMBIESTOPPEDSYSTEMEMBRYOZOMBIENOBROADCASTKILLINKTRPROFPENDALRMPENDSIGSUSPENDSELECTSINTR SYSTEM TIMEOUTWEXITOWEUPCSUSPSINGLESYSTRACECONTINUEDTHREADSUSPSIGSOFTDEPCPUPEG pri=%u, usrpri=%u, nice=%d forw=%p, list=%p,%p process=%p user=%p, vmspace=%p estcpu=%u, cpticks=%d, pctcpu=%u.%u user=%u, sys=%u, intr=%u chgproccnt: procs < 0procinit: mallocprocplprocessplzombieplucredplpgrpplsessionplidlezombiedeadonprocplimitplcpu_switchto returnedfork idleidle%dsensorssensorsensordevsuspendpausesigwaitusersystempid %d (%s): %s write of %lu@%p at %lld failed: %d %s/%s/%u.core/var/crash%s/%s.core%s.coreissignal sigaplhashinit: bad cnt%02hx%02hx%02hx%02hx%02hx%02hx%02hx%02hx%s:%s,sysctllksysctldlkthrsleep%s%s(%d)Timecounter "%s" frequency %lu Hz -- Insufficient hz, needs at least %u Time stepped from %lld.%09ld to %lld.%09ld dummynanosleepdenied attempt to set clock forward to %lld denied attempt to set clock back %lld seconds ?%9d %2td/%-4td %p %s ticks now: %d ticks wheel arg func boredunexpected %s wq state %dunable to create workq thread for "%s" wqdestroywqtaskssyswqunexpected %s tq state %dunable to create thread for "%s" taskq unexpected %s tq state %utqdestroysystqsystqmpsmashed stack in %ssetrunnablepreempt: cpu_preempt not yet implementedfailing resume cannot be handled resume %s config_defer: can't defer config of a root deviceconfig_defer: can't allocate defer structureautoconfconfig_detach: forced detach of %s failed (%d)%s detached config_make_softcconfig_make_softc: allocation for device softc failed%s%dconfig_make_softc: device name too longexpandcreatconfig_make_softc: %sing dev arrayconfig_make_softc: duplicate %s>>> probing for %s* mapply: no match function for '%s' device>>> %s probe returned %d >>> %s probe won >>> no winning probe %s at root%s at %sroot device %s not configured not configured unsupported /dev/%s%s%ccannot obtain vnode for 0x%x/0x%xcannot open disk, 0x%x/0x%x, error %dcannot read disk label, 0x%x/0x%x, error %droot filesystem has size 0filesystem type %d not known.. assuming ffs use one of: exit %s[a-p]dkopendisklabels not read:root device (default %sswap device (default %s%s)root device (%s) not foundnetbootroot on %s%ccan't figure root, hope your kernel is right (%02hx%02hx%02hx%02hx%02hx%02hx%02hx%02hx.%c) swap on %s%d%c dump on %s%d%croot device (%02hx%02hx%02hx%02hx%02hx%02hx%02hx%02hx) not founddisk_unbusy: %s: dk_busy < 0 disk_detach: disk_count < 0dklkdisk_attach: can't allocate storage for disklabelwrit%s%d%c: %s %sing fsbn %lld%lld of %lld-%lld (%s%d bn %lld; cn %lld tn %lld sn %lld)%s: NULL extentextent `%s' (0x%lx - 0x%lx), flags=%b FLWANTEDWANTEDNOCOALESCEFIXED 0x%lx - 0x%lx extnt%s: start 0x%lx, end 0x%lx %s: region not foundextentplklog page %p, nmissing %d POOL %s: size %u, align %u, ioff %u, roflags 0x%08x alloc %p minitems %u, minpages %u, maxpages %u, npages %u itemsperpage %u, nitems %u, nout %u, hardlimit %u nget %lu, nfail %lu, nput %lu npagealloc %lu, npagefree %lu, hiwat %u, nidle %lu empty page list: full page list: partial-page list: no current page curpage %p pool(%p:%s): page inconsistency: page %p; at page head addr %p (p %p) pool(%p:%s): page inconsistency: page %p; item ordinal %d; addr %p (p %p) pool(%p:%s): page inconsistency: page %p; %d on list, %d missing, %d items per page pool(%p:%s): page inconsistency: page %p; %d on list, %d missing, %d expected usage: show all pools [/a] %-10s%4s%9s%5s%9s%6s%6s%6s%6s%6s%6s%5s SizeRequestsFailReleasesPgreqPgrelNpageHiwatMinpgMaxpgIdle%-12s %18s %18s Allocator%-12s %18p %18p inf %*u %*lu %*d %*s %*lu pool_put of NULLpool_do_put: %s: page header missingpool_do_get: %s: page emptypool_init: too much uptimephpooldma%d0123456789abcdef%llo%llx(null)0123456789ABCDEFbug in kprintf: bad base%s: table is full panic: splassert: %s: want %d have %d spl assertion failure in %skernel %sassertion "%s" failed: file "%s", line %d*FOUND**UNKNOWN*0%o0x%x%3d free slot (for add) %3d %s count %d disable (pseudo device) Unknown devno (max is %d) %3d at ??? %s flags 0x%x %s [] ? Unknown argument command args description [count] number of lines before moredev add a device8|10|16 base on large numbersdevno|dev change devices enter ddbattr val|devno|dev disable devicesattr val|devno|dev enable devicesdevno|dev find devices this message list configuration leave UKC[attr [val]] show attributes (or devices with an attribute)[mins [dst]] set timezone/dst toggle verbose booting don't know--- more --- Error unknown state already%3d can't enable free slot %3d %s disabled %3d can't disable free slot already Unknown routine /%c/ Value missing for attribute Unknown attribute change (y/n) ?out of memory. flags changed %3d can't change free slot count%3d %s changed Unknown pseudo routine /%c/ %s ? Not same device type No more space for new devices. Device not complete number or * is missing No device of this type exists. Clone Device (DevNo, 'q' or '?')Insert before Device (DevNo, 'q' or '?')Unknown command, try help Argument expected Dev expected 8|10|16 expected DevNo or Dev expected Attr, DevNo or Dev expected timezone = %d, dst = %d disautoconf verbose %sabled Unknown command User Kernel Config UKC> Continuing... addchangeddbdisableenablefindquittimezoneverbosepollselectpipeplpipelkpipeclpiperdpipewrttckoutqload: %d.%02d not a controlling terminal no foreground process group empty foreground process group runningrunnableiowait cmd: %s %d [%s] %lld.%02ldu %lld.%02lds %d%% %ldk ttyrub: would panic c = %d, val = %d mbuf %p m_type: %i m_flags: %b M_EXTM_PKTHDRM_EORM_EXTWRM_PROTO1M_VLANTAGM_LOOPM_FILDROP M_BCAST M_MCAST M_CONF M_AUTH M_TUNNELM_ZEROIZEM_COMPM_LINK0m_next: %p m_nextpkt: %p m_data: %p m_len: %u m_dat: %p m_pktdat: %p m_ptkhdr.rcvif: %p m_pkthdr.len: %i m_ptkhdr.tags: %p m_pkthdr.tagsset: %b IPSEC_IN_DONEIPSEC_OUT_DONEIPSEC_IN_CRYPTO_DONEIPSEC_OUT_CRYPTO_NEEDEDIPSEC_PENDING_TDBBRIDGEGIFGRE DLT PF_DIVERT PIPEX PF_REASSEMBLED SRCROUTETUNNELm_pkthdr.csum_flags: %b IPV4_CSUM_OUTTCP_CSUM_OUTUDP_CSUM_OUTIPV4_CSUM_IN_OKIPV4_CSUM_IN_BADTCP_CSUM_IN_OKTCP_CSUM_IN_BADUDP_CSUM_IN_OK UDP_CSUM_IN_BAD ICMP_CSUM_OUT ICMP_CSUM_IN_OK ICMP_CSUM_IN_BADm_pkthdr.ether_vtag: %u m_ptkhdr.ph_rtableid: %u m_pkthdr.pf.statekey: %p m_pkthdr.pf.inp %p m_pkthdr.pf.qid: %u m_pkthdr.pf.tag: %u m_pkthdr.pf.flags: %b GENERATEDTRANSLATE_LOCALHOSTDIVERTEDDIVERTED_PACKETREROUTEREFRAGMENTEDPROCESSEDm_pkthdr.pf.routed: %u m_pkthdr.pf.prio: %u m_ext.ext_buf: %p m_ext.ext_size: %u m_ext.ext_free: %p m_ext.ext_arg: %p m_ext.ext_nextref: %p m_ext.ext_prevref: %p unknown type of extension bufferm_copydata: off %d < 0m_copydata: len %d < 0m_copydata: short mbuf chainm_copydata: null mbufm_copym0: off %d, len %dm_copym0: short mbuf chainm_copym0: m == NULL and not COPYALLmbuf prepend length too bigmbplmtagplmcl%dkm_apply: len %d < 0m_apply: off %d < 0m_apply: null mbuf in skipm_apply: null mbufWARNING: mclpools limit reached; increase kern.maxclustersrequested tag size for pool %#x is too bigm == NULL in m_pulldown()unixsoaccept: !NOFDREFnetclssoclose: NOFDREFsockplsbcreatecontrol: message too large %d sbdropsbappendcontrolsemi-panic: sbcompressnetlcknetiosbappendaddrnetcon2netconacceptunp_disconnectunp_connect2unp_attachuipc 1uipc 2uipc 4piusrreqCurrent Buffer Cache status: numbufs %lld busymapped %lld, delwri %lld kvaslots %lld avail kva slots %lld bufpages %lld, dirtypages %lld pendingreads %lld, pendingwrites %lld biowaitbufplbiodone alreadyneedbuffernobuffersbuf_get: dup lblk vp %p bp %pgetblkbuf_needvabufinit: can't reserve VM for buffersnchplwtf? leak?vop_generic_revokeallnameilf_findoverlap: defaultlockfplrelookup: null namerelookup: lookup on dot-dot vp %p lblkno 0x%llx blkno 0x%llx dev 0x%x proc %p error %d flags %lb AGENEEDCOMMITASYNCBADBUSYCACHECALLDELWRI DONE EINTR ERROR INVAL NOCACHEPHYSRAWREADWANTEDWRITEINPROGXXX(FORMAT)DEFERREDSCANNEDDAEMONRELEASED bufsize 0x%lx bcount 0x%lx resid 0x%lx data %p saveaddr %p dep %p iodone %p dirty {off 0x%x end 0x%x} valid {off 0x%x end 0x%x} tag %s(%d) type %s(%d) mount %p typedata %p data %p usecount %d writecount %d holdcnt %d numoutput %d clean bufs: bp %p dirty bufs: flags %b vnodecovered %p syncer %p data %p RDONLYSYNCHRONOUSNOEXECNOSUIDNODEVASYNCEXRDONLY EXPORTED DEFEXPORTED EXPORTANON EXKERB LOCALQUOTAROOTFSvfsconf: ops %p name "%s" num %d ref %d flags 0x%x statvfs cache: bsize %x iosize %x blocks %llu free %llu avail %lld files %llu ffiles %llu favail %lld f_fsidx {0x%x, 0x%x} owner %u ctime 0x%llx syncwrites %llu asyncwrites = %llu syncreads %llu asyncreads = %llu fstype "%s" mnton "%s" mntfrom "%s" mntspec "%s" locked vnodes: %p, %pall vnodes: %p, %p,brelvp: NULLbgetvp: not freevflushbuf: not dirtyvflushbufvinvalbufvinvalbuf: dirty bufsvinvalbuf: flush failedvwakeup: neg numoutputsoftdep %d vclean: deadlockvclean: cannot reclaimvclean: not cleanvgonemissing aliasvgonel: not cleanmissing bdevvgetvfslockunmount of %s failed with error %d WARNING: some file systems would not unmount retrying syncing disks... giving up done kinfo: vp changed VNONVREGVDIRVBLKVCHRVLNKVSOCKVFIFOVBADNONUFSNFSMFSMSDOSFSPORTALPROCFSAFSISOFSADOSFSEXT2FSVFSNTFSUDFFUSEFSTMPFSsyncer vnode syncermount: lost mountunmount: dangling vnodevn_lockspec_badop calledspec_ioctltag VT_NON, dev %d, %d spec_close: not specialspec_fsync: not dirtyspec_fsyncspec_read typespec_write typechkvnlockdead_badop calleddead_write: lockdead_read: locktag VT_NON, dead vnode dos2unixtime(): month value out of range (%u) detrunc(): can't truncate root directory, clust %u, offset %u deextend: file too largedenodedeget(): pcbmap returned %d extendfile(): attempt to extend root directory extendfile: pcbmap. .. doscheckpath(): .. not a directory? msdosfs_sync: rofs modmsdosfs: reducing max cluster to %d from %d due to FAT size RRaArrAatag VT_MSDOSFS, startcluster %u, dircluster %u, diroffset %u (LOCKED) dev %d, %d, %s msdosfs_strategy: specmsdosfs_rename: lost to startdirmsdosfs_rename: lost from startdirmsdosfs_rename: updating .. in root directory?msdosfs_write(): bad file typebpfattachbpf_mcopybpf: ifpromisc failedbpf_detachd: descriptor not in listbpfifa_update_broadaddr does not support dynamic lengthegresstoo many interfacesifaddritem%s: can't handle af%d looutput: no header mbuflo%difmedia_add: can't malloc entryifmedia_set: no match for 0x%x/0x%x ifmedia_set failedcan't establish softnet handlerrtmaskrn_init: radix functions require max_keylen be set rn_initrn_init 2rn_delete: inconsistent normal annotation rn_delete: inconsistent mklist refcount rn_delete: inconsistent dupedkey list rn_delete: inconsistent annotation rn_delete: couldn't find our annotation Mask for route not entered rn_addmask: mask impossibly already in tree %s %p at %p rn_delete: Orphaned MaskNon-unique normal route, mask not entered next == NULLraw_usrreqrt_timer_remove_all: rtq_count reached 0 rt_timer_add: rtq_count reached 0 ifafreertfreertfree 2rtfree: %p not freed (neg refs) rt_timer_init: already initializedrttmrplrtrequest deletertrequest1 RTM_RESOLVE: wrong ifa (%p) was (%p) rt_timer_timer: rtq_count reached 0 rt_timer_queue_destroy: rtq_count reached 0 %s: wrong ifa (%p) was (%p) rtentplroute_init rtable_addroute_outputrouteunexpected mode %uUnexpected mode %u%s: invalid channel freq %u flags %x %s: invalid channel (NULL) Bad IBSS channel %u%s: bad channel ignored; freq %u flags %x number %u Pairwise key expansionPMK Name%s: Michael MIC failure %s: station %s disassociated by peer (reason %d) %s: station %s deauthenticated by peer (reason %d) %s: %sassociation failed (status %d) for %s %s: received %s from %s rssi %d mode %s 80211scanfreeing bss nodenot in ap mode, mode %u%s: station %s purged from node cache %s: number of cached nodes is %d, expected %d,possible nodes leak unable to setup inital BSS node%s: no memory for AID bitmap! %s: no memory for TIM bitmap! -%s: tsft offset %s%llu %s: ieee80211_ibss_merge: bssid mismatch %s %s: my tsft %llu beacon tsft %llu %s: sync TSF with %s %s: rates mismatch, BSSID %s %s: sync BSSID %s -> (from %s) %s: creating ibss activepassive%s: end %s scan %s: begin %s scan invalid group data cipher!invalid integrity group cipher!management frame too large: %unull node%s: sending %s to %s on channel %u mode %s %s: no node for dst %s, discard raw tx frame %s: failed to queue raw tx frame %s: station %s deauthenticate (reason %d) %s: station %s disassociate (reason %d) %s: received msg %d/%d of the %s handshake from %s group key4-wayEAPOL-Key frame too large: %u%s: sending EAPOL-Key request to %s %s: sending msg %d/%d of the %s handshake to %s "0x%s: no recent beacons from %s; rescanning %s: bogus xmit rate %u setupassociatedsynchronized%s: %s with %s ssid .5 channel %d start %u%sMbshortlong protection enabled %s preamble %s slot time%s newly%s: station %s %s authenticated (open) %s: open authentication failed (reason %d) for %s assoc_reqassoc_respreassoc_reqreassoc_respprobe_reqprobe_respreserved#6reserved#7beaconatimdisassocauthdeauthactionaction_noackreserved#15INITSCANAUTHASSOCRUNauto11a11bturboaearazbgbhbnbrbybzcacncocrczdodzegf2fifofrgrgthkhnhrhuidiqisj1j2j3j4j5jmjojpk2kekpkrkwkzlblilvmcmkmomxmyninlnzpapkprqarusasgsisvtntrtttwuaukuyvnyezazwAPL1APL1AAPL1_ETSICAPL1_FCCAAPL1WAPL2APL2CAPL2DAPL2_ETSICAPL2WAPL3APL3WAPL4APL4WAPL5APL5WAPLDAPLDEBUGETSI1ETSI1WETSI2ETSI2WETSI3ETSI3AETSI3W,ETSI4ETSI4CETSI4WETSI5ETSI5WETSI6ETSI6WETSIAETSIBETSICETSIEU1WFCC1FCC1AFCC1WFCC2FCC2CFCC2AFCC2WFCC3FCC3AFCCAFRANCEMKK1MKK1_FCCAMKK1AMKK1A1MKK1A2MKK1BMKK2MKK2AMKKANONEWOR01WWOR02WWOR0WWOR1WWOR2WWOR3WWOR4WWOR5_ETSICWOR9WWORAWWORLD la_rt=%p la_hold_head=%p, la_asked=0x%lx [NULL][ ifa_addr= ifa_dsta= ifa_mask= flags=0x%x, refcnt=%d, metric=%d rtentry=%p flags=0x%x refcnt=%d use=%llu expire=%lld rtableid=%u key= mask= gw= ifp=%p (%s)(NULL) ifa=%p gwroute=%p llinfo=%p Route tree for AF_INET (not initialized) arptfreearp: ether address is broadcast for IP address %s! duplicate IP address %s sent from ethernet address %s arp: attempt to overwrite permanent entry for %s by %s on %s arp: attempt to overwrite entry for %s on %s by %s on %s arp info overwritten for %s by %s on %s arp: attempt to add entry for %s on %s by %s on %s arpresolve: %s: route without link local address arpresolve: %s: can't allocate llinfo %s: bad gateway value: %s %s: malloc failed %s: no mbuf in_controlinvalid argument to in_lifaddr_ioctlin_pcbinit: hashinit failedin_pcbinit: hashinit failed for lportIPv6 pcb passed into in_pcbconnectinpcbplinternet%u.%u.%u.%uicmp_do_exthdr: m_getptr failureicmp_redirect_timeout: bad route to timeouticmp_mtudisc_timeout: bad route to timeouticmp_erroricmp lenipqeplipqplip_initaeshmac-sha1deflaterip_attachrip_detachrip_usrreqsynpltcp_pulloutofbandm_pulldown malfunctiontcp_output REXMTtcp_outputtcpcbpltcpqepltcp_inittcp_usrrequdp_usrreqipip_input: should never reach herelibdes v 3.21 - 95/11/21 - eaycryptopcryptodesccrydevcuio_copyback: off %d < 0cuio_copyback: len %d < 0cuio_copyback: empty in skipuio_copyback: emptycuio_copydata: off %d < 0cuio_copydata: len %d < 0iov_copydata: empty in skipcuio_copydata: emptycuio_apply: len %d < 0cuio_apply: off %d < 0cuio_apply: ind %d >= uio_iovcnt %d for offcuio_apply: ind %d >= uio_iovcnt %d for lenSoftware crypto device cannot initialize!DES3DESBlowfishCAST-128Rijndael-128/AESAES-CTRAES-GCMAES-GMACAES-XTSARC4HMAC-MD5HMAC-SHA1HMAC-RIPEMD-160HMAC-SHA2-256HMAC-SHA2-384HMAC-SHA2-512GMAC-AES-128GMAC-AES-192GMAC-AES-256Keyed MD5Keyed SHA1MD5SHA1DeflateLZS1.2.3start = %d, len = %d, fs = %s ffs_alloccg: map corruptedbno = %lld, fs = %s ffs_alloccg: block not in mapffs_freefile: range: dev = 0x%x, ino = %d, fs = %sdev = 0x%x, ino = %u, fs = %s ffs_freefile: freeing free inodedev = 0x%x, bsize = %d, size = %ld, fs = %s ffs_blkfree: bad sizebad block %lld, ino %u uid %u on %s: %s bad blockdev = 0x%x, block = %lld, fs = %s ffs_blkfree: freeing free blockffs_blkfree: freeing free fragcg = %d, irotor = %d, fs = %s ffs_nodealloccg: map corruptedffs_nodealloccg: block not in mapffs_clusteralloc: lost blockmode = 0%o, inum = %u, fs = %s ffs_valloc: dup allocfree inode %s/%d had %lld blocks out of inodes %s: create/symlink failed, no inodes free dev = 0x%x, bsize = %d, bprev = %lld, fs = %s ffs_realloccg: bad bprevffs_realloccg: bad blocknodev = 0x%x, optim = %d, fs = %s ffs_realloccg: bad optimfile system full %s: write failed, file system is full ffs2_balloc: block too bigffs2_balloc: unwind failedffs1_balloc: blk too bigCould not unwind indirect block, error %dffs_indirtrunc: bad buffer sizeffs_truncate: newspaceffs_update: bad link cntsoftdep_flushfiles calledffsinodino1pldino2plffs_vget: alien ino_t %lluupdate: rofs modffs_statfsWARNING: %s was not properly unmounted WARNING: R/W mount of %s denied. Filesystem is not clean - run fsck ffs_mountfs(): obsolete rotational table format, please use fsck_ffs(8) -c 1 ffs_reload: dirty1ffs_reload: dirty2WARNING: soft updates isn't compiled in ffs_mountroot: can't setup bdevvp's ffsffs_fsync: not dirtyffs_fsyncffs_write: nonsync dir writeffs_write: typecheckpath: .. not a directory First bad Second bad %s: bad dir ino %u at offset %d: %s bad dirufs_direnter: newblkufs_direnter: compact1ufs_direnter: compact2mangled entryi_ffs_size too smallufs_strategy: specufs_rename: lost from startdirufs_rename: lost to startdirrename: EXDEVufs_rename: same fileufs_rename: lost dir entrychown: lost quotaifree: range: dev = 0x%x, ino = %u, fs = %sdev = 0x%x, ino = %d, fs = %s ifree: freeing free inodebad block %u, ino %u %s: freeing free block: dev = 0x%x, block = %u, fs = %s mode = 0%o, nlinks %u, inum = %u, fs = %s ext2fs_valloc: dup allocext2fs_alloccg: map corruptedext2fs_mapsearch: block not in mapcg = %d, ipref = %u, fs = %s ext2fs_nodealloccg: map corruptedext2fs_nodealloccg: block not in mapext2fs_indirtrunc: bad buffer sizecheckpathrec_len is smaller than minimalrec_len % 4 != 0reclen is too small for name_lendirectory entry across blocksinode out of boundsbad directory entry: %s offset=%d, inode=%u, rec_len=%d, name_len=%d i_size too smallext2fs_direnter: newblkext2fs_direnter: frag size%s: nonsync dir writeext2fs_write%s: typeext2fs_vget: alien ino_t %lluext2fs: wrong magic number 0x%x ext2fs: wrong log2(block size) %d ext2fs: zero blocks per group ext2fs: wrong revision number 0x%x ext2fs: first inode at 0x%x ext2fs: unsupported incompat features 0x%x ext4fs: only read-only support right now ext2fs: your file system says it needs recovery ext2fs: unsupported R/O compat features 0x%x ext2fs_statfsext2fs_reload: dirty1ext2fs_reload: dirty2%s: file system not clean; please fsck(8) ext2fs_mountroot: can't setup bdevvp'sext2fsext2inoplext2dinoplext2fs_mkdir: blksizeext2fs_rename: lost from startdirext2fs_rename: lost to startdirrename: linked directoryext2fs_rename: lost dir entryext2fs_rename: mangled dir- uvm_addr %s: NULL - uvm_addr %s: %p (%s 0x%lx-0x%lx) entry %p: 0x%lx-0x%lx G=0x%lx F=0x%lx free: 0x%lx-0x%lx start=0x%lx, expected at least 0x%lx 0x%lu entries, 0x%lx free bytes pivot 0x%lx, epires in %d, direction %d empty 0x%lx - 0x%lx free (0x%lx bytes) contains pivot %d (0x%lx) %s: entry was not in tree%s: duplicate insertion: state %p inserting entry %p which collides with %p%s: duplicate insertion: state %p interting %p, colliding with %puvm_addr_invoke: address selector %p (%s 0x%lx-0x%lx) returned unavailable address 0x%lxuaddruaddrhintuaddrbestuaddrpivotuaddrrnduaddr_linuaddr_rnduaddr_hintuaddr_kbootstrapuaddr_bestfituaddr_pivotuaddr_stckbrkamap_unadd: offset out of rangeamap_unadd: nothing thereamap_lookup: offset out of rangeamap_add: offset out of rangeamap_add: replacing null anonamap_add: slot in useamap_lookups: offset out of rangeamap_splitref: split at zero offsetamap_splitref: map size check failedamap_cow_now: non-resident wired page in anon %pcownowcownowpageamap_wipeout: corrupt amapamapplamap_pp_adjref: overshot targetamap_pp_adjref: negative reference countanonpluao_set_swslot: uobj = %p uao_set_swslot: attempt to set a slot on a NOSWAP objectuao_flush: strange, got an out of range flush (fixed) uaoflshuao_flush: weird flagsuao_detuaoeltplaobjpluao_create: kernel object already allocateduao_create: asked to enable swap on kernel objectuao_create: hashinit swhash faileduao_create: malloc swslots faileduao_getpageuao_getudv_faultudv_detachudv_attachuvm_fault_unwire_locked: address not in mapanonget1anonget2flt_noram1fltamapcopyflt_noram2flt_noram3flt_pmfail1fltagain2flt_noram4flt_noram5flt_pmfail2uvm_init: page size not setkm_free: unmanaged page 0x%lx km_allocvakmallockmthreadvallocwaitkm_alloc1wkm_pgrmuvm_km_suballoc: unable to allocate space in parent mapuvm_km_suballoc: unable to create submapuvm_km_suballoc: submap allocation faileduvm_km_init: could not reserve space for kerneluvm_km_pgremove_intrsafe: no pageuvm_map_clean: weird flagsuvm_mapent_addr_removeuvm_mapent_addr_insert: entry still in addr listuvm_mapent_addr_insert: map %p entry %p (0x%lx-0x%lx G=0x%lx F=0x%lx) insert collision with entry %p (0x%lx-0x%lx G=0x%lx F=0x%lx)OBJECT %p: pgops=%p, npages=%d, refs= refs=%d PAGES : <%p,0x%llx> PAGE %p: flags=%b, vers=%d, wire_count=%d, pa=0x%llx uobject=%p, uanon=%p, offset=0x%llx loan_count=%d [page ownership tracking disabled] vm_page_md %p >>> ANON DOES NOT POINT HERE <<< (%p) anon backpointer is OK checking object list page found on object list >>> PAGE NOT FOUND ON OBJECT LIST! <<< page found in uvm_pmemrange >>> page not found in uvm_pmemrange <<< checking pageq list page found on pageq list >>> PAGE NOT FOUND ON PAGEQ LIST! <<< MAP %p: [0x%lx->0x%lx] brk() allocate range: 0x%lx-0x%lx stack allocate range: 0x%lx-0x%lx sz=%u, ref=%d, version=%u, flags=0x%x pmap=%p(resident=%d) vm_refcnt=%d vm_shm=%p vm_rssize=%u vm_swrss=%u vm_tsize=%u vm_dsize=%u vm_taddr=%p vm_daddr=%p vm_maxsaddr=%p vm_minsaddr=%p - %p: 0x%lx->0x%lx: obj=%p/0x%llx, amap=%p/%d submap=%c, cow=%c, nc=%c, prot(max)=%d/%d, inh=%d, wc=%d, adv=%d hole=%c, free=%c, guard=0x%lx, free=0x%lx-0x%lx fspace_augment=%lu freemapped=%c, uaddr=%p (0x%lx-0x%lx %s) any[%d]brk/stackvmspplvmmpeplvmmpekpluvm_map_splitentry: split address 0x%lx not on page boundary!uvm_mapent_alloc: cannot allocate map entryuvm_mapent_alloc: out of static map entries vmmaplkuvm_map_setup: rw_enter failed on new mapuvm_map_teardown: rw_enter failed on free mapuvmspace_fork: no space in map for entry in empty mapfork: encountered a submap during fork (illegal)fork: non-copy_on_write map entry marked needs_copy (illegal)uvm_page_physget: called _after_ bootstrapuvm_page_physget: out of memory!uvm_setpagesize: page size not a power of twouvm_pglistallocuvm_pglistalloc: Upper boundary 0x%lx not on pagemask. uvm_page_physdump: physical memory config [segs=%d of %d]: 0x%llx->0x%llx [0x%llx->0x%llx] STRATEGY = RANDOM uvm_page_physload: unable to load physical memory segment %d segments allocated, ignoring 0x%llx -> 0x%llx increase VM_PHYSSEG_MAX uvm_page_physload: can not malloc vm_page structs for segment ignoring 0x%lx -> 0x%lx uvm_page_physload: tried to add RAM after vm_mem_inituvm_pageboot_alloc: out of virtual spaceuvm_pageboot_alloc: pmap_growkernel() faileduvm_pageboot_alloc: out of memoryuvm_page_bootstrap: no memory pre-allocateduvm_page_init: lost %ld page(s) in initsize 0 uvm_pagereallocpagersegpgdaemonuvm_wait emergency bufbackoff pagedaemon: deadlock detected! Ranges, use queue: * [0x%lx-0x%lx] use=%d nsegs=%ld maxsegsz[%d]=0x%lx free=0x%lx #ranges = %d pagedaemon: wait_pla deadlock detected! pmrwaituvm_wait: failed to free %ld pages between 0x%lx-0x%lx uvm_pmr_split: lost one pmr Flags: 0x%x, will panic now. Current UVM status: pagesize=%d (0x%x), pagemask=0x%x, pageshift=%d %d VM pages: %d active, %d inactive, %d wired, %d free min %d%% (%d) anon, %d%% (%d) vnode, %d%% (%d) vtext pages %d anon, %d vnode, %d vtext freemin=%d, free-target=%d, inactive-target=%d, wired-max=%d faults=%d, traps=%d, intrs=%d, ctxswitch=%d fpuswitch=%d softint=%d, syscalls=%d, kmapent=%d fault counts: noram=%d, noanon=%d, pgwait=%d, pgrele=%d ok relocks(total)=%d(%d), anget(retries)=%d(%d), amapcopy=%d neighbor anon/obj pg=%d/%d, gets(lock/unlock)=%d/%d cases: anon=%d, anoncow=%d, obj=%d, prcopy=%d, przero=%d daemon and swap counts: woke=%d, revs=%d, scans=%d, obscans=%d, anscans=%d busy=%d, freed=%d, reactivate=%d, deactivate=%d pageouts=%d, pending=%d, nswget=%d nswapdev=%d, nanon=%d, nanonneeded=%d nfreeanon=%d swpages=%d, swpginuse=%d, swpgonly=%d paging=%d kernel pointers: objs(kern)=%p warning: resource shortage: %d pages of swap lost swapdrum_addsw_reg_strategy: swap to sparse fileswstrategy: vnode type 0x%xswap_off: swapdev not in listswap0x%04xdisklabel reserve/dev/%s%d%cblkdev0x%xswapctl: copystruvm_swap_init: can't get vnode for swap deviceswapmapuvm_swap_init: extent_create failedswp vnxswp vndswplkuvm_coredump: user process with submap?sbrk: grow %ld failed, error = %d uvm_deallocate with null mapuvn_iosyncuvn_getpageuvn_getuvn_cluster: offset out of rangeuvn_flshuvn_flush: obj=%p, offset=0x%llx. error during pageout. uvn_flush: WARNING: changes to page may be lost! uvn_flushuvn_termuvm_vnp_terminate: io sync wanted bit setuvn_attachuvnsyncNULL pointer passed to ip_ecn_egressNULL pointer passed to ip_ecn_ingressin6_prefixlen2mask: invalid prefix length(%d) in6_are_prefix_equal: invalid prefix length(%d) in6_unlink_ifa: interface address %s has no prefix in6_purgeaddr: failed to remove a route to the p2p destination: %s on %s, errno=%d in6_update_ifa: a destination can be specified for a p2p or a loopback IF only in6_update_ifa: prefixlen should be 128 when dstaddr is specified in6_update_ifa: valid lifetime is 0 for %s in6_update_ifa: the prefix length of an existing (%s) address should not be changed in6_update_ifa: failed to remove a route to the old destination: %s in6_update_ifa: addmulti failed for %s on %s (errno=%d) prefix ioctls are now invalidated. please use ifconfig. nd6_prelist_add succeeded but no prefix invalid argument to in6_lifaddr_ioctlin6_ifawithscope: output interface is not specified in6_ifattach_loopback: failed to configure the loopback address on %s (errno=%d) %s: got interface identifier from itself %s: borrow interface identifier from %s %s: interface identifier generated by random number %s: failed to get interface identifier %s: ifid: %02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x %s: no ifid available in6_ifattach_linklocal: failed to configure a link-local address on %s (errno=%d) in6_ifattach: %s has too small MTU, IPv6 not enabled in6_ifattach: %s is not multicast capable, IPv6 not enabled in6_cksum: mbuf len (%d) < off+len (%d+%d)in6_cksum: out of datainternet6icmp6_redirect_timeout: bad route to timeouticmp6_mtudisc_timeout: bad route to timeout(src=%s dst=%s tgt=%s)ICMP6 redirect sent from %s rejected; must be from linklocal ICMP6 redirect sent from %s rejected; hlim=%d (must be 255) ICMP6 redirect rejected; redirect dst must be unicast: %s ICMP6 redirect rejected; no route with inet6 gateway found for redirect dst: %s ICMP6 redirect rejected; not equal to gw-for-src=%s (must be same): %s ICMP6 redirect rejected; no route found for redirect dst: %s ICMP6 redirect rejected; neither router case nor onlink case: %s icmp6_redirect_input: invalid ND option, rejected: %s icmp6_redirect_input: lladdrlen mismatch for %s (if %d, icmp6 packet %d): %s icmp6_notify_error: in6_embedscope failed sanity fail: off=%lx, sizeof(ip6)=%lx in %s:%d ../../../../netinet6/icmp6.cicmp6_reflect: source can't be determined: dst=%s, error=%d ICMP6 checksum error(%d|%x) %s icmp6_input: unknown type %d(src=%s, dst=%s, ifid=%d) ENOBUFS in icmp6_error %d icmp6_mtudisc_callback_registerip6_nexthdr: m == NULLip6_input: packet to an unready address %s->%s ip6_initcannot forward from %s to %s nxt %d received on %s cannot forward src %s, dst %s, nxt %d, rcvif %s, outif %s assumption failed: hdr not splitscope error in prefix list (%s) ndopts == NULL in nd6_optionuninitialized ndopts in nd6_optionndopts == NULL in nd6_optionsuninitialized ndopts in nd6_optionsduplicated ND6 option found (type=%d) nd6_options: unsupported option %d - option ignored too many loop in nd opt unspecnd6_lookup: failed to lookup %s (if = %s) nd6_output: can't allocate llinfo for %s (ln=%p, rt=%p) nd6_setmtu0: new link MTU on %s (%lu) is too small for IPv6 nd6_init called more than once(ignored) ln->ln_rt == NULLln->ln_rt->rt_ifp == NULLrt_llinfo(%p) is not equal to ln(%p)dst=0 in nd6_timer(ln=%p)nd6_storelladdr: something odd happens nd6_storelladdr: sdl_alen == 0, dst=%s, if=%s ifp == NULL in nd6_cache_lladdrfrom == NULL in nd6_cache_lladdrndp info overwritten for %s by %s on %s %s: failed to join %s (errno=%d) nd6_dad_duplicated: DAD structure not found %s: DAD detected duplicate IPv6 address %s: NS in/out=%d/%d, NA in=%d %s: DAD complete for %s - duplicate found %s: manual intervention required ifa == NULL in nd6_dad_na_inputifa == NULL in nd6_dad_ns_inputnd6_na_output: source can't be determined: dst=%s, error=%d nd6_ns_output: source can't be determined: dst=%s, error=%d nd6_dad_timer: called with null parameter nd6_dad_timer: DAD structure not found ???nd6_dad_timer: called with duplicated address %s(%s) nd6_dad_timer: called with non-tentative address %s(%s) %s: could not run DAD, driver problem? %s: DAD complete for %s - no duplicates found nd6_dad_start: called with non-tentative address %s(%s) nd6_dad_start: ifa->ifa_ifp == NULLnd6_dad_start: memory allocation failed for %s(%s) %s: starting DAD for %s nd6_ns_input: invalid hlim (%d) from %s to %s on %s nd6_ns_input: bad DAD packet (wrong ip6 dst) nd6_ns_input: NS packet from non-neighbor nd6_ns_input: bad NS target (multicast) nd6_ns_input: invalid ND option, ignored nd6_ns_input: bad DAD packet (link-layer address option) nd6_ns_input: lladdrlen mismatch for %s (if %d, NS packet %d) nd6_ns_input: duplicate IP6 address %s nd6_ns_input: src=%s nd6_ns_input: dst=%s nd6_ns_input: tgt=%s nd6_na_input: invalid hlim (%d) from %s to %s on %s nd6_na_input: invalid target address %s nd6_na_input: a solicited adv is multicasted nd6_na_input: invalid ND option, ignored nd6_na_input: multicast adv without TLLA nd6_na_input: duplicate IP6 address %s nd6_na_input: ND packet from non-neighbor nd6_na_input: lladdrlen mismatch for %s (if %d, NA packet %d) in6_init_prefix_ltimes: preferred lifetime(%d) is greater than valid lifetime(%d) in6_ifadd: wrong prefixlen for %s (prefix=%d ifid=%d) in6_ifadd: failed to make ifaddr %s on %s (errno=%d) nd6_prefix_onlink: %s/%d is already on-link nd6_prefix_onlink: failed to find any ifaddr to add route for a prefix(%s/%d) on %s nd6_prefix_onlink: failed to add route for a prefix (%s/%d) on %s, gw=%s, mask=%s, flags=%lx errno = %d nd6_prefix_offlink: %s/%d is already off-link nd6_prefix_offlink: failed to recover a prefix %s/%d from %s to %s (errno = %d) nd6_prefix_offlink: failed to delete route: %s/%d on %s (errno = %d) pfxlist_onlink_check: failed to make %s/%d offlink, errno=%d prelist_remove: failed to make %s/%d offlink on %s, errno=%d prelist_remove: negative count on %s nd6_prelist_add: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_update: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_update: nd6_prelist_add failed for %s/%d on %s errno=%d, returnpr=%p defrouter_select: called unexpectedly (forwarding=%d) defrouter_select: more than one router is installed defrtrlist_del: negative count on %s nd6_ra_input: invalid hlim (%d) from %s to %s on %s nd6_ra_input: src %s is not link-local nd6_ra_input: invalid ND option, ignored nd6_ra_input: invalid option len %d for prefix information option, ignored nd6_ra_input: invalid prefix len %d for prefix information option, ignored nd6_ra_input: invalid prefix %s, ignored nd6_ra_input: invalid prefixlen %d for rfc2374 prefix %s, ignored nd6_ra_input: bogus mtu option mtu=%lu sent from %s, ignoring nd6_ra_input: bogus mtu mtu=%lu sent from %s; exceeds maxmtu %lu, ignoring nd6_ra_input: lladdrlen mismatch for %s (if %d, RA packet %d) nd6_rs_input: invalid hlim (%d) from %s to %s on %s nd6_rs_input: invalid ND option, ignored nd6_rs_input: lladdrlen mismatch for %s (if %d, RS packet %d) rip6_attachrip6_detachrip6_usrreq invalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect header checkunknown compression methodinvalid window sizeunknown header flags setheader crc mismatchincorrect data checkincorrect length checkneed dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible versiondb_fetch_reg: botchaddress %p is invalid branch_taken: botch address 0x%08lx not a valid page Faulted in DDB; continuing... spsrr0r1r2r3r4r5r6r7r8r9r10r11r12usr_spusr_lrsvc_spsvc_lrpcund_spabt_spirq_spframetrace: pid %d not found at %p scp=0x%08x rlv=0x%08x () rsp=0x%08x rfp=0x%08x%sr%d=0x%08xBad frame pointer: %p Bad user frame pointer: %p frame address must be specified frame address = %08x r0 =%08lx r1 =%08lx r2 =%08lx r3 =%08lx r4 =%08lx r5 =%08lx r6 =%08lx r7 =%08lx r8 =%08lx r9 =%08lx r10=%08lx r11=%08lx r12=%08lx r13=%08lx r14=%08lx r15=%08lx slr=%08lx mainbuscpu, rrx, %s r%d, %s #%d#0x%08x[r%d][r%d%s, #0x%03x#0x%02x{, r%d-r%d}^f%d#%s0x%08xcpsr_p%df%d, c%d, c%d, c%d, c%d, %dr%d, c%d, c%d, %d[%c - unknown]und%s %08x 0x%08lximbimbrangeswiblxblmulSnmsmlaSnmsdumullSdnmssmullumlalsmlalstrtdaWldrtstrbtldrbtdsbisbstrldrstrbldrbstmYnWlldmXnWlldrsbldrhstrhldrshswpdmoswpbmrsdpnopyieldwfewfisevdbgmsrpFmpF2bxclzdmbkptSdn2eorsubrsbadcsbcrsctstDn2teqcmpcmnorrmovSd2bicmvnadfPRfghmufsufrsfdvfrdfpowrpwrmffmlfdvfrdpolfpbopmvfPRfhmnfrndsqtlgnexpsincostanasnacsatnfpuopstfQLvldffltPRgdfixPRdhwfsrfswfcrfccmfPRghcnfcmfecnfemcr2#zmcrmrc2mrccdp2#ycdpldc2L#vldcstc2stcNo support for this CPU type (%08x) in kernelUndefined instruction in kernel real mem = %lu (%luMB) avail mem = %lu (%luMB) Warning IRQ's disabled during boot() WARNING: not updating battery clock _bus_dmamap_load_raw: not implemented_bus_dmamem_map: size botch_bus_dmamap_sync: mix PRE and POST%s: curaddr %#lx not in range_bus_dmamap_sync: ARM32_BUFTYPE_INVALIDunknown buffer type %d _bus_dmamap_syncProcessor failed probe - no CPU ID %s %s (%s core)%s: IDC disabled IDC enabled DC disabled DC enabled IC disabled IC enabled WB disabled WB enabled LABT EABT branch prediction enabled%s: %dKB/%dB %d-way %s unified cache %s: %dKB(%db/l,%dway) I-cache, %dKB(%db/l,%dway) %s D-cache %s: %s does not fully support this CPU. %s: This kernel does not fully support this CPU. %s: Recompile with "options %s" to correct this. unknown CPU (ID = 0x%x)ARM810ARM920TARM922TARM926EJ-SARM940TARM946E-SARM966E-STI ARM925TARM1020EARM1022E-SSA-110SA-1100SA-1110IXP1200i80200i80321 400MHzi80321 600MHzi80219 400MHzi80219 600MHzPXA250PXA210PXA27xIXP425 533MHzIXP425 400MHzIXP425 266MHzARM1136J-SARM1136J-S R1ARM Cortex A5ARM Cortex A7ARM Cortex A8ARM Cortex A8 R1ARM Cortex A8 R2ARM Cortex A8 R3ARM Cortex A9ARM Cortex A9 R1ARM Cortex A9 R2ARM Cortex A9 R3ARM Cortex A9 R4ARM Cortex A15ARM Cortex A15 R1ARM Cortex A15 R2ARM Cortex A15 R3ARM Cortex A15 R4CPU_ARM8ARM9TDMIARM9E-SCPU_ARM9EARM9EJ-SARM10ECPU_ARM10SA-1CPU_SA1100XScaleCPU_XSCALE_...ARM11JCPU_ARM11CPU_ARMv7wr-thruwr-back**unknown 3****unknown 4**wr-back-lockwr-back-lock-Awr-back-lock-B**unknown 8****unknown 9****unknown 10****unknown 11****unknown 12****unknown 13****unknown 14****unknown 15**rev 0rev 1rev 2rev 3rev 4rev 5rev 6rev 7rev 8rev 9rev 10rev 11rev 12rev 13rev 14rev 15step Jstep Kstep Sstep Tstep Bstep Cstep Dstep Erev 10step Gstep A-0step B-0step B-1step B-2step B-3step B-4step B-5(IXP1200 step A)(IXP1200 step B)(IXP1200 step C)(IXP1200 step D)(IXP1240/1250 step A)(IXP1240 step B)(IXP1250 step B)step A-1step C-0step D-0step ?step C-5step 0badaddr: invalid size (%lu)kernelFatal %s mode data abort: '%s' trapframe: %p DFSR=%08x, DFAR=%08x (imprecise), spsr=%08lx Fatal %s mode prefetch abort at 0x%08lx trapframe: %p IFSR=%08x, IFAR=%08x, spsr=%08lx r0 =%08lx, r1 =%08lx, r2 =%08lx, r3 =%08lx r4 =%08lx, r5 =%08lx, r6 =%08lx, r7 =%08lx r8 =%08lx, r9 =%08lx, r10=%08lx, r11=%08lx r12=%08lx, usp=%08lx, ulr=%08lxssp=%08lx, slr=%08lx, pc =%08lx Fatal abortUVM: pid %d (%s), uid %d killed: out of swap data_abort_fault: Misaligned Kernel-mode Program Counter Non-emulated page fault with intr_depth > 0 uvm_fault(%p, %lx, %x, 0) -> %x Vector ExceptionAlignment Fault 1Terminal ExceptionAlignment Fault 3External Linefetch Abort (S)Translation Fault (S)External Linefetch Abort (P)Translation Fault (P)External Non-Linefetch Abort (S)Domain Fault (S)External Non-Linefetch Abort (P)Domain Fault (P)External Translation Abort (L1)Permission Fault (S)External Translation Abort (L2)Permission Fault (P)mmrwpmap_map_chunk: no L1 table providedpmap_map_chunk: no L2 table for VA 0x%08lxpmap_map_chunk: can't find L2 table for VA0x%08lxpmap_alloc_specials: no l2b for 0x%lxpmap_bootstrap: No L2 for L2 @ va %ppmap_init_l1: can't get PA of L1 at %ppmap_bootstrap: No L2 for va 0x%x, pa 0x%lxpmap_bootstrap: out of static L2spmap_bootstrap: WARNING! wrong cache mode for L2 pte @ %p pmap_bootstrap: WARNING! wrong cache mode for primary L1 @ 0x%lx pmapplpvepll2dtblpll2ptpplxscale_setup_minidata: can't find L2 table for VA 0x%08lxpmap_map_entry: no L2 table for VA 0x%08lxpmap_map_entry: can't find L2 table for VA 0x%08lxCannot allocate L1 KVMCannot allocate L1 physical pagespmap_enter: failed to allocate L2 bucketpmap_enter: no pv entries dump to dev %u,%u not possible dumping to dev %u,%u offset %ld dump area unavailable device bad device not ready area improper i/o error aborted from console succeeded vunmapbufvmapbufcan't init serial console @%lxunknown option `%c' cpu not recognized! OpenBSD/armish booting ... initarm: Configuring system ... physmemory: %d pages at 0x%08lx -> 0x%08lx initarm: out of memoryinitarm: Failed to align the kernel page directoryWARNING: powerdown failed! The operating system has halted. Please press any key to reboot. rebooting... boot device: lookup '%s' failed. boot device: %s cdDiagnostic Failure on Component 0x%02xTagged Overlapped Commands (0x%02x = TASK TAG)Decompression Exception Short Algorithm ID OF 0x%02xASC 0x%02x ASCQ 0x%02xCDBParametersError in %s, Offset %d, bit %dActual Retry Count: %dProgress Indicator: %dprobe%s(%s:%d:%d): %sCheck Condition (error %#x) on opcode 0x%x AT BLOCK #: %d (decimal) SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Set INFO: 0x%x (VALID flag %s) COMMAND INFO: 0x%x ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s DEFERRED scbusyunknown error category (0x%x) from scsi driver scsi_done called twice on xs(%p)unexpected xsh state %usyncxspendxsscsiiomvscsi_xfer pool exhausted! scxsplscsiplugscsi_cmd_rw_decode: bad opcode 0x%02xNo Additional SenseSoft ErrorNot ReadyMedia ErrorHardware ErrorIllegal RequestUnit AttentionWrite ProtectedBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare ErrorNo Additional Sense InformationFilemark DetectedEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnCleaning RequestedErase Operation In ProgressLocate Operation In ProgressRewind Operation In ProgressSet Capacity Operation In ProgressVerify Operation In ProgressNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Not Ready, Rebuild In ProgressLogical Unit Not Ready, Recalculation In ProgressLogical Unit Not Ready, Operation In ProgressLogical Unit Not Ready, Long Write In ProgressLogical Unit Not Ready, Self-Test In ProgressLogical Unit Not Accessible, Asymmetric Access State TransitionLogical Unit Not Accessible, Target Port In Standby StateLogical Unit Not Accessible, Target Port In Unavailable StateLogical Unit Not Ready, Structure Check RequiredLogical Unit Not Ready, Auxiliary Memory Not AccessibleLogical Unit Not Ready, Notify (Enable Spinup) RequiredLogical Unit Not Ready, OfflineLogical Unit Not Ready, SA Creation In ProgressLogical Unit Not Ready, Space Allocation In ProgressLogical Unit Not Ready, Robotics DisabledLogical Unit Not Ready, Configuration RequiredLogical Unit Not Ready, Calibration RequiredLogical Unit Not Ready, A Door Is OpenLogical Unit Not Ready, Operating In Sequential ModeLogical Unit Not Ready, Start Stop Unit Command In ProgressLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorLogical Unit Communication CRC Error (ULTRA-DMA/32)Unreachable Copy TargetTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureHead Select FaultError Log OverflowWarningWarning - Specified Temperature ExceededWarning - Enclosure DegradedWarning - Background Self-Test FailedWarning - Background Pre-Scan Detected Medium ErrorWarning - Background Medium Scan Detected Medium ErrorWarning - Non-Volatile Cache Now VolatileWarning - Degraded Power To Non-Volatile CacheWarning - Power Loss ExpectedWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedWrite Error - Recommend ReassignmentCompression Check Miscompare ErrorData Expansion Occurred During CompressionBlock Not CompressibleWrite Error - Recovery NeededWrite Error - Recovery FailedWrite Error - Loss Of StreamingWrite Error - Padding Blocks AddedAuxiliary Memory Write ErrorWrite Error - Unexpected Unsolicited DataWrite Error - Not Enough Unsolicited DataDefects In Error WindowError Detected By Third Party Temporary InitiatorThird Party Device FailureCopy Target Device Not ReachableIncorrect Copy Target Device TypeCopy Target Device Data UnderrunCopy Target Device Data OverrunInvalid Information UnitInformation Unit Too ShortInformation Unit Too LongID CRC Or ECC ErrorLogical Block Guard Check FailedLogical Block Application Tag Check FailedLogical Block Reference Tag Check FailedLogical Block Protection Error On Recover Buffered DataLogical Block Protection Method ErrorUnrecovered Read ErrorRead Retries ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block ReadNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite The DataDe-Compression CRC ErrorCannot Decompress Using Declared AlgorithmError Reading UPC/EAN NumberError Reading ISRC NumberRead Error - Loss Of StreamingAuxiliary Memory Read ErrorRead Error - Failed Retransmission RequestRead Error - LBA Marked Bad By Application ClientAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRecord Not Found - Recommend ReassignmentRecord Not Found - Data Auto-ReallocatedLocate Operation FailureRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorData Sync Error - Data RewrittenData Sync Error - Recommend RewriteData Sync Error - Data Auto-ReallocatedData Sync Error - Recommend ReassignmentRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data Without ECC - Data RewrittenRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With L-ECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteRecovered Data With ECC - Data RewrittenRecovered Data With LinkingDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationMiscompare Verify Of Unmapped LbaRecovered ID with ECCPartial Defect List TransferInvalid Command Operation CodeAccess Denied - Initiator Pending-EnrolledAccess Denied - No Access rightsAccess Denied - Invalid Mgmt ID KeyIllegal Command While In Write Capable StateObsoleteIllegal Command While In Explicit Address ModeIllegal Command While In Implicit Address ModeAccess Denied - Enrollment ConflictAccess Denied - Invalid LU IdentifierAccess Denied - Invalid Proxy TokenAccess Denied - ACL LUN ConflictIllegal Command When Not In Append-Only ModeLogical Block Address Out of RangeInvalid Element AddressInvalid Address For WriteInvalid Write Crossing Layer JumpIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBCDB Decryption ErrorSecurity Audit Value FrozenSecurity Working Key FrozenNonce Not UniqueNonce Timestamp Out Of RangeInvalid XCDBLogical Unit Not SupportedInvalid Field In Parameter ListThreshold Parameters Not SupportedInvalid Release Of Persistent ReservationData Decryption ErrorToo Many Target DescriptorsUnsupported Target Descriptor Type CodeToo Many Segment DescriptorsUnsupported Segment Descriptor Type CodeUnexpected Inexact SegmentInline Data Length ExceededInvalid Operation For Copy Source Or DestinationCopy Segment Granularity ViolationInvalid Parameter While Port Is EnabledInvalid Data-Out Buffer Integrity Check ValueData Decryption Key Fail Limit ReachedIncomplete Key-Associated Data SetVendor Specific Key Reference Not FoundHardware Write ProtectedLogical Unit Software Write ProtectedAssociated Write ProtectPersistent Write ProtectPermanent Write ProtectConditional Write ProtectSpace Allocation Failed Write ProtectNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedFormat-Layer May Have ChangedImport/Export Element Accessed, Medium ChangedPower On, Reset, or Bus Device Reset OccurredPower On OccurredSCSI Bus Reset OccurredBus Device Reset Function OccurredDevice Internal ResetTransceiver Mode Changed to Single EndedTransceiver Mode Changed to LVDI_T Nexus Loss OccurredMode Parameters ChangedLog Parameters ChangedReservations PreemptedReservations ReleasedRegistrations PreemptedAsymmetric Access State ChangedImplicit Asymmetric Access State Transition FailedPriority ChangedCapacity Data Has ChangedError History I_T Nexus ClearedError History Snapshot ReleasedError Recovery Attributes Have ChangedData Encryption Capabilities ChangedTimestamp ChangedData Encryption Parameters Changed By Another I_T NexusData Encryption Parameters Changed By Vendor Specific EventData Encryption Key Instance Counter Has ChangedSA Creation Capabilities Data Has ChangedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedCurrent Program Area Is Not EmptyCurrent Program Area Is EmptyIllegal Power Condition RequestPersistent Prevent ConflictPrevious Busy StatusPrevious Task Set Full StatusPrevious Reservation Conflict StatusPartition Or Collection Contains User ObjectsNot ReservedORWrite Generation Does Not MatchOverwrite Error On Update In PlaceInsufficient Time For OperationCommands Cleared By Another InitiatorCommands Cleared By Power Loss NotificationCommands Cleared By Device ServerIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledCannot Write Medium - Unknown FormatCannot Write Medium - Incompatible FormatCannot Format Medium - Incompatible MediumCleaning FailureCannot Write - Application Code MismatchCurrent Session Not Fixated For AppendCleaning Request RejectedMedium Not FormattedIncompatible Volume TypeIncompatible Volume QualifierCleaning Volume ExpiredMedium Format CorruptedFormat Command FailedZoned Formatting Failed Due To Spare LinkingNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorEnclosure FailureEnclosure Services FailureUnsupported Enclosure FunctionEnclosure Services UnavailableEnclosure Services Transfer FailureEnclosure Services Transfer RefusedRibbon, Ink, or Toner FailureRounded ParameterEvent Status NotificationESN - Power Management Class EventESN - Media Class EventESN - Device Busy Class EventSaving Parameters Not SupportedMedium Not PresentMedium Not Present - Tray ClosedMedium Not Present - Tray OpenMedium Not Present - LoadableMedium Not Present - Medium Auxiliary Memory AccessibleSequential Positioning ErrorTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyEnd Of Medium ReachedMedium Magazine Not AccessibleMedium Magazine RemovedMedium Magazine InsertedMedium Magazine LockedMedium Magazine UnlockedMechanical Positioning Or Changer ErrorRead Past End Of User ObjectElement DisabledElement EnabledData Transfer Device RemovedData Transfer Device InsertedInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetLogical Unit FailureTimeout On Logical UnitLogical Unit Failed Self-TestLogical Unit Unable To Update Self-Test LogTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has Changedcomponent Device AttachedDevice Identifier ChangedRedundancy Group Created Or ModifiedRedundancy Group DeletedSpare Created Or ModifiedSpare DeletedVolume Set Created Or ModifiedVolume Set DeletedVolume Set DeassignedVolume Set ReassignedReported LUNs Data Has ChangedEcho Buffer OverwrittenMedium LoadableMedium Auxiliary Memory AccessibleiSCSI IP Address AddediSCSI IP Address RemovediSCSI IP Address ChangedRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureATA Device Failed Set FeaturesSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorData Phase CRC Error DetectedSCSI Parity Error Detected During ST Data PhaseInformation Unit iuCRC Error DetectedAsynchronous Information Protection Error DetectedProtocol Service CRC ErrorPHY Test Function In ProgressSome Commands Cleared By iSCSI Protocol EventInitiator Detected Error Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorInvalid Target Port Transfer Tag ReceivedToo Much Write DataACK/NAK TimeoutNAK ReceivedData Offset ErrorInitiator Response TimeoutConnection LostLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureErase Failure - Incomplete Erase Operation DetectedCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedMedium Removal Prevented By Data Transfer ElementMedium Thread Or Unthread FailureVolume Identifier InvalidVolume Identifier MissingDuplicate Volume IdentifierElement Status UnknownSCSI To Host System Interface FailureSystem Resource FailureSystem Buffer FullInsufficient Reservation ResourcesInsufficient ResourcesInsufficient Registration ResourcesInsufficient Access Control ResourcesAuxiliary Memory Out Of SpaceQuota ErrorMaximum Number Of Supplemental Decryption Keys ExceededMedium Auxiliary Memory Not AccessibleData Currently UnavailableInsufficient Power For OperationUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change InputOperator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedFailure Prediction Threshold ExceededMedia Failure Prediction Threshold ExceededLogical Unit Failure Prediction Threshold ExceededSpare Area Exhaustion Prediction Threshold ExceededHardware Impending Failure General Hard Drive FailureHardware Impending Failure Drive Error Rate Too HighHardware Impending Failure Data Error Rate Too HighHardware Impending Failure Seek Error Rate Too HighHardware Impending Failure Too Many Block ReassignsHardware Impending Failure Access Times Too HighHardware Impending Failure Start Unit Times Too HighHardware Impending Failure Channel ParametricsHardware Impending Failure Controller DetectedHardware Impending Failure Throughput PerformanceHardware Impending Failure Seek Time PerformanceHardware Impending Failure Spin-Up Retry CountHardware Impending Failure Drive Calibration Retry CountController Impending Failure General Hard Drive FailureController Impending Failure Drive Error Rate Too HighController Impending Failure Data Error Rate Too HighController Impending Failure Seek Error Rate Too HighController Impending Failure Too Many Block ReassignsController Impending Failure Access Times Too HighController Impending Failure Start Unit Times Too HighController Impending Failure Channel ParametricsController Impending Failure Controller DetectedController Impending Failure Throughput PerformanceController Impending Failure Seek Time PerformanceController Impending Failure Spin-Up Retry CountController Impending Failure Drive Calibration Retry CountData Channel Impending Failure General Hard Drive FailureData Channel Impending Failure Drive Error Rate Too HighData Channel Impending Failure Data Error Rate Too HighData Channel Impending Failure Seek Error Rate Too HighData Channel Impending Failure Too Many Block ReassignsData Channel Impending Failure Access Times Too HighData Channel Impending Failure Start Unit Times Too HighData Channel Impending Failure Channel ParametricsData Channel Impending Failure Controller DetectedData Channel Impending Failure Throughput PerformanceData Channel Impending Failure Seek Time PerformanceData Channel Impending Failure Spin-Up Retry CountData Channel Impending Failure Drive Calibration Retry CountServo Impending Failure General Hard Drive FailureServo Impending Failure Drive Error Rate Too HighServo Impending Failure Data Error Rate Too HighServo Impending Failure Seek Error Rate Too HighServo Impending Failure Too Many Block ReassignsServo Impending Failure Access Times Too HighServo Impending Failure Start Unit Times Too HighServo Impending Failure Channel ParametricsServo Impending Failure Controller DetectedServo Impending Failure Throughput PerformanceServo Impending Failure Seek Time PerformanceServo Impending Failure Spin-Up Retry CountServo Impending Failure Drive Calibration Retry CountSpindle Impending Failure General Hard Drive FailureSpindle Impending Failure Drive Error Rate Too HighSpindle Impending Failure Data Error Rate Too HighSpindle Impending Failure Seek Error Rate Too HighSpindle Impending Failure Too Many Block ReassignsSpindle Impending Failure Access Times Too HighSpindle Impending Failure Start Unit Times Too HighSpindle Impending Failure Channel ParametricsSpindle Impending Failure Controller DetectedSpindle Impending Failure Throughput PerformanceSpindle Impending Failure Seek Time PerformanceSpindle Impending Failure Spin-Up Retry CountSpindle Impending Failure Drive Calibration Retry CountFirmware Impending Failure General Hard Drive FailureFirmware Impending Failure Drive Error Rate Too HighFirmware Impending Failure Data Error Rate Too HighFirmware Impending Failure Seek Error Rate Too HighFirmware Impending Failure Too Many Block ReassignsFirmware Impending Failure Access Times Too HighFirmware Impending Failure Start Unit Times Too HighFirmware Impending Failure Channel ParametricsFirmware Impending Failure Controller DetectedFirmware Impending Failure Throughput PerformanceFirmware Impending Failure Seek Time PerformanceFirmware Impending Failure Spin-Up Retry CountFirmware Impending Failure Drive Calibration Retry CountFailure Prediction Threshold Exceeded (false)Low Power Condition OnIdle Condition Activated By TimerStandby Condition Activated By TimerIdle Condition Activated By CommandStandby Condition Activated By CommandIDLE_B Condition Activated By TimerIDLE_B Condition Activated By CommandIDLE_C Condition Activated By TimerIDLE_C Condition Activated By CommandSTANDBY_Y Condition Activated By TimerSTANDBY_Y Condition Activated By CommandPower State Change To ActivePower State Change To IdlePower State Change To StandbyPower State Change To SleepPower State Change To Device ControlLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackPacket Does Not Fit In Available SpaceIllegal Mode For This TrackInvalid Packet SizeVoltage FaultAutomatic Document Feeder Cover UpAutomatic Document Feeder Lift UpDocument Jam In Automatic Document FeederDocument Miss Feed Automatic In Document FeederConfiguration FailureConfiguration Of Incapable Logical Units FailedAdd Logical Unit FailedModification Of Logical Unit FailedExchange Of Logical Unit FailedRemove Of Logical Unit FailedAttachment Of Logical Unit FailedCreation Of Logical Unit FailedAssign Failure OccurredMultiply Assigned Logical UnitSet Target Port Groups Command FailedATA Device Feature Not EnabledLogical Unit Not ConfiguredData Loss On Logical UnitMultiple Logical Unit FailuresParity/Data MismatchInformational, Refer To LogState Change Has OccurredRedundancy Level Got BetterRedundancy Level Got WorseRebuild Failure OccurredRecalculate Failure OccurredCommand To Logical Unit FailedCopy Protection Key Exchange Failure - Authentication FailureCopy Protection Key Exchange Failure - Key Not PresentCopy Protection Key Exchange Failure - Key Not EstablishedRead Of Scrambled Sector Without AuthenticationMedia Region Code Is Mismatched To Logical Unit RegionDrive Region Must Be Permanent/Region Reset Count ErrorDecompression Exception Long Algorithm IDSession Fixation ErrorSession Fixation Error Writing Lead-InSession Fixation Error Writing Lead-OutSession Fixation Error - Incomplete Track In SessionEmpty Or Partially Written Reserved TrackNo More Track Reservations AllowedRMZ Extension Is Not AllowedNo More Test Zone Extensions Are AllowedCD Control ErrorPower Calibration Area ErrorProgram Memory Area Update FailureProgram Memory Area Is FullRMA/PMA Is Almost FullCurrent Power Calibration Area Almost FullCurrent Power Calibration Area Is FullRDZ Is FullSecurity ErrorUnable To Decrypt DataUnencrypted Data Encountered While DecryptingIncorrect Data Encryption KeyCryptographic Integrity Validation FailedError Decrypting DataUnknown Signature Verification KeyEncryption Parameters Not UseableDigital Signature Validation FailureEncryption Mode Mismatch On ReadEncrypted Block Not Raw Read EnabledIncorrect Encryption ParametersUnable To Decrypt Parameter ListEncryption Algorithm DisabledSA Creation Parameter Value InvalidSA Creation Parameter Value RejectedInvalid SA UsageData Encryption Configuration PreventedSA Creation Parameter Not SupportedAuthentication FailedExternal Data Encryption Key Manager Access ErrorExternal Data Encryption Key Manager ErrorExternal Data Encryption Key Not FoundExternal Data Encryption Request Not AuthorizedExternal Data Encryption Control TimeoutExternal Data Encryption Control ErrorLogical Unit Access Not AuthorizedSecurity Conflict In Translated DeviceXS_SHORTSENSE scsibus at %sscsibusprint: qualifier == SID_QUAL_RSVDscsibusprint: qualifier == SID_QUAL_BAD_LUdirectsequentialprinterprocessorcdromwormscanneropticalchangercommunicationenclosure servicessimplified directscsibusprint: device type T_NODEVICEvendor-unique targ %d lun %d: <%s, %s, %s> ATAPISCSI%dremovablefixed %d/%s %s%s naa. eui. t10. serial. wwn.~ offline: %d targets, initiator %d, WWPN %016llx, WWNN %016llx%s: unable to register bio scsibusPLEXTORCD-ROM PX-40TS1.01MICROP 1588-15MBSUN0669DEC RZ55 (C) DECEMULEX MD21/S2 ESDIA00IBMRAID 0662SIBM 0663HIBM0664H3171-S2KZ-CDFRSS2FQUANTUM ELS85S iomegajaz 1GBMICROP4421-07SEAGATEST150176LW0002HPC3725SDCASSONY SDT-5000 3.WangDAT Model 1300 02.4Model 2600 01.7Model 3200 02.2CR-2801TE1.07CREATIVECD3630EAC101FX320Sq01GCD-R580B1.00MATSHITA CR-5741.021.06Memorex CRW-26421.0gSANYO CRD-256PSANYO CRD-254PSANYO CRD-S54P1.08CD-ROM CDR-S11.70CD-ROM CDR-N161.25UJDCD87301.14ATAPI CD-ROMSCSI CD-ROMNEC CD-ROM DRIVE:260SCSI opticalSCSI disk%s %s(unknown)%s: %lluMB, %lu bytes/sector, %llu sectors, thin, readonlysoftintr_establish: unknown soft IPL %d"%s" at %s addr 0x%xiiclm75alm75lm77eeprommax1617xeontemplm93lm81lm87adm9240adt7470adt7476adt7475adt7462adt7466adt7467adm1033adm1034adm1030adm1031adm1025adm1024adm1023adm1028adm1022thmc5047m192sch5027emc6w201asc7611asc7621ne1619ds1780adt7460adm1027lm85adt7516lm63lm86lm89lm89-1lm90gl523smadt7461adm1021adm1032g781g781-1max6690max6646max6657max6642tmp401sa56004xw83791sdw83627dhgw83792dw83781dw83627hfw83782das99127fw83783sw83791dw83l784rw83l785rw83l785ts-lf75375asb100gl518smadm1026se97max6604mcp9805mcp98242mcp98243adt7408stts2002cat34ts02ts3000b3lis331dlit8712lm96000emc6d100sch5017it8712f-amtp008w83795gw83793gstts424e02%s: addr 0x%x %02x=%02x words %02x=%04x: %s%s: ricohrtc_clock_write: failed to write rtc %s: ricohrtc_clock_read: failed to read rtc %s: ricohrtc_reg_write: failed to write reg%d : RICOH RS5C372[AB] Real-time Clock ricohrtc: F75375 rev %d.%dVcc, unable to register update task unable to read reg %d fintek: PCA9532 LED controller pcaledi80321_mem_bs_free(): not implementedi80321_mem_bs_alloc(): not implementedi80321_io_bs_free(): not implementedi80321_io_bs_alloc(): not implementedpciiopaauiopiiciopmuiopwdogi80321_intr_establish: IRQ %d out of rangei80321intcresettodr: failed to set time WARNING: preposterous time in file system WARNING: preposterous clock chip time lostgainedWARNING: clock %s %ld days WARNING: CHECK AND RESET THE DATE! clockstattcr1: I2C controller %s: unable to subregion registers, error = %d iopiiclkattempting reset %s: unable to map VERDE registers%s: unable to subregion MCU registers%s: unable to subregion ATU registers%s: unable to map IOW registers: i80321 I/O Processor %s: unable to map PLD registersiopxs%03d:%02d:%d %04x:%04x WARNING: unknown PCI device header. mem %02xh %s 0x%08x 0x%08x NGOK [%s] Resource conflict. No available resources. fixup failed pci_addr_fixup: fixup failed. (new address=%#lx) new address 0x%08lx PCI I/O memory spacePCI I/O port space[%s]----------------------- device vendor product register space address size -------------------------------------------- System BIOS Setting--------------------------[%3d devices bogus] PCIBIOS fixup stageirq %ldiq80321_pci_intr_map: no mapping for %d/%d/%d (%d, %d, %d) board id failed Thecus Nx100I/O Data HDL-GCertance CP3100 addr 0x%08lx intr %dobio_bs_free(): not implementedobio_bs_alloc(): not implemented: failed to map registers: %d %s: unable to establish interrupt at CPLD irq %d com_obio%s: standby command didn't complete %s: standby command timeout %s: standby command: drive fault %s: flush cache command didn't complete %s: flush cache command timeout %s: flush cache command: drive fault ST506wd_get_params: bad return code from ata_get_paramswddump: try againwddump: polled command has been queuedwddump: device timed outwddump: drive faultwddump: DMA errorwddump: %swddump: unknown error typeST506/MFM/RLLESDI/IDE disk__wdstart: bad return code from wdc_ata_bio()device faultdevice timeout, retrying %s: soft error (corrected) %s: IDENTIFY failed : <%s> %s: %d-sector PIO, LBA48, %lluMB, %llu sectors LBA, %lluMB, %llu sectors CHS, %lluMB, %d cyl, %d head, %d sec, %llu sectors %s: enable look ahead command didn't complete %s: enable write cache command didn't complete %s: freeze lock command didn't complete %s:%d:%d: bad state %d in _wdc_ata_bio_start _wdc_ata_bio_start: bad state%s:%d:%d: timeout waiting for DRQ, st=0x%b, err=0x%02x BSYDRDYDWFDSCDRQCORRIDXERR%s:%d:%d: not ready, st=0x%b, err=0x%02x wdc_ata_ctrl_intr: state==RECALpiomodedmamodegeometrysetmultirecal%s:%d:%d: %s timed out %s:%d:%d: %s drive fault error (%x) %s:%d:%d: bad state %d in wdc_ata_bio_intr wdc_ata_bio_intr: bad state%s:%d:%d: device timeout, c_bcount=%d, c_skip%d %s:%d:%d: intr with DRQ (st=0x%b) %s:%d:%d: read intr before drq error not notifiedno media/write protectedaborted commandmedia change requestedid not foundmedia changeduncorrectable data errorinterface CRC erroraddress mark not foundtrack 0 not foundbad block detectedwsevent_read%s: can't attach mux (error=%d) wskbd at %s%s: event queue overflow wskdetwskbd_detach: %s didn't detach mux %dcannot load keymap %s: cannot load keymap, falling back to default %s: console keyboard%s: attach error=%d wskbdwskbd_get_mapentry: %d(%d): bad entrywskbd_load_keymap: %d: recursion too deepwskbd_load_keymap: %d(%d): bad entry attach error=%dwsmouse at %swsmdetwsmouse_detach: %s didn't detach wsmousewsmux_getmux: no memory for mux %d wsmux: attach out of memory usb at %sendtaskusbatskusbtskunable to create usb abort task threadusbtaskunable to create usb task thread%s: root hub problem %s: root device is not a hub usbpalock: USB revision %s, not supported %s: can't register softintr pre 1.01.12.03.0usbusbd_desc_iter_next: bad descriptor usbd_desc_iter_next: descriptor length = 0 usbd_desc_iter_next: descriptor length too large usbd_start_next: error=%d usbd_transfer: not doneusbsynusbrefusbdetusb_detach_wait: %s didn't detach out of dataiface desc0 lengthusbd_fill_iface_data: bad descriptor(s): %s usbdly%s: device addr %d (config %d) exceeds power budget, %d mA > %d mA %s: port %d, set config at addr %d failed %s: No free USB addresses, new device ignored. usbd_new_device: cannot find HS port%x.%02xvendor 0x%04x"%s %s", class %d/%d rev / addr %d port %d configuration %d interface %dNORMAL_COMPLETIONIN_PROGRESSPENDING_REQUESTSNOT_STARTEDINVALNOMEMCANCELLEDBAD_ADDRESSIN_USENO_ADDRSET_ADDR_FAILEDNO_POWERTOO_DEEPIOERRORNOT_CONFIGUREDTIMEOUTSHORT_XFERSTALLEDINTERRUPTEDXXX%s: illegal enable change, port %d %s: port error, restarting port %d %s: port error, giving up port %d %s: strange, connected port %d has no power %s: port %d reset failed %s: device problem, disabling port %d %s: hub depth (%d) exceeded, hub ignored %s: no ports, hub ignored %s: bus powered hub connected to bus powered hub, ignored %s: no interface handle %s: no endpoint descriptor %s: bad interrupt endpoint %s: cannot open interrupt pipe %s: port %d power on failed, %s uhubucom at %s portno %d%s: lost %d chars %s: read start failed , %sucomlkucomugenri%s: secondary, not changing config to %d %s: setting configuration index 0 failed %s: setting configuration %d failed ugenuhidev_intr: bad repid %d uhid at %s reportid %d%s: could not read endpoint descriptor %s: unexpected endpoint %s: no input interrupt endpoint %s: no HID descriptor %s: no memory %s: no report descriptor %s: iclass %d/%d, %d report id%suhidevuhidrea: input=%d, output=%d, feature=%d uhidno usable key codes array%s: was console keyboard ukbd: %d button%s, Z dir, W dir, Z and W dir, tip, barrel, eraser %s: mouse has no X report %s: X report 0x%04x not supported %s: mouse has no Y report %s: Y report 0x%04x not supported ums%s: got polled xfer %p, but %p already pending %s: CBI bulk-in/out stall clear failed, %s %s: CBI intr-in stall clear failed, %s %s: CBI reset failed, %s %s: CBI bulk-in stall clear failed, %s %s: CBI bulk-out stall clear failed, %s %s: Unknown state %d%s: BBB bulk-%s stall clear failed, %s %s: Invalid CSW: sig 0x%08x should be 0x%08x %s: Invalid CSW: tag %d should be %d %s: Invalid CSW: status %d > %d %s: Phase Error, residue = %d %s: transferred %d bytes instead of %d bytes%s: BBB reset failed, %s %s: BBB bulk-in clear stall failed, %s %s: BBB bulk-out clear stall failed, %s Bulk-OnlyCBICBI with CCIISD-ATARBCSCSIUFI%s: using %s over %s %s: isdata not configured %s: command protocol=0x%x not supported %s: bus attach failed umass%s: Unknown status %d in umass_scsi_cbumass_cmd: large datalen, %d %04x%04x%s: failed to set configuration, err=%s : failed to get interface, err=%s %s: device is neither visor nor palm %s: init failed, %s GenericDebuggerHotSyncRemote File System%s: no proper endpoints for port %d (%d,%d) uvisor%s: open rx pipe failed: %s %s: open tx pipe failed: %s %s: open intr pipe failed: %s %s: aue_send error=%s %s: usb error on tx: %s %s: %u usb errors on intr: %s %s: no memory for rx list -- packet dropped! %s: %u usb errors on rx: %s %s: reset failed %s: close rx pipe failed: %s %s: close tx pipe failed: %s %s: close intr pipe failed: %s %s: tx list init failed %s: rx list init failed %s: MII read timed out %s: EEPROM read timed out %s: setting config no failed auemii%s: getting interface handle failed %s: couldn't get endpoint descriptor %d %s: missing endpoint %s: address %s aue%s: usb errors on rx: %s axe%d: close rx pipe failed: %s axe%d: close tx pipe failed: %s axe%d: close intr pipe failed: %s axe%d: usb error on tx: %s axe%d: watchdog timeout axe%d: rx list init failed axe%d: tx list init failed axe%d: open rx pipe failed: %s axe%d: open tx pipe failed: %s %s: media change failed axe%d: write PHY failed axe%d: read PHY failed axemii%s: couldn't get ep %d no valid PHY address found, assuming PHY address 0 AX88178 AX88772B AX88772 AX88172axerxeof: too large transfer invalid buffer(pkt#%d), continue checksum err (pkt#%d) axen%d: close rx pipe failed: %s axen%d: close tx pipe failed: %s axen%d: close intr pipe failed: %s axen%d: usb error on tx: %s axen%d: watchdog timeout axen%d: rx list init failed axen%d: tx list init failed axen%d: open rx pipe failed: %s axen%d: open tx pipe failed: %s axen%d: write PHY failed axen%d: read PHY failed enable auto detach (0x%04x) unknown uplink bus:0x%02x axenmii AX88178a AX88179axen%s: warning: Failed to write register 0x%0x %s: warning: Failed to read register 0x%0x %s: warning: failed to read SMSC_COE_CTRL (err=%d) %s: warning: failed to write SMSC_COE_CTRL (err=%d) %s: warning: failed to read initial AFC_CFG, error %d %s: warning: media change failed, error %d %s: warning: timed-out waiting for reset to complete %s: warning: timed-out waiting for phy reset to complete %s: warning: failed to set the MAC address %s: warning: failed to read HW_CFG: %d %s: warning: failed to read HW_CFG: (err = %d) %s: warning: failed to read ID_REV (err = %d) %s: warning: failed to read MAC_CSR (err=%d) %s: error: smsc_chip_init failed (err=%d) smscmii%s: warning: MII is busy %s: warning: MII write timeout %s: warning: MII read timeout smsc%s: cue_send error=%s %s: read MAC address failed cue%s: kue_send error=%s %s: warm boot, no firmware download kue%s: failed loadfirmware of file %s: errno %d %s: cold boot, downloading firmware %s: failed to load code segment: %s %s: failed to load fixup segment: %s %s: failed to load trigger segment: %s %s: loading firmware failed %s: could not read Ethernet descriptor %s: no memory for multicast filter buffer %s: usb error on rx: %s %s: too many errors, disabling %s: open interrupt pipe failed: %s %s: close interrupt pipe failed: %s extra ethernet descriptor %s: no data interface %s: no descriptor for interrupt endpoint %d %s: interface alternate setting %d failed %s: no descriptor for bulk endpoint %d %s: could not find data bulk in %s: could not find data bulk out cdce%s: udav_send error=%s udavmiiudav%s: upl_send error=%s upl%s: ugl_send error=%s %s: bad header (length=%d) %s: bad packet count (%d) %s: bad packet size(%d), length=%d ugl%s: url_send error=%s %s: %s: bad register %04x urlmii%s: failed to get interface, err=%s %s: couldn't get endpoint %d url%s: Invalid notification length! (%d) %s: close notify pipe failed: %s no %s: data interface %d, has %sCM over data, has %sbreak %s: no endpoint descriptor for %d %s: Could not find data bulk in %s: Could not find data bulk out %s: could not set data multiplex mode %s: status change notification available umodem%s: failed to set configuration, err=%s uftdi%s: failed to get configuration descriptor %s: failed to get device descriptor %s: failed to get interface, err=%s %s: Could not find interrupt in %s: failed to get second interface, err=%s %s: reset failed, %s uplcom %s: failed to set configuration, err=%s umct%s: uvscom_intr: abnormal status: %s %s: uvscom_set_line_coding: %s %s: uvscom_set_line: %s %s: uvscom_shutdown: %s %s: uvscom_readstat: %s %s: cannot open interrupt pipe (addr %d) uvsopuvscom%s: this device is using CDC notify message in intr pipe. Please send your dmesg to , thanks. %s: intr buffer 0x%x 0x%x 0x%x 0x%x 0x%x 0x%x 0x%x %s:notify serial state, len=%d, data=0x%02x %s: ubsa_request: %s %s: failed to set configuration: %s %s: failed to get interface: %s ubsa%s: unhandled set request: reg=%x onoff=%x %s: no proper endpoints found (%d,%d) uipaq%s: this device is not using CDC notify message in intr pipe. Please send your dmesg to , thanks. %s: umass only mode. need to reattach %s: truinstall mode. need to reattach %s: no endpoint descriptor found for %d umsmwiusbthrwitxlwiIDLwi_usb: received USB_BUFAVAIL packet wi_usb: received USB_ERROR packet %s: %s error=%s wiTXsyncUGH TX UGH RX write_record buf size err %x %x invalid packet len: %x memsz %x max %x %s: %s: error=%s %s:%s: invalid packet id sent %x %s: already detached %s: open pipes failed wi_usb%s: could not get card cfg! unknown-device%s: %s loadfirmware error %d %s: reattaching after firmware upload atuatu-rfmd-intatu-rfmd-extatu-rfmd2958-intatu-rfmd2958-extatu-rfmd2958smc-intatu-rfmd2958smc-extatu-intersil-intatu-intersil-extatu-at76c503-i3863-intatu-at76c503-i3863-extatu-at76c503-rfmd-acc-intatu-at76c503-rfmd-acc-extatu-at76c505-rfmd-intatu-at76c505-rfmd-ext%s: could not retrieve Tx statistics - cancelling automatic rate control %s: could not write MAC register: %s %s: could not read MAC register: %s %s: could not read BBP %s: could not read EEPROM: %s %s: could not allocate tx xfer %s: could not allocate tx buffer %s: could not transmit buffer: %s %s: could not allocate rx xfer %s: could not allocate rx buffer %s: timeout waiting for BBP/RF to wakeup %s: could not allocate AMRR xfer %s: could not open Tx pipe: %s %s: could not open Rx pipe: %s %s: could not allocate Tx list %s: could not allocate Rx list %s: could not queue Rx transfer %s: could not transmit beacon %s: could not set configuration no %s: could not get interface handle %s: no endpoint descriptor for iface %d %s: MAC/BBP RT%04x (rev 0x%02x), RF %s, address %s uralOUI 0x%06x model 0x%04x rev %d at %s phy %dmii_detach: phyloc and offloc specifiedmii_attach: phyloc and offloc specifiedmiiautmii_phy_setmedia: MASTER on wrong media: %s, rev. %d nsphyDP83840 10/100 PHYqsphyQS6612 10/100 PHYinphyi82555 10/100 PHYi82562EM 10/100 PHYi82562ET 10/100 PHYi82562G 10/100 PHYiophyi82553 10/100 PHYeephy88E1000 1 Gigabit PHY88E1000 2 Gigabit PHY88E1000 3 Gigabit PHY88E1000 4 Gigabit PHY88E1000S Gigabit PHY88E1011 Gigabit PHY88E1111 Gigabit PHY88E1112 Gigabit PHY88E1116 Gigabit PHY88E1116R Gigabit PHY88E1118 Gigabit PHY88E1149 Gigabit PHY88E3016 10/100 PHY88E3082 10/100 PHYPHYG65G Gigabit PHY88E1000 5 Gigabit PHY88E1000 6 Gigabit PHY88E1000 7 Gigabit PHYexphy_service: can't isolate 3Com PHY: 3Com internal media interface %s: ignoring this PHY, non-zero instance xlexphyrlrlphy_service: attempt to isolate phy: RTL internal PHY rlphyRTL8201L 10/100 PHYRTL8201E 10/100 PHYIP101 10/100 PHYlxtphyLXT970 10/100 PHYLXT971 10/100 PHYluphyLU6612 10/100 PHYmtdphyMTD972 10/100 PHYicsphyICS1890 10/100 PHYICS1892 10/100 PHYICS1893 10/100 PHYsqphy80220 10/100 PHY80225 10/100 PHY84220 10/100 PHYtqphy78Q2120 10/100 PHY: Generic IEEE 802.3u media interface, rev. %d: OUI 0x%06x, model 0x%04x %s: no media present ukphy: internal PHY dcphybmtphy3C905B internal PHY3C905C internal PHYBCM4401 10/100baseTX PHYBCM5201 10/100 PHYBCM5214 Quad 10/100 PHYBCM5220 10/100 PHYBCM5221 100baseTX PHYBCM5222 Dual 10/100 PHYbgebnxbrgphyBCM5400 1000baseT PHYBCM5401 10/100/1000baseT PHYBCM5411 10/100/1000baseT PHYBCM5421 10/100/1000baseT PHYBCM54K2 10/100/1000baseT PHYBCM5461 10/100/1000baseT PHYBCM5462 10/100/1000baseT PHYBCM5464 10/100/1000baseT PHYBCM5701 10/100/1000baseT PHYBCM5703 10/100/1000baseT PHYBCM5704 10/100/1000baseT PHYBCM5705 10/100/1000baseT PHYBCM5714 10/100/1000baseT/SX PHYBCM5750 10/100/1000baseT PHYBCM5752 10/100/1000baseT PHYBCM5780 10/100/1000baseT/SX PHYBCM54XX 10/100/1000baseT PHYBCM5481 10/100/1000baseT PHYBCM5482 10/100/1000baseT PHYBCM5722 10/100/1000baseT PHYBCM5755 10/100/1000baseT PHYBCM5761 10/100/1000baseT PHYBCM5784 10/100/1000baseT PHYBCM5787 10/100/1000baseT PHYBCM5706 10/100/1000baseT/SX PHYBCM5708C 10/100/1000baseT PHYBCM5708S 1000/2500baseSX PHYBCM5709 10/100/1000baseT PHYBCM5709S 1000/2500baseSX PHYBCM5709CAX 10/100/1000baseT PHYBCM5717C 10/100/1000baseT PHYBCM5719C 10/100/1000baseT PHYBCM5720C 10/100/1000baseT PHYBCM57765 10/100/1000baseT PHYBCM57780 10/100/1000baseT PHYBCM5906 10/100baseTX PHYamphyAm79C873 10/100 PHYDM9101 10/100 PHYDM9102 10/100 PHYDM9601 10/100 PHYAm79C875 quad PHYacphyAC101 10/100 PHYAC101L 10/100 PHYAC_UNKNOWN 10/100 PHY%s: %s: enter updown%s: %s: link %s : RTL internal phy urlphyrgephyRTL8169S/8110S PHYRTL8251 PHYnfe%s: unknown CICADA PHY model %x %s: unknown PHY speed %x ciphyCS8201 10/100/1000TX PHYCS8204 10/100/1000TX PHYVSC8211 10/100/1000 PHYCS8244 10/100/1000TX PHYVSC8601 10/100/1000 PHY%d:%d:%d: mem address conflict 0x%lx/0x%lx %d:%d:%d: io address conflict 0x%lx/0x%lx %d:%d:%d: bridge io address conflict 0x%lx/0x%lx %d:%d:%d: bridge mem address conflict 0x%lx/0x%lx %d:%d:%d: bridge bus conflict %d-%d dev %d function %dpci_mem_find: bad requestpci_mem_find: bad 64-bit requestpci_io_find: bad request%svendor 0x%04x product 0x%04xunknown vendor "%s", unknown product 0x%04xunknown class 0x%02x, subclass 0x%02xclass %s unknown subclass 0x%02xclass %s subclass %s, rev 0x%02x) rev 0x%02xmiscellaneousfloppyIPISASethernettoken ringFDDIWorldFipPCMIG Multi ComputingXGAvideoaudiotelephonyhdaudioRAMflashhostMicroChannelNuBusRACEwaySemi-transparent PCIInfiniBandserialparallelmulti-port serialmodemsmartcard8237 DMA8254 timerRTCPCI Hot-PlugSD Host Controllerkeyboarddigitizermousegame portgeneric386486PentiumAlphaPowerPCMIPSCo-processorFirewireACCESS.busSSAFiber ChannelIPMISERCOSIrDAConsumer IRRFbluetoothbroadband802.11a (5 GHz)802.11b (2.4 GHz)standardvoicenetwork/computingentertainmentDPIOTime and Frequencysynchronizationmanagementprehistoricmass storagenetworkdisplaymultimediabridgecommunicationsinputdockserial buswirelessI2Osatellite commDASPundefinedOZ6729 CardBusOZ6730 CardBusOZ6922 CardBusOZ6832 CardBusOZ6836/OZ6860 CardBusOZ68[17]2 CardBusOZ6933 CardBusOZ69[17]2 CardBusOZ711Mx MiscOZ711EC1 SmartCardBusOZ711M1 CardBusOZ711MP1 SDHCOZ711MP1 XDHCOZ711MP1 CardBusOZ711EZ1 CardBusOZ711SP1 CardBusOZ711E0 CardBus3c9853c9963CRDAG6753CRPAG175V.90 Modem3c9403c3393c3593c4503c555 100Base-TX3c5753CCFE575BT3CCFE575CT3c590 10Mbps3c595 100Base-TX3c595 100Base-T43c595 10Mbps-MII3CRSHPW796 802.11b3CRWE154G72 802.11g3c556 100Base-TX3c556B 100Base-TX3CCFEM6563CCFEM656B3CCFEM656C56k Global Modem3cSOHO-TX3crwe777a AirConnect3c940B3c900 10Base-T3c900 10Mbps-Combo3c900B 10Mbps3c900B 10Mbps-Combo3c900B 10Mbps-TPC3c900B 10Mbps-FL3c905 100Base-TX3c905 100Base-T43c905B 100Base-TX3c905B 100Base-T43c905B 10/100Mbps-Combo3c905B 100Base-FX3c905C 100Base-TX3c9201 100Base-TX3c920B-EMB-WNM3cSOHO 100B-TX3c980 100Base-TX3c980C 100Base-TX3cr9903cr990-TX3cr990-TX-953cr990-TX-973c990b-TX-M3cr990-FX3cr990SVR953cr990SVR973c990BSVRVoodooVoodoo2BansheeVoodoo3Voodoo4Voodoo5GLINT 300SXGLINT 500TXGLINT DeltaPermediaGLINT MXPermedia 2GLINT GammaPermedia 2vPermedia 3Wildcat III 6210Wildcat 5110Wildcat IV 72105000/6000 series RAID7000/8000 series RAID9000 series RAID9500 series RAIDFE2500 10/100PCM200 10/100FE2000VX 10/100FE2500MX 10/100PC4800 WirelessPCI35x WLANPC4500 WirelessMPI-350 WirelessACCM 2188 VL-PCI2051 PCI2051 ISAATP850U/UFATP860ATP860-AATP865-AATP865-RAEC6710AEC6712UWAEC6712UAEC6712SAEC6710DAEC6715UWMPX 5030/5038EN2242EN1217RhineIIrtl8139AWA-100M1435 VL-PCIM1445 VL-PCIM1449 ISAM1451 PCIM1461 PCIM1489 PCIM1511 PCIM1513 ISAM1523 PCIM1523 ISAM1531 PCIM1533 ISAM1535 PCIM1541 PCIM1543 ISAM1563 ISAM1573 ISAM1575 ISAM1621 PCIM1631 PCIM1644 PCIM1647 PCIM1689 PCIM1695 PCIM3309 MPEGM4803M5219 UDMA IDEM5229 UDMA IDEM5237 USBM5239 USB2M5243 AGP/PCI-PCIM5246 AGPM5247 AGP/PCI-PCM5249M524B PCIEM524C PCIEM524D PCIEM5261 LANM5263 LANM5281 SATAM5287 SATAM5288 SATAM5289 SATAM5451 AudioM5455 AudioM5457 ModemM5461 HD AudioM7101 PowerAL981AN983AN985ADM8211 WLANADM9511ADM9513AIC-7810AHA-2940AU/CNAHA-2930CUAIC-7850AIC-7855AIC-5900 ATMAIC-5905 ATMAPA-1480AIC-7860AHA-2940AUAIC-7870AHA-2940AHA-3940AHA-3985AHA-2944AIC-7815AIC-7880AHA-2940UAHA-3940UAHA-398XUAHA-2944UAHA-2940UWProAIC-6915AIC-7895AHA-2940U2 U2AHA-2930U2 U2AAA-131U2 U2AIC-7890/1 U2AIC-7892 U160AHA-29160 U160AHA-19160B U160AVA-2930LPAHA-3950U2B U2AHA-3950U2D U2AIC-7896/7 U2AHA-3960D U160AIC-7899BAIC-7899DAIC-7899FAIC-7899 U160ServeRAIDAAC-2622ASR-2200SASR-2120SAAC-364AAC-3642Dell PERC 2/QCAIC-7901 U320AHA-29320A U320AHA-29320LP U320AIC-7901A U320AHA-29320 U320AHA-29320B U320AIC-7902 U320AIC-7902B U320AHA-39320 U320AHA-39320B U320AHA-39320A U320AHA-39320D U320AHA-39320DB U3201200AABP-930/40UAABP-940UWASP-3940U2WASP-3940U3WWaikato Dag3.2Endace Dag3.5Endace Dag4.22GEEndace Dag4.23PhysXAT22AT24AcenicAcenic CopperBCM5700BCM5701AC1000AC1001AC9100AC1003AMD64 0Fh HyperTransportAMD64 0Fh Address MapAMD64 0Fh DRAM CfgAMD64 0Fh Misc CfgAMD64 10h HyperTransportAMD64 10h Address MapAMD64 10h DRAM CfgAMD64 10h Misc CfgAMD64 10h Link CfgAMD64 11h HyperTransportAMD64 11h Address MapAMD64 11h DRAM CfgAMD64 11h Misc CfgAMD64 11h Link CfgAMD64 15/1xh Link CfgAMD64 15/1xh Address MapAMD64 15/1xh DRAM CfgAMD64 15/1xh Misc CfgAMD64 15/1xh CPU PowerAMD64 15/1xh NB PowerAMD64 15/1xh HostAMD64 15/1xh PCIEAMD64 15/1xh IOMMUAMD64 14h HostAMD64 14h PCIEAMD64 15/0xh Link CfgAMD64 15/0xh Address MapAMD64 15/0xh DRAM CfgAMD64 15/0xh Misc CfgAMD64 15/0xh CPU PowerAMD64 15/0xh HostAMD64 14h Link CfgAMD64 14h Address MapAMD64 14h DRAM CfgAMD64 14h Misc CfgAMD64 14h CPU PowerAMD64 12h HostAMD64 12h PCIEAMD64 14h NB PowerAMD64 14h Reserved79c970 PCnet-PCI79c978 PChome-PCI53c974 PCscsi-PCI79C974 PCnet-PCIGeode LXGeode LX VideoGeode LX CryptoCS5536 PCICS5536 ISACS5536 AudioCS5536 USBCS5536 IDEElanSC520 PCIHudson-2 PCIE751 System762 PCI761 PCI755 ISA755 IDE755 Power755 USB756 ISA756 IDE756 Power756 USB Host766 ISA766 IDE766 USB766 Power766 USB OpenHCI768 ISA768 IDE768 Power768 AC97768 Modem768768 USB8131 PCIX8131 PCIX IOAPIC8151 Sys Control8151 AGP8132 PCIX8132 PCIX IOAPIC8111 Ether8111 USB8111 LPC8111 IDE8111 SMBus8111 Power8111 AC97Hudson-2 SATAHudson-2 SD Host ControllerHudson-2 USBHudson-2 USB2Hudson-2 SMBusHudson-2 IDEHudson-2 HD AudioHudson-2 LPCHudson-2 PCIHudson-2 xHCIRS780 HostRS880 HostRS780 PCIEMegaRAIDMegaRAID Series 428MegaRAID Series 434ADSP 21535 DSPAD1889 AudioSafeNet ADSP 2141TC9021BanditGCOHareHeathrowPaddingtonUni-N EthUni-NUni-N Eth FirewireUni-N AGPUni-N GMACKeylargoPangea GMACPangea MacioPangea USBPangea AGPPangeaPangea PCIUni-N2 AGPUni-N2 HostPangea FireWireUniNorth FirewireUni-N2 GMACUni-N ATAUniNorth AGPUniNorth PCIIntrepid ATAIntrepidIntrepid USBK2 USBK2 MacioK2 FirewireK2 ATAU3U3 HyperTransportU3 AGPK2 GMACShastaShasta ATAShasta GMACShasta FirewireShasta PCIShasta HyperTransportK2U3L AGPK2 AGPIntrepid 2 AGPIntrepid 2 PCIIntrepid 2 ATAIntrepid 2 FireWireIntrepid 2 GMACARS106SARS0303D1000PV2000PV2000MT2000MIARC-1110ARC-1120ARC-1130ARC-1160ARC-1170ARC-1200ARC-1200BARC-1202ARC-1210ARC-1214ARC-1220ARC-1230ARC-1260ARC-1270ARC-1280ARC-1380ARC-1381ARC-1680ARC-1681ARC-1880AX88140A/88141ASM1042 xHCIASM1083/1085 PCIE-PCIRadeon HD 6310 HD AudioRadeon HD 6500D HD AudioMobility Radeon X600FireMV 2400Mobility Radeon X300FireGL M24 GLRadeon X600FireGL V3200Radeon X600 SecRadeon IGP 320Radeon IGP 340Radeon 9500 ProRadeon AE 9700 ProRadeon AF 9600TXFireGL AGZ1Radeon AH 9800 SERadeon AI 9800Radeon AJ 9800FireGL AK X2Radeon 9600 ProRadeon 9600Radeon 9550FireGLRadeon 9650Mach32Radeon 9500 Pro SecRadeon 9600 Pro SecRadeon 9600 LE SecRadeon 9600 XT SecRadeon 9550 SecRadeon IGPRadeon 8500Radeon BC R200Radeon IGP 320MMobility M6SB200 AC97SB200 PCISB200 USB2SB200 USBSB200 IDESB200 ISASB200 ModemSB200 SMBusMach64 CTMach64 CXSB300 AC97SB300 PCISB300 SMBusSB300 USB2SB300 USBSB300 IDESB300 ISASB300 ModemSB300 SATASB400 AC97SB400 PCISB400 SMBusSB400 USB2SB400 USBSB400 IDESB400 ISASB400 ModemSB400 SATASB450 HD AudioSB600 SATASB600 AC97SBx00 HD AudioSB600 PCISBx00 SMBusSB600 USB2SB600 USBSB600 IDESB600 ISASB600 ModemSBx00 SATASB700 USB2SB700 USBSB700 IDESB700 ISASB800 PCIERadeon Mobility IGPMach64 ETRage ProMach64Rage XLRadeon 9000Radeon 9000 SecRadeon X800Radeon X800 ProRadeon X800SERadeon X800XTFireGL X3-256Radeon Mobility M18Radeon X800 SERadeon X800 XTRadeon AIW X800 VERadeon X800 Pro SecRadeon X850Radeon X850 XTRadeon X850 SERadeon X850 ProRadeon X850 XT PERage128Mobility M3Mobility 1Rage P/MRadeon Mobility M7FireGL Mobility 7800 M7Radeon Mobility M6Radeon Mobility M9FireMV 2400 PCIRage 128 MobilityRadeon 9500/9700Radeon 9600 TXFireGL X1Radeon 9800 ProRAdeon 9800Radeon 9800 XTFireGL X2Radeon Mobility M10Radeon Mobility 9550Radeon 9500/9700 SecFireGL X1 SecRadeon 9800 Pro SecRage 128 ProRage FuryRage 128Rage 128 PXAIW RadeonRadeon 9100Radeon 7500Radeon VEES1000Rage MagnumRadeon Mobility M300 M22Radeon Mobility X600 M24CFireGL M44 GL 5464Radeon X800 XT PERadeon X800 XTPRadeon X800 XLFireGL V7100FireGL V5100Radeon X800 SecMobility FireGL V5000 M26Radeon Mobility X700 XL M26Radeon Mobility X700 M26Radeon X550XTXRadeon X550XTX SecRS300_100 HostRS300_133 HostRS300_166 HostRadeon IGP 9100 HostRadeon IGP 9100Radeon Mobility IGP 9100Radeon IGP 9100 AGPRadeon 9200 PRO SecRadeon 9200 SecRS480 HostRX480 HostRD580 HostRadeon XPRESS 200Radeon XPRESS 200MRX780 HostRD780 HT-PCIERadeon 9200 PRORadeon 9200Radeon 9200 SE SecFireMV 2200RD790 PCIESR5690 HostRD890 HostSR5670 HostSR5650 HostSR5690 PCIERS400 HostRC410 HostRX480 PCIERS480 PCIERadeon X300Radeon X550FireGL V3100FireMV 2200 5B65Radeon X300 SecRadeon X550 SecFireGL V3100 SecFireMV 2200 SecRadeon Mobility 9200Radeon 9200 SERadeon X800 XT M28FireGL V5100 M28Radeon Mobility X800 M28FireGL R480Radeon X850XTRadeon X800 GTO SecRadeon X850 XT SecFireGL V5000FireGL X700 XTFireGL X700 ProFireGL X700 SERadeon X700 PCIERadeon X700 SE PCIERadeon X700 PCIE SecRadeon X700 SERadeon X700 SE SecRadeon HD 8670ARadeon HD 8730MOlandRadeon HD 8790MRadeon HD 8530MRadeon HD 8600Radeon HD 8570Radeon HD 8500Radeon HD 8670MRadeon HD 8500MHainanCaymanFirePro V7900FirePro V5900Radeon HD 6970Radeon HD 6950Radeon HD 6990Radeon HD 6930Radeon HD 6970MMobility Radeon HD 6000BartsRadeon HD 6900MRadeon HD 6870Radeon HD 6850Radeon HD 6790Radeon HD 6730MRadeon HD 6600MRadeon HD 6610MRadeon E6760TurksFirePro V4900FirePro V3900Radeon HD 6650ARadeon HD 7670ARadeon HD 6670Radeon HD 6570Radeon HD 7570Radeon HD 6510Radeon HD 6400MRadeon HD 6430MCaicosRadeon E6460Radeon HD 6450ARadeon HD 8490Radeon HD 7450ARadeon HD 7470Radeon HD 6450Radeon HD 7450FirePro W9000FirePro VTahitiRadeon HD 7970Radeon HD 7900Radeon HD 7950Radeon HD 7990Radeon HD 7870 XTRadeon HD 7970MRadeon HD 8970MPitcairnFirePro W7000FirePro W5000Radeon HD 7870Radeon HD 7850Radeon HD 8800MCape VerdeRadeon HD 7700MRadeon HD 7870MRadeon HD 7850MFirePro W600FirePro M4000Radeon HD 7730MRadeon HD 7800MRadeon HD 7730Radeon HD 7700Radeon HD 7770Radeon HD 7750Radeon HD 7670MRadeon HD 7550MRadeon HD 7000MRadeon HD 7400CypressFirePro V8800FirePro V7800FirePro V9800FireStream 9370FireStream 9350Radeon HD 5870Radeon HD 5850Radeon HD 6800Radeon HD 5970Radeon HD 5900Radeon HD 5830Mobility Radeon HD 5870Mobility Radeon HD 5850Radeon HD 6850MFirePro V5800Mobility Radeon HD 5800Radeon HD 5770Radeon HD 5670 640SPRadeon HD 6770Radeon HD 5750Radeon HD 6750Mobility Radeon HD 5730Mobility Radeon HD 5650Mobility Radeon HD 5570FirePro V4800FirePro V3800Radeon HD 5670Radeon HD 5570Radeon HD 5550RedwoodRadeon Mobility HD 5470Radeon Mobility HD 5430Radeon HD 6370MRadeon HD 6330MCedarFireProFirePro 2460FirePro 2270Radeon HD 7300Radeon HD 5450Radeon HD 7350Cedar LERS100 PCIRS200 PCIRadeon X1800Radeon X1800 XTRadeon Mobility X1800FireGL Mobility V7200FireGL V7200FireGL V5300FireGL Mobility V7100FireGL V7300FireGL V7350Radeon X1600RV505Radeon X1300/X1550Radeon X1550M54-GLRadeon Mobility X1400RADEON X1550 64-bitRadeon Mobility X1300 M52-64Radeon Mobility X1300Radeon X1300FireGL V3300FireGL V3350Radeon X1600 SecRadeon X1300/X1550 SecRadeon X1300 ProRadeon X1450Radeon Mobility X2300Radeon Mobility X1350Radeon Mobility X1450FireMV 2250Radeon X1550 64-bitRadeon X1300 Pro SecRadeon X1300 SecRadeon X1650Radeon X1600 ProFireGL V5200Radeon Mobility X1600Radeon X1650 ProRadeon X1300 XTFireGL V3400Mobility FireGL V5250Radeon X1700Radeon X1700 XTRadeon Mobility X1700Radeon X1600 Pro SecRadeon X1650 Pro SecRadeon X2300HDRadeon Mobility X2300HDRadeon X1950Radeon X1900AMD Stream ProcessorRadeon X1950 ProRV560Radeon Mobility X1900Radeon X1950 GTRV570FireGL V7400Rv560Radeon RX1650 XTRadeon X1950 Pro SecRadeon RX1650 XT SecRadeon 9000/9100 IGPRadeon RS350IGPRS690 HostRS740 HostRS690 PCIERS690M PCIERS690 HD AudioRadeon X1250Radeon X1250 IGPRadeon X1200RS740RS740MRadeon 2100Radeon HD 2900 XTRadeon HD 2900 ProRadeon HD 2900 GTFireGL V8650FireGL V8600Radeon HD 4870Radeon HD 4870 X2Radeon HD 4850Radeon HD 4850 X2FirePro V8750FirePro V7760Mobility Radeon HD 4850Mobility Radeon HD 4850 X2Radeon HD 4800FirePro RV770FireStream 9270FireStream 9250FirePro V8700Mobility Radeon HD 4870Radeon M98Radeon HD 4890FirePro M7750Mobility Radeon HD 4650Mobility Radeon HD 4670Radeon HD 4670Radeon E4600Radeon HD 4600Radeon HD 4650FirePro V7750FirePro V5700FirePro V3750Mobility Radeon HD 4830FirePro M7740RV740Radeon HD 4770Radeon HD 4700FirePro M5750Radeon HD 2400 XTRadeon HD 2400 ProRadeon HD 2400 Pro AGPFireGL V4000Radeon HD 2350Mobility Radeon HD 2400 XTMobility Radeon HD 2400Radeon E2400Radeon HD 2400 Pro PCIFireMV 2260Radeon HD 3870Mobility Radeon HD 3850Radeon HD 3850Mobility Radeon HD 3850 X2Mobility Radeon HD 3870Mobility Radeon HD 3870 X2Radeon HD 3870 X2FireGL V7700Radeon HD 3850 AGPRadeon HD 3690FireStreamRadeon HD 4550Radeon HD 4350Mobility Radeon HD 4300Mobility Radeon HD 4500FirePro RG220Mobility Radeon HD 4330Mobility Radeon HD 2600Mobility Radeon HD 2600 XTRadeon HD 2600 XT AGPRadeon HD 2600 Pro AGPRadeon HD 2600 XTRadeon HD 2600 ProFireGL V5600FireGL V3600Radeon HD 3600Mobility Radeon HD 3650Mobility Radeon HD 3670Mobilty FireGL V5700Radeon HD 3650 AGPRadeon HD 3650Mobility FireGL V5725Radeon HD 3470Mobility Radeon HD 3430Mobility Radeon HD 3400Radeon HD 3450Radeon HD 3450 AGPRadeon HD 3430Radeon HD 3450 PCIFirePro V3700FireMV 2450RS780 HD AudioRadeon HD 3200Radeon HD 3100Radeon HD 3300Radeon HD 3000Radeon HD 6550DRadeon HD 6620GRadeon HD 6370DRadeon HD 6380GRadeon HD 6410DRadeon HD 6520GRadeon HD 6480GRadeon HD 6530DSumoRadeon HD 4200 HD AudioRadeon HD 4200Radeon HD 4100Mobility Radeon HD 4200Mobility Radeon HD 4100Radeon HD 4290Radeon HD 4250Radeon HD 6310Radeon HD 6250Radeon HD 6320Radeon HD 6290Radeon HD 7340Radeon HD 7310Radeon HD 7290ArubaRadeon HD 7660DRadeon HD 7640GRadeon HD 7560DFirePro A300Radeon HD 7620GRadeon HD 7600GRadeon HD 7500GRadeon HD 8650GRadeon HD 8670DRadeon HD 8550GRadeon HD 8570DRadeon HD 8610GRadeon HD 7660GRadeon HD 7520GRadeon HD 7540DRadeon HD 7420GRadeon HD 7480DRadeon HD 7400GRadeon HD 8450GRadeon HD 8470DRadeon HD 8350GRadeon HD 8370DRadeon HD 8510GRadeon HD 8410GRadeon HD 8310GRadeon HD 2600 HD AudioRS690M HD AudioRadeon HD 3870 HD AudioRadeon HD 3600 HD AudioRadeon HD 34xx HD AudioRadeon HD 48xx HD AudioRadeon HD 4000 HD AudioRadeon HD 5800 AudioRadeon HD 5700 AudioRadeon HD 5600 AudioRadeon HD 5470 AudioRadeon HD 6670 AudioRadeon HD 6400 AudioRS100 AGPRS200 AGPRS250 AGPRS200M AGPS5933 PCI MatchmakerMyrinet LANaiAST1150 PCIAST1180AST2000AST2100AR5210AR5311AR5211AR5212AR2413AR5413AR5424AR5416AR5418AR9160AR9280AR9281AR9285AR2427AR9227AR9287AR9300AR9485AR9462AR9565AR5211RefAT76C506IDE-2015PLL1EL1L2CL1CL1DAR8162AR8161AR8172AR8171L2Vortex 1Vortex 2Vortex AdvantageAVL2301AVG2302ALG2301ALG2302ALS4000Dual SerialQuad SerialBRI ISDNFritz ISDNFritz v2.0 ISDNPRI T1 ISDNRT2890F5D6001F5D6020V3F5D7010F5D6000VME 617VME 270655015601BCM43224BCM5752BCM5752MBCM5709BCM5709SBCM5716BCM5716SBCM57811BCM57811 MFBCM57811 VFBCM57787BCM57764BCM5725BCM5702BCM5703BCM5704CBCM5704S AltBCM5706BCM5708BCM5702FEBCM57710BCM57711BCM57711EBCM5705BCM5705KBCM5717BCM5718BCM5719BCM5721BCM5722BCM5723BCM5705MBCM5705M AltBCM5720BCM57712BCM57712 MFBCM5717CBCM5714BCM5714SBCM5780BCM5780SBCM5705FBCM57712 VFBCM5754MBCM5755MBCM5756BCM5751BCM5715BCM5715SBCM5754BCM5755BCM5751MBCM5751FBCM5787FBCM5761EBCM5761BCM57762BCM57767BCM5764BCM57766BCM5762BCM5761SBCM5761SEBCM57800BCM57840 OBSBCM57810BCM57760BCM57788BCM57780BCM5787MBCM57790BCM5782BCM5784BCM5785GBCM5786BCM5787BCM5788BCM5789BCM5785FBCM57840BCM57840 MFBCM57800 MFBCM5702XBCM5703XBCM5704SBCM57800 VFBCM5706SBCM57840 OBS MFBCM5708SBCM57840 VFBCM57810 MFBCM57810 VFBCM57761BCM57781BCM57791BCM57786BCM57765BCM57785BCM57795BCM57782BCM5702 AltBCM5703 AltBCM5781BCM5727BCM5753BCM5753MBCM5753FBCM5903MBCM4401B1BCM5901BCM5901A2BCM5903FBCM5906BCM5906MBCM4303BCM4307BCM4311BCM4312BCM4315BCM4318BCM4319BCM4306BCM4309BCM43XGBCM4321BCM4322BCM43225BCM43227BCM4401BCM4401B0BCM431358015802580558205821582258235825586058615862425/825/42B/82B1010/1020/1007/1741415/815/41B/81B8041860410/420BT848BT849BT878BT879BT878 AudioBT879 AudioBt8474 HDLCMultiMaster NCMultiMasterFlashPointGPPCINITROX XLNITROX LiteNITROX PXOCTEON Plus CN50XXCinemasterNx10 10GbEPE9000 10GbET302E 10GbET310E 10GbET320X 10GbET302X 10GbET320E 10GbET310X 10GbET3B10 10GbET3B20 10GbET3B02 10GbE643106554565548655506555465555685546900069030CL-GD7548CL-GD5430CL-GD5434-4CL-GD5434-8CL-GD5436CL-GD5446CL-GD5480CL-GD5462CL-GD5464CL-GD5465CL-PD6729CL-PD6832 CardBusCL-PD6833 CardBusCL-GD7542CL-GD7543CL-GD7541CS4610 SoundFusionCS4615CS4280/46xx CrystalClearCS4281 CrystalClearVIC PCIEVIC ManagementVIC EthernetVIC FCoEAAR-1210SAAAR-1220SAAAR-1225SAPCI0640PCI0642PCI0643PCI0646PCI0647PCI0648PCI0649PCI0650AUSB0670USB0673PCI0680SiI3112 SATASiI3114 SATASiI3124 SATASiI3131 SATASiI3132 SATASiI3512 SATASiI3531 SATAGigaCardEX110TXSmart Array 64xxTriflex PCIQVisionQVision 1280/pSmart Array 5300Smart Array 5iSmart Array 532Smart Array 5312Smart Array 6iSmart Array 641Smart Array 642Smart Array 6400Smart Array 6400 EMSmart Array 6422Hotplug PCINetelligent ASMCPCI HotplugUSB OpenHostSMART2P RAIDISAPnPNetelligent 10/100TXNetelligent IDENetelligent 10 TIntegrated NetFlex 3/PDP Netelligent 10/100TXProLiant Netelligent 10/100TXEmbedded Netelligent 10/100TXNetelligent 10 T/2 PCISmart Array 5300 rev.2Smart Array 5i/532 rev.2iLONetFlex 3/PNetFlex 3/PBCompexeRL100-ATX 10/100PMAC 9871356k WinmodemSoftK56 PCIHSF 56k HSFiMUSYCC CN8478MUSYCC CN8474MUSYCC CN8472MUSYCC CN8471CX2388xCX2388x AudioCX2388x MPEGCX2388x IRCX2388582C599 VLBCY82C693U ISAFEther CB-TXD 10/100FEther II CB-TXD 10/100CG-LAPCIGTRTL8192ERTL8190PC-Bus II-PCICache Coherency FilterSoundBlaster LiveSoundBlaster AWE64DSoundBlaster AudigySoundBlaster X-FiSoundBlaster Audigy LSSoundBlaster Audigy 2SoundBlaster X-Fi XtremePCI Gameport JoystickSoundBlaster Audigy DigitalEctiva 1938Cyclom-Y below 1MCyclom-YCyclom-4Y below 1MCyclom-4YCyclom-8Y below 1MCyclom-8YCyclom-Z below 1MCyclom-ZIQ80310Cx5510GXm PCIGXm ISACx5530 SouthCx5530 SMICx5530 IDECx5530 XpressAUDIOCx5530 VideoDM9009DM9100DM9102DM9132PCCOM 2-portPCCOM 4-portPCCOM 8-port210502104021030Zephyr NV-RAMKZPSA21140TGA2DEFPA21041DGLPBZLXP-L2Memory Channel Cluster Controller21142/3Farallon PN9000SX210522115021150-BC21152211532115421554SWXCR RAIDPERC 2/SiPERC 3/DiPERC 3/SiDRAC 3 Add-inDRAC 3 Virtual UARTDRAC 3 Embedded/OptionalDRAC 4 Embedded/OptionalDRAC 3 OptionalPERC 4/Di i960PERC 4/Di VerdeDRAC 4DRAC 4 Virtual UARTPERC 4e/DiDRAC 4 SMICPERC 58139Viper/PCIDFE-550TXDFE-530TX+DFE-690TXDDRP32TXDDWL-610DGE-550TDGE-550SXDFE-520TX C1DGE-528TDGE-530T C1DGE-560TDGE-530T B1DGE-560SXDGE-550T B1DGE-530T A1Memory ControlSmartCache/RaidPCI-PCISmartRAIDSmartRAID 2005SPCI-SCIDMX3194UIS64PH ISDNRT2860155P-MF1 ATM25SS-3010 ATMSpeedStream 1023QuickStep 1000 ISDNLPFCLP6000Lancer 10GbELancer 10GbE VFLPe121LPe1250LP952LP982LP101LP1050LP111LP1150LPe111LPe1150LPe1000LPe1000-SPLPe1002-SPLPe12000LPe12000-SPLPe12002-SPLP7000LP8000LP9000LP9802LP10000LPX10000LP10000-SLP11000-SLPe11000-SLPe12000-SLP11000LP11000-SPLP11002-SPLPe11000LPe11000-SPLPe11002-SPEndace Dag3.6DEndace Dag4.23GEFlash memoryMemory StickSD ControllerCB-1211 CardBusCB-1225 CardBusCB-1410 CardBusCB-710 CardBusCB-712 CardBusCB-1420 CardBusCB-720 CardBusCB-722 CardBusAudioPCI97AudioPCICT5880ES366H ModemMaestro IISOLO-1 AudioDriveMaestro 2EES1989ES1989 ModemMaestro 3ES1983 ModemMaestro 3 AudioES366H Fax/ModemES2838/2839 SuperLink ModemES2898 ModemRoadRunner HIPPIRoadRunner Gig-EFreedom GBusWL11000PSST-64PSST-128PSST-16PSST-4pSST-8pXR17C152XR17C154XR17C158ATM PCA-200ATM PCA-200e801 SoundMPC8349EMPC8349MPC8347E TBGAMPC8347 TBGAMPC8347E PBGAMPC8347 PBGAMPC8343EMPC8343FL1000 xHCIFL1009 xHCIFL1400 xHCIPW008GE5PW008GE4PRIMEPOWER250/450 LANioDrive v1.2ioDriveioXtremeioXtreme ProTMC-18C30GL24110P03GL24110PGL24110P02Pulsar G7370 ADSLPR103WinTVPN672TX 10/100Visualize EGVisualize FX6Visualize FX4Visualize FX2Tach TL FibreChannelTach XL2 FibreChannelJ2585AJ2585BDiva Serial MultiportElroy Ropes-PCIVisualize FXeTopToolsNetRaid-4MNetServer SmartIRQ82557B 10/100 NICPluto MIOzx1 IOCMercury Ropes-PCIQuickSilver Ropes-PCISmart Array P430iSmart Array P830iSmart Array P430Smart Array P431Smart Array P830Smart Array P731mSmart Array P230iSmart Array P530Smart Array P531Smart Array V100Smart Array E200iSmart Array E200Smart ArraySmart Array P800Smart Array P600Smart Array E500Smart Array P400Smart Array P400iSmart Array P700mSmart Array P212Smart Array P410Smart Array P410iSmart Array P411Smart Array P812Smart Array P712mSmart Array P711miLO3 SerialiLO3 SlaveiLO3 ManagementiLO3 WatchdogSmart Array P222Smart Array P420Smart Array P421Smart Array P822Smart Array P420iSmart Array P220iSmart Array P721m7751650079517814/7851/785480658165815479567955/7954HB6HB4MSVCC01 Video CaptureSH7751 PCISH7751R PCIISP2100MCACPU - Alta LiteCPU - Alta MPISA w/PnPCPUAuto LANStreamerGXT-150P82G267582351Miami/PCIOlympici82557B 10/100RSAFireGL2133 PCIX-PCIX4810 BSP4810 SCCCalgary IOMMUEnvy24 I/O CtrlrEnvy24PT/HT Audio77201/77211 ATM89HPES12N3A89HPES24N3A89HPES24T689HPES4T489HPES5T5ZB89HPES24T3G2WDT 50x Watchdog TimerINIC-850INIC-1060INIC-940INIC-941INIC-950VirtualBox Graphics AdapterVirtualBox Guest ServiceIPN2120IPN222050265027502888498853Twin Turbo 128Twin Turbo 3DEES ISA21145Core HostCore PCIEHD Graphics3400 PCIECentrino Advanced-N 6205WiFi Link 1000Centrino Advanced-N 6250WiFi Link 1030Centrino Advanced-N 6030Core 2G HostCore 2G PCIEHD Graphics 2000Xeon E3-1200 HostHD Graphics P3000HD Graphics 3000Core 3G HostCore 3G PCIEHD Graphics 2500Xeon E3-1200 v2 HostHD Graphics 4000HD Graphics P400080303 IOP80312 I/O Companion6700PXH PCIE-PCIX6702PXH PCIE-PCIXIOP332 PCIE-PCIXIOP331 PCIX-PCIX41210 PCIE-PCIXIOP333 PCIE-PCIXHD Graphics 4600HD Graphics P4600DH89XXCC SGMIIDH89XXCC SerDesDH89XXCC BackplaneDH89XXCC SFP82375EB EISA82424ZX Cache/DRAM82378IB ISA82426EX ISA82434LX/NXGDT RAIDCentrino Advanced-N 6235Centrino Wireless-N 6150Centrino Wireless-N 2230Centrino Wireless-N 2200Centrino Wireless-N 135Centrino Wireless-N 105Centrino Wireless-N 130Centrino Wireless-N 100Dual Band Wireless AC 7260Dual Band Wireless AC 3160Dual Band Wirelsss AC 3160Dual Band Wireless AC 7265i960 RPi960 RMi960 RNCore 4G HostCore 4G HD AudioHD Graphics 5000Iris Graphics 5100Atom D2000/N2000 VideoAtom D2000/N2000 HostCore 4G PCIEXeon E3-1200 v3 HostIris Pro Graphics 5200E5 v2 HostE5 v2 PCIEE5 v2 UBOXE5 v2 I/OATE5 v2 IIO RASE5 v2 Home AgentE5 v2 QPI Link MonitorE5 v2 RASE5 v2 QPI LinkE5 v2 QPIE5 v2 TAE5 v2 TADE5 v2 ThermalE5 v2 ErrorE5 v2 PCUE5 v2 SADE5 v2 BroadcastE5 v2 UnicastBaytrail SATA8254282543GC82544EI82544GC82540EM82545EM82546EB82541EI82540EP82547EI82545GMPRO/10082559PRO/100 VEPRO/100 VM82562EH HomePNA82801DB LANV.92 ModemPRO/Wireless 210082597EXICH8 IGP M AMTICH8 IGP AMTICH8 IGP CICH8 IFEICH8 IGP MPRO/100 M82571EB82801FB LAN82801FBM LAN82801GB LAN82547GI82541GI82541ER82546GB82572EI82573E82573E IDE82573E KCS82573E Serial80003ES282573L82575EB82573V82598ICH9 IGP AMTICH9 IGP MICH9 IFEICH9 IFE GICH9 IFE GTICH8 IFE GTICH8 IFE G82598AF82598AT82576ICH9 IGP M VICH10 R BM LMICH10 R BM LFICH10 R BM V82574L82571PT82575GB82598EBICH10 D BM LMICH10 D BM LFICH9 BM82577LM82577LC8259982578DM82578DCICH9 IGP M AMT8255282815 Host82815 AGP82815 Video82806AA APIC82559ER82092AA IDESAA711682452KX/GXEE Pro 10 PCIEE Pro 100EE Pro 100 Smart8255x82437FX82371FB ISA82371FB IDE82371 ISA and IDE82437MX82441FX82380AB Mobile ISA82380FB Mobile82439HX82806AA82870P2 PCIX-PCIX82870P2 IOxAPIC82870P2 Hot PlugICH8 82567V-382579LM82579V82576NS82583V82576 SerDes QP8258082599 T3I350I350 FiberI350 SerDesI350 SGMII82580 QFX540TI210I210 FiberI210 SerDesI210 SGMIII211I217-LMI217-VI218-LMI218-V80960RP ATU82840 Host82840 AGP82840 PCI82845 Host82845 AGPI/OAT6 Series SATA6 Series AHCI6 Series RAID6 Series PCIE6 Series HD Audio6 Series SMBus6 Series Thermal6 Series DMI-PCI6 Series USB6 Series MEI6 Series KTZ68 LPCP67 LPCUM67 LPCHM65 LPCH67 LPCHM67 LPCQ65 LPCQS67 LPCQ67 LPCQM67 LPCB65 LPCC202 LPCC204 LPCC206 LPCH61 LPCC600 SATAC600 AHCIC600 RAIDC600 PCIEC600 HD AudioC600 SMBusC600 ThermalC600 USBC600 LANC600 MEIC600 Virtual PCIEC600 LPC7 Series SATA7 Series AHCI7 Series RAID7 Series PCIE7 Series HD Audio7 Series SMBus7 Series USB7 Series xHCI7 Series MEI7 Series KTZ77 LPCZ75 LPCB75 LPCH77 LPCC216 LPCQM77 LPCHM77 LPCUM77 LPCHM76 LPCHM75 LPCHM70 LPCNM70 LPCAtom C2000 HostAtom C2000 PCIEAtom C2000 RASAtom C2000 SMBusAtom C2000 RCECAtom C2000 SATAAtom C2000 AHCIAtom C2000 USBAtom C2000 PCUAtom C2000 PCU SMBusI354I354 SGMIIDH8900 LPCDH8900 AHCIDH8900 SATADH8900 SMBusDH8900 ThermalDH8900 USBDH8900 PCIEDH8900 Watchdog82801AA LPC82801AA IDE82801AA USB82801AA SMBus82801AA AC9782801AA Modem82801AA Hub-to-PCI82801AB LPC82801AB IDE82801AB USB82801AB SMBus82801AB AC9782801AB Modem82801AB Hub-to-PCI82801BA LPC82801BA USB82801BA SMBus82801BA AC9782801BA Modem82801BAM Hub-to-PCI8256282801BAM IDE82801BA IDE82801BAM LPC82801BA Hub-to-PCI82801E LPC82801E USB82801E SMBus82801E LAN82801CA LPC82801CA/CAM USB82801CA/CAM SMBus82801CA/CAM AC9782801CA/CAM Modem82801CAM IDE82801CA IDE82801CAM LPC82801DB LPC82801DBL IDE82801DB USB82801DB SMBus82801DB AC9782801DB Modem82801DBM IDE82801DB IDE82801DBM LPC82801EB/ER LPC82801EB SATA82801EB/ER USB82801EB/ER SMBus82801EB/ER AC9782801EB/ER Modem82801EB/ER IDE82801EB/ER USB282801ER SATA82820 Host82820 AGP82850 Host82860 Host82850/82860 AGP82860 PCIE7500 HostE7500 Error ReportingE7500 PCIE7501 HostE7505 HostE7505 Error ReportingE7505 AGPE7505 PCI82845G Host82845G AGP82845G Video82865G Host82865G AGP82865G Video82865G CSA82865G Overflow82875P Host82875P AGP82875P CSA82915G Host82915G PCIE82915G Video82925X Host82925X PCIEE7221 HostE7221 PCIEE7221 Video82915GM Host82915GM PCIE82915GM Video6300ESB LPC6300ESB IDE6300ESB SATA6300ESB SMBus6300ESB AC976300ESB Modem6300ESB USB6300ESB WDT6300ESB APIC6300ESB PCIX5000X Host5000Z Host5000V Host5000P Host5000 PCIE5000 Error Reporting5000 Reserved5000 FBD5000 PCIE x85000 PCIE x16E8500 HostE8500 PCIEE8500 PCIE x8E8500 IMIE8500 FSB/Boot/InterruptE8500 Address MappingE8500 RASE8500 MiscE8500 ReservedE8500 XMBE8500 XMB MiscE8500 XMB MAIE8500 XMB DDRE8500 XMB Reserved82801FB LPC82801FBM LPC82801FB SATA82801FR SATA82801FBM SATA82801FB USB82801FB PCIE82801FB HD Audio82801FB SMBus82801FB Modem82801FB AC9782801FB IDE6321ESB LPC6321ESB SATA6321ESB AHCI6321ESB RAID6321ESB USB6321ESB PCIE6321ESB AC976321ESB Modem6321ESB HD Audio6321ESB SMBus6321ESB IDE82945G Host82945G PCIE82945G Video82955X Host82955X PCIEE7230 HostE7230 PCIE82975X PCIE82975X Host82945GM Host82945GM PCIE82945GM Video82945GME Host82945GME Video82801GH LPC82801GB LPC82801GBM LPCNM10 LPC82801GHM LPC82801GB SATA82801GR AHCI82801GR RAID82801GBM SATA82801GBM AHCI82801GHM RAID82801GB USB82801GB PCIE82801GB HD Audio82801GB SMBus82801GB Modem82801GB AC9782801GB IDE82801G PCIE82801H LPC82801HEM LPC82801HH LPC82801HO LPC82801HBM LPC82801H SATA82801H AHCI82801H RAID82801HBM SATA82801HBM AHCI82081HBM RAID82801H SMBus82801H DMI-PCI82801H USB82801H PCIE82801H HD Audio82801H Thermal82801HBM IDE82801IH LPC82801IO LPC82801IR LPC82801IEM LPC82801IB LPC82801IBM LPC82801I SATA82801I AHCI82801I RAID82801I SMBus82801I Thermal82801I USB82801I HD Audio82801I PCIEICH9 IGP C82946GZ Host82946GZ PCIE82946GZ Video82946GZ HECI82946GZ PT IDER82946GZ KT82G35 Host82G35 PCIE82G35 Video82G35 HECI82Q965 Host82Q965 PCIE82Q965 Video82Q965 HECI82Q965 PT IDER82Q965 KT82G965 Host82G965 PCIE82G965 Video82G965 HECI82G965 PT IDER82G965 KT82Q35 Host82Q35 PCIE82Q35 Video82Q35 HECI82Q35 PT IDER82Q35 KT82G33 Host82G33 PCIE82G33 Video82G33 HECI82G33 PT IDER82G33 KT82Q33 Host82Q33 PCIE82Q33 Video82Q33 HECI82Q33 PT IDER82Q33 KT82X38 Host82X38 PCIE82X38 HECI82X38 PT IDER82X38 KT3200/3210 Host3200/3210 PCIE3210 PCIEGM965 HostGM965 PCIEGM965 VideoGM965 KTGM965 PT IDERGME965 HostGME965 PCIEGME965 VideoGME965 HECIGME965 PT IDERGME965 KTGM45 HostGM45 PCIEGM45 VideoGM45 HECIGM45 PT IDERGM45 KT4 Series VideoQPI LinkQPI PhysicalQ45 HostQ45 PCIEQ45 VideoQ45 HECIQ45 PT IDERQ45 KTG45 HostG45 PCIEG45 VideoG41 HostG41 VideoB43 VideoRCU32 I2O RAID3124 SATA31244 SATA82855PM Host82855PM AGP82855PM Power5500 HostX58 Host5520 HostX58 PCIE5520/X58 QuickPath5520 QuickPathX58 GPIOX58 RASX58 QuickPathX58 QuickDataX58 IOxAPICX58 MiscX58 ThrottleX58 TXT6321ESB IOxAPIC6321ESB PCIE-PCIX82830M Host82830M AGP82830M Video82855GM Host82855GME AGP82855GM Video82855GM Memory82855GM Config82854 Host82854 VideoE7520 HostE7520 Error ReportingE7320 HostE7320 Error ReportingE7520 DMAE7520 PCIEE7520 ConfigE7525 Host3100 Host3100 Error Reporting3100 EDMA3100 PCIE7300 Host7300 PCIEI/OAT CNB7300 FSB/Boot/Interrupt7300 Snoop Filter7300 Misc7300 FBD82801JD SATA82801JD AHCI82801JD RAID82801JDO LPC82801JIR LPC82801JIB LPC82801JD LPC82801JI SATA82801JI AHCI82801JI RAID82801JI SMBus82801JI USB82801JI HD Audio82801JI PCIE82801JDO VECI82801JD Virtual SATA82801JD SMBus82801JD Thermal82801JD USB82801JD HD Audio82801JD PCIE82801JD LANP55 LPCPM55 LPCH55 LPCQM57 LPCH57 LPCHM55 LPCQ57 LPCHM57 LPCQS57 LPC3400 LPC3420 LPC3450 LPC3400 SATA3400 AHCI3400 RAID3400 SMBus3400 Thermal3400 USB3400 HD AudioQS57 HD Audio3400 MEI3400 PT IDER3400 KTE5 HostE5 PCIEE5 DMAE5 Address MapE5 Error ReportingE5 I/O APICE5 PCIE MonitorE5 QPI Link MonitorE5 Home AgentE5 RASE5 QPI LinkE5 TAE5 TADE5 ThermalE5 ErrorE5 DDRIOE5 PCUE5 ScratchE5 R2PCIEE5 QPIE5 UnicastE5 SADE5 Broadcast5400 Host5400A Host5400B Host5400 PCIEI/OAT SNB5400 FSB/Boot/Interrupt5400 Coherency Engine5400 IOAPIC5400 RASE600 HostPRO/Wireless 2200BGPRO/Wireless 2225BGPRO/Wireless 3945ABGPRO/Wireless 2915ABGWireless WiFi Link 4965Centrino Ultimate-N 6300Centrino Advanced-N 6200WiFi Link 5100WiFi Link 5300WiFi Link 5350WiFi Link 5150Turbo MemoryEP80579 HostEP80579 MemoryEP80579 EDMAEP80579 PCIEEP80579 SATAEP80579 AHCIEP80579 ASUEP80579 ReservedEP80579 LPCEP80579 SMBusEP80579 USBEP80579EP80579 CANbusEP80579 SerialEP80579 1588EP80579 LEBEP80579 GCUEP80579 LANi960 RDPRO 100 ServerQEMU NVM Express Controller5100 Host5100 PCIE5100 FSB5100 Reserved5100 DDRI/OAT SCNB82371SB ISA82371SB IDE82371SB USB82437VX82439TX82371AB PIIX4 ISA82371AB IDE82371AB USB82371AB Power82810 Host82810 Video82810-DC100 Host82810-DC100 Video82810E Host82810E Video82443LX AGP82443BX AGP82443BX82440MX Host82440MX AC9782440MX Modem82440MX ISA82440MX IDE82440MX USB82440MX Power82440BX AGP82443GX82372FB IDE82740 AGPUS15W HostUS15L/UL11L HostUS15W VideoUS15L/UL11L VideoSCH PCIESCH USBSCH USB ClientSCH LPCSCH IDESCH HD AudioSCH SD/MMCE600 PCIEE600 VideoE600 ConfigE600 LPC82450KX/GX82450KX/GX Memory82451NX Mem & IO82454NX PXBEG20T PCIEEG20T Packet HubEG20T EthernetEG20T GPIOEG20T USBEG20T USB ClientEG20T SDIOEG20T AHCIEG20T DMAEG20T SerialEG20T SPIEG20T I2CEG20T CANEG20T 158882802AC Firmware Hub 8Mbit82802AB Firmware Hub 4Mbit8 Series SATA8 Series AHCI8 Series RAID8 Series PCIE8 Series HD Audio8 Series SMBus8 Series Thermal8 Series USB8 Series xHCI8 Series MEI8 Series IDER8 Series KTZ87 LPCZ85 LPCHM86 LPCH87 LPCHM87 LPCQ85 LPCQ87 LPCQM87 LPCB85 LPCC222 LPCC224 LPCC226 LPCH81 LPCI2O RAIDRCU21 I2O RAIDRCUxx I2O RAIDRCU31 I2O RAIDRCU31L I2O RAID8 Series LPCPineview DMIPineview VideoS21152BB21154AE/BECore DMICore QPI LinkCore QPI RoutingCore ManagementCore ScratchCore ControlCore MiscPowerstorm 4D50TIntense 3DExpert3D5526 FibreChannelPRISM3PRISM2.5Prism IndigoPrism Javelin/XbowPrism GT/DuetteAEONGV-BCTV3AGX016ITT3204 MPEG DecoderIT8211FIT8212FIT8213FIT8330GIT8888F ISAIT8892E PCIE-PCIIT8893E PCIE-PCIJMC250JMC260JMB360 SATAJMB361 IDE/SATAJMB362 SATAJMB363 IDE/SATAJMB365 IDE/SATAJMB366 IDE/SATAJMB368 IDExDKTIHSSIDS3SSIDS1HSSIcAppian LiteParallelDual ParallelS3 805Leadtek WinFast TV 2000Leadtek WinFast TV 2000 XPLXT1001EG1032EG1064PCMPC200PCM200PNICPNIC-II8031K56flex DSVD LTMODEMLTMODEMVenus ModemUSB 2-portUSB QuadraBusFW322 1394FW643 1394ET1310LS242 DVD DecoderPMAC 98715PMAC 98727MX86250Smart 16/4 PCI RingnodeSmart 16/4 PCI Ringnode Mk2Smart 16/4 PCI Ringnode Mk3Smart 16/4 PCI Ringnode Mk116/4 CardbusPresto PCISmart 100/16/4 PCI-HS RingnodeSmart 100/16/4 PCI Ringnode16/4 CardBus Mk2Collage 25 ATMCollage 155 ATMi740 PCILibertas 88W8300Libertas 88W8310Libertas 88W8335Yukon 88E8001/8003/8010Yukon 88E8021CUYukon 88E8022CUYukon 88E8061CUYukon 88E8062CUYukon 88E8021XYukon 88E8022XYukon 88E8061XYukon 88E8062XYukon 88E8035Yukon 88E8036Yukon 88E8038Yukon 88E8039Yukon 88E8040Yukon 88E8040TYukon 88EC033Yukon 88E8042Yukon 88E8048Yukon 88E8052Yukon 88E8050Yukon 88E8053Yukon 88E8055Yukon 88E8056Yukon 88E8070Yukon 88EC036Yukon 88EC032Yukon 88EC034Yukon 88EC042Yukon 88E8058Yukon 88E8071Yukon 88E8072Yukon 88E8075Yukon 88E8057Yukon 88E8059Yukon (Belkin F5D5005)88SX5040 SATA88SX5041 SATA88SX5080 SATA88SX5081 SATA88SX6040 SATA88SX6041 SATA88SX6042 SATA88SX6080 SATA88SX6081 SATA88SE6101 IDE88SE6111 SATA88SE6120 SATA88SE6121 SATA88SE6122 SATA88SE6140 SATA88SE6141 SATA88SE6145 SATA88SX7042 SATA88SE9120 SATA88SE9123 SATA88SE9125 SATA88SE9172 SATAMGA PX2085MGA Millenium 2064WMGA 1064SG 220MHzMGA Millennium II 2164WMGA Millennium II 2164WA-B AGPMGA G200 PCIMGA G200 AGPMGA G200eMGA G400/G450 AGPMGA G200eVMGA G200eWMGA G200eHMGA G200eRMGA ImpressionMGA G100 PCIMGA G100 AGPMGA 1064SGMGA G400 Twin HeadMGA G550 AGPMGA P650 PCIeMGA Millennium G200 SDMGA Produktiva G100 SDMGA Mystique G200 SDMGA Millennium G200 SGMGA Marvel G200 SDIS200 BB16PCI958PCI32PCI509PCI511PEX511GPS170PCIConnectX ENKSZ8841 10/100KSZ8842 dual-port 10/100 switchRT3090MN-120 10/100MN-130 10/1002IVDC-PCX1MiroVIDEO DC20Media 3DMiroVIDEO DC10/DC20Powerstorm 4D30TGUI AccelSerial MCS9865MPC105 PCIMPC106 PCISM56Raven PCICP-114C104HCP-104ULCP-104JUC168HDMA4 serialDAC960P V2 RAIDDAC960P V3 RAIDDAC960P V4 RAIDDAC960P V5 RAIDAcceleRAIDeXtremeRAIDZ8EMyrinet LANai 9.2MTD800 10/100MTD803 10/100MTD891 10/100/1000MV1000CH352NCP130NCP130A2PCI-GPIBNET2282 USBNXB-10GXxRNXB-10GCX4NXB-4GCUIMEZ 10GbEHMEZ 10GbEIMEZ 10GbE MgmtHMEZ 10GbE MgmtNX3031DP83810 10/100PC87415 IDE87560 Legacy I/ODP83815 10/100DP83820 10/100/1000CS5535 HostCS5535 ISACS5535 IDECS5535 AUDIOCS5535 USBCS5535 VIDEOSaturnSCx200 ISASCx200 SMISCx200 IDESCx200 AUDIOSCx200 VIDEOSCx200 X-BUSSC1100 ISASC1100 SMISC1100 X-BusNS87410PowerVR PCX2I/OVersa MaestroVersa Va26D MaestroMagicgraph NM2070Magicgraph 128VMagicgraph 128ZVMagicgraph NM2160Magicgraph NM2200Magicgraph NM2360MagicMedia 256AV+MagicMedia 256XL+MagicMedia 256AVMagicMedia 256ZXXframeXframe IIMA301GA620GA620TNm9805Nm9820Nm9835Nm9845Nm9865Nm9901Nm9922CMI8338A AudioCMI8338B AudioCMI8738/C3DX AudioCMI8738B AudioHSP56 AMRCMI8788 HD AudioNSP2KNetVin 5000Universe VMETsi381 PCIE-PCIFalcon PFalcon SEF100253c81053c82053c82553c81553c810AP53c86053c1510D53c89653c89553c88553c87553c151053c895A53c1010-3353c1010-6653c103053c1030ZC53c103553c1035ZCSAS1064SAS1068SAS1064ESAS1068ESAS1066EMegaRAID SAS2208SAS1064ASAS1066SAS1078SAS2116SAS2308SAS2004SAS2008MegaRAID SAS2008SAS2108MegaRAID SAS2108 CRYPTO GEN2MegaRAID SAS2108 GEN2SAS1078DESAS220853c875JMegaRAID 320MegaRAID 320-2EMegaRAID SATA 4x/8xMegaRAID SAS 1064RMegaRAID Verde ZCRFC909FC909AFC929FC919FC929XFC919XFC949XFC939XFC949EYellowfin61C10263C81553c1030RPacket Engines G-NICPI7C21P100 PCIX-PCIXPI7C9X130 PCIE-PCIXFNW-3603-TX 10/100FNW-3800-TX 10/100NX82C501 PCINDR4600 PCIBS21 10/100E-mobility WirelessImagine-128Imagine-128 IIImagine-128 T2RImagine-128 T2R4NV1DAC64Riva TNTRiva TNT2Riva TNT2 UltraVantaMCP04 ISAMCP04 SMBusMCP04 IDEMCP04 SATAMCP04 LANMCP04 AC97MCP04 USBMCP04nForce4 ISAnForce4 SMBusnForce4 IDEnForce4 SATACK804 LANnForce4 AC97nForce4 USBnForce4nForce4 PCIEnForce4 DDRnForce2 ISAnForce2 SMBusnForce2 IDEnForce2 LANnForce2 USBnForce2 AC97nForce2 AudionForce2nForce2 FireWireMCP04 PCIEnForce2 400 ISAnForce2 400 SMBusnForce2 400 IDEnForce3 LANnForce2 400 USBnForce2 400 AC97nForce2 400nForce2 400 SATAGeForce 7800 GTXGeForce 7800 GTAladdin TNT2GeForce Go 6800GeForce Go 6800 UltraQuadro FX Go1400Quadro FX 1400nForce3 ISAnForce3 PCI HostnForce3CK804nForce3 SMBusnForce3 IDEnForce3 USBnForce3 ModemnForce3 AC97nForce3 250 ISAnForce3 250 PCI HostnForce3 250 AGPnForce3 250 SATAnForce3 250 SMBusnForce3 250 IDEnForce3 250 USBnForce3 250 AC97nForce3 250GeForce 6600 GT AGPGeForce 6600GeForce 7800 GSGeForce 6800 GTGeForce 5300 PCXQuadro FX 330GeForce256GeForce256 DDRQuadroGeForce2 MXGeForce2 MX 100GeForce2 GoQuadro2 MXRGeForce 6600 GTGeForce 6600 GoGeForce2 GTSGeForce2 TiGeForce2 UltraQuadro2 ProGeForce 6200Quadro NVS 285GeForce Go 6200GeForce4 MX 460GeForce4 MX 440GeForce4 MX 420GeForce4 440 GoGeForce4 420 GoGeForce4 420 Go 32MQuadro4 500XGLGeForce4 440 Go 64MQuadro4 200/400NVSQuadro4 550XGLQuadro4 GoGLGeForce4 MX 440 AGPGeForce4 MX 440SE AGPGeForce 4 MX 420 AGPGeForce4 MX 4000Quadro4 580 XGLQuadro4 NVSQuadro4 380 XGLGeForce 8800 GTXGeForce 8800 GTSGeForce2 Crush11nForce PCI HostnForce 220 DDRnForce 420 DDRnForce 220/420nForce APUnForce AC97nForce ISAnForce SMBusnForce AGPnForcenForce IDEnForce USBnForce LANGeForce 7300 LEGeForce 7200 GSGeForce 7300 GoGeForce 7400 GoGeForce 7300 GSnForce2 PCInForce2 AGPGeForce4 MX nForce GPUGeForce3GeForce3 Ti 200GeForce3 Ti 500Quadro DCCGeForce 6150GeForce 6150 LEGeForce 6100GeForce Go 6150GeForce Go 6100GeForce4 Ti 4600GeForce4 Ti 4400GeForce4 Ti 4200Quadro4 900 XGLQuadro4 750 XGLQuadro4 700 XGLMCP51 ISAMCP51 SMBusMCP51 IDEMCP51 SATAMCP51 LANMCP51 AC97MCP51 HD AudioMCP51 USBMCP51MCP51 HostMCP51 PMUMCP51 MemoryC51 MemoryGeForce4 Ti 4800GeForce4 Ti 4200 GoGeForce 7900 GT/GTOGeForce Go 7950 GTXQuadro FX 3500GeForce 7600 GTGeForce 7600 GSC51 HostC51 PCIEGeForce FX 5800 UltraGeForce FX 5800GeForce FX 5600 UltraGeForce FX 5600GeForce FX Go 5600GeForce FX Go 5650GeForce FX 5200 UltraGeForce FX 5200GeForce FX Go 5200GeForce FX 5500GeForce FX 5100Quadro FX 500/600GeForce FX Go 5300GeForce FX Go 5100GeForce FX 5900 UltraGeForce FX 5900GeForce FX 5950 UltraGeForce FX 5700LEGeForce FX Go 5700MCP55 ISAMCP55 SMBusMCP55 MemoryMCP55 USBMCP55 IDEMCP55MCP55 HD AudioMCP55 LANMCP55 PCIEMCP55 SATAGeForce 7300 GTGeForce 7600 GoC55 HostC55 MemoryC55 PCIEGeForce 6100 nForce 430GeForce 6100 nForce 405GeForce 7025 nForce 630aMCP61 ISAMCP61 MemoryMCP61 HD AudioMCP61 LANMCP61 SATAMCP61 PCIEMCP61 SMBusMCP61 IDEMCP61 USBMCP61MCP61 SMUGeForce 8600 GTGeForce 8600M GTQuadro FX 570MGeForce 8500 GTGeForce 8400 GSGeForce 8400M GSGeForce 8400M GMCP65 ISAMCP65 MemoryMCP65 SMBusMCP65 IDEMCP65 PCIMCP65 HD AudioMCP65 AHCIMCP65 LANMCP65 USBMCP65 PCIEMCP65 SATAGeForce GTX 285GeForce 7000MGeForce 7050 PVMCP67 MemoryMCP67 SMBusMCP67 Co-processorMCP67 ISAMCP67 LANMCP67 SATAMCP67 AHCIMCP67 RAIDMCP67 HD AudioMCP67 USBMCP67 IDEMCP67 PCIMCP67 PCIEMCP77 MemoryMCP77 PCIEMCP73 USBMCP73 IDEMCP73 PCIEnForce 200GeForce 9800 GTXGeForce 8800 GTGeForce 9800 GTGeForce 9600 GTGeForce 9300 GEGeForce 9300M GSQuadro NVS 150mQuadro NVS 160mMCP77 SMBusMCP77 Co-processorMCP77 IDEMCP77 PCIMCP77 ISAMCP77 LANMCP77 HD AudioMCP77 USBMCP73 HostMCP73 MemoryMCP73 ISAMCP73 SMBusMCP73 LANGeForce 7100GeForce 7050MCP73 SATAMCP73 AHCIMCP73 RAIDMCP73 HD AudioGeForce 8200m GGeForce 9100GeForce 8200nForce 780a SLIGeForce 9400GeForce 9400mGeForce 9300ION VGAGeForce 320MGeForce 210MCP79 HostMCP79 MemoryMCP79 PCIEMCP79 SMBusMCP79 Co-processorMCP79 USBMCP79 ISAMCP79 LANMCP79 SATAMCP79 AHCIMCP79 RAIDMCP79 HD AudioMCP77 SATAMCP77 AHCIMCP77 RAIDGF108 HD AudioGF116 HD AudioMCP89 HostMCP89 MemoryMCP89 PCIEMCP89 SMBusMCP89 Co-processorMCP89 LANMCP89 LPCMCP89 SATAMCP89 AHCIMCP89 RAIDMCP89 HD AudioMCP89 USBGeForce 425MGeForce GTX 550 TiGeForce GTS 450GeForce GT 550MGeForce GT 635MGeForce GT 555MGeForce GT 640GeForce GTX 560MGeForce GT 635GeForce GT 710GeForce GT 630GeForce GT 730MGeForce GT 735MGeForce GT 740MGeForce 825MGeForce GT 720MGeForce GTX 750 TiGeForce GTX 750GeForce GTX 745OTI107OC2325OC2183OC232682C092G82C557 Host82C558 ISA82C568 IDE82D568 IDE82C621 IDE82C70082C70182C82282C8613G+ UMTS HSDPA010L100L110L200L210L400L800Lx10H100H200H400H/800H800H200HV2011HOX16PCI954OX16PCI954KExsys EX-41092OXCB950OXmPCI954OXmPCI954 DisabledExsys EX-41098OX16PCI954 ParallelOX16PCI952OX16PCI952 ParallelOXPCIE952 ParallelOXPCIE952 SerialQStor SATAPMC/GNIC2ToolsRZ1000HSP MicroModem 56Virtio NetworkVirtio StorageVirtio MemoryVirtio ConsoleVirtio SCSICMIC-LECNB20-LE HostCNB20HE HostCNB20LE HostCIOB30CMIC-HECMIC-WS HostCNB20-HE HostCMIC-GC HostGCNB-LE HostHT-1000 PCICIOB-X2 PCIXHT-1000 PCIXCIOB-EHT-2000 PCIXHT-2000 PCIEHT-2100 PCIEOSB4CSB5CSB6HT-1000OSB4 IDECSB5 IDECSB6 RAID/IDEHT-1000 IDECSB6 IDEOSB4/CSB5 USBCSB6 USBHT-1000 USBCSB5 LPCGCLE-2 HostHT-1000 LPCK2 SATAFrodo4 SATAFrodo8 SATAHT-1000 SATAHT-1100HT-1100 SATAVerite 1000Verite V2x00SH7757 PCIE-PCISH7757 PCIE SwitchuPD720201 xHCIuPD720202 xHCIT1/E1/J1Dual T1/E1/J1Quad T1/E1/J1ISP156x USBSAA7130 TVSAA7133 TVSAA7134 TVSAA7135 TVSAA7231 TVPS5000PT80C826PT86C521PT86C523PC87550PT86C523_2PCC-ISESPCI PC WDES1849I/O 1076I/O 1077PCI 6520PEX 8111PEX 8112PEX 8114PEX 8517PEX 8518PEX 8524PEX 8525PEX 8532PEX 8533PEX 8547PEX 8548PEX 8603PEX 8612PEX 8613PEX 8614PEX 8616PEX 8624PEX 8632PEX 8648PEX 8724I/O 9016I/O 9050I/O 9080Cronyx OmegaPDC20265PDC20263PDC20275PDC20318PDC20319PDC20371PDC20379PDC20378PDC20375PDC20376PDC20377PDC40719PDC40519PDC20771PDC20571PDC20579PDC40779PDC40718PDC40518PDC20775PDC20575PDC42819PDC20267PDC20246PDC20262PDC20268PDC20269PDC20276DC5030PDC20268RPDC20271PDC20617PDC20620PDC20621PDC20618PDC20619PDC20277ISP10160ISP1020ISP1022ISP1080ISP12160ISP1240ISP1280ISP2200ISP2300ISP2312ISP2322ISP2422ISP2432ISP2512ISP2522ISP2532ISP4010 iSCSI TOEISP4022 iSCSI TOEISP4032 iSCSI TOEISP4010 iSCSI HBAISP4022 iSCSI HBAISP4032 iSCSI HBAISP5422ISP5432ISP6312ISP6322ISP8432PWDOG185008580RT2460ART2560RT2561SRT2561RT2661RT2760RT2790RT3060RT3062RT3091RT3092RT3290BluetoothRT3562RT3592RT3593RT5390R1010 IDER1011 IDER1012 IDER1031 PCIeR1060 USB DeviceR1070 CANR1331 MCR1710 SPIR3010 HDAR6011 SBR6021 HostR6025 HostR6031 ISAR6040 EthernetR6060 USBR6061 USB2RTS5209 Card ReaderRTS5227 Card ReaderRTS5229 Card ReaderRTS5249 Card ReaderRTL8402 Card ReaderRTL8411B Card ReaderRTL8411 Card Reader80298139D81298101E81388169SC816881698192SE818081858188CERTL8192CE8187SEQemu PCI-PCIQXL Video5C465 CardBus5C466 CardBus5C475 CardBus5C476 CardBus5C477 CardBus5C478 CardBus5C521 Firewire5C551 Firewire5C552 Firewire5C592 Memory Stick5C822 SD/MMC5C832 Firewire5C843 MMC5C852 xD5U230 Memory Stick5U822 SD/MMC5U823 SD/MMC5U832 Firewire5U852 SD/MMCRS56/SP-PCI11P1 ModemViRGETrio32Trio32/64Aurora64V+Trio64UV+868ViRGE VX86C92886C864-086C864-186C864-286C864-386C964-086C964-186C964-286C964-386C968-086C968-186C968-286C968-3Trio64V2/DXPlatoTrio3D AGPViRGE DX/GXViRGE GX2Trio3 DX2Savage 3DSavage 3DMSavage 4ProSavage PM133ProSavage KM133ViRGE MXViRGE MXPSavage/MX-MVSavage/MXSavage/IX-MVSavage/IXSuperSavage MX/128SuperSavage MX/64SuperSavage MX/64CSuperSavage IX/128 SDRSuperSavage IX/128 DDRSuperSavage IX/64 SDRSuperSavage IX/64 DDRSuperSavage IX/C SDRSuperSavage IX/C DDRTwisterTwister-KProSavage DDRProSavage DDR-KSonicVibesSafeXcelMagicLAN SWL-2210PXP941A10xNeo-4Neo-8SK-98xxSK-98xx v2.0SK-9D21SK-9SxxSK-9821SK-9843SK-9ExxSK-9E21MBladeEngine2 10GbEBladeEngine3 10GbEIOC3Rad1TigonIOC4ImageSync 1STG 2000XSTG 1764Kyro-IISTG 1764X64GXDVDmagic-PROSC9230186C201 AGP86C202 AGP648FX AGP86C20585C503 System5595 System85C503 ISA180 SATA181 SATA182 SATA183 SATA1901915597/5598 VGA6215300/305/630 VGA315 Pro VGA85C50185C49685C596530 PCI540 PCI550 PCI85C601 EIDE620 PCI630 PCI633 PCI635 PCI640 PCI645 PCI646 PCI648 PCI649 PCI650 PCI651 PCI652 PCI655 PCI656 PCI658 PCI661 PCI662 PCI671 PCI730 PCI733 PCI735 PCI740 PCI741 PCI745 PCI746 PCI748 PCI750 PCI751 PCI752 PCI755 PCI756 PCI760 PCI900 10/100BaseTX961 ISA962 ISA963 ISA964 ISA965 ISA966 ISA968 ISA1182 SATA1183 SATA1184 RAID1185 AHCI540 VGA530 VGA551155125513 EIDE5518 EIDE5571 PCI558155825591 PCI55965597/5598 Host6204650 VGA6326 VGA6330 VGA5597/5598 USB7002 USB7007 FireWire7012 AC977013 Modem7016 10/100BaseTX7018 Audio7019 Audio7300 VGA966 HD Audio83C17083C175FDC 37C665FDC 37C922Voyager GXLynxEMLynxEM+Lynx3DMLynxELynxE+Lynx3D910Victory66 IDEVictory66 ISAVictory66 USBVictory66 PowerPirahna 2-portTulip, power, switch extenderFPGA I-Bus Tracer for MBDSZB6120CXD1947A FireWireCXD3222 FireWireMemory Stick SlotRS780EasyIOVelocity128PCIO EBus2HMERIO EBusERI EtherGEMSimbaCrypto 5821Crypto 1KCrypto 6KPsycho PCImicroSPARC IIep PCIUltraSPARC IIi PCIUltraSPARC IIe PCICassiniNeptuneSBBCST201ST1023ST202140XX4018A50XXNE-344S2P4SSpectrum24 LA41X382C10182C10382C10582C565 ISAMC322TC9021 GigEB2C2 Sky2PCTN3009TN3010TN3014DC-290(M)DC-690CDC-3x5UTerratec TV+Terratec TValueTerratec TValue RadioTLAN3DLabs Permedia3DLabs Permedia 2TSB12LV21 FireWireTSB12LV22 FireWirePCI4450 FireWirePCI4410 FireWireTSB12LV23 FireWireTSB12LV26 FireWireTSB43AA22 FireWireTSB43AB22 FireWireTSB43AB23 FireWireTSB82AA2 FireWireTSB43AB21 FireWirePCI4451 FireWirePCI4510 FireWirePCI4520 FireWirePCI7(4-6)10 FireWirePCI7x20 FireWirePCI7XX1 CardBusPCI7XX1 FireWirePCI7XX1 FlashPCI7XX1 SDPCI7XX1 Smart CardPCI6515 CardBusPCIXX12 CardBusPCIXX12 FireWirePCIXX12 Multimedia Card ReaderPCIXX12 SDPCIXX12 Smart CardPCI1620 MiscXIO2000A PCIE-PCIXIO3130 PCIE-PCIE upstreamXIO3130 PCIE-PCIE downstreamXIO2221 PCIE-PCIXIO2221 FireWireXIO2001 PCIE-PCIACX100AACX100BACX111PCI1130 CardBusPCI1031 PCMCIAPCI1131 CardBusPCI1250 CardBusPCI1220 CardBusPCI1221 CardBusPCI1210 CardBusPCI1450 CardBusPCI1225 CardBusPCI1251 CardBusPCI1211 CardBusPCI1251B CardBusPCI2030PCI2031PCI2032PCI2250PCI2050PCI4450 CardBusPCI4410 CardBusPCI4451 CardBusPCI4510 CardBusPCI4520 CardBusPCI7510 CardBusPCI7610 CardBusPCI7410 CardBusPCI7[46]10 CardBusPCI1410 CardBusPCI1420 CardBusPCI1451 CardBusPCI1421 CardBusPCI1620 CardBusPCI1520 CardBusPCI1510 CardBusPCI1530 CardBusPCI1515 CardBusPCI2040 DSPPCI7420 CardBus5634PCV SurfRiderR4x00TC35856F ATMR4x00 PCIToPIC95 CardBus-PCIToPIC95B CardBusToPIC97 CardBusToPIC100 CardBusFast Infrared Type OLongRun NorthbridgeMem1Mem24DWAVE DX4DWAVE NXCyberBlade i7CyberBlade i7 AGPCyberBlade i1CyberBlade i1 AGPCyberBlade Ai1CyberBlade Ai1 AGPCyberBlade XP/Ai1TGUI 9320TGUI 9350TGUI 9360TGUI 9388CYBER 9397CYBER 9397DVDTGUI 9420TGUI 9440CYBER 9525TGUI 9660TGUI 9680TGUI 96823DImage 97503DImage 9850Blade 3DCyberBlade XPCyberBlade XP2HPT343/345 IDEHPT36x/37x IDEHPT372A IDEHPT302 IDEHPT371 IDEHPT374 IDEPyramid3D TR25202ET4000w32pAET4000w32pBET4000w32pCET4000w32pDET6000/ET6100ET6300IGA-1680IGA-1682IGA-1683CyberPro 2000CyberPro 2010CyberPro 5000CyberPro 5050CyberPro 5202CyberPro 5252Santa CruzUM82C881 486UM82C886 ISAUM8673F EIDEUM8881 HB4 486 PCIUM82C891UM886AUM8886BFUM8710UM8886UM8881F HostUM8886F ISAUM8886AUM8891AUM9017FUM8886NUM8891NUS201USR9979023CP5610V961PBC i960 PCIV292PBC AMD290x0 PCIV960PBC i960 PCIV96DPC i960 PCIK8M800 HostK8T890 HostPT880 HostPM800 AGPKT880 AGPK8HTB HostVT8363 HostPT894 HostCN700 HostCX700 HostP4M890 HostK8M890 HostVT3351 HostVX800 HostP4M900 HostVT8371 HostVT6415 IDEVT8501VT82C505VT82C561VT82C571 IDEVT82C576 3VVX700 IDEVT82C585 ISAVT82C586 ISAVT8237A SATAVT82C595 PCIVT82C596A ISAVT82C597 PCIVT82C598 PCIVT8601 PCIVT8605 PCIVT82C686 ISAVT82C691 PCIVT82C693 PCIVT86C926 AmazonVT82C570M PCIVT82C570M ISAChrome9 HC3 IGPPM800 ErrorsKT880 HostVT82C416 IDEVT82C1595 PCIPM800 HostVT8251 PCIVT8251 PCIEVT8251 VLINKVT83C572 USBVT82C586 PowerRhine/RhineIIVT6306 FireWireVT82C596 PowerVT82C596B PMVT6105M RhineIIIVT82C686 SMBusVT82C686 AC97VT8233 AC97RhineII-2VT82C686 ModemVT8233 ISAVT8633 PCIVT8366 PCIVT8653 PCIVT6202 USBVT6105 RhineIIIS3 Unichrome PRO IGPVT8361 PCIVT8101 VPX-64VT8375 PCIPM800 Unichrome S3VT612xCLE266VT8623 PCIVT8233A ISAVT8751 PCIVT6420 SATAS3 UniChrome Pro II IGPVT6410 IDEP4X400 HostVT8235 ISAP4N333 HostVT8377 PCIVT8378 PCIPT890 HostK8T800M HostVT8237 ISADeltaChrome VideoVT6421 SATACX700VX700 HostVT6655PM800 DRAMVT8251 ISAVT8237A ISAVT8251 SATAVX800 DRAMChrome9 HC IGPVT8237S ISAVT8237AVL80x xHCIPM800 PMCK8T890 IOAPICPT894 IOAPICCX700 IDEP4M890 IOAPICK8M890 IOAPICVT3351 IOAPICVX800 IOAPICP4M900 IOAPICVT8237S SATAVT8251 AHCIP4M890 SecurityP4M900 SecurityVT8378 VGAPM800 PCIVT8231 ISAVT8231 PMGVT8363 AGPCX700 ISAVX800 ISAVT8371VX855 ISAVT8501 AGPVT82C597 AGPVT82C598 AGPVT82C601 AGPVT8605 AGPVX900 IDEVX800 SD/MMCVX800 SDIOK8T890P4M890P4M900VT8633 AGPVT8366 AGPVT8361 AGPVT8101 VPX-64 IOAPICVT8363VT8235 AGPK8HTB AGPVT8377 AGPVX800VX800 PCIEVX855 IDEVSC-7174 SATAGDT6000/6020/6050GDT6000B/6010GDT6110/6510GDT6120/6520GDT6530GDT6550GDT6x17GDT6x27GDT6537GDT6557GDT6x15GDT6x25GDT6535GDT6555GDT6x17RPGDT6x27RPGDT6537RPGDT6557RPGDT6x11RPGDT6x21RPGDT6x17RP1GDT6x27RP1GDT6537RP1GDT6557RP1GDT6x11RP1GDT6x21RP1GDT6x18RDGDT6x28RDGDT6x38RDGDT6x58RDGDT6x17RP2GDT6x27RP2GDT6537RP2GDT6557RP2GDT6x11RP2GDT6x21RP2GDT6513RSGDT6523RSGDT6518RSGDT6x28RSGDT6x38RSGDT6x58RSGDT6x33RSGDT6x43RSGDT6x53RSGDT6x63RSGDT7x13RNGDT7x23RNGDT7x18RNGDT7x28RNGDT7x38RNGDT7x58RNGDT7x43RNGDT7x53RNGDT7x63RNGDT4x13RZGDT4x23RZGDT8x13RZGDT8x23RZGDT8x33RZGDT8x43RZGDT8x53RZGDT8x63RZGDT6x19RDGDT6x29RDGDT7x19RNGDT7x29RNGDT8x22RZICP82C592 CPU82C593 ISA82C594 Wildcat82C596/597 Wildcat ISA82C54182C54382C53282C53482C53582C14782C97582C925SVGA IISVGAVMXNETVMCIEHCIUHCIVMXNET3PVSCSIVMIP9000P9100WD33C193AWD33C196AWD33C197AWD7193WD7197WD33C296AWD34C296WD9610W83769FW89C840F 10/100Linksys EtherPCI IIW83C553F ISAW83C553FW89C940FW6692 ISDNLinksys EtherPCICF32APlatform DeviceVolari Z7Volari Z9s/Z9mVolari V3XTX3201-3CardBus EthernetMini-PCI V.90 56k ModemMini-PCI K56Flex ModemCardBus 56k ModemCBEM56G Modem724734738737740740C724F7441221PCI-ST32Genie TV/FMDVDZD1201ZD1202ZD1205D-LinkMartin-MariettaHauppaugeTTTechDynalinkCoregaRhino EquipmentCompaqSymbios LogicATIULSI SystemsVLSIAvance LogicNSTseng LabsWeitekDECCirrus LogicWestern DigitalAMIAMDTridentAcerDellSiemens Nixdorf AGMatroxChips and TechnologiesToshibaMiro Computer Products AGNECFuture DomainHitachi MicroSiSHewlett-PackardPC TechnologyAsustekDPTOptiElsaSGS ThomsonBusLogicTISonyOak TechnologyWinbondHitachiSMSCMotorolaPromiseFoxconnNumber 9UMCITTPicopowerMylexAppleMitacYamahaNexGen MicrosystemsQLogicCyrixLeadTekInterphaseContaq MicrosystemsBit3OlicomSunIntergraphDiamond MultimediaNational InstrumentsCMD TechnologyQuantum DesignsBrooktreeSGIACC MicroelectronicsSymphony LabsSTB SystemsPLXMadge Networks3ComSMCAcer LabsMitsubishi ElectronicsSurecomNeomagicMentor ARCAdvansysFujitsuMolexMacronixEvans & SutherlandNVIDIAEmulexIntegrated Micro SolutionsTekram (1st ID)NewbridgeApplied Micro CircuitsTviaRealtekNKKIO Data DeviceInitioCreative LabsHighPointSigma DesignsVIACogent DataSiemensZnyx NetworksAcctonAtmelVortexEfficent NetworksIDTFORE SystemsPhilipsCiscoZiatechCycloneEquinoxAllianceSchneider & KochDigiMutechXircomRenditionServerWorksAlteraRicohCorollaryAcardZeinetOmega MicroMarvellLite-OnV3 SemiconductorPinnacle SystemsAT&T/LucentDolphinMesa Ridge (MAGMA)Analog DevicesZoranPijnenburgCompexCycladesEssential CommunicationsO2 Micro3DFXATMLC-CubeAVMStallionASIXIntersilNortel NetworksSilicon MotionEnsoniqTransmetaRockwellDavicomITExpressPlatformLuxSonorTriTechAlteonUS RoboticsNVIDIA/SGS-ThomsonPericomAurealADMtekPacket EnginesForte MediaSIIGDTC TechPCTELBrainboxesMeinberg FunkuhrenCNetSilicomLAN MediaNetgearMoxaLevel 1HifnExar3wareTechsan ElectronicsAbocomSundanceC-Media ElectronicsLavaSunixIC EnsembleMicrosoftOxfordChelsioEdimaxTamarackWorkbitSamsungAskeyAvermediaMSIAironetGlobespanMyricomVScomAvlabInvertexBroadcomPlanexConexantDeltaMyson CenturyTopic/SmartLinkENEAralionTerraTecSymbolSybaBluesteelVMwareZoltrixMellanoxAgilentQuicknet TechnologiesNational DatacommPacific DataEumitcomBrocadeNetSecZyDASAtherosGlobal SunSafeNetMicrelVitesseLinksysNetoctaveAltimaAntares MicrosystemsCaviumBelkinHawking TechnologyNetChip TechnologyI4ArecaNeterionRDCINPROCOMMLanergyRalinkXGI TechnologySilanRenesasSangomaSolarflareOptionFreescaleAttansic TechnologyAgeiaJMicronPhisonServerEnginesASPEED TechnologyAWTFusion-ioQumranetASMediaRed HatEtronFresco LogicTekramTehuti NetworksHint3D LabsAddtronNetXenNanjing QinHeng ElectronicsIndustrial Computer SourceNetVinGemtekTurtle BeachMosChipXenSourcec't MagazinDecision ComputerQuancom InformationssystemeIntelInnoTekSigmatelAdaptecAtronicsNetMosParallelsTigerJet NetworkEndaceBelkin ComponentsARC LogicINVALID VENDOR IDcy82c693_writecy82c693_readcy82c693_initcy82c693_init: bus_space_map failed (%d): broken match/attach! : unable to map device registers : couldn't map interrupt : couldn't establish interrupt: invalid memory type %d , using %luK of on-board RAM, can't map on-board RAM: can't subregion offset %lu size %luchannel 0channel 1configuredwirednative-PCIcompatibility, %s %s to %s%s: %s disabled (no drives) %s:%d:%d: bus-master DMA error: status=0x%x %s:%d:%d: bus-master DMA error: missing interrupt, status=0x%x %s:%d: unable to load xfer DMA map for drive %d, error=%d %s:%d: unable to allocate table DMA for drive %d, error=%d %s:%d: unable to map table DMA fordrive %d, error=%d %s:%d: unable to create table DMA map for drive %d, error=%d %s:%d: unable to load table DMA map for drive %d, error=%d %s:%d: unable to create xfer DMA map for drive %d, error=%d %s: couldn't map %s cmd regs %s: couldn't map %s ctl regs %s:%d: bogus intr %s:%d: bogus intr (reg 0x%x) %s: couldn't subregion %s cmd base %s: couldn't subregion %s ctl base %s: couldn't subregion %s channel cmd regs %s: port %d: device connected, but communication not established %s: port %d: PHY offline %s: port %d: device present, speed: 1.5Gb/s, speed: 3.0Gb/s%s: port %d: unknown SStatus: 0x%08x %s %s channel: cannot allocate channel queue%s: %s cannot allocate channel queue: unable to map BA5 register space : DMA%s: couldn't map native-PCI interrupt unknown interrupt%s: using %s for native-PCI interrupt %s: couldn't establish native-PCI interrupt: couldn't establish native-PCI interrupt: couldn't map bus-master DMA registers : couldn't map IDE registers : DMA %s: channel %d: cannot allocate channel queue %s: couldn't map channel %d ctl regs %s: couldn't map channel %d cmd regs %s channel %d: can't subregion DMA registers %s: no known timing values unknown SiS IDE type %d %s:%d:%d: multi-word DMA disabled due to chip revision %s: no compatibility interrupt for use by %s %s: unable to subregion %s ctl regs %s %s: cannot allocate channel queue%s: %s %s to %s mode %s: %s ignored (disabled) : no DMA, unused (couldn't query registers), unused (registers at unsafe address %#lx), unused (couldn't map registers), (unsupported maptype 0x%x)%s: unexpected PCI function %d : 5597/5598: unexpected PCI function %d , (unable to map ctl registers): cannot allocate channel queue , %s %s to native-PCI compatibility %s: bus-master DMA support present: ATA133: ATA33: ATA66: ATA100 (unsupported), (partial support)not responding; disabled or no drives?other hardware responding at addresses%s: %s ignored (%s) %s:%d:%d: cannot allocate DMA maps, using PIO transfers %s:%d:%d: using DMA data transfers %s: restore for unknown chip map %x unmap not yet implemented for this chipsetpciide540620630630S633635645645DX651652655658661733735746748760962963964966968port 0port 1port 2port 3: can't map mem or i/o space em_rxeof: NULL mbuf in slot %d (nrx %d, filled %d)%s: em_dma_malloc: bus_dmamap_create failed; error %u %s: em_dma_malloc: bus_dmammem_alloc failed; size %lu, error %d %s: em_dma_malloc: bus_dmammem_map failed; size %lu, error %d %s: em_dma_malloc: bus_dmamap_load failed; error %u %s: Unable to allocate rx_buffer memory %s: em_allocate_receive_structures: bus_dmamap_create failed; error %u %s: Unable to allocate tx_buffer memory %s: em_get_buf: slot %d already has an mbuf %s: unable to fill any rx descriptors %s: Unable to create TX DMA map %s: The EEPROM Checksum Is Not Valid %s: EEPROM read error while reading part number %s: Hardware Initialization Failed: mmba is not mem space : cannot find mem space : cannot find i/o space : flash is not mem space %s: Unknown MAC Type %s: Unable to initialize the hardware %s: Could not setup transmit structures %s: Could not setup receive structures %s: Unsupported media type %s: watchdog timeout -- resetting %s: Media change is blocked due to SOL/IDER session. %s: Unable to allocate tx_desc memory %s: Unable to allocate rx_desc memory %s: EEPROM read error while reading mac address %s: PHY reset is blocked due to SOL/IDER session. %s: No GCU found, defered attachment failed Could not write PHY the HV address register Could not read data value from HV data register %s: phy read timeout: phy %d, reg %d %s: unable to read phy %d reg %d gcu0%s: init failed, error=%d : can't map i/o space : can't map mem space %s: timed out waiting for BIOS %s: pre-2.0 USB rev : can't map interrupt : can't establish interruptpciide_machdep_compat_intr_disestablish calledpciide_machdep_compat_intr_establish called&sd'(3  P@X@CA\@d@l@t@|@@@EB@@@@@ľ@̾@ؾ@ܾ@@  6(,-)*+./'$ LJONP IK  DD DDVl(Vl DDM aTfE O fF K0Ƒ6m/EUAK۔q,W*f?dtŖee[1<\Q:v%yp:2 PikBVF!Qo%FF|5ofJrX19L3 u5nKMOaujA,puH\pqqaR(w `qRrTjEԗE^*cpA?^p~LWAxAO:SA#D' n-҉]yխQ d] Iv!3-Jˠ,)P/ww=C!!?^glVmTL\fyg:b  ... export VNAME=$(sysctl -n kern.osrelease) export VERSION="${VNAME%.*}${VNAME#*.}" export ARCH=$(sysctl -n hw.machine) export OBSD="OpenBSD/$ARCH $VNAME" export PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ umask 022 set -o emacs set -- $(dmesg | sed -n '/^root on /h;${g;p;}') rootdisk=$3 if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES mount -u /dev/${rootdisk:-rd0a} / echo ! : > /etc/rc echo 'erase ^?, werase ^W, kill ^U, intr ^C, status ^T' stty newcrt werase ^W intr ^C kill ^U erase ^? status ^T cat <<__EOT Welcome to the $OBSD installation program. __EOT timeout=false timer_pid= if [ ! -f /tmp/noai ] && ifconfig netboot >/dev/null 2>&1; then echo "Starting non-interactive mode in 5 seconds..." >/tmp/noai trap 'kill $timeout_pid 2>/dev/null' EXIT trap 'exit 1' INT trap 'timeout=true' TERM set +m exec 3<&1 4<&2 >/dev/null 2>&1 (sleep 5; kill $$) & timer_pid=$! exec 1<&3 2<&4 3<&- 4<&- set +m fi while :; do echo -n '(I)nstall, (U)pgrade, (A)utoinstall or (S)hell? ' read REPLY if $timeout; then timeout=false echo REPLY=a else [ -n "$timer_pid" ] && kill $timer_pid 2>/dev/null timer_pid= fi case $REPLY in a*|A*) /install -a && break ;; i*|I*) /install && break ;; u*|U*) /upgrade && break ;; s*|S*) break ;; !) echo "Type 'exit' to return to install." ksh ;; !*) eval "${REPLY#?}" ;; esac done fi  . ..@ bin dev etc mntAmnt2qآsbinqB tmp usrvarinstbin.profile* install.mdupgradeinstall  install.sub md_installboot() { } md_prep_fdisk() { local _disk=$1 _q _d while :; do _d=whole if [[ -n $(fdisk $_disk | grep 'Signature: 0xAA55') ]]; then fdisk $_disk if [[ -n $(fdisk $_disk | grep '^..: A6 ') ]]; then _q=", use the (O)penBSD area," _d=OpenBSD fi else echo "MBR has invalid signature; not showing it." fi ask "Use (W)hole disk$_q or (E)dit the MBR?" "$_d" case $resp in w*|W*) echo -n "Setting OpenBSD MBR partition to whole $_disk..." fdisk -e ${_disk} <<__EOT >/dev/null reinit update write quit __EOT echo "done." return ;; e*|E*) cat <<__EOT You will now create a single MBR partition to contain your OpenBSD data. This partition must have an id of 'A6'; must *NOT* overlap other partitions; and must be marked as the only active partition. Inside the fdisk command, the 'manual' command describes all the fdisk commands in detail. $(fdisk ${_disk}) __EOT fdisk -e ${_disk} [[ -n $(fdisk $_disk | grep ' A6 ') ]] && return echo No OpenBSD partition in MBR, try again. ;; o*|O*) return ;; esac done } md_prep_disklabel() { local _disk=$1 _f _op md_prep_fdisk $_disk _f=/tmp/fstab.$_disk if [[ $_disk == $ROOTDISK ]]; then while :; do echo "The auto-allocated layout for $_disk is:" disklabel -h -A $_disk | egrep "^# |^ [a-p]:" ask "Use (A)uto layout, (E)dit auto layout, or create (C)ustom layout?" a case $resp in a*|A*) _op=-w ;; e*|E*) _op=-E ;; c*|C*) break ;; *) continue ;; esac disklabel $FSTABFLAG $_f $_op -A $_disk return done fi cat <<__EOT You will now create an OpenBSD disklabel inside the OpenBSD MBR partition. The disklabel defines how OpenBSD splits up the MBR partition into OpenBSD partitions in which filesystems and swap space are created. You must provide each filesystem's mountpoint in this program. The offsets used in the disklabel are ABSOLUTE, i.e. relative to the start of the disk, NOT the start of the OpenBSD MBR partition. __EOT disklabel $FSTABFLAG $_f -E $_disk } md_congrats() { } md_consoleinfo() { } #!/bin/ksh MODE=upgrade . install.sub while :; do ask "Root filesystem?" $ROOTDEV resp=${resp##*/} [[ -b /dev/$resp ]] && break echo "$resp is not a block device." done ROOTDEV=$resp echo -n "Checking root filesystem (fsck -fp /dev/$ROOTDEV)..." fsck -fp /dev/$ROOTDEV >/dev/null 2>&1 || { echo "FAILED." ; exit ; } echo "OK." echo -n "Mounting root filesystem (mount -o ro /dev/$ROOTDEV /mnt)..." mount -o ro /dev/$ROOTDEV /mnt || { echo "FAILED." ; exit ; } echo "OK." for _f in fstab hosts myname; do [[ -f /mnt/etc/$_f ]] || { echo "No /mnt/etc/$_f!" ; exit ; } cp /mnt/etc/$_f /tmp/$_f done hostname $(stripcom /tmp/myname) THESETS="$THESETS site$VERSION-$(hostname -s).tgz" enable_network startcgiinfo munge_fstab check_fs umount /mnt || { echo "Can't umount $ROOTDEV!" ; exit ; } mount_fs feed_random install_sets (cd /mnt/var/spool/smtpd && chown -R 103 corrupt incoming purge queue temporary) 2>/dev/null finish_up ELFa(4"4 (nnpppPMPMUU44TTTۣepppOpenBSD -L0! MP@ -0P `P dp3P ;@POU8 ٥ (4$PP Υtd -LMP`Up 0S /Jt0PPQ @Q #P P0 iꄈt p-PLM@P`D xhMЍ=0,0d -"L<MȂ0r"`8K01\P@H =1#P  P0Sl `Ÿ X08@ : P4  0` $8 000P  10S000 B 1 0S0 SǑ10S 1!0!0S !l 7000@1@1@0,10S0(!1 P R `@T00SRT!0$0S 0S  0$0S 0Sl 1p(K, (d9 <(l -TL@}"PD 05 4u"P 050  =إ(c" -LM K `1p@Pq1  0Sc bR KR MR% GRkR gR=mR wR8+ $+UKTH0@P%$+U?T<@P%$+U5T2U![RE-Q*0 0 !$/U"T0 0 @P 0xS S`p *S d1#pU T 00 ,帐00" y  -Lq0 $, -Lh0 $d 0-LMK Pp@H1 @ 0S> bR KR MR GRkR gR  mR wR $P0@ (%T%@%T!ER00 !P00 @0xS S *ST8,0 (D800" Yy  -0L00(d -0L00(, -L0̊ -Lx P00 -Lm0 -Le 00d, -LM$`K✠p圀&9 @P!P @Q` 0 D Տ 0R00 (0S\(d_00 R0 ,d -L 嶏 -L 孏 -L 夏 -L 囏 0-t0LP d0  a0R00BAq 8@0P 0R0 : 0,d -L1P``8q8L  <PP  / 0S P00OU0@0V 0000 00 0U0 0 0 0S0|0e 0  `/e0 f` R*Rb80 00d$Ц 0-LMPK&P \}0: S D4 K@{P0: S S000K0m @ -ELP40  k{PD40S0o DP4000 T0$ 4L{P 0l h4P$A{0000S|TD$(4 0S 0@=0Pc0S 0/0P 0(0PdpS $0   $0 D0; S 0 @c$ #"0,c`V bwt"0spy2Q 0Sl*0  Q 7 P Z "0  ld0 00s0 0 0 0  P0 0 0 0000000 0 00 00P 0 B000 Ha00ؐ0q@P00Cs01 1R 0R!0R 00 l R R *p bQ 60 00$00S8,J̊d($4D؛< -d2LuM0Pb4K4K 0( P,04 0  bR, 0@=94 0 =,0 4K 1@@,PQ 0 0yyOKP PP0!dPP5T@ K6 P R T1TRMKd0K0C 0C8t 4 D , 僂P2Y0-S) 埋РBKAL L P0 70$RpB.K0 B Bxpppp}0Hy0<$ $p(t@Hx  p4 -LM@pP3 PP 0S nS6 =m`P00QD @ Q? P 0V0S D 0 YppV 0`p(KY" 0 0 p 0oSPġ00 0K0 ?R0S@p @ `0 p00ꨡ0"S 0($P 0 0d_ (ة -L M`PP, @,K0pK 0 g,0@S w)$K3MЍ0 -LM0S S SL0 0@K0(( KhC0h>X@[ Y -LM0S S SL0 0@&0(( Kh0hXP[ Y -0L  tt` -Lp,P`+@P 0 `$00$ (0@ -L`PVp+@P  07p0-  3m( 謪 -MLMCPa b`P ^N@ +P $@TY  1 r3P t`@ $@TYK(PEPE)0apP10S0#3P aPPPUp VQ@Pp(P$@T VC@唐PK 00 0`Y(VT B  $@T(K`ȟĪԪX Y -L0 K M, H$0@H @0 000 ?Pe bP@@  H$娽p$00#D < 8 4 0a0@SMl$$$$$$$$$$$$ȫЫ$$$0SdcBF2@ 2P R r@P00SxRbRbRPP,`pWP 0  s00 2U" D0@ 0S9P $@T 0K\\MPPDBHK@P ,d ! < 10D0 80080 4 H!ps1 pR18 040DR0Q  R`Z00R00S< R (10S00SD1APP ,@P@ @0r0 0K;<Q 00S  00 $0SVPH PA0pK  0KeP  _P`Fv@T妛`U(KTt|Њx,`Xt`0MЍ  -0LM |ttX -LM@P` 0`mTp 0S W  0Kt p-LMP@t`P P@p|x qP@^@ -2LdM2\Ÿ\[` @ll2d @P q``VJD \ X 0Q < 8 <`K `pT P0 05Q@4@ 0P PC L H @0H P TPe0##pDdD 0 | L@K00`p4PK` P `$qD``卯 V(K<K, @P'  0^ 0l4 0 P @PP**@P 0\Ko L H <K0 0TK`p@*\\< LP H` XP吂e%8`0ᐖ)@HP Y@ p-L M#`K @PIp QqKp Kq, -LMPp `5E$0@!0@ !k -L@MX 0  q `0T P "0V@<0 8@ T@K00<K@PSL@ HP P0@D0 @@ @ Pa:@*0@D @ < @P哂8W%)@P TPPeq'h L H0  <K_:@PLK]  0 p1 dp`1 R+ $`@P,@T P4@ 0P P`q 4K9:@P4: 0n 0|`p04Kp(Kopp)@P 0n D @ <K0n 0TK`pXD K 0` pwp4Y@P\t[< -0LMPpP`+0 R ; (0 $  0Sp0 RpW @PP$ (0UOK$K(KD7p<@ 00$ @.pܬ| p-LM`P& 0S# nS$ 0 @@,)PD'0PP@`00@,Px40oS0 ` T\ 0-x0LM0PS Q @Q  :P,0 r380 R88\ -LM 0S0 R3 ZP"p`0@S 0  tP "10c0\/ -p Xo 1"0c90 Ro3\ -LMp$K(`P $@PUO PPK -LtM`P$|p/ P0@$S$4ܼ̼P#LpD3D#Q 43 R,K P A0pS hA&P, PKp Py0: S Se ! 10bP,AࢾPkt2 Rk ,`1 i tPE pPWn v,`@P-PXUO Xi1 R]  w31 R\1]1 Y1 U1 1NX1 Jh1 X1C41 ?, < t 嶗"10c,0PPP,`嚗0 RX 0 RT 受P w3~,` `O px<<t\xHl -0BL M0 j 0`PP\%1R  0`P (K\%1R004 堑 000\%1R@ = 0@8P3ot d F,pp<@D_@0e,pWp , 0C@$0(@,0 @\@`@0gPZ ;-0Z 7-t (d  80$_@P(<` @TP@ P, 0C@$0(@/,0 TT(^ܭ -逑MLK 0@BP(K#@1RL0S `f`0R30 @0@c&0&a&p(&0E`&` @b@cP @P   0@Q  0@$0(@0 \0`0,0 DPZ ,Z ,t GS5H4(^MЍ -LMPYP@@P ,M`P @FP |APl<pP \7PD2P < 0-$(ܭ@D  -LM 0klt -LM@`CV( P(pKVl P 0S -SH01!@!=P0@0@V@ Kd_ p-LMPP` 0S@W!Kp+@+@@6$P  0` @2+  0-` LM0PS@ 0S  0S 0S88h p-LM`P& 0S# nS$ 0 @@,~0P 0PP@`00@,jPx4A0oS0 `  ` 0-x0LM0PS Q @Q  P,0 r380 R88` -0PLMP` JPp( ` @(K* h<`p`3@(@0&T00S  Kd_ -LM`$KpP$0PP? U @PPK@ -L4Mh0@`pX,0 k0St 08k 0DSH  `T 8 R P R   0S`7V k00@T0WSP1' 7hhW@ TTzkPL7Q,`@' Vkk! 6`V '`k!@ 6`V&Uk! 6`V&Jk! `t6Vpp&?k0S!! R <6`V4\0T&/k0S!! R 5`V0&k0S!! R 5`V0%k0S!! R |5`Vt0%j0S!! R <5`V4\0d%j0S!!R 4`V0(%j0S11S TD`V$j0S `V1$j!j!j!j4Vj, 0R(K0SJ 4`V`$j!@P% `V j)0D$4` 3V0j0hSS F@KTKl T P0 R0.0Kwj@P P[ Pz0St!Rh 2`V\ßX0P#PVj0S"\ 2`V(0 #Ij2 t2`Vll">j2 H2`V@@"3j2 2`V"(j2l `1V"jcN_Z PX XjTTKLK˒`1PTV|A@L#0"PiE\T"i`J^"1R!P!1 0`V!i1 0`Vt!i1 `0VT!i @P0S 1 `D0V@ !8iiphH@<HDL\dlxȯܯԯ^T(^ [0@ ($,<z8@- @HPX`th -L)MMğ~KpG`pG , P@^P #T@U ᑸ`sP_ Qf@ ~PP K@A@ A <0d Ld: D3qd A R ()id:S@"id:@S [Ÿ, 0R(Khp@r PeNK@Db@DO0"'@፮맕0S l @0S0Sx ~8P$&`&NKᖸPaw_KZ ?P {K 9P1 R( @JoKhZ *PW{?K h^\KA P<h:#4(1 R0SQP@C ?=yڿtP g 孑k&NK8Pa¿\ 彿|x帿Rh`dhp(^3|Ȱ԰Щ40|- -AMLM@7 8`Pp, 'epJ A0@6S6d<,P6p%p5 `bA0V84 Vu VZ @ ش`P PP50S{ |PP \PP (0EP@5 oPjpe4 RD#\4 X}PS|pN4 RI pEhjP@Tp;H4 75 4 1.4 R `84@ 0@@Z00S qPO uS 8Po \nPr |iPdlT3 R?BKHH8P{ PJ ?P@0 0  IP P 04Pt000D00~ 04 2 0@MPP B.K B BlLP@4PLpY uBK@@`P[PᱳPP1 @P  P  P 84 |`zP☑ZFP`TR@T@Z@`iP} LᒳPP84即PP84 ||jPP0DB0S 84 | P@ PUO 0tEP 0xpܭt8d(Щ`x $dȟB04pȱ<MЍ -LM. 0[ditt -GMLl1M da `!@0P$4  >|> > .'p. 0b0CS/[>KQ0C 0C A@p KAPD?@T 6: S"  S anK`F`F@ "pW@ܭP   P @TDP y= =&=a\= x=t= l= U,=.T=P=L=|.8=4C<X.D>=:<,5< .<<,< << < X< << < (< |u  0 &R06 \4VD'D7U v@@^6 %WU  & 僐 b I $F0F@$@J#&R 036 5%:W!vW pU71C0eP ?71C0`P@06&C#00R* FP Q F 6 S 6 6S< 6 A6 S<^:;AP  0&"1. `` cc  &  &6 R R &A60#r0P`6 1 H$0@T~ ^ P *&R6pp 1H$P`P`V  t &w3 R0S3 R  bP3T@1t K@ĕVP  sP p *p R00Y0S 0rS Z ``? V5  U @ RP0@X S P P 0v Q  Yx^ \ P Q T e/P 00B0R SW 00B0R SQRM  00B SQG `RIpRGqaPB ? R.R<t300 Q &R&  5S 5SMKx bpp u8PU 20 @  @ `v 6q0#0P` OvPp،x$tXp@(, Ȼ048p<`@D THL?@Tĸ  @<X/@DedA\|м [(^@\dlxĽp0Pd\`gfffhpDظAȹ(̽hػxȺ P0  0ᘯP &p= S{V&\u6 S F &Tu 6!&a 0 . `& @P 0 2" p0! ] ^ 2 6S22S \< D2^0B0 & R 0@, & l& 6 `@P p! 0b]@@T@!^: Q0 &R0:S P03 83Q2S*& RXC 6Sh3B@6 L!!  ^6R 00 T@#_6S%%R006  P0xc5 0S 05 Q5 6 % &6H_ QX^Qd^l^Qx^%5^Q^6S%^^TDP^^Q^ $PU , 0R)(K t (t]K@@5E K@@5 E @pP8 &R%6"&  ^660X*0 ^PPS00Sw %5Rs PpXn:@X &0ST#3*&/p 6PX[ 6 S! 6&SX*cQP60U&00Q5*6 S 000S 0%6R X0 5S X R 0SRaAr@U0U A1!A&jpZ 6PRt@6 # 06U0$!4060 !40 4 06 0!4 0  40 ,40!̠!4!05#Ƞ##0  %$0""Ƞ"$ %@"̠""    $ !$ )0`,)00SY <9 4  (089 [NKR@Dp@D6)7 0St 0C0 [0C)00S @T U0U 1!\&M XU:QQ ( 520#$ 0 0 P0C"$ "40 ::  0@!Nav. 4 0  6\ c[NK@D@D6+nP 00 5 % \6 S(+{ 5S,+s 5S0+k %?RX5 c02?  5 % M Q<P 5P } @ S(8<T E l @ 56S?  EpPY&r<Q &R5FU 0%r%)<R66  Q$ T  %r UP:UP6Xp4XIA@Phy=H48yYP!aQ1XmLtQXhA@`P0}|Xl(`hIH)Ti<5`H x x\ -0LM ƸLtt| -#L`M#0㘣p , 0x0 0S`pAPUH#3p a0@S\$###d$0$($`0`K1`x ` Pxt KiWP4Kx bWPXql$%|$|$BWWPx t:`0S0 t 3` l h 0SD PKx@K 00 Q/ PfP6P `000C S61|K 1|0`SpP !T  0l0 00 Ql0S$h0S xVP(, 0R((K` t C` P  0l0 xtP彷v}x喫p哫ch墾`孷X7j0 奷pptt@ht@xgtMЍ - 0LM 0ᴷ:tt$ -LNMԂԢ0S( P@`2"IK\2A0PL4: S 2x"l2Q0T. pP< BNK@D@D0<"pz PP1INK2@D2t*IP0S9 2 R_0S$ ~PP( 0Re$KINK@DP4: S|h<1c\ 0UP1OK0PA A P+$4R$4R$4R0 R | iP0S? 0<<᪪,帽pT\w|tx| -LpMP@!pp+ L0@'S>++++++++++++++++++++++++++++++++++++++++$1 0bSQ`$ S' S 10pKP20: S 0 0 0 0 0   QP @P PQ 8t|xMЍ -LMP(@`pp4B@D 0T@-P-D-D-D--D-D-D--D--D-D-D-D-D-D-4- t0gl 0O@8PC 0F ,0S 0O 0Kp=>P?> -LM*Q QP!000@S8@00_0S| -LM@R0P| -CMLML (L :0H 0, PD t @~ ,̟0 0@@TBKNN@4 X XH$SPT XP00X#RP 00pP 0/S pX@P :@P~ 00`BPCVk ;P`KpP ߢPj ;@TKBKJ0PJ >044 PS[L$440XH$PLY@@T D D ˟, 0TR(KP=V4 % 0S!T 0S `,@P44 4$  P44 4$   | w@4T0@4 44LX0]P w@@ V0gLC10Q wP*VE 0SB BKJLtJ 0R0X0Sp3 @0P 044 S  w44\0`PB.K B BL\ P @9V8`{P $vPL 㦕L 㠕4$0BSL4(Ñ aw@L@ UP L/P  0 Kw@@ dBPBKJ0J U044 S+  0 /w@@ _$P"BKJ0J 7044 SL, 0  w@40 (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpxhpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    h p x @4 c;;SL$( \PBKJ 0J044 SL$8}  0 v@@ tPBKJ0J 044 SL0^PBKJ 0J044 SL$4H@PC 0P>  P9 P4 P/ P* P% P P a0BP4 0S0SLP8^:^L`0B8&Vl BK@JQJ0 0\   `v@40@4 X @`Q0 m0\  Iv@P@ T V, DPP P3 l4@T000C S 4$ 0 @4 04S   v 4$ TL0 TL0`W "P4ß v@$ @$ TL0hC1 0TL0ࠀXh XU> 1@0 PP`8 T, 0 044 `8 }; @@z;A@TLX0`f BP0 h u@@ Hu@@ PL4 T >P$L4"T$  P  u@@ Uy  @0 PP`<$ k T 0 044 `< ; @@;A@TL0M [u@40@4 F Tu@$ @$ ? Lu@@ 4$R+$p,8t`$(^4T\Dظ9pLlxЎ4 -LM@PK@|f PC 0S@ 0,KX?MpP5 ,080 uuupu`ZKp@ P0PK2  p"_x0S PZx @uuuu,IJx@$Kd P 0SL00#4P 7xP00aa -LM@"x00CS`J J J J J J J J J J J J JPJ J@J J J J0JHh襢<h}t0hyt$huthqt$x -L M0S0S% 0EI R2!Ů( , Ὦ0 Ṯ4 ᵮ8 ᱮG<PP@ 0x妮 @P\0@SlPUPJ0p00 000P00 Ap0@ @00@0  0H00@ `Pa0P`0 `p @@0P0 Pc 0S S/`!1X X 0S 000P00  s(Ko 0S1  03 > P0 5 / *&_00C   l 0BX 0:8x (08@T\hxtL| -1L$M @R_1 R 1 RI a LP|Vxx a0,KK@ A0BCGpD@EPF`H0KP`@ PpK`l1`V " ,0aPPP0@ @PD,P0P`V0,0St$Kl0ST`h |LPTePuLP@^8[ 4  rdA, ,edAsd  p-0LM0008`@P0S xd FLP PUDD =LP x(:xWEV-gdedA  p-LM`@P1P e/P iV  xhx _, -L─$M4 `("HPpP@00  80 0 `("8@@p00@0N 0  0 00C 0SX 0Pl08#HP P4@@8Pa 8B0Q00 @PԬ 0S# 0ͬ 0S% 0!Ƭ14!R 0徬1 RX0 00CS0W0 0 0(K h10!`姬 0S Ƞ,Ƞ08囬 0 00C3 0 01 0 0 0 00CC 0qP ("8 Ƞ @,HP``pP04@p@P00`a 0pb0 (KoG0 (KoX\|(^,xtD - L M00 33 ; Rp3 !h3d 0 .T 0 )BCD@EPF`Gp@ A0$ P@ P`p 0 FX02 R00CS00  0( , 0 8 4 G<PP@ 0 T7\\\ 0 0P0H00 (Ko>00 (Ko>LtHd` -P1LM PR- 20P( P& P$ P" !AR pP`" G@P% @@T QT `Pa 00/S ! t0xd>p X0^>AP$4V ,إpt9 -LMCDE@FPG`@A B0pP@ P`@ 0S P P0P $>H Dq0P00 Kh>Kt@T p-QLMP4 *P. a`@V00?(V \9@ @0@0 @0@@P@@yAx(dd` xha THxh\xhh 88P,0 Kph=,t  0-QLMP0 a@Q00?(Q` 8h/ \ \\ \ \ 8h(9@ @0@0 0`0T!X8h  LLP@$0 K0hx= $8ht@T  p-L M L`0K( K 0K0`0@ ,P `凹p (KKp7Uh -L\M`K@X pGPP 0prSP-00Q} @@Qw ?P1( K0X00C8Spn?l???q`1@ =1TP`> T@T`0SP`00CS`0NX0  X0ll ?PP \孒PD ,@ᥒP2 @T > 0<>`0@ <1TP`> T@T`0S x )u0ሠ0C8S(K@@ uX -u00tH<\ -AMLM08 ,0 0S0 0^<4 1 \|, 0R(K P0p4t 0 `p@4T0d P@ `P`4T 0d 0 P` 440D0@pT44 0D : 8d0 c0c#"raa`  +>!'>8 08 0BKHHhQ  `>@ ,DK P/ +4[,$[ SSa B RR8t20@8 <01p<4X SP0`@0D Tp4TU;0 R `00CS`0 X0  X0hX PtcX at^pp @  M-LCMT hITTBK8PH0@0pHPT , ,4KPP E(0K 4R S 0C4BP,[?\8=,[?\3X 0= ᗊPh,K0So02P 0Sxȟ0`00h`00CS`0 X0  @PLD HT X0,, 0LHR(K*\ \UL L H D @$  LD0t0   D\ P 0E;T$8 P`LH 4$  07; LH 0';p5  B$ 0S @L4 HD 0T 7 R4L$H4=+P M 6D @$ <$ 84 p-\+\PP `0T `iBK0A0AFmpi0"S 04 R@TUTD@d 0<$849L H +V -V~LH$Y L H$ wHTu{{+4[Sg @0D @ LD HT g0E(@Kp4WS%000ӑ%0COS񟗣lxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx,xxxhxxxxxxxxxxi@P0LD HT 00@L4 HD @P LD T,5H$ 0S @L4 HD %LH L H TD( 0>0D @ 4Gh,[p< 8 (T$( Q Pq`0OO$  !5;BED4 @D 04GB,[p0<4 8D T( 00D @ 4G,[p2 <$ 84 $GTTp80",[D @ < 8$ T4( 00D @ 4G4R,[@p`vp v 80(@PU 0 4!  ~ 04 00 w 04w 04T4@ 0 4@0ᖄ## @<8 0@D7% @@4%A@@ p`t -L,M2<0 8 804 0 <` 9ᘀ@\\@P`pP@p@ P08xx! @P4@K0p0pp* w1 P8 <8 0P`0 10Z  0 R00$/ 00X%! 4(K4@W4 K $4廙Y (  t t H  -QLM0 3 aIZ0000(Z` (Ko蕙0  20P` p0@ (Ko胙00(0  0 T50 (Ko6 887P,0 (Ko3t  t   -(ML8 `)p@@0P\0XX"`p `p0Pp] xi 2 R B0  00.(Kf A0 SP80 @P 0P /0U T08 P ༙9@㘀p@ 0`Q 4 0 40K 0S@P`V40 0@ :8@0 0@49 T 0 TSq 0O30Sy h0A3SQL# 0033 U@$   tH   -QLM`N aP@U00? (Ur \9@ @0@00 0@K$P K(` Kht5PP9PPP H<KhT 44P(0 Kh2t    -LMPpc U a@Q00ϓ8 SQQ8 "@  0S 9@ @0@088\20    8808#8P8@0 4  D  4   P `   R0SRP `  hp d֗(K. L2LG2@08< \< `P弙ᘀ8@[P:8yP5<0P`0(0 @ Q Pd&  V]Z V^[  Pʀ " @@08P8 8P8P D40 0000.PK0@ @00@000\00S a0.PK.0K 0xx-0K PP P0\1x\ @(GoUUt0 `   -L$M<G 0PP@@P!0 `p0 `p4 0 4 rT 7<@ 0@0@Q4 PG 0PP@@PDL1` X4K0@TP !p0 `ppP`+ 7<@  0@ 40KQ V$ 4KP00``|dTP40KP0(K00s\\0 (Ko.1q880 (Ko%1U      t -LnM0e/ K,0 Rt6t20hFh!dUP2 XÆP: Lf@P 廆PD p@PT`U 2 502P` 500P@!`pV5 R`00CS`0X0  X0Ud200@@V UP`8#8@00, P  y,@P0 $`p `p0p pw ,0@P0 $`p `p0p p} 08@P0 ll$`p `p0p px 84@P0 $$$`p `p0py pl 484C 0C`0A 1 A @TA R 0SSr 0P`@@0@0Q a f $0p`p@ p@ pQ  /,  1.1(x p1.v X1l.p ``@PZ (1H.d0S* 1(.[P0@`@w_K`0@a0@TḀpr?K 0S@ @0P ` Ko !_0B 0SKe/+S 08O. 8嘚pt T\lH -L*MgKJ0J e/ ,0 r0: RP MP GP ; KAA   }PP[( K0S@ (K0@ @0@0 5 S:5 5S:5  e/ K0 e/K, 60:K@0@: J : -  |P V}@P |Q}PuQUQ 0ApS@ԿX p`TD4(ԿнT5E MY0`p: @P 0STHK@ @H 0p 4tPP  0.-s  )Y Ke/iPA P< NKKAe/[ +37 RR ]/@   P ǟ, 0R(KT. 47 Re , P7ǟ e/'NNK@D e/ K e/e/K x l /UR l@Pl  0/ `@0p`p @TP0,,@ P.0 0  0nU @@ 0 c5 R  [ ]WU $0N 0K0 $0E PB Y> =: 7 3ğ$00s03S0>.' Ke/P NNK@De/ Ke/ e/K O L Id.04 R L4 R 2 44", ( 0P3 @|#00@@T  u0P~ Ke/G2N.(K0S (K (K@V0`@ N lß(Kh3开(KⳀ 廅Ką 弅KNKe/K@"e/ K    3 R `00CS`0QX0  X0q0 |:K{*KX 0d`2 RT2 Rf "P P|"0000ӑyS PX"0000ӑnSP4"00ӑyP/ @pPYA-`A 000<00C0V嶄S岄JX c PPE 0SB 7 1xd+;  l@P e/K ,0勄((dV%L e/@P- 5北TV@/ Cp -6j,Dlt9`p-  ,t  T rdA nhXld| ,ĪDXMЍi' -T0L0S@640P (0 0 06؎--h. -LM, ,0Q 8P60P300S.00q|Qp P0 `DV U@0`, 0S@P,0P0 0R|Q :Y4 6 0 ؎- p-1LM0SZta0SV h100CSXHTQL1  D1\5\\1Q0000.1@ KK@ .P@#0T@0T0\ L` 0{Q_ 0z@TP 0{Q T0T0 <00SPU5@Q5Kp-4- -؎m-d -?MLMC`pP30S9 SQV'5QVp3 0{QXP#V500 Q R30SŔ 20{QsX"]P ?KK(@DR@D?+lP78@K0 3K4 &.PQX0 : LK4 .PDX0," -?KK(@D@D?+CPP3X0! ?+5P @%X!8K0@ 3K4@ -PX0x!4><1Y@B P K 4 -P0W0 !40 @_ 0z n4 0K>0, 0 K-PW ,04  ,0 `0WPV(K؎܎(PmtDp- 0-0L@T 500S ᧏Pڼ 0P0# ;;S 0@ ᒏPp0 @ L0P@TPzW0D ?4 03@0؎---܎ 0-T0L?M0S@00S ?KK0P@D?+[P 0K0؎ -lb0LPPP2 \7P@8"000"0P002PU GUE&Pڀ;;SB a 0-zQ8pPď LP01@P1+W0S! W0S W0ESPV0 SD|3 $1 V0S V0S V0S  0@TT0 0 00TSPP T0 M3V|00t 3 l00Q EPL73823-Ԏ؎܎@d -t0 0LSd0 \@ 0y RYLPV$ H3؎Ԏ -3LM0S2 2 2mP2 20S 20S 2"2Q 220%R0S d2BSP 0: SH0D@@d2?@X20S L20S @BPT00132P K x 0#4 1 10S 10S1 +6t1 X1 0S<1 41 R(1 DhQp0S1X!p0p00000S2 @0S 0 6p`V 0 0 %PEP 0 \0 B00 @00@P0  0|$0pK --- -؎4.^(^h.--8.0.$܎-,4-X p-LMP K`@.LPt(0P? T ( 33T  ((h@((L@ 33 0oP KpX -L M0U@p2 5 005 5 5 5 5 4 QdTT$4@  $*PU0$1h4pG 4Q !ATP,KC "p"0S , P3 "n0S S(0<K#2 !000@0P,K R0S 10S 10S  hZl1  24 K,P 0S $10S 1 0S  FZ0 U4KQPPQPP`&PB V D004` L00S!(KD.-<.d\. 4.-. . -bMLMP00S %P >P ,00<Pb K @@ K<. -LM , 3S 0,Q, 0 SPWhPTp`P R, PPU@$P= P:W0S9 ],P p3S P 0!0# @ 1S#Wh0S X6,pPEUH ^e,(,@-- -L M 0(K *P1`E 0 p @4 @0P 00p3PbPT+MV p \*0/S0C7SC-p 0RP`C!CR00 Q0%2>&B P`L 0S W*` P0@ 0P!00*0@00P*-S0!P \P0307 p-t0LM0@SP#X]P`K 0f᳇0S ᪇Kp -LTMp=Pa=0`P`VUTSd@`@a ◧pPK 0@<0PpK0@KZ 0KP)\)h)-0 CR 0R0 SG00 -LlMDŸ@Ÿ^ \P`p^q Ep28Ka=0  RQTSAAa 7 0@xK 1PxK0C@t1P[ 0P8 KP Ps8100CS (1 ,8,$8 #4sa=0 sxK00S y F0 0BSR׆  h00S [ hF$K(.-P)\),0t)4)))) p-4L0S$1`@ PP>000-S 00 00 00S  phY 0P0P! P ṶP00:U0S ll00:SLQ10 0 $(0s?Pp-x-tt)) P00 0P-L 0S^pPАРP(,q`P=l@P  P||@P0VPPS0    Up 0S))$* -L A}<*t -L 7}\+t -LlM@P㐀K/pE@`0@NP ;0pSP  P!0: S 0( YVp$K3 -LM K`\ 00s@PIrF 0SC kR bR&mR wR!$+%$+*$&U*T'0@P 0 !$/UT0 0 @P 0xS S *S d1#pUT@P@P 0-LMK@PuPP00S0#3 oPp0@ 00S S00 0P@80     B@0 0 C8- -LM8 8 4 /|/P800O0WPo匟p , 0 00@JS@BHBBBPB\BBhBtBBBBBBBBBBBpABBBBAABBBBB@BBBBBBBB(BB4BBBBBBBB@@@B@@BBB@BB@B8@@A AA,A A4ADAPABhAp,^,NP 040 = |(? = 0-S0S, c 0,0 i=W= pe-00-=  X=bPVT \-00P= 0-00-0F0=1,,0 00== Z  0# P0 G<00 @0< 00< < << <0|, x<0 p h`, 48L,pp,0S=;0S , ,<4 ; 0BSPZ H{0B8 SaW`00JT000 3:P/@TK D`p.Px[ pMtPP ` 0PyPPqs+0S  @PP  R h h0`0 0L*eP`ZPY :{{h*Wd:0`*W0T DP9P` ^P\Z00J@T000 6³P2@TQ `P CPf屳PP |sPP l /PQP(嘳Pr0S"  @PሳP P P10`00 P`%8x唘儈ZP49 ,PlG0S 0Se`P 0S]70Z88儧P0c00@JS^pLLLLLLLLLLLLLLLLLLJLXKhKLKKLLLKLLKKLLLL LLL8LHL\LLLLLLLDHLH|HHLHLLHHHHLHHILIIJJ(J8J4HLJp膟@~P6PP 6P 6P 5P5 P %d6@P X6P 5\ 6P\@phv`*a0BS!xIIIIIIIIIIIIIIII`00000 ` 00$00tS@ R[[,PZ45Z (5Y h4Y X3`P tP @T 4X` tD"d@ R,n@@ Tj#3lQh4QPL S84@44@00  ,FWK 4W K@-@dP0V0= QaP8-3&PV/-U0"U0##0T0dPT]PSS0 ,#R00 R00 Q0048"TpB @1("(2 P  " R  2R  B P/ T1Q ) (1 \-nXr` `0 S|@5\#naP(20S`00CS0 A0  0 @P00S!1 |00S񟗏LNLN0P0PO8 P8000hA04Szh.4--x---`..8.-D.ܐ-d.)X. .T.-------.t 0.`ȟ4.-X.p.@t..0@...,.. .<...@-..$.إ/-..(.00C00SӴ0S 0/S  <S   $<0C<0S HKP,r0 @ P.0S p E P;0W  R H y,0 RR(K0 D.h.01H1l1 Ћx11111 p-t1L`QV `1@TR T1 P00pH010S2 R010S*.VPP  R/00Pp R/0000 @0/S0000t0 @p0 S H QLp00d 0 pp8.. 2@2 p- 000L@PT`00S* 00S&#0 00/S  P @T T`\0@0S dP00ppp00s3p8.. -PPLp 0St@P\``H<0` p`( P0@@@@\2t2 -LM`P R@\S@ S @0S S_㯽PPxJ p jP00 BNK ;Z 0$4ᨺ\R@ 0S @ Rᙺ0 00PP GP gP pP00 00 }0d 00 P@08 S0PPPP K2223@3 -PLPMPPP `@K`K⫬ r00Sxh33 . 0-L MP K@zP 0S pK0 -LMp,$3P2#PP 0SR`@ @DT 0r/S bPT  /002 0S80S50S-10S(  0R# 0R!  0R S  0R 0R   0R 0R\pp ,=0 -L@p  Q.SW}p 0S0C WP `Pm 0##!>C=S0Hcp0H S^Xii4iiiihihiLh 0 <#d !>Cv.B B 0@<#!>C0   0##@!.CDR  k?C0  0!!!.A0r03 R0S )0B0@ 0#"!.B0r03R0S @ 0##!>CS0@ 0#!>C;S0ᨙpq -pPL 0Sd&/Mq`P00  S,UXB .UQ   w PR00EU0@P} ZV 0SP00MR CR cR mR00000X_ $0` R0 0S P 000X% 0S" P 9 ᭷#000  0R  0R 0p# ᗷ\0P P0@@@@, T4l444445<5 0-@PLD 0SA Q0SP4 0#S \S0#S@P@   # @]|׻p0Q0 R 0S  &P 00@ 00  0=x555 0-@PLD 0SA Q0S婹P4 0#S \S0#S@ᘸP@   # @Ӷ|养p0Q0 R 0S  ԹP 00@ 00 g 0 =5,6L6 -@Q@0@L@ M@!Qp$`K 0^0\$0 QT 0 K0.00P:$0 1 -h LM0S T`p0PU 0 P` V$K, - LM0S0 0p0`C 0 SP1S  `F0Sp 0S  0XT pW*X 0N  00 0(K$(. -` L0S `Lp0PU p@/-TP` VD' -0LpW- 00S)00S% S# S! ; 0`ᗺ@T h0S 0S 0R 0@S 00iD(  -L@LP @08 0P_ $-p6 -LM@`Tp. LPU& 0S 0S0 S 0 PS(K00@K0! ) 00 #0 0嗵ᕵ(K,= -MLM`10S`P H10S 0/S BKAAYP` ' 1 Q0Q蠟0 [pP 0@K,K 00 0p۾p0 0@OP   00PK1,0,K 0 0@嶑 Ỿ00 0崾(K$ܐ6(-6 -LM@PU`p> 姹P 0S 0S0 S. (K00K0! ㇾ$PP OP ` p0@ 00@P0 0 0Pk0K dh (K,=6 -0L@pT` [QP 0SW 㪷@P@E 00 0` 00@0=(7 -2LM0PS0 { ; 01pW@X ,  00,0 `P 0 S0 S R30`+ 0G0 0@S@,00I 0!`P< 0$00 IP2 0@ 000 0 xP 00 P oP@00S0x@0S"P +0 080( (K04H77 -0L:P -@@L0S 0㖶P,=7 -@@L0S 0Pr0=7 -@@L0S 0hP[8$8 -@@L0S 0QPDD X8 -1L@`Tp1 Q@@T PPP' ᐳ"NP  p@P NP NP @0 00@qo$8888 -x0L@`TPp X AT ̥P  ᢥP:0E0@8 -1L@`T_ 10S] 10SY; 0hᶷ P @U, L0S 0S 0R 0@PS  ! g0  S;00 S00000CS000ߵPP MP t0+0 00 @L00040 00Pڲ(aD(  8 -MLM1@Tw pP!@T; nK`F⼑`F0S!0 M 0S0S *|!  bP  *H!^FOP @T a= 0R0S:41c`P% @ 0MQ  P a=0l0 00`\*\ W*L <J (K<G@9,9D9d99 0-@LPU 0ôPld0d@` ѻ凥P0P *08 00<G9P.H.9@9 0S P  PR00S0-SN S S  L0 00N L0 L 00N00N L 00L0B 0R00*0B00R*Pp@-^P`@L ^ ^ A0 00LA0A 00L 00LA 00AP @0@ 0P!00*0@00P*@ pp@- @0R\  0R: -5L~MP0C  Pt50SVPP P>T0>> -|0LM0 K a@PwOD0@ @忳@nO0 嵳KT0t.$3-0 CR 0R0 S+00 0-LM@PZ0 !P)) 0 -O(OPhQUTPE@H00S< K0h( K0hH+>0?L?X?l?> -@L0 0Q 0 $0Q0 $ ht?? -L@Q񟗤ꜥ <DlLWQ6 8@HPX`hpxYWUS0SO #SHFDB@><:864;0Q ȦԦܦxt1lhd*sNT!PhH0 $#$(,"(h Q Q  m0ShC <8#"h???@8@|@X@@@@@@A(ALAtAAAAAAB BHBlBBBBBB CDC$ChCCCCCDD,DPD -3LM,MQ (K@ 30S  l-*dk K(@T*͚T IK@3(@D8#0. K(@*㾚K(HJK0#(@Db*ᯚ0"*㦚20S " *㚚P% `V"@P 0 L2' 0 0(" KK(@(A*q K*(@l1 Ra 10S] 1K@1@P 09p` 026(J@P/1)K0 B0/09K00C/0A/0/0A/0 / 0 AK0L/0)K0 B0/AK 80 v K(@ *JK(@Dб (KhDP0lD0D\0DX0DDY@D^0pxE -@LT  p3p3`\0 -L$M@H <KL LH000T ,70  L L HP@j 0 `S@@ D` &0 S6 0 S pP D0 K0,0,<4 ,!4$ !$4 <,,c<0K0S@ P< 8 4 0@ =9< 8 =40 <08 P@@$4 pWş` P`^`0S%0S0S*D`0#p5 Q` R0 H 0 0 B0 00 0403  rL'W` pq*P 0@$4,<4("4! dpW\ J TXBS$3  % `4E 40KP00@000 ' 0)[R00@ 0  0 00  0`40030 ! D40<2S\[@K(P -|#K K0 KPPBk[x30 3@ *0K@P830 2@ )0K@P20 2 00KPDpB@KP,#<0K@P ;P|< 80R"80KPPn0;CS0eaBP"00PP 2Q"  "Q0S@$G 0T D@80$@p A0 p\Kl`KTKPKLPK 0   0 \0 05KP8 0T @#@PF0S lB: P0 廪 @ Ც@ R 10S:0FXxT0{Gz?0FFdAF?G04GTLGdGxG!GlGGt/.Ap0P0GGH0/`0@HHH/HHHHI0I SQ7KII y 3,p$0BO?  D80 hSRQ Xp<  0R0 80 S Q tB, 0R(K| BnK`F`F@0 040($$P@b$1C1/11p@< XP Pq\$T 21COP  pǏ R380S00  BnK`F`F@00 $0PP) P 4 #1@p$Q  $  R  $42 ~ x;PGvlI}@9dt`Pp ($0P`p|6 ODOTOx<J -L@M\pK@P< h 0$0KX T@ PP P`< ፝,0,  00C0K|%@;`<; -LMPp@/T` @0S v 00C0 _0  hshEP T0*P R  @0S ;|O;@;`<tOJ p-L@M P` KH 0S 0S  aKpO -0LM [BLttO -6LM tf@P, 500T&(p" b0@S``|``````<`````````%(p5`@TU P 딥0SE1p`0Sp`FV T @ 0S 05 R(p P 0SL0S P$0S 0S0DS -0S F 0S 0S p4|D xT0t 5 0S @4 P4  aQ$4S@ 0$@R3 3 hbQ0S 3@T @T +됃0S @T p@T X#00#LS000Sq,3u$3r3o0SR 0S 2 Rz PH &Kn-P`"0S 0;"00028"000"000l2h2m `0>0P"Sn@00!0002  0b1  pmd1 RPt 1PKKQ Ah2@000 00l |tl d\] TLzD84011(A`(->K P j pT<4PtU;;|6P8;P;;Q<t<QQD6Q$RL<p<d<`<X<x<3;;xPPz;OQ@P<<LP`QK0CD0C 5 4 < 㨗$01 $0Y44Kh$ V*(0) RVQTLt40CO e\KPE ᅗ4I( K@(4(0 0d4 `D  0\4 XD S XpX `@0  ( ,0  Ti rk  m`ß  @$P  PpXBL, 0R(K"2T⫑@(0,@ Pk(vBnK`F`F@0 00B 4t( R0SkT(0EOo 03 5" @(0,@ R n Pl6(AdU rs   YpS P 0!000p0C0@0 @$P0PX[{4 02 P/  0P tr P 4 0  0p0CX0)I P||LxBp`<tTKTL6T6@8|6 TT;T8KUX<ЋT4T@TT\T,KR Y(^,J -MLM, R0,0 01 R 0S ))0L 41 R .!KV `00-1KQ KK q~0.A[SS 0@`V)ʆTP9 (`KMK@ ᳕8 P , PR0Sȟ, 0R(KQ0.S , 0,0 R `p \\PHM ȟ 0s|m Y 0 00KK8 -1K~0.A[S `,9~P *, P,0SQ 7 R 0C= P 0: S0007  0AS?0!hh7(pK MK `&,0@f , 7 00C0 ᒕ@ Pb, Pa, RrQ3 0.Sm&Vp PPS B<  0 % ,0Sڒ.K B B@)  @ D @RKL L`p  0D D& 0@5 Ra ,0S!0СP`,0K` \P X` 0AS<'$'($'''!0QMt R PP R 0S0S00嫈  0P @`R*$K&   0u 0@ 0 P0SR@0 R*A$4 Qh<|%`<X<D6JWVW -LMQp `<P@@(T` X$W,W -LzMf0,0 !PP00UQ     4Yf(pQ 4$ e P 4 0$[ $1$- K)( 0R01K1Kl1Kf   0S*1  11( \* P00P0S 1  1pG1( \:4Q$00R 0 >.9! Q ! E 0!R!0P52 5:1  11^ʤğ0S 4 1R 0l p JKJH$ 0 x4 1RK K P$0Sh# 0 c$PM0S{ 0# S2$P`1!0  1 +d3 0AS**8-8-8-* ?,+1   1pG1[0S1 S4!0  4!  iK KP l2$1001$庑P,B H4 iK(P 1$ថ00$ᗑPA{ "~o4KQ01$K p4hAQ000E0S%\!)0 R !Q0 S  1 0`S KP ᝆᛆh, 0R(K! |@1! 0 000SLkH3<p|6d<;4WpWWW`<VWWWW<X@Xd@J0M0 ЍؑԑБ 0MЍؑ 0MЍ̑ -LM P  5dX -QLM@ lP T:4tX -PLM P 4X 0-LM/PU?@P 00+8qx/00,+ x+x880X p-LpM/P6?@P KDP0: S Kp0`rS@> ᣐ 0-PLM@P0 R 0 R 0*8ht0 R8h0l VH0 R <0<808 +?0БԑؑX=tX --LM0 0 ? --LM0 0 K --LM0 0 K -LM@|< h$3 -LRMH0@K0PP`|K<P1: S V@@ S00S D`PP$KgP T P`0 R000 [K@wP l1: S 8|((q̑3XXX --LM0 0 |>t@-$@0 0   0 0 0$  (@$, (@0@, 00M00 D@0HD LH0L 330## 330## 330%% Ѝ|6p@-`ML0$SP d040PЍpP0\ lQS!A\QS0|6 -LM@L H\P4T; a4edAY$Y -LM`p@vPP  Ua0B0S U00@ S0a>C"PP R R4144!!0 00B S  d P 00C %`dʈP0Fx3 @O$4Dn  P嶈 @04ை Ḉ?P00`CPJpY@Y -PLM@ 00 R$hbB;Y= -LMp3Wȓp4  ;@P (K蘣+  pw#|3R 4pX R0 0@@;dh8@ N@FP2@ ? $404ĊdT;2&aF!($2W?004U02P 8 00B+0S@PU^ 00  0 0 00 ,0,0 00000 330330 33033 @0L@0 D0PD00 550550 55d00d0d0d 0 d  ` d0  $1 R"4(Q4#L40G 0 B+P 0 R 4 3 d0\Yd0H `P@ 0R@\  aAF T;P6<|6SY5H4X6\6;$ZYYZYPZhZ -SML M0'@,0 7@K'0AP APX5 ` PT5: S /VPP 먖P$0S~ 6 Rm 0hSPp0Sm `&`P\v\0@P PPPPx u0SH PF P( 55,  PXEU0S 0SN.K BPT, 0R4(Kt5t@h5 R`U.3S0 ( <<%@Q e $R3 &4P0S 4 R}TyT0Sq 9 lf0S噄P 4S!@đ`4S3ē4@ \   0P VW`~P ` 00B10@g3P PLC]`3P UD3P M(3P 4cS00 20!4 S 2" -B(0"SZ PX %8 pd`P@6劖H"H2lol@@*1 Racp1XZP H0S@H0@S 44"L0# iP H0T!1|o1`LD6<}0 @u 1RypX6T<;ZRP6;;4[|<p<<\6;;d\;|6t<<,]@[[\\$[ZP]d<`<<;X<\<L6@6T6H6[\]?h[\ \@\[[[[]]h]HJ]] Y(^\\d@-0M @BT|00 Q< 1P Ѝ0<000  t<d<; -LM@@ 0-LMMpPANK@D0@D\ 0 u֊ 80  0RK0 '6p^<J -LDMR@  V0 0  r(K!PU1  00C0S  rW0S 1< hK` J0PX00K 0h0 l X T @1XK d0 ` \ X` Tp 4 hK+"0V0/ l ?00bl l  a້YV$ 0 d0 4 `` \p ihK x0 Il P` ញ E0l R/  E:``KW W 003ܑ`<HЋ -L@M04 LK00 K -LM: S S  S  S 80P , S  S  S;P^ -0 @LM蠟@@0 ` @@``EPp#p 0XDP0@@ n@kPP00TQ wuX PU<<|6P<H<(<d^ - 2LM `R^q@p@3 T1 RL1 RH0S?T 1 R9qQB0SK00CS0JX0@X0FTI T00CS0)0 R0' 02P0S  P 0S XPP YTl PyTYT nTNT YTyTXE@XE@00;R;;;^^^^ -LM0@SHO@O8O@O80S d`0 R Tj00 ,BP0000^;^^ 0-P0LM PR@  ,(&P 8  m;^R_ -L MP@8 <0 ^?4 00 t40{d0< p< PH1  M 84< RA$`4 K XO@@D_@D @ P 0P0<0S$@_@P 08P P ?  \X?004O4K Dv0<0S (Ko(Kp<$_,_;X_h_ -LM0@SP Q ?R0 Q0 h` 0`` n0T tP4Sڈĕdp@T0ē4@ \   0S4S|_p_(^<|6; -LMPs 1 R)q@Tq To `U@ P}}U` Q^!0Y00%|1 R7p19o60S P1 RD!P 04A 0Pv PkpPeP30 R" @C]@R0 R 0 @P2!0 xL0o`P `fD(;<X6(<H<P<;P6;_\6|6_<<`__ -LM\ Y -L$M@@0 ?4 00 t40{d0@ p< @ P080 Q Hm@ ,4Y@ R080 A080 Y_4 K XO@@D_@H D P 0P;80080 0@ R@_@P 0<P P ?  \X?004O4K ( O8(K(`0`;X_h_ p-h0LM@P\` D088 000 0s `Px|6;<P6 0-LPM@T 0!S0S @T@T @T 0 d 000X 0000 0 @P@8=(<|6<<``MЍ -$1LpM R  1 qf0S!  D,p@, P1 P@T P MP p*p`0SxK|P@0X S;30~P<*80800 $K<<< -LMq0`S8P00@T P@T# UnP0SP@`0S tj PP@X`T0 @T$V@PPP<J`< -LMXv0S` PW00CS00@0tR U T` T 5 Rk 0 0S`0 CR` !X0M  X0`0 CR` )X0-  X0@tO 5  0 H 0SX`0 CR` X0^  X0`0T C?@R` ş .X0 X0p P0S  @t0S40#3P50S$6#3P4 R 0Sh`0 CR` X0$  X00SG4ğ`0 CR` aX0X0pPPaPP 30 S3 0`003 R TR 3 RW # 0T0Q0SO pp )0S06#3PA 403 R 0SL`0 CR` X0^  X0`0 CR` X0I  PX0hp0R Q@ $xxpP} YZNMDkpP 0S< -$cpG^ ]pB 0Sp T?@S.^Op4 0S] IGp, P"ijP4p0RAX$Npp0RXMDp 0S `0 CR` p0RX-2pp0RX^)pp0RsX^ pp0RtXIp P~PJp0R RX.-T@(<<<<<<<x`< -0䀟LM0@`TPp +@T alPPp@`6U|0 R0`00@TPn,PP @0p,,d$0 J<`ȟ< 0-LM@Pu{!+p( b0@Sdddddddddddddddddddd d\1\ Xy(2L1 (!p,1,!0S1 R% uK+P2 ,( 0000 0 000 0000 Rl0 RX0 R00 RF<02(^`tt`<t<<<<<<MЍ -LL0 L \ 00 (0 $0 0 DD0BD -0L0 D -0L0 D -$$ 0L00  DDQd d00A00d0E( 0 QPfk-@0 0 S RP4gk -(0L00S 0 D0S 00S0 $#$("(  @-0S\\ @ T2  R T2  R 0 SR 0-h0L0 X0XPT0 P@0D j40, 0h'0D ECC8BDD5i 0-LM@jP@Ko0[P00KezPPd\@\ j0 0 00 (P K0kk8BDDi k 0-L M4PK @e 0 Ppl Uj[T0DT 00000 40402KP$K08BDi kDxBi l p-,`MLP0@ Px< -T L0R S S0RS  P0 妁k=l p-L$M<@K$ ``Pρ\ iP tP< 0,` kP T&KpDDi$ li$4l 0-L M4PK @ 0 OPxt i[T0D\ 00080 <0<02K7P( &K08BDi HlDDi Xl -4L ,i(0( p& D8BDyi hl Q-LP Y$ 1ZA@^  0(0 S^oQ@娀帐`p0 0 S V |ZtS HO X00`@0D S% 4oA蠴xl(^l,jd_ll -PPLD@DDp(` <h(0  $"@Txk(^d_إ Qp-LP` 00S  R000 ӑxR 000   r   QQ 0u03P0SLL  ph4@@Tpdl l> p-L$M<@K$ a嘀 h =p h0S0 d0S*,P%xP( % #p(@`phhP VX T`PE@TUV (2vKpDDi$lll -@L \8/tl -40L0S$00S  0 DD 0-L M@P 00S00S 0 QP K< RP Pb *@KD 6h80 0QKp$w K0DDhT>h]oo p-LM*@KxPx` |h @ApP  |0 01K3p !Kp8BDi oi o -L M K0, @7 $0 x\p  006@K|P`x  `V|d @pL  @rKp0  K`(o\8BDi oi o -LM"@K .|TT0 L@Կp [Q"0[S "0[ S HK8BDi 8o@o -LM0@KQ |!|  P 0d0 姿P q- 0`p@P0S 0   0S-|-0lS v PPU@K=DDi`otoooooo -81LM@8Kq`P  {V@! V/*P  0㐠p@ 'PK 0U{P !400`tPEe@P 0 z aP ҹ $K<Bon p-L M.@K `V{P0 @p'  xc00SA[T70K  0SK XWT001K,0H Ծp4Kp8BDi o\o`i o -L M K@,0  $`\p  0" 0@0P0S ph@cP\0@Px`h@lP @4cP,0@Pp@tP|` K@BpDp8pE@p8p@p -LPp`@P0 SP 0S@ 0-@PL0 p0 0Hp -L`"d00XTp@Pp 4 00 0  2 DdpCp 0-@PL0 pd0 0,gp p-PPL@0S00pd00X Lo<8@P`RPPPpEDppqC -@pL`@1P+P@Ttk p-L$M@`P x: <@K$ dP z` 9bT ᱽP@ 4` 娽P$KpHqDDi$ li$4l -LpT `PP hzd p0 @80 0P(@Polq$jtqd_ -L@HD008 ,$00DqqCC -L@+D008 ,$00DqrC E p-L$M PP& B`@ C0P  `4@T,AT 1S1S1S(Q$!000C S0:S Q $ P妷`T 0S,,Qw.vV@P T"R0S x@e.0S,P_.K ]2S*0S' ,R.0  K.0 aC.0 <.0R4.h/."Rd0S`@ 2S |[`1P|!A t30l 嬹P01S H10S  |0 10S  x00S 00S `p@Y(K8BDDi i8i4iiiii$t(t0t`dPY@KP PK`P ` `0!`j~jP`0 x t pP `jpj0 l jhj0h R0d0  ` d0p iUjd HpEFEE0EEEEEE`guE8 -1LM@\! pPo n1 R0SL V@P 40CS `  `0SJL0SPLP (+$1 L$L0.S% Q0S,X00 P`'0S0v03U0S  <0S d0 R LP0S DĪ8,)EEE0EhE`EX -LM@`/%Ph +iP 7'000P7  0||p<0 l'pc 10@GS#                  H @   4     $              xhX T|l\P4  0&00hP 56 p5 %Tp 5r5  0@jS5 R0S 5 R5 R0Spp5 RX5 Rp0S <0S@U 0/S 040 %0S 0S S  S $0S $4 T  4(K0S S S$4 `$0S4 R $h4T  hx3X$@4H$#(43 4#4 3 0pp3 3 3 0 s<3  3 l3x#$303 X3P3 H3<3 002"22 20000"0082 X2 2 h2!\2<"142$"2!11  !001!Q ;< 0y0S !|1 #dQ0K!d1 !T1 !D1 L1 Rl!1h!1  T8 KbPA#[R0 <1 R !0 0 R !0 0 R 0 0  0 R l0 d0  ꔂhFEEF FlEEtEEEEEEETEEEFPpEEEEEEEEht@<L`hMЍ -LLMA 0Rl h $0 ( 0 R@ @0P@PlKRRڰ@lKX?dPK0 @@OPdKZ$ 0R KQCD0   8@Q @$뀒pEE\)P)@ -:LM S=  S*  SL2 RT@`0 CR` bX0=  X0 S6 I 1 R `0 CR` nX0*  X0*1 R:`0 CR` AX0@  X0h1 R%\`0 CR` 9X0/  X0(1 R`0 CR` 1X0|  X0=S|N/I@Dp0RX=Rp0RX@Jp0RX/Bp0RX|:p0RX*2 -0LMPHp*0 RL0P R 0 R : S;P`LP` 0BO?o> 04 ^ XEEEEE؂Ђ 0-LM@PT `00CS`0X0  X0@T 0S $ 808 R (@T8X  0-0LM PR$000 R00|0 Rp0 R d0 @T V`R`800 @T8EEEEh -MLMx , <0S \4 RP4 RZj 0Sd 04H R4 R@@K凨( 0@徦3 R   嶦3 R0: S S 0S3,` D@0Rl ~KpGpG ~pc  d喦`3 RdT3 Rd 8L@03 R!$3 R 0  P P 3 R:`00CS`0X0  X0Z, 0R(K0(0  P<0SgC^KPEPE0h"dNK@D@DP"pa (0K 08B4A2 R  011 R , "8"8 #$ c0 HV1LP` p0BO?= 0@7$ 4-,(!0$aD@00YC^K PEPE0 @~d 0w a` 0BO?ѣ ϥX e\|$pFEE FEEEEEE)؂EЂ(^t$tL -(2LM0@S$0pp2` R00p1 RpTC ؁PPUK`00CS`0`X0  X0$ P@T+ 0S U0S\`0 CR` 4X0,  X08!P(00S*0S!`0 CR` &X0  X0,0S!`00CS`0#X0  X0 P p0RX,p0RX @ iX X iEEEh -LM,KpPT @<0SWT䡟@ ܡ`@T: 0S ,0S` 0S?`00CS`0YX0  `X0$ O,0SPWP0S `0 CR` X 00PX OPp0RX ]P0S'`00CS`0*X0  X0$K 3`0 R0 R |` 0BO?ᙢ T嗤@4 X )`X $FEE -LM0KXP8 d R0Q R  0 x2 0S ! R0@ ] ]P00<0SSZ> 4 0 !< a Pp<  P`!$0 Y00pW @80Sڠ!0S`0 CR` #X0  @X0`!0ST`00CS`0<X0  X0400 S40 (K @ p0RX @0 R0 R ` 0BO? l  ヹ@P 0P 0@kX v00X$ 0@@0}|EFEE -0LM Utt4 p-LMPQ@4 `@q 0  00 R?`0 CR` X0X0@Q 0S q l0  0X0 R?L@Qxp0R0 S EMЍ -pL@P`nP` < }p00pT@P a@T_l0 P @ [JP@0㕓#PU`pW*FltTtF 0-LM@P  K0K PPOp (00S K0F -L MP@ `$K 0PP.p $~ZpP 0 PP!p ,00S ٢ 9 KFMЍ 80MPP 0 RЍL -L,b M04  Cr r r0VW0 Cr P MW1 @0K@?P30PU 0 @  0 R% PUQ UZPE <14101 R Q @00@S0(K940PY& |IP @ T0 RtZP` \0@}AP 0004 $ T0Llq -p-M L M0` R P  0 R 0RKp  \"nT NANK@D@D08 ` $P $p(t` -LM0 0PT0<0@0D0RD$TT0!K800 S80[T<`p0Q80<`@pA,K,K<`$0D81 PHL P0@ =9@HL =CP00 R0 w40S)`p<`@pZ0Ϡ Al $!B30b ` 0<`@p@DTQ 0H` UX0 R0T0 `p<`@p`p<`@ph?B@BC, -LMp~`PU PPHhX@PS ` /`P/ `XPL z0Vd0PPPPPPP$0 ( (0S<0 0P000 P00000 0S0@ 0[0 U0dh PX U0$8 UUL,t -LM@P 0S@R 80_0PdS J 0 ٞt -L0M`@VP 0S xИШЈL  pH 10@<S<H8,  p'0cP1@ QPh'0S`7  0S 0S  :9 )5P 0So PHPP 0@0 P0 H0 $K P0Sr&0|TP@ PPt8KXPU T0SH80KP Q ʭ  Rc %0S0%000SMXX5 200/%00+00(00%h%00!0L0 uP:P" )P{ (Pyv@@T 0$0004 RT0SHX P W0YV 0S P`pPUxXx 8KQ R0IF 0Sz 0@  S0S00# AL R9 P R 00S \0S1 R(KP O+P000 P000040ST000V0Q0Q*P 00R  *P  > RN$/L#b HKPEڲ4[ P8KUPUHd"QnP0 S00n00( cV P0@=9 =0x!00040D QA $0< 0bS$0;0$002RT00Z00Tz0S v~ 40`!/ P  u00Sf0@`]0PdS p圠圀0L0 0)PV 0p n X h @ b (p \ <$0t(L0,xTFMbxĈ4H  -LLMsC0 0 Pp Q20S/  0)SP`02 000 R%U ^ PO0PU3 ^ K.0U0K@Y0"@ 0RK"S  0)S00.S /S00Q  Q `0P0PU8PU ^ K.00K@0!@0! 0!V- 0S% ^ K.00K@0@T!^ K.0 0K@0!@! 00S@P ^ K.0ǃ 00 v\00 0R\0m04000gx^ K.08⫃0K@寝0@ YUpL`LHD܈$ЈXLh0 -L(M⼁A0@K$0 `q@0KP0d@0(P D0 `0@0 ) R ࠓ 0 .@0@@@ PP00 00 P0   DK+ B~[P0 00 *P`0P 02S 0TX 40$040 Q K00 R Wp4LT@Ld< -"L0M0T Sz 0Sd "@P@@@ @@@@PxP`\: 㗩XPqPHH"T0KPP_0pK)$ 00` P|PU0)% P0` sP`@ : P0K4@ P@ L@ H@ D@ <@ 8@ @ ap@W x!10@Pp!01 0x1@0 `P `(K0TP00!Op!0Hp0S0P~ <p 0 2x  0 (pt0 d L0` pTP4L!L8L$FLXLHL`Ċx܊| 0M 0 ЍLtL0MS GS Ѝ -L(M0 $  ,K  K0K0@K( @,  9PK -L$M@$   ,K K0K( @,  @!PK 0-LMPKxPP@@T BP 0STS0P @ ZXU@K0 -LM@@0 S GS ,, { @0 hY꜄, -LPM☡0H@Kp⌁P `(0 HP DP @P  nx>>> -L@M@( 0RDpH L!R$ ) 8$("( Ġ"Č#4,`4P Ƞ$<,Ƞ! R@KP`孖 .0|P x壖 .0|P $ 0R  K4.  . pt$ -H0ML@,Ƞ, , <@M 0PK nL -AMLM@pT0, 8$ 0M*PU 0S  z=ZAU4 0S@G8?0aSF^40dU1^PE7WBnK`F`Fq @1  00! 0$T 1P K=ZPEu@ WU 000 T0P, 0R(KT:?WQ BnK`FBKX`F@ @04 P  =Zp̜, -LM$M"KŸ(HKH0@)K(J(PK0J "b,@ UT* <lr0h"KT* <L0H"AT *<0SBP `P70@P~0 04 1a5 0M4!0T *< *<Q 1 R oT  ?K0Q\  Q, 0RB(K4!S,!S *<:0@P 0 4`p 04 @P05 03mx0 00  @PS *Q<TpnĎnnDnDY@^LnD| 8 -LM@,ܪzT 0p3ת 0p3n p-LM` VPU ^ 0 0 )R @ TxQ ^ 0 0 )R @0,S,^t B @TP R T00S R @0   +$嫔x P:xmm nH -LM Sp3*n -LM8 匔1`   0l 傔80VG*0 48#8 p80QPf=0E S[*YU @0K R0 <( 4"4,<  00 @Up  0!48 #8(p`" #[04"4858#80S(KU 4KR3[ $#$("0U:#[Q04"48#710S`p n -L8M 0p1$ x`P.VPR@K .0 zP  PU hP`P֓U$ 0R  K4. '(Ǔ "p܏ @ -LM P0a0ᯓ@)K0K4pK  0pr@t% )0[S S 0 嘓4, K02[d#!ና8 K40C8 0 8#"{$K(hD 0-LMP \P @0)S 0 00 0S@8Q 0)S0#0CS*****************8> / 7 yȐ -4L(M Rßp3S00@@@@@@@@@PL "娓0 0j0m)Kgp3Ƞ ,Ƞ("( ",D3!, ̠( Ƞ"(,Ƞ! 0^0 `a2 pt0 0````$Q8#8 $#$2p` 22@P0KL PP L 0 H@ D@ /W00S@ RC02 (0ᣒ0P (K h t00@@@@P8#8 Ġ#Č P p|1@@K8@@,̠<Č4("Č!4 <$̌4K 4 00 l0(1 @t00@P8#8 Ġ#Č P p0t0 0@@P8#8 $#$pD0@ i0Rʉ$nn\MM nMLn`(n nMmnܐemԐn 0-LMP 0 R 0@$0 @ P0@00 ,@ (P P 0K ؼK0H0 0080 0ʎ0$  0@$0 @ nh#@@ 0-0`LM'SP@Ց 8h4(@0dS<Q<p1d1d1d1d1d11d1d1d1d1d1d1d1d1d1d11d1d1d1d1d1d1d1d1d1d1d1d1d1d1d1d1d1d1d1d1d1d1d1d1d111d1d1d1d1d1 22d1d1d1d1d1d142d1H28h艑凑001@U 0$ 8ht 0$ |8hiple0\8hT]001 88hS,((Lt??H$(  -CML Mw@0 @ 0 PR񟗋545554444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444446 66$606<6H6T6`6l646$7,姐 0RKQ񟗜77777 048< ("#剐Q{ Q ~{Qt *tu 048< ("#<f4c,`$]ZW TQNK媐NPK .0dvP = .0ZvP 30. 048#8 $#$("(RC88|8p8d8H< 048#8 $#$("(R88888fys]pZmWjTgQd2  @ Q328ޏpۏl2  / 0`S fC -*Rb L͏$<ʏ8Ǐ0ď( 徏廏帏嵏岏寏Q 媏3 夏-SRNPK .0uP 1 呏|V( ppMK∏ @D K`@D @@ 0Td P 0w$. :. +NPK .0uPa^pP0DB?Ȓؒ4@P`H0 CX̑8@?x` nHx$$Clt̓L  -82L4M ,2pA , @` 0Sw S 0n0Sb`00CS`0jX0  X0W[ڸ1""2! WW=PZK(`FVP(p. GhZ <,$!$$q, 8ێ0S`00CS`0$X0  X0`FVPpZ@` .0tP `F>V, 0R(K宎X E h+W`X城P圎X 38 npxldX -LGMMK@ B0C @" B0C D q9Pl$0S ̟0 3 00 )噵Pl,0 4̟ 0S  Op+0 R ,,00, ANGBP v ̟0Tt+00B0S }X[T+0 00000000`@AH`@ T 0X$ @˟@ 0X$ S $RF :E>K)* 0CX 5p+ M>K0C0`* RM.K44 B B:0%   4 4 ɟ: 5P0 ʟ$0R pspW@$R$ 4S P L0s 00) /,:   0)00P@@X04 .PHv 00) 30 ) B0pP UFnK`Ft `FP@  08P^l4 Rh[P`PlU@ȟ0) d$R ɟ0R.ENK@D @DPp((0P唴P7PL)0P勴PxǟE>K@)$ 0CX @~P:7)E>K0C% @tP3(@ @姉4!l塉Q @j$@T㥳墳ǟ0@l `g00 FKG~KKDJpGI J0 pG IPUS@T'0Sǟ0 T6@t (K @KPP6P0PDƟ4 H0K 4 4 4 t D ̔ Pt % R <Ɵ0R},&d6 0 aBQ6 50SpPU h5 %0:;:0%0<0%0:;70y5EKAA  6Pnş0 Ri \4 Re$Pb %000Z şx5   Q$080L$ $ H-Pq(%EKAA PGş0 RB \4 R> 1$EKAA4`p0SA \4 R= 39Pᆅ$P@0)! 0*' 3n()U.@l3Pڬ#000DEKA AL3@ R  \4 R0 S o8#0:;80SEKLL @0`$h R,"F>K"0CppKKL@@@@@@2QK.K@ B N" B0 6P0l F2 D "090!070P2 0*4 !080!050{!0@00vaEKALL0 P `$0Re 0띴Q0EK0AA \4 @@d 吴0S 0 R \4d$TQF ͝p nMM@tPnn M(nMM $nl@tM?.A'L!GFnLnnM nM@H ' nHMGpnmm'uh0n|\ĖhȚ8xdxGFИ@(D`` nxLЙ@40 *++ 0S @A0C2S2l[ZX[ZZZD[ZZZZ0[ZZZZZZ[ZZZZZZZZZZZZZ[ZX[ZZZD[ZZZZ0[ZZZZZZ[0SH"0<0\"0:0p"0;0"0:0"0;0"090YP"000<i"060d\204 `(0S33 0 T.0@>@$ 4 '\3P^l3@Y ePRp0 N ņJo0SF  វA3p3M>K0C0C 5 }EW1 0`Pqo\#,4 CP HFnK3`F`F@P)' 0lD POPz3)( 0PFP 壯4$0000嚯$4E>K00C- 00) 0   0,0Q @@$ =X5P@ d@p 4F>K0C0C@)& lD P E>K)+ 0CX pzPv  .IKK 6NLNL L6 R}{0l4 ̒@P|6l  &0\0  4). 孰P0Ps `) 0`埰P0s 0) `唰P 47$R 0)3 僰Ptl$PF.K B B0P(ҮϮl$TE>K)6 B0C`p ㋛H 儛(偛0~ @yHvLT dl hh00b ]00W R0N?<$52 $00&8)0 SD9ɠE>K@TT)0CX @Wlp @|}zwqnkMЍ 0-8P8@L4 C  0 ttd(^ - Lh -BMLMpP<E;8E04`00 ,0 6rP dP jP5`- aP* uP zP# tP#P, 000r4 8lp 000C S0 L$p00S84@,0S 0KsP Znpq 1 dR 0+S 3L4  L$ H@TPp00F S.VWppP`V@CW0P 0p `BCP_ 0RR!>C 2#=S0V5C@ PRghghghLghghf@ Td0 T?#C0 2#0@0TT!>C 2"0r03 R0S 00C0@0TT!>C 2"0r03R0S @0TT!>C 2#S0 0RR!>C 2#;S0x1@PQ0GT1pW*@10S HKpLJ 1HPK`<K0S@<0 8@ 4p Np( <K<@ 8P 40 rP/B P %㊰HQ 0+SL HXä Y ` +kPP|㈙MK@D0L$i*(^xTnXn\n t(@hMЍC0 S S  -`0@P@@T0 LQ <00S 000S.6:ldn| -L}:@PD/p p-L@.BP `-*p -2 B 0LP@0`P 0S00d2M $ -2942@B0P/S @P#*P 2 B 30S ),',%,#, 1R]P @*PPE ,U 0+S-S0Sf*Pc*Pp+]@P@`%p``7UPE00S3PZPP700S 00St0Q. /'p9v8P6PPx||Xt 000s 00@` 0-L@PU0 0 cs,% -|@L0p0h c0\0L c0D00 zc0,0 sc00ēr,%rrr -L@`0X _cP0@ Yc<0( Sc(0 Mc0@r,%rrrē -L@$000P hē 0 0S00)cė,%rr 0  cr,%0 0cr,%00S 0  cs,% 0 cr,% 0 br,% -D0L0S (0@ThVh{4ē0 0br,% 0 br,% -h@L0S X00SL0L H0b@00S40$ 0b00ȓd s,%s - 0 @L0 0b託sm p-0PSL`0S <0 S @Tp00Sg, 0-0L0S0 0mb|00Sp0` \0cb\00SDP@v,0 T@J$0 0脘s,%dsHȓ - 0 Lb hbP00 P00z- 5@K44444P4P4444444ŬPŨ40$4P 4 P4$0tP`4h$0\P@4P$0DP<$40,(P 0S$0030 K30S P 0S#0030 KP 0S#0030 K#P 0S  30 \C\S\3c pK LL0`444#43Pp   # 3Pp # 3 Ppva"0P00EPBUP 0S20 KJP2 PP0PS@  Z`|"  `% @=00 0 P"^H2 K@)1 `P0`S@ 2  B7`!  `% @=00 0 Q :1 @K1 P  `PPPp0P0ASP `100ST1  K8s@TDHȗLėTЗPԗ̗ؗ`ThnrR(^s sXsԩs r\r<r@`rrrdrrh@rrrrlps|sxthr|rhDrrrؖ -2L,M0P t2pPpLPK `2`b0S HB00nP2pR nP2 2P+ KP+ P1FP+ PA%P' KP<& P. 1P$ KP2P K P- P# K P' P X1P!              0 09[7[0@H 8@[0G  @0@ H ,0K1K+K.KX0,@L K[0 KԓГrP -PRLp@q*pq P U* ( P pU P@DTUt`l`@ P@ P@TZ@U  ip i()ꄟȟT0@-T0P?0" 0@0S0S0 R0 s@0P 400S4C sp@-@00Sp($$,F6PI`p sP<0 5-=?0S> 06S000ؓ,0 0@S200  s@-0 4D044D s 0P s 0- L0S( 4 @ 0   0A1@0Q@ DLP 4ֆ 0T4)10@0h0 s -0L 0p0q 0 -0LPU5 40 0@044D 0S"040P`0$44p Td$T(d,t$0@044D $ 0pqh1( s -0Lp`PP#R30 4@0$($,T044Dt T$= P 404(0$00 4siꤓ s8 p-L@ 00s'0@ܓ -4LpMP0 Q $$0R($0R,0Q00:$($? 20€0 S 0S0,$R030 5: Z02Z00 L R 0s0s* 30S 4 3 R 4S2P3 3@ 40 400@000  83   0 0 0 $4(D0@0 00 2P$($6F`IpIpq QʡP4S4S 4?  0p@Pq@1'M20dtŸ q 00010*b%pl P'-1 4D0O4D0P0030d4t|10S) 0SN+K X&͐L10S@1mKӺP(0 S 0S1 0S 0 +00 00S$00 S 0 0 0  0 0  02 0 ,0PN*0(K sPؓ ܓX 0-0LPU ,4S0C$(QP40@[P $4(D 0@$4(D0,40h0 s -l@L0S~p D0,$R0,4$4(D 0@$4(D0,4 s -1LpPW`Z 7VYp q  V0U00I0O(?   69F$4S4S  P4S* 4S&p" 0ꀀp 4S4S:AT0Q$(080@00,00 s -LP l0 P 0R 0R Q0$4(D0,4 s -p0L@T 4 x 04pq hW0 @/p sp$ 0 010#Q0S4:Ss0p 0 00  p-L 000 x 0Pd `R P @ r 0 04 (0$ 7 ̜,$s04<040 0 ,0(0 00Lu,s4u,u8u J1PD eP PyJ{}yFB00S S=A00 S njQA0S0S S _QA0S\0S SXx1@@`1pDA00SG?#=!p1 1R0R S P@0S00S S ,P@0S%0S S!( 00 S@ h@00 S 00 SS 00pPphp e nD ^00.@0S0> G*.0Sed.0S:  _P  P d> PM T>0S P (> P> N0S $@$P T 0S:n B-0SD0eS`p]`p-@TD0eSe @D 0S Sf Sc S S/S 7S[ S00G.W S}dPx Q@H,0SP0!W@  +W W R0R00@0#0<0WT t<0WP h<0WuK* ,PN@ 4 @K0@0SP +aGQ0+V0;/P%WQ W W W !WG W*W @W07S,; 07S+607S 1*. W W !P 0#0CSXP;0S P LP )0K*pK*K 0K0 @0PT 0DcS긯DXеx@ܲ4D$бtܵTp ж0<``  0RQ80S0SX80S88;  2RQH80S0S; +0S0S0@,70S 0S0Sh7  0S0S0@ 0S0S0@$70S'0S!#0S 0S0S0@0S0SD60S86 D RQ5,60S5 5RQ55  # 0S0S0@!0S0@D50S0dSd0@55U xyQP o mn0S0@4 b_`!8 8K@XYnU00SN0S00S00 0S0@440[0S 0R<00S0@("d3P0  0S@3P0   ,S3 0S0@{2P&0S0S0@=P kP P ^ 0S0S220S0S0@P 0S0ST202P8K80 b0S0S0@PT1@P P ` !001 8 0;C01p0P 10P} 10 PPx Pv !t0( #+0p0Pi 00Pe 00 PP` P^ _Z 0sR/Q-03ꨗTuPuXutudu,lu`u(^l ԠܠpuH$ܗPdu 00S(00գ?0O<0 R0S0p  0c0RQ000S00գ?0O0 000 0S  0p9 !0S,00"00S -LMS0 0`p.(K00p  80 @0P4 < @0 H4 80P00S T @DT70 3 R0S -<Q PP,00,0  ,0 P ,0S:@ R r 000 R00 ӑ0Q0 f 0g1@UP1,Z:U00! 0U SPE0Y00f0(Kd -L@0 !0S@-P@p`E5 p-0SS%0P gP' 00dP ^S0gS 0S 0S  0S  \:QfPd 0 0 -0LM0@P3 00P/ 00P`+ P=pK,KUڏ@@ PP`  0@Sd`0dV0S0E@WU@DPE,P ``(K 0-LM@PK ^P8,P  0S NP 88 -LM@R,  %P @- R P`Pp F-Pڤ`0 C @R`0P R0  0S0@  0R@S  TP1:, 000 - LPh4 - LPh\ -Lq hĕ -LQph- 0-L MP0S& @K 0s0s alP&@T T0SP0 cm"000 0@$0 0 K0褓|uPI -@LPA褓 -L|MB0PP 0S U P0,K0 K00 pYP@@00S`R`PX2`0 HP`0,0 AP8  8Kg8"X 0 "8 !!Z g oP, 8 8K10SP ,P X8K8p yPYP ,yw`Z,1 o 10 @1 P0 , KP 0K 0 0P@ !P@0 0R0 O{0Up00S,8K8p !(K褓`|h|u|̜ 0-LP@(@P NP0h0 -`LP`pW`V@ZP PT 0 踘 0 ꤓ 0  ꤓ 0 ꤓ 0  ꤓ p-L@P`P U  P V  P php -L@uh P-L 0hꤓ -00LP L hꐖ`X -L@0+ 0r/S@ R -LlM|K@4P8K 0ݻK -L0P1 -L@%$P 0@sS @ 0-D@L0PS0kP(000P0Ԗ  -L M`, *@pP@0S 0S P W @P RX Y"*@rXP@ d \00T @D* P  d,@000S0(K( -LM@pP 0S `PKh|{*@x*@@1L0H P`*  e@ K$ȟX0 -0LM0Sp(R`P" ?PڄiQC*@@*@=*@@P 0)@T i蔗<H -2LM0pS d2@T+PP0`|S -S` -P} Pu)@)@@ P0)T`V_ X$ 10S@ )@)K P ᑯX00P0SF 04000)[ `@p9dvp@d0S 00CS00PӤ0>P U g0H u RS @>)p@P00F0SpTd`p| -LAMPP2  01pq) NK,PKp@%`@ 0S PP   0S*P P` 0S:VKx -HHaLp@P#R %RT0TS 0S %R #RP )PP@ R묐0ਠ`P@#R %RU0US 0S %R #R P  d(@ P R 訓 -L@( 0 pS` R0S000S(`PU(P@000S 00 0-LlMKPᘩP@0: S@@GK0 p-LlM0`0SP (@@ P KmPPl00S0: S g(*@! Pf, PKphĖ<00S,0P 00S00Cؖ(H'00Sn 0S00\ -Lp@P`WV 000CW`K@tPuZ UX`yoXpWZVX (00S@ md ꨗ4 -LMp`p@P qV i 0 0-t0L0Spq p@Pq0T0U0000 -LP  00SR -L@pP`\T p200CW `20SWD200CW @w$200CW yUV UV P@ 1P @1@T@ ZZP`!hpP`qXUp4q2P P AP!XT 0 0S0uv 0 0S 0S0x  \p 00pWZYT+00 oi 00SuꨗLHܖ -LMp`P P 0@IP9  Kiop@P(q&V 0ATP 00S dP@P 0p@Pq Kif 0 K託0PP0PP< P000S SP000S00P0000000   -0L`Pp@vP `VV'(` W  00P`p0@ 0 @ `000pW 000 0-@PL tP 0T T00 00C0 R( 00C00h0褓 p-L@Pq P`pp P P@P40`0ps@Pp P P00谓 -L$MpXxWv`#0S PHC0S <#0 QPW 0L@ P08 40 TP ~B0S ('@ T T "06 P P p/ PB0* P 000 ,0 py0 , 0KP0K0PK`p@ !00<0  2\ P P=tA0S9h!0S5@H 00D @0  @P!0S !0S<@0@X P ` 0P`@DTʵ0@0Y@XW<0KPp2D00S 0K8 K PP*(K`8 0p, -LMpwx 0S P#0S t3tC 00S@_ 0drP0p , @P0p PA0 K  00 ,0 80K0KS0@K00* x @0P`Pɯ`V* @T PXW5p@q P P`pR0gt T"@tTP`80S4!P00PUo-c  8 TPPx1@Tl0ST!0; Pp@@G41P`@ @ P?P`@&0K3@PpA00S ( 000K@P*00SZ 0 P` D@ P P pc(Ko(K`8 p,0 -L MP`, EP,0@cT D dq~@P X(Kopw0x0XW0@,@p(Xy z  V0 U00 1 ,0@c 01pP`q @,0T (1(,0@d@ 0@7pP`q XW 000S (Ko&@00CT h00SeD0@@x$0 0@@(K蜢lH p-L`@PP  P p #@P$00S phl -L`ppq|Dp@PqTh 0AUT0 hܢ -L MKy*K  K p-LP ph P`pqP0  Bph4@  B@PQ php -LM`pp@Pq KP |00Sh0 W V @P,0 $K!uKl8P\0 0TSP0 H0 D0 @0 <0 80 40 00 008uuuuuuu000 @00ᘗd00S X00S P~0 @P 00 000000u<0 0 uu -p堀0L@PP `PP^ `! `!P`@  Q-L?P=0@P60 `Cp3 PP 0p V@P  @P@P 0`d "0`FP@PZ<0000Y$000C0f0@P  p-Lpq0 @PP-p@) 崠`t T 0 @P00CV]P z@P@P0@`@40W 00 X`@P  -L0<0  000 $00 00 ̗ -L0<0  000 $00 00 ؗԗ Pp-LP@1 00S PP@&` Rڔ@00SP 00S@@P @0 R 4000SP@pu P-L0Pu P-L@ P0Pu M-LMp020 ` @0,K]P W @"st VU`@p20S52 0@ ,PK, PP P% ,0 S P0P,!0 xA0,0 ,0 SPP b@1 F(10SXX 11 0,K,  &PpP00S 0@0@0@Tʔ0Z 0$K0 0CjRh`0 0\0L0p0 0 0P  $K蠗 xuuܗ  -LM0@`p P@D\0@@0@T (P \ 0  uܗ -PLM@`pS3 R 33\ ڼ0Sڰc000S0  R0  RtS(@K  00$ !@ p,0 0l0 0`  u0P0`0 2 \0S000S0 2 Ÿ0S#ڔ2 t2Rx2  d2 0TP _TPP^@20SPPX_TP@` _RP0P0P TJ10SnSSjK11 1 1Q0cڨ1!0\A1!1@ `_`` 0 B\AQL!01`l  @0J$!00 0S10! GP`F(V(00S TP 00S STT0  0 P(K萘uuuuuܗPx -2L M@xx2 0 d0dR R `, mH"0D"S PP(2  fP`p4 04 p00P`K 00WH 0SDPP PpP3V!p0x!0S0Wp!0d!ӷ0 P#D! 0P(!0*!P0W!0P P  P0W P, 0iSɟ@,0Y| T0  000 @ `@HH0T,80 0i `0 (Kuuuxu -qL0PS`@ 0 2Pp1 T 0P0p@0`$0Q 0p00\p0p 0 ?R\0X0 00lW 00psp3uuuܗuu0u -2LM0PS`prp10S' 11 001st TS !0S0S1 @0t1 0l0 L1  010S (1 @ T 0S0S: p\ 000  P`0 Rh0P0 RQ0@^0 00 uuЎ Q-LP`pr1P PU 0 S0S:Q R`\ x1U 0Q 00X@R%Q#@tPE(`@0 0`p9pq7  0@P Y0$X!QP"`@0 0`ppq 0@P U0T 0/`pu$$0S0  00eD 0-T@L0S0dS0 PP(000P6000Ԏ؎ -2L0`Sp pq WVP2 X 0S0S:0S 0S{ 1X1 0 0Q 0 @0S@T6S4P[1刡@0_0@P3pqI  0 W0V  0U5T30@. P'0帠@00@P Jpq R 0 U0T 0 Z Du؎Ԏ -L@P`p@Pt 0u 0 X00S L0XR@P*TU0@託0 50S, -50 S  Ra0@ S-00LA0@S0?܈|У 0-L MPP @K0 000K0褓 'Pp-L7 $P'.P ^P"L1L!@00 0%VP 1 !1L0 0 0  P- 0s0sph0^ ND3s H3s 0@D3HCP0 d00@#L3800 `P0 #P php褓܎, -L M@KV0s0s ?00@3K -,0L R000謗@B -,0L R000谗ܗ@B0P 00ဘP Pk 0  -PL M P P"P00  R 0ShX0RH0  80< (0K0 K0K0 0K0K0 8 K, -PLM@) T TV\Q@p ` "00C0 S10R!@œ0,STT901 0b 00@0PK  0Sp` T1` |@0|T @KaT m@K,0`04 d0$K$@ K8Bd_DP -@PL Thd0 \.X,T*P(L&H$D"@ <8h2謓`hp$\P6 P P0@ 0-PLM@& P P*0mS MS hS =S sS wS pP hPdP`P\PXPTP@808 0K10 SK0謘x|\ P-L800S (0 0 h贗3 -PL M0 " P P>00K.S K 000 0S0-0S $0 0 00S00K,@Kp @P0t @0S  K0 4 CK,0K0 K营ĥ -PL M0 " P P>00K.S K 000 }0S0-0S $0 0 00S00K,@Kp 5@P0t @0S  K0 4 CK,0K0 K (<`Q PPP0SP 0  0Pp$0$0S0Sᴗ$ -Q0LM00SK0 M K舦 -Lp@P000C0 S @ h,,@0`0 C0 ST y@DT  0@TU0 `0 p-L`P@0-S000C0 S ph!!00 C0 ST00^ap -LMK  K褦 -LM 0R0*, ,h0* `<Ȧ -0Lhp -LPPM0 pb @`V0@ , `,KWV0  , <,KM 0S SV000S`B V? i e fV V V 0 1 0 0s03 V V V&@  00 0FSPV V V 0K$ KD$0S0R90S V0V 0= @00SSS 0010,K0,0 -V 0 \0   000CSllll KԦH -@LT`p"|0pP@W \S0 S@$S X P 000S00蘘 -Lk@0 dfl -PLM8 B Rp,Kz 00S S 0 8K@|2 @9P8@ 0P `!80 %5*$P  P P+P -PnP! `$0+SX080 u!000 o0Pn ,80 0+S6!;,\!0Sn`z`@^PPh4K4@ `P,p 000CS;p@ @@@X@ 00s03X@ 00&aFQ 800S8 80 S  0P 8 800S\0P8K @0S,,P 80Pd(Kpp< S 0 Q $ 0S C ḗ -dL`P 0SL0  D@  R000 $@$0TS蠧ܗ -p@!`PLPQ  0 0 -LM d 0 K p-LMP`d@002 0@?Kp'@B -LMp/7`y@v@@/0 P`0 -LMK\ K -锠PLp` 0@SP0000ST0S0#S < -L P P Pp h -0LMo@p@`!0K!PK Z 000eo@PV-00e  K -QLM@Pp@tPp0%0K%`K 0㾣00 f0@PW-00f $K -QLM@Pp@tPp0%0K%`K 0㔣00 f0@PW-00f $K -\0\0L@S L0 PyaP p> 0 0 pt 0-L L0PS000@00 R+0 P00 0蠘ps -L@0@S -LMpP`5K+%P0 p`$ pnR sR dR @`0@SP  D 06;`P K 0-0L0PS@ t00Sz P0@0S @00S b$00S0 Z0謓|ܗ 0-L@PUD 0 0@ p-0L0 S P` 00S 00S /0@@ct0P0S h00S ph1XJP0 @@@ 400T,0 phꬓ|4ԗ\ܗ -0LM0  l0 `0Pp `K  0T0EPZ@PC踘p3 -LM@ ` s`\Q  0R QZY!X11: \` 80K@P8@ 4P 0` ,p 0Kp3Q 8 00 0 00 00S0!P(K -@LPh00 -0LM0@Sp S00S f 0PcP@`0 ` r 3Xg@P 4@Ph`U (p p p @00C000C 000C?001ᨗt0@-<0  0h0@P4 p 0q-  + Q 0%P#4p@q 0Q 0r S 000 )P LP808 PHZ0P:j@x`D(^(0$0 0b0c0AVܗԗ -p0p 0LS@ 0@s@3H0H0@0<0 80b0cA6$0 贗\|ܗԗ0&x -XL'P@L#D <80400,(0舝Мx$|t@-p^ 001`0S10tu 0S 0Sqr, R*Q'00S  0S qr 0S0S:\^00H00S 0S000s38`D 0-L@P5<0  0S0S0 R0脝 -0L @p30S -L hl-  0R 0RQ^  QP 0 0S  SR 0 0 0R 0R (00 0- LP@ R  0@ 0HPꄝꘝ -@LP00h$00S0 0  \ X` -LM@QPp@  PP0T0 `Kp@& P@ p 000  0S : `0R  T00S S@00S 00 0 0 \ X 0-@LPT 0S$  0 0l -L M 0R\4 0 ,0 T  A8 0@i{ @ip4K0PO8 a# U  S R 0 O4K0@ 0@ U S4Kp0OP` U 0S, X D0,@ 0h @ @P(K蘝` -L@MP`X T0 *@P <` @p < P`00X r T0s  T@0TX\00 Q R` 0@0C 0 , K00K p 0@, K00KJ p 0@P`wx R@0K0S @ 0bS0c S  0PB0SH 2Q H l20SHH  S H  H QH ,B00SHH H-@L H@D ,LD 00K@%P  AP 8K00L 4@K @2P m` p\XPB H008KL 4@K@ P3 PQ 4H@8D00L  @"AQʸ00S 4H@800DL  @LDQP 0 `LD @@(K踘DXxl`` -L4MP43@(3$H D @ < nPzP Z 08 40 `8 4 8 4 V8K0`2pq tu Q P`2YXtu 42 0@_` pH D *tu UT@P1 0@_ QP1 0 QP`p` p`VpH` Dp t u  80s04q 00 4 U80T8@K0t u U0T00" 0 0K 0 )Ph0qr ,0S00S0K@ < 0HK@K 0(KHP`  -LLMvwJ 010 @0R0 , (Ko00S )np@Pq f, R00Sp q Q0P 00 V58 00CXZ (Kon(K谓 -0L0@SBPTpW"0000S `3p@tPq G`00CV80pD 0-LM K @K0tu  0K0 -0QLMp 0S#BP 0y:*R B0S 0S"0S002 d ZP\B0S vH2 00S 3P `@P1p@Pq}@P$10S S  1 ````%vV@P 0@PLa0Z c@Pt u Z JX@Ptu t,@ (P u(8$,K  0pP h00S00X0S  D0,K * $0P$K`8X`Dx -L 0 0S0 h`D -<LP(h 00s030h`8D 0      `l 000Ḙ 000Ḙ 000Ḙ -LM0 $ KK0 0 /P$ K -@PL \TL hdP|PP -1LX@ @@ _J_C/Q60  @`Pp0S0S 0` 0?0080  000S i踘|Pܗ| -LMLp`KP p@P0[SPKT[輘 - LK P00=MЍ -0LM 垬$tt  -L MP@pP 0S 0S1 S K R3 GP 0B?SlP ,K9P ,0Sp`(K (0,RpQ &P` KWQP00 -LM+ K K -L@MT 0dT[ 00 ZP T@@PP 00(SRP 4 0R  L0 P # 000S53Cp00Wo<0: 0S00P pP0C0 00CS00|S 00G@P RRRD巌000<)^0S3Py #0@T 忌2 0@ R<0 8@ 4  0SV 80K0K<0 PU( S@ 0T"H0 D@ 0@0 ``2`@0 HKT00"P P A0qA0  00 aP0S1 RC xpDX 00KgkPXϒa0,4"400 0 0D (KM@P 0 t!T:@P TPT  ppL  0 

KPDD 0CT@!@0C, 4D L 8 T4 L4$BT#P TP @(K 4R S 0C4B,[\ *\ (K0@@4TSx#000ӑb0CSPr4rdpdpdp rdpdpdpqdpqdpdpdpdpdpq `@$ -\+\ TT 0 lnBK0A0A r@PbnV 0~`p+Xr -X "YY P[  0.PP 0!PI 0PB04 Rv @D 0L@Ay04D,[s`@ H04D,[m0`@4 H Q8d H`04D,[k @$ H04D,[g@`@D 04D,[Ddc0@4 04D,[ lK@ =@2l0KΌ @  0T(K -LMp0O S.`0 @၎U VPP  g@,St  T #*Ok0 0 -L%M0p,0 $ ?KP@Ht K nK@ `2@PΌ  0`09V, 0R(Kƨp -LM0p0O S.`0 @U (KVP   p00W0S00 ,  00U V  J z Z  @ j0 0sd p-LM&>P`D> *@2@ Tx -LM| pBU0U 1!`8K200 Yo`  )V$K -P,L&>M Y0\"]280`S0<2<…0S00@2 D"0叏0CL2  BH" 0P2 0Tr( $@S 0X2g0`TX2iAST0S0@2U LM _R 0S2! 0 Ѝ(0MS0?SЍ4 0S 0S0?S0S -LM!0S PU  0 0       p0@rP@ck@@cPE@a@Pc[PPcP@ -LM`!pQ 0 P 0CA2$,0 %@$U00e0PDf00e0P00 -LLMpH W@ !!< 2D  `4 @Pp1C8p 0V@ < `*`p00 7480(D00d@P 0t@@P 0Z0 H <00$<(K <<(Ko<8 M-LM`@0V Pp+W)!0SS P& 00 ,?0"10  00 0,?0"10  00!  00h0 p`$KWpV` < p-LM ` @ P?  0 1<00 ! 0! 0 QQ?  0 1<00 000  Kp -LMa<`Hp  p;`W` 2QPY.EEwOE B1 @@P@;^WP, pr`W` K,HMЍMЍ 0-LM ePFP  t0R hK=p T婀@P H0H 09aM eK0` -LM44 4Kԋ0K0 @"0P\`  |;(K4pP 0  0Q 4 g;x "10 0 dZ; @T1"0 0 0@1!T$F;|Tt -40LMQ @ 3; Q  -LM@ y &> ;U -L8Mt, ,KV,0`S (pK0 p塈(@\P  : KX;0, p劈(0`Sp , :P# 2pP`K2A@ @N P0PK000 :|4 -LMΨ -L!M(1`"( S92RS]2S\@cP KP:/0p D 00`n( 0R $Kg@0少D g@庤p` 0-LMP@J:48 -LM$KP`p0 @ч$0S  -:K"100!aRRl@0S`VX{:L:D:@_ ?0:8 0P -LM(K0 @ᎇ(P`Up  `9 K A2@@ (1P -LM@hP  ;Pe <<_  ?0(Y  h -L$M0K@`p0 P40X  h9< <(K2! P@ D  0P|D< @!R8 0        f9`PY 0D 0C`40  pD0Q<\`F 0h< D0Q<\ 8< D Q<\40< D 4 8$0 $04 @4 4 '4 $ 4!00 4 $0@|CP h=P0L6P @L84 (4@0p`S`@0 @HLD 4@pP3H 0cl@80T 3P)`p)@P 0 S 00K⯜PX0S0#3 #PP   *BdPU< @R@X00SX00SL0  %H20S\"0000SD"0000S 10S`\B\TRD2p` (,"0QP 0B1 IP ! 30S:S0S6R) 20SQ b 0R20SR ]3p2 2R T"&p2HR 0R08 KPK:r D2b PKR8 K-i00C020S 0S0`KH Z\ 0S00R0S QPK000`` ``` `P 0S!0S D10S`10S h10S`@2 X`2`0tX -PLM P X 0-LM/PY@P 00+8u/00,+ +884X p-LpM/P:@P KHjP0: S Kp0`rS@B  0-PLM@P0 R 0 R 0.*8h&&t0 R8h0l* Z`H0 R <0<*808*/0 *ptxX=tX --LM0 0  --LM0 0 K --LM0 0 K -LM@V刕 h$3 -LRMH0@K0iPP`|K<iP1: S V@@ S00S D`PiP$KkvP T P`0 R000 [K@{iP l1: S 8)(()u)l3XXX --LM0 0 ㄗt -LM @Xp`P0S 6? 0P P 000K耣 -L0MH L &P0 0D  4 80 tP D'v@Pl LP TD `0YX 8\{ V 8 R 0<  C@Vp@@ 0S00C S000C S BV0VPpU @ VP0S PURP10 0 %0 00 ğP0P00 @TT@TQ PQu@PX! 8  Y8 D0T l`VR h( @T P(@T ^`V$`>SVXg 4 4(K8 (k 44 U  0P P4 I @< @00  0@@30f0cß`H0S H0XX @T` PP@ 4 0K pq Ÿ@TM@TJ 0P0D,4pp PB ^^I R0000 0W G 0024 4  0PP2  A R00C0VV X0Q1 `V` 0S 0SPP 4 YtQ 0`'0 ^^  0(4Pop{yw4\/ @T3 0Q  0V P 0I@TRf PDPa 4 ||P4 F;s4 LD| (t4D\(^,H^MЍ -L@ P ފ  -PL` @Pp 0eS P  0N=W +P P#%C=+@ apPt  00  gP H .= 8 P, e$8\| -LM04 p mP@@@PP` @ X4 @T 0 0K  p0<0S P'  (K p-LlMP@`Php@= O)p@` `00 P.KPp 0: S  <Kp` -LpM  KPP 0: SPKQP@HPp`T 0SR w<PP@pdm<   &p @։ P Po@` 00`(K4LH -MLM`p @g^KPE\ p H $0KN 0~ 0$KH P-L   0 弉B YttX 0-@PLPha@P @T uP@UP  ,;(* 00h -CLMp P `㨘 尘 嬘 *nP( cP% VP eP08  mPqP (  pP sP xP  V ` P0"op$20W(0u03R0S Pr INK@D @D!82p  PP1:;V_8S\ ~KpG\ pG0K⤠KZK< `J0 p  P X00K0S@ 00 ,@ 00  0 K >0@K0 uPp  #2p( P@`T/0@ J  0 K (Kxt` 0H@-@|0  " 0|0  "4\ 0 ^|-0,0C/1Q0#0C/00CS00 c0 0c|0x0\0nx0A0 0b0 01 R|00|0 0-LM@K P& 10 RK0 p-LMPK`FOK    0RQKp -b 00"00#0\ -LM@K K00 !0 S0 0S-0 00\N-0|v?M0|0 1?01 R  00b0QЍ.A-0MP`  0S3 0 ##\0 ^+ @0!" |\|0|0@|0  " 0|0  "4\ 0 ^  pAЍ -LM⤀KR^KPEJNK@DpIoK iK K oK |`@@ TOK/Kf@``V/KQ`@@ TOK/K;}@y@u2TBNK@D/K%jg@`b`^dVB.K BTQ`M`I2V/K@=:74 i/K$K -LM`KJNK@D# I_KiK  oK P@@TOK/K@@ TOK/K@PPU/KP@@ TOK/K@@2TBNK@D/Ku@PPdUB.K BePP2U/KW  M$K -LM@K 0| 0C00CTK -LM K0 0 R0 0S K K0@- MtP @0 0 c / QB @ 00#00# Q0 Ѝ0X -0L!M`PK  0BS0KK 0SK 0S| 1##@0!\!P?1!K#$1! "41 00 R5 T 1##@0P ^+JKK0 #$ PKKK0 0`0b/40Q$K8协Kp@ KKKnK@X -LM CK01 R 0 0SCKy K 01 R -LM CK01 @R c K 00 @R0 0S@  10 R 0 S R 1 BS R ! 1LR*|-0 00\ "4\ 0 @-@  00b0n  #4\ -0LMP@K  0 S  1##\0 ^>K0 #$ 0K\ K~K` p-LM@KP`d Kp@-P`pP@0000100 "#  010 " 00000#200 #  000 " 0#1000 200\x0@0P0x010P0x "# R |0100#R0|0340P0|0#20P00000 <- 0@0#1C0T\T00T00@-@P0000 "  010 " 0#100 #  000 "  ""  020 " 0000 "#  010 " 0100\x0000x " 1 |0100#10|0#10000000 <. 00#2C02\200200@-@ 0 010 0"!#1 010 0""#2 010 0"##3 01|\0| |0 01|0| |0"!#1 01}0| |0""#2 01~0@-@ 000  |\#|0| 00|0@-@0 <0b0  |\#|0| 0b0|0-   00|Q"Ġ|0 00|0|  00|\"000G-Pp`& !0\.@0 .Q@ TPG@ G-@pP`&! 1B$0l\:  !0LJ$ ^: 01 @ 0 0:#P`@G0@-P 0@C0  # 0"00 "  \0 -ML M HK00 R)0[H [0 @0;KH K)0K A 01 R;K KA00 R02 0/K0S0H4 =K0C/KSY0HK 01 S20>  KK-K?K@A BMK@D% KK @A#mK`FK A)}KMK@DpGK A'KHK A+K- K%KJ@A1]KBPE >/MK @D%-K B 3mK5 K `F@ K%rOK-KA  RK04ş,"00|Q"$L1,"0  RK  0 0|P"0-MK@D0 K]K0 PE+-K B K K@rK!MK@D5KA;mK`F K@K  KI 0@K yXK H00 Q9}K`KpG_KROK rK oK !MK@D p`@@ TMK@D!-K BX}z@v@rT-K BChe@a@] TMK@D!-K B,QN@J@F2TMK@D-K B:7@3@/dT-K B%"@``2V-K B  9MK@D;mKr/K`F7 K @@ 10 R7 K@p rL=K!00"0 0#P1 1@0 R(KA M-VMLM@00 Yp @h?XfKPa 00 P 0 Q 0 @ @P 0 0Q R@K 0B_KQboK` @ K 0@KH@K`KA 3P ?  ?  ?00RP` 0@Q5 R 0@Q(KX -LMpK@JK‐joKP 늏K J= C HP C 3  ;  7(K -LMp`ᨠKPOK  တ&  "JK  =   j_K 0-OK+t ',#  2  2 2 (KX -}P`L@    h 0-L@P ,0h -LMM KK(@2 " P" K(@ K(@}K! K(pG(@OKzK,t(J  0aP0,<S*0 CR )00 \ 0 CR 00 \0S bJ \0 R \kJRJ0R P_J>hDJ0R>hSJ -LMpQ@ᜡ0S:`00CS`0UX0  X0hmً`PPP!m0S@0`00CS`0BX0  X0 Q 0 CS  \  XQ IP` X U t`0 CS @` VP0 IX IX Ilئ p-LMHPH`@D98  03$  xhr| -LM`@ Q (Ko<<Q P 0^0 ` pP 0 Rp RP R0S0C000 \  R  R  R0  R P @U@00R T B0P0v hPW 0~Z  @X c $Y @ Y   @ !p H0 R 0@00pD(8<0 L @L@t @|d1 R+ 0 (KDq@!  B41 R-(`00CS`0,X0  X00Sc0S_ ~ (Kox; u;:(Ko;?ppW <zP (KoHX (KoHܬ \4\pĥĩ ئH -L$M@B@0 S$ P Q 0;$ 0Ry K0A0S0 0CS$1$10/01 QQ QR  H x 0 d\X!0S 0`0`p;8 <0 L @L@( @p4@KP  xx j xph{{>`Vpĩp4<ĥ@LX`l -LM@>e&./aT0 P cT 0 P gT000 P t(@4P4 004   p4l$h40$` 0 (4 0`P (4 0 S0C0a P  dPi0S#0 30S0C0@@  V0PS|0 30S0C0@@  B0PS,#0 D308S0C0@@  .0PS0  20S0C0@@  0PSu"0  20S0C0@@  0PSi<0  `20TS0C0@@  0PS@f@2 R (K0@fS@ j1 RQ JPN0 R\A&.(uP 0S@ 0Rl!0S|>  6 .(Ueu10S0 Ph 0 T 00 P00 RogxkglЩ\8Lĩܬ̪pԩ4(ЬL̬ (08@̩Tp -7L M@ T4 P`0gS l7( `w@p <@ 8@ PEU@0-Su 070j 4 KPEUp6&0QSX@@6P R@k<03S g<0S 6 R0S 4Q 0 0R 040d PL<00< 80+`P0gSd ?<6@ R6X&  @00S9V4 T 7T TD -{tV(K4 K@@@  0@4S,;P>;P>4;P>P>\;P>t;P>\;;;;;;$<@<;P>\<p<<<p=P>===\;;;P>==<<<=$=,=\;L=\;\;T=\;P>\; >(>H>l4 @a%PU  8$00031PU 4 K0@0 'PU !PU  p#000PU  #000PU  PU T3 !R 03 L33 43PUz z2 3 2 2 !R2 PU` PUZ  0K@?0A\0 R8 ,2 !RzL2 2 2$2 <0! 6<0 PU* !0SSV1  PU l1 !RD1 R7 vt01 !R)P1 lj DFU00V0S 0 R0h5($O|#$ $$$$$$0 $뼩̬(^Щd`t̩0x4h8Ԭp-L 4d -L@(MK0C0C@ @;8p> 1 R1 1R v{`9 8  0@ 8ppnK`F`F+rp@90S pp8:( $ K@C H: 0p(pp̬جЬĩL($H  -4L4M@PT`4S PEU50-S@PECCpE`EECCPECCCCC@ECCCCCCCCCC8PU  0K@?0Z0 RPEUʬ30P0  0CPpK4PKL @0 8 H D < P  0@@ph90 S@ 0@@p 4QPr0SX X *0@T0 0S" @UA(K2! {2 wx2 sh2 oPUv cPi <t"0SR $20S 2  Q 0QY 0 SZ 0 S0S 1 R00T001 00l1`PNT00T0 `1 R0S?0 `7 (2 0S0C0'  40Pq} 0 Ro  j{oxoTro!0|!ZXAcP W꼩̬Lĩ`h Ь̩Ld -PLM`P0#[#Up1 T0@"S"JIIIIIIIIIIIIIIIJIIIIIIIIIJIIJIIJI I3 "Up2pq!2AO["P 1"P0`gSX@@bP P 2 Ri x p2p P"0SXb 0E1SiDKKDKKDKKKKKKK8KKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKh1 ad1 ]X1 YL1 U@11 MP 7  n 00 2y0 05pknHx0@ @{yy yFP y 9y@NnL$ĩtجȩ@̬̩\Ьx,(,0M R P" !P Ѝ\0@-|0Q Pt@ MO\ 0 l# BN0R0.0N0N  00BЍ0`8MPdM\MTM@MLM$Ѝ- 0`SM$*1S! 00CSNtN N N N N N N N N N NhN\NPNNDN8NP01 `R*0SЍXTLHD -PLM   <4("4#6$ $ p` -LM Q0S 0S S h?h|0 p -LKM−0HK,0 @T`? 00CSPPU`p@\K P0 0Z000 00 R@U0 0Q0V @0S <0S80S40Sd ZDX1R_K@\H[ <@,P;0!`8, 0R9(KP` P` P` P`P` P` P`P P P2`4 `sp\pT  p-<L 4(M"4Q l 0SPx1 r3VQ0X1@@UT ,850Kp <4("4!\[P@ 00@U T!P`UU U&Ƞ& &< PP&Ƞ &<t hP&<X HP&Ƞ& @&<, P@ P\p -LM@0DSUTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT0D DH<KKhgKhKh}KhH p -T0ML\@4 <@P ,OK\pT p-PLM@  0 R b@,lqdKp K ♰`P @.}PP (僯P@T  \pp p-L$M|Ÿ|b0 S P? R6 @!T# W(WW(W(W(W(W(W(W(W(W(W(W(W(W(W(W(WW(W(W(W(W(WW(W(W(W(W(W(W(W(WW"RH U0! 0RYKp|, lpA00t]P! 00s8@K0 0 80 40 00 ,0 (0 $0 <0 S08 K70K >.P ,ծ BЮ00[S S/0[0S S Q"[-K04"48#8 0 .K0r/0[0SpppP 0-L(MtP9@K0l 0 0KS00 R00 0RK0qpL$ p-LM`!\P@ x0R0S + Lj% 4d$xh^ Y  p-LM\P@` !\ "10Q0S 0S. S UT*0 R xh+xE 00S S 0004"48#800< Kph 00Sxh\( p-LM@\ `PTN  00ESd\X\ \ \ \ \L\ \@\00CS\\\\\\ R R |xh Rxxhph`XPHxh@0TDL8@ht`إ 0-QLMP@( 0S S U0 R p 0K0hv U04"48#Ƞ8K0hi0 cK0 \0@MS^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^,Ѝ2$$Ѝ. X -PL(M@C !P- FT H ldd \\PP L1L @1 R;41 R2(`00CS`05X0  X0K  0@ 0@0 R KhD<||X KhQ<4lĩt@HP8\< 0-LM@0PS$ @K _P@@` L@@\ XQT 0p ;K0I000  -L@M0r`@0TP 0   \KP201 0S0C000 R2 R X0 R 0RKP0SaD"0T @ \@T`T T0 M<0 0XS0[  i( @ <Q<a0S;80`  B LR` BX0X00K @ @<1 R 4Q  0S `00CS`0,X0  X04P P `0S 80 LC; ?;y0 R00p0R PTG;X C;g@opX4$DL``hĩX\, -RL0,ML0  0C``PLK0pKH <0 8 D @ 4 QP P 0@@~pd10 S@ 0@@~px 0QU U*@0@Y0SZ0 0 R0@YPZZ,0 L H @0 < D0 8 0Q& P< P 0@@`~p00 S:@ 0@@R~p00*S)(K0000U c U*0`S@ 0`S V01@YᖸTg,Qg$NgKgHgxMЍ r 0000 W0700c00B0200p  4000 W0700c00B -- LM 0P  KP 0 -0PLM 0 -dL @mWP H gWP 4 aWP  循P$,4< -pPLZ`P 0@0P f+R %R0s 0D 00s 0D hP P@ Rd @ -Lp"Pj@ᳺ`P8 0 Cp ṷ9h 0-@LtP 0000 hP%T r 8000D p 0D00-0 CR 0R0 Sj900 -?LϟM080 0 P<0 Q P" Ps L VP2@p , VP@p   VP"@p`r ,"/㭩P 0S U 㣩 T  0  S2  0S` UTT +P B B Uc0P/S4P xC4 40S 400ST   0&P00S 2 a Q8 80S:8t )VP80p 8X !VP80p T V+P " wW 0S$ J+q0\/S/00L4P 0S00@+@P! 0S 00:!PP )+ R P[@0  08:*  0@Sp " 22 V e< <@t (YP 7<K+p0@0K,;@T 4+H@ @0S 4 YB %l<0S8<4 I@ 0D0 $ H0 P D0SD+H0S  H+P (+[0D0 @0Л@y#P $ +묫`H :R0O@Ip@4@ XHwP P0P0`P0 P R +0S ˟0S  0S#x#70`0S0S*y(<eP P HQ+`:0S/ T:0S+X:R&Q$,:0OTS :0S:#>9#790S9 19 79CyP@T PXk90S D +PU0[S ]nP 0 :SSp`  :n@P00 K⭿$8T00 00 8PK0`K 0Vp70X p@K 'P0X 0EP W )P " 0P倧0oK<0 B00000 <$P@,ǟ0S'( -d\ < <0s# < P2-0S .-<0@ )-Ħ0@<0  00p@K00@ 0PxPU0|<0S TWP0<@aG6 0S6  cGP`@9P@PUҷPؕ@Pc"&P00  0翾@PUPP8@T! 60S58 Lc "R <5<ş (% 0ZF5ş % 0PP<ğ$ 0H: P ,OPP %P@$04ቴL$0,X hP0T$!(44<$40S4  ) gP wp@WP " P KP K0BP0 P R 00 S S  㱦P P,@K ᐦLK> "ML0SPKPP  3P #0 S00`(` #0@LKP KP 0BP0 P R 00S S S RP L /SPP8@PP0 LL0L"S5 V2  SPP,2 @oP YN@P #01PP0S1 b\ e<0s<R 4 2PᤳR塳t00 SX4\\ n@ @0SX4D1V<d,$4$PxX,B0 8 X0`\(^l(C3P`D,|0\ĉXh|\,00S`0dE@ 0D0 tH0 P D0SD(H0S H((P0D0 @0`@VP !0P0 s(pǏH B8"b0OPP @  p@4UHS(PP `P`Uʸ!0S 0S 0S#G#4"0pÏ0S0S*PvP0SH$(T20S/ `20S+\2R&Q$20OTS 20S2#2#q420S2 2 d42vPQ #U.03qr P0SP0S0S `30S x3xt30SD'P &0 2 P2 &P\ 'd <0s <`42 P=8;9 7(K -LM0T ,0 X \$ d@P X70S,08'0 '(PH  0 S H$ PD  0 S D$ C>K0C0CLD `4 PD ,0X$:hP PL,0X$LP|8 x (QP d "QP T6@ D\$@bpLD  ( Q@PH$R  \$QpLD PD $,0LD PD Wp/*:`&@@"P00T00S4 T2*P0#03V0S+ H40@0 P@@PTT*  &W 0S ,0X$&,0 L$ P$ hP epL 0L4 P4 0[S]ܣP P0#03V0S @T 0:S+0p0@T$ :ã/Pΰ U P00S P:R V  R0305P1 : :㨣 ` pPP$ L$ PW 0S V @@V 0S /RjP@@@`@#0Sz0#U0 @0 $P(P0}@ K(( -AML M< BK+@2$|,$ p#)0Kl8 4 p@4 `BKP$AP0 `T!44%@P񟗰ꘒD% 0#C% 0\cqt<4S 4# x 30S dCxoLqh#H3 TP/ @ RR5V(U&4TV 0V04V0S30S0S U UR2 \"0S_/U 00D S\2X 000C00W42 0BSpRdppU00W0S 00D SW T)T,000p ,!pQ,45@4,4 5dW(TpU-T4$R4$1 4$ 04@V`S@404 5T!$ P@?H0SS5V4V010S 0!0S ^ .pXBK04A a R+#j4Q 84@T S8D 8D1V00   f"P d0 TR t00S 0ZZ 0F(KHTx, p-AML M20, S P D!10S1  q n%"`BK0@!P蟶10S|10p1I?BKA 0PlBODAd [)pD10SD10811?,4S( K 10S,4,$?0 1K(K PO00S0  # ,4S 1[ BNKP@D0S,4,?+l\PDP800S= ;!KpTDxxH' -@L0S) # $ P`P?SRdpd0 `@ ` o0S40  \$<@HLT --LMP@p0T0`x 0 P !\!0 @ 0 ]t#nvoh0 `\p30PST=!K, p-DL0 M0 4 0 8 0 7P$@ 3#3Q0$0 3@T 30S 30S@@S0S-P 3mt30S \3dmT3 0S44rP(2PP7 c008 0 bP@  l g 00 0 $4 NP`B0008U4 N<24 \80P/Z} 82 0屝P 20S 20S 0Q0S  @T$4 PO A1Qp30S @T $4 pP  0S5 (2PA0S"81p30S 10S10 1=0,K , 2K P}M00S0   00S00SD0  * Kpp x D0(H'xD -4L!M 0R,0 0S 00SS   0KDpKK 0p؜ ! 1 q ̟P <  <P M0S S A)X<0S L<0S@L0P8 0K0< 0P0CS< l!R ; qW, 3܋ ȁ  -; 00CS; hl\   ^ x[@T K  8K DK0 K40KpK P 00Sd40Sa80S^ ᷳ [0[[(,[ D0[@[$Č<4 4 "<, 0 K0 p @P`$,0( 0( ,00 K0KK4 80< 8K4 80<p@LDKX0 K40KpK@P`$DH嚱P 7zk00S40S80S  V[[0[`[ [P[[p[@[h1 [唠[lXᤀ[[[\`@p[D0[H[L P [T d4@1 D|<, ă $x q  1,(p,4Ɵ&<.  01*$t$%,.t0pODU@Po86D@ 00CS, Kq4L K1@P 05j-0[ [R~[Q}0[S o5 @ Ƞ,Ƞ0 4,40 0S le@T @$ 00 t2K`'D  PP0S((0K  # PK`K` |ğt\hğ\p D ~8$P,JV 0t0t0S `,0K`PP4ȓ0S S ß,  ,0KLP |, ) ,0K>PJ 0RS 0S Q00-S ? |U R?lUd>0S D0S   :8> 04 S< 0@ D00S0H0 |PN0SxNP[00<0S<80S8h= h= *x0<0 08 STPQ 00|SM O9P>0S 0 S  I<8p= /_@P000T  T )9T/00P<0S[0 S!PX<0S N0 S 4<0S  0S DQ<0S  ;;0S ;P PJD0S ;0 PQ  l ` PlT 0 00S,  R'yP ;,0 :)00|S X@ 96, ,0S  P*0S00H:: vX, ,0S:D oH40 l:0S,0,e8K(P0S;0 0j0 S J峥囨P0P0 KHP0: S T)0S00P9  90S 9X90S 0CS@9 00 L90S,0,890@Qw0hDy0E*@0S,0,8 p X@`T;(0/S' 0S 80S0S}#''T@K00/@0T0 P@ 0TKS#0S*h0S00077 *UPPX``u000  70S3 60S 60S+6R&Q$60OTS 70SD7#)07#&60S7 6 &6hhU Q4&0@VD X>D>4F  , MYPP@",`p60S,00#30#,p3P 00 P@T@, 'YP0S H0G840 S4 4 40,9 TL00L0 Q N0S#G&gT0K 0OT0 P@ $0S D0S H$0S 0TKS#0S*0@0 P@H0S 0S,00#3 ,PP)0S, j, &T t T 0S,Z,%0@(S吃̣ `p0p@h30S000@0]P 430S,00@,PP  L0S (CL Rf20S. @20S D20S&,TK0S0S *p20S2#2#%<20Sl2 X2 %H2?g10S000#3 0PP 0 Sy3D!0@10S,00#3 ,PP (c340S0 0 40,<8@0S@ 0QEUPQ11P @0SP@Cef 0 00d|hЎ`x3p 4ȟ`hd<@X<THLh(|0T@(0RtD0Sq RQep00Sf 4 0Rb p\ X qY 90l h lK\0Kd0 `@ pK0\K@P&L 0Q?@0S,1 41 @ 52P10SX1<  #tQ01@P@[@40S ,0S40,00S0T!0S0S<8(K -\4LWMPpP` X@K8孬 ᩬ$4X  00KT P LP Up!xPKP P#xK 0ܔP#xK P0Gx0[S xKX K00K1P pd C PH3 004`Q,,#30P ^K E000S  <P,s0S2 Q3`P( P 0S* 0S 0S  <ФP(,I D@@`PUVD1 0 I\xq 0040 @=4 K0@ 1PgDB0S (0K  # PLWDH4@A@ 400QS P" 00S 00 PPPnSP jS 80K8 ,T0<0 #(KLX B0lT 8(@ȟH` -0L BPZtt 0-LKPs10S 0P 00S3@S00@P000 +t00S h0P \00S3D@R00$0 (0  P0x( -LD0@0<S03( @   -&6LAM &60 |Ცt&P 0S\60X6+ P6H6PP@6@vP<6 0`0  !P -AMLMP44 0P0004 @0P,4 1  Z Zp6 h10S' \100S<1BK0`Ns 0 r 0 R0 @R 00S" 2,4 04R Q|00s344dX 0@Y 800S (Kd`4 -AMLM< 1BK1@@ @@, 4 0 6BPK $8 qB^KPEp`ĐĠ PE4K0S0 0S 7P0 K  0 0 0@ =X0< e@P8 0@(KPT D4` d 0 00 00 4`  0-0@P0@ TLP Q0T 0S`0hTL 0S <B0>P 0@0P0 `    Pp-LP$A  KQ!aK P0PZ^P@ ʼ0 K 厎P @0S0 J 0 p R 0S phP <H0D 0@ 0p p(^ `      00 -LM  $K 0K   K -LMd0@0\S0R.H Kp 1[4 SP00 0P @Kht@ -3LM0  4K+A4PK`2, PU`pQZ0=y@P` }V@Pᴁ 2勅 0ctŸ 0PXR@ P@; 0tVW$" " 2Q0PR@R@  0X0!Kdp&0SK 1WXVV  0lPO|1QKp1 @PUETBP~@P~ 0& 0! 0 ؆`ᖟpKQ KP@᧟<`ᣟ<ᅟPEd@d0 ؤ00S0P -P@K- P(K.A|?(^ [d@0A0 h4`  -pLMpL GR@77'4KH@70S 7`V77D @ d D"d @ 0!|l7L0qH /SdRdQ &P 577 0R42K7PU ᾤP@Ɵ`@ PƟƟ!` @`0K&0I0pK&Bpx60Sl6`V ᚤ PPT PUDDpPÍOK፤0a(&`#0pK & 060`gVdҞOKPrşşea0%p_K`pP`%VF% 0U0W00SOKJD%0 \T B$%a@Pڣ4K, p pW^Z0=Ɍ@p ͌$@0S0DS*40KXK W(4p   p4  P`^Z0=i@ m}@P 4弃 0ᔃ< 8 LQ/KjPB@PoK a0#xأa#p_K`̣<@$<pP<#Ld0n2ZYK 09kPژ2@"R D2SOKᢣ"a X WOKᕣ"a-B2oKP}@P }/K G 0B/K Pѝ@P qa0!ha!ᢝ_K`\<@ᴝ<pᖝP!Ld0p1p0S0P +POK? H^ (N!LPH 00S 00CS0 0  0 H@P 000L\(Kt4lh|̧(^((x hD    ,.A<DTdt< -LMH@0s0 K`p 0SЧwt@ -L~@P 00sr@ -LANKM @D+`Ẋ:PيP ~K pG<@Pp:8[/Sᛢ@ P K08SS/SK 0-0L0M0@S DPK0 N 0PD0SH  402PF K0  -AMLM4 p@8 T2 0S2@ P 0S 0S4 00P0Sx嶡PP 0S`R#0 S0/R0 S?N0D BnK`F@+(0K 4R/S@/04B+d PN:hP!X0080 0\0 ,$ 0BnK1儑儡4D`FP t1p3\\ PP` 0P @,100CcSX108P 0p3v0$0, BNK0@DJP X000YP /@P&I@he00(KP 33X`ȟ ^ -LM0ԧ -PQ00`R0LMSpF ,20SB K"@1,^K-1PPPQPOK@D^K70!Q`$1PPٗP PU  0Et EPd!@/P T(0KP@x0[SPDP0x@KU @p PV%`PT %@pP 0w03T0S P  X0 SpP h00S`0  (K!HTXh^t| x p-2L0PS 22 VE2 p2 R22PR x2P 0S\P 420S 89P(20S 12 'E1@ @刈1 @傈1 @|1 @v1 o10S1@1 T!0`0PV | p@Ph k@PP 0T.S@D0P008,!DTP$$ 㥈P10S 1 1  V  d0 D R00 V   ㇈P0W 00`pxTD(Pt0(> X`|  0- LM0P@0P P K.0 R r X0000 T 8@,W 0P8 -2LTM!0p`0HP^1A0 @0s 0 @0s 0 P |1|mW000 0000,K0K4K(0Kd@K@$ K$8K s, A80$ d0 40(`0 00v.B\0 ,0A BX0 0T P D0 vpP@uV00S 0| C@0@_ V `@T&W @P(0tpu0 K@`MЍ -40LM((\ 0 0C5Nt(^lt -5LLM % , 0-S ``P@Pp00`lp $*p d0@ S 000000000P$*pD4 U/@P ZY $W p   !'pL Hp@H P9 p Y/p !pP UX@K(ZT00 T0 ",,#3L&]0S0jl0 `pl}`K .0S `0#40Sj@\K \@ 剝/PS 7WV 3 $p@ @ T ( p 0S b/ 1p( ^ h d `KN hK0P`@ `YpT 0-SP d6MU.@P9 Q 0" l0S$  @ = 0S (I6"   ,A\96P  (65%65,mP@@J '/T3Bh0Bptt(^X<dT(ܢ MЍ -LM+ 0Lht -GML1M |a x!@0P$4 T!(p oP8 0!(p 0bSQ`A~K pG0pG4 m7P2 $$004 4 =K 0C 0P" P -P P J0$t@A.Kh0 B B\T0$81XL ,Apt|ܭسx4 -LM@pP3 ^.PP 0S nS6 =(`P00QD @ Q? 1P 0V0S D 0 YppV 0`p(KY" 0 0 p 0oSP 00 0KG0 ?R0S@p @ `0 p00c 0"S 0($P 0 0d_ (ة -L M`P,P, @,K0pK 0 g,0@S 2$K@MЍ0ሚ@-PQ @p`0N S3. P P 0 CS @ Tp@-PQ @` Q 0 CS @ Tp -LMP & 2@0 @P & 0/ @a00@2S o&pPo P? P` a`P`%1?FA   0S1@0 @ 0S0;S<0@0 @,K ,0K(0 S ,0S1@0 @,0K(0 S ,0S1@0@,0K(0 S ,0S1@0@$K Pp-L@P6 PQ5 0R14 40 0R+((P P% Q# P ,,P`@PP Q P 808PS <<ɛP`@ Upp -LMP00K/00BP a@p)T'Q 0,<4("4!| ,K♚0 `V,0 0,0 00S , ,"0 `S:(K -\LM`P p 00Q 0 ! 0@T K 0-LM@P  $ K@ @  $K@00P $0!K0 -LM`0 P PD $]ppG hbA $pu}G U 4P 115N;NpDaiG0 d@$@p DTQYG 0$/h@l -@̠Lp`.0'.TP! .U.S Ut! 000t0 00000s03-T0S _T _TX00`@T -L]KCMPE쐟MPE@p ` +D P:$0 0L0P < 00 8KLp H @` 8P 4 , D 埴pF 3(K @ -LAMJ_K, ,KOKՙG+p`P#0S @ .P @T T x R 0SR( K0ACp <+`V440 JKp,  (KHL 0-L P%p@dlF8 pX`F 0h0h| p-40L`,0 0Q 0   000S V(P/,P,0P ( 80PS<" U@ph@Pp蜚 -DLP㡑pP`H 00 @0 0@4 40 0040404 00 4 ( 0$ P` 0$  )P( ,P x)P, 0P q)P088fP< <8 @zTP @w`8 -LM, P BR00S ,P㯎0@),BR00S (P㢎03)(T"P0H<`S 00<S$0 (00S`A<凎8< 0V 0Vd18S_x a@80S<k01800Ea@80S<_, 0p188P<B 0!0<8 <0q`80S<A,0@188ɐP<$ <8 ޗ< 8 0!a@80S1S 800箐P< 0!PU `X$;\` -LM@P4K 0S   Kp0 0 z( 0S 0S  4@K$ $`K Po)P 0S pt @T `P4pK@0PS @ UT $1 1P @ᩍ`40(K  `p (P(`P ( (厍    刍@4pK0S  }@ T<0 80Q K(^PX4P -L$M@PPT wppd @@K$ tD 8 p D0Sn ?GDh0`ŏP, `  p+3DT,P@QNPUT@D0 jPD`:,@0 WP,,Kt|i$  p-0L0S00@T,``0@p  Pp 963t00\2P/D,8),& ph"p茚,  -L Mp@p P tpbph d2d o=L~@PD ሲ4R4,Ka( 0,0 0 2Kp 0S |C P 2[ ֱpmuCr`P I#0S |AͰ0S  pPXC 8Ta0S D@KP e  ~0L 04 000 @T00P00@00@#C tCH0s TE$K4 3@ L (X  p   О    -L M`*24 PB2 @1r P0"0ƕp P*J`P$r10"ẕpP*,0``Sp! `"宕pP0*,@P``0 pPv*@`P"啕pPm*``p(0Sj !剕pP0`*(@P``0 ipPQ*@`Pl!ppP``0p0H:E1=U80 80S ,1 A0 !UpPp``+*P Um0 }P @`Pm0 }P @`P}m0 x}P @`h (pP 5:L P(K(^  ,!@!0K蜚" -LMMA~K pGPpG0`+0K@_- ;0Kt6 ,0x6  t1d& 0@h6 0S1!l6 p& 0SS 0 ;0& 6 0ˇ 0S R0 0 PK @@p@ 06S 0 ; ;KSK?; 05%% 0$ 0CS\0&0 0606 6600 a>0K蜚" -MLMq`KP @@+@@K_- ⻓`1V0K,t6  H1d& xF 0Kh6 00+06 k1f 0 AA+ ˁ0SP00 Q K @@p@ 06S 0 ; ;KSK?; 05%0&$0&6D0 & 0 40& a>0K蜚# -(0L 00hꔚD# -L@`孋PPT$pH0S, 4 `,V  {P Px "0 GS R 2 P 0 < 80p W@x1xt1  018@T R0 Da1 SL0 0P0$0 10h0S A㥋P@(eP*@ hY( 0@0(j@P((塈(@1S 10t`00S |P@,X  5, 008X#### ##$ -LM‣000P k0 0000w@0`00 00@P00`p 0& 0S#@P0 0000000@ 000@00 -0`0@0x@TP 0\QLRh0@0 4B0`00`L )BL s@0SD0L`0 0 04S08S 0L P0ST0vP 0 L00 <0 0 0 0L  %@1S 10LA0}0P` 00SP 0So P 40@  %400# 0l0S0  000  000 0,@0 00 0$Km! ꜚ($3 0-LM@Kk00@ - 0R 0R@ -M| 0@ 00T 40P H;40 00404 0<,0 VK0P$t$$$/ -LM(KH2D2, (0 b0/S0S*}4 80 <0408@ 1 `4@0 0.!@P4@8P1Ap08 ]=0`R40S0 ]=0 !0O?0@@@c00@408@1!0 <0,0(PK`400@T SP0@48X("(04"4 0 p0\@`0 \02T00 4 <080(0, 4L K蜚$D- 0-`PL@圏$0 00 00@,0 0@408@0hAꜚ -LM(K(`KP3,0PPc43@_0,< 0S0S*00 P 0S0S *R 2 L V2 004 80 20<0408@ ?X2 `4@0 0M @P4@8P$R$208 ]=0R40S#P 4 4 0O?0@@@c00@408@10S (`K4@00@PU T0@ Q 48 8K $10SS $0 S (0S 00,< 0S0S*0040 0S 0X P 0"P8#8 $#$h0`0 P04@R+ @ <4& 0( 04I K蜚%@0 0-t@LP囎$0f@ 1S1000,0$0 @408@ 000hꜚ -t0L0PP P P0S 8@8M0 00 00h蜚 p-LM T1@@L1LQ@ K0P 0R 0R0@0 P40 0R 0RQ 0@S P@0S 40` 00s$0 00@O,0 0@408@|Kp萚 0-l0L0P0SS S S@P40h$00@q 0hb0蜚% -Lg 10PU R  00 0 S   002hq`@TUh1S#P0@升P010@僇P 02}0@yP02p  00h 00 00@,0 0@408@H#hꜚ.' -x1@L0pSPL` R PO PU  .PPi4 P=1S400400 0<40,0`p\0 P + 0S 00P0P0000 000 0P0 PHbWVi: i蜚%6 -0L 2s=tt0% -L0MゆpP e+3p@0S P+0T(0S%0 0CS  ;T<=>;T0 $S P P P$ @d@ P@0@0 L)0`0@0@TP 0 00 00 0 R,pK 0)B@K u))0  X!)0t 0[Lc0 $S JP fP P$ #P00 R 0 2@T0S 0P(W 0 (@  00 02! rQPR,pK $(B@K u@2(<0  t$(0 0kԁ 4RL0 ,KD 2@K Ḍ` 㴍@P  P00P0|1 F0H 0C0S00S' H0H^ 10@,0S 0.n 0S  0$S ,K00P 0@T 0   0i/@᱂pl h, Kx%%($%%%&&0&8&(^T&d&  -7L|MP7` `G崗 pK<iP9 cP dP LP1qPx7- uPl') lP&0T'P'0000p 0: S+tp 0: S p8&p6p0gS-T뜆P[ 幄FPS 0PP 000\P TF0 0奄P@@ 86P0&]=000S0 0&p* Uc@ L0L2p0L@8 Z (pp 0SH 8hK6p8D70\K@0@T-s*d@HT00S80\ 1p8 P \0SX0S |6D P`"` V 4 0l0 E0,$ `0@_S0S*ps儃@ l0P.H0 VڠC *3pOW8p pwlԂpPdr ) X  40Kp9A8(b4 40 004q4 BPJ R02.p`@8 73|2P@8 X' 8Bp7(0K* #P Pp70a0L0 Pp7p p  d"pp  o/p\  ůpD ~8 x0H0S `0 00B(Ktxܧا|&&t& &d&PT&&&& '8'`'X''''(t,(8(@D(X(`(t((((` ((()4)@)3@ H)T)F -LM␀pP(K` P  .@Pdq (0`0 000@0@`,P,P 褞Tt) -LMp 0 D,Ks;PXP; 0P P0pP ,`@00P @T T00X ~ R 0SR@ ,PP =,PP P;U(K)) -LMP$@Kp A?@0CS@P@ T ;P% :P0P$` R@X F  @4;T $K@)))* -BMLM`,KL  D4@P P0pP,Pp1@qP p WjC.K@ B B@D P$ D 0K@4H4 AQ SQ^ CQ BQaIQ/ LQEfQd XQlQ5 tQP$+hap ,K 3@P Y,Pt@0 S P4 ň D$ {4KP 4K @ TP4ಈj  Pl  ~P H{   qP    gP  ,K3 !@P P1pPT ;T] ,PP P0 00KpP `P  0KD9KP7 9 [9K00B1  H$ H$ H4Q? H$0AS,P H$0AS,P- fP D4Q`dL$P@| CKAA L4p(K,*X*p***** +0+H+P+X+l++ p-LM@PK <@0C`SZ(RQRRRRRRR8RRRRRRRRRQHR\RpRQRRRR40040BK~ 1`P40 pP3 40- * P(x$P"x,x(xxx x8fx0q ;V xx+++ -PL`. {P@ W ;Tn hW@P 40 0 4  0sl= }S [ "D1R0 Q R$MP " =~ hE0 p4 40 0RU 0   001P 0PRVt 000@0@ 00S0@0 @0@000,84,L,l, p-LM@ <@0CP&S|V8XXXXXXXXXTXXUVV|WWWXXXXXXXUXXXWWWV,VTV,XXdW W 3Sp 0 1Rp 0 1(R{p 0 1Rqp 0 1d2EF_K,p ,02 , F_K,py 1 , tnF_K,pf 1 , x1$`1PD1,,141<0]0:/+-(C`P0@<`P0@Pq|0@X0D0P D4 ;U Kp褞 \`, p-LM@`K 0PP 0 nP  {PP l ;U xPT 0s4 x}S u x+,, 0-l@L\.@P PP` 0s S ( 0h-0ܧȟ , p-aL 0<$0 <0, @ 0,4 @0@<<0 K?,,  0]- @ 0, @81 , (A 00 0   000   000   y00 0P0 P0   000   00 00 #.@P  p #phQ-pاLȟ0 ᨞0   ᨞ p-L M` ypPV^2T 8@K q m (p@(@Kppi -L M@0PSD0 p` `,K PS ,@"P mP 00SP0 0 00 40  Z R4 @T,(K蔚-- -LHM` pP <@K  5m p1 2[A0ASp0<Qd@K(  m \p 0<0 L0  VRKL-i H6i( p-L M` p@ 8PK Ḅ l ]p12[0 2KNpy1\ 2[ 0@2K?pjr1$K KpL-i `-i -- p-@LP`0@P0`p訞 0-LM@K,K:pP@?G1 @ tB @00@0 ;P <0S @0S , R P [(K0蔚. . -LM,K PD> ,`B0Z=(!P lP6 @0S!pW/0 4 ᝃ0P=S=S  w|P  0=t 080S |@P\  %l< 08@`V$080S  ,-H. -xRxxL M{`p0SX0 L@DT@ O0S 0K00KRQ0PQ1P/20S q?!0 H @0 0K80 KKA0S #K HKp_0#S% [0S! W_0\4[ R H0S 0s3[ 0SD3[3[ 100@S 0S 00 l00s H&2(K舚d.|. . ...  -LMPap4 00000004U (K蔚 -LxM PK⟂x0CO0KKL >@K 0@ 0 1d [P {@ H$H08#8d K#d[0c0K0d`K\0K 0 [0K0dKK6K5K5KX T @H$H Ġ$Č Ƞ,Ƞ(K 0K$t0;x`,$3KC<  2K0K2K _^ P  0@K  0(K!x0K`t0x@tpxPpKP0  @K 'P0K 0 0|0 xp tP $ Zp@.(K蜚. p-LMP0     p@.` 0K`p.T0L0@ `p. 0$@Kp蔚//!8/ -L4MPNpK02 ዁ q`PP 0S .XP@P08 ZP @. @0 KT/`/lB x/ p-LMp PWP4TN TSST 0A BS@ AS?IS6 LS:3fS5 XS eS26lS) tS-#T T p BT '3 0s L 0 QQt0:p@p0P p @@@3\ 0 ST2 0T00w0S 2 0WypWڔR d2|00 W < 8#" !0 !0~@& x!0m 0X!~@D!8!00$!$S!0~'pP$T0P:\Z`P` ~pP`P`TZY P0~pP`P`Y)~(K $1H1t11112@ulFH+P+82P̜ - LM, [W0W , S *P0S :\1 ToD1HjJ,!100tS  RPa 0 BS a0S00 v@P m  }000@Pv@Pt Z  } }0 00 t@0p,0WX:(KT2x222 -MLM2@> pR~2X~Px$ @0Rt1 10Wl Q^KPE+ ~J ~PKM.\P x6S 6S 0  MP 60h@ Dx6S 0S S S`P`P`P`P P`P <0 S0``0PP=@[v 0$KRp UKA$ $sNK@D[@sT K蜚P122`6283X433,3 -0L0 S 00CS00Ӥ0D& \00! P 0 000p0 T0 p LPQ(0  B000TĞD@ -PQ@`Lp D} @} <}0|0 `t0Pp0pl0 h0d0 `0 \0 X0 T0 P0 L0 H0P螉\@Ğ̞DTPLHXȞ -3LMؓ ԣԃp@ 0`bPep 0  0#PWp P "P9X3XPT3`L#|@8@`"U00ST P@`\U@@ V 0pP0$T2 00d "u 2P"2堂 \00A S-Q5T"d2PP"@@00S (R{  "  Ke^ --LM 0 T &*H@ @00S (.{    Ke^ --LM 0 dd@ *XL 0S 8 {0 ( 0S=4#*e^t0p@-@P` 0S400 0 CS @ Tp p-P@L` Pʄ0#S p 0S10{0 S w0S s{' 0phv00Sp脚4 -0Lt00@ 0 up O0S KS'$0Phmh44 -LM@P!  bpP 1 pp `P@PPV Ep0S K5 0-L" @P,z00P2 0T yp'40P0 0 5545 -LM  p&@p귯K&. ya0( K`p2K1p2 ڂKxK\1(K @8PK2 2 Lp Ђ P y(K0 00PK0 70K@P <@ 8@KHP D@ Gp 0S7 &' P@ &.p&P2[S2[S2S2"SP {&Xx|KKT,P@ @ (Kh5LT5555 -L$M4`K@pP py a0UL0 $0 0 0 H00:p4<&9K蔚56 -L(M@@K`P p>yp0 `ia\0 00 ,` (p  p & m$K蘚 6@6 -L$M8@Kp`P yl0 `:aX0 0( $` ܓp%? K萚L6p6 -L$M0@ T:?l p`(K77777 p-L0M0@KP v0` 0 ` S0S H@K v ^ 080 4 >Kp0@-`P@ 04"48#P @@\:\* 0P @"@"000#  -LM8 Pp,  P00 P aU0@@uTs pPn 000f 0,@0 04"48 #8PSP J00` 0SPaU0@@HTF pPA 90P $#$("( ⶐw  sĠ n0@U@``U@@T PV0@@T hpP X p, p(K耚| 8plH8xtp8 p-LM&PK`@ Au =uKp -L @u0 .u00蔚 -,<4(L"4!<M K 0!u -LMK u0[#  -LMK u < 8#"  -LMK t < 8#"  0-LP@d}PT @T {P@ ;PT00 P0h{xp0 -L@n;PF -LLMB@KP %uTTp(`K#;P@ /P :P P P C(@ f]Pf.;Tp@KBPK, t P 0S  P 0S  d P 0S LpKEpq04$K FF G G0G@GXG 0-LMPK00K >0@0S 00S 0"St T@ŕK0 -LM@,KLT BTe ST lT` A  @ A @0KP0, ?p0PA<0@L$ @@80L#D< @@40D#L40 0@@#4<$D0 0L@#<4$L H@$4D@P`$<p80Kj@P 8@ 4P s(K 0-LMPL K@~P<}8,<4("4!<@8xG p-L@`PB _P. PU) '.P UtOp/P XG{pB <P 0 Sp6jpGGG -LM@0PP ;U$ !P:`&pKP PU :P`UcP &K $s:V  / KG)* -LM@P.`(KB pP PU .P`U(00.V (HH p-LMPK`0@P T;T` `P0R @Pi`x0HLH -LMdddq@C $0CSL'@<$K'hHHHHHHHI,IMЍp@-<@< `P 0000PQAp -$0@LP g !̨ -d@LP YPHX Db0,0( 0@ 0 ̨xI -L 0LR RP 0R 9؞I |00-PPp0Ll PdZ\[p@ LH0P 0( ,0н8ĮII -DL@ P(0( 00000 S<؞ 0-@AL81 PP,1, 0P  R0 L\00P  BRʔ00 0 0 QT0@0<0UP<@00v00@؞ 0-DP@L0000@@0 0 0 0ȡ@ -`L{jpPlv0 SPfu% ࠟ0S @ PS:00000 ΰ`PV p 0@;\EXg@P`0 @0O9III1 P-L`h 1 @0Q0S 1 00XP\DX` Q0DQD0 Q@L00=jpP00CS04@030, )0@0CSp0@0 0@p00 TPP \, 0O00؞I9JG-鄠儐Pp0 0S0 0 BS00R \P@`A -D0D@00  R P   p-P@0|`00t0L@l0@d0@`0@sf0@0CS0 @@00 ph!p  -1q00SL.@`0\0 09 P!+00CS0#@0g0 0P0CS 0`@0U0(000    9 -LMP@0 2~XPB ,K A@P 5hhhrhb`"PYm 0 P40S0`00P, 000S SPp PIXP aP AXPTAZ,KPPU 1 ,0Q.0 Q@L00h PH00CS0<0A004 U100CS@ 0@00C,  +o@p0P@ 6 Pn P \0uP 00S Pp(K0^] ȡ(J@JDJ9 -LMP0@ T T.SpP- 弐0帠S0@0*@P`P 0S  0~  0[p3PPP0T@0XJL8$-0 CR 0R0 S00 -@0LP`rPe9`Z !`0Vh'`c0SUJ L0SF I0S\\@U`T x,WP 0`!Sb/*0S@,0@00US8080p0US00c`zU[PX*\00S` lP M U 0@0^S00\P0SJ(tJxJ -LLrLLL`~@0S 00CS00PӤ0/PuG  Q/0 Q@L00^g P00CS0^A0T0V S0`0CS@ 0 L!0A800 S0!00 U`!00000 +0S0#3 NPP 0S0`00` 0S0`00V @V00 00 0 <0 ` D98̡JJ0 -3LM, 0 0 S@`TA3P, `3@, P00T$00 R0 Ch"000S 00CS00Ӥ0x0S0  0P 0S0@ 7P X R/ڈa刡0 RP\00d Pd00CS0J@A00B o?0P0CS 0P00^ X00p 00S0#3 PP isW d0 00l0 pD0 00@00S <00SWpGp89J -L M4 pRŸP2 0A`00 p30!00P PXP1 ^P00CS0W|A0^0O L00CS0  00CS@ 0 "005"0 0Pp0L0| 0P:Ad"0S\ PPe$2 , Q#0 Q@L00w^ P'100CS0A00CS@ 0!0e0 0P0p,00Cs,0 @00p 0 SD R/ Qa0 R@L004^ P00CS0+@0*0# V0@0CS 0x@00P0T@ dH0 p000%S!S08<,DJHK9ġ -"LM00 S2 100 r 0 R R$K!P\ 0!S 00ZPT`1$ JL1$0 S8u, Q. Q q0K00]`PWa00CS0.@00& &0@0CS`0@00h0H0$0 $ 00$  Q0000K,K@D9 -0LMP@( pX 0@T@@T@ET P`P ` 0S  0i  0pGP  0T@ȡ@8K -2L 2ŸP pqb匢倒刂00 QP0@.TR 'Tf $TL  T T%T,Te +Tp 9T0T1*B?T@ ^T ;TdU!0   r 0 R00B S  1@s^T-T`Pt 0^T-T00PS@  1@s 9S6 .TPP00S. /TBPP) 0T00S 0000XPPS 0;T0 0 0\ P00wPP U(00S(8Pȡ0@(KLI -0 L`pP0 @000 00 ,S;S;S "PD 0S0S0 000S 0 0 pȡ($L0 -Lϟ @ t 000 Tlo iT  &WT HT ET !T =T` TGTbQTs VT^ PT?eT cTI |aT gTP rT mT kT8 cpT TnTvT< tT +xT N:zTP@0 nR pR lR 0P0P00PP =  Q ,>0S p>0`>PsP0 nR pR lR 0P0P00PP 4=  Q =0S ==PI==]P?P0 nR pR lR 0P0P00PP d<  Q <0Sd <<VP,0 0SS0 x<0S <0S( p<0S r ;000 <@P P0 nR pR lR 0P0P00PP 4;  Q Y;P RPPP0S!SH +#J0S, 0S @P ; ::;0S[ rc T:000] P 0!S4  P0 nR pR lR 0P0P00P\ 9  Q 0S+ I U9`V 9PaGTPPgTPXVTP P0 nR pR lR 0P0P00P\ 8  Q  P(000)90SP0 nR pR lR 0P0P00PP 8  Q ) 80SP0 nR pR lR 0P0P00PP t7  Q it'00cS0 `'0S TT70S. P0 nR pR lR 0P0P00PP 6  Q 860S @7@c(7PP\0 nR pR lR 0P0P00PP 5  Q H60S 66P} $0h&@ 0R P0 nR pR lR 0P0P00PP 45  Q 5TL5fPH 0 nR pR lR 0000P 4  Q $5 55;PT`pP40Se @Tk40SgV`pT P0 nR pR lR 0P0P00PP x3  Q j30S) t3P( 0 nR pR lR 0000P 2  Q >d3 \3H3P 0 nR pR lR 0000P 2  Q 2 220S;P0 nR pR lR 0P0P00PP x1  Q 10S |1 Rt1 d110S  0 nR pR lR00P 0  Q L10S d10SqT\ P6q 0000 10S1  1 k@P" P0 nR pR lR:0P0P020P0(L0\@DP Y H0 0`S  0oN0 M400CS:0 2`2 0hQ0 QP\00\R P5 0l0CPdS 0T"0Q@0,  2 0P0@ 0S0!`V&0 VP\00&R P00CS080t0CPlS 0 \!0H001 00@ 0 0c SC R/`p0 RP\00Q P00CS0@00 k0P0CS 0PP00Z(0 00@(Kܡԡ9ء -LM  @$" (2 >P  Ld0S  0@_K  0 B 娑P$" b  ," (2S  S ;#rPU0 U@L00wQ P; 0ß0CS@ 0 h0mT#00ß0S 0 W K 0P 8"RpW$0 W@L00;Q P00CS0U0pŸ0CS@ 0 X0)D"0 Ÿ0S 0B WK`0S 2S ,\    ?K Pk  "向0pf 0 Q2 /hQ`0 Q@L00P P<00CS0AA009 c60@0CS 0@00RW "1 $ sp00S 0T@ %W HWQ"(K8ԡܡ9hM^ -L M0P䑟0C0 4 , 0Q000B 400pP^A sPX|0`00pP`P UDA % MPP!00CS0:A0L02 /V00CS0  0:0 P,00,0 p@0d 0b, RZPP  P(K$ȡԡLK -L0  0%Su0 SqB 0S  Q.0 QP\00O P0@CT@xR00 _0<0CSP 000M0  Q@ 0S.@D/\Q)0 S0 @!!0S 0S0`00 tQP d!000S SPFq@a$@00 S R0 a䀟0 RP\00kOpP%00CS0#@0a0 0P0CSp0XP0N0$ H0@000LС94 ء -@p@@0LP` U0@ P0 R00R00 10B0S 1@s @@ gR00000ءK -`吀L p Q0@P #@KT00Cs0,0 (0000 0萱ȡ@ -2LM0s22080  20smxB0Sl2  o`"0X0 @0A0 S6 000  0' 0 00 0 00L000 000 000 0000 0 00   00#0\L 1   @Bp4`K07# @D0 0C0n##0 C0?^NPnʬ00S~t0x@C d0 \0T800@ \P0 0 (K蔱ȡ@M4 -PpL0` Sd0 0廫@P 0 P 0 5$ 0 5$0 % 00(J@@茱9MЍg -LM/@P  0 ST @T 0/S 0/S @T  -L|M  %P  ( PP3 40CS! !  !  !0SB <0Se 0$ p0/S0`c(4@ 0T/S/000h0 S" 庾  PP70S (K@6 夾00 垾  ;00LKZp4 4ST H0 Sp * R2 0: S  R, T R{  RV QP  0S. N@dp `<P$  $ p4Sj H00* RP2 RD2 Ra 0Sh  应PS!$ 0 pf0: SF1 Rb0S? H0x: R6  R/  R1 R q3*P) 0S 0S T, H 0: S  00 1 R q3.P -Nq3GPu  00 0: S p P0H lϽ HOPU@ 뜱M0hЋM NM -LM@PԓJ01 p0#p5 H0@*S*0(|&|&|&(|&|&|&(|&'|&|&|&|&|&|&|&|&|&|&|&|&|&|&|&|&|&|&|&'|&|&'|&|&|&|&|&|&'|&'"mp2`@fT"0Sa 0S!001p2`Dx2xBݕQ+; P*SPDd 0 0!KpPw0SkVu8  ,!00}1 yy1 1 q1 1j00g0p1 b p! ] p! X0S 1SX0 0S0S 10 AK+1: S0S AK. 0 . B0 )kp 0S p喩h哩 \ P勩0: S(^@Nt LNNN 0-LM(@(P(    ttNO -LM0 4P0S 褱LO p-LM0:#:0 0P( `/C#b ,0 0@4 /C#b &P@[V  (PP0V* ᳓PP*ſ0V0. XPP.x 忔PP0 0S H@0V<0kPP 8뗿0V@0dX#PP 0-SX0S 8(!@x$@MbdOpO|OXO -QLM@ hPT PD0P4(hV褱OO -QLM@ d̨PP5PD0P4(h0褱OO -LMMpA^K PE0PE`@ 0 'p% 0K T04B%P0P 0RK`全P XLHH,pOOOM -LMЄ0S  0S  ᡔpp H Q! GD0S>t4 R, hDhd$`0SPD00CS00`0 Pp@@ $0S0$0CS00 Pp0@@yVYV ``v$'{0S 1l x,K`v AKӻPP$1:( SPPn@P0?8 0 l '. qp  0T00(N@PU h2 PP/0Hp8 t  00 @,0?PX B0S>0  s 3Q R !0  0!SB ᭛᫛P"(Kᡛ៛q00 T廽F{HPD(~Pỽ*HPnK(P1 0R!0  !ᜑP XDNPDt`ጽ`tO &MЍ -0LM`0p 0gSR :R'P 0P 0@ @O 0|| PXX\ T0P 0\P L4P 0 0(,CtH(^,Z0ZtZZ M-LM00, 0S  (Kon00SP ) 0O0@P( 04/, 0dld0 0 S0@ `p0  ,` p(Ko`Zt\Y@ZX[ -D2L$M04 SP$20S"坐!40S0L 0S0(K@ 0'0 S0 00000  P` 0Pp\&G TS3 P( I< 0 00(00 >%P;0075\+93 P 3H( 5.:)0E,p 00.S.0@0K`8,0 , g b"30,0 0x 0 0E000 ?H%000!P P D(5Pp@P5@X-CP 4@0H8S 40TS4T 0HST 00 R|š$0s400s030 #P CK.KI B BI`X( L(00 @0-S 0SH8SCC000S40C S;8IJJIJ0LIJJhIl30S|帴 ~0S.cP,  @K2P @KX$#0J P *XHcPH00: S  JH00: S S0S2P" 8XH0S d"0SP d(H8S)0S @+;2!0S  +P10SPO @pK !0pI P: AV`<H!0S t0S<10S  H0t\0l10  P8 P P`0S00S 0S P |0S(V` PPX00S tTXH\\-\O\P@\x]P<`]L(Pt`4]Dh]\J]0](^]]]^t$^ =<,^ 0-D0LS@ 0PU@PHP)EPP0D00 0C0 0 -L`pP@@PHpD@ R-LP` q@0@P T@T O0 0VX1Xq 00 @0D00 00 0@T:p VOp@@0P00 V4vpV00 0P00 d@ep _]8 000DP  O00 PPH@L@ -鈁LMPpH,  F@T @ )PD p` pv 00;P'  gIp:0P c 010P 000 <@PD`  (PD0S0S(@  g0, cP@L@ -PPL`p/ (0S 00wSp rS"ppV 000x000p000 0 0@00@ 2W夓p堓=T@H@P@L@ -`QL MH p0rSwS ?R@@T Wٵ00}a@Pw 1,@@0@0@4@@@@@@D@ 1嬑0 PwS 0 !@0q`P =TH0090姵` 0HwS:XW@ W@@0 #020Kt0"̠10K"$}000K- K0 ` )0KX20K/K,K+K*@KD0 . K@  < G 08 0X  DKp  05P  KP  0(P(KX@H@P@T@^L@ -RHL`p$H X 0P @@ R,B BQRQ0Q@P`Fvd2TLDX@DA00 0 0 0 0 0 0 0  0  0  0  0  0 0 0 @^PlsAd@oAV}VmFP0p0`F@@ VV1E0\\0\ 0 \ 0 \ 0 \ 0 \ 0 \ 0\ 0\ 0\ 0\ 0\ 0\ 0\ 0\ 0 @`FPV 0 0R@P`Fv   A@AP[ -PpL 0눀H`$HA%XL\8@#8P@'XPfTPLD@DTLD@D(0U[E>^E0PEU\EPE@- 0S  00 0 0cRÌ`@0  0"0Q1 P0 0S訵RP< -0L0S褵< -`QLp@00SP(0^ ^0 01^ 4# # !^#$""1^"4##!^#$""1^"4##^#! ! !@D!$""1"#T T $0@T0 01 #褵< 0 "Q p-L`P@@Tp -pLAM0`, . 0J/K(1 |00R0@KJ_K   Pf@0    pd`0,1((K 0@-@P $^ 0 SΎ809P  L0  ( , 0 8 < lPP0P@-@ $P Q < ^ 018 0C0,0<8 0 Rp-PL@4 0@Q1S``.Pp(0 `S00`(0,0S0 ,00(PpUE20Pe$00E`S0,0$0p040$Pphpyy0%0  -@PL $Q ,0S 4Q00$,0$0P $P 00  00 0@-@P \00^ ^l\P:0 -LMpPL $`VI 0S<0S0S < 80 0(K08< 80080< #4 B80< <0 S0 h0 hh0  `h0S @ 0 0P 0@P0P $P 0 S<0s3 -P00@Q0SLT$PUQ (\N ,0SK 0(! `P 4P $ 0(P0,p CLS.Q :%<,0Q P0b0bS.00 L P0l0S.0b0S>0Wl0 $0 #4C4p$`0% -$@L40pS` $P0 (P47 (Q$ 02,(000( PcU4:b yC (0,00 0e0`U`1`!  jCPU 4e cC(0,00P00( 0S00, (00PR:0,0 -pPL`P4 $@T1 0S 0 S+0 S  > ;0P P 00( 4UbC(0,0e C,P0 0 -L0MPP  $PU 0S 0S0S0 S00D < , 0H0 8p<`@ 0S񟗗esssssssseglgxgHhheil\mnnopDqpqseee< y< !  ;< 0S  0  Z  0RJv`V0'=P0S'r0$ 0SH͟`F 30 `  0 0p8Z  0RJv`V'4<'<,4<0`80 00p 0S < H  D00<`8p k 080P\ 0S  07s`0Z  0RJv`V 0 Sgg$h,h 0 0T0 0+X0 00LP 0; 000!q`F<07s` Z } 0RJv`V@˟("('8,Rc`0@ 0p@0Sg DQ01 S@1 @!T`  HB@0D H0d d dD H @0Z M 0RJv` V"'5t  0 0Q\0`d 'w`FR0 0h Z + 0RJv`Vʟ00 0'hq`Fh\0Q* h00h0S S.0L T0l T/p l0PZP< 00<0h0T03L@ C 01QZ  0RJv`P Z  0RJv`V:7q 0`ah UP  Z  0RJv`V:^`a7q< 6 0n00'q`F(P   Z  0RJv`V:71a q`AZ  0RJv`V:71a  s`AL 0S \7 000 h0 0h P*d `0h ^L x:0S! S>/΅T 0 l@L0T l0p` 0P< Kl0`P00X0X 0  p0d P0< 0 h6 05T030CL01 P0 Z . 0QJv`S4  03 @C403<1 R0 Z  0RJv`7|`lS``@ 7p0  0@ L% 0H000HQ Z 0RJv`V:1H0C07q@ `a @ 00X030CP01 P0 Z 0QJv`8 03 @C803<1 R0 Z 0RJv`7|`l@``7p'0H00D 0HQ Z 0RJv`V: 1H0C07qD `a D @,0DD 00`R00< jD Rr @D0 bSH @c 0 bR a(00b@40bRD@0 Q10l@0D0H0lD0 0 R0@0HS 0L H DQC @0H AD 0H 010S4  Z 3 0RJv`V@0Dl00@0@0Q00 H0 a8'4<,'<4 <S D@  00D`@ p0 0< H00D(08pS<`0S 0@P @P0< 09,0@ pc`b0 00@ 0@0 0RV0 f q8 QS@00<`P  \ 00R40 <P<  < <(K\QP`PG-|M⠀P00\ 0 S |@0 2R02BQ0`\ @00S@T@ \0@ @@@'@\ 00S@T 0 sJ QR0Q0P0S< # 000 Q | 0S4Q 0$A\0P P 3ß(0,  (,0 3ß(0,00S0!Tp!p1' PP#0 \00LS`$P08 8  8 800@0i^040@(,Ŏ0@`@0ià0%3l l 041 R @0@# R@0B00|0 02S0C8#(@  P P@@a800@|0T"C$ \ YPi0 \00cSPR :  0<Q00SA 0P0 0pa 0bC1 0wY $ 0S0`4 @8914 @00Q  0A0000S@010p|ЍFYYWW^ 0`Z47MЍ{ -0LM R0 R P0 |P0 |@||0StX@` @PQT0D0L 0S 4ldt`Pht_(|@_P__ -LM0@SKb3P K0 R 0_ 0-LM0@SPK0@5P K0 R U0_ -L8MP@[5|'|x0toS000 `gR   0T` mS000 0fR  pX` L`  'p= H0@0S0~X}X}X}~X}X}X}~X}~X}X}X}X}X}}X}X}X}X}X}X}X}X}X}X}X}X}X}}}\}X}X}X}X}X}X}}X}X}}}}}X}}}L &p 0T0 0S 10 -R 0bSX0SP  L0SIWppV00Pp P0 `QV@ (  < 000C0S008K <姇@0S/80 R' D H 4@  X q`pnp`kp`hpW0S `:D%P p D ` H @ Pu`Pp J@P( 40C S؀   p0S Z| 43zP :"@Pp0S N0SL 0!R0S0S ZP\t GP T R 0S0SL0SX HD PP TQ 8pX RJ 0S0S@000C0SUI8K` ]PPlA0S80 R| D \P H i<K4K0 KRPl0D0 000H 00 ZH4 X00X0H0 X00X0H XyPR vHD P OH0`僄0P0S0L00D H0 )P` 1 0D0 H0 .V$pPD  p H D D `ԩ"00Bxp< `< T<   D 4u(^thpld_t_`0`MЍ&p@-DP0S@M4  Ѝp0S\ /+0;;0b <w;=*D0T0C0 :!6+P( 衟00 PrTuM ;000*0 00p!$r2 $X w*000@0S <WBKJJ`+4KjQt p$   00C0tp \0@ 0R 4s~R pJ@K<|T\KhK^KKK LLKtQ 4p07 g20@ W0L4 Rw0S04 R# pyğ0 ?qn808\ 1> A0 1080< j  B V V  V p(KE#0S:># 8 00083@ @U(ß4#0P\Q 'pt"0#\Q t0p  0S<0Ÿ00"\Q ѿ"0"\Q xŸ"04K\Q00d0X0L"0T"\Q40040K 0$@ Ÿ,"0\Q00"0D00"\Q40040K(0,@!0\Q00!0@00!\Q40 040K004@!0\Q00d!$0H0d1\%RB 40O0@41<1\%R404h0 404O0@ 0@e"F60N"00Z@$"p00=(00s03i?'(Y0Sz S:pg40O0 @tg,p@t|U dThd 0-PL M@ ZoU K0T`!0S:O iDQ@@Go08!\Qp$P$ ;o8o 1 R)0 \Q- +o0 \Q0O(0 K 0 @ $ o0 \Qpohod0 R \o04 \Q0S:Nt|NTN<NNN= -MLMDEH <\, 0X P( L8 D > L(RH80 $P D, 0R (KX(HH0 B8( 0 #'48HT00tpǏ Po t Po8"5XHpQ0K@0@ 0T QTʑ 4 H8 4R 4(R3^z  10 8H^ fHD(g4(Zk >K0S@P8 LH pCt#0\^K  1   RHHL<0S00^3 0 nKH(`F`F@0 00!"PH8B[0"\Q 0K0S@0@n|2@@000QPQ0 ! R H8.K ' 000<0 !?0003Pk4 j4H\la@ Kp l 0 \5 XE 0BOhE?DE 4kpU\ed ` 8U 4e @E Kp l lBnK`F`F@0 0\0 P#L!P,C3\%R 0 L5O0@l3 H @U(0/08 20 \P 0 \UXe21COPU`p2TU Pe P`hpǏHe 3 D 0  R/ $2PX0OD%0T%P5 H]aHDH D Pt0r OS(!\1pTP%Q PT P% X0 S R<0PES00T1 0 BnK`F`F@0 00w  P' 0\Q) 0TUPe0S@0@[l0 (0TUUh0S*W.K \% X5 m0 L5O0 @MD70TP%0S@0 @p|T ODOTOt` -LDM`@KP`@ * 0$0KP DP @` p(t0 p0\Q `,)fH  0@K ) |Th\ -LMpP@T% @0S k 0`@P``0 0\Q ,)]00iP 0: S`0P\ \ @ )0S <|Oh|TtOJ\ -`LMXH RS, @4ȟ (0S 0Sp P ǟ'0S0@0 G0S ǟ0S7 R ]k|0@S K 0S 0S 0S ^X 80   O  $ Q ?KP``F0`>_K`P`P`B2 MP`K 02/R 0O? 0@l& @Ācp 0 0aB K2@jşu0S %`PU`0P@`P`%`M5 R 50,PO/Q o 5 p@PELş@_@P004@#%8Po% "2"_K`PU`P@`P`D0`ğ0S 5j|4@T .j@T hT0S8 t#j@T `j@T W*#0S84Dp ^t00Dp Wt00, 0R(K`" (?K vPS3T@@@@0S3 R2 ,ß 0S. p, R*D0 O  & _? d0 0< l21 \>Q,ʠ0p, @RʰrH"0TBS8000, Rb xb@ 10>Ÿ@ ,0SHR@4@1@0L,)2&!0S tA0S 0Sh0Si Px &KPf 0S8 sXm/9xipi 0S^\i 0S\HiY@iJ @104@0 0T 1iP i 'iii iw<p$ PP|h,e,etQh_XQ$RLP8ܭ3ȲԲTRHD @P,RQ0!Sdyh00!000|1 c 0|~t1Pd\@1 T 0boD1  8Sh0!000 1!0000z0pQP`g K0 RDV 1P@@ 0T0P=l,\вfte<xPP$eez4OdptS hB D P -LM`0 @P0pW-"1> R.$` 0@ 0. 80pW080 0@P`Z  P 80pW080 (K0!`!0@0@Q ڜ1 R< h/ 1P1 ``Q 00L1 R R 0S0S R0S 0S0 0S P PPY0| `Nt 0@0@QTY PWԲ, Wf<RȲ RR(^hR -TLM,0SPڼ0@P@ |P D  0, PK`@P`RP |` 8ڼ0|/@ 00T 0 PoPpǏ`pT 0/ XP`1> 0P@`UVW4HTLd@- pǏpXʞ @ lK%=@P-m͟0000K\ 0-0=0, Ryڈ@ P @0 x@ PoP ` ,m0删O *Qx0   0ǏOP``L 0 <\%R0pǏ \0Sd < R` l< R\0/  00@@1> R00@p q00@@R$p l̟0 pT̟0 0 0, 0PK`@P`QP ` ʈk00#(K  P`K0@0 0p@   `ePWXxK`0aP` p KP p T <;@ 0P `@tP p` `*VKGD K`0tK@t p K P p R@Z j 0@_U \ xPOTli DʟP`PU`0Pf W )1S%ᘐ   :PK@I`0\0:0 PU 9Q ,9Q K00)K800PO/ 0\49@Z 0T 9Z 45S: @ Ty lX0S \ 8Z 0 0BO?^cQ8p5@P4 \ \@ PI T1!(0p  P P0S  \8Z00S0S 7 R 7xZ 1100(p&e @H7 R 7Z 0(eKK 00P@Kf@K 0'\Q ,P#6Z{ 0S0sp6 R 6Z_ dd(X0 6$PW HK[(PP3eK0P&\Q ,#%%O?@0\6@Z100p` $P $P0S 00 0 xpǏXW p SH5Z X #P0S 0005S:PR 84\Z謤S@ 00$@0tT00 0c ( " R DPt@PFPPU`1!X0   0 S PUM3Z00S0S D3 R 3hZ1100Xd@T<T5  `"g43Z  (ř Q \3ZX  0 0 0@1>@ T DR @Ӛt0 BR @P  0@!K000S00S  R K00KP!%601@P00 K lKP L0 #,14 404 14 \Ph0O0 /S x1APh00LK0S 0cKP,!0\Q40h0 40O0@;Q pܠQPm0Zs0 0@#1?@r|,h d@T<U زf$XflSTtOLSR\S\pff 0P@`UVKK6 0`\%RF 40O0@0P0\ X>0PV> @Pa V0 0Q`080@LAL!0\Q  0  0S2 K00K 0 40O0 @=P 5U0 a!  FP K,"00K00Th0S3 Hp tP    -D0ML8 , 0N$ 0p!PK|g -LDM@ lK=!0 000 K\0 0 ,0S+ڸ P`Rp Vp`Ui@P PP L` ?0lKS 0 P@`R,0 S 00(K |d  -D0ML8 , 0N$ 0p PK|g -LM4 0Z 0 :0쐟쀟00  GP0 P U0 0U PU 0S\4 | 0U R 0R Z 0@`p000 0(K蜦Ȳ W@-0,0,0S@TMTЍS -UMLMP'0,0 00CS񟗎LpL PP 0:0090?vF>K0C 0C t5 66+@ t< |0 1p6 bB! dd6 `4 X6X&Z4K0d0`00 0SZ S;;SV~KpGpG, 5)5(K \%5R 0@`5 \E ( R01 0#SP %0\Q,0(0,0p0t@(  R01 0# SP R P(%0(%\Q0X000@\0T4 PD t0L4 HD jZ4$p0Z0 "0`00@0 0S T r  Pğ  @$PBPpZ#0P1`0U0:0@0PV @ 0S0SPV@, 0R(K`#4< 0 PF $#0\Q: 0@0 @A7 0@h5 dE GB~KpGpG@0 002 RSB 0̠  0SS 0?044 0 R|P n4"04"\Q 0@0@U{ rjsw  h Ÿ Pj )0p00"0!0C0@0 @$P0PcZ1SpA 0̠ xd 0S `l`H D yP( 2 0Pr  p eP  I0p0CZ0LPQ+ptTKT( |TDTT<`gK8KUЋ8g,KT\T@TT4T(^R` -LM(( @0 @4PK訦g -LM<< 04 @ PKh}K訦g -ML M8 `R0,0 (@TR8(04 KK ,.1K-K`0-A[S00@`VʆT7(K MK@P 8 RP0S, 0R(KQ0.S 8 0`80 R`p `00CSS(<P0@S &P 0S &00sP8  8 R0,-1K`0KKL.1K4 -1[8 00Rp 000 P8#8E c(K 08  8 0 0C0(K (K@@@T0W .80 8 Pk 00C0e0Sz*<ş 0$`Y4(K` MK80@f 8 00C0 T@P68 58 RFQ 0.SA$PP'TP`& 80S< 00@@R0S ğ0E00P<00C0V 0 080S ß080S$0S`ß \3 RP3 RDß 0d P` S+@0: S00S000<  0 80Sڒ~KpGpG@0 0l0RnKE@`FP `F 0@0;04"0H2 Re .^ 0`Pb =8 q88 lPlP<0@ 0$@ Ra !APV` H@0 0$@0!Tw $ 0(K MKlPLP  @0 0$@pTUTt U R*A R P* R 0S0S@00T pW 0@P`0:0 D   0@pW0(KQԲ , -LDM@ lK|"0t"00K\ l2l"0, RڸX 剁0S\ڑ pPoV0U.PP L` #00CSQ  p    QW R P^ R 0S0S00lKp q p0S0@P`!0,!\Q0  000S lKQ p0Sʸ0 ,0 S$ڸ 0lK 8lK 3AlK 00 0S Q 00(K|  XJTWVW -80ML0, 00p0)PK账زg -MLMXXXO0 KPK(JX!J,0 HK TQC? R KH!8KX1Lqp Q[ ]hKXaXQxKHŵXKXQ$ETnTTʠnxKXqQQ$PPpxKXq`0\3  BqB00B"1K1X0 000SXN0S  KX$@QPPӼhKXa`0^3  BQxKXq0@%0 B 00B!!L0   KH @ 8KX1 LqHKXAt0XK  Ba?0\a/PŔbL8KXQ`AKKT K0dhl!P5K(@KA/@8KD`@KXKpxKp!xxa pKp0Kx@ 0<0|0XKXQ808t< Po 0c O`VP' (K0X!0,;+HK;XA ,0SxKP`}G4K`tKDKX0XK @OxKDhKXa,HKXA 4 X 0`OPǏ`XKXQ 0 hKTaH+0S 3S K DKXK0@O8T 0p@W(K4!R7  R\0?00 10  B\ HK8QLAUʠ KX$5S.pPl h0U`0&p@ @ T 8KX1$%T  1@01pP0SUT XKXQ$%T  101$0hKxaO0@0@0KOx0@0 @P`(KD!  8K/x1  0hKO0xa@xKXqPL#@ RPKH^ 8KX1KT EB0 0XKXQhKDaK,L0 p@R HKXPPL5hKsKd!8KP%X1x?N P`, 0RP(KXK 0R# 4  R`0?00 108KX1p80P@`PW7 W"$0#0$0QK`0X800cPK0ϊ/.Q00b\Kt!0 KX80O(K8! R8K<1SHK0APHK0Q0HK00XA$%RhK80l 0 0 08WKA`KX8XKhK Tl!}P 2 RQKT2xKQ\01h!\XKTQHKTA\0bP Kp@ P KT1 DARKT \0|1R\08Kh!P0 0KTx0 R0R0 Kp P0 0K`Q8KT1 `0Q\0?0@0RxKTqXK\0TQ0?00SH qP#p|@hC"00 00 00 R R3#!2(K0 00B Sd' L#o0@ P 00C 40 Q0 0C#4 4 4 48D 0004@0@D4<0 8@ 0(`@ dH |0(` d@p0PH! ?bR8<0p4p(0, 4@(08 4 ଠ ? 804 <P%0<,H 4@< 0B$%帀@ /T P @DL@ X p W 00S  0G000HLz 4 0Bu 40H0<n 00P@@`0 ?RT K <@ ?RH0 S,d 0S d @\`0@ P3  B  B00B11X@00D0 SW0  0% ' :`Xi@Yd -PLM@ 00 R$h>jS<Y= -5LM RE夅夥XS%3Sy Pu| U?004`ʠ 0 P@ş@o05 \5 SS SU u\ :0,\ڴ R\4^o hp Wy0 0Bz RxRv40@RR00Pz\$0S{ \4^& 0O044D $0O84 R  0S> NQ0S pLϟ.p80P`@`` pp pp b /N ] 0^Sp Pn mP( >>,  P@o = R0  TIM0S T^m84Q ,h\`P &RJ?Pa F0 6 00`pWV p0OO  Q^Pa `0O?0@@ c@P5P f0,5P 0%?>T 0 5U  l5PTE P5P xş 5  ,5(5  e+[h4 IL{ JO , 0R(Kt0Sß@T" 0+ßPAC0SJ iG@&O+P-  O)`SjYL3-K B B7P P S@Tc 00NP c\54 S0 `5Sh@=tqE{基 TN23YHß80N+([PPcS  0<0 iVfV$:RFTS8*06O1 Rb BR0 0 0a|O1 R hl"0 0 0HO1 R 4B8R0 0 0N Rf bŸ0 0 0eN1 RD !0 0 0CN0 Ri AQ0 0 0kN RF pt0 0 0\0 EHN0 R 4!8A0 0 0NL0 R AQ0 0 0L]`p8вZR<p4[($tj]k4kTXk|kkXlTllllTm(m4P]Բ,($ܰX@[[[-h[ ad\$[Zjj(k|8h]\xmm@mm`\ \j[[[[(^<\\kk ltRN R= `0 0 0<FN\0 R  0 0 09N0 R @P0 0 0!h  1,Mp@.0L,M`MpM|Md5S/4xUtp d0 pP!4txUO .5 O0o,@0@L l3B \AQ<0P d5WxXX\\\\"\2cMttXx2x |2R m -BMLMp0 0 y0P0S ANK @D@DPyP 0R KO`Pt0@  h0 < 84 4$ 0D  CKH0 A, A (4 $ `y_Wip =d^8a - LM0S* | t0 @_ 0JT0 `q0 J0pP 1$0S*tm| -LMzy@bvvpy@ 0-LMMpPANK@D0@D\ 0 K   |Y80 v 0RK0 p^ Da -LDMRP`@ # W0 0  (K!0S w0S q0S  qX0S l1@@ @lK2 0 U0@K@0 # HP D` ,1H@K0\0 P@ LP Hp D T hlK& 0W01 ?00i+   i VW 0 \0 T Pp L JlKp0 XX 00   @` n D0/ Y D:PpKX 3hЋ -LDMP L PK S K -LM0: S  S  S  S <0P ,K S  S  S$P^ -LM!@0@@0_P; 0 ` @ @ ``0 Pp&p  @0@X ` P P $90P05@P00UQ A?XP|̲IJ@d^ -02LM `Rc@p@3 㴁T1 RO1 RK࡟0SBT 1 R<qQ[K0ST00CS0SX0@X0FTR T00CS0.0 R0, 02P0 S w P 0S #9PP 0 !KK0@w PyTYT nTNT IYTyT  `0 XEvw@XEw@00<Rp8d^^^^ -LM,0@SDL 4Q,h\pK00p`V np_(^|8 -LM0K408 4K 40 0S 3\%RX` r2 R8BrV @T T `U@ z PFDU`Q80`"`S0000L2 RC@BPSPS  P(K0OO  4;DPP@X 1 RP 100 070 1 R=xP 0 , #<1 R @1@!@P2!0 4I04Z 0 `84$0@4(0 H4030 3040 40000Y0SZX@\S0  02`jfD8|T@IJ̲$<Hn_40`__ -LM ^ -L Mt< 80 {< pd0 4 @D0P0 R <KH 4H R 0 A000 < K XO@@D_@D @ P 0PH00000 0\@_@P 04PID P ?  \X?004O<K (H ~0(K(`0`(X_h_ -LpM@d` `1lP PnQT@ \0:PP 000 0@n`@K0S|84 -t2LMP`0 8ZL2/0@TPU0"`jpVr1 S2iZ0!0R# ]1S2Z0 Q 00@cp0  P  oWO 0X`!0S 3S Du,!0P)11 01 0R`00 0# P U 0O0@ 80 S0$00C0j0$0(K Vp ?U TzTz@|ԲU d, -qLM`V( 0 dQ 0a8SA QPQ\ `V 0S0S 000 00 0  ` p ` `V `V 0 0 T렲|0``A-p8@TM`ကP(/.000b0X3 | |0  T0 S0 008@ TQЍtaPa-8MPp* P P 0 RЍ030P @0A#O1 g00S0P'1? 0@  `HAR-8MPp$ P P 00 Ѝ030 @0A#O1 g0000P'1? 0@ ` HA -8MPp! P P 00 Ѝ1>0 !A `gPP@0A#O 1"1?0P HA`p-8MPP`$ P P 0 r3Ѝp1>0 R! "A@e0 0@A0#O 1#"1?0P01 FA`MЍ6 -LP`  PT  P P@  P8  P( $ 0 (n (h xp s 8s _ D$0 000, R8,o 0 < -@LP  P $h} 0-L@0PP HPZP@@ePNP0n -\0LM@(0K( 0 @ K$ K0 P K$K@ -0L@z#P  h&(^ --40LM K 0   Kn -`0LM00 0@0 K P @ r K@n -t0LM $0K 0  $  K K0P $0@q K@n -0LM0S P qְX@0 @p00P qð@nn -LM  K K0K 3p@q墰 dKn 0-LM 0PS    KK0p @vq~0 >K0o -L@C3ZZPo 0S00L -p-LM@0`P0 RIqP0200  0S CKp -0-L$@KM0 0 T0P@$0 S000 @ e* 00 0SK0 --LM0 0 #qq K p-PLP`  0Ep uP@@p0S PsP@ PpXP@$0  @pp&dooo - 0LP`p, 0S) 0S& 0BP 00p@xt 0cEpdaPP@ V0,0,0(`@,@(`@&&8 -T1L000,Q,p5@p 0`P0 ,@T"0 0R0 0Dp 0 0S 000EP 2000p) {nPPn@000]) ,@T 8odo,o 0-|0L@0S,@TH0@;PP 40LP@nP Ptn08u ,o --LM0 0 pp,Y K -LM@Bp`PK! bP4$0很$0 Yop0p -LM@p0pP0Kbfpt PBp`lP Uh ,SM0!K 㵧P 0KM`\0GM!0[ 1S000SU% 0@2 : 0 @@00@0`:   0 S`l:   |(0@S`Ld <`KP h30 0c 0 0@ 0 @@*0 @@0Y@P X 20Sl` 0PP|2|`0O?   4D;S##t`2^`V u2 (2 R P 00C  J R |*(0 S;30 R 0S1  0#R ʄ101 S90!0S`1010p10S xA0S d10sc00!0S00S00#1ѣ10L@Kp:  x* `00S  P |*p8,00Sp D x D㯨t@8v$v0@3C 000t30SvL3 Q`0P0 20D080U00@ d a0 0G4K(KU yz0z  - L0R  PM\z -2LM00 S8 4 o0lk0 P2R@ d ( 0= 2P)M 00C 08P4`\\0`"1>\\0?0 80(R0! @ d 2 0; 0@4D1 00C04P ,0OT8`S8 K _M0O,0 (@ 8K 0[50 O Pop@P <` @S!.Ǐ@ 0@W< !@p`p, K 8KC5x `?65` d 0 0@P0 0S 08Kx ?)500 08Kx ?500,h$000 (00$KkhU y |zش -LMK@P,0 K`0@ P A P @ P 姆 刍 0!C p  0 K4 0@ 0 @ ^K`pL =0@0O$+41 ! d 6004 0 KA<ش -LM@PpGK,`v$1@ 0 A SA  9 K00` 0  0K N / ,K01B00@S  0K42P L=EK0@0O4;0 dH04 0GK DKAL<ش -:L0MP0OH0 D@ P `HL` ȟH08d 10S70܀80P)0p@pl@`x0W0HOH DpP,0 /0Od '00 0 080P0x `RU(Kܴz U zشT -LM  @<P ,;P4Kp`;0S ; 0t{Wd` 00Ֆ: @P0R:p   7d;:Q: `: Sr\ mQ (:  S4Z@ ,00IttJ @P@PPjɟ 00T 0L59 0$ : 049 0B90A  I`0UT T0PD R@: R08R0HY00 8 04 000cH0 400cL0 H00O85}}~0~&TT`~ ht@ܴش~$h_8~~  ؐY Y400S40|  00 00 ,00p0$@QPU``0^3  Ba0B 5 =0 B110L 000@x0`S0 0OH4LD ,L=2 000^`1Pm P=LV>00h0 h0 S:h0@2 0<0L2 0\ X2 0 0R0PT0XT0P0P0HU 00 400@0PP40@90, 0a84 0 =(0 H4LD0 ?>0 ?0 ;0 4 D0,40S0 ,d@8t<94P`E# 4/  4d U0O?`@P$+4T K ФTp ?/@p4P` 5P`8, 0#/D @ , DK< K,0KUPTKsP LK<0KQ  P0 @ 5K< 8 p6, 08dP A0`@ @c0 0@` R pQ 0ȐĠ J)F#Z **0PW70S@P' !*0\%$8R48\5*0$H*0P<8(8Q0\5h80S. |8PP jX8ppD K0p [P P PP8 0(Y0 ,i R01:0PT&~ 0I *,u`p㸐K:4K`0S- 0O ,00 /0Od y*P0d PcP@c@t 0 S 0dL  -T $@P`pPZpJ0P,0V0S d :0S :P :4K0S P  ?>0 ?0 ;0 4 D0P , C0K*0`PTH4LDVKd  00 f0 R P000`P pV`0 008P40 V @@SA@p< 008#80(K 0-LMZX0@K P0,L 0P< PR ":YPK0 $~MЍ -0LM ِ_tt~ p-LMP`@T I0@T *0P/S @0P/S00@T:/P@0.S P@Tx0S .S0S`V (0  0S0#V< -1L MС`V( p1 R 0: S PtP8( 0RX$K ddm\a\q 0SB@F00CS0A0P0 Pp 0S0!0CS0 0 Pp0YUyU Y9YPY0 S7Ka.. [0 R@@nPm0d6 KHP$@FXPYP(ܖ4p08t(^PD~ -RLM`p0 *0 W @P :  0)9P `VpW (KV W @P@ PV@ PQ -LMq0@QP(0  0: S ( 0R:$K0S EUoKpP`% P]`6D1  ( .p` KVP  03S ,3S X00@H (3S43: SKφp T2 S!3 kP D0ZP zP6n +p`<~ -LpM`@T PKpP 1 R QX0S 0 @TK0 Q p0S  Q 0 RAP 0S x0 RhTT0  yP 0 Q++(<8, -LMpb0Sd2 R~ p hPP g@P# 0A S5 \ \ \ \ \ WW 0Sg P @ TT1 ]g@PW0S`h)d0SH P d0 00S? 0AS&     0!* 0S S+P 0S90 0 R Q AHAP 0S W0Sl0 Rp|yH Pw ,)(40<80 -LM@Pa0p0!tp- P0@"S"p h X < h 1 tp0 bQ!@+00S 0W 00 0|0 t0h0 p0000c(0 R(^8t0<(4,MЍ -000 0LS    @``t-0 CR 0R0 S`00 -@RLP 0S D) 4)TH UF 0@SB 10S< 08`6S<  6S1Ԙt`[~ [~6S`@@<@TU ISh`bISA7S̿B;S );S )`ͦA7S̿B;Sk ;Sk a}yA7S9Sө29Sө2 p+\A7StIS IS cVݢA7S 7S 7S d@A7S 7S 7S eK/uC7S 7S 7S f`;S,#;S,#;S,# .h;Sk ;Sk ;Sk bd;SҌ;S;SH 8 @    ( 0 P PA;SҌ;S;S X ` h p x P0&;Sp%;S;Sg\U);SQ";SQ";SQ"g =;SF#;SF#;SF# i6;SF5%;SF5%;SF5%/tmp/fstab.shadow!;S(;S(;S(/tmp/resolv.conf.shadow ;S );S );S )/tmp/hostsJvIS LSCLSC D*UHLnp1-f4S1t$iB5{qXCoAf,>oTLq8IĘĵ/pB|]N6li7~+nFbcUvE2({ 7*? k=Ɛ@4lliF0ԞV(x2i\,ʩ߻/C0yXM~5PDb RQ >d>ST}{ON2gEc'D]7m5&@D-pOuf9}V=. uB`7aP_p7>ZL=>aR|ue^~׌"c㳣귀;`-kx# sKdBg@Z^@#S{̂WarsD~Aòꑻ`f -dǣ Dhuݤ~ZT\ I HZ,XVM)w 8\'6ЏkqեGd~V[ P9J7c/89g:y~ɪb: {s . ..firmware@signifygroupA protocolshdpasswdtmpspwd.db serviceshasswd.origԪpwd.db֮ fstabA resolv.conf$ hostsA . ..openbsd-56-base.pubuntrusted comment: openbsd 5.6 base public key RWR0EANmo9nqhpPbPUZDIBcRtrVcRwQxZ8UKGWY8Ui4RHi229KFL84wV . .. dbإemptyqئ tmpF runtzlist ... ... ...root:*:0:0:Charlie &:/root:/bin/ksh daemon:*:1:1:The devil himself:/root:/sbin/nologin operator:*:2:5:System &:/operator:/sbin/nologin bin:*:3:7:Binaries Commands and Source:/:/sbin/nologin uucp:*:66:1:UNIX-to-UNIX Copy:/var/spool/uucppublic:/usr/libexec/uucp/uucico _dhcp:*:77:77:DHCP programs:/var/empty:/sbin/nologin nobody:*:32767:32767:Unprivileged user for NFS:/nonexistent:/sbin/nologin p `(<a`0C3@ R 0S, ,P`0S|G`@ l R @0 S0S400S(>h>h,`oo 0-PL@0S(0h)BQP x)t d\00SP e <` 0w) (0hr)d <@T - L +Pˌm @@h +m -LM@/*"P0002hPp2 lR dr`XT2T"PPPfP tP  Psp2 10 bSP PP P 0@SX :$Pq10S Ya@a,@ pQl 4  WPP `@a0<S 00K@P U0S 1 0S0+0S% 3KP ,K ㌒ 04 P,00S >040 8K[P @00S d 0X=Ɩ`T`x.-xt|,\\0MЍQ -0LM 㥖tt$ -LpMp`@ V,*U&/00K_@50 PsP3U @'P UKHhP0: S T0 0 $KJP T 3 -LMp`)[[!Trp mP2 pP X!HrpL1 ApPE @`* 0@S 0P/S @0P/S00 R:X  wPPP/@P /P'P00 U030"S PJPH` 0==P` (^LtxMЍ -`LV@pPq \V Vfb[RC[VS  0 ^S0 0]S0 $0[S0.P =P:P 0SE  0]S0\\S0nS  0S ]S00]S*@P"\R0[S  S nSP \SW0R0000P R @Px M -`RLp00@P0@ s0@0S S ;S s0@0S S\ 4F0gPV@v @ -L`?0rS aS bS6tS {S1-000, XP & 0R0 S 0A 0Sp P 0  @T0S04  e` V t p-L`@P @P 0S0  T X0 R :P 4 0$ 0S5,p ԁ$ 0-LM0 9SP0S*$S /S\S @PP 0@00 00 K/@@8 -LBK@tCM @ P T L$ Lt TT1P@, L4S4nP?@/PLt ,0S , ,0 r p000,0 R#R ;R Pp0000Pt 00,0PPL j,wP,  , ,0 r 000, 0,S0P0-0S,0  , ,0 r 80008,EP, , ,0 rP 000,00S ,0 M00,R @0 S0U,  P0 SK $  x 8 ,00S,0  , ,0 r 000 0"0 00,00S,0  , ,0 r T 000L ,0P$ 0S0L0P0z L0pL4 ,00S,0  , ,0 r 000,0 ;R R  X,00S,0  , ,0 r 4 000,00\S <,00S,0  , ,0 r 000,00S, !0P`0K00 ) 0eS * e 0`S01:-`   \S0S S@000S0lQP 4K@P0W 00M,00S,0  , ,0 r ` 000,00S , M PU00B,('p;,@%Q- 0t1,00S,0  , ,0 r 000,  ,00S,0  , ,0 r 000,0S 0| , K w,00S,0  , ,0 r 000,<, K 0S$V `  0b0 S01@ 0S 0 P )P 9 @Tj0 @, 2, 0,0 0\SSh% Y,3P, @ ,0@,0  P<$ R<H l 00  `84 @4 D4 8$ 0hS * h 0`S8 01:@@ @4 P<D$\SQ# RD `@T`FD + LP \  0 S0@B 0T0S@\T&T\00<Si@`Hd  S 00`0Sd`P0iH$0, P4 ` 0p40S 4 40 r 800040 gR 9R1R*Rj R;R_epR wRZVk`UpSVb44K 0@s@\X`@0S40 4 40 rT (000 R  A40 40 0RT0P0- T.rT"@TT@@"i%p O嗎$0T$40L40040 wS,0  , ,0 r 000, 0;S}0,0@,@ 0\SS ` @PiD PP`0 HP0s 0@T E 000 S 0 0Q5hd t@Pd|H\ 0hx,plX\؅ $PU,P  , ,0 r h000,0 ;R0,0 R P@ 0`S0 E @TP U0 0n1!00g1(K -"LM0S>̂r`P y @R"2 0  PP@{N働 0ld"0S 00CS00 Ӥ0MN.N r@ k300010S 00A,K{1P0S00#3 PP h1@7N0S 2N: 0H 0 , P4! 0qa00!0P 0 0S 0妈PP@N  0| 0S 00CS00 Ӥ0MM r@ mktJȟ0 -@L 000@ 0-PL @ 0P@000 -LM0S`p00S; :SiP 000S S,3"PP 0@M唌 0l0 00T2 0DD"eP<< $"0 00001,K噇@P# Q000 ,0S:Y, , ,0  RO0#SL0nSt1 G0H00@$!0S 0#S0nS 1  0,0 ,0S ,0+;, a0 @\ \0 0 0^0^ d 0000H000 0 00,00Cȟ0x -鐁向吡L`Pp@)fP aP eP EPrP uP nP 41 @@p 1@*1 +jp0 00@pQ @0S@Pd0x@aP L匋< x $tt --LM0@``0 垖0DSL0@ D0D0I  HTǍKt -Lp@PCLK  -L@P3L;  -P@Lp` 8 05P 05訷(^ -LP`p/0wS {S& sS'0 p )P 0@K 0p0 pp )P @K 0(npPU0 -P` PLpK y@ W000 p 0 0 -LM`0PPp@0S1 T 00S S@D 0@0V l0 l00 T000P S  0P$ h$ԁ-0 CR 0R0 SNU00 -L`zK((MP$pG!0 0R R0ޅ@P *0  P0 ` P0V00S06#3 d| PP K0S K<  00$ 0$Kȟ -/LPM<K0t 0N00l 9.00l0Q0Sm l@PT 0" R 00$P RTΟ 0SH0SPL l 000> D R000P RM 0S͟0SP) l0Q|M 0Sx͟%!%*ll000 R000 R$͟M 0Sl0 p3Pl  g l@0=0C>S񟗭P ` ` ` ` ` ` l ` `  ( ` ` ` ` `  ` T ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` `  ( 8  ` `   4 ` ` D `  ` 0    0 ` `   ` H [k0SK0000P 0 0 0l0 0 @l @ WSl  l L00l@000S6 ˟0S= 10S? R  B Pd 002d 0` c : J0S 0 ʟ 0 0 l 4 0J`0s P \s P KP4[S 0y䙟䉟PD9< 0U QPVp )000 \P 0S^SP" P 0S\ \tPS@V P 0iS@0?SPP`0VS80S$$*S80S  ST80S`86#3  PP~ 7I0S 2I: q880S0S 8 }P 00] tPW70S0S7m {0SH 7cB0S? R  B Pd  00bh@ 0 ,7Kd\h& 70S0S 6: xhƟhf 0SXF 0 zP4 0 0 0l@0 0 @l @ PP6l 0p0 @T\@ X 50S  0S0xl 00 " \X0P< E0l0  @` `P\0 HX0T4   00 `Q{l D0p`Z&Up% \U 000C SS p0&S\SpPğ0@0S :K@ p0@` X$P0001 @D"0T 00tu& qr ßPd0@00S :K@ 0@` #T@0X `000PUl0@0S :K@ @#0@` `0PS@`@  ß0 X0 `A` "0XSX00X0 0S @X@0 SS S X0` X0X0 @`0 /Y00 \X 0P'`@TVYXX 0PK  @PK l 000S 1l @P- PU* 0s<@ 01p@Wk `PVk 0S0zO Kd0S2 TPr 0S0PP 1S0S@T 10TNOtA ppr0_? P .U?0'K&0KR0(0ԕ0@ ;0-Q6  Xƕ 'KS0@ RU t3OO0+0'0K&K%pK  0 , 0<<NzݓHl`4 0-LMPP $0$@Q pPP8` -LMPP 0-S- `pC# rp lP sP ?P`Kɋ`PhN`PCP#qppV OA0' #0@| 2  0 㟋`Px @T3 IP @, 0T00S&R+PppT] 01P`$KtP@ $pKP=@T 0%S?UP`}HN`T; 01P$`K0S #N@T' tPw $!0LSLL$ 2Q0 d NXN`kDs 8N```T N`O0 R @[$ R @MTM`I0  @TH0T0SH0 p(I%I0!I0I0I0I0I0 I0I0I0HHulԕ4( YH|xtld`\XT -LM0 3wR#ZP``< pC )lp pPM D?PE VPhC lppZ 4  < R40 040 1000 pXp8 00@T00 ' <  P"P`0vdSmW 0BRSH 0BS/ / . d/ ,/ / d/ vP 8 8(K0<0 <pH8 0"0 (jH8 0"0W aHW 0!WHYI j07 WU JHW EH0F@6 80(0  1pP' p.P 1p 000C1!pp0`~ꌗ`<` p-H1LM`P8A0!ip LP PP ?P>@x@ wip`0QU $Fx`0@ R V"T 'WPExug@P `E\0xL<T{4Exp@` Y -L4M8dP0D($(ip LP PP ?P(KC#ip0S EA^P [L X PU 0S xEl3p0S\Eᑶ@P :`7X @gX 13px"P  {"0 @X0s H T 2 ; <0 8 Z<0 0xD0 @ h4pKD`K0K4 @ 00@jSP)40S "0 $nZP@m@@VSU BEH0Sh !b;z 1Eg/t10S<@@0/S4ZBT0 VoP KT  3H0S> !H7 嫋 1P+ 0H0 T0 ȵPL0P HP T |D%o@@L DxDn@P@@XD`ԗ,LTL` ء Y0MfPЍMЍ p-LMPU pDxd0 R R`O@OT @T DxNx蠜` -lALMP`!g`pp mP <1 8 xD0vD@`P- ;@p gp01 PR @@1ST TVp X d@V X>D@0 pR@D d@T$P -LM`0 R$ p@@ T P 0@P0 s 3T R @0 0S  @  T 0 0` -L MDPKp@2e0D0  .gp ?P pP :P<D 000< DD0S  ڄ`P{D PR1S0 01 0S00S 000@$K謙p -LMQp@  VL0ϠAl  0 Xr(Kt0V< 0 `4< 0[ 00B Ln 09rꭋh(^ -L_MPpPK`LgKYSKVP p TT0@@@@ /0S] \K+gK8gK5p PK`b0KPU`Q8P 4` 0 00 ß `80KP` R8P 4` 0  PK`b0KPU`QDP @` < <0 ` D0KP` RDP @` < PZTH \PK`bP0KPU`Q\P X` T W^ BŸ\ K0@>C0\KPfKgK 0pD!0TSK0K \8 4 0 0@ =9L8 4 =C00 8 ]K`0KP`QDP @` < 0P=)A@` -BPDP @` < W A8 K0@tD K0@`L\ K0@D8 K(0,D K0l (K0P@=9B` =C8P 4` 00 N0P@=9B` =CDP @` <0 _0P@=9` =W\P X` T0 e0P@=9` =DP @` <0 <0P@=9` =8P 4` 00 pL<?B^ؙ  -L\M@xPK`ሀ#lK 0lpx 0r 0i 0c$KP^ -LMPp@ Eep fP/ vP ?P>@@ 6epp01@T `ꀈP0 [P@T WH-@TpA  p-LM 0S@P3  KhP+ 0S"  D 1`0P @h0P0fC10C0{ 0S0 (0 R 0Kp``, 0-hAL M`!Pd?PA 0AT00  KgP5 \51 R= 08S9 R 08S S\ 000 R\ 0 S Q0000 lp0@0bP*]K0@$A (0@0n  0-ALM PTd?PK00AT KFgP%  0 0 rR P0S @n\\,EP0@0d0 R R 00C8S@ 0  @L -DLMKP`@0 0=00 0<00^L@D,00tP@T@B?FD?Ap,0tlxP\c` Yd p-ALM!`b?P8 0Q@P |P# P|P@ {Px@B^ 0S c? al^?T @xTm?xP@U 0-S0S>@x0$ -`LM @b?P@ hp O0T 10 00PS<0< |[@`, -0LPX 0 >D0$\0 3bp01 `Rl40&X0>`$Xo?@唯PP 00XP  .>\0STp 0 80 4 80P0@0 < `0IVT0 <`u UD 0S C0 P0U u0  $0SayP 0;0 0S CmP0`0 h\0S P0 cRPK_pPp@0  cR@K_`Z4 UJ uPu U0S<V  Vx 00S 0V0 R`FV000`D2 R9< qPh0`0\U00Su U 0!0  <0S 0SPr1$ RPkXCP MP1zM PE][  0phT0=hh\0S@x@3u00#T uP0  H0 D H0p0L P0 p` 000L5LDX<30` 0-PLM @`?P0 01P@PK C0PSK00S0PKCP0 p-(QLM !@`?P>@* 0aV% 0 0K<'P( 00 R 0 0  Q  0S  0ZPKp3r HO= P4  E=r\0 p-0LM` P@y`?P 0AT  K04 \0\  00 0l Kp0= =L MR4 5:0QЍMЍF -LM`0 Q\p 0PS @0S 0S᝭P00@S萈X -LM @R:Q0AS Q 80xp3P000 Љ -LM0P@ @ K P&0 pP#0:0S0: pP]  `PG00< !@@p@3|0@ `P4!@ YP `P  P. @ 0@@ @ P @ 0@L @{4 @t @m؛ p-LM@PW0`PP x P P` `V`x p-LMP@0`PP x P P``V`x 0-LM@0P 8 P 0u38  p-LpM`PL@PT0 RKpK%EP@ : S I@@8 -LM`PP@p1 0A#Sf f tf \f Df f e e e he P1 RK2P040#0# 0#  `p30  `Ӫ 0R*~$ $Īp3ᾪP,K 01P 0ES񟗡i i i i i i ( ,0Rӓ( ,0R( ,0R( ,0RÁ( ,0R|( ,0RvtT0Sw`8MЍ+@-0S0%M0#@0% *0Q00 Ѝ@9Ѝ@90 -L$M@2@"P80 4 020"P00 , D @ @@1SCP1`6 T<` @ >@T\J`DpK T; 8P` @TJ8PP*T 48PP<@00C@0 8P`@ y @D1`P 59$KDpK 40 RP @ 00 p3p3DpK 4 0  0D0 ] ] 8j Dj К4,`8 0-LM@P(KCG (Kp  ?<8K0 Kpq8Z@ -@LM`ᎩP@Q (K 00P (P 0 08 K0C8pKF8@ 4P 0@ ,P eP.@T @.m (8 8L0Xl -PLM0PS8H 0 S S0 0   0#  A0A0 S00`pB"[p?@C "Pp o o o o o o o o p o o o o o o o o o o p o o o o o o o o o o o o o p 0SV0SR 0RQQ  NP A!_[pp?@0!R  8``JYhA\!G[p . ?0B"Sp Lp Lp Lp Lp Lp Lp Lp Lp q Lp Lp Lp Lp Lp Lp Lp Lp Lp Lp q Lp Lp Lp Lp Lp Lp Lp Lp Lp Lp Lp Lp Lp q 7W |Q @x7QQ@T  8P$(ĜМ0 M Ѝ0@-M^@ 0#S^ 08 S00S0 0#S 00 RЍ0^P P0 SPR R^ J0Q S0 B00Q B\0AZ# 000 -LM@`}FT- p@PP 0`pc@W P`P ާP@W l1p -LM@R00?P`p@% 0pUWdŸ ,0K P  0Sp,  0 0 00$KT0\\S@DLT\!0'P "P `P =P :P @DL^`0 Z'QX "QV `QT =QR :QP PP^0 'Q "Q `Q =Q :Q \QP^TJ q, 0  0& 0D@q 0 \ZU 0/S 0/S PPpp0PdpU@o W8pn0 PpPz 0l  -QLM@' T# AT *0Q/S 0/S@T:0/S d 0R /S @T:0/S Qdþ p-LM`PP@᷾VP 0R  0RQ^x^x -LMPP`@p 8p@@P Th -LM@Q.0  =^00X p`@[T*T ?T $T P(U /TpU @\T0 SP` U~X 0* 0 dP W -RL|MJaApPNE0pp0G P PJ5`$KPb14Kt!, 0 4 4,0Q*PP0 0` 40 a@P/ ``QUV V& @`0 @`DA EA@,@ 0 4 KKCP0 R5`T &0`0@  0-LM 0@PͥP 0c8 -L M4K` n nPp   ZP P0xU*T[P nPp  (K @`DA AP@P -L0MT P X @[L 0 80 4 L 80T0@0 < p P:eP<@w  YH  0@ 0 bR@KU@Y R   P /00H00H0 L@0  cR@KU@TL rX <0 X0b CASX00jC1TD0 $1`pDpW` 000 0 KP PPQH p@ ND`WX 1 00 R P<4(K00S 0ȼ -RLM@0 9 @P`8`KH#8#040 80 0 ##0@T T@T"0 !z}2P 0 4p800gCz @W `2  @Y< @ ` P X`P @ 00fV 0P 罤P XP @  <1< <0 1 RW 1 !0 08 800Q8*00044 ` 80 @  (K !WIZ0 P`` VP @1PA0@x  4X0@` DA QA@0@ 4 8  40; <\| -LM/`jHPDp`@PP@ T iYꌊ -!LHMp0W,0 H PM dpK PLAXK@0[?[ 0H0[XL0D[1EP[C`[@b0X KX L 70K`:K9K8@K?0S0S 0S0 S0S0S  㿻P H, 0R (K40$ v? f@ptp -LM@TPP x0S C x  Tp0@ p0TP`F^@4Mx R p0 Bx p0Ѝ`Ѝ4^ -LM`R@OPPT^ Tp ppT PW ovU 00 S/R  0R B/S PU/W10@  `1`0V0 T@j DA  ,1A` 0V@0T00 3 oP@j DA  A MЍi\  0-LMPK S@P=(0SL0 R n S@PT[K0 -LM0S 0 0@Q@ K0 KP1[S S|ࠁ ࠓl 0@|P[nz1[S < 0|P [`z \pht@( 0-LM@Pt\ 0S0S @g80S@  @` -`0@LM! @@@ @@44lP, 303 0 hq r 0 PM@ p ( 00  Ѝ 0-LM0SP @P0PS80 M ЍD0<0< 804 00 M ЍL\TX`MЍ-t 0MS ^S 0000S(Ѝ >R@0̗?R!00E0M 0 ЍTMЍ 0MЍ -LMpQhd0d @pT *T0`VPUgTP@00`\Xt - LM0p`P@0 ^000@S@0C@0000`.P  r 0  @D -|LM0pp0s sTT 0RHHr P@4bU]0c00D0c "S00!000w!0PL 1pW)a0 S@10`PcU]0 0CSX@0 0CS@ TT 0R( 0R <rt Q!0@TtY0S:00 0R>*@DWt R00 QPW?d\@P d0 R} X0 M?w۲@d\LpltX`T -`0LMT0L0L0@DP 0540 ,0 5htTLh\l p- P PP0PLM`0 0@R 0 R R00CRxhx0DS ꔒ 00C0000pld p-LM04`PP @0U@Pxh -LM -LM Q0   X -LM`@p0 ddP$ K$ @P$ `00`D0D T KrLXPT\40M ,0( 0c0ALЍ - PLM@ p D 00 hE^CT?@hq -(0LM R P -LMTp@PP <`0T: 0S0UPh` 0-LMePP @@T8 0-0LM \+ 0P @ @T!:\$Q \ q 0_Qq 0_Q $Q\@T*@88TXx 0-0LM@Q 00P:|0@8hlP P: O T80B0R T*0B0R T:\tT -1LM!@P\j q``VE:\ 0$R \ r 0_RLUD r 0 R0@!0 ӑ  T q 00 _Q $QUU q 00  Q 00ӑ\`V* `wq 00  Q` 00r 0 R0, 0 TXxhdMCЍ|MLЍxMUЍt -8LMP $0 8T -0LM@Q 0 Q 0 R 0`S Q0S0S}0Sz0 SS CCQ0j0Sg0S  CLTX` -0LML -0LMX -L0L LM0 S 40R TXx -L0L LM0 Q 40R `nTLx 0-0LM P- 0P  @^!: P$Q @ P@ Pq 0_QPq 0_Q $Q@ P@^*p8/@TLx -LM -LM0 VT -LMD0<0< 800 00@@-L\XT` -LM -0LM `R0 PhP0@I|0 p d&@`0@TPT0T @@@ThXLP\XT -X0LM R D0404 00 0@|Xx -$0LM 0x - 0LM Ax -0LM -0LMvXP MP00Ѝ0 0S P0ЍЍ -0@LM Q@!00@0@ QP D0 @<0 40- 000x| -LMpP` ȀȠ08 @0 < 0 40 0 @@@@T8 0 b00/@0< 080 04 00 0D?Y Y (K\LPXT p-0LM@x`0 ^P :ϠQAQ 00S 0U^@*xxTxLX -LMxpx0P R`*\@  `W S0 0 0 XPTMЍ -LM@ҳP嬀`@P0 ㌠ S0 |pS030#0C0V 00@0TtQ0S:00Th`d 0-1LM @Ts 1 RD0S S S "S 'S0S  B0S0S"S 'S 0S S S S S "S 'S0S B0S PU "U 'U PU U U00xP8L D0T'* P P "P 'P 0CT: P P0]8 P P "P 'P 0CT:"P 'P|x -p0LM0d S`\00000C0P 80 40 *$T 0-PLM T@00Cs0 0K0KPK 00Cs0K0xMЍ p-h0LM\ RT@T`0PP88 1?1c"10c QxTHgfff -LMpPphp@``d@D0 <0 40,0p prXLT`\ -LM`PP LPD < P0P0f 50%QA!V0Pfp p@v@Tp e` PIJP0 0 B cRW@@T P U@@T00T0 0@Pt0S:YTXdlp p-0L$MP 0$K(K K a0a,@K @c`PKp0$(0$`wV P 0APH PU$PXTL  p-LML`@T @00TPc@PdF@x~T p-0LM Q 0Q` 0 xl`tP0P `0@d0S00CP 0x d ̝T -0LM| |0Q pp0 ` X0R 0`@RJ@d_|LXxT -LM -LM -L0LMD 0Q 40QXTx<0< 0MQ Ѝ0 R ЍXL| -X0X LM0 Q @@0R `TLx -1L$Mxx 00K n0nP,K8@K4K @C`P3 U ,8 ,K$K004 ,pcVW00S@ X ,0  0R/S 0!U00SQ,"l,8 00",0 6XTL  -LM -LM -LM} -LMt -LMk -LMb -LMY 0-LM0@^SP Pe8@N ḘP8 -LM⼠0Qp @aT`*@DT:PPX`0@&@0@^SD(0P  XL - MLMKK I0 , -1KZ<_K`P@1p@0T-9K.yK@ ^KPEPE@T9 P0V 3 p1R5 h1R; `1RK-0KS20Zp0'81 @lP 0i-![ ^R@Z  `P, 0R*(KV Z ]UY *00hY MDz wZZpH L -@LM0 P 0px@`00Cs0 V U PP}PP FXTLx -L0M`p 9\ 0S  2 1C 7P@T@T 0U TP0@T @iW0@0 PU? 00  0@@a&H -p-ML M` 0 R0 $ P#  $ 0SQNK@D$ @D NK@D$@D $ 00\ { 0RKp$ #Zp 0-PLM00 @R 00   Rt0 RT0 R@0 R(000K0  x -h8LM \ T8  @P 8嚖P,8  $ȟ@0 h0 c 0@] b0@W <0@Q0 L C0@F c0@@ #0t@: 0`@4 0L@. 08@(0 $# =0@0 0  0@  0@ h0@ d0@0  B0l@ L0X@ l0@@ >0,@0 0 0  0@ *0@0  C0@ f0@ g0@0 <0 \ ?0L@ ?08@ 0$@0 0 0  .0@{ _0@u0 p 0@j0 e0 |` 0l@Z0 XU0 HP A04@J U0 @D u0@>0 90 40 / y0A@( [0B@  [0C@ [0@D [0@  O0@ O0@ O0@D O0,H`@ [0`FP@ [0,P@ O0`@ O0P@ 00@@ 10(@ 20@ 30@ 40@ 50@ 60@ 70@ 80@ 90hPE `F5p@ [0@ [0@ [0@zD [0H@r(K咔P H}`x D  P    p h 4 ܛ ȝ D t , p H p 8 $ X  d  -LM0@  0S <k#,he#0 h]# ( -LM @R0 ,00  0 P㫡 hH -MLMŸ帢@^(@ `Pp: S B_ @T Q 0d @!#T( 0R$KP" $낎KHH0"_V^ 0S2@T@S ޓPP0 #1@T p@TUpAp t1@T @S ồP0| 05P9U @8 P ᥓP0@T @S ᙓP0Z21C 0@T @T ၓPP |P L"t@V<"mp Y0$ HT -3#ML M3#3#3 `3 S3#帓K@A A@`, 1P48#`0e0||#Pp@@T0c00 F cDCD3  10S$C\ 3" #0l0cCP00쒟002 `-(K -P40( Ks`(0K A2B"| R# @Z@Vm PF Pb PQT0, $2@ $0 -8KR000``P01@T p@T PVʂKAA )PPVpW@Z@W00S 0`!Q P0 0c, 0R'(KW! R 0S  ^=JNb0 0C0P0JUP\T`LpXlpdthXx|$ l -LMPp&`P- @eT: V PR 0gXR@ @ 0gR00@  LP Z 0gX(00W  ב\ -LM` 1 pP ^V 0U/00ń/\@0@0cS eBP@P/\ /őPP 0 0CPN 00`3T )P  _ m*PP 8 0.S0S .Si 0.SFP v0 0cS !B@  0H0Y 1!0 @4*PP  <( f00 lRA@ d)81 `Y10I(K@0S `0Vሁ5L* ` H1`0S K.PT U0U/S0: S SAK)P1: S  0 SU0U/S 0: S SR 1: S/0 0 ԨP 1H@` DA -A!`@`AK)P -0LM<p40 0 BP@4U @PP0 <K,K< 8@ P,@ 80 `jcFa@f$K -LM`pP@PP0U*~ iPX0@` DA AP@Pd 0A0b CahD -L(MpH L0 0{S mPMP0UO*HL `.P(KPQ  z0C RS R {R0 }R0C ,RS  RS0S0Z0SP Z  Q @ 0S 0SSp0S" +S2 -S  V eW0P PL8U xU 0S <0 cR<K7>0S00 00 STd X@ , <`` X> S`S0@P {Z @K 00 Ep N)p |0〠 p A00 p 0 p 0 A   00#0CS                         ,   .@Te  #T  Q00  0 9 00  000 RQI@T*T000 #0CS #450S:00 R 0@T@@@  0 @PH0   0@ U5Q00ST 0-S=S ?S@ 0S 4P 0S0   S0S 0 800c0 P 0P0 0#0C S \ p ' `p  !0P  $00(   0S @<0 cR <K=0Tp00S) 0  `p  0 $0( 0 0S @<0 cR<K<0Tp00S)00 `p  p p Yp 0080 `h`@TQ 0P0U*  PZK 1 ( 040 ``0 '400  <0 8 Yc  /0S  Q   0SzczbKQr0 t 3 0@  0  0 a P0UM*` ZP(Kl(^,0Сԡ`0pTLē  800c0 0+80S3pP 0P0Um*p0 P I@ 0@` DA AP@PI!P11 @`DA AP@P<@|  0S00 0R+00 %` 0` 80!0@PT b`d R0 00    00@"00@080GdpP0%S! ڣS S `V0S   0S` p  } #@P;PEW0 P80@XC ᬢ  A0<0 ` X#S)pp@`S3 `P( 0S KY K`8@P  g 2tq! 0H`     z` ` 4 0 hPK@K0 d c0S @<0 cR<K:00 R `0`PV 0S|[?P 0@S*S0]S @V*Vo@ 0Q  0S00S T  :&00 ?  P  0  SD W`  ]P?0 00 c[P 0@S*S v  =R e _P,c@ 0 :S 0  00S     0 R  #70SS P@yW @` @0'e[`00 R 0@T 0S 00SGg 00PbJ`PP Xp3@ 00s03S+P@ 0 a_Pb@ 0]S  #0BS 8p]J_PP@ `bPU 0 T @g DA A`p@#SRW@N`UK:0` 0>P p`@0` 0v>P`EW20` (  P : g @`pJ^@TP@@ +0  xR Q+R l @^b;@P@P  0S ^aP̗PP ]>0 00 ^aP g B@`pH 0S\ n^aPp`g0S1x,0@S@@pP @\Q^< 0@S@P :  P q 3/0 (-Z0 8 V :D=AA  Ap`P Hp 0@@S000 H p-LMl`0@P[ 0(K $0 (0 {$(00`0S@@Kp p-LM`0@P8 0(K$0 (0 X$(00`C1@@ S @$Kp@ -LM0@S`' p P( , $ *,0  ,0 P ,PK "P,$0Q*00( 0` ,0 @K  $ ( , ( @`DA A@$@ ( ,  p-L M0PS` `@q`1T@S0 8Kp  p-LM0@SP` P`MP1V`S U T ?Ac Q0 0( (0K(@ $` 8Kpgfff  -LM@ 0 >G 0-L M@P0 +GK0 p-LpMPK@`P@k'@PU Kp : S  S @PV 0S I -SLMD0 @ D 00@/P[ Ǟ1P  040 0 40T0<0 8 1 `:ӆP8P7 X pf<0@ cR<KY7P@ /00P<0  cR<KH7P  8@D P 0S80(K` :㚆P8Pu8`0 @D  cP  p-L M$PK`|[O`O@P  V 0 /R 00OO@PKp WT p-LM@`P0=S\ *SZ +SZ@O O 0 ` x -0LMp@`TT P YOPT@0t03V0S  O 0 0  -LM`N2p/@PP`F  U  Q22p 0@P 2U @ ;X  t2000Y @ @ 0"00P00 [ _ 2P 0 P 1 P  0@D&10; 0 8 Z P5 0S0 l NP@@ 0  Z PU00SP NPP 0 %P 0 00 m00010  +PP 0@pC[^h0P@@  0\ 8N0P0y`\T -LMP`000N  @0`|;X .S0 00P;000 QXMv30MЍ -LM0ppp00h @`0PPE0D0t5 @>0000 0-LM@PM ,M@P 8h  00MP R00, 0ASЍvЍ Ѝq 0-PL M0, 0 0 i AF/9( 0$0 $ R<   0S41 /@PA0 R $,d?:/$DpB K041,Qo#, 0 0% P l 0 0 $A?(0$ P0R@@ H0 >$0S $C h0$ .m`*d(0@ H 00xz X@ -0LM  40  P00 0P0 K  0 '/\? R>0 R@ 00 0;0  0S O@P 0 @ 㙛0 R^ 0 RY `(X >$Q `KP00>\ #,QX \ 0HS񟗥  h x , 0-S 0< KpP<0S! WN= P @0SP 4 YQ  _P3X W 0S 08C80CS4 x  l   ( 8 8  P p     < R  ,pWw 040 04 S<  0S0 40|,0.040S 0  P 0S!_O< R4(Kxpy; R 0@H  XS\> @+`0KT C`K003.Wr\+CmPh 0Se 8;Ra0 [0 R  00 R 0 RKP0: S`0Sz N0 Rt: @@d:  A8 0 29# R& 80 R" {X[P @80 R @880 0\9 0@80 @Rt (<80 R| 80^ x0 O0 0 R  C4  N (`0K S@F 0?X yXH (8XX@@F 0(;0  4 0 4 0 p34 0<P0 000`0  7\ 'T0 P 7'`KL0 H w4 0 4 4 0S00Q0#S0<\0 000 4 0<0K 0Sx 0 68 006@P t6 ("( [0DSXT4 r0y0@ 0Sg 0 Rc0 8 80 R 80 cP  6Pg80080 8 0S0 0SB0 R> 0 dP-0  [4 .,5 5@P 5 ("( 0DST4 04 0T00 0 @ 0 @ 0 RD@K @0D0  Dj000 00 0S C0 A0 0  @00 4 8 04 0 @Z8 Ks+08 F}0Sx|@8`V(ZPP 0S0SLS 0 0P0 )@_gE0 D< K՗p2 @P@"0S 0SH,R0 @I 0 @B D`KVDPVTBP@0P0PT d<K 㞗1 00 0%7 K4 0+8K`0K ,!R <0Z!+++0 00 64 0  -4  DuD0 0@  0@ 0 0 P0 00PPH|PJ`  l@ , Ԣz   ,4<\$304@ 0 Rd 8@<0[ R`  `0`SQhU'Y0SPP^UY{ PUY0S .P00V00SP 0DQU040 t4@ 0 4 0  0 S00P0#S\@<@K0}U W0 y4 80 RH 0kU80 80 V0 e4 80 R4<K ㆖4**D LP -L(M@ \D0 000 ` 0S@0 SL < @0@T8@0<) Q @0,) Q @0) Q- /PpP(1pP pU L  8 R=0L0 (01@PTs L0`@ @0SX 0S @0S @0  xZ@0S @0 R4 0H0 7 0R Ru Pp"0'0Q70 <00 R   0YH R I p Q0SO 0 47@# R WDTX4 <@PTP  @ @0S  `L 0PS D0 0L D0 0SE @\ <X V7 H 0@pX Q0SPU @0S @ 00CSY 0      < @0  005 `0S 0SLe0 @0  8ş#040 @ @0#20#0 ,8 @0<0 00]@P <54$@@#08 <00@ 0< S T( % D00(K7. XL YLH @0 `@0 R @0B 08 ~000 @ 0@@0 R @0 0]*PqF P 0@ l@ 0 000 @0 @ 00H0  `3 0 3 R /}P  ( 000 L@ 02Ģ@iY`H@ B\ D0vŸ@0  D  0`70 s 0p n04M  b l2 0 d Xq 000 ]6((@0@B0 _ 000 K0`L0 @@ K@0 RS @0A 0K ~000 7@0  @ 000@@0 J@ 00@0D  L1@ H@ 00 0P0〽D0 0S @QG NGy <MW@0 }Tk   000 0 d0 =(`$> l@ x1 @  \ ,(Tģlp8MЍ 0-L M$Q0 0 @R! ^0\ 0A|3SQ/ P 0R+K00|p3P000QP ^ K K  L0S0K\ K00?p(| -LM4@ ⫻?0000  -LM0@00Q" " " " " V ' &0BS\# P# H# ,# G B = |8 21Ch 0 X. 0K 0 K0K4nU00dxP< -LM0(S 0S     "(0!B "0!B 똍 -LM`@t `2  @t 0T(0`0< (Ÿ00:0R _T{ 000#T0Sq 000#P0S _PqPA f k3@80<000 @ TPP ⤺'0`0`@0 [T5 0S(Q ` A3@wQሺ&00`Pp+0 0pS T21C   {P0p`040)00`NP`(  0, 0-L(M@< 4 $0K0 8 (@ @ p&1l@P  R050% T+80S)K04PK0,0(S #,0(S< 0 aT8 <R%$ [-T0C,0 L&   -LM0@SP 00S l ` TP @0u@050%T0 050p ` -LM`p@T  00@@0A   P  SX @RX @ - QLM`8 .@TPP!0DS00STk #T T&0DSpQh(K8|!T 0p0 0 "T^ U 00c 0800C40 @pPDU%21C0 80R^T  0 \ 0D00 O0 p RSTT T 4@0DTST U- - + 4, - - . x. h. X. H. 8. (. h. X. . , , , X, \- 4, - - . x. H. 8. (. , + 00 S(0    )Sp@PDUT$21C0 80RwT 0    0  00 ST  0S 00 048 P 00C 0 0Rö 0R 0R 0PSPUv  p0%SU 00 0  00C 0 0S 00 04 0SL 00C 0{ P [ t P P ŋm 0Rh 0Rb 0R\ 0X 0"T 0P 0RL 0H 0cD 0@ 0S 0SS 0 0 SQ> 0S. 00 0  0p0C 0 0S q q R p){p 0Ip 00s03 0 e0p$S { 0/p, 8   똍 0-L$M,P0@8K8 4@ ,00K0 0MЍP-L0L 0lCQ  /1$0 0M0ЍXP -LM@ 00H -LM \P -LMP@P. xP00PT"QaA0 10Q*(Kv0100CQ*00 0!  BR 0 !P!` pP8 ) P 0@0+pP 0 R 6@80 c0 0C0. 0PPp6 `E̠E1K0 ED0K/K10K.@K-PK 0  0 $0nTHXL\ -RLM@PB `0S  U@PER3 4 x4 h4 X4 84 0U `(K0 d0 h0 lX0 p W:0FS 0bC1AVV0a100 PL @v-00  ``  XT -ML3M 3R, , 0R(Kh#00`#`wMPTP HC-5P-@PsT 0 ؂P  0@P0:p` 0S0SZfJp J@ @0S00P :S6 08 (8 8 8 7 P0*2PI P PEV.*0S PEV:U&  RU! BKAA! 0!7-| P$ aP@f @d T/ ;P[65=t000^@0 J0!5< 09+P 3IKAP$400"P8:`pX\ TT HL l -LM8@0S (0}/ }ҵ0 @ XT p-0LM R PP vP l`PdxhxL0@D@@r80( ,0 B @@XTH\LTX -LM`Pl0V ``p0`C!VQA8 啵0`0Qe @ᏎXT 0-P LMH0@Po% P 0dCPB88P8X -LMQ@00 ``p PhEQT00?@AP*Z:a@ SvP X@0fPZ :00S 'vP 0hC(KX -H0LM@ 0 S:PS0C 0X  p-LMP K`@R+P P11 0 b! P!U4 S-Kp0P?S0 b@@0 @x0P 1 0 S*U VSD4 \X4H  -(!LM A0`S: q Q0 R 0B0 U00C0 V pP PuP@ 00 R0 plP@!@0 ,TP 00DX\T Y -:LM$ `R pp p p p I)'pV 00@CSC C C C C C C C C C ? ? ? ? ? C ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? A ? lC ? ? ? ? dC ? TC ? ? ? DC A PtPHx(@'p0XA P YW pW 0S㴀 Q Z0S0S  @TK X f c7  040 0 姳408 0<0 pP ^00S  <  bR$P@ ᘋ ᔋ0 PptP `g 0 .<KQ}(K6 $4^ # Z 000   $6@  + p&tW  l0S0l Z o S[Qo @Y@X (P X   X Z 0 r 3 Yy H%H5^ppQjZ00 ` & 0  fB!A1@1@ sPP0 d 1Q00`Z  X 3R[-h|dp`d\^ 00S 0Y   ZJ =sP 3P.)00c  Z  `0P3F/P`U RoZ00 @  $\10S00@Z  X 3R2pZ H JBWPPP 03PP K Pd0T24 (000 J40@ `8 <  '2P0< @d\800c00b S<Kڗ#< @` RP _Y   aZ  @0w7# f2008`#8_$@l7 4U2᧊<0`@ cR<KS#P@ 80 `=q@AI7 gb40S('[@ ``ȥ\|4|\ Yܥ\H$|`$0 M    Ѝ<4000MPЍQ00< -0LM`0V`Pp1@@{P,@ p0PP C22s P 2$0  00  -D@LM 20 20 D2 0 ` 0-PLMtP lPP 0SP:@0  8,@P100P+00< -LM$@0SS 00< -LM4@ P0SS 00< -LM,@0SS 00< -LM@h p-LM0`0C Q@ R pS0S T0P0Pxxh!PP0&P00S 0P0&10P0` T 0 00P0P0T0P0 Ц -LpM|KZP|0: S K --80LM R 0 0 , * K`  -PLM( `@T PU p?qPp0 -R  2/@T PU 0 S0HL%/ 00$0$  -R  h/ =  --LM4@0 0 C, +*K  --LM@HH.0 40 *,( +*TK,  --<0LM R$0 0 , K@ --LM0 @0S\*0 0 R   p0  KTP0 R 4@.0 0 + + `= --LM\0\ @0S<!*(0 0 + ^+  - PLM@ @P 0 S@ X -L M@KtP0Pm0PfKx 0-LMP@P80 S UX 0-PLMP@ T U  8h;8)T8h3 M0SS   0SPS00Q00ЍQ R 0S 0S R h -LM@K <ن40 R000 φ0K4pt 0-LMPKH ῆ@00S@ @0@S 㱆K04h -L`\M0V,0  0p#@00d3 Q\# Y+0x t0  0 S 0-0t0 8PUR  p R xX X W LV 0"#4020lK@ Jo@VR 80Sn x c-Vo VG ŸR2 T l K0P-p PU  R0SVb V$"Q$2 0  7-PUp0S .-, 0Rl(K0 0@:V0@60 SS@@l K/l0[S x!Tt1 0|l K -0p0 V0@l0K 0#40/lK@@ n@80S $ t0,V  ,lK@ ny 20lK@ nr @Q 0@ x P@,lK@ .@ R x,<hP  ,T1ph0ܧ ȧԧ x- M \\00S^)0080S 0 R00  x 0Sl 00C0`0` T P000P00Ѝ (Ѝhh xlp  -LM$pK` [@T P 00CS0<0@T 0S 0@ h \' <KPT 0@  h4` @ -LMQ@P 0= S; 05 @`p<0 0^@Q Q 0  P  0RQP tF0^0   ^  <00,h$/px|thdH -LM@L#00F%T0?S[ _ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ _ ^ ^ ^ ^ ^ _ ^ _ ^ ^ 4_ 4_ 4_ 4_ 4_ 4_ 4_ 4_ 4_ 4_ ^ ^ ^ ^ ^ |_ 2P <0S 0Qk R0S Q PZT/1`@T P8 mPUSP@TU D1Ph(1 P 0R@0R P0PU p8@T `HmP Wp@TPUW |0P P00Q 00Z 00Z 000h -L M0Kp`P\ WpV@ 4K@P> U4T P@T ,40#00 W  @  00CS0<0V 0P T 0@  T  㪃(KU<0@  ✃4$0!4h0 0-0LMQ2 0 @P ^ T\ Q  P 0S R pp0R`  0  H0H8 P 0S 8h `\(^ -LM`00Ȃ000pSp Q  Q2 R  26P 0@`00(K@ 0070@00 00/ 00 R 2 R 0S QY 1QDPȑa 0SW 1P 0S2 ! 0S0;00< S 0S+ d,0X 0P@ 0S 0S  !f% 0S 0S U 0S0  !?PP 20 7x0P0p;00D 00?P@0 00r`ptL< 0 -LM4K pxt0KPP  RI Wx8@T `0S0C00$3`\# q@Tl$V @=W. 0SB0SU0000 U00 0S W@ 2 R0x">0@  %(K @M@ 0SPW`A00 R ܑVQGPY  / #@0 t- p,P0 -  ہ0@ pPPT\/0 @  ȁ00!@Z$k괐D 0S0n  x 0S T0P@&/ 0L}4ptpX 0t0 -L M(`K@p( xPTP $KP0 0S$ @ bT0d0K0P 0 P 0S 0S F@ @@ :$ R@ $0!a@4 h0 0-LMPK x0P h }@K0004( @ 4l p-LM8@PT` `@T P ᒨ@P`Tx -L M(pK` P׀$K@P'  R 0S P @ €KP9A. \@UU  ⦀$0! @40080M0 R,<0SЍ0 Ѝ-  -LM@K <y80 R 000 lK4l -L M4  P1@(K0K ,S(%`V00 0 0000S D0S $p0``0$40:PP@0#SuTs 4@ RnPP@@T zd$0S Q  &44 R  4NZ0$(33 !T<Z @  #pW00| 3P \5 0S0 R  + 0@ 0$@,00@D34(  , 0"0002@8`p`{   A. @`TO2   | @ 0p00% f(" 0S DD ~&8@T $(w&@T  `#"@}1 k,t刧p}!@l 9&Z E [X!0S = @!0S 1d`1@!@ 1@ @@:3 4$4g 0S 2 {2_y@P  A@` PD@D ^2T4ld` T'd(`0" 1!MK@D @D  SKJJ0 'bp6K J0J 0&zp p00B0S00A0SwKJJ0 p&zX6K J00J0a 0&vzp|KJJ Jpt @l( }b{@T@P@Tp!]KPEPE+lb}bP@!MK@D @DRKJJ0  bl}bpG!MK@D @DRKJJ0 ,%ybp6!MK@D @DRKJJ0 $hbp%8;@|8;xzPbP r8;bPKJ~0pJL4KKKt bP  zbP KJJ+ Xb nbP 0p0KJJ +Hbp!MK@D @D40RKJJ0 #bpK3JJ +-bpKJ 0J ph( L4KK$K`3K JR# $ 0pJL$KK4KKJ 0J ph( L4KK$KPu PKJJo + apYKJJ0 KJJ ^ .bPKJ0 pJL4KK$K{!MK@D @DQKJJ0 $"apjKJ0 pJL4KK$KaK0J`8 p0CJL4KXKJ\0 pJL4KK$KOKJ0pJ`8 L4KGh7;@\7:aP+ KJJKJJ +ap,KJpJ'KJJ +ap$1K0J1J0  ypj7: aP0/SX^7:KJ0J0 \ xppB` 1 īL3` 0R, SK 0 , b  nR?,PL 0 R _Pq 2  0 <@@$00$0"<0Q0$ $ $Pa $00$0000<0@ 0  $0S `1 R, V+,P`0S7 W@5 * RH  00S< 00S60 S6$00p p0S Y)0t |0,n<0 3  @`X   0 p-1LM R 0 0P0@0 x`0SP 0  0P0@0xhwv@\T0 0R0 P 0 0R@0_ P 00x - 1LM  0(00 , 000P80 4 p@`T`\T00S 0 R00 @``80 cRP8K,P[T@p ]TpGW00S T004, `ȝw3$K -LM0/K,0  " ?@ 0@ 2 ! >K*.KH! 0  B 厝101 ? @  p@`00`" <` `X/ P\PH @ϟ0S00B P P #PL b? $0 0$0.0S, 奟Kb  P\P Ο0S00 X V V00.01 cRKp VМ P  $ d  P 0S0C0  P\P ͟0S00 )P \X[ `X $X  00p8= R X-!X  $01 P\P (͟0S0@0 @ TT T !Tc 00D-T S}t  l 00  " PK@K T T% T# @-0KU t  P\P \̟0S0@0 m@TPK4PU+1PUO 0 !RK 0(i0˟00; 0 0< 6}Xm |X (Xw @X*X ?X+X !X 'X \X= "Xm000 Y 0 p`0)X |Xt (X 0 0 0 Y p 00"X \XP* P\P ʟ0S00 $X> "X; X9  \00 p2\X 'X "X, 0 `0 p(X000 )X p}X1 IY 0`0p"X1 IY{ `00 p'X00p1 IYe ` V 8 00 p B `X0u \X  P\P ȟ0S00$P "P? P \00py)X (X000 'XI 50 V0S0T0 0  Y * 0 p`0Y0S꘢ h 0 'Xx @T~1 IY, `@ pB"Xr \X@00@0C0(X@@@ O"X 'Xd  000@X' P\P @ǟ0S00(P 000 Y] 0p`0(P Vt x00 }J[X`  /P [00 p` P\P HƟ0S00P00pP00p0 Y 0 0 0C%00 pS  `0S CCR 0S BR 0S0C`0L% P\P 4ş0S0P0 P(U| {U 000@ X0 0 1@ cRK1 @P P\P ğ0S0P0 xP00  0 X  pV $ P\P ğ0S0@0 X@$T "T  1 cRK pT3 0\  p@) 0@0p 001 IY ` p00 p1 cRK p P$<XPP>X V`  Af V` 00 !`\0FXbS>(@T0"0PQA  `rT0S   #@  $@Pz 0w 0S  0To   0Tj < 0S (  @lh0 <0$1 ⺙O 00 p0W S WV媙(X* ;X |X>0 P\PK 0S00EX^ |X&PF+ )000 p`0j\TA `T?  $ ;pXp0` ܫX, 0R(K0 Y  0` 0  p`000CS0^0 P\P 0S00)P1 IYm `00 p P\P? 0S009(P:0 Y 0 1 0c0` p  1 cRK p X00p0P@0  $PJ p(P 0 Y 0@  ` p 0 0 0 Y  K0P0Pp @T\T 0S00 @W4 @ \  #Tp9 D3 0p2p/ p+W)00Xp P\Pa t0S00[:P\ %P#Pn VVS0 Y 0`0X$0 1 cRK P@P`$0[TKP @0S @1 cRPK P00 R$:4 P\P 0S00 !:P@00 P\P 40S00p%P#PG0 Y/ 0`0\P `Pf\X6 `X4 X2 )X@@D@ \X@00  &00C0@@00{ X &X|<<0008& P\P P0S00 P P00C00S0&0 0`00C06 P\Pe 0S00_X >P00S00 &P Z00 0|P0@00 000 0 凗7E`KPs 00p0S @1 cRK p00  0pSP(^A0S p:J@00D  KEf  K  K`$0 0 op  K  K( p0 Yc 0`0U` Q@ dip00( 0C p( B`0 ! 0S   0B)000: < 1 ! #10 1  `0P pa P\P 40S0@0 @T W T p0T 1 cRK^`@`P P\P0S TT @ UC 1 cRK=@P@8  P\P P0S0P0 P U 1` cRK@`P; R P\P+ 0S00%(P( D  K0=PC  K  K~  KG  KB:8  K9YP  K1;XȀ |Xㆀ =&XK00  KAH  V PP1 " h=R }R(d= |0(00 00 < [0`!@000C02 S " :2,,tx  KP!  KWh.>X00`0  KC  K>X00) 00 P\P 0S00 -P0 00U000,0MЍ -LpM℁P`U @Th P偕H~0806 `PG K:{VpP000T\S/Rn n%kV@PPD0 R ㏕00@`P /P0: S 0@ 0@0W0P `?EV@P 00h0K 0@0W0P$KT` 0-LpMP@P Ppd 0T  KP 0@ 0@K00: SX0K 0@T p-LpM  | P@@PPR@ X1PUC P K`P0: S 0@ 0@PUKpD @0 \K  0\KS d0S& M+ @3-0S])\K0S0SD+P 00Ph0S\$ Y 0-LM@P 4P@T  0R@T8  -(0LM@T @T p-LMp`PU R @0@8C8Sړ @TO0 0PU 00x -,@LM0 01h\ -LMhaPp0S  0R0 R @@ T 0Q A@ T 0S 0S W 00h ,`V0 R@0 xP0@CTT W{HP̭@0 P42 Eᙓ `\0 -T`LMpGP@pP⺓ P00 Q @ -PLM@ 0 RP0S 02n T000bɩPPh0 R \0 RH:    S@ 8P @HP|8P @>PThT8 0弪P8m( )'$@000RP{h(00  7 0! S P @  0,P ǟ@P0PP @,xt1(P+0@/Sz P70S8@7T  )@$(;*( )0FS Q0S 0S0SV'0  0S5 Q&6Qf00'0@ 0S ;0P 0P 0PS`PZ0S$"R@T5 PP5 0s L C%PdEAAKP1: S 0P0 0Sğ0I pPQP$"0f0P 4p 00`0P4 R 0TS@T  0PR 00V00 0S44   (K 0S h^'*0S  0*#nQPi0S*QP` (똴0P\g@T0VVT1S00 `1AS`A0l|!'*9PW $0F@c_2T   11 R!0P0g[ 0@TxD 0m2PPŸ0S QP~ hP0Va|@P P\7^ 0S #*G$P P$P$  $ 0 00 KPAKP{ 1Rw 0Rs 0Rnnl  00pP  ` 0dA0D PP x`0P @#+ Tdr`X  \ 8s``Ы܏(ԫ$hȬ0 -LM@ֿP@ 0 -LM0@0cSz bSz q$PK f$ 0`S R `K V$  0S PU 0$ ā,40V |GpC,((0 "4P P@ ,0-M d 0X00  R000 R 8$# 000 RЍ0 -LM  4<0< R808R;\0;LD<4 ,@$h0 -L LM0@p0@P`a00fa@PԮ 0M 0    Ѝ p-LM0`@R0 000 P⟎0Pf 00 x p-PLM xhNXPXs@F`P g  xh},x -LM @v P  mP -LMPp  `PZ 0#S@Pʎ@ -LM@Q s"P PP@1*@U0S pd a"0P`d  @gU g@j00 -LMtP< @ D0 @D18 < ``P`H`TXp V8ʕ ``PVPW4 0P V @PV@PX8 <0@D 0 0| V  r YH8(Koh 44 00u V0``ppѿ 0-LM^ 0    0 0 S8ho@P H0S C H @0 @0^ '^ UhY\PH0S C0 ^U8(eGP8hB0U -PLM@Pp*`@U0S)Q |Q00W0S V  ,M@P`U`V*\ -PLM`H* p V0S@P*T ?T [T ]T$ |T' )T/ VX00S% z3MP XpX0S pX Y 0X0Y0S X Y:0 !S ]SppZJ0S0P \ -L M@PTp p0 `V  Rd @-Q@ 000#0+Q0SY00-SX `SR 0-Q  0 p@ p@:V?V@ ,V;V0000 0:S0?0` 0402 ,2 ` 0? _? (K#V MP :P& ;P$ ,P5 #P0 `@V4 !0`W 00@000@@ R0p00p 0 0Q  0Sp0p @@00010 00 0 @T! 0 0 0`@0;P :P00 0hP0 L0 HLP 00(LP`(^d0LMЍL p-L`LMP@@%T 1S LPx&@Dx0M Ѝ -PL MD RPH .R*D ZH 0H D  ҅@ @ D S D @ RH0YD  RH 0SH ?SW @[S S H 0R@ 0 (KS:SI0CSH  P H 0RD SpBP HP  Y0 3 Z@!':00`C@Z!: 0P   0P *SH  R D0@C H  0~P T@:0PX@0SH  P H 0RD S`B HP  Z< :p@@@Z: 0QP  0JH0P C  0V @P@Z* 040 < -pPLDM䀟00PQ0S$ @ $ 0R) Kb`~bT@P0e@@Td`K \Jp3 0 0⪉` p 0-LM@P K 0S  P00Q0Sp00K0 0-LMP@P8L p-LM`PPP !b@k P Jx 0-L,MxP0>Kp0 @Q X0 R%\<000 0RK0V p` p-L MH@P4 `0T0 @ Kp`, -QLM`P0@p`( PPR 0000` T0GS0 0Q$`KP PSQ T00R0S00QR R $ $K0 Q` \8 -LYMT0Sp! j W41  HK| x HK!p@ 80AT00#`9 oT" ?T WsT0|1  @$PP%U 0T0  s%U k(K@@T  PS0S 10   VV@00x1 VGpgdS@0PS PQ]@%T<X4( IaC* PI`䂟Jψ0S 00 Q0W0021 t0-S /P 0-S`RLŸ bd@PtA `AT `1(K! 0 HALQt1`Pt P%Ut!]?K D80H !R 0-S+S00S 0SQ h!0S#0H0 \ x1S P H0! R  x1S 0S 0S  7|\ H 1  Q 01 0Sl x1SH H  ! xX H1S1 0H S D@p`X4<  ` 0-LM@QPy0 08h8@-MQ@( /Q``V/Q P Q .Q \ /000S/S 0S/S/Q0\.00Ѝ0/^^ 0 .^0p/SS0&\00S \/00 0 P0 \ L U*0/S -`QLM`@ /QpPy .Q< | @ X <0S80 40 00 , 0S:S00S00   0S:S00S Q0000 P00@R08 4 0  0/S8  4  040 8 00 Y 0SR400  0c0@n_ P0 bR@ ^<0S@0(K80@ cR8P@8 ^8 0 S/R/000@<0 00@ .S0S/S000#<0 Xy< 8 4 0 &_0@ cRP@ r^ 0 S/R/00P -MLM0 c1\, @ TPA @/T@/T T9 /GP `eP V9 V:  @/00 0 0  cR@B^K pPE,^PEp 叡P@'( K0tC,$[/R0  0a P PZ, 0 R(K.T.T0.S Y0y/SP0S^` p0 -LM@^0     ͅ00 $K$0 fP 0Q/0000  `΅K -LM`P@$ ]^P0Up ]T t0T l0h`LpP P姅 ]T0@P@T 0-LM @  0  8 0S[ :Q0 a/ 00 0 P8  88h - $0 0 -LM`p  0SL;z ( S , 0P@aT#T 婫PP@`0S[` k`x 0Q$ 0% ` 009 0|`j`0i `0` ]000 0= S, @0  d0d`0 0 `$00 -LMP `pM WP@T 0P Wd@ \0 0 dX`0 WXBp X0Q@ rW@`Td#T! P`@`0S#0 ;0 00$ \;WL 5X \\ 0 0h0 0, 0-LM@PP \ 8h~8 p-LM @`, v  0`KS' PK+ 塪P Py0S  ;0p0`$0Kp R 0 B `0TH U$0`0p`  D\ -LQ@M0\ ,0 H H X  P %P`  R 0 B 0HH P0 H00H0 @, 0HR(K0pT0 P0 L0 W 0GLSL P P  P P P P P P   P l L P ( P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P  P P P  0 ~ @0G0 P 00D@SP 000L0 X EpUpUX `T P plWpL0L@0  `L0 L {L p `L uL0 ` LppL lL p,0 `L P0 dLp `L ^L0p0 `L0 X\ L \0 X   pX `\ P JL p `L DL p `L >X0Sp `\ T0 6 pL\ X  b `L T )A0G0S 0LP pc0G\L S        L p L L0;@L0 \\ `d0GS @ @ @ @  @ @ @ @ @  h @ @ @ @  @ @ h V0X0 Pu`X ,Kh  0d :d0l 0d ( P`duWt XQ -00lh lL  XL T L T XPL0TPh p L Pe= S L0 p0pUX@0C0 0 @0T 0S @d TdHH US@0 B @Tp0  R @TH  H >L 3#,Kh %2> &BP0`lLT ^x0X00L L00B0Bh0l,Kh 1>A P0 0` lL: 0R 000lhlx,KuL  0\0\  P`P`\ \ &L\ 0 L \ CKC0KL!40#0X0S^ \CKCpK\0\0 02\ d ^Zdh lA-P+PR PP 0P 0pT0Sf 0C0 00 HHXH 0xS0SW 0C0 00 H  H0pH 0L05 +00lhl @`` 0 B p0` @0T  R d &` @0TdH00ePH0 0S 0C0 00 H00H0pH0 L E 00lhl d d d d d dp0@Ԯp --LM0 0 4 K 0-LM@P" 50u    P  &P0 : @0 P@ 00 08 0S P8 X0PS 0@0 0p  ꐱ -LM @  0S# & -*  pP 0S0 0S0:0x}  $00Ip 0+ 0 00$ 0ꨱ -LM @ R 0 B 0,Jp R꼱 -LMP @3 T6 pD `Q!   P 00a0S@@ KXpW   0Xd0P0 `Yp Q V`T`Ա -LMP p! X `$R5p R V@@ X 0`d d0Vp0 V f4X ` 0; 0-LM0@P 0P  0000   ,80 0-LM 0@SP 3P 嶣 0P 0P 8 0-LM 0@SPP 垣PP0  8,T8,O8 -L^M\`pP@%T㼀& 0W, pE <  p0$ (P PPPB0BSU@P?ppEPk(*0lD@ --L8MH@K0B 0 0 JRK -p-`P00PQ0 L8MS P 0P@K0 0  0 )P0Kp( -pLMl`P@)# T P (0V0W< `0``0$     dT P PPp P PPpPphH -LMl`Pp@% T9 V`+0 0,0$ (` p ` P  Ⱅj 㧕PPP P PPH[v~P 0\l~00@0 -LM@`#0pU~00 0,0< (0P ၚ@P T00ӧ2 0 o0Q00 Q6X@,}@-(( 0M0Ѝ40 M Ѝ4MЍ -@0LM@ }  @      p-LMP`@@P`x p-LM@0`S 0 P x00P@0T * 00x00@X0T0@` DA }A000 0@@P<@ -LMR0pS@3Q0@A0T2 P- T<2P``V 0T0 XQ P@0T*00T+ T4 T- T: 0DSLQB`1 P1 R|1@` DA r}A000 0@@P41P``(P``Q 1>`p`3)P``0  0>`p`3TEP0  0BS Q` L 7`P H040R@0@ `w<@G(<DA -PPL ML H00@!@1  Q@ - EQ5 Q 1P AQ 0 S P0AS0KK0K@K0  P 0  QP 0x 4 X\ 0KT * 0t @z= @0@80 < @ zԭ@0p Sd 0P0=URʨMUq4KU x xx 4KppP `t1@U@P=PU8P} 98Px |48PLr<@     p    J`X{ }$(, -LMP!@Q 0  *=Q&0  "=Q QD1@P U0`0$ 岀00#Pp  000${ 0 @v0@v P0P0 :00 0p0 p@v 0p P0<< 0-0LM@0  PP0S p0P0S 8 P 00,004<0@ 0-LM|| Pt0@T P@T 0S  ,0 00 0 0@T8TP MR 20 RЍ0M0Ѝ M 00Ѝ M0BS 0 0P0 0 Ѝ 0-LM0@&v0 S@P0SL 0 0 R0S0eCA b008 8 MЍ6 -LM\ P0L `01P@U 1pT@P4U 0S 6P0 -LMp@ uTP 01 R1 0d?A1cX0@ P. Z$` $ ` V AT 0 B 0B0S 1 P00S@0`0C V0mTuQugfff -L MZ0 4 , 4 0J @01P`U 0  1pV`P6U 0S0>6P(K0Szʊ x.v0M@Cu000 @0 0P0 CM00C0P괳R M  Ѝ ЍO@ M0S 0 $0R Ѝ00P\M0S R 0S 0  R 0P Ѝ0P 0-LM @ P 0Q0   Q Q 8 00  8<  0Q0    8008ij p-LM@`!PPP4  "   0 R)00 `0`S 0` (K(` $0 0 ?tKpT( K9t( 0R    `D DPMЍ Ѝ -LML@1  !R 110 0-H@LMB^T @ 0 ! T @80 1M0 ) 1Ѝp0F - L0M 01!"Q0  !Q0 $4($B0TPt`q40000嘠@0P`0  B@phTPt`q44  L0  @,<  o'0T DD PpP 0-LMP @Ps^0T̃ 0 0R0q03 00S  H0 R80 8h00Q00 0008TD ` 0-x0LMl@l h0B^T @ 0 0S 0S T @80 -LM pW` % 0S !RRP, 0@@   p <00l0d@PPLs  @ 0  [ 0  VT p- LM@PT" P0@Bn0 0S T @0S UTx@80 000 0 0 0M RЍ Ѝ p-|0LM"@PU`T0 @ H0  0S40,  R=`x0 -LM04!0`p Q 8OP qKP0U* P@T W3P _KP 3P3PKx <P P H0UP$KP $ R R0Ղ"P00P p-LMڸL`P@T ԸPxHP 0@0ɸPx> -LMpPPH P r0S P @rP0r0S P @rP0r X @T `Pq PqPqq@Tqiq -L4MP`K@ B 00P SI H H dI I H H J I I I PI @$((P P))@$(P P)K|@(@}Px@$sp{P PP @h0TPS@@^ 0-`LM@P^$Q?@8hL0S 8hG^$C?8h? p-LM`P0@ S pK dK dK xK xK XK XK K DK `K K K VU@ PEP@x0P@SP T#0TSU S 0P@SP  p-LM`P@e$q xh-I -L MP`4  q4 04  S  40R  0Sb@p4@0P PP00 R40  0Sb@p4@0P PP00 pW7 @Tg@pPU%  0 p 0@000 00 R r 0S l 0S PU0 0p4 pj4 e4004(KKp -LM`pPG %P?;0@:S:Q P P P P P P P P P P P P P P P P P P Q P P P Q @Q P P P P P P P P P P P P P P P P PP P P P P P P P P P P P P P P P P PP P(K0pP @P p?dP00S b R-00@@@0SppX @80CSV V V U hW hW PW W Y hT X X \Y \Y X W V V TV (;@p$4(1(.P P)#) P@v$(P P P@] y0S&$Tok Y @ @@D TT @T~d0 %0 SG 0S x%  0S @ P%0S 8%4%0 % 0Su @T P  @T 0@TP  00S @TR[  W0S ~ Xd$0 P@ 0 <$HX:0 $? $08 #00P0#  $ #0#0 #|#0 R 0S @ #0S R 0Sv @ "0Sm ""P 0  "Z "00S @ "00@S x"C h">X"0@0Sb0"0 0S! 0!@ T! ! !0PU 040 !  0S @\)| t!}0S04T!uPU Z(0 b t -LM@ `P   00 R 00!0U@@ TpO 1p P@ t!0 00L S ? | 0W L? 7 L?R0S''0S( -\P #\W00Z  R$Wp@0T  R  XRxR@Upgp@ 0R@ @0T  0 0-LM@ KgpP@ `00S 0 S0P?  0K0a00 e -L,Mt0 ,0 HX   0, 0RI(K(!(1 @; p0W pPP-0K-`K8 00f8@P W 0 WBa!00#F0c 0F C`C 00f  0S-00f   <0 0O#ODpgfffd -!LM ve!0,8 Y0 4  0 4 `p`V JPU 0 0 S# p`VZTY804S 0 @1@b DA0 deA@0 4@ 4001 00 c(KoSe T@T   4P000T@T0 804S 04 p04 0 \0@b DA0 +eA0 @4 8@ !0<0 H -LMK @Xp K ?L -LM`< @0 P@ 0[S =S\4h  SH4P R cp0e k8p e  <QZ0SZ 3d<  Z 80SW <)@4 0 40T0Z0S1    <0 P  P <X 04 00XS0T0Z0S00S@Rd@T P &p0e k8p  8 0Yq Z 0 %   R 80 ?S" (K1 PRj %P %P~p m80 ?S80S8 t 8Q`eX$P? PP U cX P 4000s T 0 PPQ3 cP  @\0`0 00   Q@0`(`$0 0-LMTT L0@T PJ # @0T 08|Tl -LMp `T0P0@@TJP 0 P@TZ 0 `0 @kch@c(0 PP p-LM`X`c0 0P!c0@0S000 L000 L@P@ 0 T 0PxX0 0M  .P'@ P @ Ѝ [PM {P }P ]P Ѝ(P )P@-0pPMP#W! 0` @@P r 00  PJ0q0 P`VЍPJ\L0 q 0 0 -LM0LtSxȇ 4  0 D ȇ ( ȉ  P@R Pz@R 00hOx7 @h7@ pW0`P@T `PP T P @W0VP pPEUk V@TZR @TX 6  @TJ0s 00As 0@TZ@TPR(l 6 @ PLT X :@U0s 0@ T0s 0 @D5 P@@T@Dkpx5 aRX0 T5 @  TZXX:@0s 0 T0s 0 TC0 \0@s40 BP9|5 |4  0@-0s! 0 @TR oQR 4P @ `TX:N@ T r 0ȣ0  @^00 @D@^0 q 0 @DR4 03 @ P`TX:p 0 ' 0 0 Q3 0 | 0 @T  0 Q 0s @| 000 | 0Q0<Y ^@€Y~ \@{00S@@u1aP,\ P!.U@g X*I@Ua 0 \ ^@TZXYV@U1 Q7N0  RMF0  R->0 RH80  RX00  R(l0  R L0 R^FPfP ^@D@TY00S@ ꘿0M ,0 R00PP0Ѝ` - PLM@ 0 p-LM@`0@ PR  a=9 e 00b 0x p-LM@QP! R `0 Q 0Q 0  9 000xT`  0Sxx0 a9 00 0M Ѝ 0-LMdP@T\@D P0R  P 8,0 0S0C0008<(0  0  MЍ8 0-LM0@0,P 80 0 8- `80RM Ѝ0Ѝ8P$0$  0MЍlh -pLMP@P`0e R0@0|0U0C0P 00 0b@|0U00P |8 0U00|0U00P`d -PL@4 M<$@ 0,4@@0 pPDp WV0`@T3`VG3 Vb 8 у 0U{3# @@0S 8 _QQ„ V^00@0!0@0pWS0N 080  VP\ 0SYW00S8 0 Q 0 V0WP ژ 0?0 PÐ @ 4 ` 0f S00 4P4@  H `n@TH b$2`?ÐY 0@] 0` S PPT M0 V0 0C V00Dp80 W0080  V0<0   0Q00l 0C < 00@!V@8 0P 0 qS 0S  {000PU@0< 0S  +@R<@ P0S | 0 {0@0008S  , 00c0(KP @>@pt`d` -d0LM XX0@ 6T { {}$0$  0 |td` -LM(@0S ]0000TT -LMa{h{ 0-LMP@]8h]T -P0LM @R TT^A{@@$h={ {@`D 0-LM@P 5 0 08h p-\`LM@]P] 50 0 xT -L M@Pa0SW P 00|q(K,K0 @0K @fv`PJ (1 ,(# (0V0 P00AP5  vP#U0, bQ P0P00Ť0 00 @@ K lP P4Q (0Pf@@1Pꌿ, H<@L  -L$MK0 K$@K K @u@P $  z wK -L(M@PPb0S S P 00吢U0 0K4K8K<@K @uP U? `EX<0SE80qe5P@40x00  !huP00S 1T0 S/R  v8v1!1|1|!@@J (K80XPPpfv1 @ 80!A@ (vXpPPU U 80Av5P80@ pꌐP{ D00dQq X0@@ZW< 8y8Kvꌿ, H<@L -LMPQ@0 U `V T4tp@0 P0C 0 5 D0 PK:$0PϫHDH -L M`PP 0 |? R) 0@yS\ d d X ܬ X Ь T p Ь ܬ \ t  $ 4  d  P t d Ĩ | | | ( ܬ   4 0 ԫ | x}  "30#`qd͟d-0S00PP=  Q $?Q@@NP@$= ,00CP00S̟T 0 PP@^R pp00 ɥ`PZXP P|3@0 P0C 0 %4 00L,00H,``@<P < R 0R0Bࠡ0(K@<$ @ ;+;;;" R% [y0S;cP` 0 @c\Vwy\ 0` cR@0S0C0DJ0 30 :  `3Z ZVT:`V@ :<*00fc@A,ZVP*00@r`J0 0 8@0S0C0c9 *9)@@ &9@bx9x9d)x9VH9@)lYD9@@ H P`FVT \9 0S0C0V) 6HXPn0 0 08! R;`8(L8X( 0S0 00<8 PIV QB \8  q 0 QuQ8 \, 7'7@@\ 0`x7@P7帧@'L7 0S0PW0HW0D P`FV@0S0C0~@7 ^ 6&6 RFP VnP0` 0v0P<64&P<6V@@Pd0dA 00d0mL6 @T Vf5引5pPQ%00 @ p0DP0P0U q %000 Q\%00ӑtE \ 4$4\ ``0   m V4 Rc4x t4 0 c`P$4`@1 H4  vCTfP?0 0f 03#3@@ 4# 00@3C0 FqP 000C0` l@`P00T0SP0 䒟pWF }P 0S T2Ÿ2P2 P@2P0   Pc\! 0@P`@0`%S@D"h0S `V  q 0 Q Qm P1 P00P0S@Zd!pGQ 1 @ q 0; Q9 \@Q0@ 0 0R00Q 1  `Q q 0 Q  POPJVH80  T@HLD<`d hdph TTq 0 Q[Ql `U00S' P"` @0` 000ԟ0 P0^V  P00 PP0E00 <00 0c c0 @00p ~W  p/00Q0 0 {/14Wppd 0 @0 0WSwS0  r 00 0 0R@s B 0d -L$M\PH L P0D/D?8/8?,/,?$$ϟ/P,L ? / \ˠ#OHΟ0KP @ P PPP0偶̎ 00 N0b. P0>լ.Pը^0l0ŠnN cR0N 0NRtN lNh.0VP.V  d/  `/0  c> B > . >.@@AtQ4  P 00 S t@t) R ] 0S 0S 0S# RP꠶ $ 4 x x x ` T 8-0 0 @S00,QB T00^@  T  0 TPPU Qb Q < R B 0AL c0  v/P< 0S P0S S S00d00 0S 00LPmꈻ м d l T00e ˟0  @0 000D S` `˟Q\;X;  H;  @ T " +0000010DS 00D 0 1:ʟ @ T  *0 00D Sp 0!0000C00 T T`` 0(*TT 0T 0T :'Q{  :@ 9 R 0  R)l9@ M0 0 0C0 TT70  R@9 ^0 0@0$0  00Vs@t s ss R8 0 R0@ $8PȟȟH yP0S cQsQ CQ d8uPP8 pi8   0 B y T TPP& '10DSP00D P 0iǟ`@` P 0 St0@ @@- t r r"sL0 SH Q .6H 0 0 (Kt&0SLƟ00*Ɵ0 ( 000r Pq\@T] P6 D  00`0 0Ɵ 00@m5@T5 R@{0T 0T 00ST  R %PTd긿 ؿ ؿ ؿ ؿ h X ؿ ؿ ȿ l ؿ ؿ l ؿ ؿ ؿ ؿ ؿ ؿ ؿ ؿ ؿ ؿ x ؿ ؿ P A,P% #@=! 00C060 R84 0@ {yL4 P 3ß P @ğ@$a00@fP P. p]00v3! R|S0 0CR4#@0#Q@3 $ß0 @0S 0P0 0ż. 20P~ @ R B0 0P0 0 з0C 0 0QH2P0" @0S 0 ` a,1 0 f0b 00R0bP0`l"2`@0 D0K4` 0PFP @ `vcPE`X@ ڰ 00r P  a, 1 0Pc 0/T PP  XrPxTb,10cSsS8 CS6 2 \P aX )0  c, 00 0;PDLH@<xlh|d`tTpT ` 3MЍ3 -L"MŸQ p,  S P2 `R` P R* PP 2 RjKAіp{ X~8: S}BNK@D@D ¹Pw +P 0@(K0$S RM 囂BNK!@D@D0+aPP V$ ^K!PEPE0+TPZ +`+VP +K++G+Hl A+i+ 0pIP0+1+, 0R&(K裳CIF B?<3|0tph(+*0!pȟعlx@l 0-LMP@P Q 0SP R:00 0 0 K00(  ߁݁,H\ -LMD0"3 00Q@0P 00uw謿 -LSM✀0YOKp $ 6np `IKPK@dK 0<@k$ 0R Kptd@A -L$M@0P0 , 0S ,S0 0,SS af\ n\ 4@K s XfS 0R KSS p -LGMБ0Pp,0 j 0S@`KS@' ,S0 0,SSBKHH j 2 0GpP; IKA5p: ru|41` V,0@SV1S   Q RQ\ P00\0S x`, 0R(KP DT듗@5u0$ iՀ8p(̺ p-LM`P 0(0P`0,P 4@0 0 0 (400 PPKp婀뤿D p-LM0Sp0``QP @3!   @j@Q0S xQ僀t,X -LMMMNnK`F0`F@/㸀K,0 pD)[K ?)"K :) 6) Kc!0,2 0 (2 $ lPP6NK@  08 0 3ONK@D0@D ,2 ( $B t t l@ ) (  (T NK@w(, 0R(Kwp(BxDhԷ p-LM`0.^K@/0 (h0 ,K P0 HwlPKG 0RKpXHp'BŒ -MLMH0PQ,0 p H !P  zCTPJ cT T0UCTUCKHH/(2"2CT(K! W`` 0( K@V0@  1 吡 W00 S[K=<< l@ ^(tg  1, 0Rb(K0[K PK`I( E(10 x1 pQ |a k@PJt1S* 0 |1 x! pq  0EpP8 JKAA]p6 s@4[K 1 (0 D1 0Ch! |A x1 @! lA pq 0  '"||tl `뿕@as0@ !hpػ&B(8  -LWM 0`(0 pokpP* OK/' ,` ^k@P"YnKK`F,/'0$K0 ᳀ r IkPs( 0R $KD, ' 40~($pHBB$B¤Tt -ML M/NK0 /`q(0 h'0 2 k@P0K00S$^^KPE PE2KP 00@S,J'0x 5 @C jP V( 0R$K($p B"BÈ p-LM@a0_K@/0 ' !0d0C S \ h t t  "~0$0 0 jP-Kp0gS 0R||h 0RKp0$0 0$0 0$0 0$0 (k$[p#BPH$ -\LM0OK /,0 &4&4Ɵ0 (3 \j@P 0Sw ş, 0Rv(K;K0SjKA AI  I , &%ş0e6 9u4 (K0P)|0P-j@PO)R KP9S (K06PK8C8sj@K 6K %+&( K0S3S dQt $4QppA?KK $ &3s s 4 R K K?C^ c^ KP6KjK 0K@K pVg3S b'}KpGpG`/&#09 9 g 7 iP7S| t l d \ T p G 3CSL GW`3 Rt  KP?L#(KH0( K<#(KFK(#%6[SW V@K 6[SI PK  0KχKf2 RK3`S)0 S) "儢 7K p"u%3CS GWK@H"H2i%@<840,b=a;b9b7b5a3PK V@K 0K@!P>%T  0PfOK0K0@!P+%C^+p 0KKjKX!%PPPP!P1f 3S0C9 $  0KKK6KjKjf3S9 p B(*"B,h(^dlĽ!B ,P  \<4PD@8tp|м0 -L`M0xpKP `(0  :1 P @@.P) P @|K< 袳|\ ( 0 R$K|K< 即|\< 傳|>p8 -MLM 0/KA A ,0 + POKℂ/$;lr 3K; TK00 6hP2Sd St ZNK@D@D/{$0 5 "h@PvZK@2SXڊKJ`J, e$0 8 e h@PWK@Y - P95S6/]KPE5@S//D$04 ; i I gP)1( K+Q0(K+\( K0+Q8[S  +S, 0R(K2`Sht.K`^XP0+@${8p$B B"B!BؾD -L M0K@P`/$0 #6Kp 03KD300 0U ,P "  Qp(  0 ogPK?$ 0R KKP2"3K2#K3K<D84 ,z0 zp%BT - 0LM 0Utt -H&LM0@Pp,0 B VC P`C C B B B B B %Ʈp> C0@3S3X     4                        4         d T  ,  $凮p$0cP1 @ P`T ?K @tp0 Q"#U U U U0 @ 0@0 0@0 z4 {#0 @P`0# 2 q3 m1 K@蠱"3R_ 0y Xl3x#SX#8 @P`# K8303 G0@P`B(3 >0@P`92@ P00@ S` . 0K@ b2S8#82 "0 @# P `" `"0@P`D" 0@P`02 02 " 0@ P`" ! 0@P` 112 1 /x, 0RB(K`V=  RV08Lep= 8..K0@ e@P2K1" 0_V V"g 0@0 P #S+y(y|%yt"yl0 D0y\4 ptxHBdTMЍ -LMx -0LM tt -LM@P[! p1` fRp0`S.S0C  " P5 A1!O @_@P 0P (KQ0`S.Sp0C  .S W000 8K8` 4p 0 ٌP E00CV꘠@0@* ?Tᚐ)Ac 0TPS0C Pw0T0Cs0PS0 C RY  þ(^| tgfffMЍE 0-LM(@(P(  rtt<\ -LM  _P: K yp* 0#4  _P; K jp 0#4 LGKA<[pVd@ dd d0ɨTFw @,8 ,0廨 -L(Mp P \dPP= -VdP} PH L 5b [b0S㤂 u@P *|2nT l  wP`k k(KT0,06P@@P@H L fkL0S  a1 R@ bPM(00X P:(40l!Ϡ` @0c,`?AlN3c DKD@ @P < 8` 4p 00 TP1 kP ᢸ 坸k 喸P}wP P厸H å0-SX0S x |l x` tP0ppDH ᦥMb4XHh -rML MtK0J` ,0 ppP%L3Q iP03 R;$3 RAbkP, 0R(K莍0S  '"H7: Sl mKAA:P 6: S vPPvH7: Sm k$P, (H"P mKAAᔠP;Kab2 [1 R A@ P0: KP`$렑0SQA00CS0P0P0 Pp 0S0P!0CS030 Pp0yUYUw {یfNK@D@D_P! 'KP{KyPwc d^ᑷY`P|͌p^JL@ᨌPPpxOt(^PD, -GMLMl2 P@, T"8p fP- iP$ ("-p2 PbaU4|1pJQIKAޟP4: S X1 11 1qBKAA + P: Dua$ `0V/S /004`04 X p5 p@/PP 0PST @T 0/S 0/S @TP0 S`岈pHX  mPppltMЍ @-0MS@00Ѝ-\Q\ 0 00L S0 ^!00 000C\0LQ0c0 -LM3u -LM0@S K, `p 0 KB -LM0@SKKP  00 -LM0@S0s30 RP 0s3 -LM0@S h -LM@rP 0C 0-LMPd@P  P 008. 0- LM0@T) 0P0Q 0S =S 0S <Q >Q !Q0 8l0 \0 8XPP <0 e 8,0 80 8 0 8  0-LMXP0S S0@ S 80@8!  -LNM`0\(0 0P S:NKXT1*D1S8 @1Hl@MKs0P St` rP V?K VP 4P9@hC@( 0R$KP*@JOK <^t sap (^ -LMp` Q4 T P" *@T TT#PP P T0 P $q00qss , -LMp` T0 0 00b00@T TPwP sP s  -L M넃`p@T T T TT T(KPPc ,KP^ 0D S,  , @ @ @ @ @ @ @ @   ` ( ,0Rpp_]i`( ,0RppRP\`( ,0RppECO`( ,0pRp97C`( ,0Rpp,*6`( ,0Rpp)`0D S񟗯  X @ @ @ @ @ @ @ @ $   \i`dOiPpp`VAipPp`I4iPpp`;&i`/ippp3`" K  p-LM|`P0S @PP 0PS x  p-LMT`@0S PaP v0@S xn  0-LM@PTlwPX0H0@ R0S(>\/]\(^ MЍ! -0L ¿Htt@-0 CR 0R0 S䮒00 -PLL8Mp`@MPP NP@"&pp1&@pK0KP< , K00 @P &`P,00,0 @Pq 0< ,0 0 `` P \4XK pL0T PR0T0 T0@`5K,0T@X >\P <\00S \ 0   \PP1f40[S  5[0Sn|t [`@L0VU D00S8 Y $(KxdlMЍ -0LM tt -0LAM @Pp  {p sPp  qp0` fRAT 4RqPTNK㢰PP W[.?PP劾凾p [t -@LM `P 00 Q03*,  0,, pW00P0 U 00 @ep 0 P02@0P5 :0P *0@@,0 PdW p谿 0-LOM@P' @\@0P00 K.aD10@1P0  :RK0t  -LOM@&+\@0P00 SK.<@10<1P0  :n-Kt  -Lp`.PM+@P04`0K*K0C8M4>K0C4A=K(0C4$QK 0B*K44(I C:K$$P0B*Kp(I4 0 SG           \ h  40S 0000 0 070S000S00 0- 2)p 0'  (00?0bS fS)0S00 h< 4<̠Č8#Č:K"̌,K$44, -*K 0&880S0 0000 0 0:K P$ Z0`<`:KdK U)p0`06PZ@`T0  0KP T d KP @T`P d p@ d0Kp @T `)  `Dž*K@坿…V@0SE h8-P 080(x0 0S$k $@`PO dK .-dK<K./3[0C3K:K3[dKS3dK Q/ R)0S S S"Z  xZ:Kp0S   p ,<4("4!< 03[0C3KA3[ST `$Q VP0 0000'0S<0 00S 0S< 000 08a0 000 00S081 0-0 000 000 0(Kȟ p-PPL@00+`8)@P L00040唧P0 ((@,p -L@M` P  0 \13000 55:W00000 0 S,0 ,, pW0000P U>*0  0 @ep 0 P02@0P5 :*0 P $*0 @@00 PdW p0@ TP3 : 0S 0C0@ 0@,0qU dP"(K贿 p-LOMP@`$0 X|P0P00 UK+dH10 D1P0 @@ :f@ T T  00P@Kpt 4 0-LOMP@#ui 6P5@K+0D10@!\0P PP :1@ T (0 @00SK0t 4 -L@#000  PhxG-M T 0 $0@(@ P,P`0`p 4p@0Tp  <0P<` 0Ԣ($ 0,($0P00P4@ h ! @(`$, <@0g\ P. 0@!g.,P(@T<@`0$ 04@, p$0( 04$(0Dp4pHXLP @ @0 ! 0@!0@ Q18 P!@`!@08P! LPpHI$PDHpf.. 0 p 8D0#Hpj!E$ 0#j 0P%@@X@ 0H @^LP@D PpX  `DHL@PPT@00P0 00 pD0 00H000000000 L@000 PP`000ЍG-M0@ Q0@0@0@0@0@0@0@0@0@0@0@|0@t0x@<0@@408@,00@aAq@P `(p08! AQaq ,0\481Q l!p1@0  0p^P0Qp nt ^Q nt LtP@ t ~ BtPp t <t0P0L0#,0 #(8 , 4 #@ H0 < D H #",#,L P H .(#T X H "D0\ #<`0 D d "(h D0l #4p0 @Dp.\..40[8[T@[?  08^P0Q8 n< ?^Q@ n< <P@ < n8 <P8 < <0P0D0#<00 , D04 #880 @0D#\#.pT.l0[#4<8[0@0 @P劐pP0(Ko: 0-PL@ 0#<00#800#400 R0 0h? -pRLPw D@A1>0O `cWP: @1@ T@D SH0 0@H0L@pf.@1 0S@DBR@H0 0@H0L@@00 @TpG†@0D@ S H00 @H0L@`W W  PZ@1 0S@D RH0 0@H0L@ \00-PLP @0@0D@H0L@0 -RL`? D@A1>?0( @PcXPp: @0!0@@0D@e`@0!0@@0D@T@00 @@0D@@H@?X X  P@0!0@@0D@ D00-PLP L@0@0D@0 -LOMP`@~p 0+P~0 S 0 ~ 0p WKh%H1 s000}P10H1 KQ`0 S0$00DS$0 0!$0D -MLM`p$"PP) 0V0 BNK@D@D 0 PXP0 Z QP4 W\  n @0`p\0!!P$$Kd6  -L0M`PpP) K.0 P耞 0S }0"S UD@K 00 KPP(@\u("(04"48#K -鈑LM`, W0RSd0 S SMZK hP0U UP SBU U8p UpK0C*K ; A A A A A A ? A A 0 0R,040S 0S000 l0St0Sp0Sx0S\0wp"0"S000`0SS S000|d0SS S S000qS4 P\0@A ,KqPX,`@ 0 0S@ S0S 00S `Q O` 00 RT v3R00S0r03T0S Q0`0`0@00V00S0`0`0S S d0S S R  h0S S R  r 000SS\ 4 r<h0SS\ 4 h88q < r qr h0S r q0000000S2pgpGP\0  P'P HK#HK i0P0p0S,0S0 #p HK QP0sHK0S,0S\0 000p0$0 00$0` R$01D0s,0S000 0u0( 0?0bS@$@|p|@W0` W3 0S  0P.S  0J.K0 0 B00. 00 .S0S00P 0JNK@D0@D 0% P* # 0 R 0 010J.K B0 B4100~JNK@D0@D 0$} Pr po P000JK@@⩝P 0|00 00(00?0bS fSU|P0 0 + `0S$01D0S 0 P 0z0 S 00P况P3 `pdKW0$ 1Dp K (p` @ K0P  "p@TT \0"   SP z0 S 000 0 0 ጴ0!P 00( r0 d@K$-"K#$:[0C:K:K:[S,b,,@MzKdKK$K{K :WRA(pK 0R<K K^ 4 K|0  0 K7K ^(zKxxK0K0KK\0 :K*Kv00 -0LM0@` @0s 0P$pK 8$ P00R0SP :R Ur 000RPU$ @ 0-LP@P 0 S Sp00@ r 0R <8P  10u000 -L0P! -MLM]PP"0, 00S S0B,0 , 0RX,0(K0  CCP  @PuRnK`F`FKK,KïPgu00(Kȟ -ML MpPP#1, 00S S0B,0 , 0R,0(K0   C CbP @P0BnK`F `F2K,K~P"Gu00(Kȟ -LM@`p@P0 P@ PpK踿 -LSMP`p@u  0 P u0 S 0 u 0WKfH1 stP10H1 K -LPp`@P d000S@  S@ @p080400<0 0\0W -LM@A0p8`PDH 06.P' A0S#XPU H 0-0KR0,0KI00SR I0P P,KHP0,K  -KK -L$MP` LK 0 Sh S S A 0R0R0TS@0SQ@0S  4K*K0C M8>K0C8a=K(0C8Q=K(0C8(P 0B*K88 C:K((40B*K88( C:K( 0 S^ e _ e e e e e e e e Pb pe e 40P0 P 0000 SL0SRL0S 000 00S00S00  0 .V S:V` 00FV08 K>+Px40p@P  Zp 8K p4Ar0 00lp 0y (00?0bS fS0S4 0R  0 :K(45<*K 0S880S 0SP\ :K P(n 0S<`:K(0 5g`P0`0*K84pL*KpK pPr0`0?P:K8S@p KjP@pH K*P T pH K*PHK P}`P l p@p0Kp @ T HK ,p ` r*K@rV@4ar0S 8KP 080(pw0 0S$0P04 $`;@P  pKlpKHKnK`F,4[0C4K4[pKS:K""r_*KpK:K8"`VR0S SL- S SG6Z:K <*KјP8*K$"2Z0*KØP**K @p#:K ZY:K /*K Z Y :K !*K p 4[0C4K4[Sb@$_T^q0 000090S <L lp`JKq0 0+0S00 S0S:04A00 00 0P0S00 00S041 0 -0 000 000 0 `(Kȟ -L@`pP 0B@ -`PL@pP00pPP d0T04@0 T0L0uP0 P]   -LMB^KM`PE@p x0P 0 @@P <00@PP<4p8@ Kg -L@4P 0@0B -LMBKMH@`H p 0 S񟗹th h k k k k k k k k k \j j lh <00S00D00 pS:fRxR:0PI0 J"00003 J000S03 03 S  :J   60K0UI0 0 0CS0000ᤩPU  ?K0CUUᏊUXPxPPE ;-0 80#=80#@   0p@  0p 0p @pp4# 4# 8 0`Y H?K8RPPJ,0 9R 0RJ#*-R .R +R!ER eR  J  J9S:J0 0CS0000(PX   _K@PEtT-xePEP x;0 8o0p@ 8p0p8v0p4# 4# 8S 0e4P4 4(K -DpL0`S@PL 0@SL -L M0`Ⴠp娹X0S 0@P0e&p q@ d0P0S&p@  嬤@  b!$K -Ll'l7 l  @0S1&*l@ @0S 18#X `!0 8#X`l @ PQ`P`  P 1P` 0 P` @0S10P`P`x0   H *0K@P㊡ D D' Dw  <28Wp\Dw  ȲPD8WPaDP"P0L7 )0Kl' l' l7 l  @0S1 `B `>ll l  @0S1&*l'@ @0S 18#X `!0 8#X`l7@  PQ`P`  P 1P` 0 P` ZH l l  @0S1 `B `>l'l7 l  @0S1&*l@ @0S 18#X `!0 8#X`l@  PQ`P`  P 1P` 0 P`lw 0  *K 0)0K88Yl0̣l 0Q0O/KD' I R OK2D 5 :R3 58wPD7 Lw NOOK!1 D>A0  `P`D l+ 0R000`D & 0750 0d'5P`V U00 DD' 0DO?KD7 Hw %2 D>&B lP`D DO?KP`dU8L Y 0.K⠑K)0KL7 D' P)0[LYS*0[Sl70t7 1K000` \0 R0\0 ` PxdKPPKDT'0B0` \0 0R\0 ` PxdKPPKTw87@gTr`2H` \0 R0\0 ` PxdKPPK@DT0p@` \0 0R\0 ` P pD0 `  \0R0\0 ` PxdKPiPKXK\' ` \0 \wR0P\0 ` pW xdKmPTKp l. <@iTaP'p'(` \0 0R\0 p7` 0p7 xdKOP6pKpw @DT0p`@` \0 0R\0 ` xdK9P <'h1 R 0`R\0Sh  xdK'PK0p `0 \0S xdKP0`0 x'0@0h7 `p 00hw PY U@P 0KP D@h(K̿ܿ -DpL0`S@PD@ 0@SB@QRP000S0 -LS`P @ 0S\00R001S @  T0p@ 0\ T0Wp@d 000XT00S <0@@ \ 0 0z<x! -LMGPPX 00z`10>CNKTa@D @D 0P3KHH h p* T0S \PT3 4`K Xp8K0D@K0@3[<3K03K\ Ti  (0!"(80S _00 @3[P3<8XP@<0X0P(K  0- L@?pP  i0p  c0p  0?p _0$S _@;=_P@0 p-`PLU@`oP`0h`  h0S0#*P0h``0p -AMLM8pK`d P(K},0SF"[3RB2[S?2[p< : 8 CNK"[ @D0@DD0H  ,0S+#[<0R'#[80R#@eP2[  6_W0 02["[[AmK0`F@`FT@D,Pd 00S  _00 K -L0MP`XK]00 2[34[<03[80P@ 9P K .S 0S0( <0R0(0 -LM`Kp&@P0S@PUP| -L M `p6P2}<@P/P+ 倗PP&, 00S S0L,0 ,0P4P 0 P៖ ,K4K @P ᓖ``(K,ȟ -LMp`P(K ז@PL( 00S S0B(0 (0 P 营 -0LStpPB`. T@! 20PU`pPE@TU E000  -PQL`p@P P) 00S.S%P 00S.S 0.S PP*L P *  P*h~ -p LP "`@TP@@ T`h`P@ P00CS0 0-PPL@<< 0s@T P0h0! -LtwP =00D00H00L0(0 P00T00X00 \0 8 0-@PLP WP 0000000 000 0-MLM0P S ANK@D@D @0CP @7~AP000K0 -LcMXK M`\ , $@P X&KeK @ 8(K00C0eK S@(K0eKXK@ 0CYP X@`PPBT0S ZT 0[SOK,]P P0:S 5P 30K 1|00S8#X VOKQp W1[S S04%40T0VK1`X![T00T0DPZ 0ST} P\Vp 7p@}P @ TP Wpy<X KQl0P @ dP0b @ `[P 0f@< p W8t<@Tp IPP@P U@ @ X0K@ TW0P*Z00Z0SP IXKAP P pP= U`@PX KPDP@ U$!0@0' PXPKp @P000  2P , 0,K Z{,0SpP W0SX[T@AP`*(K(DH\;T@H\` nhpH p-LM`9P0:0/ PP JK@D***|* P11;dPP JK@D*Lg*$* P11k;Kpx^ 0-LMP^<0SY T0ST 0S OK㯂P.QPhp| 0S @ .C@P@ P TK0(^ -AML8M0`SZ (K-pU (@K0 PQP F @PKlp?  h0R d0R7 pP4 h0K-@P# A K@08@ 0P0S020# p3PPNu A=K0C80C  kp9"PPpKȟ 0-!L0PS00@P) U8PPPP0!SOP! :p{P k0S <P P'p 00P P-L@ XX 0}@P@T5 000! -0L@S4     $ h p6TP 00  `P@@P<8P0 PP/10P4P|P `Ph p-LP@X`P@ X`p -LMpPX`(K0 S00( 2K 'pX0S @P zX` K0 00 0 -QLMD H0  Qz H<̠Č8#Č"̌,,H0 @,̠D!;d , 0 @ P ` p @0  < 080  4 000 .2 0$20%20&2 0'2(0(200*280)2@0@0#2H0<0@#2P080P#2X040`#2`000p#2h0"2p0,0 #2x00 , @l  D<,  L8  T4 \0   t DH4 d @P`$p,4<(K -QL MPp` Q QiPc  a$ KQPZ@ $00@PP%)P Hz@PF  f008 K4P :8 K'P0@  80K@ X 80[S70[0SS 70[0S SMP @0(KP dx(0S K p- `LV@P p 0P*(0 0p 000pt -L M`Ạ pḀ0@P `4 ĠDT"4!Č'(D*T0K 2KKKBKRKcK$K -LMK![K04"4 1K -`LpHXb$H %X P p- `@VLP p0lS*(0 0p000p8 - Lp @P`p 0$ Ġ4%.$$&Č'40  - L@p ,<4("4!<0 - L@p 04"40 -LM 0pSU 4 0 4 \ 1,0 5P1)::0S 40P3 0T U.*X104 PU%0F>S-!@ T @!  8 $8 d, X100,0 00`VZY`w 0S0%5,0 r<040R(0 0ZY (K -LMkP"{`@p{xb"Kq 0Sn"[0hS*1 0Q Q Q QD1Q Q6 Q=  O4!Y;   !O! J&" 00S   0S   [`0 $000 0S 0"[0hS,0 0 0S8  0-< LP@ P0 -0L.S@P#P*QR00)P00X0`dS F>R`V@1@! 'WP P0@0S.pJU000U -`3LM00< 00 0s 00 S P R P s@0+S  -S00` Pp8 4 !R ZZZ Z5@I$`V U"0I8 45L$@  8 4  0L.\  0 S00S@ P 8 0O4S "8S 8P 4` `4` \<@8 K  V d1d0@0\ 0 R \Ap 0P0 T00<110 0`pJ W  0Vd9#Zp `p X 04085# <0 @TT00 (Kd -?@p##pWL$MX< 0O?   BE!5;t l@VT"0 01`V#U!42T100  8 4   0Xv8 4  0ᖾT 18K1 錾8 4 @T0 8 40 000 8 24|A$p0OT?@ 00@@#U[ UDe VZ00@@P` @ <M 30 0r03Z cY 0zdyVUZ00@@l 0@ 0<X  D 0 0<4 ` (K p-H<`LMP@1Px0Sx -LMP@ R@00 00 -LM@)1pMЍy- 800Ms00Ѝ p-(LM"X`  p@xx -LM   PGS@"00S0  @0 $ !K00 @P $K p@K$ -LMP p@ 0^ Ƞ,Ƞ0@P` ("(p V`00 K p-LM ` Ƞ,H@PP  p 00jKp -1LM`PV@7 |0pA("S*R"0 0(Q% 00P  000 `0 YP*@` _$0@0    ? - 2L WR0S SR0#S 50 !S0S0` 0C# @U  000PP P/@` T0L 00P00 R p LX0 Q dp  PpWU ,0 dS(Kp  , 0-@LMP$0 (0P0CP$;0@008 $0 R0MЍMЍ0McЍ 0M 0 Ѝ000M00000ЍMЍ -LM@h 0-LM R00 0P0@pL/00C08h -LM@0S -LM `@p 0QP@150` !!@c + RT -LM0MJK1@D00@D`* 0 LK P Q  0000 0b00@sPU:K0C00CUD0 @ 0s 00K<0 0 ,0 00 (0 8 0$0 LpK  *p@ 4Q0S 0Q07S+Q#00P$Q@ U p .00 0 SKp8 -LJKM@DM@D`*!p  W@  0p000 0b0QZKPEPE Pp@ P0S P07S P#0 0 PP @3 K 0-LM 0PQ@P 0 0P0 0 0 8 0-LM0 0S@Pp80  8 p-LM0P 0S@`p 0 (000x p-LM` 0PP PSP@cP0 `0`x -QLM@*P T@ -L$M`p@0 EP 1! /< P +&@,ZP@& +|%p@ 8PK  @00 000 Z00000 ,1080 4@ %pP-P@Yt2O0S. a< 0p P*%@O?00tO0S<`l d0p P*8%@O?00@ R00(K(^ȟ!Hwd Xd -LpM`10@W,0   @Ku@PK ߅Dp@K@  i`P060#0P@U@KW …  ᾅ #  iP0\0#0P@U@K: ᥅  ᡅ 0, 0R (Kpl -L\M` @ V^PP, p t x a 0Cs^0l0 *PX   hKTpK| :(< 0|0(((  lp t0@iD0@00 hKp t0\X0D0 @0A 0@A0#Q 0@ T:V@1@# x@Kx `d x V@@PKl hK@K ,0 S (Kpx -LM@qP $p /",")"Tf,at -0LMM0 ,0 $PPWoKJ%T1[S   a@P UK,MK N0 dq ..㕆Pp *, ,0 S0(Kp -LAM0 , 4$ 84 `@ PgN?0004ApP 0$DP UN0Sdd!0N48$U#PD GN0S@ 40B^KPE@DPE (0K@tD_P?p%0 _N%@P P 0+4J PNhpl 0DN04$847aPC_ ,0 S0(KpЋ -LM< @ ᅈPg `0pKV8 D0 S `PT 8 }80@#<P0S> 4 nPP8 $ |P@ yn@P8 00S4 KP 4 R ;;S dn@P"0 M<P 4l NnQ@  0 8K⸇@PV Y$@(Kȟ RMA Q:0S Ѝ -LŸMS 04 < `0 80 @ D Y00K00@zPPU 004SQ@04 S  P<0eS\00 @000T:0 R 00S S0B00 08 QR 0E 80R P000C00 0<pqp3\pW  *@P<<@ Q 0 00<@  pX00V00S< < R9 QP4 0<pP@"0B 0S S 0S 4S8  S4 S S 8S S R`00 0S 00<D R<(K -aMLM20$0 pP" i"p` ]KPE[NK@D + 0K 0 E 5 U\e I"pT*cK_PXGk06: S  S [NK@D+ K@@P[NK@Dp1l!6 0K@@X@9@UTSaD[NK@D "`P3L0S } K0UC!`PX% v!n/K!PX[KAv)) K2SPX [KhAH\00S $0 S4 KpHwd edA0$ -LM  K K0K kP K 0-LM@PPP0.S 0a C00C0  SRQ88 -LM  K K0K 3P K -0LM0`p  $0 b!PPKHPUOK 2f SK.f,KK*fJK.+P_KBA) $0 S Kp -LM@Pp@ 000C S 00 B00C S 0.S 0  00B S00EP@000C S0*S@0@SU T0 0B8 S8< 74`@T@DPR -PLMb2 pP@0 %Sp{0BS| 2S- +SI .SI %Sm3S >S7iSb DSp dS nS rS 0 &`*`( UcU V*d|d000]P V* q0 V* P0000c00 0 RPE PC0 U0ppP;0PUU U00S!0S 00S Q0  PP U V{*PP Vs*0 ' B P>10CB>A#>A0BPE0Sj<@@f  PW*(K %%XTt& p-L M`0`@K$ KKK`KPP$+0$000Kp& - 0LM: P& -(0LM K[P K& p-ML Mh20@0 \2`)PPDPPAK@0@$0/S PAK@@ P 0S AK@0@! P :AK@@AK@@+6A.KI>K B0C B0C$ :S S S:S0S QA"*0S0U0 0S /S P+AKIK@A @`A d PPT00S +:̊P 0S` T00S <0Pu 0 S(3Kpp&08PL\t( -,"L$Ÿ M RP`@ 0ቼ 0P Q 10m Q 02 0eP`bN Aʠ^   0b< 0BcA4H6&? `? 0S_ c`\ Q @ p^00P00S P@T00Q n B2`p? W P  |0 ` 0:5 6!ƠP `N* -LDM \p, 0 \P0QF0XSxSB >r< 000D6 W @`  Q#00ӑ iPhh#h3e00T02@0 pW: @QP q "000DTpG- u00A SrТ` @ j Pv"2$TaQ 00A SpWa:/QQ@ .QQN00A SKP/Q!D00A S00V0S< @ j P$ T9Q *00A SP&Q@"V t0S SS0h1P@@0h!0Q  0T2 H@0(^PK2 \1PH@(0/l@P00 }PT@ dK0 hd0S@ G@00G/00@ ,0 S,(Kpd -L M 0~&t -LM0 ~tP -0LMP`0pK00KP i 0 ##SVPU`0.T00S` U @ TU 0K ((K -h2L M0P,0 PD  PD<@K 0:S0:Sr ` p@ H >PP1P 1@ RY0cr1WT @ %:TXZ I0SF H 0SB'$0 p`p@ .T5`,0KV1 hP,@TX  ,0KR!0'$ p`Z<K 0Vj  0\0 l^A0VD<K F/00 ,0 S(Kp|%%=* M0Ѝq[ --LM0 0 p K..&* -L M@P4K0`px $@ PPP00P0#S F00  $0 S@ Kp -L`M\,  0  \ |K ! BB/A?/A0(K B 0bT 1#QT ` |K1Sr @@r v T` Qr v T`v Z`ZK p. ;v W 0WW10SG*:*W @T>*: W VZ Zh0L S   dNP@ S@|KPd!1PPpW00P0#Sv 0S ,0KR*:00ZK .0R:E0a @S@E00 !E/00 ,0 Sp(KplF 0-LM 0@0 @P}K0 -0LM@P$0  0S 0 S =S00SR E0 0 $0!0S0,pPd$`K %P K -0LM,0 0= S S00SR \E0 0<Pj,@K  P ,0 `@,  ,0!0S0  P  00pW0b\PU@P  8`0S @@0 0p$K& -0LM`P@00 <  0S 0 S =S00SR D0 0]<fC 8 0 KP T00M HQ04@K40  40!0S0  P0 00Q@ 0bCpQ@P* 0S i@@ 0@0  80p 0P@P 00! 0S0 =S=00<0S< 0 (K& `MЍMЍMЍ p-L M@P`kP0fC @\000C S 0 WeKp -4L,M TK@KT0 P@ Ple/ud4@D0 D D R*0S0 |S :S00$  $@: @P#X0@0X0H K[pH0C<HPK (0@QH0 00@KH0 ,0@EH0@D K40PDl  @P4pH0 8#(3 H K0@)p2B, 00H0 800H K7@p8 40H 2KKN0CBK 0CL|8 LN B;` Tx ( X8 d\  }P U%PD%0S@ d  0P7 h< f8 ( 0 p P D8 R@ <8 @80C88 RppEP`P1  P.`(\8`%T~{Pd p P |xHx PPH(W:|+d8:Plğ0Sd02@ d @P(RdzT+|8H p0 SU!0U@E\S 0X@ U:;PfPVP^ dnz0fP@`XX d @T0#SS hPl(R PP0:S@lP@T80T8 T0S*.K B0 B0CL p( t8 x = =pPn @0S :S@DxptT(d8PPP uP(Rdz4pvU u0:DL8 DLX 4 0S :S08 i b0( 4 00SPG:S:08008 0(0ecX(0hZX;0f p.PVP^dy )f0f fpPXx `0H a@40( DP(RdyX8f`S0A0 P`V ?p 00 L\(p^p`Ypp ,0 S,h}(Kp'',ȟ4 -MLM,30(ß,0 $3$C0 <8 3R048 0@ S0.zP 2X "0S00f  gP BnK`F`F⌢{8h PP8Q(: +0P`8 P"0S00#3@ @P@Te1y1 @00P@Z yPS8(0 S8( U0U E\S 0U:;@h]P= 0hpP000S#S 8(81f/0Mz1 h 1 6NK@D@D Pࠟ(K0pxC0`KA PA@0pt@T 0"z@>l 40PS H0<( T> P,0 S,|(Kp''''ȟ'8  0-LM@P8h -LM 0  K/ K 0-LM,@0PSk0@Sm8 0-LM,@0PSY0@S[$8 -RQ3LMP@ :Q P*>W000@00= : 00S/0 R r 1S010pS0 `0 000zP`e t00S f p(V  0f0 0 0S p-LM(0`S.>@0P0-00Sz0 P@0  0(p@Pq 0 00 0@T_S <0@T_ R 00c@_00Sx -LMQp=W0 0 -M 0 S S@nЍ` `      @-@M0 0#@\LTЍDD*MA Q00  A0S 00Ѝ -LM4 0 -[à`8  @4pKP445(54(5(5(54(5(5(5(5(5(5(540#2>;?C0C,  4K2 グ4 0 0#2>;3Sa SC S- Sy'S- St4So S Sj Sj:SL Sb Sa^S\ S\: SW "SVH&S SQ 0 P!P1WWIXF4!W,1W? W< W8>32 0 00 0->400 2&0aPC E 00>  >3 0>3 S0 >01 >3 S00P@ UsЍ -LMp8 Q04 Q@0 0Aό  D0Zl` X00 X00LR,@P@ V00  V 00"U00P@T T 0  @Dʰ1U  XD x 00 000s03_X0S  V vd 0  0 _V00R08!SP X" x 0  0 _X00R0S U  V v 00  000s03_V0S PA?E0CS 0  0<04 80 Z\0 04  @\0(K -L MPp0 0A>#R R R >3>3>3 SR8  R R R R RR RWp0 0@0  000 DPP`I 0`P 0 `pw0 0`0  000 FP@IpP 0P  P00S0@P R@ 0rpE0 00  000 JP0 E0`0>3@ 0` 1>3@1>3"S@D0 @~ PP0 @<p 0 >0c"O 0 >0c"O0 @ P U/(KG- M,0@H`pIP>3Sg SD S. S'S. S5S S S} S=SW Su SvqSo Sq@ Sj "SkV&S Sf0X !1XX]YZX!XSXP XL>32 00 C 0 > 0>0 0 `0 S004S0``C/ 0>0 0 0 00$ P >3 0>3 S 000 0>0 0 01>3 S 0     0 0 0` V] Ѝ -LM8  0p 1>#R# R/ RR4 R R~ R&R8 RT |8WW 0RS8 WO 8WJ >32 0 0A pa0W0[ 0W6*0W0W0P -,*0 S)0H% W0 0W*0W S0 W Wr 0_R  0W * 0W0 * R0r 0_R 0W Wr 0 _R  !>3 !>3 S .Z00S\R 8W 0J000 Q>3S9 SF SM SS Sd S0>S4P "0st `@S dR 8 0dW  XP040 !0S   8  0P>3 $0 1p 1WA  >3 q 0c 8 P\ @>30 @C1>3@1 >3"S@D0 8 @P<0 1>3 S5 @>3@d_8 0 0 P0 0 @>3@d_8 `@ P 0 ~P0 0` p(K -LM8  0p 1>#R# R/ RR4 R R~ R&R8 RT |8WW 0RS8 WO 8WJ >32 0 0A pa0W0[ 0W6*0W0W0P -,*0 S)0H% W0 0W*0W S0 W Wr 0_R  0W * 0W0 * R0r 0_R 0W Wr 0 _R  !>3 !>3 S .Z00S\R 8W 0J000 Q>3S9 SF SM SS Sd S0>S4P "0st `@S dR 8 0dW  P040 !0S   8  0P>3 $0 1p 1WA  >3 q 0c 8 P\ @>30 @C1>3@1 >3"S@D0 8 @P<0 1>3 S5 @>3@d_8 0 0 P0 0 @>3@d_8 `@ P 0 ~P0 0` p(K -L MP< @0 Q`40(@08 4  V@ 000 0Aό@ @0Y|p Z00 Z00b,@`@ W00  W 008"88V00`@T @T0@ @D1V  ZD z 00 000s03_Z0S  W w 0  0 _W00R0S` Z" zP! 0  0 _Z00R0S 1V  W w 00 000s03_W0S `A?F0CS0@ @0@\00 08 00 n< YP  4d0 8_@ 40aO0(K -L MPp0 0A>#R R R >3>3>3 SR8  R R R R RR RWp0 0@0  000 DPP`I 0`P 0 `pw0 0`0  000 FP@IpP 0P  P00S0@P R@ 0rpE0 00  000 JP0 E0`0>3@ 0` 1>3@1>3"S@D0 @h PP0 @<p 0 >0c"O 0 >0c"O0 @ P U/(K -L|Mp 0 \  >R(00  p S$0 0    0 Y:<`V Ph@ 0R0@ U.P @PE Tʠp0 ` Xp 40 d \0 H0 T P @0 <0 80 T0AϠX0d  `Xl0l t P0tXpl|\ Vl d00 V`0d0],@P@ Wd00  W `0<U, d0P00@T d T 0  @Dh U  VD v\ 00 000s03_V0S  W w, 0  0 _W00R0SP V" v  0  0 _V00R0S U  W w+00  000s03_W0S X[A?E0CS 0d   6<>  X00S  0td  &`ZlRL  x\嫻HPH0S dPKL 0@PL00L0  ^H0Sf \0Sd0Dp\ \0S  \02  d0D0RH0S `0 dKL 0>LPH0SEH L0SH0S\ dKL 0>P`dPKL D T 0 0J@P 0 ( L``%PP" XL0`0`O/\ @P` d0D0T\02P`P`@T\PHP      0  =  ^*<`V @Pi 0R0@ UP @PE Tp@` Xp d \@ H@ T P ᥽P@ P d0D0 < 0 0D 80 0 0D 40 0 0D0 0  T04Y80<@x0 d0|  |pY00AϠ0 d@=d0 x/h P0d`Yx &hP  Wh 0 W`0,@UP@ Z0  Z `0``ş`%U00 P@T d T0 @D U  WD w 00 000s03_W0S  Z z$ 0  0ğ _Z00R0S P W" wx 0  0 _W00R0S <U  Z z( 00 000s03_Z0S SA?E0CS0d  0 Y00R0Sd0 |d0 xd |0 pNhL 0S y\ƹHĹ@¹Q H0S dKL 03@PL00L0  ^H0Sj \0Sd0Dሼ\ \0S0  \02  d0D0RH0S `0 dKL 0!LPH0S]H L0SH0S\i@g adKL 0PPL D T0dK H@P0 dK@ LPPPP" XL0`0`O/\ @P` d0D0T\02P`P`@T\PHP@ L0 SL0S(KeEc* M0-LM0 0 0@ PhK0M Ѝ/R 02 MЍmNA90 0MЍ 0M2 ЍmNA90(* --LM0 0  K -WMLMp0@P  C/$0 KN?K`5 8 4 0  PKⳀ0YnKⳀSKl0NFK|E E t d5 @P|P@$ 0R+n KpxhLMЍ*""*1 xB 02 #4xB 024=> 0&@-1@d4xB 02d @-M+Ѝ@4=> 0M Ѝ?X -LM KaC K -L MK  KP K -L MK  K}P K -QLM@ 0K00#0  '0p03T0S00#0K MЍF BB<*A 0-LM 0@PᤉP d0喉P8p8 (0?P88C -LM 0P`yPp h0"P X0ᰢ@ <0媢 0qtpC=P4M<P81#8181:P02410!0 < 8#" Ѝ- 0-Y+ ̌!0M0@  0Ѝ*\\* -02LM0@ D  p@t 0-T@  +T040 @ 4  z 3Z00S 0T0XSxS@p R 0T  ȟ 0X < 8 0ZP0 `00D S t1 !000+ W070c P%\!80V< U <0U08 V00 P00S .P"0`0 6#P o@40\00S Pu`D R \pG@p @ D0 (K -LM; K -LMK2K K -RQ3LM@`P :Q %P*.W000@@00'@$ 0,` 0(p S,0K80 040 0p 00 R r 1S018Kx80`0S%V 0`@ K p-0L$M0PQ`0 A0P P<@K h 0#200 00 R0@T 0 SkKpph -LMT0@K`P$0 p߯ ᓯ$ 0R k Kpt -MLM@lK, l p`P@ VKAQ+p ;$U eXW 0PQ | )K RV U PUo0 ONK@D@DV  U epPʵ-@ W -W@lKV ,0 S Wk(Kp 0-@ MPL 00K0 -- LM 0  -PLM\ p` PP@ldU  00$w}l  ]dntt=d YMЍl' -LM@P4\uTuTuTuhuhuhuTuTuTuTuTuTuuhuTuTuTuhuhuhuTuTuTuTuTuTuhuuuhu d R0 0D<4~ %-0 0 dr*(MЍy*As* -QLM ,0 (@ 0 0 @ 0$0 0 ,K>@K -LMp `Pf^P@YP 0S@W LP eP @TP f@ -LM 0 0P(WW*QQ* --LM0  0  KZZ* -PLM `h,00 -L M< K 0-LMPK@pWP@  R 0S0U Q@P 㷦PRW],PK0 -L M0 Fd K* -L M@ᒾ0 0 S00@ (0 0$0 00K 0 00 , h d0 R r 1S018 Kv$0@0S T K^||~* -3LM0D < @  8 8x8  0-X8 08  +X4 8 08 40 D q 3Q00S 0X 80XSxS 8 D R 0X 00D0 4D Q@Q@Qɯ 0M 00  !40`Sp 0QD 0@`bp0 000c00 @P00H S xO p000I W070cD PB\<40S W V T0U00P00S +@Q 5# @Q_U T T0U00P00S g+@Q"  5#@ _8080 @Q \8 @0 B< <(K=*= -p-1L]M0PC/0 `>KJK\1 0Q ,Q @T 0K 0 K P |  0 cKx1 1 4 p@ 1P|:P |P 0|1 00+ 00@ 0 ShKppB\*<<X*::T*: SMb0  Sc0  Sd0  S  Sl0  Ss0  S-0p0?0 0r0-00w0-0 00!=@S S-0  S ! Sx0S0s00 r0-00w0-0 00 \ \-0  \ 0\x0S0s00r0-00w0-0 00t \ \-0  \ @0\x0T0t0000 00Ѝ 0-LM@PCp PXMp Tl B U` p@ T8883@66***0@-RM@P \4, 0L 0lRQ@PЍ0M3P3 ,<<PPPPPPP```````ttttttttttttăԃA 10=009005001001,0010014#001001Hp0h00\00L00 <00 ,0(00L 0PЍ(^p 0-LM@P8P(008P008Tt\|QM R P000SЍMЍ 0-PLMP@   01S S  R 0^0A)T0 0 ^  RR11:008-PM Ѝ0S1 P P10:00Ѝ -PLM Q)T0 0 PM 0s3Ѝ -LM0S ( 0P ( 0 $ >0S@ !88S@ ::S ( T00@ 0lA?0 B<R<00  -LM@\`(0+Q`L RL \P %VP?0  P 0S 0S0 [ 0S0 X (T00&0 P|3Rp1p!0S?0\:\0l) P6;@ S:0VP0(^ -LMPP`&RZ 0S00S)0 R  d 0ypD pB P@ @@pT:6SR 0S00Sp@"(T00#  00S d 0Fp00 p00 P @pT X1:00 -LM`P4 80  'P00LXP=@Pp0K0QQ=  pP6 P@4 T/00SS0&Y p@  0K@t0K 0P0 T LP804 q ZU1e@:0 10(K 0-LM@PP㇯ᅯU@8//* -(LM"x H!X` P  h HU -LM,K2 2R (0 Sa ,0S]|2It" 890h2 A\ (084"#H<208#Xᷳ@ 2@ᝳ r X`iᨳ@ T 女 XZ!A 0S1h1 " P"-8KF8Kd0@0   S9001Q1 0@ s0.00 !@Q0 \ ( <@ 30B320 0 R0#@$@T0@@#K(/u(y(((((b(*M 0LS\\ 񟗕<dܑH\Q0000aQ@ 7Q 0Q'*$QH -Q00 QK@MQ EQE7\Q =rQ fQ, nQ bQ8tQ" 3 03:vQ0G00A00000 0 00600 0 0 00"-Q0 ^Q0 0000?Q0000 0A0S010000A0S0001000 Ѝ -LM0p`@(K(0  0DP  @@00 PU( K0-P@Pg K -0LR M p`C@-K4K4  C  0P ȓT-0[505@ T-0[505@T00ĕPU-K4 K0PT-0[505@T00ĕg(K@-AM@0gS -S0 XS1 +S50oS uS0=#80  0 30100  0301000T 0ЍI@@-gQM@  =Q +Q -QXQ1 oQ uQ, 0R0- 0+\ 00\00  00  00000+T00 -T00 =T000Ѝ -L(M@T$ j8@K04K 40 `` XcPz 0`00C S<` P0`@ ( 0K p00`0S>0S ᶬ$ "00\ U@1:`ׯ@PP <0H%=i0 0Gp0gS aSoS uS ~p'}C~pp +RL -R=R {|$ 0LD0=\0D0 H |0sS gS# XS~oS rSyuS :wS xSqIW  W 0 |ꒀIX U:@⌡ @ d@P 0f0 D P`<0L PLH +Q00R0D=QSD  U:@⁡@ =@P\ 0f0 D P`<XH0 PH U:@  ₡ @ "@PA 0f0 D P`< L0PGXLD =QRLD0=\0 UD0 :@⁡@ @P 0f0 D P`<L0 PHQ! U:@  ₁@ @Pᰫ Y0f0 DP`<H0X jPIH -0S ,SpX+-0S2 `0+S -SXS@0-S0  @ +S0  @XS00T@p`Qp`\p` (K -1LM0`p0  P@t 0-T@ +T@ v 3V00S 0T0XSxS@`P R 0T ``㽯㩯00D S t 000 W070 cR\ Q00 R00S!! ""00@\000 SaR \00pEp(KG-1M0 `p00B Sn0R  XRxR   P00B@@ S<, Е^ Q r 0D A0a00c ƒ.R`VC  R Q;r9 06 0mC10S%ꠠt 8\)*0Š$\"*0S R<8\0SP R<84 Z ,< $8 #$,, Ѝ -LMKyP K** -QLMP`pPp`pQ00 g1@&GW1A* -L M K$$*M 0ЍQ0M  Ѝ@-\QM@  @Q*Q?Q [Q#Q p 3000#"10# Q00S10# Q00S"20# Q00S  0A QSp 2000 \Q@S Q Q# Q> JQ QF& Q*  Q Q>*0\  n00\  r00m0\  b00\  a00\  v00\  t00\  f00\  s0\00 L0 R00000Ε< P   ?Q*Q #Q[Q \0010"#0 000 0@\00M00| `0000  0^  Q?0@00-  00Ѝ p-LMP`@00 S  e0x -LM@pP`T0PEU0 @U 00g0 -LM8 `8#1!0#  "@0 1K Pp<0 @ D W\Q  AQ*Q?Q [Q#Q q 000 <0 Q00S@0 Q00S&20# Q00S   0A QSq 000 @\Q@ T@25p#*p01K D0pc@ T1K ? HPX HQ U:8\000 S@1pK0ggP0S i(K*bb** M0-LM0 0 0@ PMXK0* -LM KP Kwt@MЍ⺚MЍMЍMЍ -LM K  Kvt -0-L MP0U0 @0 0 0Q a0Na0 |P@T( ,K K$0K$ @, @mP 000(   K0(t=0P*==L*aaH*D*@*pM L0000 P40 P000Ѝdh0 S0M00Ѝ0 -@LM $$ R*00 C R00T0SQ00T0S  @-0P`p @M 00000l0P20C^  00C 0Ѝ0S M1>3 01Ѝ p-LM0@S`x  DPP x` Px p-LM0@S`P 0S0?0 P  0 1 x -LM` R*P*0S0]SY`pPhəP0Sp@T U?T 0-LM @R#3+ R!*0S*0[S.Q00 PR *0S*0.S0]S00 8 8 -LM@ 0SP* rP &  iP ^000 `0 00Vp'@@ P= 0!0峩P0/\ 0 1#"0 "\00g ᖰ0Q  R V001@B#"A2A` B 0V 0000@M0@0H0 @o R*0^S00 R*0]S 00 ]00]00]0 -S00 -00-00-00-S [SR: {0:S =Sw 0S0!#M+00-S]SF R*q Ɵ000ujꨘP0S p@ T $0 000000Pp @P@ P㻥 @  @  g 00S R!#+ R*0S*0:S0]S. ] 0S0!#+00-S]S =Y 0000 R!#+ R *0S*0=S0]S00/l pR*0-SQ*0]S -P00W@ @ 0000000SQ*0]S  R*-S0]S  -00-00-00 R*0]S  \0Sb 0 0h@Cp0 t 000 'P 000000@DT Y 00C  0N@@000`00^00  00 00 0C0p 0 0P\ 0 0PWo 0@0S00T0S 0 0 00Q\ \ @T:`0  bB"o.~$hp p-L KM0P0^0 0K 00KS0`0K 0@0KP`Kp -LM0` @8P pw 0000 lP #0KP 0]0@ "0K0#pK!0Kn@P 0S04  4K -LM`RP@p P 0!ᷭ000 -LMP\`@ 0 q$0S0$0L0S0L0 Q   fA! B⛮ 0p -LMP`@p0 ST TW0 W000Stꈻ           ܼ`  f00   fU  f," L B a#  .@0 f|  f8  f" / B a  & HpG`@  f0W  fi5@DpG/@D`vi -L M04  \@0 :P0^S00  (00(0 ,00,0\Qp0P!#c+0 0|4W_ .W *W|w[W JWwlğ W >G0CSnNL$WjF00  e a+^ 70D  D 0DP U 1  R *0S*0\S0)S \) U 1H  | R *0S*0\S0)S00% !<0`CQH0S  _ H  V0HU  7 R*0*Q 0 0 hv  h2   h0j  h&PSw*\Qu0{Sr00 `R*0,S0S0 *000C SVP \P 0` R *0S *0\S0}S0 0  R*Q*0\S0}S f c  P R *P*0 S04 SQ 0 0C0 (00(0 0000000 S(Ko:$W (K){} - LM@0 8 G ?U pe +U*U`*$UM (U.U~\^U7 [Ud \Uvd{Uk |UqHR!#+0D  D 0DP U 1  f R*0)S ) U 1H  U R*0)S I   G (00(0 ,00,09 9 (00(0 00000+ #00P   R!#+00 R*000C S  R*P*0E0?US{U0S*000C S0Q0 y+U *U?U' {UzB 0  g  g   g0   g    g0  gT 0  g  g  g " B a|  5 `R*0,S00000C S\ %VP P 0 R*0}S00  R*0}S  Q* *0B0?RS{R 0S*000C S 0S*P|U 8 U0 S R/*0|S,00 0R    j 0m 4 0   i&04 aC0" 40 4  a  i (Ko 0 R (K -0LxMS` 倀0  PPa *)ጪP"@P % 00 0 P  % 0K0 @ `   P(0 PHPP0|P40 pPP P(P,P0P3S S SS S SP`B B>3!>3S S "S (00(0@0P@P >3S@P >P<@@  >3S BR000S   0>3S SPASQ(00(0d0L0D 0 L0 @0(0Kb0S"p(KEe p-RQ3LMP@`:Q 㚣P:xh# 00x -LM l0R @T T0R000PݞPڞPמ<PԞhўeE8* -PLM 0@ 0 @ K0,K0 KP0@,0 (@ ,K --LM0 0 -H0LM@`P4 0MT  3Xtt= - LM0 K  dp K33* * * -LMp`@ P@D`@0c%T -L8M\$ p`<@ 弐P @ PU@V@K 02R R @ RV@K 2 z` 2 lWP m $0 S S KpT`TBto* -0CLsM@00 `V_ |1R 0R 10CRG@P! T*0S TG  00P@0PS> 0VS+검VX7 0 pSY@0U 0@ S 1Pp0 SU0Sp#@UpPh0U W 0VS ` TPF:0Vs3(K?*!: -]M0P P0ЍM00P  R*Ѝ p-LM @R 0`Q0PSb`V*^000SP 01PSR0UM00x -LMPq@ |   t00  t%`pDAP P) 0  0S 0S0@V`P 00P 0 0!0 3P  pR 0S '0SpZ 0p < 0P  `R 0S &0S`ZX`0 0 0l 0  R:0 0F@0l@౟AP<  00l h 001  0S0 i@00ᕟ`P  $P ᡜ0 0a0 @0A 0  00 0S @V  (K -MLMğ  ` ,  P8 @T g@ 0  (0 S00:`p/0@@0BNK@D@D+P 0K@A ( ,P 0* 0U/S' 8: S S!BNK@D@D+P 0K@A ,i'P 8: S0 S/ 000>K(0Cp   R0B0S/S@@Q P PU0E0/S |(U@@K0@S@L+4+VP  0K@@@ $%P0Sm B^KPEPE+=Pb@0PY 0VW 0p@ ! ( = 0  d0S00p0/ 00 10.S0.S%@ 8T*0 S0 T:p @0vP  D8` pP (P 0@  $ppp ,0 SQ(Kpw? -LM:K M00 K~S4 G 0 D K@K@0^@`P.K0A@ Q p 0S /S000S PP K@@⚜P 0FV 0`SR*0S0>K0C0C K00nK`F`FKP8`?WPu [W *W0u@!TP0S ]HP!TpPEr!T#3@ 0p@[W:0:S7P:1P1 0]S.0e4c 0^^  R*0S `PU  Ÿ0l10 0p[W@0 0 ]W 000-S 0]S dŸ 00@0]Sp 08< 0P` 0< 0 *K 08 <V 0 V1R 10pWp1p(K0S KLL K.KK(@AK@A4 0 PO 0 P < SEK:K4 00 > P;Ipi - @ಜ`P0 AP 000000P  0$ 00 00@QP 0 D0$(KL[! :-]?** -MLM0@{S0}S0Sv {>Pn >K0C0C@@C@Tp0 @P` [S   0]SSSP {S` }SVゞKIIB `FP0SK@@>0[S ,S2{S }S-   0]SSS@ `V`FV0 CQ 0:0S0 P  00 @T (K -LMt`,KPp@ PN 0 000 <Q 0p> R;q9 r7 10aR3 K @ 0\`.KS   0R\S0@0Q09 B0LP*0 S L00K, K @ K MЍeMЍ`p 0 M00Ѝp 0 M00Ѝ P PMЍp 0 M00 Ѝp 0 M00Ѝp 0 M00Ѝp 0 M00Ѝp 0 M00Ѝp 0 M00Ѝp 0 M00Ѝp 0 M00Ѝp 0 M00DЍMPЍMЍM @ЍM ЍM QA 0SbЍ -LM@000@00 0 R10K' -LlM Q 0 000?/0 S @?P046S d  X  0㌀ 刐 P0  H [K4 K00KkPT Q ):**R K46oB`FX 4 000C Q@0a3 A 0a8CnAج`FAX h>壁d.d>`.`>封@P}L.L>݂ 0ᤁ@Pl 0iP l} 0hPlAl l R0h0 l=K1 oiPlࠣA h l h 00l0fS0SaBC` U|0 U| E` E^` ` \ x |0l0ll|0 x \  R @R0@0C0 Ő@\ <dt p d # d 0  `t  p d 0d0 \ ` t p d l 0`V0Ft` p0 `t` 5PH  t\00S2 l^+; NB1`p;K #@@ *P`tT p  0 "l @bT ; 1 K DbP@p` @PV ph0S :  htP00\00S@ P p^  P:ځlp A< 8 t0l80 < | 0ȁ :呀8`^ p@ UA 9 r 0p`sgP8 L p 1chPd8Qd)1A 0 d勀 0RHD ;@| 0C0@ 0@`PgPl0<0 L pHl P H100<00l0 T VLahPL  ZLLH@ P L L g@P L0  ! 1DhPTPTfL`g@P 0SPTfP ,K @P6,0 R% 0SMR GR KR R kR mR gR`PA`VK 5` @ `[F`Q@Pڌ% TpLX`0XX `兕P0P00(@$K(K(^1 --LM00  K 0-@0LM@P ,,Z:T ע  8htt=-p0M0S 0 CR 0R0 SЍ9 Ѝ 00Ѝ -2LIM0TK(0 `@"QP:KPP50z WeV? ͔ 0Pˌ@P 0lp h0 l0Kd0 0`0 dK0\ K PPX 0FR\嬔/@P*1 0R& 0R" R'"" ዔ #PP @1R <1R  81R pFQK`P (0 Sn@$Kp 0-LM@HHA/0#PP PA/c@P P@81155* 0-LMP@ $K㲔 E0R$@ 0 0 004003200 $K0 K⹻P0K0\88ڽ*[[ֽ*QM  ;Ѝ -RL MP` ?R0Spf10S M00P @0PC0 000 R r0 11@ppp2NZ@ ,K0 K3NV@,` X  Pp,0Vp `pX@00000C 00 0S ,0VKZ@0@`0  f00 ` 00STN$K0iiO*99K*RM 0S0S0  R00ЍEE3*M&"R!" Q\R0"S0Q0 #Rt0 00 R R R L0 000 S S S  R00LЍ3 -LM(@Pc;003 -LM0@P <<P3ȟ  -LMC0SP S !P  {P0t00CS00 Ӥ01 R r  r 0R#R S3 k0@S0 d0@S0\@2b P  {P  r 000 00T {P  r 000 00 0] {P  r 000 00 {P  r 000 00 {P  r 000 00\ {P  r 000 00  s{P  r 000 0 0 c{P =Q {P@pWyx00#S #W0 S SHP@0 S0zP0  0 3 223,P:4< D 0-LMPzP @P8yyû*H0M0S 00CS0Ѝ1Ѝ00Ѝ0M0CS 0Ѝ 00Ѝ 0-\0LM0@S00CS00PӤ0P00S8 -LM0 @R r 1S01<P0 0C0 MЍ`0P M 0ЍMЍ=0MЍ= -LM0  = K* p-L M$@K`Pj0 zKpL --LM0 0 K 0P M 0Ѝ 0-LMP$KI-PU$0K$KK0@-0@0@$0M00 00000Ѝ#EgvT2ܺ -LDM@ lK0 pl( 0 @ 00# h ,0*0 0#da0"00# `@dȟ0! 00#\@Dlŀ0 0 0#X@$(0, 00# T@ b* 0.0 0#P@0"00# L@ǟ`0! 00#H@̀0 0 0#D0n)+C0,0O B0#  @`G' 0.@0 0#@<@@dE0"00# 8 0$00#4`ǟ` 0! 00#0 ǀ0 0 0#nh@& 0. 0 0#  -T@0" 00#@@|0!00# ` l@\Ɵ0 00#lƀX@<0,00#D@& 0. 0 0#  +0@0" 00#a\@0!00# `H@ş0 00#̀0,00#`@% 0. 0 0#  b)L`E0"@ 00#@@dF8@0$00# d ş0! 00#ˁP0,00#n$ P.0 0#  X0b&P%L@`0"0# ğ@0 0 0#lȁ0! 0#h@d$0, 0#  H\0b. 0.0#P@, 0"0# ğD0a 0 0#8@ā0! 0##l0n 0,0#`@  * 0.0#T0`0"0#H@ ß0 0#ll΁0! 0#P#00 0,0#d@ 4 b( 0.0#l@000# P@Ÿa0 00#lˁ000#X@"0 0 0#  % 000#`@|` 000# D@\Ÿa0 00#h@<ȁ000#L@"0 0 0#  0Ab- 0@00#@@TQdK0P00# PP8aX0`00#``\e000#@|` 0 00#d \lˀ000#H@<1  0p0  "0u 0 0(KxjVp $ν|*ƇGF0FؘiD\"kqCy!Ib%@@QZ^&Ƕ]/SD!7Ç ZEogL*B9q"am 8D꾤K`Kp~('09|eVD")*C#9Y[e }]O~o,CN~S5:*ӆ -LMP`1>?0@@N10@j@Rp0@P:Z @  ᜎ `phP[@P@pG?W W   o膎 -L(M< 1>?0@0c@ S80 D ,T`p@P  @00#:k0cS:UV@ 0o`p -LpMoP0p U<0  TPᏎ&P@ ᇎ vPဎ>0@H0 D@ 8p 8 0 S S*S? +S -S S x 0x0 080 0S,080 @x@ 8 00S| 00XS xS!x@<0K8K@ K@Q0S@ Ss SV x < R =PKS<V0HKPK@ QC8 080 00S S; | 8 T  t Qt@Ւ4$t@ 00@Q:*080 8/P00@9P0P M0SI RQ 080   @@ 68 @080 0P 10@S 28 T @0P@ 0 PPt0t R  \BSt  0ӓ"t R 0ӓ*@8 080 00@ S00 ᄐ @EPeP:|0 y 8p 8 0+S -S```080 00@ S8 080 0P 10@S8P0@ <,808 /P00@9Pڨ*0e\S 00V0c08p 0XC| R9NP IP4iP nP/8@K$RP( 800C 80 RP80080 H:D0 08@KRP 800(S P KSPL046D0 P0H0 L0H0 D0 H0x0 8p DX``Q0it X0 VH D 891H C m@ Pԗ 0lH D X,?PP)X@T T8HK؄1 PhX0\ʤHHK1 mX 0eA mH D X0s`(X@0##HK lX0f @TW  8HK1 mH D 0 MSl p h d (8D0 0H0 lQ <BUp@Uh>UlS\ < 00`Ws80V:\ <0000D b(KM. ".Q  .RA Aa0A \.\A Aa0ARS 00A S  RS 00A-Q S _Q  QЍ0M*S0.S S ЍЍ-0MS]S.R00 S Q\R !R!0B.RЍЍM]R0S! CЍ0MЍ0 <8MЍ <M 0Ѝ <0 Ġ 8M0Ѝ -RLM$ 0 0 -LM@@{T p-LM PR @T@{ <0S{$0``PP{{}{vP Px@t@x -LM$0`pPP}P@ 0(P004$0@L0000H0 L 0-LM @<Q *P?{00>?0 0 a~PPP P.{ P8 -LpM$0@0`KH`  bP p PP 0PAp P 00l ' 010  P%L 4,00.R80M0S L040. S  ,0S00S40\0   <0S0 P 0  P000K -LpM$@pP(R` `PP KPP4 0R, 0R0 0R P00%PW@>@K -LM0@R`p (}PPPP}zPP0P0 0p 0^10 -L4M\ PP \ Rl04O00 0p\ R0@0  $ 0S 0@ <0  8 00 c@  < @0\ @S@R  0X H0 L0  0 WP0L H0  X  00404L OH $000S/S$0L 0/  4 <0sD0 D 0 D ZP 0  piP 0 T 8 $0  0.S0S 040. S  h@P Q&: pP T`y0 04$0 :0 $0` W $0 04  80 8 0piD0<00000 S$0*y0  $$0 :0 $0?00L0S @ R 04 0L 40 0,@ R <0S P P $0 0L00$$0L 0( 0 4  7@0S0@8PS@  B@ 00  ST00@ @P T@  P |`P]fQ00c00 RL00  Q00c000S0 <0LS$0 0P RY400C40 4 00H0S# \ P0SR<0S $0P 09PP  $$0 :0 $0P0SX R00 04 0P SR0(KoP000  8 R 0(KЋ -pQ00 W@@LMTP 00;`@$0 4D T1 T.P  W$0p:$0<0pS00/S $0` A\ q@P5P 40 0-LM@P̂UP10@S8 -LM`pV $0*0Q46 Q4 0C8S *P$0 $P4֡ 04ơG0 $04SFQ $@ 4 0R 4 P 0004P   :$0u000S  0KP 4 04  000 R P$0  `00P0`V\ w<0S($0@pP$0`( L$  嗂/1P P0S @!P ⅂(P04 00 94S S P$0  P4֡ 04ơ0 $0040$  0R/S@/00(  LO Pw<0sw``60$ `<0S$0$4 $0  P s@ o@    L0P $0P:$00`S004P`Ћ -0L M@p E 04 0{(yPP4P u 4P p40$@4 0$0  P @P^ PV 0`<0'iP00E @P? L000<0$  P $W``Vp00`@0` 0@  ATWY U` sP `0 $$0d P$00$0Y v  vvv040 4(K(^ p-LMXP0@S$0` 0v0S$0S$vxhHMЍ -LpMKp`P'0: S P00(ryP P;80@000gyP xvP 0@p$`0 @``0@PK 0-LM@pP  00R00S VP 00PP 0^  8 0-LMp@P PP 8-SM " 0\0  0\0 Ѝ -LM`Pp@P PP@@ PP@@ -L` M <0 0f8 D H0 D R0V000  0 80S'# f f40 @ 00S 00  00@ @p@0TP< P40Z* @ p8 0R㖃' (R0B▃*8 1<0P  <0d{ d p<0 eu <0op00S 00  00L8 @0B▃*p P 00S 00  009p@T/< Pf 00S 00   00  fH  0TP<0P4 00  00Pf0hpgS08S㖉) c00 0j PefQ!Q 00 aWy <0$U y e8 (0 R (K -0LM`P0p R p  P   @!R  000lR0 0  0  00@ 0-LM8P0@S$ɀK0S$ŀK0&&"*LL*oo*G-HM@pP0 #2b P"3 UpG1?7 (1 L0LLLWW& 0 00000 R0 S` h.22 1 W00&#!0=00=00P U03107:Ѝ -`LM@pPUq ("000L=QN fP| UCtyyyHzT P< Vp*1 P0c104T Vf*!0 bB2 Q05:PX` PT VQ*P!0 bB1 Q05:PC`P T V<*0 0c  `PQ/ U-L{L{zz0000r 0  PR=R  r 0  PRTV*0SU ` p-LM`PPp@0S@ PT  0Rxxdd* 0-LM@P PU0. @ }@P0/S P /U l0@P  Q0r/S0Pa U:e@?00@ }008P3 * -?0$ LM0@S`0Slp0Sjq00rPZ 040 }$@ ed7`7P7 -?0$ LM0@S`0Slp0Sr00sPZ 040 |$@ Nex@t@d@Z*))V*0 M!ЍI -LM@R$  ,  `0A XK00C 1 儠K─K0 h!0!S @PpP P " ! 00P 8P L00L0 60[S0 60K Q Q , |L0 0, L0 |x00x0 00 0 \3 K0  K㼣 K㸣,K 㴣 K㰣 K㬣 K㨣 K㤣 K⠣T| zA p ! # T *!R00K [r d000 1S R@00 ӑ KW [R 00 ӑ K0[0K 3"P  0[ S S00L0  8 , |P  }p0ST!X0S K >K :K 6K 2K .K *K &K "K 1S }1S T4P@!TU!R 10 qQ P@p ,0 S(c'(KpI=~dh^M 0ЍxIP0M00ӑЍdP0M00ӑЍh 0-0L0M0P0 @ DK<00<0 D KQ Q QT L;@d00 0 S 'K0pt,t,t,D* -LM`P @0S 3pP PUP #P -LM 0PJd 0-LMPP "00@q@@q @@8MЍd -L M0`SPP#P 0K4K)#@P 4 R 0#S S 00S# S0B40 4 6P0d40 4tPPk 4 z40%P@@0 S SPP h%pPP  %00S ?R0Sp 0S9sP PW@Pp)+ S S@" 0@1UsP@h @00000c0P@L%P p@T 0S0 0 (KDȟ| -LMV0PdJ 0-LM0@SP$$"P# 00 08DȟMЍd 﨣*((藍**##*''* *$MЍ --LM0 0  K p-`0LM@`PL HT  ,v, <2 ' xhtt=d Y_*MM[* p-0LM0PS{0@0S @T00S{Qx0 d0 0SX{! `K P pP0S ou KplJ p-LM0 0, rSwS@T `00{ r 0S`t (K9P `10S{p@ P :10S{($$" `xoUd1XQ@0S0@T0 0rS $@( T $(P Ḻ(,0 m~00SM{0 0rS(`$0$`( 0LP` 0@0S81{4 000 S *{KplJXX -0LM  -BML M20PP ,0 T$ 0S /naPP0 L4 04 J\xX2@P@Ay00 c]0   0| ;aBKJJLT `0SPa )yP &y0 Sp1KH4 0D4 1A84  0@d 0@S/ L$ P$1!S 0 c@] P40T$HBNK@D@D `PL$R s 0p0Sl00 ,0 S,$(KpdrX 0M ЍA --0LM00  00  0  0S10 c]6 00 00 0  0S0 0 S # Kp --0LM00  00  0  0S10 c] 0000 0  0S0 00  0 S # Kp --0LM00  00  0  0S10 c] 0000 0  0S000 z 0 S\# Kp! !\x p- PLM@ 0 Km `P(  JPP" R 00R 00)' P 8# 0 <040@$0,0 ,0$0(0 0 0 Kp`aa`` 0-LM,@0PS0@S@8RM 0S0 0A R RЍ!!*;*; -LaM ``0 pqP@qP@T iqA \00 c 1   ^@P(K -L MDCDß`8 < 4 =@ D0 [_Ppf5wp0@P0H0 0 * _P"$wP " 0Q0W0Sz  H R @0 0R 0R 0S 0 P@T00P00S 20Sm <0:Si  dzO @ X B R00S 10S <0:S 0|!S 00<00-0BS QP1 R408!,1 10S410S000S <0:S0 S 0000  B < 0:S:?0S 4p0 L d00S <0:S\H0? D R0 S(Ktp (xxPt -LMR0 4 80 m E0S5  0 s 50S uP -R d50S+RL-R+R0S858%00,% u0< 0S %00S`04V4$P4u0D @40 0@d0d0@t@0|$`0[40lA@-QPU+^P'<44,$Q0 4 `@  Pu` @t  40[0 e0b#0000003pw #0s`U l-U0SL0S@H3 t0  4010 g0b00`0"8Q# 204 1R -Q 00:Q ]P48 08p`N\rP@`:V@ -V0S]P-V0Sw 0S!00010S 0:S1`?`e8 0R0WV0S" 0;S0Sh!000S4010d1 X1R0248 0`$!1 ;0:S 0S4 000/000S@0:S 000S04 100 0S0  0:S1p0`0:S:`?`(D 80  `(Kt|x|(^px -L Mm K -L Mb K -L M 0W K -pLMP 20S# 10S"0 R r 1S01010Sc -P0000000 P0 p0S$@0P mP 00/0;0B0 3A03@03 ꇠ Hm`P @ s00@`00 0B0B0000 0Q0 R0RS0B0 0@0< 800 00B0 B00SкP0MЍ -0L M @ R R R0ᓗ0 P xh h0s R@0@0@ 4s( 0000Kl,J<, -LMh+t 0-LM0@$K$ R10t!qsp PLH1$ PL`R5````(Ĥ`(```````` o 0 Hsp P# @`R01S 0 4s |  0(spP,T,[PD@ sK0J0Xh^KO -LMhO+tP0 !MЍ Yt -LM@P 00O p-LpM`@T  lK1PP D @0  0: S O0 0 x P KpOȟ -AMLMt3B~KpG0`c,0 pGIJP3P @P <PPC, qP 0#S  g bP@ [P  @[2PŸ MP 1 w0DT` >P 1 h04S|0 -P 0#S  #  P @ @@P 1 90DT| P 1 *04St + Z 4 Q@0vrP'ZP0  ZP0  ZP0  ZPh0 zZPP< d @T4 ,0 SD(KpOOK|X\d_$8L 0-LM@P KZP8PP8O 0-LM@P 4ZP8PP8O -80LM0SP P OO -LM@QPʑ00J,10SG0 R r 1S01D p00S P W)0P+ 2'0`X@1@!  U-0P d  @f 0d  p00 0 d0ppX0000S 0@-PM@P0 0 ^ 0\^0 P0SS00@0ASЍ0 MЍO M-L(M\PK0p@0L0 0 X0 WP`'0K <00PT` 0SPQ0"S XWuv0"S V U@@@@ R( K1(0 0( K1T$0P`0(K` -3LM0D < @  8 8x8  0-X8 08  +X4 8 08 40 D q 3Q00S 0X 80XSxS 8 D R 0X 00D0 4D Q@Q@Qɯ 0 00  H40`Sp 0QD 0@`bp0 000c00 @P00H S xO p000I W070cD PB\<40S W V T0U00P00S @Q 5# @Q_U T T0U00P00S @Q"  5#@ _8080 @Q \8 @0 B< <(K p-QLM@P`p`S@rP$K 0dHV $0K0s@$0 @ $KKp__+*vv'* p- 1L MP8K8 7 K$ K0 0 )oѭp` P $K o$ $Ko0 8K[P(K@  `$Kov(KpM0Ѝ 0-LMPo@Lh0P@ @o87Ę*7 -LM@$_q@P0 @O -LMp`᭘@T xP JqP00 @ťP墘-@xo V*(嘘"n 员OO 0-LMX! 0P冘P !@PP@T00P8OOTTb*^*??Z*V* -LM0 0 K -Q0L M4 0R004 000 040`0S+ Pp @;WP 㕒"0S 0WP pt0 2"0S Z0 00 X0 00PU0K3`P(KP -LMP g@P` |` ᨀ,pP 0Rp„S0C \0 ^00@-@MP 0SS 00B SЍ77ﶗ* -LMP0A Q@"` p0 0 B0&&hP00R00S 0/S9SV00 V0S` 0-LMPPhdEAh`88 -LM`AHnp  4PPP0U`VP -SLMp8  +; ; ; 圛.q 0000 00 r \˟00088 T8 %Q 8 P  ]P8080 %0AUS񟗶XLdȿD(|4LLĽt4\||`ܽP00 Q00  ZUPWU S0Q`ɟ (UK0H0#UE040U?0 0U90 0U300 0- 0' 0 -P0 U4P (1@Tm0` ?P AIm 5P0 40 4PUU P 00 0'U4P ǟ0h@+m0` P 8@ m P0 40 4P U U P 00 000 W 0K4Kc0jP 40d 0I0K  0[P 00U 0K0U0K 0U0K 6>P 00C0000 0K;00K 0(P 00C000Ux`@l0 P0 ShP@l P\0 SY S 0000 0 Q0K=0E K0K4K' F0K0P@ =0K4K 0P6 4f000K4K "0 000 000C S0K4K 50 0K4K4P 40dğv>C 0C 000z 80Kc0PC0@@ TP0 S 04K$P40<<0 0 q ß000 GQ0 +Q7 -Q4UQ ZQ  0 MS0 00 TR00  SB @4KL#00 @P 04K0(#@P 0 00 <00L CA0C0  RS000 0 P4 000L Q 0 4@ R:\ 0 4 R@R Rd f;P4  U ~0 00 r 0008Q1 r 11QDRd0 0v>C 0C0!000t1@R 0vn `dePep3 0ST10 2) 00C0040 0!4 004 0R0 0% PF@{F@e@@eeP0000 c 0 S 1X0 00(KlOOOn'  M0Ѝ0@-LMP@P 0 0S 0Q0cЍ0p@-`RMP@ L 00S0\0cR ^Ѝp *P 0MЍMЍ -LM$0!  0-LM$@P`P|`$z`Pw`8ht` p-LM$`4PK@.0zAP <P8;00000S4KKp -L@M$@ 0PR/ 0`00dpKH` 8` 0LKH JP 4K40L0 d` `0 :Pd@K0LKd0 /`00S$K -LM`Z$P@K 0P _00 @pP@ pu$K -LwM 2 0(, 2 bP||"`QbPP`XP"_`E@1@! 0$P@ 0@rKT~K 0 oK . ء ԑ KP 100@bPx!oK ;i 10S~K__` ,0 S,(KptԺ -0LbM0K 0 0p" @!@KtpU^K`BkP|00 PNK0 0 ^0 K@Z 0 SKp -LM   K 0K $p K 0-0LIM0 P0  0SN_K8! ai04 01 0,1 J_K EOK@D @QiNKH0 a0!0 00 0RK0pd^ 0-L MP@P  P PP  KP , 0PK0(H -LMp`@P P U@P -LMP`@7P< pW2cW0S1T0S S+W) PlaP@ P h`P0P0UV @#3`:0S`^PPtM ЍmGϠ1*MPT|tld|xtplhd`\ X TPLHD@Ѝ4Pht$<XH++s*- M P0P A0A 0B $0P P0A A0P P 0A A 0P P 0A A 0P P 0A A0P P0A A0P P0A A0P P0A A0P P0A AL|ЍKK3* p-LM`P @T0. @h@P 0/S @P0/SP|0/T/ . @  @P0/S 0fP U:@?00@ 6g00xO -0L4M`p8KP K@P8@ 4P ,` (p 00 $0 P <0S D0K 0@D0 @@ DKUUː* --LM00  K p-LM@PLP0` HH4 T  ,t, vE xh$ tt=d Y -LMp$K!P$`@@  PU 0SOP@ @TT00KMЍ] -0L@MH0 0 D0 0X 80 ` @ < 4 HK0pK` 0``"p@z 0Q X`PP}  0``q"p@0XP S !XP X00Pp`N0SI0 S SD 00`@ 0` R000 0 Pp0V. @T 0夀' 0 X2 0S000R`  R ` X< R000\RP P \p`0 Q:00S`@@X0Q_ P\ Xb\ f\0Xp`PPP T 0S0 S3 S 00 PPᶠ0@0 Pe0P  ` e0S0@@@@P 0 B 0R #P0 e`00T QZP RL ~e 0LG T0 0 0  \0 0S0  P  PP 00S5 0S0@@U U U ` `Q e ``  |e`P U00L0p00X 0Wk:[\0HS:00\ ` `0@@\[(K* -2MLMD4@0TP,0 ``0V  ,  w^P 0`< 0/S0000S BK@@+Mp@P ,R l[`d+MleBK@@+Mp,#XW00< >K0C< >K,BK0C0CI B< I0F, < /MP PP"@iT  d( K0Z (Cpd  e,0 /S \2Xm/00  ,8[Sr (MPm M@P Xf<@/>0f@]+M!PIKA@P 0STZR<0U<: SA, R>01L!PP>( K0LC,<[/S@ X<@/0@fZ ( KAP9 P4 PP+ P="P- P P $% P!PP P2P /P 0P 1P 8P5P 3P 4P9P+\P+[PIP CP @P APFP DP EPBPP  NPMPKP LPXPRPYP ZPqPoPfP dPr. mPlPgP kPz|PvPtPsP 3P }Pl3P 0P 04 040 0DKPDKpq QpDKPDKpq Qp W0fQq Po:"~040 0]040 0Y!t4 4K# K0K0 >pW PT Q @㽰 @ P U;J,QA/O4 0 4K( K0K p0 (@K0 ?:%@f/K0 UϠ4K0K 4@ p!&040 0b 0000 K4K0Kp   L @  +!+K0, i @-0@0@,0M0$00 00000 0Ѝ#EgÉܺvT2 -/LM0 @ lK,0 a1Ahp PaA ad`lnDi4 i80/0%1  d0 ac 00#l1 p `0(p0 $nd-c Hc1@l ` 0(T` 0\,@1 P\0P Q\clD0%X0H@aqbacT`Οc< Ȑ X0' &@0 P01 T0Q T "aDc, 0% P0H͌@`lcTc< 0* (0X A1 L0 PL|  "d Qc,lDnad@͟H0% &@ H0  "aq@cTc?1 0 @?Rp0@`P@Pl@  V[@@P?0S@@:  eoB[ -0L M0P@ 0 (`K  !f@Tx ~op` 0 P Qn/B(K 0 SKp8,0 0-LMP@!1 1 !320Q\ 8hm[$MЍPP醙* --LM0 0 -LM@Pp-T0` LLT  0h0$W&   tt=d Y --LM0 0 wh Khhm*i*0MS  0S0 0S Ѝ PM Q 10C0 Ѝ -LMQp' %R`@@PU@ UP@  P 0Pg0 B T:00 -LMQPp R`@@ P 0S0B e0@T:00 0-LMP @!Z8 0-PLM @Z8 -LR0L0M@@P T@ lR0  0 R B0 0 qZ -0LMS00 P@0Y.0D0TST' T%0 `TPpp``UVZ W@@ W G00 :Z@0 0  00`(Kp*-RM 0R\Ѝ\* -LM@0Sp \P.0Q 0 \P"PO000RP0 0[P 4`4P4协  @R00T TT{{*RR*G-$1M0 ` p00S0 XSxS  R!! \s  D A0a00c0PP@S @0 C .S^ s 0 0m C Q171Q ЍIIツ*6ﺂ*6 -LM` P@0SV AP 3pP @TP @ -LM 0 0PT 0-LMPP 00@ O@@O @@8MЍꀷ -L M0`SpP 0K4K@P 4 R 0#S S 00S# S0B40 4 P0d40 4QPPz 4 yX40P@@0 S SPP P P  00S ?R0S`1P8#8 $#$(@"( @0S $QP PPP/ 00@% S S@! 0@1UQPw@Xs @00000c0P@Hl@P T 0S0 0 (K<ȟ|L -LME0P耷(T 0-LM0@SP$$5 00 08<ȟMЍꀷ 0-LM0@SP 00400Sӥ0 R r0 110` 0PS PP೼0M00P @0PM0 00DP M0D0000000S8 0-LMH0@SP:8DPPDHP8 -1LM0S@Ⴅ0 R r 1S010SHPF  P Pe0 :0 a100P`PP f+D>W%P `P 0`cpPD &W0P0f00P@0P0DPS P 0PPP ) p-LMP K2`P@' @P$   $0P00ı@ S00C@000L0`$0D0@,0<0(080 0 0 0Kp`aa`` -LM0rS wS aS   ̠00 Ϡ0+S bS0+S 00 -LM @(00S0`0000 0-LM4P0@S㛤0`000S 8h虤8 -L|M@T PD ( R  0Nu0SwZ ZG ZE :0 PP` 0  pP`q0S  ^ 0 00 0PUoS <0PUo R 00cPo K  0 0 40S7p 00P`0S 30S 3\ 08CJKP0: S 0;00D ;L 0ZpK KPTpK K pY0 P  0 pqz 00 0PPoS <0PUo000 S 80<0b q/ 00bU 0R60#0Q  P`VU0 ab00 0P @0PK0 000 00+L00cPo 0 pq# 00  P @0PK000PW 00 MP R :0 e00 00S0 p-P K 0 pq00S Z00P @0PK0 000 0P080$0S C  (Kк`0M/Ѝ 0-1LM0@S 0 P0XY 000@0D PG0P00P00000P @0P;K00P<0S0 80080Sd 0 90088  R0w  $0X P  8 0080@000088кD0M 0 SЍtЍM SB0SPЍ -R00 H"R00LMS Q00~2`0 Pu 0-UP  +U000 P 0  x 3X00S 0U0XSxSP` R 0U 00SAA0OpFO0 @R Wph@pg 00E S u4 000. W070 cR(Q$00S \ 00R00S b m"  \00R00S,, \"00PZ QF (K p-0LDM \@K:PK`  S 0@K @0 S0 L@K" QT0 H0 D0 L0 e{RK{RphxPRM  Ѝ0M0Ѝ -- LM 0   K -ML MßPL,  P, P, L#\|3#0t#P[%[ 0 S2 H 0NK@DP@D0$#S3L,PR@[` PEP`@0 D<0RD< 2000S "SPEP`@0 Ԫ0p"SPEP`@0S UPEU:00 00PEBKHH{-%V'0mS@ L,R H !0!H<`SPGp` %S00W0S 0`pG`@W`pG`VB.K` B BP<PE0^KPE PE @e DK 0e0c8< 0A4< A0 0< < Up0  `P>;0e0cK8< Ap0A 4< < 0 ẞ ,0 S<(Kp(^t^ -LM00 K -@LM u8T -LM@LPpA 0 /T #R 0 1 #; P@36:/0 ; P`$*?XQPdP0@ KM0P@X P*0`@@ -M0f 8MPP@D"@X-00@ : -LM0@!  0 K -LM`p@oP0PP@0  pv@_TPPK -pLM@N 0 0P  AH  -pLMP6 0 0^p@,<4("4!<C `J,<4("4!<0cS= @ @,< (l<4",(.̀%"4$<PA `@,<4("4!< 0cS<,$ ݻ00ڻ0SL`Ko`PK`T0KXL PU`QZ0=@P`  L2K P0= @@ @Q R@P00Y0X00Sz0<K@ K@  d 0nP0SPPfꉻ 08 40J`0h 0RYx@K h0`K-P* 440S@0 @ 0P0400800S 0@0 1\ 0 0 P  B xP@x@ xP 4@4<0#S  ,0 S(KpԺ?B@ -80LMQ< 0( mMЍMЍMЍMЍ p-LM@PU@EP" P<\04`Kx0 @ 0 0(00<000SKpmԺ0MS S. R > Rh?@?H?P?X?`?0 0 0 0 00 000 R0 R000000 00000S00 S S000 00 00Ѝ 0-0LM0000PS@{P YP qP  lP 8hf8 0-LMP@@P 0S S RP 8hL8h+8 0-LMP@?P P 0S 0HK0M Ѝ  0-LMP@P  >K0h 8 0-LMP@P  P 0S S 88P 8h8-$$ M @ Ѝ,PMЍ-0MSࠓ 0C0,<4("4!<0 00 0Ѝ0SM0C0 ,<4("4!<0 00 0Ѝ0 McЍ0 Q0aM0 Ѝ MR %3 a 0 0% % ЍMЍ 0-LM0@SP*80b0 $K 00 08 0-LM0@SP*80b0 K 00 08 -LM0@S0C0 ,<4("4!< K0 J 00 0K 0-LM0@SP0C0  KJ,<4("4!<0 00 0K0 -1LFM0PQ,0 p@ K_K<N/K81 pR 8!+A[1KT081 4A `T041 081 `).005@81V0OK@  >KKK?KU N/KP@ ,0 S i(KppMЍ 0-LM@PuP pP kP  8he8 -0LM (0 (K KMЍ 0-LM@PT :T 0 K0  0KP00K0 0-LM@PT :T 0 K0  0KP00K0 -LM R :R00 -LM R :R00 0-LM@PT :T 0 K0  0KP00K0 0-LM@PT :T 0 K0  0KP00K0 0-LM@PT :T 0 K0  0KP1[0K0 0-LM@PT :T 0 K0  0KP1[0K0 0-LM@PT :T 0 K0  0KP1[0K0 0-LM@PT :T 0 K0  0KP1[0K0 -LM0@K0 P00K -LM0@K0 P00K 0-LM@PT :T 0 0S00 K 0KP 00S00K0MЍ 0-0RLM@& P0PeS 0P U  0h8S 0 P U  0, 8S888mt -LMP@p`P 0@S RV -L MP@U` :U) '0(PK( $0 0P 0(pK0P 0P (0$ @@00K -L MP@U` :U) '0(PK( $0 0P 0(pK0P 0P (0$ @@00K -LM0PS`p@ ST- H$ $KP' $0S$ R :R T AP@XX\$0  $ >00KtM Ѝ -LMPp`@P( PU0S"0S :SU T @P@PP iT =00t M;Ѝ 0-LM @Hx0 0$ S 0K,0 0(0 s0 R r 1S01,K 0P0ShK0 -L M0S@ 0 0SWP 0 0 0p Wp  W 1+#,Pp`00`S0 040 00 dWp 0B<B S0S*0P`` 0PU:x@P 0 0b00P0P  UP! F0 0e P0 #0PW  F000{P o W:,PP e F0 0g 0 P00eS0[ pe0p40 W 40S   P00h000 040  0`0V`!PP00V0S  F0000P $V ,PP  sF0 0f 0 P000S00 P4 00eS0 pe0 @00 (K p-LM0@ `V  00Pf`0 ,Pʼ0@00x`P` Ux p-LM0`0PS:0@S:x 0-LM@P\8hT00S#0`P 00P00S84X -LML`p@P0X@SpPUZ`V 0-0LM0@S 0P,  00P @0P<00P0 $000 0000S0B< S @0  0 0c0 800088к p-LpM0@8CP`JKOP00 ; 04  Q00R0 ;0  Q L ( 0R   Kp` p-L M0@ C 00 ! K$ K` >PP0C0  0D$0 SPP P yPP000Kp0 -LM P`;00S~Gp@T 0S @ 0@P0mp 0@0  F @00@ DGP 000 :G40 00S KiIG Km -LMlA0S5G\!000P!P1@ /` P0E%' 0S# Z 0Z E 8KD  48pFP   F 0S G 0SG 0S PE`VZ@Tl Z00C0 ST0@ @T ,0@00S (KoF(Kmm -LMpVP`@K410SF(1@T 0 0S FP3P 0@0mpP% 0@Q0 D00 F E?| 00P0 B  pvFP80 @  @00SF$Km -X LM^   K0K p 0 KmMЍFMЍ -LM@rpq0:00PT:0 p-LM0@ `P 0V0: 0xh\ 0-LMP=PP00OP0T@80:08 -L0M0@0@K0  0R Kp MЍއt,@RM 0S@  RЍ0 10M0S0C0R:Ѝ 0-LM0 RR@  P  100P:R0 b320 8 0-LM0@10 0s00R: 0R PP@  ! PCv @0 1 8 -LM8 <0 P4 K00K@ `P? 00 i40R040 0  R5Y0S @TT T  BR \ 0210 32@@0Q&0 0Ppp T( `P 0@0y0@1 @d P p X0 40 p040 a `P 0@0[ p40Q8a Z40 0S 00 pP008PJU00X0S XQ4 21@0PC L 0T0 ,`P`p 0@0XPp  Q 00040 "00p <K 0  @000@ (K -LMoPpU 0 X P C;P@ C +PB8?0@T0 P@ 0H0 80 Dp D 0 S S*S +S -S S  00 0D0 0S 0D0 D 00S0XS xS DKH0K P8  P  D 0D0 00S S     D0  X0 QՒ<,Є 00@Q9)0D0 D/P00@9P0P M0SI RQ 0D0  @@ 6D @0D0 0P 10@Sࠃ 2D X @0P@  0 PP0Є R  \BS  0ӓ"Є R 0ӓ)@D 0D0 00@ S00 ᴀ @EPeP90 y Dp D 0+S -S```0D0 00@ SD 0D0 0P 10@SDP0@ <,D0D /P00@9P`+0e\SVlDp ZDQ:NP IP5iP nP0D@K<P) D00CD0 4PD0 0D0 0 80 D@K'P 0 D0 80 0(S  i 8 080 Dp   h 0`  R080 00c0  R   r 3 Z ``Q  SL VT P ڤ91H C c"@ PFL 0&!T P 5^Z[`P 0TKF4`^ T  9RQL LK Z 5@`P06L0 T @`` 8TK1 1"T P 05\TK!Pj`0^(ʈHTK1 "` 0eA " `~L8 2#TK T P 0TK8K<P 80S?Q`  0f@T=  7TK1 !T P 0y GCb46 56,ʠP0 LLTK !T P `FVHǟPp4656P0 T@K0` !@PV >F@d  6TK1 T P 09 FCb46 56,ʠP0 LLTK !T P `FVHƟPp4656P0 T@K0` }!@PV 5T@ PP 0#:?C0C PPTK@ K<0Ki PH  <0@a@0T0@0 @0 0< @0 @<0 Pn0Ug U0 P 0 4@lT H P<0H 0<0  R< r H0  H0 P080 RH 0<0 00dHB Q@  0S00 $4X 0Pt [ ``  t Px L t0 ! p?H0P| ? H  ! c?"00SC S40X b040 8 <0R<0F0ZCP0f0CI X 0 S S R0S zPP000'S S SQ  R0pbPP@@[D0P 0P @T0U 0g R#1 0@00S>PP  0 0CP00@  q0Rh ^000Q@ @dDA@`Q@hP D21 03pQPppW40040 @aPP 4 d4 0 p04Q룠/4 RE40`cV) 0S S SVX HPQ  R 0000D bP0@0è뿨P"00`W@FpTp0 20 2p0f40 W? 0S S S70 2 000, 0bS( `PP* Z 00CX21 030S@ 1 0dP40Q4 p D P4@0 (Km0M 0@RZR R\00Ѝ0A10M 00 R0: S:Ѝ0 \M 1 21R  10 02SRЍ -L M@,KP0K0p0 c,0`0b2SzG  0$K -LMp` @4 00RP! 0 V0 0@ P @@ P 0 B PP@ U @ @0 BP U P p@-0"RM"1@ 0`  00 3$ Pd05003$Q:R 00Q :0 0cC1S00Ѝp -LM0 10@ @R*0 S K0 @KM0S. 10          $  (  )  *  + , ! - " . # / $ 0 % 1 & 2 ' 3 ( 4 ) 005 L0S @04 0000 00 Ѝxm|0@-@PM 0Ѝ0@0@- bM@ l 3. P:Ѝ -2LM00< S@ 0 2140 040 8 4 00<0BP0 S SP00S p @ 0p W0 XSxS0 SP"`V< S$00S T0#03P0S  T7`$0p P0 S0S+0 XSxS&0 SP")S00W0S< 00 )Q<0B 0 S= PpT  $ 0200SW* T0#03P0S  `T  0 T000 R 80S 8 0 b 21040ASQ00(K- M 0SЍ -8@LM,    hHd -LM` -LM<` -LM0 PR0P``@PH 00010p 8!#800"( (!( 0( \"x:0 0b 0("( #8!80#x \:W  0RPP@  ! s7@0 1  M 0"108#8S"("$"""!   Ѝ 88S00000PM 00Ѝ-0 MS10 0LRA 3#\Ѝ -LM0p100`@PC 0` P0 `6>03U<U@@5 P 256 b42Uࠓ> M0S0Ѝ 0-LM@P 0 S8h -D0C05 `0 C>@0C01B@`@ K -LM@P`PwP00`?0P@``kP6 p0!1  0 ``0 @P0Q Q @ ^ P@:0t @  P@0  0V: pG02S p(K -LM0@0 P` VpP 0!R 0010P n0>00R3:Q`0R0:0F0 -LM0 @R0@PP` pWP9 10080 0 8S:1 ! 00 `P00 4 Z 0 @:4 0@^0:@P`00U:8 pGW02S p(K -LM@ P00@ -LMpPoȟ0@)"0@ \0P`0 0Zv@Pp  ! &5Lp 1P  -LM@` 1 1`P@ Dq> APU0S]7PUPP+ 000SQ7 ?@P `p @T0S\97@T+P@ 0S -7P`tPwq0 SM0 RЍp@-0MSP`P` D4%LP`\ЍpM0S0 C ,S R-S+SЍM0S SЍ0@-PPM  00L S @#0C^00L S^Ѝ0 0-LMPK@ 0P  >00:S 0P 0<##00:S  0 P0 00K0 0-LM0P-S@ +S@P T00c08 -LM0@JS000 #MS00  0P& 0.S" 0P 0.S 000C S00 [?mP 0/Sh00m  -L MPp@0  d.P000 .p30 0S# S Sf 100 2" `0F40  1:C=C00SO ;RMX1@H0@!B0ß40 QV@@Gd.dPt. @ p.0 @.T  U0B0C@].0P S04 0 \@ B1Q \000 O0O(KQ 0-LMPPK.dEAG.`88 MR10bQ1bQP00Ѝ -L(MRP0 L PP 09H0D LR L=Q:S0T.U50S8 ( 0 5  00S9P0 8 80080 U0L SPE 0S 0<0R 8 0"4 < PUZ8 < DğP 00 ~ H` D @ !@ 9$0 p Po0@0S@T SUQPRZ 004K40 \P04pß0Os/< PL$ `GPU`9@H6@`Uį0p Z0@ dc-P]-p3`1 Qʭ P,C! ,3 `a-HD 0n00a<L lpz}HWzG}G2WPd00@#-P0-0p031T0K`PX U 0 d -P0-0p030KAPndؑ`0@P  d,P,p31XP@PPPp0@`DP{D@,PfP,PP00,P ,<@,P0<,8P 0@  d,P,p3 00 P00bP 0P0!0X0 00 0L$P P(KP@D@Qnm?Q MR10bQ1bQP00Ѝ -LMP`Up@s,n,0c0h% 0RM 0R  0R  0R 0R 0cЍ -LM0 00  lK0S lK< PlPK`< P  P\PXpU , , 00`K0c\0 0p wPsrP mnPdh\ 00``RPP+P+p3 10`0 XEp`0 S\ 00RPP+P+p3 10c`0 3P/DĔp0K``dV ʨp` @0K0Pd +P + p 3\0`2"1Q c P` \ \` P 0K Pl00;Q X0 v># 0Sl lK:>Pl ;0 l0 0 0 ?S p 0O /?0@ @  `cP@a0P`Z@P <` Y@ < VU@p < @K K0P <0S@0SKlKP- @ K R  S ZʐY@ < R S ppSʀR~@p < ZzYwP@ K pіL RKx0SH 1\11`Va  A=0K4 L0R. 0pB=0P L0\ @0K 0O0SO80 4@ 0PlK fPx L0R80K@0 <@  PEW 8KpGJHZ @ K PoSR ?!0 @K8P 4` @P <` P00@K(Klnpwtw -LMp@P`10S 0'K@-p0M@ 09H00 NS N0S: 0C"0\ZЍpwP@ -MLM`P8 <( 0 0 0S0 000K 0Pz 0S 18P11Zm B.K0 B B0S =0 B@4 P(0K 4@SD4xp4x 4(KR B.K B BD( ?Dx 1員! 0S@ , 2DP圥% p\! @ H @H L w3Lx dP00 S@x 0 0` cq3 4xX8<(00K4 Y (KpwtwL*H*P 0M 0ЍY P0 0M ЍP -P?0LMS+? Q0S% R#0.,0 0St0 0Sd0 0ST0 0S D =0Ap3H*L*T*X*P* -BMLM90@,0 9Kp";'PT 0T00 8|P 0:S / P 49P/S .P I0:S@0/S . P)*B\K(PEPE+++.P@ @,P9rp@ H(hPyPUIK922,`bR @BBH`bc0`j2bK $ ( @ 2TQ Q\K\P2P)K2SSYY 0##iKb0 2"K0#"B0aS)KR`@r KPK`P@0V0 SH&00@P9KR`0S0o 0PRi@`0V 0e 0 0`R K"B)K0%P09K2Sz K` @P0X9K# IKBT@ 0S0(` 0QK# Y 0S0` 0Q @0 UT00CP0S )K"0j@c)KB 0 0 9K2RIKBTiKb PiK"9KB2TS0 SIKBD0 S}00 SyBLK(@D @D Po0Sl 002Sg,#aK0(A 000 00 0  0  0 P ``V BP*Y` -RLLM`@ ,,6p@ P01h0 @000 0<S @>>0>Sv dp@ h &p@ @d h@ 0Si 0K~@Pd  RpP00PU& <U @>0 >SP dl@ d l@ @dd@ 0S,S ;S 4KVP;00>C40 0 s 3W4 R0;S,SHK VP& 0,S#\KMP PU|ğ @M00@H04 ` h0004 b 0a 0004}0Pp0(PPG0` H0K V4P@ ` \0KMU T  G0  G0@ P 0G G0`00 `d%P`%p3"1p QʍP`  ` 00KSځSB0`"0Sh20c Q0TBD  0c#0S ,rR( R0 0h!00 0S0 0 n0O0@0 Sb0 \| @M00@00 4h081 b 0a 0 0 00C00͆@00 00 blP  000P0PlPd h0d R d00 0 0 S pdQ h d0 l (K$TwH*L*Q%X* -LM@ P  hN p-LM@P`S 0S00l #h0PLSP0@0 V40T(0(0x=0(0xx|xBtw MЍx -LM@  -3L(M\4p 0 H L 0S 0S0S 0S~ 0!0Sx0Su*4| -lLM0SX@0 0R@!P (@ 9PRhxxpwB -@LMVRhURx p-LM,(@PxhQ0S IP< )PP,P0SJ!P% PQ0  B B,p P` 0:S  UP xh.xxxxwpwBP* p-@`LM@Q  @PQxx P0M 0Ѝ p-<`LMP@Q @Qxx -@LMQohQx -LM< 8 <@K0<Kx4`K@_4@ 0P q<KpTR0@ Qp`4@K0@P4@ 0P [<KT R 0 @ QQR* 4KP'T"S `p4K4@K0@P4@ 0P 7<KTZ 0 @YQR 04K@4K(K 0-L M  @K0 K T?K0 -L0M@@KaM K -LM(@, 07QP hcxhw -LM(@, 0%QP h<xlw -LMh p-QLM@P`p`S@rP`& 0V pKpp@-`M@Pb0 <250^@ 0<0Ѝp -LPM@P`p 4!`^0p(S RP 0p#83K`#[ &8R! X.(,Ƞ3K0#KKKsK3KᾂKSK@PK@\ ;3[S @0K@P\ 23[S*[ !3[H!3[ !Q ! !H !$Hx!H !$Hh@0K@P0\0 \6Kll PIl l0 SP i00CJ K 00S BZ J0Kh X X X RX R\0l<\LX 7\0x @l d@ T P0`P p0 t l0d P0 RᴠX Hd9!dP%!d!PPE` 8Rp0t@\x 0  c a"88c !^@NLl00a#0\0 000#Q@DAJlPE000T h0 RT P\ X^ \l 0Bn0X 3><A0 Q@l0#[[[2[x h[$[[4[xh(K -QLM`p`pp%1 <0;@P10 X0AAQM Q0!0a0PЍ-RM \1,0l00 ?\0 00Ѝ-RM 0bR12<0 RQ ?R0̑030Ѝ@-SM@ 0l\4<0̠ \ ?\ 0 0@\ P R  0 0 0Ѝ-MR ,0l0>ЍàS-0c02Ì.1M0 00Ѝ0M S 200 ЍM0 3# R02 R02 0ЍM bQ B2c00 Ѝ@-M @0cR#3n P0C2Q0C2 d  l 0Ѝ0@- H. !Q, H@ ,P2\Ƞ3# MЍ0 -LM@,pK` 00K(PK 40K(4 ,000 ,( 0 K -L(M8pK4`K@H0  <0KDK 00PK@@K4D 80e  00@ 40`Z H 0@D 80O04 @0`I0< 840 000(K -RLM@`P&"xZ᐀,4 K80Kf,@K0PK4 800<h0H0, Q02[Z $KP1#3P1 <2MЍPQMЍPM3:00QЍPM3:00Q#2ЍQPMЍ ;; ;SMЍp@-9`\@T0 QMP R ,@00@0000#Ѝp p-LM`P@@@`@x -LMPP`p P0`B53A0Q B"A0E0U00` EU0 u @@ 0@dpQ@$K0@-@_Z@@P  @PMЍ0 p-PLM 0 o@a@I PP5Q 0 U0S$0 UZ$K e 0KAe $0Kp0 000M Ѝ"#Ѝ -LM, T"`@pt3Z00 P T  W TTV1("SU*0U,!00QsKPI T 0W0T0SWT  !0Vt0RU/u P ,08!0P,K0K 0e,0|X 0SZ0P W T T0SP0S 000P ,K 0,0K00000  000 00, 0P, 00$K -,1LM0( s3Xp@` S P SS``(8?S@!Q vZ)?45VC"QqP0P_a( K(0@Q T< 000(0@T  030? K p-LM`P@'@!axh -LMP`pZ00 T0 G  0sRq0P00 0G (K -L :@KDK T0Z@ D0 J)@0 6 `H @0 0@K<0DK48 0 @0`DS :`@KDK@HKDH 0IH@ D0e (K -LM@p`U@0S0S00SU -;LPp45gc M3^@(` ,0 0U0/@@UPpS3:V:00S00O2WS0"?DE)U1(0 n(( K,01,0 , (0( cUV W1,0 N,, K~(01(0 ( ,0 cA@ K -;LP`45f M3 à^@p$0 ( US8 V2N(0 (( KM!V\?DE% U2$0 n$$ K:U GU 1?"C   $0( 2 N$0 A A4@K -顏OLMX`p P$K -顏OLMX`p Pp$K/RMЍЍ|/RMЍvЍ -LpM| x x 0 ,JPJt@ %Jt優Cʠt \oOp&tP|@㪪<@ 8 0P D @ 4  @ tPZ t   lCZ  !  0$Z @tP0P 0DK4 K@0K00S 8<0 hT@KlXPK\`K8< d0@ P` HXLH @\ D@ P`T 0RX\@ ;#;SL 1lK D@h0KpK lX@Kp\PK``KX\ h0@ P` @\D` L @ P`X0LQL`0\ 00 00L0 HKLKHL 0PK-PH L0I(K -LPM` \ \h d0 (JJX@ Xd@ʠP`X $Jㄪ\X@p8RToOP&`@X<@ h@㪪0 8 D@ @ 4 `` XZ 0 0  AZ c0XZ  0X R  0 ` @ d7P2P,c(c0 )@@%0`s00ZZ d2I  @ d PP|2x2V^V gQ  9 00  0  a$ j0S00Cc9  I 0HKH R`Y Y Y K⛜P Մ0S@@|-Zp@Ȅ0S WP@ 0S00S0 00@(Kx -LM @PM Ѝ{M Ѝv -LM @npMЍ -LM@ ,0( P00 -LM(0 :1PX(0  XaALpP+   dW q`AP 1!0 1!( 0  P1D 1D , Z00  ,0o -PLM@ 0At(00 -L~M41Sm 5 000  @0 P P `Q `Kla `pH 0@L1 T 0X1  0\! Pd h 4 p P0aK/qK.K-KLQH+QK,KPaTqX\Q*aK)qK(KP`a `dqh$qKl10QpaDQ `p4|q ⌑  ! 001 P4qtQ 4x `a pq 刑  !  0p1 @0A PR `8 a a$`p8q(@taxq aKp|,P1a1K`qp向!K 10a堑8qaK!( 11K`a pq Б  ! 嬁 01 `a ,` $pq 0pȁ @崁A ( P4Q , 8@" 0$ 1 P 0PX@ P   00 AT$K -L$MR` X 0SR D @ 0 13 B1 80 0D0 @ 010s03@0 < XQ 1U   01 0Q0PQ!0Z000 R00S 0S S0101S 1UK0P  P CPT w1S0C1\0   P0R 0S00S40 0 0Ps 00<3 Q B  1 001% p # 40S0S00S40  0pmPC p00 p 10!00@0@@T00Q00001P0Q =U0 P @ 0 Z00 PZD< 081  01 0ā0P(K &3 >MbЍ -@LM%   H900D9 -LMD9@SD9 H 0D9 -1LdM0`P 0 |1p4@K x@ | e0 l0t H@Kp 0l h0 0d0 `P V\ X@ T`  0| RT h0K P0 0L0 {Z|H0p0S  0 S(Kpt4^t -L LMQ080 000 0 BS "0| 00 0-LMP 0@Sl000C L{8:#:3 201 32 l8  -LM0PC@[ 0 0 b 00刡 0@ 0 `0D @1p0W00  P # 3TX0#0300 0 p (K$ p-LM0P,  0%R@`@l90\ lN@1A.S R00SRPx< -LM 0`^0 4 ;~PrP 01@0鎐5pPI@   p 1@T  0A !0S0@0pW:P 0 P0 000@C0  BP0!004  00C 0(KT -t4LPMl$@0, 000(@pPlKX X X` ? #PP( K0 `DCZP `3`<0C<Swh?8@L?8@8@|?8@8@8@8@???8@?8@8@8@H@8@?8@?@8@ @8@8@0@8@8@8@8@8@8@8@8@t?8@8@8@8@???8@?8@8@8@H@8@?8@??8@@8@8@(@(00 S,(0( 7(00 P2p0P"p"$P*$(P&p$P"00PpPpP P$P@0(000 p$(P P p P p1 Z`V 0SyXZAx P, pP` 1p`4P@?  ?  ;i:B< 00 1p`4P 00 0 0R@\,0Z0$%Z Ul)0@  p00SD0 0SXz 00 ,0 S0·(Kp\p9 -LMp2`, 0&P@0 l90\ @V>0>0T M1$Z  1@P04o+1p(L$X! 1A/ Sq 0S  0S 0 1R0j1 +0S 0- Cp0! QPW' 0 0jR q 0S 00 0j01R0j1   0S 0S  L0@P03!(0R(K< ->0>0LMRP8 n1"( Y 8P8ce10cY cp`0 1S رPT01Xa140a1!010`0 X 00( 0B0P40 A:s0( BaVp0S8  1 0S  8 8011 010XAp@@(0X@K !(0R((KoB(KT - 3LMp@Pk *"*RP R B0RP Ub;$ 0b S:XWR U53;2 @T $a | PXD R 0S R>0>$ 0+ b . . $ m|0SU  0S  Epd !9T I@TW PP\m @(pG !0 1!08#(R!1 S1@10S00@@1S$ R00 1Sl0 0S  *1S1100S00@@,<HT  -LM`wVp# P0S 0 @|0T 0S dhMX@00S0 h0 0CR0 wp`h -L MD P8 < `Y$8 0:CR*80< p>0N@pPwP 00p0 P  BwP$Q a s Ppde0S $ 0b S*0S b $0< c:b0PPA 0S>:$0S9<0S$0$ c g b-, 0&Rl90Q 80@S08 R 800C10 @0P0U40  8p Y:3), 1 ""p  0 W0 3 @P0e1p0#  0@ 00S0@@00@P 1P R0000  0U 0 *\Y# ᰑ01 R1J438#811  P  w0S00PP`6:39 )8#8!1Ბ1 !2R0 B101!2 Q 4 @0S00P40P0  0PO 0Rt1Sd1@@T0@@$20!0Rp@ >8#Ƞ@T@ 00001!0C8#8 ,S!1 R00 00t 00c0!2QB!Rj0P<PU 8 R ^(KH<h -LM`4 p'v0F80 V@@T0 P|20S pRp"0Sh2 PT"00S0  V W!1-@X$0:CW-*>0~ Vp:X Oh0Ve pP^ 80 0f@T `~P|8ePauPT/Tu 0,PP   \u@ 000$Q a P 0S$  b 0 0 BS T p0 0S xu 00u00P040@uPu000@(KTH9 -LMP`iu(1p0SR 1!@1T ,PP9VU3:U P *00S< 0 0SDuP@0Q P h\ 0 0CRP0 U 80 0S 4$u 00 up9 p-LMPu0`0S0 @0T PP#@00S0 P &\ 0 0CRP0U 80 0S 8Jt 00t`x9 -L(Mp`t40@ S4$@4T P'$0@T@ r@TW8  @8P< L<@$ 0:CV:t@ 000@0. N^@PUX$0Sd@D@ DP8@ 40 DP:PP !8P!10b1@"4P(0UP4P :@PD  20LDPP@@  p2P0j.@DPT ,20S = <@`et6 ḬP1 q-*$Q a P d$a P [ e800< @0< V0S$  b f0ZJJJJJJJJJJJJJJJJJJ }J xJ sJ nJ iJ dJ _J ZJ UJ PJKJFJAJ=Q:Q:Q:Q:Q:Q:Q}:Qx:Qs:Qn:Qi:Qd:Q_:QZ:QU:QP:QK:QF: QA: Q<: Q7: Q2: Q-: Q(: Q#: Q: Q: Q:Q:Q :Q:QA ? QA ? QA > QA > QA = QA = QA < QA < QA ; QA ; QA : QA : QA 9 QA 9 QA 8 QA 8 QA 7 QA 7 QA 6 QA 6 QA 5 QA 5 QA 4 QA 4 QA 3 QA 3 QA 2 QA 2 QA 1 QA 1 QA 0 QA 0 \aBC`B0QA 0  -'QLM`$rP@ 2P0,p@  upߪ1 @0 84 0<00 84 0<0 0 84 0<00 84 0<0 0840< 00840<$0 0 84 0<(00  8 40<,00 00 00 0040000 840<8008 40<<0KHexpate knd 32-by -9LrM 9, 0 @,! 0x0 @@ PP `` pp Ā    $00 (@A ,P Q 4`a 8pq <,$ P T H 0 L L?P  HA00 LQlKRH 1`pD1 $14a 8q < @ xP `p0A1 04100 81 (00 <1 00 0,@#1n, 1lȠp `p D@qc8` dH`1 p0P# ,&0b*a0 0 'eZ0` 0 (0 0#@,0n 0#1 1dLc̠1`c<1 0&00 000 1p0'P#0  #0\00 0,00 000 10(1 0 #0lȠ#0n@#1dHc8`1 0p00 0'00 0a#0` P#0eZ041 0 &081 0b*0<1 10(1 41 #81l̠#<1p@#1Dq c<`p1 0@a ndL`p@1& #D1P'#p0, \0Cp0 p0SF01( x0 01 t 41匀80|0 0< 0 ऀ ̀P P  P  `p1 ` p aq@!DQ P! Q  $t| @p !",q A X \ `! 0@P`p؀(!#<$L%\&l'|(,̠. !",d1 hA pQ |a q 唁   ! 1 A#p?$(,(0!4 180 A<@,QPaq0V4p00L@@HL Tp(\(#0P!0@  "@ PT@(@( @s00 ?00, 0R(Kp p-L,M`0 0R0 P 0SD@K(p  0S((bp@DK(0\0+@7 H0040 0S00e0 0 SKppj p-LM`0SP00S.`0 @0M@c K  00C00S Kp -0LM0@S`뤀夠p00S @VP1P!M@c [  p0`e0e00P V00S m -LM@K 0 0 k  W100)*2 -LM@h'+)*+MЍ 0-@LM P~8h@-@-pPM`P 0@T00 S R B \0dC10 P  =\Ѝ -0LM0 0S=S` K K --0 L^M0`QP 0 paM_KPE`@M?KC/KKd1 4A 0A l0F`KppX0 peKQ Q < _1@0 0RKp-R0 0c BSR48 R p-@P`x BRpR0 BRRRM 0SbЍQM@  0R:(tsstttt t(" 2 02 02 02 02 02 02 02 0Q Ѝ M00S:ЍR B 0\R! B@-Q:@- R (2 R R -PPPP RrPP B PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R@- RP1P P1P RrP1P  B P1P B@  R010 1  B R0q0`0q0`0q0`\0q0`0q0`0q0` R 0\6 R B0@-81, Ġ%̌T$\D#L0P  R0@ Ġ01#̌  R R B0@-81, Ƞ%ȌX$XH#H0P  R0@ Ƞ01#Ȍ  R R B0@-81, ̠%Č\$TL#D0P  R0@ ̠01#Č  RJJ'*SS'*OO'*}'*MЍMЍMЍMЍMЍMЍccg'*MЍMЍMЍ``Z'*22V'*11R'*N'* 0-LM 0@0 @PǣK0Π05'*>>1'*-'* -LM` pP@H1B@A01  P d 0200 0 0崜8q -AMLMŸP, p p8$ 2KPlYP`BNK@D@D0H"` P:qk?0|BnK`FBK `FA0A 04 p T < 1sa 1 <4 1R& Y 0CA 004 -4[.$[/[0[0L LLL^0H 0Q( K0/4[0$[0A A PZ<` W @00%BT  @ F : : 8$P0@<PJp 8$P jO00 ,0 S (Kp3,  -LM`pyQ 0P40 00 0 ? Q< R c@00%BT U@ H : : r4 P0@ P9p G P 40P jO0 0<Z 0S 0 0C0pp/ 0R* Z 0CA 000 -0[. [/[0[0L LLL^03K/0[0 [0 003K/0[0 [0  P (K p-L M1@QP .aP8 0,0ZP8 82Kp p-LM 0P8-`#1@::0C0$ 0\\1 8!$ BP@  T00~AB2AA 0B 1 0xh -L M404  SP0 00S400404 000 `0$0!QD AQ! 1 BN?p @%PP T 01C T 0 ! 0$ 10C0S  "0|X 0S@p T!D0V$0@00@c TD `Vu F!D1DD0 `0CD0@ 010CX$0Sc pPi!D0@0 TD0"`V1 I{iR F!D1DD0@0CD0 ` 0 B Q~AB"AA 0B 1 05:    RQ00~LB2A0AB <0 0$ 10Q0A $0PD0 QP1@0c0Q51 KI'i008#8#H! 04 [40P 00P00 00000P0C0@P0 40(K< -LMP0@0P@cH$HX`p %X0@@bH$HPX%X0 0C@0P0@ -L M`PD OXX 0S0?pQH NR7 0< 00Q8 -:@0@0F@bH$H0 @T0H @cH$H4 @J000<0H0@ 00 0c80b0C 0< 00@ 0@G0 SD0PU `尀X 0R@0 00S0S 00 0S `4 DPP1 0S 0 0 0S H 4  0D P040 0400D Q808(D40P4D(Ko(K -LtM@ 0  PRP` > 0JPh 6 `(0P 00h"0  0@ `p| 00S`@d 0h 0C 8xp hp#X`p 00C8Sl   0\KPXX \p0W T`V @p d` (^#x0`0C8#8 I 00l0ἐ 0`P~ dPP @a8 @#d` x  0P8#8t0 Ut0D  b@ 00L0 00 0lH t P0S H @00 0S DKZP; 0DKL K\000p 0S @0H 0 0SpDK<pP 0DKp0 L K>00008#X0S0S UH:dP dDB4 00c 00  0f P4K< K8|#8  08# l  0 0b00屐 00<0 00l80 08#x`0X0g8#8 I! 000ഐ`000h 000(K -LM@0pP\o4R 0080S#80l G8U#h 0  b^000 R C CCC0^(1U0E(10 00G000 000B800C80000 -LMPp Q0`@\ Q QVPP P0S -L M@pQ 4  P n0 %`P;#P> Z) 0(10S$1 0 ! 0S 0kP * 0P$1 0$10 0S0YP  0 `P0 8#R f`00 4 0 `(K -LMP@`Q)PPq  Q0 Q000a0P^ 0 8ᲀ#xP`=0 R  0S0 ` pP(E000Y0n0@ 0S$10 (!$1 50S 0P ) 0(10P%$10$1  0h8(#h"x 0 /p 0S }e00  ,10 -LM@pAQ 4  n`0 PPP8P- 0 PP #0 0S0P  0PP0 8#R ,eP00 4 0 P(K 0-LMP @p10K0 -L M@0 D <0K4 K `@P^40 j@KPtP 0@ +PJ 0D pUpW 000ᴠ08#8 P(@"(0ᱠ00 @0@0@ D0@00Q@0A 8#8 P0 00@PP W000(K -L M`H0 00C< H8 H 8 4 D g< S0@8@#8@cH$H 00 '   8#8 @@0 0@ 0@00 DWP <0P< 0+p@4T # TH0X @ T@PH$HPdX%X 0PC4 4 0d0d00@ 0P00B0`008008 000C8< @ P#88 00;R008R#XH 0X0E8#X0 0@@eH$HX 8#8 B @0 00@ 00 DP `04 0 4 00000C8X#(p4(K -LMP `  a("HpdX0P pP`PP  0 0b8#H0T ʲ0S T0 5P P -LMpP`@LQ\QQW@p.T0X  Q00SP ô 0@00!0 0 0C2#00 0 0T00WW800C80 -L@P/ 0E`p( 0 A 0P-LEA 0- L@0@PᒸP $000A -@L(T 0A -OL@POR0@-@P l^0,00n1C3\NP0 -0LMX@ -LUsage: %s ..., where is one of: instbin%s: %s not compiled in mount_cd9660md5sha256sha512dfmountmount_ext2fsarchsyncnewfs_msdossttylndisklabelpaxtarfsck_ext2fscatifconfigsysctlrtsolping6datelessmoremount_nfsfdiskgrepfgrepegrepumountmount_msdosfscksignifymknodreboothaltmount_ffsdhclientcpgzipgunzipgzcatchmodchgrpchownfsck_ffsnewfsrmmtejectmkdirksh-shbioctlsleepmvexprdmesghostname|hTHX`@@hȎlpt̆ d@@xȌ unknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs cannot be zerocbs meaningless if not doing record operationsbuffer sizes cannot be zerobuffer sizes cannot be greater than %zdseek offsets cannot be larger than %qdnonenoxferunknown status %s%s: illegal numeric valueunknown conversion %s%s: illegal conversion combinationcbsconvfilesibsifobsofskipstatusnoerrornotrunc%s: end of device%s: short write on character device%s: short write on tape devicefiles is not supported for non-tape devicesstdoutinput bufferoutput buffercase conv and -DNO_CONV%zu+%zu records in %zu+%zu records out blockblocks%zu odd length swab %s %zu truncated %s %qd bytes transferred in %lld.%03ld secs (%0.0f bytes/sec) skip reached end of inputmain|8|ȩЩusage: mount_cd9660 [-egjR] [-o options] [-s offset] special node session number is %s: %segjo:Rs:realpath %scd9660%s: Filesystem not supported by kernel%s on %suserquotagroupquotarwnetautoaccesstimeatimeexecsuidrdonlyupdateneedsdoes not need-o %s: option %s a value-o %s: option not supported%s: illegal value '%s'%s ("%s") = %s %s (%s) = %s usage: %s [-bcpqrtx] [-C checklist] [-h hashfile] [-s string] [file ...] error encoding base64cannot open %sstdout: write error%s: read errorbC:ch:pqrs:txbase64hex%s doesn't support %s ,unknown algorithm "%s"SHA256SHA512usage: %s [-hiklnP] [-t type] [[file | file_system] ...] df: %qd: %s 1024-blocks 512-blocks%-*.*s %s Used Available Capacity Mounted on Filesystem%-*.*s %*lld %10lld %11lld %5.0f%% %s %7s%-*.*s %*llu %9llu %9lld %5.0f%% %7llu %7llu %5.0f%% %s %-*.*s %s Used Avail Capacity Size1K-blocks%-*.*s %s Used Avail Capacity iused ifree %%iused Mounted onempty type listonly one -t option may be specified.hiklnPt:-h and -i are incompatible with -Pretrieving information on mounted file systems%s is not a local file system%s mounted as a %s file systemffsext2fsprmountmountfsmainnfs:@ufs%s: fstab uses outdated type 'ufs' -- fix pleasemfs%s: fstab type %s != disklabel type %susage: mount [-AadfNruvw] [-t type] mount [-dfrsuvw] special | node mount [-dfruvw] [-o options] [-t type] special node -o%s,%s on %s type %.*s (%sunknown flag%s %#x, ctime=%sv3v2udptcpsofthardintrnoconnrdirplus%s%s=%dwsizersizerdirsizetimeoretransmaxgrouplistreadaheadacregmin, %s=%dacregmaxacdirminacdirmax%s%s=%lu %smsdos%s%s=%u, %s=%uuidgid%s%s=0%onowin95direxecnorripgensextattprocfsversion %dlinuxstatfs %s on %s type %.*s: %s already mountedexec: mount_%sfork%s/mount_%sexec %s for %sno mount helper program found for %sforceAadfNo:rswt:uvrqnoautogetmntinfounknown special file or file system %s.root_devicecan't find fstab entry for %s.%s has unknown file system type./var/run/mountd.pidsignal mountdasynchronousasyncexported to the worldkerberos uid mappingNFS exportedanon uid mappingexported read-onlynoatimenodevnoexecnosuidwith quotasread-onlyroot file systemsynchronoussoftdep/usr/sbinmain|8|ȩЩusage: mount_ext2fs [-o options] special node o:specified device does not match mounted devicefilesystem not supported by kernelmount table full%s on %s: %susage: machine [-a] usage: arch [-ks] machinearmisharmOpenBSDmain @@$@h (p,p 0p 4` <@ D $%s: no default %s%s: illegal %s%s: bad %susage: %s [-N] [-a FAT-size] [-B boot] [-b block-size] [-c cluster-size] [-e dirents] [-F FAT-type] [-f format] [-h heads] [-I volid] [-i info] [-k backup] [-L label] [-m media] [-n FATs] [-O OEM] [-o hidden] [-r reserved] [-S sector-size] [-s total] [-u track-size] special [disktype] %s: bad FAT typevolume ID"*+,./:;<=>?[\]|%s: bad volume label%s: bad OEM stringbytes/sectorsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorsfile system sizesectors/track/dev/%s is mounted on %s%s: block devicewarning: %s is not a character device%s: unknown standard format%s: can't figure out partition infoioctl (GDINFO)%s: can't read disk label; disk type must be specified%s: unknown disk type%s: partition is unavailablebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %u-%c is not a legal FAT%s optionblock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectorstoo many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) bps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs=%#x bkbs=%s: can't read sector %uNO NAMEFAT%uBSD 4.4%s: can't write sector %u160180320360720120014402880px |h\    <:TX\`dlt|  #3#3233#@@K@@  (08@HPX`hpx  @@% , 4 @HPXdpx@@@@  ( 4 @HPX`hp@x@  C$CC$C ( 0 8@HPX@`@hpxprintmainoption requires an argument -- %sundefmaximum option value is %d -- %soption requires a numeric argument -- %sdiscarddsuspeofeol2lnextminquitreprintstartstopsusptimeflushrprntillegal gfmt1 option -- %sillegal gfmt1 option%lxcflagiflagispeedlflagoflagospeedgfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d TIOCSTOPTIOCSTARTTIOCSETD%d %d rows %scols %sillegal option -- -%scbreakcolscookeddecekeverythingextproclcasenewoldostartostoprawrowssanespeedttycs5cs6cs7cs8cstopb-cstopbcread-creadparenb-parenbparodd-paroddparity-parityevenp-evenpoddp-oddppass8-pass8hupcl-hupcl-hupclocal-clocalcrtscts-crtsctsmdmbuf-mdmbufignbrk-ignbrkbrkint-brkintignpar-ignparparmrk-parmrkinpck-inpckistrip-istripinlcr-inlcrigncr-igncricrnl-icrnliuclc-iuclcixon-ixon-flowixoff-ixofftandem-tandemixany-ixanydecctlq-decctlqimaxbel-imaxbel-echoechoe-echoecrterase-crterasecrtbs-crtbsechok-echokechoke-echokecrtkill-crtkillaltwerase-altweraseiexten-iextenechonl-echonlechoctl-echoctlctlecho-ctlechoechoprt-echoprtprterase-prteraseisig-isigicanon-icanonnoflsh-noflshtostop-tostopflusho-flushopendin-pendin-crtnewcrt-newcrtnokerninfo-nokerninfokerninfo-kerninfoxcase-xcaseopost-opostlitout-litoutocrnl-ocrnlolcuc-olcuconlcr-onlcronlret-onlretonocr-onocrtabs-tabsoxtabs-oxtabsonoeot-onoeot tablet disc; slip disc; ppp disc; strip disc; nmea disc; #%d disc; ispeed %d baud; ospeed %d baud;speed %d baud; %d rows; %d columns;lflags-extprociflagsoflagscflagscchars%s = %s;%-8susage: %s [-a | -e | -g] [-f file] [operands] -aefgaef:gnot a terminalTIOCGETDTIOCGWINSZgfmt1illegal option -- %stcsetattrTIOCSWINSZlinkitusage: %s [-fhLnPs] source [target] %s [-fLPs] source ... [directory] %s/%s%s: disappeared%s and %s are identical (nothing done).fhLnPscmplabelduid_parsegetasciilabeleditXXmpsavehas_overlapgetuint64editor_allocspaceedit_parmsedit_parmseditor_resizeeditor 3   @ @@  @ (@ %($@3  `N@$_3@d3` P (0q8@DLT(^(^(^(^(^(^(^ܭ ,(^(^@(^0(^(^(^(^8@txDHLPXtt\`dhd\{sFOڭ=Qw-)~$lɒŶd/ | fr$׏o_|3z/ ^k]8M/6ѫ*B׻ߵ< (K'o/;}&16u*Qd *OUit{Uvj_ɿyr>yϒ3y?'0,&in_2YfˤL\&/)2~6LJ(}q.eLt3.[_4Ƈ?7(>S‹WdDy|H>/ˤ"U;E" wdʇqo~yN8l?_X`*cʟ/xś $'0-PgGx:k[60&TtZM6(S+SiZ|6KʹɶU*68ymn4ވ瑌_YU6 yUTcY6~5[ZemLfӉ5f u=#3sQBm4MU뜩ƍo9IEh!i5̤\M4,Z7fL9[TOM ך\M8mnlz37V"XWjUXW]ܓhs3p ]\۬63miJ0;Sƚ <Nq `m*awtf .gTSͼY#j{^f!ao:x&Q?I-7nOt{UJ^N>-=;UQT[h+  8)0Jf_ZtúV=Le2x_&o#?LNSzwq|@I||7Ju %?B:665KVR`u(5-(#83 80JHTsTCBCjQTd@ V3bckf K ϜZ,d`v7Xz6*QF (zm},6r:"\PA̢p[P jଓjw}()~֚fɭBD!v/^ \Egi wp07Uop/5D9xrD8 G@6hVdv6yF3?x)&z4 u ^Wy]V87AMÊ6dF~:;,q^J^70,u*9 n׶h:YҖP"I,R`1ĤikJFײ`?,&+jEZVnW"pǬr}cb@s^kܝ}!AO-w x D[u  <" P\09MmA"YXx,^^WV{W>8X0 q_ )iKi1MtɦyLl) 8?\OLQD/G q 㾂 Caw["*_Ho(d*WX^Gռֺ7#Z1#VP"OCڼ$&P*)f•tq&=89;#0 q>MmA*&x¢PTp'okm7 Q@*U=kQh%w(DVG٠HA_ㆁ}hSEaP3Ay:_rB"2bbg%9A#) M6Es 4/[2NiJ Yҷj.dйmЭ/mP7[rAt}%_0Jb 3hjSBh !PB`DEmny&'Q-:Q5kh{(,O H0ǖy/(| :K'Hkχ@\RѨLz5bu9;9)SV.+)sAgp ;ln:ot>zZ8Hc=QO0/| )aDiNC78pu5K:Y:2JGq;j9,I|J8N\\C- 6X\MEPE*bGlHJik118ƫ.r`MTC%obE!@8TKQG2Th)80vCu9/Uij-[~k+sd˥IP>8fqChB03N{r,M}0"ksem,LdD5daYx#64pYJv0:[8Xm%Q"lX6`qW:_cRf5l(ۮ~fRDxx2<hS 7 y(֠AMdirm… Z9EFy!G (S vzPpsB:&LIV9ҵpiE+o]u×<|Rsyj L"~`0RQCDSbEɖZP7`F'~uMV74܉<:FͪZwNwS|exC*`}!nW Y6m7pM*i\\ 7>< ӍIg*ebYb6 {GƧ Xh_hF=U n/ì P}[]Zct$62.>sK>/:/KDu50<a< 8It(`ڑycu5{-+ 㘃`nL$aѶFV̆i'vp,o@ @6- 2\"1V8ԠZ4>bON%-qN޾cz4ʚ2rTxvR1*WW`vQ陁%)95'J9EOZ;~/VT\xɥi4Q;YR'v/cX؀Z'cdz6[UA6,ӾVȘp$ ``'0u_#GXUv%dێGׁ2덂K:w.~3=bxܹv\$f=`&fHIQRܱ49 .(F-n5½c*I5x@(Y BL wfX `O:/Pqa޹W YV69)L? rx4UF d-3jkr뼇Q ;kX(g;D7wWv5ӈK`4+Ʈ "YPˤ]-f`Jzߊ-k t2ƻF? A F_*W*TͧBwW`4"*}<k`̬egﺮ0x ;BTzi_}Vo3WqQ^5S]"=C<6y4 nPWV>0,8B¬)Dm#C@6^~xVCȄ5yUId 5cَL[15 尿$2~ i慾hPKܜS?%?I:1\ :jA{SjbZcv< Z<1A9@ ӇEmOȋ*{''JX;$RVi_,MR=gAMua)ϔ7uJj-%k8gm4zJU( י ȝm!"TdsiDL7(8ݖ ~K~gBtLmGO֓Va"UI`!.K;΀Tߴ/4oD(Tchj)AЏ$innqA-,bC .붼JďU}- Cm=2[U5f6 t3TRU .-m}>oBmr =bA֠2Y._8sm~bA,*y#6O!^IS)(R9#0' -Km9I''m4Ϋ=0&?,2)X̘i[`ҔvNo|?BדmE'G&fʪЯwZ, LH`wk%D\I PKq PB1bp(SQP)K0NBWmv37=H abWQ at BsVFJ]yG:A l N**oQ]_ŀ(Iżtد,ZvMES'v0@eW.[$D:E\d2i#p-2Z߮x?4p+hNh,:;ۭ[C-!U݂]W31J'qT%S.R{^+ce裥8D*`w7 zdzY8u-Hɷ !'zԌO/xsGH:;V8Zɱ<)Fz0wWp50A0jpZTT3eMm[0)SJƀPqSJEJTp0i] zQX.-Ns-!b#Q^[9s|sςH߮W̫),)٠5k0mei_1e{iV~N=1۵;ol-Ƭs%X֪+Yч-x='O;+%r~k Y3f.Ḧ I0Oh; tP324Yw;4{F" '|L>'o[$'XA'cC Kc\r%v. .;'IYoqG"5j< wE~N LP+΄a%'MY$</XQ4+) TY<;|Z1`)Iz20rcE@;da'*HPfծyŷ ! 5PII0^/.nܨ-J!\4w*,x7J.p,HQ(]VcW%7%#a ߭aRj5{5l<ɢ("75i~c'ڮ7$h..}x'g8Ct + fS:rxDTD>~5:kje7uD怉?B8ã! Ãp@8>b_89|=>j$ߣFXbƤ{=y:ru)rrr_7|IO=}&3ݪmz&pyMț#]-y ޚNa;)y0mN9 hUGuK@w(.'):x 0Wԇ/,A' wRtG.F,m~atXk_z|gDx |>zX*+L' ؿMC(f)O &TFx7VNg+={>&W_?;OCG}ܓ16v~nde/n]2&*\ߨz ڴv?`hF~)-;]RH5i(A635t`(1R¤ՐA_?G8.j-sh2>5u!'I 3ƾ5fhKqBw*Hwh6/F˜"{J3wyѤUQp_?%03/~<[]`i}lnw%Pa= 4V.\*X>vFJ\~,j2Iij'ٍh&[,2 0(Uz;5#yͲ"w]],~fD={2t_ԽꉢjjVQc˶=}l<4=:8|2zG@bCARusage: disklabel [-Acdtv] [-h | -p unit] disk (read) disklabel -w [-Acdnv] disk disktype [packid] (write) disklabel -e [-Acdnv] disk (edit) disklabel -E [-Acdnv] [-F|-f file] disk (simple editor) disklabel -R [-nv] [-F|-f file] disk protofile (restore) `disk' may be of the form: sd0 or /dev/rsd0%c. `disktype' is an entry from %s, see disktab(5) for more info. /etc/disktab`packid' is an identification string for the device. `protofile' is the output from the read cmd form; -R is powerful. For procedures specific to this architecture see: %s fdisk(8)sector size %dsectors/track %dtracks/cylinder %dcylinders/unit %dboot block size %dwarning, boot block size %% sector-size != 0super block size %dwarning, super block size %% sector-size != 0warning, number of partitions (%d) > MAXPARTITIONS (%d)warning, partition %c: size 0, but offset %llupartition %c: offset past end of unitpartition %c: partition extends past end of unitwarning, unused partition %c: size %llu offset %lluBootstrap doesn't leave room for disk label line %d: syntax errorunknownIDEESDIline %d: warning, unknown disk type: %sbadsectvendorline %d: bad flag: %sdrivedataline %d: bad drivedata %s%d partitionsline %d: bad # of partitionsduidline %d: bad %s: %ssectors/cylindertracks/cylindercylindersrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seektotal sectorsboundstartboundendline %d: bad partition name: %sline %d: too few fieldsline %d: bad partition size: %sline %d: bad partition offset: %sline %d: warning, unknown filesystem type: %sline %d: unknown field: %sVISUALEDITOR/usr/bin/vi%s %s/bin/sh%s: No disk label on disk%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of disk%.*s|Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:nc#%u:sc#%u:su#%llu:d%d#%u\ :p%c#%llu:o%c#%llu:t%c=%s:t%c=unknown%d:b%c#%u:f%c#%u:ioctl DIOCRLDINFOioctl DIOCGPDINFOioctl DIOCGDINFO/dev/%s%c%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx.aioctl DIOCWDINFOunknown disk type: %s %c: %16llu %16llu %c: %15.*f%c %16llu %7.7s%7d %5u %5u %4hu %19.19s# %s# %s: type: %s type: %d disk: %.*s label: %.*s duid: %02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx flags: badsect vendorbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %llu # total bytes: %.*f%cboundstart: %llu boundend: %llu drivedata: %d %hu partitions: # %16.16s %16.16s fstype [fsize bsize cpg] offset # Notes: # Up to 16 partitions are valid, named from 'a' to 'p'. Partition 'a' is # your root filesystem, 'b' is your swap, and 'c' should cover your whole # disk. Any other partition is free for any use. 'size' and 'offset' are # in 512-byte blocks. fstype should be '4.2BSD', 'swap', or 'none' or some # other values. fsize/bsize/cpg should typically be '2048 16384 16' for a # 4.2BSD filesystem (or '512 4096 16' except on alpha, sun4, ...) No changes.re-edit the label? [y]: bckmgtBCKMGTValid units are bckmgt ABEf:F:hRb:cdenp:tvwSMDMSCPold DECSCSIST506HP-IBHP-FLtype 9floppyccdvndATAPIRAIDunusedVersion6Version7SystemV4.1BSDEighth-Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSHFSADFSNTFSUDF-cTreating sectors %llu-%llu as the OpenBSD portion of the disk. You can use the 'b' command to change this. OpenBSD area: ; size: ; free: # %16.16s %16.16s fstype [fsize bsize cpg] Can't stat deviceAvailable commands: ? | h - show help n [part] - set mount point A - auto partition all space p [unit] - print partitions a [part] - add partition q - quit & save changes b - set OpenBSD boundaries R [part] - resize auto allocated partition c [part] - change partition size r - display free space D - reset label to default s [path] - save label to file d [part] - delete partition U - undo all changes e - edit drive parameters u - undo last change g [d|u] - [d]isk or [u]ser geometry w - write label to disk i - modify disklabel UID X - toggle expert mode l [unit] - print disk label header x - exit & lose changes M - disklabel(8) man page z - delete all partitions m [part] - modify partition Suffixes can be used to indicate units other than sectors: 'b' (bytes), 'k' (kilobytes), 'm' (megabytes), 'g' (gigabytes) 't' (terabytes) 'c' (cylinders), '%' (% of total disk), '&' (% of free space). Values in non-sector units are truncated to the nearest cylinder boundary.%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx.%c%s%c none swap sw %s%c %s %s rw 1 %d failed to sort partition table%s: [%s] [d]isk or [u]ser geometryEnter 'd' to use the geometry based on what the disk itself thinks it is, or 'u' to use the geometry that was found in the label.Command aborted BIOS geometry not defined. Note: user geometry is the same as disk geometry. You must enter either 'd' or 'u'. Where to mount this filesystem (ie: / /var /usr)'%c' already being mounted at '%s' Mount points must start with '/' The disklabel UID is currently: %02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx The disklabel UID, given as a 16 character hexadecimal string.Invalid UID entered. partition to deleteThe letter of the partition to delete, a - p, or '*'.Partition must be between 'a' and '%c' (excluding 'c'). Partition '%c' is not in use. partition to nameThe letter of the partition to name, a - p.You cannot name a filesystem of type %s. can't get mem sizePossible values are:"IDE", "%s"Disk typeWhat kind of disk is this? Usually SCSI, IDE, ESDI, ST506, or floppy."%s" is not a valid disk type. Valid types are: Error, partitions %c and %c overlap: Disable which one? (^D to abort) [%c %c] %s: [%llu] %lldRounding size to cylinder (%d sectors): %llu FS typeFilesystem type (usually 4.2BSD or swap)FS type (decimal)Filesystem type as a decimal number; usually 7 (4.2BSD) or 1 (swap).Invalid entry Unrecognized filesystem type '%s', treating as 'unknown' Size of ffs blocks. 1, 2, 4 or 8 times ffs fragment size.Error: block size must be at least as big as page size (%d). Error: block size must be 1, 2, 4 or 8 times fragment size (%llu). Align partition to block sizeRound the partition offset and size to multiples of bsize?Rounding offset to bsize (%llu sectors): %llu Rounding size to bsize (%llu sectors): %llu fragment sizeSize of ffs block fragments. A multiple of the disk sector-size.Error: fragment size must be a multiple of the disk sector size (%d) Zero fragment size implies zero block sizeSize of the partition. You may also say +/- amount for a relative change.The size must be > 0 sectors The size can't be more than %llu sectors, or the partition would extend beyond the last sector (%llu) of the OpenBSD portion of the disk. The 'b' command can change this limit. Sorry, there are only %llu sectors left partition to change sizeThe letter of the partition to change size, a - p.Partition %c is currently %llu sectors in size, and can have a maximum size of %llu sectors. Starting sector for this partition.The offset must be >= %llu and < %llu, the limits of the OpenBSD portion of the disk. The 'b' command can change these limits. The offset must be in a free area. partition to modifyThe letter of the partition to modify, a - p.No space left, you need to shrink a partition The letter of the new partition, a - p.Partition '%c' exists. Delete it first. Starting sectorThe start of the OpenBSD portion of the disk.Size ('*' for entire disk)The size of the OpenBSD portion of the disk ('*' for the entire disk).Changing device parameters for %s: What kind of disk is this? Usually SCSI, ESDI, ST506, or floppy (use ESDI for IDE).label name15 char string that describes this label, usually the disk name.The Number of sectors per track.The number of tracks per cylinder.The number of sectors per cylinder (Usually sectors/track * tracks/cylinder).number of cylindersThe total number of cylinders on the disk.The total number of sectors on the disk.You may want to increase the size of the 'c' partition.Not enough free space to shrink by %llu sectors (only %llu sectors left) partition to resizeNo such partition Cannot resize spoofed partition [+|-]new size (with unit)new size or amount to grow (+) or shrink (-) partition including unitAmount too big Partition %c shrunk to make room No room left for all partitions You need to specify a type for this disk.can't run when there is partition overlap.No 'c' partition found, adding one that spans the disk.Label editor (enter '?' for help at any prompt) unable to get default partition tableThis option is not valid when run without the -f flag. PAGER/usr/bin/lessgunzip -qc|%sunable to execute %sIn no change mode, not writing label.No label changes.Write new label?Write the modified label to disk?unable to write labelResize only implemented for auto allocated labels Free sectors: %16llu - %16llu (%16llu) Total free sectors: %llu. FilenameName of the file to save label into.Original label and mount points restored.Last change undone.EnteringExiting%s expert mode Unknown option: %c ('?' for help) /tmp/var/usr/usr/X11R6/usr/local/usr/src/usr/obj/homelfsadosntfsudfsdrzwdFLOPPYxdhdCCDVNDsvndabcdfiklnoprstuvwxBDEGHLPTUXYZ0Cannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specForward positioning operation on archive failedCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Reverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Tape drive unable to backspace requested amountUnable to backspace tape over %d pad blocksUnable to backspace tape %d blocks.Failed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDUnable to truncate archive file%s%s: Waiting for tape drive close to complete...done. %s: unknown format, %llu bytes skipped. %s: %s vol %d, %lu files, %llu bytes read, %llu bytes written. could not pipecould not fork-dccould not exec %sFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed chdir to %sFailed stat on %sCannot write an archive on top of a directory %sUnable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Ready for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sUnable to open %s to readCannot identify format. Searching...Sorry, unable to determine archive format.Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot mix current archive format %s with %s%s: Reading archive to position at the end...Cannot chdir to %sCan't fchdir to starting directoryUser specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUnable to append when there are archive read errors.Archive read error limit (%d) reachedCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Write block size %d too large, maximium is: %dWrite block size %d is not a %d byte multipleWrite block size of %d too large, maximium is: %dWrite block size of %d is not a %d byte multipleWrite block size of %d larger than POSIX max %d, archive may not be portableUnable to allocate memory for group name cache tableUnable to allocate memory for user name cache tableUnable to allocate memory for group id cache tableUnable to allocate memory for user id cache tableFile changed size %sFile %s was modified during readFile rewind failed on: %sFailed seek on file %sFailed write to file %sFile seek on %sWARNING! Major Internal Error! GNU hack Failing!Out of memoryCould not set permissions on %sUnable to set file uid/gid of %sAccess/modification time set failed on: %sUnable to close file descriptor on %sUnable to copy %s, file would overwrite itselfUnable to remove directory %sCould not unlink %scannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCould not create: %scpioCould not access %s (stat)Unable to link file %s to itselfUnable to remove %sCould not link to %s from %sUnable to link to %s from %sA hard link to the directory %s is not allowedUnable to create %sIgnoring unterminated pathname at EOFIgnoring too-long pathname: %sCan't chdir to %snext_fileFile system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %sWARNING! These file names were not selected:Invalid file name argumentUnable to allocate memory for filenameUnable to allocate memory for file name buffer%b %e %H:%M%b %e %Y%s%s %s %s%2u %-*.*s %-*.*s %4lu, %4lu %9llu == -> %s: unknown option %c %s: %c argument missing Invalid option nameUnable to allocate space for option listInvalid options formatusage: tar {crtux}[014578befHhjLmNOoPpqsvwXZz] [blocking-factor | archive | replstr] [-C directory] [-I file] [file ...] tar {-crtux} [-014578eHhjLmNOoPpqvwXZz] [-b blocking-factor] [-C directory] [-f archive] [-I file] [-s replstr] [file ...] usage: pax [-0cdjnOvz] [-E limit] [-f archive] [-G group] [-s replstr] [-T range] [-U user] [pattern ...] pax -r [-0cDdijknOuvYZz] [-E limit] [-f archive] [-G group] [-o options] [-p string] [-s replstr] [-T range] [-U user] [pattern ...] pax -w [-0adHijLOPtuvXz] [-B bytes] [-b blocksize] [-f archive] [-G group] [-o options] [-s replstr] [-T range] [-U user] [-x format] [file ...] pax -rw [-0DdHikLlnOPtuvXYZ] [-G group] [-p string] [-s replstr] [-T range] [-U user] [file ...] directory Invalid block size %sbzip2compress/dev/rst0/dev/rst1/dev/rst4/dev/rst5/dev/rst7/dev/rst8b:cef:hjmopqruts:vwxzBC:HI:LNOPXZ014578-IUnable to open file '%s' for readProblem with file '%s'-Cwrite_opt=nodirTAPEInvalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multipleError count value must be positiveab:cdf:ijklno:p:rs:tuvwx:zB:DE:G:HLOPT:U:XYZ0%s: Invalid combination of options: -%cDestination directory was not suppliedThese format options are not supported %s = %s ustarFile name %s/%s, too longWARNING! These patterns were not matched:Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Removing leading / from absolute path names in the archive ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Pattern select out of memoryPattern list inconsistentEmpty pattern stringUnable to allocate memory for pattern stringEmpty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %s CPU time limit reached, cleaning up. Signal caught, cleaning up. Can't open current working directory.TMPDIR/tmp/Cannot allocate memory for temp file name.Unable to set up signal handlercan not gzip while appendingEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [[[[[cc]yy]mm]dd]HH]MM[.SS][/[c][m]]Unable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory for directory timesCannot canonicalize %sUnable to store mode and times for created directory: %sDirectory access time reset table ran out of memoryDevice map table out of memoryUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableCannot allocate memory for device mapping tableCannot allocate memory for interactive rename tableCannot allocate memory for hard link tableNo interactive rename table, links may failCannot update rename tableInteractive rename table out of memoryHard link table out of memoryFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sUstar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sFile is too long for ustar %snobodyUstar header field is too small for uid %lu, using nobodyUstar header field is too small for gid %lu, using nobodyUstar header field is too small for %sTar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sInvalid extended header lengthInvalid extended header recordInvalid extended header record lengthExtended header record length %lld is out of rangeMalformed extended header recordlinkpathwrite_optnodirUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.%s: /dev/ttyFatal error, cannot open %susage: ping [-DdEefLnqRv] [-c count] [-I ifaddr] [-i wait] [-l preload] [-p pattern] [-s packetsize] [-t ttl] [-V rtable] [-w maxwait] host patterns must be specified as hex digits%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0x%02xVr HL TOS Len ID Flg off TTL Pro cks Src Dst Data %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %s TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Echo ReplyDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set (MTU %d) frag needed and DF setSource Route FailedNetwork UnknownHost UnknownSource IsolatedDest. Net Administratively ProhibitedDest. Host Administratively ProhibitedDestination Net Unreachable for TOSDestination Host Unreachable for TOSRoute administratively prohibitedHost Precedence ViolationPrecedence CutoffDest Unreachable, Unknown Code: %d Source QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect, Unknown Code: %d(New addr: %s) Echo RequestRouter Discovery Advertisement(%d entries, lifetime %d seconds) Router Discovery SolicitationTime to live exceededFrag reassembly time exceededTime exceeded, Unknown Code: %d Parameter problem, required option absent: pointer = 0x%02x Parameter problem: pointer = 0x%02x TimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask Reply (Mask 0x%08x) Unknown ICMP type: %d --- %s ping statistics --- %ld packets transmitted, %ld packets received, %ld duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/std-dev = %d.%03d/%d.%03d/%d.%03d/%d.%03d ms packet too short (%d bytes) from %s%d bytes from %s: icmp_seq=%u ttl=%d time=%d.%03d ms (DUP!) (TRUNC!) wrong data byte #%d should be 0x%x but was 0x%x%x %d bytes from %s: LSRR: 0.0.0.0 %s (truncated route) (same route) RR: NOP unknown option %xping: sendtoping: wrote %s %d chars, ret=%d setresuidnumber of packets to transmit is %s: %sbad interface address: %sbad timing interval: %s%s: only root may use interval < 1spreload value is %s: %spacket size is %s: %sttl value is %s: %srtable value is %s: %ssetsockopt SO_RTABLEmaxwait value is %s: %sDEI:LRS:c:defi:l:np:qs:T:t:V:vw:unknown host: %s-f and -i options are incompatibleNo audible output for flood pingsbind-R option and -D or -T, or -t to unicast destinations are incompatiblerecord route not valid to multicast destinationsping: record routesetsockopt IP_MULTICAST_LOOPsetsockopt IP_MULTICAST_TTLsetsockopt IP_MULTICAST_IFgetsockoptsetsockoptCannot set the receive buffer sizeCould only allocate a receive buffer of %d bytes (default %d)PING %s (%s): %d data bytes PING %s: %d data bytes ping: recvfrommakeentrylinkupfileerroriblockckinodemainpass2pass2checkpass5setup (0q8@DLTcatchquitNO SPACE LEFT IN %s (EXPANDED)EXPANDUNREFDIRLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED)ADJUSTUNREF %s (RECONNECTED)RECONNECTNO lost+found DIRECTORYCREATE (CREATED)SORRY. CANNOT CREATE lost+found DIRECTORYlost+found IS NOT A DIRECTORYREALLOCATESORRY. CANNOT CREATE lost+found DIRECTORY SORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu NAME=%s %s=%s DIRECTORY CORRUPTEDwrong type to dirscan %d lost+found%d %s I=%lluBAD STATE %d TO BLKERR cannot find inode %llu bad inode number %llu to nextinode Cannot allocate space for inode buffer bad inode number %llu to ginode blk %d < cgdmin %d; blk + cnt %d > cgsbase %d blk %d >= cgdmin %d; blk + cnt %d > cgdmax %d LARGE FILES UNSUPPORTED ON REVISION 0 FILESYSTEMSSETTING LARGE FILE INDICATOR SET LARGE FILE INDICATORTRYING TO SET FILESIZE TO %llu ON MODE %x FILE I=%llu OWNER=%u MODE=%o SIZE=%llu MTIME=%12.12s %4.4s cannot increase directory list PARTIALLY TRUNCATED INODE I=%lluDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDSCLEAR (CLEARED)-%c flag requires a %s usage: %s [-dfnpy] [-b block#] [-m mode] filesystem ... Alternate super block location: %d bad mode to -m: %o ** lost+found creation mode %o b:dfm:npystarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system** Phase 1 - Check Blocks and SizesINTERNAL ERROR: dups with -p** Phase 1b - Rescan For More DUPS** Phase 2 - Check Pathnames** Phase 3 - Check Connectivity** Phase 4 - Check Reference Counts** Phase 5 - Check Cyl groups%d files, %d used, %d free %d files missing %d blocks missing The following duplicate blocks remain: %d,The following zero link count inodes remain: %llu, ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW *****EXCESSIVE BAD BLKS I=%llu (SKIPPING)CONTINUEEXCESSIVE DUP BLKS I=%lluuDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%lluINODE I=%llu HAS DTIME=%12.12s %4.4s (CORRECTED)bad size %llu:HOLD BAD BLOCKbad size %llu ndb %d:bad direct addr: %d bad indirect addr: %d LINK COUNT TABLE OVERFLOWINCORRECT BLOCK COUNT I=%llu (%d should be %d)UNKNOWN FILE TYPE I=%lluROOT INODE UNALLOCATEDALLOCATECANNOT ALLOCATE ROOT INODE DUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYFIXBAD STATE %d FOR ROOT INODE DIRECTORY TOO SHORTDIRECTORY %s: LENGTH %lu NOT MULTIPLE OF %dMISSING '..'BAD INODE NUMBER FOR '..'BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'CANNOT FIX, FIRST ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '.' BAD TYPE VALUE FOR '..'CANNOT FIX, SECOND ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '..' EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEUNALLOCATEDDUP/BADZERO LENGTH DIRECTORY%s %s %s IS AN EXTRANEOUS HARD LINK TO DIRECTORY (IGNORED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%llu ZERO LENGTHBAD/DUP%u: %2x summary info for cg %d is %d, %d, %d,should be %d, %d, %d SUMMARY INFORMATIONS WRONG FOR CG #%dblk_bitmap:bbmap:BLK(S) MISSING IN BIT MAPS #%dino_bitmap:ibmap:INODE(S) MISSING IN BIT MAPS #%dsummary info bad in superblock: %d, %d should be %d, %d SUPERBLK SUMMARY INFORMATION BADstrdup failedrealloc failedmalloc failed/r%s (%s): UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat rootCan't stat %s %s is not a character device ioctl (GCINFO): %s %s: can't read disk label %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: NOT LABELED AS A EXT2 FILE SYSTEM (%s) BAD SUPER BLOCK: %s MAGIC NUMBER WRONGBAD LOG_BSIZEBAD BLOCKS PER GROUPcompat 0x%08x, incompat 0x%08x, compat_ro 0x%08x INCOMPATIBLE FEATURE BITS IN SUPER BLOCKsuperblock mismatchesoffset %ld, original %ld, alternate %ld VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATECan't stat %s: %s %s is not a character deviceCan't open %s: %s ** %sNO WRITE ACCESS (NO WRITE)cannot allocate space for superblock LOOK FOR ALTERNATE SUPERBLOCKS%s %s %s %s %s %s SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO FSCK_FFS TO SPECIFY THELOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ext2fs(8).USING ALTERNATE SUPERBLOCK AT %d state = %d ** F%sile system is clean; not checking ** File system is already clean IMPOSSIBLE RESERVED BLOCK COUNT=%d IN SUPERBLOCKSET TO DEFAULTWRONG FPG=%d (BPG=%d) IN SUPERBLOCKBAD SUMMARY INFORMATIONcannot alloc %u bytes for blockmap cannot alloc %u bytes for statemap cannot alloc %u bytes for typemap cannot alloc %u bytes for lncntp cannot alloc %u bytes for inphead returning to single-user after filesystem check bad file type 0%o cannot allocate buffer pool INTERNAL ERROR: GOT TO reply()%s? no %s? yes %s? [Fyn?] (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %d CANNOT %s: BLK %dProgram terminated WRITETHE FOLLOWING SECTORS COULD NOT BE WRITTEN: %lld (%lld), %lld,PARTIALLY WRITING %sZERO'ED BLOCK %d TO DISK UPDATE STANDARD SUPERBLOCKSPanic: lost %d buffers MARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEANcache missed %ld of %ld (%d%%) READTHE FOLLOWING DISK SECTORS COULD NOT BE READ:deadlocked buffer pool %6d usage: %s [-benstuv] [file ...] benstuvpqll<{l@{lH{lP{lX{T{`{T{h{T{p{fx{v|{y{y{z{z{X{X{pk{pk{ԍ{{d{ { { or{roq|@foXg ||X|H(|(0|T8|PwD|PwP|fX|fd|fp|f@p8p|||i|i|xh|xh|xhDxh|xh|xh|xh|w|xh|xh|xh}xhzl}l}l} l }l(}@l0}l8}X@}LL}؋PpX}ud}ul}iehft}L ti i@XBA n@{si i|BE |} }`}}}}}}إ#}#}#}#}$}$}$}$}%}%~% ~%~&~&$~',~'8~(@~(L~)T~)`~*h~*t~+|~+~,~,~,~-~-~-~.~.~/~/~0~0~0~0112$20283D3P3X4d4p4x5566677ccdde}e  (08@HPX`dlp|   (4 ܀ < D`L`X\dlt āԁGԁ܀܀܀T  (0randommalformed link-level addressSIOCSIFLLADDRSIOCGIFXFLAGSSIOCSIFXFLAGS[#%d]SIOCG80211WPAPARMSSIOCS80211WPAPARMSSIOCGIFFLAGSSIOCSIFFLAGSSIOCIFDESTROYmedia mode %smediaopt instance %d"%.*s"0xSIOCGIFGROUPgetifgroups groups:usage: ifconfig [-AaC] [interface] [address_family] [address [dest_address]] [parameters] invalid channel %s: %sSIOCS80211CHANNELprefix %s: %sSIOCGIFMEDIA%s: no link type?only one `instance' command may be issuedmust specify `media' before `instance'media instance %s: %smtu %s: %sSIOCSIFMTUinet6autoconf not allowed for this AFremoveaf not implemented for this AFbad hexadecimal digitshexadecimal digits too longstrings too longSIOCS80211NWIDmalformed BSSID: %sSIOCS80211BSSID%s: bad value%s=%o%s=%xSIOCGETVLANSIOCSETVLANvlan tag %s: %s vlan: %d parent interface: %s SIOCG80211ALLCHANS %4s %-8s %s chanfreqproperties %4d %4d MHz passive scan%d: bad prefixleninvalid vlan tag and device specificationinvalid %s %s: %s%s not allowed for the AFvltimepltimeunknown %s media mode: %sonly one `mode' command may be issuedinvalid media mode: %sunknown %s media subtype: %sonly one `media' command may be issuedmay not issue `media' after `mode' commandsmay not issue `media' after `mediaopt' commandswpagroupcipher: unknown cipher: %sstrdupunknown %s media option: %sonly one `-mediaopt' command may be issuedmay not issue both `media' and `-mediaopt'only one `mediaopt' command may be issuedmay not issue `mediaopt' after `instance'wpaciphers: unknown cipher: %spsk802.1xwpaakms: unknown akm: %swpa1wpa2wpaprotos: unknown protocol: %snwid chan %u bssid %s lladdr %s %u%% %udB powersave %uMESSIBSSCF_POLLABLECF_POLLREQPRIVACYSHORT_PREAMBLEPBCCCHNL_AGILITY SPECTRUM_MGMT QOS SHORT_SLOTTIME APSDDSSSOFDMDELAYED_B_ACKIMMEDIATE_B_ACK,wpa2,wpa1,wep,802.1xCACHEBSSAUTHASSOCCOLLECT no permission to scanSIOCG80211ALLNODES none restore ieee80211: nwid chan %u bssid %s %u%% %udB nwkey persist%d: wpakey wpaprotos %swpa2 wpaakms %s802.1x wpaciphers wpagroupcipher powersave on (%dms sleep) (auto) %ddBm%sHIDENWIDNOBRIDGEUPBROADCASTDEBUGLOOPBACKPOINTOPOINTNOTRAILERSRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTTXREADYNOINET6INET6_NOPRIVACYMPLSWOLAUTOCONF6 rdomain %d metric %lu mtu %lu lladdr %s status: %s %s: no media types? media: supported media: tunnel: inet%s %s -> %s:%u vnetid %d ttl %dunsetifgroup: group names may not end in a digitunsetifgroup: group name too longSIOCDIFGROUPsetifgroup: group names may not end in a digitsetifgroup: group name too long SIOCAIFGROUPSIOCG80211NWIDwpakey: invalid pre-shared keywpakey: passphrase must be between 8 and 63 characterswpakey: nwid not setwpakey: passphrase hashing failedSIOCS80211WPAPSKpersist:SIOCS80211NWKEY: too many keys.0x%sInvalid WEP key lengthSIOCS80211NWKEYinterface index is already filledgetifaddrscould not determine link local address inet6 %sSIOCGIFDSTADDR_IN6 -> %sSIOCGIFNETMASK_IN6 prefixlen %dSIOCGIFAFLAG_IN6 anycast tentative duplicated detached deprecated autoconf autoconfprivacy scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime inet %sSIOCGIFNETMASKSIOCGIFDSTADDR --> %s netmask 0x%xSIOCGIFBRDADDR broadcast %sSIOCIFCREATEinvalid carp demotion: %scarpdemoteSIOCSIFGATTRSIOCGIFGATTR carp demote count %d%s: no such interface SIOCGIFGMEMBprintgroupinterface name '%s' too longcreatedestroy'%s' requires argument'%s' requires 2 argumentsSIOCDIFADDRSIOCAIFADDRarp-arpdebug-debugalias-aliasdeletenetmaskmtunwid-nwidbssid-bssidnwkey-nwkeywpa-wpawpaakmswpacipherswpagroupcipherwpaprotoswpakey-wpakey-chanbroadcastvlanvlandev-vlandevgroup-groupautoconf-autoconfanycast-anycasttentative-tentativeeui64autoconfprivacy-autoconfprivacypowersavepriorityrtlabeltxpowernwflagrdomain-inet6descriptiondescrwol-wollink0-link0link1-link1link2-link2mediamediaopt-mediaoptinstanceinstlladdrinetEthernetetherFDDIIEEE802.11TDMCARPautoselectmanual10baseT10baseT/UTP10UTP10base210base2/BNC10BNC10base510base5/AUI10AUI100baseTX100TX100baseFX100FX100baseT4100T4100baseVG100VG100baseT2100T21000baseSX1000SX10baseSTPSTP10STP10baseFLFL10FL1000baseLX1000LX1000baseCX1000CX1000baseT1000T1000baseTX1000TXHomePNA1HPNA110GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10GbaseCX410GCX410GBASE-CX42500baseSX2500SX10GbaseT10GT10GBASE-T10GSFP+Cu10GCuSingle-modeSMFMulti-modeMMFCDDIFH1FH2DS2DS5DS11DS1DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72t1t1-amie1e1-g.704e1-amie1-ami-g.704t3t3-m13e3e3-g.751e3-g.832e1-g.704-crc411a11b11gfhmasterfull-duplexfdxhalf-duplexhdxflag0flag1flag2loopbackhw-loopbacklooprxpausetxpausedual-attachdasadhochostapibssibss-mastermonitorturbohdlc-crc16pppframerelay-ansiframerelay-ciscoframerelay-ituno carrierno networkbackupactivekeepalive downusegroupwep40tkipccmpwep104displayprinttimeprintlong %s: %s: %s: directory causes a cyclefts_readCOLUMNS1ACFHLRSTacdfghiklmnopqrstux%b %e %H:%M:%S %Y%*llu %*qd total %llu %s %*u %-*s %-*s %3d, %3d %*s%*qd %*s ls: %s: %s usage: %s [-1AaCcdFfgHhikLlmnopqRrSsTtux] [file ...] usage: sysctl [-n] name %s=kern.osreleasehw.machinehw.modelhw.producthw.disknameshw.ncpufoundwarnmsgrtsol_timer_updateifconfigmake_packetmainrtsol_check_timerrtsol_inputsendpacketrtsol_inputsendpacketsockopeninterface_statusinterface_upget_rdomainlladdropt_fillinterface_statusinterface_upget_llflagget_rdomaindefrouter_probedefrouter_probe:sendprobeprobe_initmultiple interfaces foundreallocprobing %s<%s> %sillegal interface state(%d) on %sstop timer for %sset timer for %s to %lld:%ldfailed to get link layer information for %sinterface %s was already configuredmemory allocation failedlink-layer address option has null length on %s. Treat as not included.memory allocation failed for %susage: rtsol [-DdF] [-O script-name] interface ... rtsol [-DdF] -a usage: rtsold [-1DdFfm] [-O script-name] interface ... rtsold [-1DdFfm] -a adDFO:adDfFm1O:kernel is configured not to accept redirectskernel is configured as a router, not a hostfailed to open a socketfailed to initialize interfacessetting rdomain %ufailed to initialize %sfailed to setup for probing routerstimer expiration on %s, state = %d%s status is changed from %d to %dNo answer after sending %d RSsthere is no timerNew timer is %lld:%08ldselect: %srecvmsg: %sfailed to get receiving interfacefailed to get receiving hop limitpacket size(%zd) is too shortinvalid icmp type(%d) from %s on %sinvalid icmp code(%d) from %s on %sinvalid RA with hop limit(%d) from %s on %sinvalid RA with non link-local source from %s on %sreceived RA from %s on an unexpected IF(%s)received RA from %s on %s, state is %dsend RS on %s, whose state is %dsendmsg on %s: %smalloc for receive msghdr failedmalloc for send msghdr failedff02::2inet_pton failed for %sIPV6_RECVPKTINFO: %sIPV6_RECVHOPLIMIT: %ssetsockopt(ICMP6_FILTER): %sunsupported link type(%d)ioctl(SIOCGIFFLAGS) on %s: %sioctl(SIOCGIFMEDIA) on %s: %sioctl(SIOCGIFFLAGS): %sioctl(SIOCSIFFLAGS): %schecking if %s is ready...socket(SOCK_DGRAM): %sgetifaddrs: %sioctl(SIOCGIFAFLAG_IN6): %sget_llflag() failed, anyway I'll try%s is ready%s is tentative%s is duplicatedget_rdomain socket: %ssysctl(ICMPV6CTL_ND6_DRLIST): %smalloc: %sdefault router list contains a non-link-local address(%s)probe a router %s on %sshutdown: %snigrouppr_iphdnsdecodesummarypr_rthdrpr_icmphpr_nodeaddrpr_packmain4 DT\@usage: ping6 [-dEefHmNnqtvWw] [-a addrtype] [-b bufsiz] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-V rtable] [hops ...] host ff02::2:0000:0000-%uVr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->\%03o --- %s ping6 statistics --- +%ld duplicates, %.1lf%% packet lossround-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms path MTU for %s is notified. (ignored) NodeInfo Supported Qtypes, compressed bitmap, raw bitmap???nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu HbH Options: Dst Options: Routing: sendmsgping6: wrote %s %d chars, ret=%d IP6HBH DSTOPT FRAG RTHDR AH ICMP6: type = %d, code = %d ESPUnknown Header(%d) No Route to DestinationDestination Administratively UnreachableDestination Unreachable Beyond ScopeDestination Unreachable, Bad Code: %d Packet too big mtu = %d Time exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option Bad code(%d) pointer = 0x%02x Listener QueryListener ReportListener DoneRouter SolicitationRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sNode Information QueryNOOPSupported qtypesDNS namenodeaddrIPv4 nodeaddrunknown qtype, subject=%s(%s), oldfqdn, no subject, subject=%sDNS label(invalid), invalidNode Information Reply, %sBad ICMP type: %drefused truncated no address %s(TTL=infty)(TTL=%u)invalid peernamefailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!)extra (%d bytes %s)refused, type 0x%xunknown, type 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPTTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luinvalid socket buffer sizeMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %stoo small interval, raised to 0.01Must be superuser to preloadillegal preload value -- %sinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %da:b:c:dEefHg:h:I:i:l:mnNp:qS:s:tvV:wWtoo many intermediate hopsgetaddrinfo failedgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface namecan't initialize rthdrbad addr family of an intermediate addrcan't add an intermediate nodeUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP setsockopt(IPV6_RTHDR)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> recvmsgnew path MTU (%d) is notified IPv6 addressIPv4 addressSuccessRefusedusage: %s [-aju] [-d dst] [-r seconds] [-t minutes_west] [-z output_zone] %-*s[+format] [[[[[[cc]yy]mm]dd]HH]MM[.SS]] illegal time formatUTCcannot unsetenv TZad:jr:ut:z:settimeofday%a %b %e %H:%M:%S %Z %Yspecified date is outside allowed rangeCould not get local time of dayadjtimedate set by %stoo many argumentsconversion error?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for data?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?m(%T %i of %m) .?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%tCannot allocate memoryLESSSECURE-G-L-XLESS--WARNING: terminal is not fully functionalLESS_TERMCAP_DEBUG<%s>LESS_TERMCAP_krklkukdkPkNkh@7kDLINESlicoTERMhcxndadbsgpcticdcmsomdmbvbbc|^srNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketseek error to 0ch_ungetchar overrunseek errorESC^%c*s<%X>less %s(P)+Non-match First-file EOF-ignore Keep-pos Regex-off &/Pattern not found& There is no %s optionCommand not available(N-th) No %snext fileNo %sprevious fileNo such filemark: goto mark: Brackets: Warning: some edit commands disabledWarning: some commands disabled@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)LESSMETAESCAPELESSMETACHARS; *? '"()<>[]|&^`#\$%=~%c%s%c%s %s %sLESSCLOSEInvalid LESSCLOSE variableLESSOPENInvalid LESSOPEN variable...skipping... Cannot seek to that file positionDetermining length of fileDon't know length of fileCannot seek to end of fileCannot seek to beginning of fileCannot seek to line number %nLESSANSIENDCHARSLESSANSIMIDCHARS0123456789;[?!"'#%()*+ Line numbers turned offCalculating line numbersInvalid mark letterMark not setUse "h" for help-" must be followed by 1 or 2 charsquotes %sTab stops and then every %d spacesless POSIX regular expressions) Copyright (C) 1984-2012 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less #Invalid column fractionInvalid column numberHorizontal shift %d columns.%06dHorizontal shift %s of screen widthjInvalid line fractionInvalid line numberPosition target at screen line %dPosition target at screen position %sNumber is required after %sValue is required after %s--%s-%c (--%s)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric option-%sThere is no %s option ("less --help" for help)LESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenAssume intelligent terminalAssume dumb terminalDon't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numbersprompt: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directlyDisplay control characters directly, processing ANSI sequencesDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linesDisplay underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersfakeInvalid patternNo previous regular expressionPlease re-enter search patternNothing to searchmain|8|ȩ Щ\ l@LH ȵ@еȯܯusage: %s [-23bcdilsTU] [-a maxreadahead] [-g maxgroups] [-I readdirsize] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-w writesize] [-x retrans] rhost:path node hostname too longno : or @ speccan't resolve address for host %sNFS PortmapCannot MNT RPCbad MNT RPCcan't access %s-2 and -3 are mutually exclusiveillegal -a value %s: %sillegal -g value %s: %sillegal -I value %s: %sconflicting version optionsillegal -R value %s: %sillegal -r value %s: %sillegal -t value %s: %sillegal -w value %s: %sillegal -x value %s: %s23a:bcdD:g:I:iL:lo:PR:r:sTt:w:x:Ubgconndumbtimernfsv3mntudpresvportnfsv2acmainUSER_print_diskUSER_modifygetuintask_pidask_numMBR_pcopyunused DOS FAT-12 XENIX / XENIX /usr DOS FAT-16 Extended DOSDOS > 32MB NTFS AIX fs AIX/Coherent OS/2 Bootmgr Win95 FAT-32 Win95 FAT32LDOS FAT-16 Extended LBAOPUS OS/2 hidden Compaq Diag.OS/2 hidden OS/2 hidden OS/2 hidden AST swap Willowtech ThinkPad Rec Willowsoft $NEC DOS 'Win Recovery8Theos 9Plan 9 @VENIX 286 ALin/Minux DRBLinuxSwap DRCLinux DR MQNX 4.2 Pri NQNX 4.2 Sec OQNX 4.2 Ter PDM QDM RCP/M or SysVSDM TOntrack UEZ-Drive VGolden Bow \Priam aSpeedStor cISC, HURD, *dNetWare 2.xxeNetWare 3.xxfNetWare 386 gNovell hNovell iNovell pDiskSecure uPCIX Minix (old) Minix (new) Linux swap Linux files*OS/2 hidden Linux ext. NT FAT VS NTFS VS Linux LVM Amoeba FS Amoeba BBT Mylex BSDI NotebookSaveFreeBSD OpenBSD NEXTSTEP MacOS X NetBSD MacOS X bootMacOS X HFS+BSDI filesy*BSDI swap Solaris CTOS DRDOSs FAT12DRDOSs < 32MDRDOSs >=32MHPFS DisbledCPM/C.DOS/C*Dell Maint SpeedStor SpeedStor SpeedStor BeOS/i386 EFI GPT EFI Sys SpeedStor DOS 3.3+ SecSpeedStor Xenix BBT XwriteXreinit[Ys8~EWlw)bKp;&sctd$)RM_spS3/W.7ooq89Z'nz%߫D-tv`Pqk >\kb0A<Or<ʣ4+%NThEVέ]`7kq ?/xPb+'TSx*H" =T!KĐ%?S,~Tvz53~:gXAױ%yXɃII2)aY _]8Uip^+ʼJlh}Ԇ)2fz%F'9qS+UNϜG0ڱ1Fu<ͼ r50J(P97ۂxX4.VaEs&` Ev+4x,]i. UT`u`i]%qTv>-q_TC= T#g2NagW > P)'?8XtGZe[; RSγH?iW]CLq%VXt|8:vSȂQ#e-xTɨ8FvoɭDMT~-4'^D14A!m~TZw-A[E+oL%djHBjv''4$w:C+RL@nG*r@ꚂDgHmŰ/Q:!)M'ka 2}~Q^N{?"yHZK,^ݞl@Zl.u4pt[4 {&(z ĬUx.$2Mh)_XslI$,$e  { YD:?u?VwS}aħ̌m@'1ݫ KK6(K[D WG.zأ- \>![z&}J kĜrXe&8Rׅ֮2y,8~cPK/Ƞ T7MS*b\twM",( cE﹌=?8NR!*o/kp>04)Ӛ5@l]<aզ&8C(3$ȬFtvضb7ށT%rY++ _LG,CB5 SKʺmLi16<_z)>p?ejv4'k?J0QJ))כvO"FV]_p=3h׷n7}_ F ;qx-/典x'I /nͯW FZA 3hE>١ Il%[2J‰>?˹\kw  7zcyp6: Ge?憽͹ n7/:-94Fim/ _#e:~>+\ʷVF㹛©郢WJ ǃ,@j6r*P]m*T5k=v9VEfB*v{a\#)% ZE.Dd֞Hg/fju]Jcx,Q%{}[eX:KIêDxLG[0Ǿj2䊍AV3:eJeQrVB⴯ȥ qhdxӦw(\YWR^nH r)lË`b~rxx|.v\%L90 &&=\x| 2oƉ[3]]JX*I҄WΑ|KȰ,5CLu[(.ōZ$uKG4;yqNr?" l;M\x<]{oJ/LA2$dSuZ_XK/n_G" &#=xx<͎;Uar7=r4ҩf/T~2ߛ^#TZSwec?5>}(K8hXX-S6xv5!2h}-+;97c?̎ ֋jLbv:m8._I!i xr¸`f50'*op8GZ?>bdX[ir+23m<|{12VIm!J^cXrm+m>4[bȍ zi[DAٖ)7EGLBP K81+mܢ3Z1*c7-=ggԻHB*xjO#D:]2[*Q[@st3ܹ v+Lb)"uBT g _Z͢Ec77kvR,ͱb֟.h;tJտ.h;+RB%")D ڑ(ZE9'=>iENǮubM|::n"*+L<6`wsoxFiavvU[;VknyNZ (yMQ^Ǫ6/pϳ9.R ՂN?P5zn ַh'6\@ }U|8pk뵵u.njl!ԕQ˕^(w `\]d. el7Ykit&I˺zǫS&TbbrśxkZ)wȊ^WuChW 7(*i#h-$@0jݬY:SDadcp--sku]rDZls=>]!m,@hlϽڼg[^x][iG;3֞/v.?|8'i`1 ]/ӗ1Y5#SfrCi2 ڎk!︯fk /jn:H{W4(}q#&!4ڸHrFpg4o*~3a,S'f!MPbvu\w-s?䰛@*- Mluwcy<^AVn]M\ēXodLNOhf]ߜi=aۚH _aȬv;Zkvr"9oˤo?>3mxrJZj{rgX(<_`31KE ͱ–o.>nA $eSB'l F0 ?TO& eW*w_|R˽tzZrQ?vz[3/usage: %s [-eiuy] [-c cylinders -h heads -s sectors] [-f mbrfile] [-l blocks] disk -i: initialize disk with virgin MBR -u: update MBR code, preserve partition table -e: edit MBRs on disk interactively -f: specify non-standard MBR template -chs: specify disk geometry -l: specify LBA block count -y: do not ask questions `disk' may be of the forms: sd0 or /dev/rsd0c. Cylinder argument %s [1..262144].Head argument %s [1..256].Sector argument %s [1..63].Block argument %s [64..%u].ieuf:c:h:s:l:yPlease specify a full geometry with [-chs].Can't get disk geometry, please use [-chs] to specify.using builtin MBRUnable to read MBRerror initializing MBROffset: %lld Enter 'help' for informationfdisk:%c%d> Invalid command '%s'. Try 'help'. Aborting changes to current MBR.Do you wish to write new MBR?Do you wish to write new MBR and partition table?Command help listShow entire OpenBSD man page for fdiskreinitRe-initialize loaded MBR (to defaults)setpidSet the identifier of a given table entryEdit current drive statseditEdit given table entryflagFlag given table entry as bootableUpdate machine code in loaded MBRSelect extended partition table entry MBRSwap two partition entriesPrint loaded MBR partition tablewriteWrite loaded MBR to diskexitExit edit of current MBR, without saving changesQuit edit of current MBR, saving current changesabortAbort program without saving current changes%s: [%u] %s is out of range: %c%s%c %s is invalid: %c%s%c %s [n] Partition id ('0' to disable) [%X - %X]: [%X] (? for help) '%s' is not a valid number. '%x' is out of range. %s [%d - %d]: [%d] %s is %s: %s. BytesSectorsKilobytesMegabytesGigabytesDisk: %s geometry: %d/%d/%d [%.0f %d-byte %s] geometry: %s is not a character device or a regular fileDIOCGPDINFOdisk too large (%llu sectors). size truncated.Signature: 0x%X Start of partition #%d after end! Starting Ending LBA Info: #: id C H S - C H S [ start: size ]-------------------------------------------------------------------------------%c%1d: %.2X %6u %3u %3u - %6u %3u %3u [%12u:%12.0f%s] %s Warning CHS values out of bounds only saving LBA valuesChoose from the following Partition id values:%02X %s %02X %s %02X %s %02X %s partition number is %s: %s. flag value is %s: %s. Partition %d marked active. Partition %d flag value set to 0x%x. %s %s Machine code updated.partition number is invalid:partition number is %s: %s %d same partition as %d, doing nothing. MBR contains more than one OpenBSD partition!Write MBR anyway?Writing MBR at offset %d. error writing MBROffset: %d Partition %d is not an extended partition. Loop to offset 0! Not selected.Selected extended partition %d New MBR at offset %d. Change disk geometry?BIOS CylindersBIOS HeadsBIOS SectorsPartition %d is disabled. Do you wish to edit in CHS mode?BIOS Starting cylinderBIOS Starting headBIOS Starting sectorBIOS Ending cylinderBIOS Ending headBIOS Ending sectorPartition offsetPartition sizeIn memory copy is initialized to:Use 'write' to update disk.invalid file type(standard input)(fd %d)usage: %s [-abcEFGHhIiLlnoqRsUVvwx] [-A num] [-B num] [-C[num]] [-e pattern] [-f file] [--binary-files=value] [--context[=num]] [--line-buffered] [pattern] [file ...] ^\((%s[[:<:]]%s%.*s%s[[:>:]]%scontext out of rangegrep version %u.%u binarywithout-matchtextUnknown binary-files optionCan't use small fgrep with -wbinary-filesmmapline-bufferedafter-contextbefore-contextextended-regexpfixed-stringsbasic-regexpwith-filenamebyte-offsetregexpno-filenameignore-casefiles-without-matchfiles-with-matchesline-numberquietsilentrecursiveno-messagesrevert-matchword-regexpline-regexpunix-byte-offsets0123456789A:B:CEFGHILRUVabce:f:hilnoqrsuvwxyLine is too big to processBinary file %s matches usage: %s %s umount [-fv] special | nodeumount -a [-fv] [-h host] [-t type]%s: not currently mounted%s: not a directory or special device%s: unmount from %s afh:t:vmain|8|ȩЩ@usage: mount_msdos [-9lsx] [-g gid] [-m mask] [-o options] [-u uid] special node invalid file mode: %sunknown user id: %sunknown group id: %ssl9xu:g:m:o:stat %snot an MSDOS filesystemcheckfsfsck_%snostart %s %swait %s%s/fsck_%sexec %sCan't get resource limit to max data sizeCan't get resource limit for data size-b %sInvalid option stringusage: %s [-dfNnpvy] [-b block#] [-l maxparallel] [-T fstype:fsoptions] [-t fstype] [special | node ...] b:dfl:nNpT:t:vy%s: unknown special file or file system.Can't open checklist file: %s/etc/fstabpass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s: Unknown pid %lddone %s: %s (%s) = %x %s: %s (%s): EXITED WITH SIGNAL %d THE FOLLOWING FILE SYSTEM%s HAD AN %s UNEXPECTED INCONSISTENCY:%s: %s (%s)%s, )c]!!\cX%`-V%`,i\1Sn6i!XfffffffffffffffffffffffffffffffmRQw }dNfev_gY&V0V$xYMuAAM pywy@so+lRJ'x/C/=M+ O$+malloc %zuuntrusted comment: invalid comment in %s; must start with '%s'comment too longmissing new line after base64 in %sinvalid base64 encoding in %sEdunsupported file %sverification failed: checked against wrong keysignature verification failedSignature Verifieddup failedcan't open %s for %snot a valid file: %smsg too large in %sread from %susage: %1$s -V [-eq] [-x sigfile] -p pubkey -m message verify with /etc/signify//../untrusted path %smust specify pubkeyCGISVc:em:np:qs:x:must specify sigfile with - message%s.sigpath too longmust specify messagewrite to %susage: %s [-m mode] fifo_name ... usage: %s [-m mode] name b|c major minor %s [-m mode] name p node must be type 'b' or 'c'.non-numeric major number.non-numeric minor number.major or minor number too largemkfifoinvalid file mode.m:sodumpinet6_makenetandmaskgetaddrprint_rtmsgmonitorԁGԁ܀܀܀Tnetname6routenamep_flagsp_rtentry0123456789abcdefUGHRBD M@dmCXLS1@2 3cPT l@bdefaultconnectedstaticospfis-isbgpbad label: %s is %sinvalid table id: %slabel too longprefixlen is not supported with af %dprefixlen %s is %s%s: link %s; %s: inet %s; %s: inet6 %s; set_metric mtu: %s is %sset_metric expire: %s is %sking bula sez: set_metric with invalid key128internal error%s: resolved to multiple valuesmpls labels require -in or -out switch%s: not a network%s: bad address%d: bad address familybotched keyword: %susage: %s [-dnqtv] [-T tableid] command [[modifiers] args] commands: add, change, delete, exec, flush, get, monitor, show setrtable sockaddrs: locks: inits: route to: %s routing message version %d not understoodmessage length mismatch, in packet %d, returned %dRTM_GET: %s (errno %d)destination: %s mask: %s gateway: %s interface: %.*s if address: %s mpls label: %s %s priority: %u (%s) flags: label: %s use mtu expire%8llu %8u%c %8lld%c sockaddrs: [rtm_type %d out of range]: len %d, if# %d, name: %s, link: %s, flags:, metric %d, flags:, if# %d, name %s, what: arrivaldeparture, priority %d, table %u, pid: %ld, seq %d, errno %d flags: use: %8llu mtu: %8u%c expire: %8lld%cso_dstso_gateso_maskso_ifpso_ifaso_labelso_srcwriting to routing socketread from routing socketmust be root to alter routing table-mplslabel requires -inet or -inet6-in requires -mpls-out requires -mpls-out requires -push, -pop, -swap-pop requires -mpls-push requires -mpls-swap requires -mplspriority is %s: %snetmask missing: gateway %sentry in userouting table overflownot in tableroute-sysctl-estimateactual retrieval of interface tablesetsockopt(ROUTE_MSGFILTER)setsockopt(ROUTE_TABLEFILTER)got message of size %d on %sno such interface %sactual retrieval of routing tableExamining routing table from sysctl(address family %s) write to routing socketgot only %d for rlen %-20.20s donednqtT:vrouting table %d/dev/nulladdblackholechangecloningdstencapexpiregatewaygethopcountifaifpjumbolinkllinfolocklockrestmpathmplslabelnojumbonostaticpopproto1proto2pushrecvpiperejectrttrttvarsasendpipeshowssthreshxresolveRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics or flagsRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_RESOLVE: Route created by cloningRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_IFINFO: iface status changeRTM_IFANNOUNCE: iface arrival/departureRTM_DESYNC: route socket overflowPUSHLOCALPOPSWAPlink#%dillegal prefixlen%s/%d%u/%d%u.%u/%d%u.%u.%u/%d%u.%u.%u.%u/%daf %d: %s(%d) %s%-6s %-*.*s %-6u/esp/ah/ipcomp/ipip//use/require/acquire/deny/bypass/dontacq//in/out%-*s %-5u %-*.*s %-5u InternetInternet6Encap Protocol Family %d: MPLS%-18s %-5s %-18s %-5s %-5s %-22s SourcePortProtoSA(Address/Proto/Type/Direction)%-9s %-9s %-6s %-18s %-6.6s %5.5s %8.8s %5.5s %4.4s %s In labelOut labelOpGatewayFlagsRefsUseMtuPrioInterface%-*.*s %-*.*s %-6.6s %5.5s %8.8s %5.5s %4.4s %sIfaceLabel%-6.6s %5u %8llu %5u %5s %2d %-5.16ssysctl of routing tableRouting tablesspd-sysctl-estimatesysctl of spd Encap:Extra `@' characters in usernames and passwords should be encoded as %%40 KMGTPftp://http://file::/Can't allocate memory for URL decodingerror in base64 encoding <>"#{}|\^~[]`receivedCan't allocate memory to parse URLurl_get: Invalid URL '%s'No `/' after host (use -o): %sNo filename after host (use -o): %sNo filename after directory (use -o): %sCan't allocate memory for proxy URL.Malformed proxy URL: %sCan't open file %sCan't open %sCan't allocate memory for transfer bufferWriting %sReading from file(unknown)Trying %s... r+Requesting %sCan't allocate memory for URL encoding%%%02x (via %s) GET %s HTTP/1.0 Proxy-Authorization: Basic %s%s %s GET %s HTTP/1.0 %s%s GET /%s %s Host: HTTP/1.0Can't allocate memory.[%s]:%s %s%s Writing HTTP requestReceiving HTTP replyError retrieving file: %sToo many redirections requestedContent-Length: Location: Relative redirect not supportedCannot allocate memory for URLRedirected to %s Reading from socketRead short file. Auto-login using ftp URLs isn't supported when using $ftp_proxyImproper response from %sftp_proxyhttp_proxyCan't allocate memory for auto-fetch.Invalid URL: %sCan't connect or login to host `%s'*?[]{}NLSTRetrieving %s/%s mget file fetch aborted. http fetch aborted. Forced abort. The connection will be closed. local: %srunique: can't find unique file name. receive aborted waiting for remote to finish abort. acceptsetsockopt TOS (ignored)%c%c%c421 Service not available, remote server has closed connection. Lost control connection for abort.%cABOR No control connection for command.QUITRETRSTOUSTORPASVproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s use of scoped address can be troublesomeEPSVwrong server: return code must be 229 LPSVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%uBad family! %c%c%c%d%cparse error! setsockopt (reuse address)setsockopt IP_PORTRANGE (ignored)setsockopt IPV6_PORTRANGE (ignored)listenEPRT |%d|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dlocal: %s remote: %s REST %lldnetin%s: short writeWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sftpgatehttp%s: bad port number `%s'connect to address %sfdopen failed.Connected to %s. usage: %1$s [-o output] ftp://[user:password@]host[:port]/file[/] ... %1$s [-o output] http://host[:port]/file ... %1$s [-o output] file:file ... %1$s [-o output] host:/file[/] ... FTPSERVERPORTFTPMODEpassivegateunknown FTPMODE: %s. Using defaultsgate-ftpFTPSERVERNeither $FTPSERVER nor $GATE_SERVER is defined; disabling gate-ftpdumbemacssukeep alive amount is %s: %sretry amount is %s: %s46AaCc:dD:Eegik:mno:pP:r:S:s:tU:vVUser-Agent: OpenBSD ftpnmap: unbalanced brackets. CWD %sCWD command not recognized, trying XCWD. XCWD %scan't get cwdSkipping non-relative filename `%s' a+winternal error: unknown type %d.TYPE %s %sTYPE %susage: %s [ | Using %s mode to transfer files. %s: unknown mode. asciiimageebcdictenex%lld byte%s %s in %.2f seconds (%.2f %sB/s) ETA: %02d:%02d:%02d %-*.*s%s %-*.*s%s %3d%% %3d%% |%.*s%*s|************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************* %5lld %c%c %2d:%02d:%02d --:-- ETA - stalled -%02d:%02d ETAUnable to determine real path of `%s'%s: not foundunable to create temporary file: %sftpXXXXXXXXXXLISTcan't find list of remote files, oops. can't find list of remote files, oops.anonymous%s@Name (%s:%s): Name (%s): USER %sPassword:PASS %sAccount:ACCT %sLogin %s failed.Already connected to %s, use close first. gateserver not defined (shouldn't happen)PASSERVE %sConnected via pass-through server %s non-printstreamSYSTRemote system type is %s. 215 UNIX Type: L8215 TOPS20Remember to set tenex mode when transferring binary files from this machine. SIZE %sMDTM %s191Y2K warning! Fixed incorrect time-val received from server. %*s %04d%02d%02d%02d%02d%02dCan't convert %s to a time. mainusage: %s [-dn%sq] dlnpqhalted (with powerdown) by %shalted by %srebooted by %s~SIGTSTP init/etc/rc/dev/consolerevokesetsidopenSIGTERM processesWARNING: some process(es) wouldn't die(can't restart init): main|8|ȩ@Щ usage: mount_ffs [-o options] special node filesystem must be mounted read-only; you may need to run fsckreload5X{3"3333xK333'4 , 4&8}$4,4h84#@4ܢ$H4P4X4`4p4 x4 4!48(^88 (888888888889898$98@9L9,X9d9p9|9999999,9::0:4:,D:X:l:::::9::;;(;@;X;d;8p;8|;<~;8;8;;;8;8 <$<4<L<`<x<<<<,<<<=<~=<~$=<~0=@=8P=d=t=8=8=8=8=8=8=8=8=8> ><~,><~8><~D><~P><~h><~t><~>8><~><~><~><~><~><~><~><~><~><~?<~?<~ ?<~,?<~8?<~D?<~P?<~\?<~h?<~t?<~?<~?<~?<~?<~?<~?<~?<~?<~?<~?<~?<~@<~@<~@<~(@<~4@L@P@<~\@<~h@<~t@<~@<~@<~@<~@<~@<~@<~@<~@<~@<~@<~@<~A<~A<~A<~(A<~4A<~@A<~LA<~XAlA<~xA<~A<~A<~A<~A8A<~A<~A<~A<~A<~B<~ B<~B<~$B<~0B<~DHCPOFFERDHCPNACKBOOTREPLY%s from %s (%s)no memory for info stringeof in string constantstring constant too longnumeric token larger than internal bufferappendbackoff-cutoffbootpdenyethernetfixed-addresshardwareignoreinitial-intervallink-timeoutmediumnext-serverprependrebindrenewrequireretryselect-timeoutsendserver-namesupersedetimeout%s line %d: %s%*c^ %s: msgbuf_write: %sRTM_DELETE write: %sshort RTM_DELETE write (%zd) DHCLIENT DHCLIENT %dcreating route label: %screating route label: label too long (%d vs %zu)default route socket: %sRTM_GET of default route: %sget default route read: %sno data from default route readdefault route read rtm: %ssendhup: imsg_compose: %ssendhupadd_address: imsg_compose: %sadd_addressdelete_address: imsg_compose: %sdelete_addressadd_route: imsg_compose: %sadd_routeflush_routes: imsg_compose: %sflush_routessocket open failed: %sSIOCAIFADDR failed (%s): %sSIOCDIFADDR failed (%s): %sdelete_addresses getifaddrs: %sRouting Socket open failed: %sfailed to add default route: %ssysctl size of routes:routes buf malloc:sysctl retrieval of routes:route cleanup failed - %s %s (msize=%zu)opening socket to flush routes: %s%d bad IP checksums seen in %d packets%d udp packets in %d too long - dropped%d bad udp checksums in %d packetspadsubnet-masktime-offsetIAtime-serversien116-name-serversdomain-name-serverslog-serverscookie-serverslpr-serversimpress-serversresource-location-servershost-nameboot-sizemerit-dumpdomain-nameswap-serverroot-pathextensions-pathip-forwardingnon-local-source-routingpolicy-filterIIAmax-dgram-reassemblydefault-ip-ttlpath-mtu-aging-timeoutpath-mtu-plateau-tableSAinterface-mtuall-subnets-localbroadcast-addressperform-mask-discoverymask-supplierrouter-discoveryrouter-solicitation-addressstatic-routestrailer-encapsulationarp-cache-timeoutieee802-3-encapsulationdefault-tcp-ttltcp-keepalive-intervaltcp-keepalive-garbagenis-domainnis-serversntp-serversvendor-encapsulated-optionsnetbios-name-serversnetbios-dd-servernetbios-node-typenetbios-scopefont-serversx-display-managerdhcp-requested-addressdhcp-lease-timedhcp-option-overloaddhcp-message-typedhcp-server-identifierdhcp-parameter-request-listBAdhcp-messagedhcp-max-message-sizedhcp-renewal-timedhcp-rebinding-timedhcp-class-identifierdhcp-client-identifieroption-62option-63nisplus-domainnisplus-serverstftp-server-namebootfile-namemobile-ip-home-agentsmtp-serverpop-servernntp-serverwww-serverfinger-serverirc-serverstreettalk-serverstreettalk-directory-assistance-serveruser-classoption-78option-79option-80option-81relay-agent-informationoption-83option-84nds-serversnds-tree-namends-contextoption-88option-89option-90option-91option-92option-93option-94option-95option-96option-97option-98option-99option-100option-101option-102option-103option-104option-105option-106option-107option-108option-109option-110option-111option-112option-113option-114option-115option-1 08`6S<  6S1Ԙt`[~ [~6S`@@<@TU LSbbLSbbA7SY۩8S.z#8S.z#` yA7S7S7Sa xeC7S7S7Sb ~A7St7St7Stc A7St7St7Std șeA7St7St7Ste <йA7S 7S 7S f T_ hnYI?X*.msώӊ\2ѻ&4_ xv {* L@զriV<]v Lcm|̕Srr%o>-F[g9Zw+B 9"zR$wvC1lYkPBof B*xJ,GS+</kV'u'R`u3,gUJ_ޫ#x`>|\$aOBuR b>pCХ!pCI}[=#6w8k-㭶H].#h݃6w‚)[iХW*n\m'aQÊB~GW_*0mg!nLxO %΁dy;b=p<jd$45; O C<qhEƜ;elϯnbTTj8~47pZr{RAs|*Pނaj~ng0HŦOWhj Ƽ97"&DVFruN5īJ)Mχ-;@ . ..arch@ catdate@chmod@chgrp@ cp dd df edexpr@hostnamek2 ksh sh ln ls mtsha256sha512mkdir@eject@ mv pax tar rmsleep@stty@|sync@A ...B ...C ...D . ..EkeymapsmiscqE .D..F ...ip 0 IP icmp 1 ICMP tcp 6 TCP udp 17 UDP 16option-117option-118option-119option-120classless-static-routesCIAoption-122option-123option-124option-125option-126option-127option-128option-129option-130option-131option-132option-133option-134option-135option-136option-137option-138option-139option-140option-141option-142option-143tftp-config-fileoption-145option-146option-147option-148option-149voip-configuration-serveroption-151option-152option-153option-154option-155option-156option-157option-158option-159option-160option-161option-162option-163option-164option-165option-166option-167option-168option-169option-170option-171option-172option-173option-174option-175option-176option-177option-178option-179option-180option-181option-182option-183option-184option-185option-186option-187option-188option-189option-190option-191option-192option-193option-194option-195option-196option-197option-198option-199option-200option-201option-202option-203option-204option-205option-206option-207option-208option-209option-210option-211option-212option-213option-214option-215option-216option-217option-218option-219option-220option-221option-222option-223option-224option-225option-226option-227option-228option-229option-230option-231option-232option-233option-234option-235option-236option-237option-238option-239option-240option-241option-242option-243option-244option-245option-246option-247option-248classless-ms-static-routesoption-250option-251autoproxy-scriptoption-253option-254option-endexpecting semicolon.time string too longinvalid time string%w %Y/%m/%d %T UTC%w %Y/%m/%d %T%u %Y/%m/%d %Tunparseable time stringtime could not be representedexpecting unsigned 32-bit decimal value.expecting CIDR subnet.expecting '/'.Expecting CIDR prefix length.expecting 'ethernet'.expecting '.'.expecting decimal octet.filename must be a stringno memory for string %s.dispatch_imsg: imsg_get failure: %sbad IMSG_DELETE_ADDRESSbad IMSG_ADD_ADDRESSbad IMSG_FLUSH_ROUTESbad IMSG_ADD_ROUTEbad IMSG_HUPshort IMSG_WRITE_FILEbad IMSG_WRITE_FILE (%zu)received unknown message, code %uusage: %s [-] [-s] [-p string] [file] cannot close temp fileinvalid address/tmp/ed.XXXXXXXXXXw+cannot open temp fileline too longcannot seek temp filecannot write temp filecannot read temp fileunexpected end-of-file& no previous commandinvalid pattern delimiter\  \abfnrtv\cannot read stdincannot write filecannot open output filecannot close output filecannot read input filenewline inserted newline appended cannot open input filecannot close input fileinvalid mark charactered.hup/ed.hupno current filenameinvalid filenamefilename too longno matchnumber out of rangeinvalid command suffixunexpected addressunexpected command suffixinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioncrypt unavailableHOMEcrypt unavailable ? p:sx ? interrupt? warning: file modifiedscript, line %d: %s unbalanced brackets ([])trailing backslash (\)no previous patterninfinite substitution loopnothing to undocopy_link%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).HLPRfiprthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too longusage: %s [-fip] [-R [-H | -L | -P]] source target %s [-fip] [-R [-H | -L | -P]] source ... directory lchown: %sutimes: %schown: %schmod: %schflags: %sunlink: %smknod: %smkfifo: %sreadlink: %ssymlink: %soverwrite %s? 8^@^D^H^h^x^xRO M|Q^^^\\      A@!  @a`10  @`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O @@ !1Aa  0@` #+3;CScs^^(^^^^^^^(^Vusage: %s [-123456789cdf%sh%slNnOqrt%sv] [-b bits] [-o filename] [-S suffix] %*s [file ...] usage: %s [-cfh%slNnqrt%sv] [-o filename] [file ...] usage: %s [-f%shqr] [file ...] OK %4.1f%% -- replaced with %s %lld bytes in, %lld bytes out method crc date time compressed uncompressed ratio uncompressed_name%-7.7s %08x %s %10lld %10lld %4.1f%% %s %10lld %10lld %4.1f%% (totals) .-_tgztazfchown: %sfchmod: %sfchflags: %sfutimes: %scompression not supported%s: won't read compressed data from terminal%s: unrecognized file formatcrc errorzcatzipunknown program nameGZIPoption -a is ignored on this systemillegal bit count -- %s-o argument is too long-o option may only be used with a single input filemay not mix -o, -c, or -t options%s is a directory: ignored: unchanged%s not a regular file%s%s already has %s suffix -- unchanged%s: unknown suffix: ignored%s%s: name too long%s: input: %sdeflate.gz123456789ab:cdfhLlNnOo:qrS:tVvcfhLlNno:qrtVvfhqrZgzz1.2.3need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible versionusage: %s [-R [-H | -L | -P]] %s file ... owner[:group]usage: %s [-h] [-R [-H | -L | -P]] %s file ... %s [-h] [-R [-H | -L | -P]] :group file ... group is %s: %suser is %s: %sHLPRXfghorstuwxthe -R and -h options may not be specified together.invalid flags: %sinvalid flag: %smakeentrylinkupfileerrordirscaniblockckinodecheckfilesyspass2pass2checkpass5setup (0q8@DLT @ catchinfocatchquit?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@%lld %s I=%llubad size: blk %lld, offset %lld, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock.fs_fpg %d cannot allocate memory for inode cache cannot increase directory listbad inode number %llu to nextinode %llu cannot alloc %lu bytes to extend inoinfo CG %d: BAD MAGIC NUMBER %lld files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %lld files missing %lld blocks missing conversion levelcannot do level %d conversion usage: %s [-fnpy] [-b block#] [-c level] [-m mode] filesystem ... dfpnNyYb:c:m:EXCESSIVE DUP BLKS I=%llucannot alloc %u bytes for inoinfobad direct addr: %ld bad indirect addr: %ld INCORRECT BLOCK COUNT I=%llu (%ld should be %d)too many inodes %llu cannot realloc %zu bytes to %zu for inoinfo phase 1, inode %llu/%lluphase 1b, inode %llu/%llu%s %s: LENGTH %ld NOT MULTIPLE of %d%s %s: LENGTH %ld NOT MULTIPLE OF %dphase 2, directory %d/%dphase 2, parent directory %d/%d (REMOVED)phase 3, directory %d/%ldphase 4, inode %llu/%lluDELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCREATCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS UNKNOWN ROTATIONAL TABLE FORMAT %d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %ld MARKED FREE ALLOCATED FRAG %ld MARKED FREE BLK(S) MISSING IN BIT MAPSphase 5, cg %d/%d%s: NOT LABELED AS A BSD FILE SYSTEM (%s) NCG OUT OF RANGECPG OUT OF RANGENCYL LESS THAN NCG*CPGSBSIZE PREPOSTEROUSLY LARGEILLEGAL BLOCK SIZE IN SUPERBLOCKILLEGAL FRAGMENT SIZE IN SUPERBLOCKoffset %d, original %ld, alternate %ld VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN LAST ALTERNATEINFORMATION; SEE fsck_ffs(8).clean = %d UNDEFINED OPTIMIZATION IN SUPERBLOCKIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE NPSECT=%d IN SUPERBLOCK (FIXED)INCORRECT BMASK=%x IN SUPERBLOCKINCORRECT FMASK=%x IN SUPERBLOCKINCORRECT BSHIFT=%d IN SUPERBLOCKINCORRECT FSHIFT=%d IN SUPERBLOCKFormat of filesystem is too old. Must update to modern format using a version of fsck from before release 5.0 with the command ``fsck -c 2'' INCORRECT MAXFILESIZE=%llu IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%lx IN SUPERBLOCKINCORRECT QFMASK=%lx IN SUPERBLOCKINCONSISTENT CGSIZE=%d INCONSISTENT INOPB=%d INCONSISTENT NINDIR=%d cannot alloc %u bytes for cylinder group summary area cannot alloc %u bytes for inostathead cannot alloc %zu bytes for inpsort cannot alloc %zu bytes for inphead inoinfo: inumber %llu out of rangeCANNOT %s: BLK %lldWRITING %sZERO'ED BLOCK %lld TO DISK UPDATE STANDARD SUPERBLOCK   delete %d: %sinsert %d: %ssession database close: %ssession database open: %scannot get kernel security level: %scannot change kernel security level from %d to %d: %sfatal signal: %scan't parse getty for port %scan't allocate windowcan't parse window for port %sport %s changed utmp index from %d to %dcan't fork for window system on port %s: %msetsid failed (window) %mcan't exec window system '%s' for port %s: %mcan't fork for getty on port %s: %mgetty repeating too quickly on port %s, sleepingcan't exec getty '%s' for port %s: %msome processes would not die; ps axl advisedcan't open %s: %mcan't get %s for controlling terminal: %mcannot disable lid suspendcan't exec %s for %s %s: %mautobootcan't exec %s for %s: %mcan't fork for %s on %s: %mwait for %s on %s failed: %m; going to single user modeinit: %s on %s stopped, restarting %s on %s terminated abnormally, going to single user mode/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bincan't exec %s for single user: %mcan't fork single-user shell, trying againwait for single-user shell failed: %m; restartinginit: shell stopped, restarting single user shell terminated.single user shell terminated, restartinginit: %s init: already running initial setsid() failed: %mrootsetlogin() failed: %munrecognized flag '-%c'sfignoring excess argumentsusage: %s [-b block-size] [-c fragments-per-cylinder-group] [-e maxbpg] [-f frag-size] [-i bytes] [-m free-space] [-o options] [-P file] [-s size] special node usage: %s [-Nq] [-b block-size] [-c fragments-per-cylinder-group] [-e maxbpg] [-f frag-size] [-g avgfilesize] [-h avgfpdir] [-i bytes] [-m free-space] [-O filesystem-format] [-o optimization] [-S sector-size] [-s size] [-T disktype] [-t fstype] special ioctl (WDINFO)%s: can't rewrite disk labelinsane maxpartitions value %dP:T:b:c:e:f:i:m:o:s:NO:S:T:b:c:e:f:g:h:i:m:o:qs:t:%s: invalid ffs versionsector size invalid: %sblock size is %s: %sfragments per cylinder group is %s: %sblocks per file in a cylinder group is %s: %sfragment size is %s: %saverage file size is %s: %saverage files per dir is %s: %sbytes per inode is %s: %sfree space %% is %s: %s%s: unknown optimization preference: use `space' or `time'.file system size invalid: %snewfs_%s%s/newfs_%s%s not found%s: getmntinfo: %s%s: not a character-special device%s: can't figure out file system partition%s: `%c' partition is unavailable%s: `%c' partition overlaps boot program%s: no default sector size%s: maximum file system size on the `%c' partition is %llu sectorswarning: changing optimization to space because minfree is less than %d%% setblock bad fs_frag %dclrblock bad fs_frag %disblock bad fs_frag %dwtfs: write error on block %lldrdfs: read error on block %lldcg 0: bad magic numberfirst cylinder group ran out of spaceinternal error: can't find block in cyl 0ilog2: %d is not a power of 2 fsinit: inode value %llu out of rangeinode table does not fit in cylinder grouppanic: cylinder group too big: %d > %dpreposterous size %lld, max is %dpreposterous size %lld, max is %lldblock size must be a power of 2, not %dfragment size must be a power of 2, not %dfragment size %d is too small, minimum is %lldblock size %d is too small, minimum is %dblock size %d is too large, maximum is %dblock size (%d) cannot be smaller than fragment size (%d)fragment size %d is too small, minimum with block size %d is %ddensity reduced from %d to %d bytes per inodecan't honour -c: minimum is %dfile system size %jd < minimum size of %d fragmentsreduced number of fragments per cylinder group from %d to %d to enlarge last cylinder groupcalloc failed%s: %.1fMB in %jd sectors of %lld bytes %d cylinder groups of %.2fMB, %d blocks, %d inodes each can't get physmemcan't get rlimitwarning: fsck_ffs will need %lluMB; min(ulimit -dH,physmem) is %lluMBsuper-block backups (for fsck -b #) at:cannot allocate I/O bufferfsinit1 failedfsinit2 failed%s: initializing cg %ld/%d checkrm_overwriteusage: %s [-dfiPRr] file ... "." and ".." may not be removedremove %s? override %s%s%s/%s for %s? %s (inode %llu): not overwritten due to multiple links%s: malloc%s: is a directorydfiPRrusage: %s [-t] device usage: %s [-f device] command [count] %d: unknown tape drive type %s tape drive, residual=%d erblocksize: %d (%d) density: %d (%d) ioctl MTIOCGETf:no remote support%s: unknown command%s: illegal countbsfbsrdensityeomfsffsrofflinerewindrewofflretensionweofWriteProtectMounted76543210usage: %s [-p] [-m mode] directory ... m:p\ can not be used as a string delimiternewline can not be used as a string delimiterwhitespace after %sundefined label '%s'RE error: %sunterminated regular expressionexpected context addressunexpected EOF (pending }'s)0123456789/\$command expectedinvalid command code %ccommand %c expects up to %d address(es), found %dunexpected }extra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandfilename expectedw commandread commandbranchempty labelduplicate label '%s'substitute pattern can not be delimited by newline or backslashunterminated substitute pattern123456789\%c not defined in the REunescaped newline inside substitute patternunterminated substitute in regular expressionmore than one number or 'g' in substitute flagsnumber in substitute flags out of rangeno wfile specifiedbad flag in substitute command: '%c'transform pattern can not be delimited by newline or backslashunterminated transform source stringunterminated transform target stringtransform strings are not the same lengthextra text at the end of a transform commandunused label '%s' ..."usage: sed [-aEnru] command [file ...] sed [-aEnru] [-e command] [-f command_file] [file ...] Eae:f:nrustdout: %ssed: %lu: %s: first RE may not be empty\ %03o\%d not defined in the RE\abfrtvh p`9 tx1 1 $ ?     H1 7 $ $ ̘( ؘ0-   @H c_umaskȚZ ̚> Кj Ԛ,K ܚ$> ,K S l@ L > L J (\ 08H 8xR @Z HXT Pj X> `o hM pH Ԣ> x4> `-a-b-c-d -e-f-G-g-h -H -k-L -n-O-o-p -r-s-S -t-u-w-x-z===!=<>-eq-ne-gt-ge-lt -le!-ef"-nt#-ot$<؜tfcd s0lDmTn0px_modex_search_histkb_addx_bindx_emacsx x  P   Ȟ 8   p ,p 4h t < D \ T$ d HD t  , X d D  ̟  ܛ ȝ   $ 4 H8 P \ l H p ܌ Ƞ Р ܠġ lv4  ĝ    0$ @ L Tdbteste_isa$83++--==!== *= /= %= += -= <<= >>= &= ^= |= <<>><=>=<>&& || */%+-&^|? , ~!():hist_initj_printp|doppromptyylexIFS= ${PS2=> } ${PS3=#? } ${PS4=+ },8($gmatchgetoptionsac eȯЯܯiklXmChnf @b(u0<Dp`rXJsPh\vdlxxdo_phys_pathshf_vfprintflX`hpt | $ }  Ĵ`{} QVG[^]]<>!let||&&()str_val l3      $,4<@(#)PD KSH v5.2.14 99/07/13.2 AAA  Q AA A QBafree: %p not present in area %punable to allocate memorylmmissing options argumentmissing name argument%s: is not an identifierc_getopts: no argvarguments changed since last callOPTARGbad signal `%s'ls:usage: kill [-s signame | -signum | -signame] { job | pid | pgrp } ... kill -l [exit_status ...] %s: arguments must be jobs or process IDs%*d %*s %s%*d %*d %sjob control not enabled%%lpnzno argumentsadtdprtUxalias: -r flag can only be used with -t and without arguments alias %s alias not found L#R#UZ#fi#lprtuxonly -t, -u and -x options may be used with -ffunction %s %T %s() %T %s: not identifiertypeset -i -x -r -t -L%d -R%d -Z -l -u -U exportreadonly%s[%d]pvpvV is a reserved wordexported is an %salias for alias %s= is an exported traced undefined (autoload from %s) function special is a%s shell builtin is a tracked %salias for not found%s is *GOK*Rnprsu,-n-p: %s-u: %s: %sLPcan't get current directory - %srestricted shell - can't cdPWDOLDPWDno home directory (HOME not set)no OLDPWDdon't know current directoryCDPATH%s: bad directory+alias+cd+command*=export+fc+getopts+jobs+killletpwd*=readonly=typeset+unaliaswhence+bg+fgunalias-tacan't suspend a login shellinvalid file modeusage: mknod [-m mode] name b|c major minorusage: mknod [-m mode] name ptime: -%s unknown optiontime: -%s requires an argument:p%s%*lld.%02ld%s%s%*lldm%lld.%02lds%sreal real user sys user system fv%s is read only%s: cannot %s%s: can only %s %d level(s)%s: bad numberugorwx%#3.3o augo=+-rwxugoXsbad masktrap -- bad signal %sprsu,nothing to shift*=.*=:[*=break=builtin*=continue*=eval*=exec*=exit+false*=return*=set*=shift=times*=trap+=wait+readtest+trueulimit+umask*=unsetsuspendmissing closing parenmissing argumentexpression expectedmissing second argumentmissing expression operatorunexpected operator/operandinternal error: unknown opmissing ]-t-aunlimited unlimitedinvalid limit: %s-%c exceeds allowable limitbad -%c limit: %susage: ulimit [-acdfHlmnpSst] [value]ulimit: %c%-20s time(cpu-seconds)file(blocks)coredump(blocks)data(kbytes)stack(kbytes)lockedmem(kbytes)memory(kbytes)nofiles(descriptors)IFS"#$&'()*:;<=>?[\]`{|};|&()`+@!fileglob: substitute errorFPATH nothing to yank yank something first I-search: duplicate binding for %sPOSIX%s = %s %s = '%s' cannot bind, not a ttyauto-insert%s: no such functioninvalid return codebeginning-of-historycomplete-commandcomplete-filecompletedelete-char-backwarddelete-word-backwarddelete-char-forwarddelete-word-forwardkill-lineredrawend-of-historyeot-or-deletegoto-historymacro-stringkill-to-eolkill-regionlist-commandlist-filequoteyank-popbackward-charbeginning-of-linebackward-wordend-of-lineforward-charforward-wordnewlinedown-historynewline-and-nextno-opup-historyprev-hist-wordsearch-character-forwardsearch-character-backwardsearch-historyset-mark-commandstuffstuff-resettranspose-charsexchange-point-and-markcomplete-listexpand-filecapitalize-worddowncase-wordupcase-wordset-argcomment*+?@! substituteexpand(NULL)%Rfunny $() command: %s%s: cannot open $(<) input%s: parameter not set%S%s: bad substitutionparameter null or not set%*d) %sdbteste_error: %s (offset %d)shcomexec: %shere document missingcan't %s temporary file %s: %sherein: yylexerror writing %s: %sPS4%s%s %s: restricteddupcannot %s %s: %scould not finish (dup) redirection %s: %scoprocess already existsPS3EXECSHELL%s: %s: %sbuiltin: %s: not a builtincommand -p: restricted%s: can't find function definition file - %s%s: can't find function definition file%s: can't open function definition file %s - %s%s: function not defined by %sCFUNC %d%s: cannot execute - %s-rend of expression%s: unexpected `%s'%s: bad number `%s'%s: expression recurses on parameter `%s'%s: %s requires lvalue%s: %s applied to read only variablemissing )zero divisormissing :HISTFILE%s.%dno history (yet)%s: not in history%s: invalid rangehistory functions not available-%c%se:glnrs0,1,2,3,4,5,6,7,8,9,can't use -e, -l, -n, -r with -s (-e -)substitution failedcan't use -l, -n with -e-16%.*s cannot create temp file %s - %serror writing temporary file - %s${FCEDIT:-/bin/ed} $_cannot open temp file %serror reading temp file %s - %sno coprocess%s/shXXXXXXXXbad file descriptorfd not open for readingfd not open for writingillegal file descriptor name%s[%d]: internal error: shl_stdout not validtoo many files open in shellcan't create pipe - try again RunningDoneDone (%d)[%d] %c %5d (core dumped)%s%s %-20s %s%s%s%s%5d %-20s %s%s %s%sremove_job: job not found (%s)notifyj_async: job not startedj_async: bad nzombie (%d)zombiejobsstopped and runningYou have %s%s%s jobs j_waitj: tcsetpgrp(%d, %d) failed: %sjob not job-controlled[%d] | 1st tcsetpgrp(%d, %d) failed: %sfg: 2nd tcsetpgrp(%d, %d) failed: %scannot continue job %s: %sjw:resumejw:waitforwaitlast: no last jobwaitlast: not startedjw:waitlastexchild: XPIPEI and no last_job - pid %dfork failedcannot fork - try againchildexchild: execute() returned[%d]jw:last procj_init: getpgrp() failed: %sj_init: tcgetpgrp() failed: %sj_init: setpgid() failed: %sj_init: tcsetpgrp() failed: %swarning: won't have full job controlj_suspend: tcsetpgrp() failed: %sj_suspend: setpgid() failed: %scheck_job: job started (flags 0x%x)checkjobno such jobambiguousargument must be %job or process id%a %b %d%l:%M:%S%r~/%sPS1\$PS2missing ] no closing quote here document `%s' unclosed MAILyou have mail in $_shell: %dUse `exit' to leave ksh include: %drshrkshrpdkshpdrkshSH_VERSIONPPIDUSER$ -c requires an argumentCannot determine current working directory/etc/profile$HOME/.profile/etc/suid_profileENVtypesetKSH_VERSION-xOPTIND=1evaltypeset -i RANDOM MAILCHECK="${MAILCHECK-600}" SECONDS="${SECONDS-0}" TMOUT="${TMOUT-0}"hash=alias -ttype=whence -vstop=kill -STOPautoload=typeset -fufunctions=typeset -fhistory=fc -linteger=typeset -inohup=nohup local=typesetr=fc -e -login=exec login-tUccmailmakeprviwho |&;<>()*@#!$-? =-+?#% "#$&'()*;<>?[\`|0123456789ABCDEF%-*s%*s'\'%s%s-%c: unknown option%s%s-`%c' requires argument%-*s %sA:o;sCurrent option settings -o %s%s: bad optionparse_args: `%c'allexportbraceexpandbgnicecsh-historyemacs-usemetaerrexitgmacsignoreeofinteractivekeywordloginmarkdirsnoclobbernoglobnohupnolognounsetphysicalposixprivilegedtrackallverbosevirawvi-show8vi-tabcompletevi-esccompletextracealnumalphablankcntrldigitgraphlowerpunctupperxdigitshf_flush: no fdshf_emptybuf: no fdshf_write: flags %xshf_write: nbytes %dshf_putchar: flags %xshf_putchar: no fd0123456789abcdef(null %s)shf_ungetc: flags %xshf_fillbuf: no fdshf_getchar: flags %xshf_getse: flags %xshf_read: flags %xshf_read: bsize %dshf_sopen: flags 0x%xshf_snprintf: buf %lx, bsize %dshf_reopen: missing read/writeshf_reopen: bad shf/buf/bsizeshf_fdopen: missing read/writeunmatchedsyntax error: unexpected EOF ?%dsyntax error: `%s' %s unexpectedtoo many <<'s too many redirections for%s: bad identifier %s: invalid function name thenelseelifficaseesacwhileuntildo{[[&&||;;((|&too many varssetexecsig: unset signal %d(%s)ERRError handlerEXITtimed out waiting for inputSIGwdscan: unknown char 0x%x (carrying on)%S #no-vars# #no-args# ( %T) %T| %T%;%T%s %T %S ]] select %s for %s in %;do%N%T%;done case %S in%N(%S%c%;%T%N;;%Nesac if %Tthen%N%Telif %Telse%;%T%;fi %s %T%;do{%;%T%;} %T|& %T& function %s %T%s() %Ttime %T< <<- << >> >| <> <&>&No controlling tty (open /dev/tty: %s)Can't find tty file descriptorj_ttyinit: dup of tty fd failed: %sj_ttyinit: can't set close-on-exec flag: %s%0*s%.*s%*s%.*s%s: subscript %ld out of range%s: is read onlysetstr: %s=%s: assigning to self0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789abcdefghijklmnopqrstuvwxyzOPTINDPOSIXLY_CORRECTHISTSIZEMAILCHECKMAILPATHRANDOMSECONDSTMOUTLINENOM-grabhist: bad history arrayy$%s %dfc -e ${VISUAL:-${EDITOR:-vi}} --derive_key_pkcsbio_diskinqbio_createflagsbio_parse_devlistbio_changepassbio_deleteraidbio_createraidbio_blinkbio_getvolbynamebio_alarmbio_inqstr2locatorbio_setblinkbio_setstatemainInvalid keyInvalid saltToo few rounds: %dcan't specify passphrase file during initial creation of crypto volumeinvalid passphrase filecan't stat passphrase filepassphrase file must be owned by rootpassphrase file has the wrong permissionscan't read passphrase fileinvalid passphrase lengthunable to read passphraseRe-type passphrase: Passphrases did not matchpbkdf2 failedinvalid KDF infoinvalid KDF hintKDF hint has invalid sizeunknown KDF type %dnumber of KDF rounds too low: %dDIOCINQ%s: <%s, %s, %s>, serial %s invalid flags listinvalid flag %sinvalid device listcould not open %scould not stat %stoo many devices on device listduplicate device in listNew passphrase: unknown errorBIOCDISCIPLINEOld passphrase: BIOCDELETERAIDno devices specifiednot enough memory for dev_t listunsupported raid levelnot enough disksnot exactly one partitionioctlPassphrase: BIOCCREATERAID/dev/bioCan't locate %s device via %sBIOCBLINKBIOCINQBIOCVOLinvalid alarm function: %sBIOCALARMalarm is currently %s %-11s %-10s %14s %-8s VolumeStatusSizeDevice %d%% done %u secondsScrubbingInvalidOnlineOfflineDegradedBuildingRebuildWTWB%s %u%14llu%11s %-10s %14s %-7s CRYPTO%s%s %11s %-10s %14s %-7s CONCAT%s%s %11s %-10s %14s %-7s RAID%u%s%s %s BIOCDISKFailedHot spareUnused %3u%14skey disk%u:%u.%unoenclunknown serial%11s %-10s %14s %-7s %-6s <%s> %11s %-10s %14s %-7s %-6s '%s' target not specifiedTarget %s: %sDisk %s is not in an enclosureDisk %s does not existinvalid device %sBIOCSETSTATEusage: %s [-hiqv] [-a alarm-function] [-b channel:target[.lun]] [-H channel:target[.lun]] [-R device | channel:target[.lun]] [-u channel:target[.lun]] device %s [-dhiPqsv] [-C flag[,flag,...]] [-c raidlevel] [-k keydisk] [-l special[,special,...]] [-O device | channel:target[.lun]] [-p passfile] [-R device | channel:target[.lun]] [-r rounds] device Invalid RAID levelNumber of rounds is %s: %sa:b:C:c:dH:hik:l:O:Pp:qr:R:svu:need deviceneed -c parameterneed -l parametermust use bio deviceusage: %s seconds do_movemainusage: %s [-fi] source target %s [-fi] source ... directory /bin/cp-PRp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status/bin/rm-rf%s: remove%s: set owner/group; not setting setuid/setgid%s: set owner/group%s: set mode%s: set flags%s: set timesrename %s to %scannot resolve %scannot rename a mount pointcan't remove %s%s: destination pathname too longeval5syntax error|&=<>+-*/%:()non-numeric argumentdivision by zerousage: %s [-M core] [-N system] M:N:sysctl: KERN_MSGBUFSIZEcouldn't allocate space for buffer datasysctl: KERN_MSGBUFmainusage: %s [-s] [name-of-host] sethostnamegethostname/etc/networks"(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDlɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~[/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxqg jgrn<:ORQhك[0.0.0.0127.0.0.1::::1/etc/group/etc/spwd.db/etc/pwd.db/etc/ethers%02x:%02x:%02x:%02x:%02x:%02x  0123456789ABCDEF0123456789abcdefnanNANinfINF(null)bug in vfprintf: bad base HOSTALIASES/etc/hosts;#nameserverlookupypsearchinet4ndots:RES_OPTIONSoptions LOCALDOMAINsearch lookup bind filenameserver 127.0.0.1ASR_CONFIGlookup file %d.%d.%d.%d.in-addr.arpa.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.ip6.arpa.no spacebad domain namedomain name too longbad dlen@BKMGTPE0B%lld%c%lld.%1lld%cimsg_readmsgbuf_write/dev/diskmap%s%s%s%c%s%s%shmac_sha1pkcs5_pbkdf2logout/var/run/utmplogin_protect%s: %s: %m/etc/fbtab/*%s: chmod(%s): %m%s: chown(%s): %m%s: opendir(%s): %m%o%s: bad entry: %s\\#readlabelfs(^(^(^(^(^(^(^ܭ ,(^(^@(^0(^(^(^(^8@%sr%s%s: not a device node%s: couldn't read disklabel%s: bad filesystem type in labellogwtmp/var/log/wtmp5MS7) OOPStgetentTERMCAP/usr/share/misc/termcapTERMPATH.termcap /usr/share/misc/termcapinet_net_ptoninet_net_pton_ipv401234567890123456789abcdef/usr/src/lib/libc/net/inet_net_pton.cn >= 0 && n <= 15n >= 0 && n <= 9assertion "%s" failed: file "%s", line %d, function "%s" assertion "%s" failed: file "%s", line %d inet_pton01234567890123456789ABCDEF0123456789abcdefinet_ntop4inet_ntop%u.%u.%u.%ub0b1ncdtscsbpxbxfxoxtxdxgetentcgetnext%s.dbtc|:InfinityNaNvdprintflongjmp botch. SHA256EndSHA256DataSHA256FileChunk0123456789abcdefPOSIX_V6_ILP32_OFFBIGPOSIX_V7_ILP32_OFFBIG-lpthreadasprintf<DLd^[Yy]^[Nn]yes646NONEUTF8 [:<:]][:>:]]ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ !"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789ABCDEFabcdefNULSOHSTXETXEOTENQBELalertBSbackspaceHTtabLFVTvertical-tabFFform-feedCRcarriage-returnSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBIS4IS3GSIS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoponetwothreefourfivesixseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDELregerrorREG_0x%xREG_NOMATCHregexec() failed to matchREG_BADPATinvalid regular expressionREG_ECOLLATEinvalid collating elementREG_ECTYPEinvalid character classREG_EESCAPEREG_ESUBREGinvalid backreference numberREG_EBRACKbrackets ([ ]) not balancedREG_EPARENparentheses not balancedREG_EBRACEbraces not balancedREG_BADBRinvalid repetition count(s)REG_ERANGEinvalid character rangeREG_ESPACEREG_BADRPTrepetition-operator operand invalidREG_EMPTYempty (sub)expressionREG_ASSERT"can't happen" -- you found a bugREG_INVARGinvalid argument to regex routine*** unknown regexp error code ***glob2SHA512EndSHA512DataSHA512FileChunk0123456789abcdefclnttcp_create: out of memory xdrrec_create: out of memory BLOCKSIZE%s: unknown blocksizemaximum blocksize is %dG%s: minimum blocksize is 512%ld%s-blocksttyname_r/var/run/dev.db/etc/ttyssecurertsctssoftcarwindow%h %e %T MD5PadؗҜ<3#I9=D2[%Cod(hinityan0123456789abcdefABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/readpassphrase  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~tcsetattr (4<P`lx(4DXp 8 (4<P`lx(4DXp 8Signal 0HangupInterruptQuitIllegal instructionTrace/BPT trapAbort trapEMT trapFloating point exceptionKilledBus errorSegmentation faultBad system callBroken pipeAlarm clockTerminatedUrgent I/O conditionSuspended (signal)SuspendedContinuedChild exitedStopped (tty input)Stopped (tty output)I/O possibleCputime limit exceededFilesize limit exceededVirtual timer expiredProfiling timer expiredWindow size changesInformation requestUser defined signal 1User defined signal 2Thread AST/etc/protocols8$(08@HPT\dlt|HUPINTILLTRAPABRTEMTFPEKILLBUSSEGVSYSPIPEALRMURGTSTPCONTCHLDTTINTTOUIOXCPUXFSZVTALRMPROFWINCHUSR1USR2THRexecvpeexeclpexecleexeclexecvp: : path too long unknown option -- %coption requires an argument -- %cambiguous option -- %.*soption doesn't take an argument -- %.*soption requires an argument -- %sunknown option -- %s0HX|<(Dd|0RPC: (unknown error code)RPC: Port mapper failure%s: %s - %s RPC: Remote system error; errno = %s; low version = %u, high version = %u; why = (unknown authentication error - %d); s1 = %u, s2 = %uRPC: SuccessRPC: Can't encode argumentsRPC: Can't decode resultRPC: Unable to sendRPC: Unable to receiveRPC: Timed outRPC: Incompatible versions of RPCRPC: Authentication errorRPC: Program unavailableRPC: Program/version mismatchRPC: Procedure unavailableRPC: Server can't decode argumentsRPC: Unknown hostRPC: Program not registeredRPC: Failed (unspecified error)RPC: Unknown protocolAuthentication OKInvalid client credentialServer rejected credentialInvalid client verifierServer rejected verifierClient credential too weakInvalid server verifierFailed (unspecified error)fstabscanxxswT""too smalltoo largeXXT`lt ,nosappndnosappendnoarchnoarchivednoschgnoschangenosimmutablenouappndnouappendnouchgnouchangenouimmutablenodumpnoopaque%m/%d/%y%Y-%m-%d%H:%M%I:%M:%S %p%H:%M:%SESTCSTMSTPSTEDTCDTMDTPDT  ,4<DLT`htSunMonTueWedThuFriSatSundayMondayTuesdayWednesdayThursdayFridaySaturdayJanFebMarAprMayJunJulAugSepOctNovDecJanuaryFebruaryMarchAprilJuneJulyAugustSeptemberOctoberNovemberDecemberAMPM%a %b %e %H:%M:%S %Y  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~authunix_createauthunix_create_defaultauth_none.c - Fatal marshalling problemauthunix_create: out of memory perrorxdr_array: out of memory argument buffer overflowunknown/invalid errorno errorinvalid value for ai_flagsname or service is not knowntemporary failure in name resolutionnon-recoverable failure in name resolutionno address associated with nameai_family not supportedai_socktype not supportedservice not supported for ai_socktypeaddress family for name not supportedmemory allocation failureinvalid value for hintsresolved protocol is unknownrealpathinet6_rth_reverseSHA1TransformSHA1Pad/etc/services,/ ((((( AAAAAABBBBBB __stack_smash_handlerstack overflow in function %s__vsyslog_r_rsyslog%s: unknown facility/priority: %x<%d>[%ld]Error %dlibcUnknown signal: Unknown error: _catopenNLSPATH/usr/share/nls/%L/%N.cat:/usr/share/nls/%l.%c/%N.cat:/usr/share/nls/%l/%N.catLC_ALLLC_MESSAGESLANG4P`xp(4LXdx$4D\l ,Ll$Tl4Ph 4H\l,@\DXlUndefined error: 0Operation not permittedNo such file or directoryNo such processInterrupted system callInput/output errorDevice not configuredArgument list too longExec format errorBad file descriptorNo child processesResource deadlock avoidedPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkOperation not supported by deviceNot a directoryIs a directoryInvalid argumentToo many open files in systemToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksNumerical argument out of domainResult too largeResource temporarily unavailableOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not availableProtocol not supportedSocket type not supportedOperation not supportedProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceOperation timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downNo route to hostDirectory not emptyToo many processesToo many usersDisk quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticatorIPsec processing failureAttribute not foundIllegal byte sequenceNo medium foundWrong medium typeValue too large to be stored in data typeOperation canceledIdentifier removedNo message of desired typeNot supported (4<P`lx(4DXp 8vsnprintf<clntudp_callclntudp_create: out of memory bindresvport_saxdr_string: out of memory xdr_bytes: out of memory isatty !#&(*-/14(^(^(^(^(^(^(^(^(^ABCDEF7yACnF?O8M20HwZ> P30123456789.=:f/?/*?*n+n,N-N.&7m'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !+ Hh VqQ:q:QZZ    l h b  w  i x X      0  $  k  j  is not a regular file (use -f to see it) is a directorya4ԧb4@@l<B4P\c4Hܨܨd4At e4$8Thf4hF4,g4` ,Xh4(i4 `̪j4D,<J4!8LlK4|L4T̫m4\$n4"D0H\p4HP4|q4ܬr4"x8s4!0xS4!pu4"ЭV4w4"l0Tx4(̮X4Aخy4L 8z4\t"4~4!<į?4 #44Ad44,P4Xt4 ... (interrupt to abort) (press RETURN)tМ$t458 Ȏмظ11"t €u6Uu|agPtPS[X!Using drive X, partition YMBR on floppy or old BIOS Read error No O/S No active partition OxUL}l`X(80ЩT}x0H<\LDx̌`"P(K@dt|AB>CDEFGHUlvV abcefh iL,l@nLqTq\rhstvwxuLP\dh{lpx     (Ĵt} nDx{ !p{"#$%&o'|()*+,-$.(/0041@2H345T6(^`t$Ll0Px priorityrttvarrttssthreshsendpiperecvpipeexpirehopcountmtuUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CLONING XRESOLVE LLINFO STATIC BLACKHOLEPROTO3PROTO2PROTO1CLONEDMPATHMPLSLOCALBROADCASTUPBROADCASTDEBUGLOOPBACKPTPNOTRAILERSRUNNINGNOARP PPROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD SRC SRCMASK LABEL<NOOP 3    I( (^`)( 0(EHC P E(  0(EHDHC؞H(^L ... ...aaabu |8|ȩ@Щ @@@......Ȁ h ̀ЀԀ܀{}abcdDgGhHilnNpPqrs tw xy !:#= P,84,@$L,4,4DPXX{ĭԭ$8HXdX{xD| l P|L`Xd (XȰаHذ(zHx _ xx:xx:xx:xx:xx:xx0000000000000000 tx (0q8@DLT,RuneCT10NONEBBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~PtȰаHذ (z@ĄԄ8,ЈPx(x(^(^|(^(^(^Ȱ(^аt(^H(^ذ(^(z(^(^8(^(^PTX\`d2hltx          ,$ (z !,"<#H$T%d&p'|()*+,--..//8012345678$90:,;8<H=T>h?x@[\\]^^__`{${8|H}T}h~p,A@8EDpD DCCDBB0CpD DCCCB,XPn s P .shstrtab.init.text.fini.rodata.openbsd.randomdata.data.eh_frame.jcr.gotpad0.got.ctors.dtors.gotpad1.bss.stack.arm.atpcs.note.openbsd.ident ppPP dd! g%pp9ttDM?INUWU$\UcUjUsxTT . ..chown@dhclientk2 disklabel2dmesg@fdisk@fsck@ fsck_ext2fsfsck_ffsk2ifconfigk2init@mknod@mount@ mount_cd9660r mount_ext2fsr mount_ffs2 mount_msdos mount_nfs2newfs@ newfs_msdosping@ping6@reboothalt@route@rtsol@sysctlumountbioctlwheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root bin:*:7: news:*:8: wsrc:*:9: users:*:10: auth:*:11: games:*:13: staff:*:20:root smmsp:*:25: sshd:*:27: _portmap:*:28: _identd:*:29: _rstatd:*:30: guest:*:31:root _rusersd:*:32: _fingerd:*:33: _sshagnt:*:34: _x11:*:35: utmp:*:45: _unbound:*:53: _lkm:*:61: _spamd:*:62: _radius:*:63: _token:*:64: _shadow:*:65: crontab:*:66: www:*:67: _isakmpd:*:68: network:*:69: named:*:70: proxy:*:71: authpf:*:72: _syslogd:*:73: _pflogd:*:74: _bgpd:*:75: _tcpdump:*:76: _dhcp:*:77: _mopd:*:78: _tftpd:*:79: _rbootd:*:80: _ppp:*:82: _ntp:*:83: _ftp:*:84: _ospfd:*:85: _hostapd:*:86: _dvmrpd:*:87: _ripd:*:88: _relayd:*:89: _ospf6d:*:90: _snmpd:*:91: _rtadvd:*:92: _ypldap:*:93: _smtpd:*:95: _rwalld:*:96: _nsd:*:97: _ldpd:*:98: _sndio:*:99: _ldapd:*:100: _iked:*:101: _iscsid:*:102: _smtpq:*:103: dialer:*:117: nogroup:*:32766: nobody:*:32767: ftp-data 20/tcp ftp 21/tcp domain 53/tcp nameserver domain 53/udp nameserver www 80/tcp http nfsd 2049/udp nfs nfsd 2049/tcp nfs bin*Binaries Commands and Source//sbin/nologin1binrdrrootdaemonCharlie &/root/bin/ksh2rootdaemonCharlie &/root/bin/ksh3MHdaemon*The devil himself/root/sbin/nologin2daemon*The devil himself/root/sbin/nologin3nobody*Unprivileged user for NFS/nonexistent/sbin/nologin1nobody f]\W operator*System &/operator/sbin/nologin2uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Boperator*System &/operator/sbin/nologin3operator*System &/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonrootdaemonCharlie &/root/bin/ksh1rootA<bin*Binaries Commands and Source//sbin/nologin2bin*Binaries Commands and Source//sbin/nologin3uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucpD6Duucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2_dhcp*MMDHCP programs/var/empty/sbin/nologin1_dhcp^P^_dhcp*MMDHCP programs/var/empty/sbin/nologin2_dhcp*MMDHCP programs/var/empty/sbin/nologin3M@2@nobody*Unprivileged user for NFS/nonexistent/sbin/nologin2nobody*Unprivileged user for NFS/nonexistent/sbin/nologin3a  n}bin*Binaries Commands and Source//sbin/nologin1binpbprootdaemonCharlie &/root/bin/kshs2rootdaemonCharlie &/root/bin/kshs3MHdaemon*The devil himself/root/sbin/nologin2daemon*The devil himself/root/sbin/nologin3nobody*Unprivileged user for NFS/nonexistent/sbin/nologin1nobody e\[V  operator*System &/operator/sbin/nologin2uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Boperator*System &/operator/sbin/nologin3operator*System &/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonrootdaemonCharlie &/root/bin/ksh1rootA<bin*Binaries Commands and Source//sbin/nologin2bin*Binaries Commands and Source//sbin/nologin3uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucpD6Duucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2_dhcp*MMDHCP programs/var/empty/sbin/nologin1_dhcp^P^_dhcp*MMDHCP programs/var/empty/sbin/nologin2_dhcp*MMDHCP programs/var/empty/sbin/nologin3M@2@nobody*Unprivileged user for NFS/nonexistent/sbin/nologin2nobody*Unprivileged user for NFS/nonexistent/sbin/nologin3a  n}Africa/ Africa/Abidjan Africa/Accra Africa/Addis_Ababa Africa/Algiers Africa/Asmara Africa/Asmera Africa/Bamako Africa/Bangui Africa/Banjul Africa/Bissau Africa/Blantyre Africa/Brazzaville Africa/Bujumbura Africa/Cairo Africa/Casablanca Africa/Ceuta Africa/Conakry Africa/Dakar Africa/Dar_es_Salaam Africa/Djibouti Africa/Douala Africa/El_Aaiun Africa/Freetown Africa/Gaborone Africa/Harare Africa/Johannesburg Africa/Juba Africa/Kampala Africa/Khartoum Africa/Kigali Africa/Kinshasa Africa/Lagos Africa/Libreville Africa/Lome Africa/Luanda Africa/Lubumbashi Africa/Lusaka Africa/Malabo Africa/Maputo Africa/Maseru Africa/Mbabane Africa/Mogadishu Africa/Monrovia Africa/Nairobi Africa/Ndjamena Africa/Niamey Africa/Nouakchott Africa/Ouagadougou Africa/Porto-Novo Africa/Sao_Tome Africa/Timbuktu Africa/Tripoli Africa/Tunis Africa/Windhoek America/ America/Adak America/Anchorage America/Anguilla America/Antigua America/Araguaina America/Argentina/ America/Argentina/Buenos_Aires America/Argentina/Catamarca America/Argentina/ComodRivadavia America/Argentina/Cordoba America/Argentina/Jujuy America/Argentina/La_Rioja America/Argentina/Mendoza America/Argentina/Rio_Gallegos America/Argentina/Salta America/Argentina/San_Juan America/Argentina/San_Luis America/Argentina/Tucuman America/Argentina/Ushuaia America/Aruba America/Asuncion America/Atikokan America/Atka America/Bahia America/Bahia_Banderas America/Barbados America/Belem America/Belize America/Blanc-Sablon America/Boa_Vista America/Bogota America/Boise America/Buenos_Aires America/Cambridge_Bay America/Campo_Grande America/Cancun America/Caracas America/Catamarca America/Cayenne America/Cayman America/Chicago America/Chihuahua America/Coral_Harbour America/Cordoba America/Costa_Rica America/Creston America/Cuiaba America/Curacao America/Danmarkshavn America/Dawson America/Dawson_Creek America/Denver America/Detroit America/Dominica America/Edmonton America/Eirunepe America/El_Salvador America/Ensenada America/Fort_Wayne America/Fortaleza America/Glace_Bay America/Godthab America/Goose_Bay America/Grand_Turk America/Grenada America/Guadeloupe America/Guatemala America/Guayaquil America/Guyana America/Halifax America/Havana America/Hermosillo America/Indiana/ America/Indiana/Indianapolis America/Indiana/Knox America/Indiana/Marengo America/Indiana/Petersburg America/Indiana/Tell_City America/Indiana/Vevay America/Indiana/Vincennes America/Indiana/Winamac America/Indianapolis America/Inuvik America/Iqaluit America/Jamaica America/Jujuy America/Juneau America/Kentucky/ America/Kentucky/Louisville America/Kentucky/Monticello America/Knox_IN America/Kralendijk America/La_Paz America/Lima America/Los_Angeles America/Louisville America/Lower_Princes America/Maceio America/Managua America/Manaus America/Marigot America/Martinique America/Matamoros America/Mazatlan America/Mendoza America/Menominee America/Merida America/Metlakatla America/Mexico_City America/Miquelon America/Moncton America/Monterrey America/Montevideo America/Montreal America/Montserrat America/Nassau America/New_York America/Nipigon America/Nome America/Noronha America/North_Dakota/ America/North_Dakota/Beulah America/North_Dakota/Center America/North_Dakota/New_Salem America/Ojinaga America/Panama America/Pangnirtung America/Paramaribo America/Phoenix America/Port-au-Prince America/Port_of_Spain America/Porto_Acre America/Porto_Velho America/Puerto_Rico America/Rainy_River America/Rankin_Inlet America/Recife America/Regina America/Resolute America/Rio_Branco America/Rosario America/Santa_Isabel America/Santarem America/Santiago America/Santo_Domingo America/Sao_Paulo America/Scoresbysund America/Shiprock America/Sitka America/St_Barthelemy America/St_Johns America/St_Kitts America/St_Lucia America/St_Thomas America/St_Vincent America/Swift_Current America/Tegucigalpa America/Thule America/Thunder_Bay America/Tijuana America/Toronto America/Tortola America/Vancouver America/Virgin America/Whitehorse America/Winnipeg America/Yakutat America/Yellowknife Antarctica/ Antarctica/Casey Antarctica/Davis Antarctica/DumontDUrville Antarctica/Macquarie Antarctica/Mawson Antarctica/McMurdo Antarctica/Palmer Antarctica/Rothera Antarctica/South_Pole Antarctica/Syowa Antarctica/Troll Antarctica/Vostok Arctic/ Arctic/Longyearbyen Asia/ Asia/Aden Asia/Almaty Asia/Amman Asia/Anadyr Asia/Aqtau Asia/Aqtobe Asia/Ashgabat Asia/Ashkhabad Asia/Baghdad Asia/Bahrain Asia/Baku Asia/Bangkok Asia/Beirut Asia/Bishkek Asia/Brunei Asia/Calcutta Asia/Choibalsan Asia/Chongqing Asia/Chungking Asia/Colombo Asia/Dacca Asia/Damascus Asia/Dhaka Asia/Dili Asia/Dubai Asia/Dushanbe Asia/Gaza Asia/Harbin Asia/Hebron Asia/Ho_Chi_Minh Asia/Hong_Kong Asia/Hovd Asia/Irkutsk Asia/Istanbul Asia/Jakarta Asia/Jayapura Asia/Jerusalem Asia/Kabul Asia/Kamchatka Asia/Karachi Asia/Kashgar Asia/Kathmandu Asia/Katmandu Asia/Khandyga Asia/Kolkata Asia/Krasnoyarsk Asia/Kuala_Lumpur Asia/Kuching Asia/Kuwait Asia/Macao Asia/Macau Asia/Magadan Asia/Makassar Asia/Manila Asia/Muscat Asia/Nicosia Asia/Novokuznetsk Asia/Novosibirsk Asia/Omsk Asia/Oral Asia/Phnom_Penh Asia/Pontianak Asia/Pyongyang Asia/Qatar Asia/Qyzylorda Asia/Rangoon Asia/Riyadh Asia/Riyadh87 Asia/Riyadh88 Asia/Riyadh89 Asia/Saigon Asia/Sakhalin Asia/Samarkand Asia/Seoul Asia/Shanghai Asia/Singapore Asia/Taipei Asia/Tashkent Asia/Tbilisi Asia/Tehran Asia/Tel_Aviv Asia/Thimbu Asia/Thimphu Asia/Tokyo Asia/Ujung_Pandang Asia/Ulaanbaatar Asia/Ulan_Bator Asia/Urumqi Asia/Ust-Nera Asia/Vientiane Asia/Vladivostok Asia/Yakutsk Asia/Yekaterinburg Asia/Yerevan Atlantic/ Atlantic/Azores Atlantic/Bermuda Atlantic/Canary Atlantic/Cape_Verde Atlantic/Faeroe Atlantic/Faroe Atlantic/Jan_Mayen Atlantic/Madeira Atlantic/Reykjavik Atlantic/South_Georgia Atlantic/St_Helena Atlantic/Stanley Australia/ Australia/ACT Australia/Adelaide Australia/Brisbane Australia/Broken_Hill Australia/Canberra Australia/Currie Australia/Darwin Australia/Eucla Australia/Hobart Australia/LHI Australia/Lindeman Australia/Lord_Howe Australia/Melbourne Australia/NSW Australia/North Australia/Perth Australia/Queensland Australia/South Australia/Sydney Australia/Tasmania Australia/Victoria Australia/West Australia/Yancowinna Brazil/ Brazil/Acre Brazil/DeNoronha Brazil/East Brazil/West CET CST6CDT Canada/ Canada/Atlantic Canada/Central Canada/East-Saskatchewan Canada/Eastern Canada/Mountain Canada/Newfoundland Canada/Pacific Canada/Saskatchewan Canada/Yukon Chile/ Chile/Continental Chile/EasterIsland Cuba EET EST EST5EDT Egypt Eire Etc/ Etc/GMT Etc/GMT+0 Etc/GMT+1 Etc/GMT+10 Etc/GMT+11 Etc/GMT+12 Etc/GMT+2 Etc/GMT+3 Etc/GMT+4 Etc/GMT+5 Etc/GMT+6 Etc/GMT+7 Etc/GMT+8 Etc/GMT+9 Etc/GMT-0 Etc/GMT-1 Etc/GMT-10 Etc/GMT-11 Etc/GMT-12 Etc/GMT-13 Etc/GMT-14 Etc/GMT-2 Etc/GMT-3 Etc/GMT-4 Etc/GMT-5 Etc/GMT-6 Etc/GMT-7 Etc/GMT-8 Etc/GMT-9 Etc/GMT0 Etc/Greenwich Etc/UCT Etc/UTC Etc/Universal Etc/Zulu Europe/ Europe/Amsterdam Europe/Andorra Europe/Athens Europe/Belfast Europe/Belgrade Europe/Berlin Europe/Bratislava Europe/Brussels Europe/Bucharest Europe/Budapest Europe/Busingen Europe/Chisinau Europe/Copenhagen Europe/Dublin Europe/Gibraltar Europe/Guernsey Europe/Helsinki Europe/Isle_of_Man Europe/Istanbul Europe/Jersey Europe/Kaliningrad Europe/Kiev Europe/Lisbon Europe/Ljubljana Europe/London Europe/Luxembourg Europe/Madrid Europe/Malta Europe/Mariehamn Europe/Minsk Europe/Monaco Europe/Moscow Europe/Nicosia Europe/Oslo Europe/Paris Europe/Podgorica Europe/Prague Europe/Riga Europe/Rome Europe/Samara Europe/San_Marino Europe/Sarajevo Europe/Simferopol Europe/Skopje Europe/Sofia Europe/Stockholm Europe/Tallinn Europe/Tirane Europe/Tiraspol Europe/Uzhgorod Europe/Vaduz Europe/Vatican Europe/Vienna Europe/Vilnius Europe/Volgograd Europe/Warsaw Europe/Zagreb Europe/Zaporozhye Europe/Zurich Factory GB GB-Eire GMT GMT+0 GMT-0 GMT0 Greenwich HST Hongkong Iceland Indian/ Indian/Antananarivo Indian/Chagos Indian/Christmas Indian/Cocos Indian/Comoro Indian/Kerguelen Indian/Mahe Indian/Maldives Indian/Mauritius Indian/Mayotte Indian/Reunion Iran Israel Jamaica Japan Kwajalein Libya MET MST MST7MDT Mexico/ Mexico/BajaNorte Mexico/BajaSur Mexico/General Mideast/ Mideast/Riyadh87 Mideast/Riyadh88 Mideast/Riyadh89 NZ NZ-CHAT Navajo PRC PST8PDT Pacific/ Pacific/Apia Pacific/Auckland Pacific/Chatham Pacific/Chuuk Pacific/Easter Pacific/Efate Pacific/Enderbury Pacific/Fakaofo Pacific/Fiji Pacific/Funafuti Pacific/Galapagos Pacific/Gambier Pacific/Guadalcanal Pacific/Guam Pacific/Honolulu Pacific/Johnston Pacific/Kiritimati Pacific/Kosrae Pacific/Kwajalein Pacific/Majuro Pacific/Marquesas Pacific/Midway Pacific/Nauru Pacific/Niue Pacific/Norfolk Pacific/Noumea Pacific/Pago_Pago Pacific/Palau Pacific/Pitcairn Pacific/Pohnpei Pacific/Ponape Pacific/Port_Moresby Pacific/Rarotonga Pacific/Saipan Pacific/Samoa Pacific/Tahiti Pacific/Tarawa Pacific/Tongatapu Pacific/Truk Pacific/Wake Pacific/Wallis Pacific/Yap Poland Portugal ROC ROK Singapore Turkey UCT US/ US/Alaska US/Aleutian US/Arizona US/Central US/East-Indiana US/Eastern US/Hawaii US/Indiana-Starke US/Michigan US/Mountain US/Pacific US/Pacific-New US/Samoa UTC Universal W-SU WET Zulu posix/ posix/Africa/ posix/Africa/Abidjan posix/Africa/Accra posix/Africa/Addis_Ababa posix/Africa/Algiers posix/Africa/Asmara posix/Africa/Asmera posix/Africa/Bamako posix/Africa/Bangui posix/Africa/Banjul posix/Africa/Bissau posix/Africa/Blantyre posix/Africa/Brazzaville posix/Africa/Bujumbura posix/Africa/Cairo posix/Africa/Casablanca posix/Africa/Ceuta posix/Africa/Conakry posix/Africa/Dakar posix/Africa/Dar_es_Salaam posix/Africa/Djibouti posix/Africa/Douala posix/Africa/El_Aaiun posix/Africa/Freetown posix/Africa/Gaborone posix/Africa/Harare posix/Africa/Johannesburg posix/Africa/Juba posix/Africa/Kampala posix/Africa/Khartoum posix/Africa/Kigali posix/Africa/Kinshasa posix/Africa/Lagos posix/Africa/Libreville posix/Africa/Lome posix/Africa/Luanda posix/Africa/Lubumbashi posix/Africa/Lusaka posix/Africa/Malabo posix/Africa/Maputo posix/Africa/Maseru posix/Africa/Mbabane posix/Africa/Mogadishu posix/Africa/Monrovia posix/Africa/Nairobi posix/Africa/Ndjamena posix/Africa/Niamey posix/Africa/Nouakchott posix/Africa/Ouagadougou posix/Africa/Porto-Novo posix/Africa/Sao_Tome posix/Africa/Timbuktu posix/Africa/Tripoli posix/Africa/Tunis posix/Africa/Windhoek posix/America/ posix/America/Adak posix/America/Anchorage posix/America/Anguilla posix/America/Antigua posix/America/Araguaina posix/America/Argentina/ posix/America/Argentina/Buenos_Aires posix/America/Argentina/Catamarca posix/America/Argentina/ComodRivadavia posix/America/Argentina/Cordoba posix/America/Argentina/Jujuy posix/America/Argentina/La_Rioja posix/America/Argentina/Mendoza posix/America/Argentina/Rio_Gallegos posix/America/Argentina/Salta posix/America/Argentina/San_Juan posix/America/Argentina/San_Luis posix/America/Argentina/Tucuman posix/America/Argentina/Ushuaia posix/America/Aruba posix/America/Asuncion posix/America/Atikokan posix/America/Atka posix/America/Bahia posix/America/Bahia_Banderas posix/America/Barbados posix/America/Belem posix/America/Belize posix/America/Blanc-Sablon posix/America/Boa_Vista posix/America/Bogota posix/America/Boise posix/America/Buenos_Aires posix/America/Cambridge_Bay posix/America/Campo_Grande posix/America/Cancun posix/America/Caracas posix/America/Catamarca posix/America/Cayenne posix/America/Cayman posix/America/Chicago posix/America/Chihuahua posix/America/Coral_Harbour posix/America/Cordoba posix/America/Costa_Rica posix/America/Creston posix/America/Cuiaba posix/America/Curacao posix/America/Danmarkshavn posix/America/Dawson posix/America/Dawson_Creek posix/America/Denver posix/America/Detroit posix/America/Dominica posix/America/Edmonton posix/America/Eirunepe posix/America/El_Salvador posix/America/Ensenada posix/America/Fort_Wayne posix/America/Fortaleza posix/America/Glace_Bay posix/America/Godthab posix/America/Goose_Bay posix/America/Grand_Turk posix/America/Grenada posix/America/Guadeloupe posix/America/Guatemala posix/America/Guayaquil posix/America/Guyana posix/America/Halifax posix/America/Havana posix/America/Hermosillo posix/America/Indiana/ posix/America/Indiana/Indianapolis posix/America/Indiana/Knox posix/America/Indiana/Marengo posix/America/Indiana/Petersburg posix/America/Indiana/Tell_City posix/America/Indiana/Vevay posix/America/Indiana/Vincennes posix/America/Indiana/Winamac posix/America/Indianapolis posix/America/Inuvik posix/America/Iqaluit posix/America/Jamaica posix/America/Jujuy posix/America/Juneau posix/America/Kentucky/ posix/America/Kentucky/Louisville posix/America/Kentucky/Monticello posix/America/Knox_IN posix/America/Kralendijk posix/America/La_Paz posix/America/Lima posix/America/Los_Angeles posix/America/Louisville posix/America/Lower_Princes posix/America/Maceio posix/America/Managua posix/America/Manaus posix/America/Marigot posix/America/Martinique posix/America/Matamoros posix/America/Mazatlan posix/America/Mendoza posix/America/Menominee posix/America/Merida posix/America/Metlakatla posix/America/Mexico_City posix/America/Miquelon posix/America/Moncton posix/America/Monterrey posix/America/Montevideo posix/America/Montreal posix/America/Montserrat posix/America/Nassau posix/America/New_York posix/America/Nipigon posix/America/Nome posix/America/Noronha posix/America/North_Dakota/ posix/America/North_Dakota/Beulah posix/America/North_Dakota/Center posix/America/North_Dakota/New_Salem posix/America/Ojinaga posix/America/Panama posix/America/Pangnirtung posix/America/Paramaribo posix/America/Phoenix posix/America/Port-au-Prince posix/America/Port_of_Spain posix/America/Porto_Acre posix/America/Porto_Velho posix/America/Puerto_Rico posix/America/Rainy_River posix/America/Rankin_Inlet posix/America/Recife posix/America/Regina posix/America/Resolute posix/America/Rio_Branco posix/America/Rosario posix/America/Santa_Isabel posix/America/Santarem posix/America/Santiago posix/America/Santo_Domingo posix/America/Sao_Paulo posix/America/Scoresbysund posix/America/Shiprock posix/America/Sitka posix/America/St_Barthelemy posix/America/St_Johns posix/America/St_Kitts posix/America/St_Lucia posix/America/St_Thomas posix/America/St_Vincent posix/America/Swift_Current posix/America/Tegucigalpa posix/America/Thule posix/America/Thunder_Bay posix/America/Tijuana posix/America/Toronto posix/America/Tortola posix/America/Vancouver posix/America/Virgin posix/America/Whitehorse posix/America/Winnipeg posix/America/Yakutat posix/America/Yellowknife posix/Antarctica/ posix/Antarctica/Casey posix/Antarctica/Davis posix/Antarctica/DumontDUrville posix/Antarctica/Macquarie posix/Antarctica/Mawson posix/Antarctica/McMurdo posix/Antarctica/Palmer posix/Antarctica/Rothera posix/Antarctica/South_Pole posix/Antarctica/Syowa posix/Antarctica/Troll posix/Antarctica/Vostok posix/Arctic/ posix/Arctic/Longyearbyen posix/Asia/ posix/Asia/Aden posix/Asia/Almaty posix/Asia/Amman posix/Asia/Anadyr posix/Asia/Aqtau posix/Asia/Aqtobe posix/Asia/Ashgabat posix/Asia/Ashkhabad posix/Asia/Baghdad posix/Asia/Bahrain posix/Asia/Baku posix/Asia/Bangkok posix/Asia/Beirut posix/Asia/Bishkek posix/Asia/Brunei posix/Asia/Calcutta posix/Asia/Choibalsan posix/Asia/Chongqing posix/Asia/Chungking posix/Asia/Colombo posix/Asia/Dacca posix/Asia/Damascus posix/Asia/Dhaka posix/Asia/Dili posix/Asia/Dubai posix/Asia/Dushanbe posix/Asia/Gaza posix/Asia/Harbin posix/Asia/Hebron posix/Asia/Ho_Chi_Minh posix/Asia/Hong_Kong posix/Asia/Hovd posix/Asia/Irkutsk posix/Asia/Istanbul posix/Asia/Jakarta posix/Asia/Jayapura posix/Asia/Jerusalem posix/Asia/Kabul posix/Asia/Kamchatka posix/Asia/Karachi posix/Asia/Kashgar posix/Asia/Kathmandu posix/Asia/Katmandu posix/Asia/Khandyga posix/Asia/Kolkata posix/Asia/Krasnoyarsk posix/Asia/Kuala_Lumpur posix/Asia/Kuching posix/Asia/Kuwait posix/Asia/Macao posix/Asia/Macau posix/Asia/Magadan posix/Asia/Makassar posix/Asia/Manila posix/Asia/Muscat posix/Asia/Nicosia posix/Asia/Novokuznetsk posix/Asia/Novosibirsk posix/Asia/Omsk posix/Asia/Oral posix/Asia/Phnom_Penh posix/Asia/Pontianak posix/Asia/Pyongyang posix/Asia/Qatar posix/Asia/Qyzylorda posix/Asia/Rangoon posix/Asia/Riyadh posix/Asia/Riyadh87 posix/Asia/Riyadh88 posix/Asia/Riyadh89 posix/Asia/Saigon posix/Asia/Sakhalin posix/Asia/Samarkand posix/Asia/Seoul posix/Asia/Shanghai posix/Asia/Singapore posix/Asia/Taipei posix/Asia/Tashkent posix/Asia/Tbilisi posix/Asia/Tehran posix/Asia/Tel_Aviv posix/Asia/Thimbu posix/Asia/Thimphu posix/Asia/Tokyo posix/Asia/Ujung_Pandang posix/Asia/Ulaanbaatar posix/Asia/Ulan_Bator posix/Asia/Urumqi posix/Asia/Ust-Nera posix/Asia/Vientiane posix/Asia/Vladivostok posix/Asia/Yakutsk posix/Asia/Yekaterinburg posix/Asia/Yerevan posix/Atlantic/ posix/Atlantic/Azores posix/Atlantic/Bermuda posix/Atlantic/Canary posix/Atlantic/Cape_Verde posix/Atlantic/Faeroe posix/Atlantic/Faroe posix/Atlantic/Jan_Mayen posix/Atlantic/Madeira posix/Atlantic/Reykjavik posix/Atlantic/South_Georgia posix/Atlantic/St_Helena posix/Atlantic/Stanley posix/Australia/ posix/Australia/ACT posix/Australia/Adelaide posix/Australia/Brisbane posix/Australia/Broken_Hill posix/Australia/Canberra posix/Australia/Currie posix/Australia/Darwin posix/Australia/Eucla posix/Australia/Hobart posix/Australia/LHI posix/Australia/Lindeman posix/Australia/Lord_Howe posix/Australia/Melbourne posix/Australia/NSW posix/Australia/North posix/Australia/Perth posix/Australia/Queensland posix/Australia/South posix/Australia/Sydney posix/Australia/Tasmania posix/Australia/Victoria posix/Australia/West posix/Australia/Yancowinna posix/Brazil/ posix/Brazil/Acre posix/Brazil/DeNoronha posix/Brazil/East posix/Brazil/West posix/CET posix/CST6CDT posix/Canada/ posix/Canada/Atlantic posix/Canada/Central posix/Canada/East-Saskatchewan posix/Canada/Eastern posix/Canada/Mountain posix/Canada/Newfoundland posix/Canada/Pacific posix/Canada/Saskatchewan posix/Canada/Yukon posix/Chile/ posix/Chile/Continental posix/Chile/EasterIsland posix/Cuba posix/EET posix/EST posix/EST5EDT posix/Egypt posix/Eire posix/Etc/ posix/Etc/GMT posix/Etc/GMT+0 posix/Etc/GMT+1 posix/Etc/GMT+10 posix/Etc/GMT+11 posix/Etc/GMT+12 posix/Etc/GMT+2 posix/Etc/GMT+3 posix/Etc/GMT+4 posix/Etc/GMT+5 posix/Etc/GMT+6 posix/Etc/GMT+7 posix/Etc/GMT+8 posix/Etc/GMT+9 posix/Etc/GMT-0 posix/Etc/GMT-1 posix/Etc/GMT-10 posix/Etc/GMT-11 posix/Etc/GMT-12 posix/Etc/GMT-13 posix/Etc/GMT-14 posix/Etc/GMT-2 posix/Etc/GMT-3 posix/Etc/GMT-4 posix/Etc/GMT-5 posix/Etc/GMT-6 posix/Etc/GMT-7 posix/Etc/GMT-8 posix/Etc/GMT-9 posix/Etc/GMT0 posix/Etc/Greenwich posix/Etc/UCT posix/Etc/UTC posix/Etc/Universal posix/Etc/Zulu posix/Europe/ posix/Europe/Amsterdam posix/Europe/Andorra posix/Europe/Athens posix/Europe/Belfast posix/Europe/Belgrade posix/Europe/Berlin posix/Europe/Bratislava posix/Europe/Brussels posix/Europe/Bucharest posix/Europe/Budapest posix/Europe/Busingen posix/Europe/Chisinau posix/Europe/Copenhagen posix/Europe/Dublin posix/Europe/Gibraltar posix/Europe/Guernsey posix/Europe/Helsinki posix/Europe/Isle_of_Man posix/Europe/Istanbul posix/Europe/Jersey posix/Europe/Kaliningrad posix/Europe/Kiev posix/Europe/Lisbon posix/Europe/Ljubljana posix/Europe/London posix/Europe/Luxembourg posix/Europe/Madrid posix/Europe/Malta posix/Europe/Mariehamn posix/Europe/Minsk posix/Europe/Monaco posix/Europe/Moscow posix/Europe/Nicosia posix/Europe/Oslo posix/Europe/Paris posix/Europe/Podgorica posix/Europe/Prague posix/Europe/Riga posix/Europe/Rome posix/Europe/Samara posix/Europe/San_Marino posix/Europe/Sarajevo posix/Europe/Simferopol posix/Europe/Skopje posix/Europe/Sofia posix/Europe/Stockholm posix/Europe/Tallinn posix/Europe/Tirane posix/Europe/Tiraspol posix/Europe/Uzhgorod posix/Europe/Vaduz posix/Europe/Vatican posix/Europe/Vienna posix/Europe/Vilnius posix/Europe/Volgograd posix/Europe/Warsaw posix/Europe/Zagreb posix/Europe/Zaporozhye posix/Europe/Zurich posix/Factory posix/GB posix/GB-Eire posix/GMT posix/GMT+0 posix/GMT-0 posix/GMT0 posix/Greenwich posix/HST posix/Hongkong posix/Iceland posix/Indian/ posix/Indian/Antananarivo posix/Indian/Chagos posix/Indian/Christmas posix/Indian/Cocos posix/Indian/Comoro posix/Indian/Kerguelen posix/Indian/Mahe posix/Indian/Maldives posix/Indian/Mauritius posix/Indian/Mayotte posix/Indian/Reunion posix/Iran posix/Israel posix/Jamaica posix/Japan posix/Kwajalein posix/Libya posix/MET posix/MST posix/MST7MDT posix/Mexico/ posix/Mexico/BajaNorte posix/Mexico/BajaSur posix/Mexico/General posix/Mideast/ posix/Mideast/Riyadh87 posix/Mideast/Riyadh88 posix/Mideast/Riyadh89 posix/NZ posix/NZ-CHAT posix/Navajo posix/PRC posix/PST8PDT posix/Pacific/ posix/Pacific/Apia posix/Pacific/Auckland posix/Pacific/Chatham posix/Pacific/Chuuk posix/Pacific/Easter posix/Pacific/Efate posix/Pacific/Enderbury posix/Pacific/Fakaofo posix/Pacific/Fiji posix/Pacific/Funafuti posix/Pacific/Galapagos posix/Pacific/Gambier posix/Pacific/Guadalcanal posix/Pacific/Guam posix/Pacific/Honolulu posix/Pacific/Johnston posix/Pacific/Kiritimati posix/Pacific/Kosrae posix/Pacific/Kwajalein posix/Pacific/Majuro posix/Pacific/Marquesas posix/Pacific/Midway posix/Pacific/Nauru posix/Pacific/Niue posix/Pacific/Norfolk posix/Pacific/Noumea posix/Pacific/Pago_Pago posix/Pacific/Palau posix/Pacific/Pitcairn posix/Pacific/Pohnpei posix/Pacific/Ponape posix/Pacific/Port_Moresby posix/Pacific/Rarotonga posix/Pacific/Saipan posix/Pacific/Samoa posix/Pacific/Tahiti posix/Pacific/Tarawa posix/Pacific/Tongatapu posix/Pacific/Truk posix/Pacific/Wake posix/Pacific/Wallis posix/Pacific/Yap posix/Poland posix/Portugal posix/ROC posix/ROK posix/Singapore posix/Turkey posix/UCT posix/US/ posix/US/Alaska posix/US/Aleutian posix/US/Arizona posix/US/Central posix/US/East-Indiana posix/US/Eastern posix/US/Hawaii posix/US/Indiana-Starke posix/US/Michigan posix/US/Mountain posix/US/Pacific posix/US/Pacific-New posix/US/Samoa posix/UTC posix/Universal posix/W-SU posix/WET posix/Zulu posixrules right/ right/Africa/ right/Africa/Abidjan right/Africa/Accra right/Africa/Addis_Ababa right/Africa/Algiers right/Africa/Asmara right/Africa/Asmera right/Africa/Bamako right/Africa/Bangui right/Africa/Banjul right/Africa/Bissau right/Africa/Blantyre right/Africa/Brazzaville right/Africa/Bujumbura right/Africa/Cairo right/Africa/Casablanca right/Africa/Ceuta right/Africa/Conakry right/Africa/Dakar right/Africa/Dar_es_Salaam right/Africa/Djibouti right/Africa/Douala right/Africa/El_Aaiun right/Africa/Freetown right/Africa/Gaborone right/Africa/Harare right/Africa/Johannesburg right/Africa/Juba right/Africa/Kampala right/Africa/Khartoum right/Africa/Kigali right/Africa/Kinshasa right/Africa/Lagos right/Africa/Libreville right/Africa/Lome right/Africa/Luanda right/Africa/Lubumbashi right/Africa/Lusaka right/Africa/Malabo right/Africa/Maputo right/Africa/Maseru right/Africa/Mbabane right/Africa/Mogadishu right/Africa/Monrovia right/Africa/Nairobi right/Africa/Ndjamena right/Africa/Niamey right/Africa/Nouakchott right/Africa/Ouagadougou right/Africa/Porto-Novo right/Africa/Sao_Tome right/Africa/Timbuktu right/Africa/Tripoli right/Africa/Tunis right/Africa/Windhoek right/America/ right/America/Adak right/America/Anchorage right/America/Anguilla right/America/Antigua right/America/Araguaina right/America/Argentina/ right/America/Argentina/Buenos_Aires right/America/Argentina/Catamarca right/America/Argentina/ComodRivadavia right/America/Argentina/Cordoba right/America/Argentina/Jujuy right/America/Argentina/La_Rioja right/America/Argentina/Mendoza right/America/Argentina/Rio_Gallegos right/America/Argentina/Salta right/America/Argentina/San_Juan right/America/Argentina/San_Luis right/America/Argentina/Tucuman right/America/Argentina/Ushuaia right/America/Aruba right/America/Asuncion right/America/Atikokan right/America/Atka right/America/Bahia right/America/Bahia_Banderas right/America/Barbados right/America/Belem right/America/Belize right/America/Blanc-Sablon right/America/Boa_Vista right/America/Bogota right/America/Boise right/America/Buenos_Aires right/America/Cambridge_Bay right/America/Campo_Grande right/America/Cancun right/America/Caracas right/America/Catamarca right/America/Cayenne right/America/Cayman right/America/Chicago right/America/Chihuahua right/America/Coral_Harbour right/America/Cordoba right/America/Costa_Rica right/America/Creston right/America/Cuiaba right/America/Curacao right/America/Danmarkshavn right/America/Dawson right/America/Dawson_Creek right/America/Denver right/America/Detroit right/America/Dominica right/America/Edmonton right/America/Eirunepe right/America/El_Salvador right/America/Ensenada right/America/Fort_Wayne right/America/Fortaleza right/America/Glace_Bay right/America/Godthab right/America/Goose_Bay right/America/Grand_Turk right/America/Grenada right/America/Guadeloupe right/America/Guatemala right/America/Guayaquil right/America/Guyana right/America/Halifax right/America/Havana right/America/Hermosillo right/America/Indiana/ right/America/Indiana/Indianapolis right/America/Indiana/Knox right/America/Indiana/Marengo right/America/Indiana/Petersburg right/America/Indiana/Tell_City right/America/Indiana/Vevay right/America/Indiana/Vincennes right/America/Indiana/Winamac right/America/Indianapolis right/America/Inuvik right/America/Iqaluit right/America/Jamaica right/America/Jujuy right/America/Juneau right/America/Kentucky/ right/America/Kentucky/Louisville right/America/Kentucky/Monticello right/America/Knox_IN right/America/Kralendijk right/America/La_Paz right/America/Lima right/America/Los_Angeles right/America/Louisville right/America/Lower_Princes right/America/Maceio right/America/Managua right/America/Manaus right/America/Marigot right/America/Martinique right/America/Matamoros right/America/Mazatlan right/America/Mendoza right/America/Menominee right/America/Merida right/America/Metlakatla right/America/Mexico_City right/America/Miquelon right/America/Moncton right/America/Monterrey right/America/Montevideo right/America/Montreal right/America/Montserrat right/America/Nassau right/America/New_York right/America/Nipigon right/America/Nome right/America/Noronha right/America/North_Dakota/ right/America/North_Dakota/Beulah right/America/North_Dakota/Center right/America/North_Dakota/New_Salem right/America/Ojinaga right/America/Panama right/America/Pangnirtung right/America/Paramaribo right/America/Phoenix right/America/Port-au-Prince right/America/Port_of_Spain right/America/Porto_Acre right/America/Porto_Velho right/America/Puerto_Rico right/America/Rainy_River right/America/Rankin_Inlet right/America/Recife right/America/Regina right/America/Resolute right/America/Rio_Branco right/America/Rosario right/America/Santa_Isabel right/America/Santarem right/America/Santiago right/America/Santo_Domingo right/America/Sao_Paulo right/America/Scoresbysund right/America/Shiprock right/America/Sitka right/America/St_Barthelemy right/America/St_Johns right/America/St_Kitts right/America/St_Lucia right/America/St_Thomas right/America/St_Vincent right/America/Swift_Current right/America/Tegucigalpa right/America/Thule right/America/Thunder_Bay right/America/Tijuana right/America/Toronto right/America/Tortola right/America/Vancouver right/America/Virgin right/America/Whitehorse right/America/Winnipeg right/America/Yakutat right/America/Yellowknife right/Antarctica/ right/Antarctica/Casey right/Antarctica/Davis right/Antarctica/DumontDUrville right/Antarctica/Macquarie right/Antarctica/Mawson right/Antarctica/McMurdo right/Antarctica/Palmer right/Antarctica/Rothera right/Antarctica/South_Pole right/Antarctica/Syowa right/Antarctica/Troll right/Antarctica/Vostok right/Arctic/ right/Arctic/Longyearbyen right/Asia/ right/Asia/Aden right/Asia/Almaty right/Asia/Amman right/Asia/Anadyr right/Asia/Aqtau right/Asia/Aqtobe right/Asia/Ashgabat right/Asia/Ashkhabad right/Asia/Baghdad right/Asia/Bahrain right/Asia/Baku right/Asia/Bangkok right/Asia/Beirut right/Asia/Bishkek right/Asia/Brunei right/Asia/Calcutta right/Asia/Choibalsan right/Asia/Chongqing right/Asia/Chungking right/Asia/Colombo right/Asia/Dacca right/Asia/Damascus right/Asia/Dhaka right/Asia/Dili right/Asia/Dubai right/Asia/Dushanbe right/Asia/Gaza right/Asia/Harbin right/Asia/Hebron right/Asia/Ho_Chi_Minh right/Asia/Hong_Kong right/Asia/Hovd right/Asia/Irkutsk right/Asia/Istanbul right/Asia/Jakarta right/Asia/Jayapura right/Asia/Jerusalem right/Asia/Kabul right/Asia/Kamchatka right/Asia/Karachi right/Asia/Kashgar right/Asia/Kathmandu right/Asia/Katmandu right/Asia/Khandyga right/Asia/Kolkata right/Asia/Krasnoyarsk right/Asia/Kuala_Lumpur right/Asia/Kuching right/Asia/Kuwait right/Asia/Macao right/Asia/Macau right/Asia/Magadan right/Asia/Makassar right/Asia/Manila right/Asia/Muscat right/Asia/Nicosia right/Asia/Novokuznetsk right/Asia/Novosibirsk right/Asia/Omsk right/Asia/Oral right/Asia/Phnom_Penh right/Asia/Pontianak right/Asia/Pyongyang right/Asia/Qatar right/Asia/Qyzylorda right/Asia/Rangoon right/Asia/Riyadh right/Asia/Riyadh87 right/Asia/Riyadh88 right/Asia/Riyadh89 right/Asia/Saigon right/Asia/Sakhalin right/Asia/Samarkand right/Asia/Seoul right/Asia/Shanghai right/Asia/Singapore right/Asia/Taipei right/Asia/Tashkent right/Asia/Tbilisi right/Asia/Tehran right/Asia/Tel_Aviv right/Asia/Thimbu right/Asia/Thimphu right/Asia/Tokyo right/Asia/Ujung_Pandang right/Asia/Ulaanbaatar right/Asia/Ulan_Bator right/Asia/Urumqi right/Asia/Ust-Nera right/Asia/Vientiane right/Asia/Vladivostok right/Asia/Yakutsk right/Asia/Yekaterinburg right/Asia/Yerevan right/Atlantic/ right/Atlantic/Azores right/Atlantic/Bermuda right/Atlantic/Canary right/Atlantic/Cape_Verde right/Atlantic/Faeroe right/Atlantic/Faroe right/Atlantic/Jan_Mayen right/Atlantic/Madeira right/Atlantic/Reykjavik right/Atlantic/South_Georgia right/Atlantic/St_Helena right/Atlantic/Stanley right/Australia/ right/Australia/ACT right/Australia/Adelaide right/Australia/Brisbane right/Australia/Broken_Hill right/Australia/Canberra right/Australia/Currie right/Australia/Darwin right/Australia/Eucla right/Australia/Hobart right/Australia/LHI right/Australia/Lindeman right/Australia/Lord_Howe right/Australia/Melbourne right/Australia/NSW right/Australia/North right/Australia/Perth right/Australia/Queensland right/Australia/South right/Australia/Sydney right/Australia/Tasmania right/Australia/Victoria right/Australia/West right/Australia/Yancowinna right/Brazil/ right/Brazil/Acre right/Brazil/DeNoronha right/Brazil/East right/Brazil/West right/CET right/CST6CDT right/Canada/ right/Canada/Atlantic right/Canada/Central right/Canada/East-Saskatchewan right/Canada/Eastern right/Canada/Mountain right/Canada/Newfoundland right/Canada/Pacific right/Canada/Saskatchewan right/Canada/Yukon right/Chile/ right/Chile/Continental right/Chile/EasterIsland right/Cuba right/EET right/EST right/EST5EDT right/Egypt right/Eire right/Etc/ right/Etc/GMT right/Etc/GMT+0 right/Etc/GMT+1 right/Etc/GMT+10 right/Etc/GMT+11 right/Etc/GMT+12 right/Etc/GMT+2 right/Etc/GMT+3 right/Etc/GMT+4 right/Etc/GMT+5 right/Etc/GMT+6 right/Etc/GMT+7 right/Etc/GMT+8 right/Etc/GMT+9 right/Etc/GMT-0 right/Etc/GMT-1 right/Etc/GMT-10 right/Etc/GMT-11 right/Etc/GMT-12 right/Etc/GMT-13 right/Etc/GMT-14 right/Etc/GMT-2 right/Etc/GMT-3 right/Etc/GMT-4 right/Etc/GMT-5 right/Etc/GMT-6 right/Etc/GMT-7 right/Etc/GMT-8 right/Etc/GMT-9 right/Etc/GMT0 right/Etc/Greenwich right/Etc/UCT right/Etc/UTC right/Etc/Universal right/Etc/Zulu right/Europe/ right/Europe/Amsterdam right/Europe/Andorra right/Europe/Athens right/Europe/Belfast right/Europe/Belgrade right/Europe/Berlin right/Europe/Bratislava right/Europe/Brussels right/Europe/Bucharest right/Europe/Budapest right/Europe/Busingen right/Europe/Chisinau right/Europe/Copenhagen right/Europe/Dublin right/Europe/Gibraltar right/Europe/Guernsey right/Europe/Helsinki right/Europe/Isle_of_Man right/Europe/Istanbul right/Europe/Jersey right/Europe/Kaliningrad right/Europe/Kiev right/Europe/Lisbon right/Europe/Ljubljana right/Europe/London right/Europe/Luxembourg right/Europe/Madrid right/Europe/Malta right/Europe/Mariehamn right/Europe/Minsk right/Europe/Monaco right/Europe/Moscow right/Europe/Nicosia right/Europe/Oslo right/Europe/Paris right/Europe/Podgorica right/Europe/Prague right/Europe/Riga right/Europe/Rome right/Europe/Samara right/Europe/San_Marino right/Europe/Sarajevo right/Europe/Simferopol right/Europe/Skopje right/Europe/Sofia right/Europe/Stockholm right/Europe/Tallinn right/Europe/Tirane right/Europe/Tiraspol right/Europe/Uzhgorod right/Europe/Vaduz right/Europe/Vatican right/Europe/Vienna right/Europe/Vilnius right/Europe/Volgograd right/Europe/Warsaw right/Europe/Zagreb right/Europe/Zaporozhye right/Europe/Zurich right/Factory right/GB right/GB-Eire right/GMT right/GMT+0 right/GMT-0 right/GMT0 right/Greenwich right/HST right/Hongkong right/Iceland right/Indian/ right/Indian/Antananarivo right/Indian/Chagos right/Indian/Christmas right/Indian/Cocos right/Indian/Comoro right/Indian/Kerguelen right/Indian/Mahe right/Indian/Maldives right/Indian/Mauritius right/Indian/Mayotte right/Indian/Reunion right/Iran right/Israel right/Jamaica right/Japan right/Kwajalein right/Libya right/MET right/MST right/MST7MDT right/Mexico/ right/Mexico/BajaNorte right/Mexico/BajaSur right/Mexico/General right/Mideast/ right/Mideast/Riyadh87 right/Mideast/Riyadh88 right/Mideast/Riyadh89 right/NZ right/NZ-CHAT right/Navajo right/PRC right/PST8PDT right/Pacific/ right/Pacific/Apia right/Pacific/Auckland right/Pacific/Chatham right/Pacific/Chuuk right/Pacific/Easter right/Pacific/Efate right/Pacific/Enderbury right/Pacific/Fakaofo right/Pacific/Fiji right/Pacific/Funafuti right/Pacific/Galapagos right/Pacific/Gambier right/Pacific/Guadalcanal right/Pacific/Guam right/Pacific/Honolulu right/Pacific/Johnston right/Pacific/Kiritimati right/Pacific/Kosrae right/Pacific/Kwajalein right/Pacific/Majuro right/Pacific/Marquesas right/Pacific/Midway right/Pacific/Nauru right/Pacific/Niue right/Pacific/Norfolk right/Pacific/Noumea right/Pacific/Pago_Pago right/Pacific/Palau right/Pacific/Pitcairn right/Pacific/Pohnpei right/Pacific/Ponape right/Pacific/Port_Moresby right/Pacific/Rarotonga right/Pacific/Saipan right/Pacific/Samoa right/Pacific/Tahiti right/Pacific/Tarawa right/Pacific/Tongatapu right/Pacific/Truk right/Pacific/Wake right/Pacific/Wallis right/Pacific/Yap right/Poland right/Portugal right/ROC right/ROK right/Singapore right/Turkey right/UCT right/US/ right/US/Alaska right/US/Aleutian right/US/Arizona right/US/Central right/US/East-Indiana right/US/Eastern right/US/Hawaii right/US/Indiana-Starke right/US/Michigan right/US/Mountain right/US/Pacific right/US/Pacific-New right/US/Samoa right/UTC right/Universal right/W-SU right/WET right/Zulu 08`6S<  6S1Ԙt`[~ [~6S`@@<@TU IS bIS?A 7SY۩;S<;S<x1ϞA7S̿B7S̿B7S̿Ba9V=A7S7St7StbWA7S9S͵09S͵0ckA7St7St7StdA7St;SG,;SG,e*d4;SS9S/79S/7hp0ۨ!:S֍6:S֍6:S֍65!:S֍6:S֍6:S֍6*!:S֍6:S֍6;S<s_w#!:S[|7:S[|7;SnOk!:S[|7:S[|7:S[|7V!:S[|7:S[|7:S[|7 o!:S[|7:S[|7:S[|7i!:S[|7:S[|7:S[|7&!:S[|7:S[|7:S[|7!:S[|7:S[|7;S8 o!:S[|7:S[|7:S[|7]V!:S[|7:S[|7:S[|7a:S[|7:S[|7;Sg}zr!:S[|7:S[|7;Sg܇a:S[|7:S[|7;Sgō7!:S8:S8;Sgqa:S8:S8;Sgl!:S8:S8;SgRa:S8:S8;Sgv!:S8:S8;Sga:S8:S8;Sgԇ!:S8:S8;Sg;a:S8:S8;SgS!:S8:S8;Sg_a:S8:S8;Sg)n!:S8:S8;SgW|ia:S8:S8;Sg!:S68:S68;SgXa:S68:S68;SgE|!:S68:S68;Sg΋a:S68:S68;Sg ڛ!:S68:S68;Sg #<a:S68:S68;Sg nv=!:S68:S68;Sg P+}ha:S68:S68;Sg s!:S68:S68;Sg 9M a:S68:S68;Sg YG!:S68:S68;Sg a:SuG9:SuG9;Sg aM!:SuG9:SuG9;Sg %a:SuG9:SuG9;SgҖ<!:SuG9:SuG9;Sgɕ|a:SuG9:SuG9;SgTa8!:SuG9:SuG9;Sgu֙a:SuG9:SuG9;S[\A8!:SuG9:SuG9;S[kxa:SuG9:SuG9;S[8_.1!:SuG9:SuG9;S[a:SuG9:SuG9;S[ !:SuG9:SuG9;S[0ya:S 9:S 9;S[Q!:S 9:S 9;S[g a:S 9:S 9;S[c&*!:S 9:S 9;S[ia:S 9:S 9;S[U!:S 9:S 9;S[<N&a:S 9:S 9;S[D!:S 9:S 9;S[ra:S 9:S 9;S[ce!:S 9:S 9;S[<a:S 9:S 9;S[N$!:S 9:S 9;S[?Da:S y::S y:;S[k!:S y::S y:;S[p[_ma:S y::S y:;S[7]$!:S y::S y:;S[a8Da:S y::S y:;S[Kw!:S y::S y:;S['Lxa:S y::S y:;S[{oP!:S y::S y:;S['a:S y::S y:;S[27c!:S y::S y:;S[-qa:S y::S y:;S[;!:Sg;:Sg;;S[tu#a:Sg;:Sg;;S[簀!:Sg;:Sg;;S[na:Sg;:Sg;;S[~[o!:Sg;:Sg;;S[a:Sg;:Sg;;S[vo!:Sg;:Sg;;S[x a:Sg;:Sg;;S[ A!:Sg;:Sg;;S[Xa:Sg;:Sg;;S[x!:Sg;:Sg;;S[a;S%;S%;S[u!;S%;S%;S[Pݭa;S%;S%;S[^uL!;S%;S%;S[Ema;S%;S%;S[G!;S%;S%;S[VǙGa;S%;S%;S[!;S%;S%;S[{la;S%;S%;S[~f#!;S%;S%;S[-a;S†;S†;S[V!;S†;S†;S[za;S†;S†;S[3q!;S†;S†;S[ha;S†;S†;S[#w!;S†;S†;S[e!;S†;S†;S†<)`Ր!;S†;S†;S†=cP!;St;St;St">!;St;St;St"^!;St;St;St4 4!;St;St;S[fv!;St;St;St(l!;St;St;St(``GH!;St;St;St(ԍ!;St;St;St(6@;SG,IS*}IS*}j pK>}TMV sa[&Qd{&VEF V }*rr=$(encr_pwd "$_rootpass") echo "1,s@^root::@root:${_encr}:@ w q" | ed /mnt/etc/master.passwd 2>/dev/null fi /mnt/usr/sbin/pwd_mkdb -p -d /mnt/etc /etc/master.passwd [[ -n "$rootkey" ]] && ( umask 077 mkdir /mnt/root/.ssh print -r -- "$rootkey" >> /mnt/root/.ssh/authorized_keys ) if grep -qs '^rtsol' /mnt/etc/hostname.*; then echo 'net.inet6.icmp6.rediraccept=1 # 1=Accept IPv6 ICMP redirects (for hosts)' >>/mnt/etc/sysctl.conf fi finish_up  ... . .. binmdecqCsbinqDshareq . .. ftpgrep@fgrep@egrep@gzip@gunzipgzcat@less@more@ sedPsignify ... .D ..mtermcap . ..MAKEDEVconsole tty memkmemnullzerostdinstdoutstderrksymsklogbpf0wd0arwd0awd0brwd0bwd0crwd0cwd0drwd0dwd0erwd0ewd0frwd0fwd0grwd0gwd0hrwd0hwd0irwd0iwd0jrwd0jwd0krwd0k wd0l rwd0l wd0m rwd0m wd0nrwd0nwd0orwd0owd0prwd0pwd1arwd1awd1brwd1bwd1crwd1cwd1drwd1dwd1erwd1ewd1frwd1fwd1g rwd1g!wd1h"rwd1h#wd1i$rwd1i#!/bin/sh - PATH=/sbin:/usr/sbin:/bin:/usr/bin T=$0 [ "$eo" ] || eo= hex() { case $1 in [0-9]) echo -n $1;; 10) echo -n a;; 11) echo -n b;; 12) echo -n c;; 13) echo -n d;; 14) echo -n e;; 15) echo -n f;; esac } alph2d() { local t="$1" local p="0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ" local sub=${p%${t}*} echo ${#sub} } h2d() { local s="$1" local f=${s%*[0-9a-f]} n=${s#[0-9a-f]*} echo $(($(_h2d $f)*16+ $(_h2d $n) )) } _h2d() { case $1 in [0-9]) echo -n $1;; a) echo -n 10;; b) echo -n 11;; c) echo -n 12;; d) echo -n 13;; e) echo -n 14;; f) echo -n 15;; esac } unt() { arg="$1" tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" while [ "$tmp" != "$arg" ] do arg=$tmp tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" done echo $arg } dodisk() { [ "$DEBUG" ] && set -x n=$(($((${5}*${7:-16}))+${6})) count=0 [ 0$7 -ne 8 ] && l="i j k l m n o p" for d in a b c d e f g h $l do M $1$2$d b $3 $(($n+$count)) 640 operator M r$1$2$d c $4 $(($n+$count)) 640 operator let count=count+1 done } dodisk2() { n=$(($(($5*${7:-16}))+$6)) M $1$2a b $3 $n 640 operator M r$1$2a c $4 $n 640 operator n=$(($n+2)) M $1$2c b $3 $n 640 operator M r$1$2c c $4 $n 640 operator } RMlist[0]="rm -f" mkl() { mklist[${#mklist[*]}]=";mknod -m $1 $2 $3 $4 $5" } M() { RMlist[${#RMlist[*]}]=$1 mkl ${5-666} $1 $2 $3 $4 G=${6:-wheel} [ "$7" ] && { MKlist[${#MKlist[*]}]="&& chown $7:$G $1" } || { case $G in wheel) [ ${#whlist[*]} = 0 ] && whlist[0]="&& chgrp wheel" whlist[${#whlist[*]}]="$1" ;; operator) [ ${#oplist[*]} = 0 ] && oplist[0]="&& chgrp operator" oplist[${#oplist[*]}]="$1" ;; *) MKlist[${#MKlist[*]}]="&& chgrp $G $1"; esac } return 0 } R() { [ "$DEBUG" ] && set -x for i in "$@" do U=`unt $i` [ "$U" ] || U=0 case $i in ramdisk) R std bpf0 wd0 wd1 sd0 tty00 rd0 wsmouse R st0 ttyC0 wskbd0 apm bio diskmap random ;; std) M console c 0 0 600 M tty c 1 0 M mem c 2 0 640 kmem M kmem c 2 1 640 kmem M null c 2 2 M zero c 2 12 M stdin c 7 0 M stdout c 7 1 M stderr c 7 2 M ksyms c 8 0 640 kmem M klog c 6 0 600 ;; vscsi*) M vscsi$U c 100 $U 600 ;; video*) M video$U c 38 $U MKlist[${#MKlist[*]}]=";[ -e video ] || ln -s video$U video" ;; tuner*) M tuner$U c 75 $(($(($U*2))+16)) 644 ;; systrace) M systrace c 50 0 644 ;; uk*) M uk$U c 28 $U 640 operator ;; tun*) M tun$U c 33 $U 600 ;; rmidi*) M rmidi$U c 57 $U 666 ;; *random) n=0 for pre in " " s u a do M ${pre}random c 40 $n 644 n=$(($n+1)) done ;; radio*) M radio$U c 97 $U MKlist[${#MKlist[*]}]=";[ -e radio ] || ln -s radio$U radio" ;; pppx*) M pppx$U c 103 $U 600 ;; pf*) M pf c 46 0 600 ;; pci*) M pci$U c 88 $U 600 MKlist[${#MKlist[*]}]=";[ -h pci ] || ln -sf pci0 pci" ;; lkm) M lkm c 35 0 640 _lkm ;; hotplug) M hotplug c 37 $U 400 ;; fuse) M fuse$U c 77 $U 600 ;; fd) RMlist[${#RMlist[*]}]=";mkdir -p fd;rm -f" n=0 while [ $n -lt 64 ];do M fd/$n c 7 $n;n=$(($n+1));done MKlist[${#MKlist[*]}]=";chmod 555 fd" ;; diskmap) M diskmap c 102 0 640 operator ;; crypto) M crypto c 47 0 ;; bpf*) M bpf$U c 22 $U 600 ;; bktr*) M bktr$U c 75 $U 644 ;; bio) M bio c 52 0 600 ;; audio*) M sound$U c 36 $U M mixer$U c 36 $(($U+16)) M audio$U c 36 $(($U+128)) M audioctl$U c 36 $(($U+192)) MKlist[${#MKlist[*]}]=";[ -e audio ] || ln -s audio$U audio" MKlist[${#MKlist[*]}]=";[ -e mixer ] || ln -s mixer$U mixer" MKlist[${#MKlist[*]}]=";[ -e sound ] || ln -s sound$U sound" MKlist[${#MKlist[*]}]=";[ -e audioctl ] || ln -s audioctl$U audioctl" ;; apm*) M apm c 34 0 644 M apmctl c 34 8 644 ;; usb*) [ "$i" = "usb" ] && u= || u=$U M usb$u c 64 $U 660 ;; urio*) M urio$U c 67 $U 660 ;; ulpt*) M ulpt$U c 66 $U 660 ;; uhid*) M uhid$U c 65 $U 660 ;; ugen*) n=$(($U*16)) for j in 0{0,1,2,3,4,5,6,7,8,9} 1{0,1,2,3,4,5} do M ugen$U.$j c 70 $(($n+10#$j)) 660 done ;; uall) R ttyU0 ttyU1 ttyU2 ttyU3 ugen0 ugen1 ugen2 ugen3 ugen4 ugen5 R ugen6 ugen7 ulpt0 ulpt1 uhid0 uhid1 uhid2 uhid3 urio0 usb0 R usb1 usb2 usb3 usb4 usb5 usb6 usb7 ;; ttyU[0-9a-zA-Z]) U=${i#ttyU*} o=$(alph2d $U) M ttyU$U c 68 $o 660 dialer uucp M cuaU$U c 68 $(($o+128)) 660 dialer uucp ;; wsmux|wsmouse|wskbd) M wsmouse c 63 0 600 M wskbd c 63 1 600 ;; wsmouse[0-9]*) M wsmouse$U c 62 $U 600 ;; wskbd[0-9]*) M wskbd$U c 61 $U 600 ;; wscons) R wsmouse0 wsmouse1 wsmouse2 wsmouse3 wskbd0 wskbd1 wskbd2 R wskbd3 wsmux ttyCcfg ttyC0 ttyC1 ttyC2 ttyC3 ttyC4 ttyC5 R ttyC6 ttyC7 ttyC8 ttyC9 ttyCa ttyCb ;; tty[C-J]*) U=${i##tty[C-J]} case $i in ttyC*) n=C m=0;; ttyD*) n=D m=256;; ttyE*) n=E m=512;; ttyF*) n=F m=768;; ttyG*) n=G m=1024;; ttyH*) n=H m=1280;; ttyI*) n=I m=1536;; ttyJ*) n=J m=1792;; esac case $U in [0-9a-f]) M tty$n$U c 60 $((16#$U+$m)) 600;; cfg) M tty${n}cfg c 60 $((255+$m)) 600;; *) echo bad unit $U for $i; exit 1;; esac ;; pty*) if [ $U -gt 15 ]; then echo bad unit for pty in: $i continue fi set -A letters p q r s t u v w x y z P Q R S T set -A suffixes 0 1 2 3 4 5 6 7 8 9 a b c d e f g h i j k l m n o p q \ r s t u v w x y z A B C D E F G H I J K L M N O P Q R S T U V W X \ Y Z name=${letters[$U]} n=0 while [ $n -lt 62 ] do nam=$name${suffixes[$n]} off=$(($U*62)) M tty$nam c 4 $(($off+$n)) M pty$nam c 5 $(($off+$n)) n=$(($n+1)) done ;; ptm) M ptm c 98 0 666 ;; tty[0-7][0-9a-f]) U=${i#tty*} o=$(h2d $U) M tty$U c 12 $o 660 dialer uucp M cua$U c 12 $(($o+128)) 660 dialer uucp ;; st*) n=$(($U*16)) for pre in " " n e en do M ${pre}st$U b 25 $n 660 operator M ${pre}rst$U c 25 $n 660 operator n=$(($n+1)) done ;; vnd*) dodisk vnd $U 19 19 $U 0 ;; rd*) dodisk2 rd $U 18 18 $U 0 ;; ch*) M ch$U c 27 $U 660 operator ;; cd*) dodisk2 cd $U 26 26 $U 0 ;; local) test -s $T.local && sh $T.local ;; all) R vnd0 vnd1 vnd2 vnd3 sd0 sd1 sd2 sd3 sd4 sd5 sd6 sd7 sd8 sd9 R cd0 cd1 rd0 tun0 tun1 tun2 tun3 bio bpf0 bpf1 bpf2 bpf3 bpf4 R bpf5 bpf6 bpf7 bpf8 bpf9 pty0 diskmap vscsi0 ch0 audio0 R audio1 audio2 fuse pppx hotplug ptm local wscons pci0 pci1 R pci2 pci3 uall rmidi0 rmidi1 rmidi2 rmidi3 rmidi4 rmidi5 R rmidi6 rmidi7 tuner0 radio0 video0 video1 uk0 random lkm R tty00 tty01 tty02 tty03 tty04 tty05 tty06 tty07 tty08 tty09 R tty0a tty0b apm crypto pf systrace wd0 wd1 wd2 wd3 std st0 R st1 fd ;; wd*|sd*) case $i in wd*) dodisk wd $U 16 16 $U 0;; sd*) dodisk sd $U 24 24 $U 0;; esac ;; *) echo $i: unknown device ;; esac done } R "$@" { echo -n ${RMlist[*]} echo -n ${mklist[*]} echo -n ${MKlist[*]} echo -n ${whlist[*]} echo ${oplist[*]} } | if [ "$eo" = "echo" ]; then cat else sh fi  . ..MAKEDEVconsole tty memkmemnullzerostdinstdoutstderrksymsklogbpf0wd0arwd0awd0brwd0bwd0crwd0cwd0drwd0dwd0erwd0ewd0frwd0fwd0grwd0gwd0hrwd0hwd0irwd0iwd0jrwd0jwd0krwd0k wd0l rwd0l wd0m rwd0m wd0nrwd0nwd0orwd0owd0prwd0pwd1arwd1awd1brwd1bwd1crwd1cwd1drwd1dwd1erwd1ewd1frwd1fwd1g rwd1g!wd1h"rwd1h#wd1i$rwd1i%wd1j&rwd1j'wd1k(rwd1k)wd1l*rwd1l+wd1m,rwd1m-wd1n.rwd1n/wd1o0rwd1o1wd1p2rwd1p3sd0a4rsd0a5sd0b6rsd0b7sd0c8rsd0c9sd0d:rsd0d;sd0e<rsd0e=sd0f>rsd0f?sd0g@rsd0gAsd0hBrsd0hCsd0iDrsd0iEsd0jFrsd0jGsd0kHrsd0kIsd0lJrsd0lKsd0mLrsd0mMsd0nNrsd0nOsd0oPrsd0oQsd0pRrsd0pStty00Tcua00Urd0aVrrd0aWrd0cXrrd0cYwsmouseZwskbd[ st0\rst0]nst0^nrst0_est0`erst0aenst0benrst0cttyC0dwskbd0e apmfapmctlg biohdiskmapirandomjsrandomkurandomlarandom dumb|80-column dumb tty:\ :am:\ :co#80:\ :bl=^G:cr=^M:do=^J:sf=^J: vt100|vt100-am|dec vt100 (w/advanced video):\ :5i:am:bs:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :@8=\EOM:DO=\E[%dB:K1=\EOq:K2=\EOr:K3=\EOs:K4=\EOp:K5=\EOn:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=^O:as=^N:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:do=^J:\ :eA=\E(B\E)0:ho=\E[H:k0=\EOy:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k5=\EOt:k6=\EOu:k7=\EOv:k8=\EOl:k9=\EOw:k;=\EOx:\ :kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:\ :ku=\EOA:l1=pf1:l2=pf2:l3=pf3:l4=pf4:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[0m:mr=\E[7m:nd=\E[C:pf=\E[4i:po=\E[5i:\ :ps=\E[0i:rc=\E8:rs=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :..sa=\E[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t\016%e\017%;$<2>:\ :sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: vt220|vt200|dec vt220:\ :5i:am:bs:mi:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :%0=\E[29~:%1=\E[28~:*6=\E[4~:@0=\E[1~:AL=\E[%dL:\ :DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:F1=\E[23~:F2=\E[24~:\ :F3=\E[25~:F4=\E[26~:F7=\E[31~:F8=\E[32~:F9=\E[33~:\ :FA=\E[34~:IC=\E[%d@:LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:\ :SA=\E[?7h:UP=\E[%dA:ae=\E(B:al=\E[L:as=\E(0:bl=^G:\ :cb=\E[1K:cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:\ :cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:\ :eA=\E)0:ec=\E[%dX:ei=\E[4l:ho=\E[H:\ :if=/usr/share/tabset/vt100:im=\E[4h:\ :is=\E[?7h\E[>\E[?1l\E F\E[?4l:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k6=\E[17~:k7=\E[18~:k8=\E[19~:k9=\E[20~:\ :k;=\E[21~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=^H:\ :kd=\E[B:kl=\E[D:kr=\E[C:ku=\E[A:l1=pf1:l2=pf2:l3=pf3:\ :l4=pf4:le=^H:mb=\E[5m:md=\E[1m:me=\E[0m:mr=\E[7m:nd=\E[C:\ :nw=\EE:pf=\E[4i:po=\E[5i:ps=\E[i:r1=\E[?3l:rc=\E8:sc=\E7:\ :se=\E[27m:sf=\ED:so=\E[7m:sr=\EM:st=\EH:ta=^I:\ :u6=\E[%i%d;%dR:u7=\E[6n:u9=\E[c:ue=\E[24m:up=\E[A:\ :us=\E[4m:vb=\E[?5h\E[?5l: #!/bin/ksh MODE=install . install.sub DISK= DISKS_DONE= _DKDEVS=$(get_dkdevs) _fsent= rm -f /tmp/fstab* ask_yn "Use DUIDs rather than device names in fstab?" yes && FSTABFLAG=-F while :; do DISKS_DONE=$(addel "$DISK" $DISKS_DONE) _DKDEVS=$(rmel "$DISK" $_DKDEVS) if isin $ROOTDISK $_DKDEVS; then resp=$ROOTDISK rm -f /tmp/fstab else ask_which "disk" "do you wish to initialize" \ '$(l=$(get_dkdevs); for a in $DISKS_DONE; do l=$(rmel $a $l); done; bsort $l)' \ done [[ $resp == done ]] && break fi DISK=$resp makedev $DISK || continue rm -f /tmp/*.$DISK md_prep_disklabel $DISK || { DISK= ; continue ; } grep -qs " / ffs " /tmp/fstab.$ROOTDISK || { DISK= ; echo "'/' must be configured!" ; continue ; } if [[ -f /tmp/fstab.$DISK ]]; then while read _pp _mp _rest; do if [[ $_mp == none ]]; then echo "$_pp $_mp $_rest" >>/tmp/fstab continue fi [[ /tmp/fstab.$DISK == $(grep -l " $_mp " /tmp/fstab.*) ]] || { _rest=$DISK ; DISK= ; break ; } done /etc/fstab rm /tmp/fstab.$_rest set -- $(grep -h " $_mp " /tmp/fstab.*[0-9]) echo "$_pp and $1 can't both be mounted at $_mp." continue fi while read _pp _mp _fstype _rest; do [[ $_fstype == ffs ]] || continue _OPT= [[ $_mp == / ]] && _OPT=$MDROOTFSOPT newfs -q $_OPT ${_pp##/dev/} _fsent="$_fsent $_mp!$_pp" done >/tmp/fstab munge_fstab mount_fs "-o async" feed_random install_sets if [[ -z $TZ ]]; then (cd /mnt/usr/share/zoneinfo ls -1dF $(tar cvf /dev/null [A-Za-y]*) >/mnt/tmp/tzlist ) echo set_timezone /mnt/tmp/tzlist rm -f /mnt/tmp/tzlist fi if _time=$(http_time) && _now=$(date +%s) && (( _now - _time > 120 || _time - _now > 120 )); then _tz=/mnt/usr/share/zoneinfo/$TZ if ask_yn "Time appears wrong. Set to '$(TZ=$_tz date -r "$(http_time)")'?" yes; then date $(date -r "$(http_time)" "+%Y%m%d%H%M.%S") >/dev/null fi fi if [[ -s $HTTP_LIST ]]; then _i= [[ -n $INSTALL ]] && _i="install=$INSTALL" [[ -n $TZ ]] && _i="$_i&TZ=$TZ" [[ -n $METHOD ]] && _i="$_i&method=$METHOD" [[ -n $_i ]] && ftp -Vao - \ "http://129.128.5.191/cgi-bin/ftpinstall.cgi?$_i" >/dev/null 2>&1 & fi sed "/^console.*on.*secure.*$/s/std\.[0-9]*/std.$(stty speed /tmp/ttys mv /tmp/ttys /mnt/etc/ttys echo -n "Saving configuration files..." (cd /var/db; [[ -f dhclient.leases ]] && mv dhclient.leases /mnt/var/db/. ) hostname >/tmp/myname if [[ -f /tmp/hosts ]]; then _dn=$(get_fqdn) while read _addr _hn _aliases; do if [[ -n $_aliases || $_hn != ${_hn%%.*} || -z $_dn ]]; then echo "$_addr\t$_hn $_aliases" else echo "$_addr\t$_hn.$_dn $_hn" fi done >/mnt/etc/hosts rm /tmp/hosts fi _f=dhclient.conf [[ -f /tmp/$_f ]] && { cat /tmp/$_f >>/mnt/etc/$_f ; rm /tmp/$_f ; } (cd /tmp; for _f in fstab hostname* kbdtype my* ttys *.conf *.tail; do [[ -f $_f && -s $_f ]] && mv $_f /mnt/etc/. done) apply if [[ -n $user ]]; then _encr=$(encr_pwd "$userpass") _home=/home/$user uline="${user}:${_encr}:1000:1000:staff:0:0:${username}:$_home:/bin/ksh" echo "$uline" >> /mnt/etc/master.passwd echo "${user}:*:1000:" >> /mnt/etc/group echo ${user} > /mnt/root/.forward _home=/mnt$_home mkdir -p $_home (cd /mnt/etc/skel; cp -pR . $_home) (umask 077 && sed "s,^To: root\$,To: ${username} <${user}>," \ /mnt/var/mail/root > /mnt/var/mail/$user ) chown -R 1000:1000 $_home /mnt/var/mail/$user echo "1,s@wheel:.:0:root\$@wheel:\*:0:root,${user}@ w q" | ed /mnt/etc/group 2>/dev/null [[ -n "$userkey" ]] && print -r -- "$userkey" >> $_home/.ssh/authorized_keys fi if [[ -n "$_rootpass" ]]; then _enc usage() { echo "usage: ${0##*/} [-a] [-f filename]" >&2 exit 1 } auto=false respfile= while getopts "af:" opt; do case $opt in a) auto=true;; f) respfile=$OPTARG;; *) usage;; esac done shift $((OPTIND-1)) [ $# = 0 ] || usage . install.md set_term() { local _layouts export TERM=${TERM:-${MDTERM:-vt220}} if [[ -n $CONSOLE ]]; then ask "Terminal type?" $TERM export TERM=$resp else [[ -x /sbin/kbd ]] || return _layouts=$(bsort $(kbd -l | egrep -v "^(user|tables|encoding)")) while :; do ask "Choose your keyboard layout ('?' or 'L' for list)" "default" case $resp in "?"|L|l) echo "Available layouts: $_layouts";; default) return;; *) kbd $resp && { echo $resp >/tmp/kbdtype; return; };; esac done fi } stripcom () { local _l [[ -f $1 ]] || return set -o noglob while read _l; do [[ -n ${_l%%#*} ]] && echo $_l done <$1 set +o noglob } quote() ( for a; do alias Q=$a; a=$(alias Q); print -rn -- " ${a#Q=}" done | sed '1s/ //' echo ) tmpdir() { local _i=1 _dir until _dir="${1?}.$_i.$RANDOM" && mkdir -- "$_dir" 2>/dev/null; do ((++_i < 10000)) || return 1 done echo "$_dir" } scan_dmesg() { bsort $(sed -n "$1" /var/run/dmesg.boot) } scan_disknames() { local IFS=, bsort $(for _n in $(sysctl -n hw.disknames); do echo "${_n%%:*} "; done | sed -n "$1") } get_dkdevs () { echo $(scan_disknames "${MDDKDEVS:-/^[sw]d[0-9][0-9]* /s/ .*//p}") } get_cddevs () { echo $(scan_disknames "${MDCDDEVS:-/^cd[0-9][0-9]* /s/ .*//p}") } get_ifdevs() { ifconfig "$@" 2>/dev/null | egrep -v '^[[:space:]]|(bridge|enc|gif|gre|lo|pflog|pfsync|ppp|sl|tun)[[:digit:]]+:' | sed -n 's/^\(.*\):.*/\1/p' } get_drive() { ask_which "$1" "contains the $MODE media" "$2" "$3" [[ $resp == done ]] && return 1 makedev $resp || return 1 return 0 } mount_mnt2() { local _dev=$1 _opts _file=/tmp/parts.$1 _parts disklabel $_dev 2>/dev/null | sed -En '/swap|unused/d;/^ [a-p]: /p' >$_file _parts=$(sed 's/^ \(.\): .*/\1/' $_file) set -- $_parts (($# == 0)) && { echo "No filesystems found on $_dev."; return 1; } if isin "c" $_parts; then resp=c elif (($# == 1)); then resp=$1 else cat $_file ask_which "$_dev partition" "has the $MODE sets" \ '$(disklabel '$_dev' 2>/dev/null | sed -En '\''/swap|unused/d;/^ ([a-p]): .*/s//\1/p'\'')' [[ $resp == done ]] && return 1 fi grep -q "^ $resp: .*MSDOS" $_file && _opts="-s" mount -o ro,$_opts /dev/$_dev$resp /mnt2 } askpass() { stty -echo IFS= read -r resp?"$1 " stty echo echo } rm -df /tmp/lock lock() { while ! mkdir /tmp/lock 2>/dev/null && sleep .1; do done } unlock() { rm -d /tmp/lock 2>/dev/null } retrap() { trap 'kill -KILL $cppid 2>/dev/null; echo; stty echo; exit 0' \ INT EXIT TERM } rm -f /tmp/update if ! $auto; then ( while :; do lock if test -e /tmp/update && [[ "`dmesg`" != "`cat /tmp/update`" ]]; then dmesg >/tmp/update kill -TERM 2>/dev/null $$ || exit 1 fi unlock sleep .5 done ) |& cppid=$! retrap fi _ask() { local _q=$1 _def=$2 _int _redo=0 _pid lock; dmesg >/tmp/update; unlock echo -n "${_q:+$_q }${_def:+[$_def] }" _autorespond "$_q" "$_def" && echo "$resp" && return trap "_int=1" INT trap "_redo=1" TERM read resp lock; rm /tmp/update; unlock if ((_redo)); then stty raw stty -raw else case $resp in !) echo "Type 'exit' to return to install." sh _redo=1 ;; !*) eval "${resp#?}" _redo=1 ;; esac fi retrap ((_int)) && kill -INT $$ : ${resp:=$_def} return $_redo } _autorespond() { typeset -l _q=$1 _key local _def=$2 _l _val [[ -f $respfile ]] || return mv /ai.conf /ai.conf.tmp while IFS=' ' read -r _l; do [[ $_l == [!#=]*=?* ]] || continue _key=${_l%%*([[:blank:]])=*} _val=${_l##*([!=])=*([[:blank:]])} [[ $_q == @(|*[[:blank:]])"$_key"@([[:blank:]?]*|) ]] && resp=$_val && cat && return print -r " $_l" done /ai.conf [[ -n $_def ]] && resp=$_def && return echo "\nQuestion has no answer in response file." exit 1 } ask() { while ! _ask "$1" "$2"; do done } askpassword() { local _q=$1 if $auto; then echo -n "$_q " _autorespond "$_q" echo '' _password=$resp return fi while :; do askpass "$_q (will not echo)" _password=$resp askpass "$_q (again)" [[ $resp == "$_password" ]] && break echo "Passwords do not match, try again." done } encr_pwd() { local _p=$1 if [[ -z $_p ]]; then echo '*' elif [[ $_p == \$2?\$[0-9][0-9]\$* && ${#_p} > 40 || $_p == '*************' ]]; then echo "$_p" else /mnt/usr/bin/encrypt -b 8 -- "$_p" fi } user_setup() { local _q="Setup a user? (enter a lower-case loginname, or 'no')" while :; do ask "$_q" no case $resp in n|no) return;; y|yes) _q="No really, what is the lower-case loginname, or 'no'?" continue;; root|daemon|operator|bin|smmsp|popa3d) ;; sshd|uucp|www|named|proxy|nobody|ftp) ;; [a-z]*([a-z0-9_])) ((${#resp} <= 31)) && break;; esac echo "$resp is not a useable loginname." done user=$resp while :; do ask "Full name for user $user?" $user case $resp in *[:\&,]*) echo "':', '&' or ',' are not allowed.";; *) ((${#resp} <= 100)) && break echo "Too long.";; esac done username=$resp askpassword "Password for user $user?" userpass=$_password userkey= $auto && ask "Public ssh key for user $user" none && [[ $resp != none ]] && userkey=$resp if [[ $sshd == y ]]; then ask_yn "Since you set up a user, disable sshd(8) logins to root?" yes sshd_disableroot=$resp fi } function ask_until { resp= while true; do ask "$1" "$2" [[ -n $resp ]] && break echo "A response is required." $auto && exit 1 done } ask_yn() { local _q=$1 _a=${2:-no} typeset -l _resp while :; do ask "$_q" "$_a" _resp=$resp case $_resp in y|yes) resp=y; return 0;; n|no) resp=n; return 1;; esac echo "'$resp' is not a valid choice." $auto && exit 1 done } ask_which() { local _name=$1 _query=$2 _list=$3 _def=$4 _dynlist _dyndef _key _q _key=$(echo "$_name" | sed 's/[^[:alnum:]]/_/g') while :; do eval "_dynlist=\"$_list\"" eval "_dyndef=\"$_def\"" set -o noglob set -- $_dyndef; _dyndef="$1" set -- $_dynlist; _dynlist="$*" set +o noglob (($# < 1)) && resp=done && return : ${_dyndef:=$1} echo "Available ${_name}s are: $_dynlist." _q="Which $_name $_query?" echo -n "$_q (or 'done') ${_dyndef:+[$_dyndef] }" _autorespond "$_q" "${_dyndef-done}" && echo "$resp" \ || _ask || continue [[ -z $resp ]] && resp="$_dyndef" isin "$resp" $_dynlist done && break echo "'$resp' is not a valid choice." $auto && [[ -n $respfile ]] && exit 1 done } isin() { local _a=$1 _b shift for _b; do [[ $_a == $_b ]] && return 0 done return 1 } addel() { local _a=$1 shift echo -n "$*" isin "$_a" $* || echo -n " $_a" } rmel() { local _a=$1 _b shift for _b; do [[ $_a != $_b ]] && echo -n "$_b " done } bsort() { local _l _a=$1 _b (($# > 0)) || return shift for _b; do if [[ $_a != $_b ]]; then if [[ $_a > $_b ]]; then _l="$_a $_l"; _a=$_b else _l="$_b $_l" fi fi done echo -n "$_a " bsort $_l } showcols() { local _l _cdir=/tmp/cdir set -A _clist mkdir -p $_cdir rm -rf -- $_cdir/* while read _l; do [ "$_l" ] || continue mkdir -p /tmp/cdir/"$_l" _clist[${#_clist[*]}]="$_l" done (cd $_cdir; ls -Cdf "${_clist[@]}") rm -rf -- $_cdir } makedev() { [[ -z $(cd /dev && sh MAKEDEV "$@" 2>&1) ]] } addhostent() { local _addr=$1 _name=$2 _delim="." [[ -z $_addr || -z $_name ]] && return [[ $_addr == *:* ]] && _delim=":" sed "/^[0-9a-fA-F]*[$_delim].*[ ]$_name\$/d" /tmp/hosts \ >/tmp/hosts.new 2>/dev/null mv /tmp/hosts.new /tmp/hosts echo "$_addr $_name" >>/tmp/hosts } select_sets() { local _avail=$1 _selected=$2 _f _action _col=$COLUMNS let COLUMNS=_col-8 cat <<__EOT Select sets by entering a set name, a file name pattern or 'all'. De-select sets by prepending a '-' to the set name, file name pattern or 'all'. Selected sets are labelled '[X]'. __EOT while :; do for _f in $_avail; do isin $_f $_selected && echo "[X] $_f" || echo "[ ] $_f" done | showcols | sed 's/^/ /' ask "Set name(s)? (or 'abort' or 'done')" done set -o noglob for resp in $resp; do case $resp in abort) _selected=; break 2;; done) break 2;; -*) _action=rmel;; *) _action=addel;; esac resp=${resp#[+-]} [[ $resp = all ]] && resp=* for _f in $_avail; do [[ $_f = $resp ]] && _selected=$($_action $_f $_selected) done done done set +o noglob COLUMNS=$_col resp=$_selected } configure_ifs() { local _first _ifdevs _ifs _name _hn _vl=0 _vd _vi _p _tags while :; do _vd=$(ifconfig vlan$_vl 2>&1) [[ $_vd == @(*no such interface*) ]] && break [[ $_vd == @(*vlan: +([[:digit:]]) parent interface:*) ]] || break ((_vl++)) done _vd= ifconfig lo0 inet 127.0.0.1/8 rm -f /tmp/mygate while :; do ifconfig vlan$_vl create >/dev/null 2>&1 ask_which "network interface" "do you wish to configure" \ '$(get_ifdevs)' \ ${_p:-'$( (get_ifdevs netboot; get_ifdevs) | sed q )'} [[ $resp == done ]] && break _ifs=$resp _hn=/tmp/hostname.$_ifs rm -f $_hn if [[ $_ifs == vlan[0-9]* ]]; then _vi=$(ifconfig $_ifs 2>/dev/null | sed -n 's/vlan: \([0-9]*\).*/\1/p') _tags=$(ifconfig vlan 2>/dev/null | sed -n 's/vlan: \([0-9]*\).*/\1/p') [[ -n $_tags ]] && _tags=$(rmel "$_vi" $_tags) if [[ -z $_vi ]]; then _vi=0 while ((++_vi < 4096)); do ! isin "$_vi" $_tags && break done fi _ifdevs=$(get_ifdevs) set -- $_ifdevs while [[ $1 == vlan[0-9]* ]]; do shift done ask "Which interface:tag should $_ifs be on?" "${_vd:=$1}:$_vi" _vd=${resp%%:*} _vi=${resp##*:} if ! (isin "$_vd" $_ifdevs && [[ $_vd != vlan[0-9]* ]]); then echo "Invalid interface choice '$_vd'" _vd= continue fi if ((_vi < 1 || _vi > 4095)) || isin "$_vi" $_tags; then echo "Invalid or in-use vlan tag '$_vi'" continue fi grep -qs "^up" /tmp/hostname.$_vd || echo "up" >>/tmp/hostname.$_vd chmod 640 /tmp/hostname.$_vd ifconfig $_vd up ifconfig $_ifs destroy >/dev/null 2>&1 ifconfig $_ifs vlan $_vi vlandev $_vd echo "vlan $_vi vlandev $_vd" >>$_hn [[ ${_ifs##vlan} == $_vl ]] && ((_vl++)) fi ifconfig $_ifs 2>/dev/null | grep -q "^[[:space:]]*ieee80211:" && ieee80211_config $_ifs $_hn resp=$(hostname -s) [[ -n $_first && $_first != $_ifs ]] && ask "Symbolic (host) name for $_ifs?" $resp _name=$resp v4_config $_ifs $_name $_hn v6_config $_ifs $_name $_hn if [[ -f $_hn ]]; then chmod 640 $_hn : ${_first:=$_ifs} fi NIFS=$(ls -1 /tmp/hostname.* 2>/dev/null | grep -c ^) _p=done done } v4_info() { ifconfig $1 inet | sed -n ' 1s/.*/dev/null /sbin/dhclient "$@" } dhcp_request() { local _ifs=$1 _hn=$2 echo "lookup file bind" >/etc/resolv.conf.tail echo "send host-name \"$_hn\";" >/etc/dhclient.conf ifconfig $_ifs group dhcp >/dev/null 2>&1 dhclient -c /dev/stdin $_ifs << __EOT initial-interval 1; backoff-cutoff 2; reboot 5; timeout 10; send host-name "$_hn"; __EOT mv /etc/dhclient.conf /tmp/dhclient.conf mv /etc/resolv.conf.tail /tmp/resolv.conf.tail } hextodec() { local _d _b for _b in $(echo ${1#0x} | sed 's/\(..\)/\1 /g'); do _d=$_d.$((0x$_b)) done echo ${_d#.} } ieee80211_scan() { [[ -f $WLANLIST ]] || ifconfig $1 scan | sed -n 's/^ nwid \([^"]\)/\1/p' >$WLANLIST cat $WLANLIST } ieee80211_config() { local _ifs=$1 _hn=$2 _prompt _nwid _haswpa=0 _err ifconfig $_ifs -nwid -nwkey ifconfig $_ifs -wpa 2>/dev/null && _haswpa=1 rm -f $WLANLIST while [[ -z $_nwid ]]; do ask_until "Access point? (ESSID, 'any', list# or '?')" "any" case "$resp" in +([0-9])) _nwid=$(ieee80211_scan $_ifs | sed -n "${resp}s/ .*//p") [[ -z $_nwid ]] && echo "There is no line $resp." ;; \?) ieee80211_scan $_ifs | sed -n 's/^\([^ ]*\) chan .* bssid \([^ ]*\) .*$/ \1 (\2)/p' | less -XEN ;; *) _nwid=$resp;; esac done if [[ $_nwid != any ]]; then ifconfig $_ifs nwid "$_nwid" quote nwid "$_nwid" >>$_hn _prompt="Security protocol? (O)pen, (W)EP" ((_haswpa == 1)) && _prompt="$_prompt, WPA-(P)SK" while :; do ask_until "$_prompt" "O" case "$_haswpa-$resp" in ?-[Oo]) break ;; ?-[Ww]) ask_until "WEP key? (will echo)" if _err=$(ifconfig $_ifs nwkey "$resp" 2>&1) && [[ -z $_err ]]; then quote nwkey "$resp" >>$_hn break fi echo "$_err" ;; 1-[Pp]) ask_until "WPA passphrase? (will echo)" if ifconfig $_ifs wpakey "$resp"; then quote wpakey "$resp" >>$_hn break fi ;; *) echo "'$resp' is not a valid choice." ;; esac done fi } v4_config() { local _ifs=$1 _name=$2 _hn=$3 _prompt _addr _mask if ifconfig $_ifs | grep -q 'groups:.* dhcp'; then _addr=dhcp else set -- $(v4_info $_ifs) if [[ -n $2 ]]; then _addr=$2; _mask=$(hextodec $3) ifconfig $_ifs inet $_addr delete fi fi if [[ -x /sbin/dhclient ]]; then _prompt="or 'dhcp' " ifconfig dhcp >/dev/null 2>&1 || _addr=dhcp fi _prompt="IPv4 address for $_ifs? (${_prompt}or 'none')" ask_until "$_prompt" "$_addr" case $resp in none) ;; dhcp) if [[ ! -x /sbin/dhclient ]]; then echo "DHCP not possible - no /sbin/dhclient." else dhcp_request $_ifs "$_name" echo "dhcp" >>$_hn fi ;; *) _addr=$resp ask_until "Netmask for $_ifs?" "${_mask:=255.255.255.0}" ifconfig $_ifs -group dhcp >/dev/null 2>&1 if ifconfig $_ifs inet $_addr netmask $resp up; then addhostent "$_addr" "$_name" echo "inet $_addr $resp" >>$_hn fi ;; esac } v6_config() { local _ifs=$1 _name=$2 _hn=$3 _addr _prefixlen _prompt ifconfig lo0 inet6 >/dev/null 2>&1 || return set -- $(v6_info $_ifs) [[ -n $2 ]] && { _addr=$2; _prefixlen=$3; } [[ -x /sbin/rtsol ]] && _prompt="or 'rtsol' " _prompt="IPv6 address for $_ifs? (${_prompt}or 'none')" ask_until "$_prompt" "${_addr:-none}" case $resp in none) return ;; rtsol) [[ ! -x /sbin/rtsol ]] && { echo "No /sbin/rtsol."; return; } ifconfig $_ifs up if rtsol -F $_ifs; then echo "up\nrtsol" >>$_hn fi return ;; esac _addr=$resp ask_until "IPv6 prefix length for $_ifs?" "${_prefixlen:=64}" ifconfig $_ifs inet6 $_addr prefixlen $resp up || return echo "inet6 $_addr $resp" >>$_hn addhostent "$_addr" "$_name" v6_defroute $_ifs } v4_defroute() { local _dr _prompt=" or 'none'" [[ -n $(ifconfig | sed -n '/[ ]inet .* broadcast /p') ]] || return [[ -f /tmp/dhclient.conf && $NIFS == 1 ]] && return [[ -x /sbin/dhclient ]] && _prompt=", 'dhcp'$_prompt" _prompt="Default IPv4 route? (IPv4 address$_prompt)" _dr=$(route -n show -inet | sed -n '/^default */{s///; s/ .*//; p;}') [[ -f /tmp/dhclient.conf ]] && _dr=dhcp while :; do ask_until "$_prompt" "$_dr" [[ $resp == @(none|dhcp) ]] && break route delete -inet default >/dev/null 2>&1 route -n add -inet -host default "$resp" && { echo "$resp" >>/tmp/mygate; break; } route -n add -inet -host default $_dr >/dev/null 2>&1 done } v6_defroute() { local _if=$1 _prompt _resp _routers route -n show -inet6 | egrep -q '^default[[:space:]]' && return _routers=$(bsort $(ping6 -n -c 2 ff02::2%$_if 2>/dev/null | sed -n '/bytes from/{s/^.*from //;s/,.*$//;p;}' | sed -n 'G;s/\n/&&/;/^\(.*\n\).*\n\1/d;h;P')) _prompt="IPv6 default router?" if $auto; then _autorespond "$_prompt" && _resp=$resp && echo "$_prompt $_resp" else local PS3="$_prompt (${_routers:+list #, }IPv6 address or 'none'): " select _resp in $_routers; do [[ ${_resp:=$REPLY} == *:* ]] && break [[ $_resp == none ]] && return done fi route -n add -inet6 -host default "$_resp" && echo "$_resp" >>/tmp/mygate } enable_network() { local _f _gw for _f in dhclient.conf resolv.conf resolv.conf.tail; do if [ -f /mnt/etc/$_f ]; then cp /mnt/etc/$_f /etc/$_f fi done ifconfig lo0 inet 127.0.0.1/8 for hn in /mnt/etc/hostname.*; do ((NIFS++)) if=${hn#/mnt/etc/hostname.} (ifconfig $if||ifconfig $if create) >/dev/null 2>&1 || continue while :; do if [ "$cmd2" ]; then set -- $cmd2 af=$1 name=$2 mask=$3 bcaddr=$4 ext1=$5 cmd2= i=1 while [ i -lt 6 -a -n "$1" ]; do shift; let i=i+1; done ext2="$@" else read af name mask bcaddr ext1 ext2 || break fi case "$af" in "#"*|"!"*|"bridge"|"") continue ;; "dhcp") [ "$name" = "NONE" ] && name= [ "$mask" = "NONE" ] && mask= [ "$bcaddr" = "NONE" ] && bcaddr= dhcpif="$dhcpif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 down" if [[ -x /sbin/dhclient ]]; then cmd="$cmd; dhclient $if" else cmd="$cmd; echo /sbin/dhclient missing - skipping dhcp request." fi ;; "rtsol") rtsolif="$rtsolif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 up" ;; *) read dt dtaddr if [ "$name" = "alias" ]; then alias=$name name=$mask mask=$bcaddr bcaddr=$ext1 ext1=$ext2 ext2= else alias= fi cmd="ifconfig $if $af $alias $name" case "$dt" in dest) cmd="$cmd $dtaddr" ;; *) cmd2="$dt $dtaddr" ;; esac case $af in inet) if [ ! -n "$name" ]; then echo "/etc/hostname.$if: inet alone is invalid" return fi [ "$mask" ] && cmd="$cmd netmask $mask" if [ "$bcaddr" -a X"$bcaddr" != "XNONE" ]; then cmd="$cmd broadcast $bcaddr" fi [ "$alias" ] && rtcmd=";route -qn add -host $name 127.0.0.1" ;; inet6) if [ ! -n "$name" ]; then echo "/etc/hostname.$if: inet6 alone is invalid" return fi [ "$mask" ] && cmd="$cmd prefixlen $mask" cmd="$cmd $bcaddr" ;; *) cmd="$cmd $mask $bcaddr" ;; esac cmd="$cmd $ext1 $ext2$rtcmd" rtcmd= ;; esac eval "$cmd" done /dev/null 2>&1 route -qn add -host default $_gw && break done [[ -z $rtsolif ]] && stripcom /mnt/etc/mygate | while read _gw; do [[ $_gw == !(*:*) ]] && continue route -qn delete -inet6 default >/dev/null 2>&1 route -qn add -host -inet6 default $_gw && break done route -qn add -net 127 127.0.0.1 -reject >/dev/null } install_files() { local _src=$1 _files=$2 _f _sets _get_sets _n _col=$COLUMNS \ _tmpfs _tmpsrc _cfile _fsrc _unver _t _issue _srclocal for _f in $THESETS; do isin $_f $_files || continue; _sets=$(addel $_f $_sets) if [[ -z $DISPLAY && ! -d /mnt/etc/X11 ]]; then isin ${_f%${VERSION}.tgz} xbase xetc xshare xfont xserv && continue fi isin $_f $DEFAULTSETS "site$VERSION-$(hostname -s).tgz" && _get_sets=$(addel $_f $_get_sets) done if [[ -z $_sets ]]; then echo -n "Looked at $_src " echo "and found no $OBSD sets. The set names looked for were:" let COLUMNS=_col-8 for _n in $THESETS; do echo $_n; done | showcols | sed 's/^/ /' COLUMNS=$_col $auto && exit 1 echo return fi isin INSTALL.$ARCH $_files || ask_yn "INSTALL.$ARCH not found. Use sets found here anyway?" || return select_sets "$_sets" "$_get_sets" [[ -n $resp ]] || return _get_sets=$resp _get_sets=$(for s in $THESETS; do isin $s $_get_sets && echo $s; done) _unver=$_get_sets for _issue in ''; do ! isin SHA256.sig $_files && _issue="Directory does not contain SHA256.sig" && break _tmpfs=$( ( for fs in /mnt/{{,var/}tmp,home,usr{/local,}}; do df -k $fs 2>/dev/null | grep " $fs\$" done df -k ) | ( while read a a a a m m; do [[ $m == /mnt/@(@(|var/)tmp|home|usr/@(src,obj,xobj))@(|/*) ]] && ((a > 524288)) && echo $m && exit [[ $m == /mnt@(|/*) ]] && ((a > 524288 * 4)) && echo $m && exit done ) ) if [[ -d $_tmpfs ]]; then ! _tmpsrc=$(tmpdir "$_tmpfs/sets") && _issue="Cannot create prefetch area" && break else _issue="Cannot determine prefetch area" && break fi _cfile=$_tmpsrc/SHA256 _srclocal=false _t=Get/Verify [[ $_src == file://* ]] && _srclocal=true _t='Verifying ' ! ftp -D "$_t" -Vmo "$_cfile.sig" "$_src/SHA256.sig" && _issue="Cannot fetch SHA256.sig" && break ! signify -Vep /etc/signify/openbsd-${VERSION}-base.pub \ -x "$_cfile.sig" -m "$_cfile" && _issue="Signature check of SHA256.sig failed" && break for _f in $_get_sets; do rm -f "$_tmpsrc/h" "$_tmpsrc/fail" ( ftp -D "$_t" -Vmo - "$_src/$_f" || >"$_tmpsrc/fail" ) | ( $_srclocal && sha256 >$_tmpsrc/h || sha256 -ph "$_tmpsrc/h" >"$_tmpsrc/$_f" ) if [[ -f $_tmpsrc/fail ]]; then rm -f "$_tmpsrc/$_f" if ! ask_yn "Fetching of $_f failed. Continue anyway?"; then [[ -d $_tmpsrc ]] && rm -rf "$_tmpsrc" $auto && exit 1 return fi continue fi if fgrep -qx "SHA256 ($_f) = $(<$_tmpsrc/h)" "$_cfile"; then _unver=$(rmel $_f $_unver) else if ! ask_yn "Checksum test for $_f failed. Continue anyway?"; then [[ -d $_tmpsrc ]] && rm -rf "$_tmpsrc" $auto && exit 1 return fi fi done done [[ -n $_unver ]] && : ${_issue:="Unverified sets:" ${_unver% }} if [[ -n $_issue ]] && ! ask_yn "$_issue. Continue without verification?"; then [[ -d $_tmpsrc ]] && rm -rf "$_tmpsrc" $auto && exit 1 return fi for _f in $_get_sets; do _fsrc="$_src/$_f" [[ -f $_tmpsrc/$_f ]] && _fsrc="file://$_tmpsrc/$_f" case $_fsrc in *.tgz) ftp -D Installing -Vmo - "$_fsrc" | tar -zxphf - -C /mnt;; *) ftp -D Installing -Vmo "/mnt/$_f" "$_fsrc";; esac if (($?)); then if ! ask_yn "Installation of $_f failed. Continue anyway?"; then [[ -d $_tmpsrc ]] && rm -rf "$_tmpsrc" $auto && exit 1 return fi else DEFAULTSETS=$(rmel $_f $DEFAULTSETS) GOTSETS="$GOTSETS $_f" fi [[ -d $_tmpsrc ]] && rm -f "$_tmpsrc/$_f" done [[ -d $_tmpsrc ]] && rm -rf "$_tmpsrc" } startcgiinfo() { ((NIFS < 1)) && return set -m ( ftp -Vao - "http://129.128.5.191/cgi-bin/ftplist.cgi?path=$HTTP_SETDIR" \ 2>/dev/null >$CGI_INFO echo -n $SECONDS >$HTTP_SEC feed_random ) & CGIPID=$! set +m (sleep 12; kill -INT -$CGIPID >/dev/null 2>&1) & } waitcgiinfo() { wait "$CGIPID" 2>/dev/null [[ -s $CGI_INFO ]] || return sed -n "s,^http://"'\([[A-Za-z0-9\:_][]A-Za-z0-9:._-]*\),\1,p' \ $CGI_INFO >$HTTP_LIST 2>/dev/null set -- $(sed q $HTTP_LIST) : ${HTTP_SERVER:=${1%%/*}} CGI_METHOD=$(sed -n '/^method=/s///p' $CGI_INFO 2>/dev/null) CGI_TZ=$(sed -n '/^TZ=/s///p' $CGI_INFO 2>/dev/null) CGI_TIME=$(sed -n '/^TIME=/s///p' $CGI_INFO 2>/dev/null) } http_time() { local _sec=$(cat $HTTP_SEC 2>/dev/null) [[ -n $_sec && -n $CGI_TIME ]] && echo $((CGI_TIME + SECONDS - _sec)) } install_http() { local _file_list _prompt _mirror _url_base waitcgiinfo ask "HTTP proxy URL? (e.g. 'http://proxy:8080', or 'none')" \ "${http_proxy:-none}" unset http_proxy [[ $resp == none ]] || export http_proxy=$resp if [[ -s $HTTP_LIST ]]; then _prompt="HTTP Server? (hostname, list#, 'done' or '?')" else echo "(Unable to get list from ftp.openbsd.org, but that is OK)" _prompt="HTTP Server? (hostname or 'done')" fi while :; do ask_until "$_prompt" "$HTTP_SERVER" case $resp in done) return;; "?") [[ -s $HTTP_LIST ]] || continue less -XEN < $HTTP_LIST ;; +([0-9])) [[ -s $HTTP_LIST ]] || continue set -- $(sed -n "${resp}p" $HTTP_LIST) (($# < 1)) && { echo "There is no line $resp."; continue; } HTTP_SERVER=${1%%/*} ;; +([A-Za-z0-9\:.\[\]_-])) HTTP_SERVER=$resp break ;; *) echo "'$resp' is not a valid hostname." ;; esac done set -- $(sed "/^$HTTP_SERVER/x;\$!d;x" $HTTP_LIST 2>/dev/null) resp=${1#*/} [[ $resp == "$1" ]] && resp= if (($# > 1)); then resp=$resp/$HTTP_SETDIR _mirror=yes fi : ${HTTP_DIR:=pub/OpenBSD/$HTTP_SETDIR} ask_until "Server directory?" "${resp:-$HTTP_DIR}" HTTP_DIR=$resp _url_base="http://$HTTP_SERVER/$HTTP_DIR" _file_list=$(ftp -Vo - "$_url_base/index.txt" | sed 's/^.* //' | sed 's/ //') install_files "$_url_base" "$_file_list" INSTALL=$_url_base PACKAGE_PATH= if [[ -n $_mirror ]]; then PACKAGE_PATH=$(print -r -- "$_url_base" | sed -E "/\/(snapshots|[0-9]\.[0-9])\/($ARCH)\/*$/!d s!!/\1/packages/$(arch -s)/!;q") fi } install_mounted_fs() { local _dir while :; do ask_until "Pathname to the sets? (or 'done')" "$SETDIR" [[ $resp == done ]] && return [[ -d /mnt2/$resp ]] && { _dir=/mnt2/$resp; break; } [[ -d /mnt/$resp ]] && { _dir=/mnt/$resp; break; } [[ -d /$resp ]] && { _dir=/$resp; break; } echo "The directory '$resp' does not exist." $auto && exit 1 done install_files "file://$_dir" "$(ls $_dir/)" } install_cdrom() { get_drive "CD-ROM" '$(get_cddevs)' || return mount_mnt2 $resp || return install_mounted_fs } install_disk() { if ! ask_yn "Is the disk partition already mounted?"; then get_drive "disk" '$(bsort $(get_dkdevs))' \ '$(bsort $(rmel $ROOTDISK $(get_dkdevs)))' || return mount_mnt2 $resp || return fi install_mounted_fs } install_nfs() { local _tcp ask_until "Server IP address or hostname?" "$NFS_ADDR" NFS_ADDR=$resp ask_until "Filesystem on server to mount?" "$NFS_PATH" NFS_PATH=$resp ask_yn "Use TCP transport? (requires TCP-capable NFS server)" && _tcp=-T mount_nfs $_tcp -o ro -R 5 $NFS_ADDR:$NFS_PATH /mnt2 || return install_mounted_fs } set_timezone() { local _zonefile=$1 _zonepath _zsed _tz _zoneroot=/usr/share/zoneinfo [[ ! -f $_zonefile ]] && return [[ -n $TZ ]] && return if [[ -h /mnt/etc/localtime ]]; then TZ=$(ls -l /mnt/etc/localtime 2>/dev/null) TZ=${TZ#*${_zoneroot#/mnt}/} fi waitcgiinfo if [[ -n $CGI_TZ ]]; then _tz=$CGI_TZ [[ -n $_tz ]] && isin "$_tz" `cat $_zonefile` && TZ=$_tz fi [[ $_zonefile = /var/tzlist && -z $TZ ]] && return while :; do ask "What timezone are you in? ('?' for list)" "$TZ" _zonepath=${resp%%*(/)} case $_zonepath in "") continue;; "?") grep -v /. $_zonefile | showcols continue;; esac while isin "$_zonepath/" $(cat $_zonefile); do ask "What sub-timezone of '$_zonepath' are you in? ('?' for list)" _zsed=$(echo $_zonepath/ | sed 's,/,\\/,g') resp=${resp%%*(/)} case $resp in "") ;; "?") sed -n "/^$_zsed/{s/$_zsed//;/\/./!p;}" $_zonefile | showcols;; *) _zonepath=$_zonepath/$resp;; esac done if isin "$_zonepath" $(cat $_zonefile); then TZ=${_zonepath#$_zoneroot} return fi echo -n "'${_zonepath}'" echo " is not a valid timezone on this system." done } sane_install() { local _q=$1 _s for _s in $SANESETS; do isin $_s $DEFAULTSETS || continue [[ -n $_q ]] && return 1 if ! ask_yn "Are you *SURE* your $MODE is complete without '$_s'?"; then $auto && exit 1 || return 1 fi done } install_sets() { local _d _locs="disk http" echo _d=$CGI_METHOD ifconfig netboot >/dev/null 2>&1 && : ${_d:=http} [[ -n $(get_cddevs) ]] && { _locs="cd $_locs"; : ${_d:=cd}; } [[ -x /sbin/mount_nfs ]] && _locs="$_locs nfs" : ${_d:=http} if ! isin "$_d" $_locs; then for a in http cd nfs disk; do isin $a $_locs && _d=$a && break done fi echo "Let's $MODE the sets!" while :; do umount -f /mnt2 >/dev/null 2>&1 ask "Location of sets? ($_locs or 'done')" "$_d" case $resp in done) sane_install && return;; c*|C*) isin cd $_locs && install_cdrom && METHOD=cd;; d*|D*) install_disk && METHOD=disk;; h*|H*) isin http $_locs && install_http && METHOD=http;; n*|N*) isin nfs $_locs && install_nfs && METHOD=nfs;; *) $auto && echo "'$resp' is not a valid choice." && exit 1;; esac [[ -n $METHOD ]] && _d=$METHOD sane_install quiet || $auto && _d=done done } update_firmware() { echo "/usr/sbin/fw_update -v" >>/mnt/etc/rc.firsttime } munge_fstab() { local _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do [[ $_dev == @(/dev/vnd*|\#*) || $_fstype == nfs || ! -f /sbin/mount_$_fstype || $_opt == *noauto* || $_opt == *xx* ]] && continue _opt=$(echo $_opt | sed 's/softdep//') [[ $_fstype == ffs ]] && _opt=$(echo $_opt | sed 's/ro/rw/') [[ $_fstype == ffs ]] || _opt=$(echo $_opt | sed 's/rw/ro/') echo $_dev /mnt${_mp%/} $_fstype $_opt $_rest done /etc/fstab if [ ! -s /etc/fstab ]; then echo "Unable to create valid /etc/fstab." exit fi } mount_fs() { local _async=$1 _dev _mp _fstype _opt _rest _msg _fail while read _dev _mp _fstype _opt _rest; do [ "$_mp" = "/mnt" ] || mkdir -p $_mp _msg=$(mount -v -t $_fstype $_async -o $_opt $_dev $_mp) || _fail="$_fail\n$_mp ($_dev)" echo $_msg | sed 's/, ctime=[^,)]*//' done 0)) || continue echo -n "fsck -${_f}p $_dev..." if ! fsck -${_f}p $_dev >/dev/null 2>&1; then echo "FAILED. You must fsck $_dev manually." _fail=y else echo "OK." fi done /tmp/resolv.conf for _ns in $resp; do echo "nameserver $_ns" >>/tmp/resolv.conf done cp /tmp/resolv.conf /tmp/resolv.conf.shadow fi } apply() { if [[ $sshd == n ]]; then echo "sshd_flags=NO" >>/mnt/etc/rc.conf.local fi if [[ $sshd_disableroot == y ]]; then sed "/^#\(PermitRootLogin\) yes/s//\1 no/" \ < /mnt/etc/ssh/sshd_config >/tmp/sshd_config cp /tmp/sshd_config /mnt/etc/ssh/sshd_config fi if [[ $ntpd == y ]]; then echo "ntpd_flags=" >>/mnt/etc/rc.conf.local [[ $ntpd_server == default ]] && ntpd_server=pool.ntp.org echo "servers ${ntpd_server%% *}" >>/mnt/etc/ntpd.conf fi if [[ -n $aperture ]]; then echo "machdep.allowaperture=$aperture # See xf86(4)" \ >>/mnt/etc/sysctl.conf fi if [[ -n $lidsuspend ]]; then echo "machdep.lidsuspend=1 # Try to suspend on lid close" \ >>/mnt/etc/sysctl.conf fi if [[ $xdm == y && -x /mnt/usr/X11R6/bin/xdm ]]; then echo "xdm_flags=" >>/mnt/etc/rc.conf.local fi if [[ $defcons == y ]]; then cp /mnt/etc/ttys /tmp/ttys sed -e "/^$CTTY/s/std.9600/std.${CSPEED}/" \ -e "/^$CTTY/s/unknown/vt220 /" \ -e "/$CTTY/s/off.*/on secure/" /tmp/ttys >/mnt/etc/ttys [[ -n $CPROM ]] && echo "stty $CPROM $CSPEED\nset tty $CPROM" >>/mnt/etc/boot.conf fi ln -sf /usr/share/zoneinfo/$TZ /mnt/etc/localtime } questions() { local _d ask_yn "Start sshd(8) by default?" yes sshd=$resp ask_yn "Start ntpd(8) by default?" ntpd=$resp if [[ $resp == y ]]; then ask "NTP server? (hostname or 'default')" default ntpd_server=$resp fi aperture= xdm= lidsuspend= if [[ -n $DISPLAY ]]; then if [[ -n $(scan_dmesg '/^[a-z]*[01]: aperture needed/p') ]]; then ask_yn "Do you expect to run the X Window System?" yes && aperture=$MDXAPERTURE fi if [[ -n $MDXDM ]]; then ask_yn "Do you want the X Window System to be started by xdm(1)?" xdm=$resp fi if [[ -n $MDLID ]]; then ask_yn "Do you want to suspend on lid close?" yes && \ lidsuspend=$resp fi fi if [[ -n $CDEV ]]; then _d=${CPROM:-$CDEV} ask_yn "Change the default console to $_d?" defcons=$resp if [[ $resp == y ]]; then ask_which "speed" "should $_d use" \ "9600 19200 38400 57600 115200" $CSPEED case $resp in done) defcons=n;; *) CSPEED=$resp;; esac fi fi } upgrade_to64time_t() { /mnt/usr/sbin/pwd_mkdb -d /mnt/etc master.passwd >/mnt/var/log/lastlog >/mnt/var/run/utmp } feed_random() { (dmesg; cat $CGI_INFO /*.conf; sysctl; route -n show; df; ifconfig -A; hostname) >/dev/random 2>&1 if [[ -e /mnt/var/db/host.random ]]; then dd if=/mnt/var/db/host.random of=/dev/random bs=65536 count=1 \ status=none fi } store_random() { dd if=/dev/random of=/mnt/var/db/host.random bs=65536 count=1 \ status=none dd if=/dev/random of=/mnt/etc/random.seed bs=512 count=1 status=none chmod 600 /mnt/var/db/host.random /mnt/etc/random.seed } finish_up() { local _dev _mp _fstype _rest if [[ -x /mnt/sbin/swapctl ]]; then /mnt/sbin/swapctl -a /dev/$SWAPDEV >/dev/null 2>&1 while read _dev _mp _fstype _rest; do [[ $_fstype == swap ]] && /mnt/sbin/swapctl -a $_dev >/dev/null 2>&1 done $/\1/p') md_installboot $ROOTDISK if [[ -f /mnt/bsd.mp ]] && ((NCPU > 1)); then echo "Multiprocessor machine; using bsd.mp instead of bsd." mv /mnt/bsd /mnt/bsd.sp 2>/dev/null mv /mnt/bsd.mp /mnt/bsd fi update_firmware upgrade_to64time_t store_random cat <<__EOT CONGRATULATIONS! Your OpenBSD $MODE has been successfully completed! To boot the new system, enter 'reboot' at the command prompt. __EOT [[ $MODE == install ]] && cat <<__EOT When you login to your new system the first time, please read your mail using the 'mail' command. __EOT md_congrats [[ "$MODE" == upgrade ]] && \ echo "After rebooting, run sysmerge(8) to update your system configuration." $auto && >/ai.done } ROOTDISK= ROOTDEV= PACKAGE_PATH= SETDIR="$VNAME/$ARCH" CGI_INFO=/tmp/cgiinfo CGI_TZ= CGI_TIME= CGI_METHOD= INSTALL= METHOD= HTTP_DIR= HTTP_SEC=/tmp/httpsec HTTP_LIST=/tmp/httplist WLANLIST=/tmp/wlanlist FSTABFLAG=-f for _opt in d f l m n p s; do ulimit -$_opt unlimited done dmesg | sed -n '/^OpenBSD /h;/^OpenBSD /!H;${g;p;}' >/var/run/dmesg.boot HTTP_SETDIR=$SETDIR set -- $(scan_dmesg "/^OpenBSD $VNAME\([^ ]*\).*$/s//\1/p") [[ $1 == -!(stable) ]] && HTTP_SETDIR=snapshots/$ARCH MTDEVS=$(scan_dmesg "${MDMTDEVS:-/^[cms]t[0-9][0-9]* /s/ .*//p}") NIFS=0 DISPLAY=$(scan_dmesg '/^wsdisplay[0-9]* /s/ .*//p') CONSOLE=$(scan_dmesg '/^\([^ ]*\).*: console$/s//\1/p') CONSOLE=${CONSOLE% } [[ -n $CONSOLE ]] && CSPEED=$(stty speed /dev/null 2>&1 for _ifs in $(get_ifdevs dhcp); do set -- $(v4_info $_ifs) [[ $1 == UP && -n $2 ]] && continue ifconfig $_ifs delete down -group dhcp 2>/dev/null done get_responsefile() { local _f _ifdev _mac _mode _server _lf [[ -x /sbin/dhclient ]] || return _ifdev=$(get_ifdevs netboot) if [[ -z $_ifdev ]]; then set -- $(get_ifdevs) (($#)) || return if (($# == 1)); then _ifdev=$1 else while :; do ask_which "network interface" \ "should be used for the initial DHCP request" \ "$*" isin "$resp" $* && _ifdev=$resp && break done fi fi [[ -n $_ifdev ]] || return dhclient $_ifdev _lf=/var/db/dhclient.leases.$_ifdev _server=$(sed "/^ *next-server /!d;s///;s/;$//;q" $_lf) _mode=$(sed -E '/^ *filename "auto_(install|upgrade)";$/!d;s//\1/;q' \ $_lf) _mac=$(ifconfig $_ifdev | sed 's/.*lladdr \(.*\)/\1/p;d') hostname "$(sed -E '/^ *option host-name "(.*)";$/!d;s//\1/;q' $_lf)" if [[ -z $_server ]]; then echo "Could not determine next-server." elif [[ -z $_mode ]]; then echo "Could not determine auto mode." else for _f in {$_mac-,}$_mode; do ftp -o "/$_mode.conf" "http://$_server/$_f.conf" && action=$_mode && return 0 done fi return 1 } if ! $auto; then cat <<__EOT At any prompt except password prompts you can escape to a shell by typing '!'. Default answers are shown in []'s and are selected by pressing RETURN. You can exit this program at any time by pressing Control-C, but this can leave your system in an inconsistent state. __EOT elif [[ -z $respfile ]]; then if ! get_responsefile; then echo "No response file found; non-interactive mode aborted." exit 1 fi rm -f /ai.done echo "Performing non-interactive $action..." /$action -af /$action.conf 2>&1 >/mnt/etc/rc.firsttime ( /usr/bin/mail -s '$(hostname) $action log' root < $_lf && rm $_lf ) >/dev/null 2>&1 & __EOT exec reboot else echo "failed; check /ai.log" exit 1 fi else cp $respfile /ai.conf || exit fi set_term if [[ $MODE == install ]]; then ask_until "System hostname? (short form, e.g. 'foo')" "$(hostname -s)" [[ ${resp%%.*} != $(hostname -s) ]] && hostname $resp THESETS="$THESETS site$VERSION-$(hostname -s).tgz" echo donetconfig ((NIFS != 0)) && startcgiinfo echo while :; do askpassword "Password for root account?" _rootpass="$_password" [[ -n "$_password" ]] && break echo "The root password must be set." done rootkey= $auto && ask "Public ssh key for root account?" none && [[ $resp != none ]] && rootkey=$resp questions user_setup set_timezone /var/tzlist echo fi diskinfo() { local _d for _d; do makedev $_d echo -n "$_d: " disklabel -dpg $_d 2>/dev/null | sed -e '/^label: /{s,,,;s/ *$//;s/^$//;H;d;}' \ -e '/.*# total bytes: \(.*\)/{s//(\1)/;H;}' \ -e '$!d;x;s/\n/ /' rm -f /dev/{r,}$_d? done } while :; do echo "Available disks are: $(get_dkdevs | sed 's/^$/none/')." _ask "Which disk is the root disk? ('?' for details)" \ $(get_dkdevs | sed 's/ .*//') || continue case $resp in "?") diskinfo $(get_dkdevs);; '') ;; *) isin "$resp" $(get_dkdevs) && break echo "no such disk";; esac done makedev $resp || exit ROOTDISK=$resp ROOTDEV=${ROOTDISK}a SWAPDEV=${ROOTDISK}b %%%dLC8%%ؠplA+'tA (|A(Al%A%A%AlA%A؟%pAH%Ah%A%~A%QA%LAħ%A%A%A@%AP%A(%5B%A%At%A%eBģ%A%A%At%AX% A<%,A4A̴%<A̺%1B̺%DA(%0A%uA%D@%LAD%0AD%TA4%\AX%dA%lA%@%tA$%l C$%Ah%A%A%A%A%A+'tA (AlAHlAx%A%Ax%A%8%$%% %%%xxXpXpPl&sAhl%Al%Adl%A\l%A`l%A4l% l p ppP&\&P&& ERt8&CE=&STT1&SL8;&RR49&CE=&STT1&NMl9&4&CL(?&0PL(?&0RE41&@RR49&CE=&STT1&PX?&6&TF\5&H5&PNL>&RR49&CE=&STT1&<[&[&Y&@*a&(&4A*|X&((^&P,&X&[&P &(lX&X&X&Y&e&`a&[&+&((DA*((W&Y&\[&(<[&[&Y&*a&P*?*4A***+^&P,&**@**+0**Y&<+**+&**DA***W&**+`*&l4{&lnativeph6K l&W6l&s&Pj6dj6nativeph6K lD&W6@w'Pj6dj6AA AȆ' 'd' ( ) *&&'l**'в** ** Ĭ*38&R'7'|**\E'\8'x8'Ȇ' ) ,)D) |) P) |)H*P*$*4*4'*8'4* &`*8'X(Ȇ' 8t'8'k'l:':'Ȇ' i'@& x) "(t** ̹* &8*@* *x**H*(',(( h'')l&3 3 3*\* D 3;'\B'<8'>'}(**Ȇ'<( (( &( &Ȇ'4'* DV' ) ) Ƞ*W'Ȇ'Ȇ'hg6 L)))Ȇ'Ȇ'(),l'Ȇ'Ȇ'Ȇ'Ȇ'Ȇ'Ȇ't)Ȇ' \( \ )Ȇ' **Ȇ'F'\H'*Ȇ'Ȇ'е&* )))**Ȇ'Ȇ'@'Ȇ'Ȇ'Ȇ'Ȇ'Ȇ'Ȇ'@'H*Ȇ'Ȇ'Ȇ'Ȇ'Ȇ'Ȇ'Ȇ'Ȇ'Ȇ'Ȇ'Ȇ'Ȇ'*Ȇ'Ȇ'Ȇ'7Ȇ'Ȇ'Ȇ'Ȇ'Ȇ'Ȇ'Ȇ'|**Ȇ'Ȇ'Ȇ'Ȇ'Ȇ'Ȇ'C' C'D'Ȇ'Ȇ'Ȇ'Ȇ'Ȇ'Ȇ'Ȇ'*`& 3Q'(U'Ȇ' 3Ȇ'*h** 'H33Ȇ'Ȇ'@>'Ȇ' (Ȇ'Ȇ'Ȇ'Ȇ'Ȇ'Ȇ'Ȇ'Ȇ'Ȇ'Ȇ'Ȇ'Ȇ'Ȇ'Ȇ'Ȇ'Ȇ'Ȇ'Ȇ'Ȇ'Ȇ'Ȇ'Ȇ'Ȇ'Ȇ'Ȇ'Ȇ'Ȇ'Ȇ'Ȇ'Ȇ'Ȇ'Ȇ'Ȇ'Ȇ'Ȇ'Ȇ'Ȇ'Ȇ'Ȇ'Ȇ' 3Ȇ' (8' *=' 3Ȇ'Ȇ'Ȇ'Ȇ'Ȇ'Ȇ')0*Ȇ'Ȇ'*̛*&Ȇ'p3H3Ȇ'Ȇ'Ȇ'Ȇ'Ȇ'Ȇ'Ȇ'Ȇ' 0;' @' :' I'Ȇ' P#3&Ps'Ȇ'Ȇ'Ȇ'Ȇ'Ȇ'D*Ȇ'Ȇ'Ȇ''7'Ȇ'' ' |q' *'Ȇ'Ȇ'Ȇ'Ȇ')8)Ȇ'*̮**Ȇ'8* h* **l*** * *Ȇ'Ȇ'Ȇ'9':'$&4&D&@&&&&&&&X&0&d&&&&/l/l/l/l1l/l <0l@ 0 di'i'i'1l1l$1ldX&Ad&Al1ll1l1l\'@B'Al1l1l(2lp2l2l3lH3l3l3l 4l1l $(A(A 4l(A 4l @h+A|+A5l (}(45l(<( `% P;A1B 4AjCT;Al C\;AL_A`;A0Ah;A(Ch,AtdBp;ATBAPAA>BAFBx;AtdBA@;AA;Al%At'APA@@ )@) ))))p )h)0 )))`!),!)H))P)))ttyclsttyopnttybgttyinttyout))R) ))l()_)@)L)8)_)B)!)>)((((_)((4>)((((_)((4>)((((_)((4>)((((_)((4>)((((_)((4>)((((_)((4>)((((_)((4>)((((_)((4>)((((_)((4>)  $0@BA9l)9l)9l)DI,F,G,F,CA))48l9l)8))t)p))P@*@*9lcd9660>msdos2lockf@` $LA,LA4LAl,>l4>l^^3333`A,L,#$%&'()*+ʚ;,-.ʚ;/ʚ;0ʚ;1@B2 T3 T4 T56 T7 Tcde@B@B@KLاO[@T6nQ%l7Jpp@@@@j j j @ AllAl ,,F,},,F,Pw,UAo,8AllAld,Cl.u.u.,d.ClCI/DE/. A/T/=/Cll. /4/47/"/,$/@0/Cl... .ClZ... .Q.9Q9(69(49(((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((&(((((((((((((((((% %0%@%P%(((&(((((((((ahGH@ A A(AdLC AGA<T\7w7u7w7 +BD7@777(A\77<7p7 A4X77.B /HNPWT782Bl 8 8<3BD 88`3B08H!8X4B`-885Bl(48<384B?8D;8p6B8Byli8Bylv8B*yl2!>?? ' ` ~ ^ "' ,AAA AA'CEEEEIIIINOOOOOUUUUYaaaa aa'ceeeeiiiinooooouuuuyy"A"E"I"O"U"a"e"i"o"u"yA^A`A*A~ACE^E`EI^I`I~NO^O`O~OU^U`UYa^a`a*a~ace^e`ei^i`i~no^o`o~ou^u`uyDBB88,8888̩88\8T88l@CBCBCBCBCBCB IB|IB JB5939594959& KB  % 3u Du u <u 8u 2u 0&'u 1&u 0&u     )%uu 0 1 8%u   3 D D%uu < 8 2u 0&'u 1&u 0&u  TKBXn9`m9Xn9&?KBlLBOB*999̸9PBhSB|UBWBZB# # ZB<[B ^B4^B{{T^B^BT_B|:::\:::`B::|:\::h:`B(::@:|::aB:::4::aB`:,:@:::bB;@ ; ;\;;dB$;pdB;$;;;leBP:;5;1;$;';(;<;<#; ;";4 ; ;fB@gB :5hv1! !vvvvvvv3 P q q2vqqqqCW 2D k"{"{"3" dAdAW 2]\ \ ;  DgBTgBdgBxgBQgBgBgBgBgBgB hB(hBDhB\hBkB;;;xlBؼ;;;lB;H;;lBT;;;mBL;x;;$mB$;h;;4oB@;;;|oBL;x;;oBL;x;;oB@;l;; pB;;;(pB;;;lpB;;;pB;;;0qB;p;;HqB;H;;PqB|<<;rBxh>Xg>k>k> m>k>T$o>q>Dq>q><hy>Hw>v>w>!z>hz>$z>D(.symtab.strtab.shstrtab.start.text.data.openbsd.randomdata.sbss.bss.arm.atpcs " X# (D#0(.0l0/L$B4l4SLH4l4SLsM4SL4SLXDUL  4DN  D0l4l4l  3x H 4,9"o)x-L'T8b*8N&Y$ pȟ=h(9<!<p=? P0;'D6%@6*'txh>.-9ul Et3U3bE-\zT(,w;Py2Tdj6$p?N,xe0 .:,2;DDlH0l$#H:_6D9W-8q8'|,( )4 ;\ :TWl,\ =))8(\Dt(,`&H 9,L5hJAlQ",b<;,q|4l}c:\v.$LO,@?*D(8P= 4|)(d4lP@<$s-Lr:lFplOܱ9,\v>k8;Txz-;TDlE60B$;&`L8#Ȍ!hj,@0-0:@'E#4aP-q7T{\5V>ll:|,8OrT .l5  ",t9(^1/ܰ&97lEHl$W-o`p% $0z!  t 8!:tX3P u-t:l@"c<<2284@x":Oą84^x%<nxI&Dz% xl-P0h$4S6x,`*,85$*;lCԿ:PR24^'<f,loP!(~o>HAl`";lP t|?\Dl+=X) 'q a84 <7d,  :6 7qB k*T X"4d &"$r ,>lx 8q '(\ D tz)H 8  l .2h &( @67P ( 0I! $:x *l .$+ l6 c6G ܗ3Y Dh \]0w ;P V7 Al Hj' l&h p$X \u3h #2$ $-\ {l 1*P: 5<? R6N HU-d %tw 85 p # % /T ,x 6l @R-H "   74! Wl@  (Q U04` x%8i 8} ! Xr< 8?` ?  Nl$ #2$ $5l \ !4 r ps' /X= `6H ?O :x^ (-`~ 8H <; D2X 30 h3/ ;q |8,*,,!)4s ' -<w)HC p<V;i5z*P1q c(\"dWl L':4;  !?+DT4&sCP(LMP%lax9\m.lk(|;4<7H-P ' h'XlT? V<8Į$|#܎((~l=,d.Gc9T4X+,cJ7w8lt%$?Y(%l5 &Td<T6 ԡ&D$/2F1XlAl4dT\9o{4{(*D(L|q(807t($63H!0Y+<\( K708b.?0lO2$`0mp8X=T <2+L5'@u.LE-h%$(9`) ?74P2,.7' ;C&GV=TZ;pk4|2q:|<~3(l2h8,x*$;l=d-$*D"o+1e&=%0Kd>\-{&D |qȉl$  0\2T8Ht2H!(ti$-?N7&CD\a5k6?|Gl 5:XrD)$20<')@T88ȗ59#+0h'`\6> l&22D1PET,Ln'`tE=nD!8L-0[&0pHl85H?2$w=e6_)l t:8F," ;x4`#@ 5J]'8[sd*pq 9 (s 9,4T0Dlb0+hl8d1q\ ) DV'@:3p)(AD_(9g:@v9 84dDlt>;4:P8h-L&l4B8.tr"4?(h+#B4'Kl9PZ!5hlr|28|9+`0+,&p:\pDt6lt|'4=7Pl1q !4 A?+Df"@<w6\WjreB.q`*@|H]%t$'8tldphk0@$|'t6*  ppxl.{&B8,T1d:'Pq$7yHkr%`,Rlg-,7  S; @Dl!pDl!" (!t8DA!P6R!g3h!ppr!<<-!4l(!h&s!7!t-|!,N2X!81!;!\K8$"3h#q#p;,#4'h;#(48LL#"_#,n#<#P:#9#xl#ar0#p#?#d5l#t:d#Al#6$%x$p9($,s1$|';$Q'G$D'S$9,`$\g2Dp$<:$8L$2$ (q$H;$ 0X$k>H$x;$A60$o-,%ܧ,.% 9@%W%Y%&@h%8Dq%;~%~l%D8\%,7%'%`l%@'%l&t%D&%&<%$&D&!+&tS86&%(X@&I&N&']&x$Hl&'s&'&x>#H&Tl&<.&̮*,&;,&XV6&)t&p&4&&.p'6D'h$d,'"q(<'̎ ,F'ԡ9V'%@l'x $'u<0'!8')?)L-6)~38).<)d&, * l*Pi-d&*['1*@6E*U6W*/f* ;"~*|A1x*;*M7*D<*Cl* 7*H79*8P*( +t%+ԝ;*+. 4+"G+#V++_+P0ln+?(Pz+|U:x+`(P+3+hz>D+ n3h+x+8+%8+L(@+)$+W%+* ,',`p#,$l1,94A,'|Q,3\,7qe,@$to,$z,0,81l,%,~"L,D,U6,X`1,Z%4,T6,h+-̶6t&-W03-,E-88P\-"`w-l,*l-Vl-(%p-(-^!$-70-d 2|-l ,-@-h9-;-L#.Ql!.$$L-.Hl5.V:d?.;qM.T~6c.S#ls. .4 ;`.(>l.X&.=p. D,P.DF..83...((/G$4"/2q./2A/T2P/*dW/lla/Dd/L;`w/ h5</,&/2H8P2e6h28r)@q2&2:928'h2P2h2&"28O7D2t,`2xA;@282xn+$30'q 3 63XRl135>3d'XG3>0R3.a3@:n307x38s3+h3j9`lE9|9S9#d9W0,s98:49(F,$9c'9ot:xl:T2D:I=0:(;l;[$((;t 0;*;;,8L;Y&0\;=$c;(pr;#'4{;;@;9;L1;D< &=,<@:8<O8< l=pFl=.3h'=>l0=̓* C=/N=p$0h=::py=D :=W6= ",=lX&=d#'=d8=xj0 =<=$D=@2$ >82>e*P+>l1>l;>&sF>1U>P%g>HT#q> >;>%`>4w7t>m9>(*8>&>ll0D>8@-@?L[2 ?3?*0$? 'h2?%tDs@;~@? @*h@%x@l4d@\$4@!;@ -:@Ol@2@(DA7:8A9'AMl7Ao1HCAv)PA@"D]A5% pA0t1 zA*A?<A8pAp;A0:A]?A+*hA n.B(l#8B7$B(@3B@,>B*TGB@!PB"s]Bn.jBl*xrBPw<`BdC:B(B#B5LB`E7Bн?B /TB9hB)C$Cs!C%2 CCh8WCqaCL8oC|qzC,B$tCD(CDCh4:C"2C/8C C'Cw6\C< D$$9D3,<D\[&0.D4l?D"QD3haD+tD)DH3(D2|D\ $D&$DqDT)x D- TD(|DDDf7LE-E:D&Ex-@E$(UE0aE(9XoE|{5 {E 5pE!LE$wlE|48Eb)E80Ex,8Eh$,`E*hEX+dF&DF\+ F%,.F9@=F8$JF8DlZF-(gF*,uFr%8|F0"tF,>hFDy6F)F-xF+XF,%FT?F`?8G)|G,x)G%$)G2FGpY*LG"d^GxW=HnGW6G20G`1G$4X G +G@sGT? G`!G}>~G"H6XH3t(HdQ02H2q=H&xIH,8bH 3"LuH:H9pH8pH,HHx"lHx23,H3hHh.I\^!|IH :Ip7+I8l5IV6HI5qRI"q(cIȠ*TpI<_!XxI@ !`Ils<I:I,(DI*<I" IP/I$g)I*Iy#JoAJDJ4lJ$6$JDc$lJylJ=>xJ:<KT6KE=l!K =00K9=K'IKt%ZKl&shK0&oKpyK&pKT? KLarK"8K:XK@d"dK6lK8K̂9tK04 Ll-"LJ>l8LD:(JLq"pZL@RliL-`L_2,LL.L(L *LlL~lLLlLdOlL6 L!LL?  M$Wl$M|/4MF'AMԢ/`JMP8YM#oM-;MP:M3M<M8HM0$MX!MGlM%,M TN!N78N \2-N̛*9N v: GN& SN ,hN(+4wN4"lNX:pN8N@/N$LN?xN%8NP7Nk+HNGlO(O\:O@<.OX8@=OlHEO*tSO&ZOldO\;(mO0l |O% Ol On)OK!HOVlO0 24O$? OT"s`Ol5LO`j1 P`!LPppPH*,*P\=T;P; HP3 TP(bP " sPh!P'\P:pP8$PH!8 P-Pv*P $4Pp[8HP2QN8@Q0<`(Ql 7Q,pJQĮ>RQY=4kQ:uQ 1Rp&s@Rn=[RhX;HgR[9yR/;RX5hR@4Rȩ&8RD-R(R'R6.0RL|*P S"SPv:.Sx9\6S(0GSV-paSg'kS%LwSp=SZ"(S`X+LS$#Sl-SJ*$S8'qSl S.T$|- T"h0T? lV")!Vd)&V->V"4MVdu%[V+rV8pV u;|Vr VL$<V= VR8$V6VqV 2`V)W)xW|*W%/W \$ CW '`LWЂ$ZW+ iWa)hpW:6~WTDW9Wܾ!LW,,8WZ%EZhV=4TZp`ZgroZQ1 zZ]<ZR9ZA1dZKlZ:Ztc6Z4(ZR)(Z%+tZ(xZ'|[x"[hI9'[5.4[%D[) pa[9ps[#s[~(l[7[D,@[T6[n6D['5@[h=$P[:[h1H\X7%!\ ($x5\hQ:B\sS\n*d\<(`|\Կp\P% \4:\7\|?l\p1P\=\@)\9< ];]tp ]X!L2]4L@]/lM]v%Y]*c]x+r]h'd]D],6l]7T]_5]^5\]7p]Lq]%2 ]:8]6 ^T*^;$)^1(;^DsL^=?f^,)Lr^PB:^D4^x T^?^ }:^!T^ 8^4Ol^a1|^-`_9L_8wl_*(_$l/_xN%?_0!T_x9g_3|_4t _3_ܮ>_'L_,l'P_J&_phiiP:;ti 7~i?!iEl i&Pij: ih4&8i$Di$;|i\*Hi%|iA?j*j pxj'D%j) 1j);jf0Jj*$Sj̲$ij0;xjxy9,j*@j? jZ.j4lj؇*j Olj{-xj$2jTDk 3khpkDHl$)k},t9kt4lEk"DTk_'_k@%8hk:$ykP8`k{8kHsk^9Dkl:'4k+hkT0lk#<k0M8lHRl!l"/l4!+7l%HLlZ6Tl*'TZll&DdldDpl.|}l _9l\8|lIl$lD#l;HlT-8l\%<lK1Xl`a&Xm*ml#<m*,,m1$8m>Bm7Km\'p]mP Pym@%/pm 9,m8)<m`.mxlmh<md<msmv$ n(%(n!!n ''D/n+'(An7Kn̋$4en2{n,n.\nX 'Xnx8'nPln@=nClnl*.nq+Pn4@)oRlo3,#om?Jo8)8Xox(tbo9"TtoLso-o2o4+ol oT3o6o0$oH,tp\284pI=0pp8Hp03,WpФ)bp(Ltp܂l}p8(p9'4p 4&\plpԊ.xp"p 8qpL&p qLL-qsT$qD9p/qt&s;qv5Hqv7`Zqq9\qh(lqh% r,4HrT(t%rt%T:rf'Lr4Ur 2XfrVlqrH8rs&r`!<r,+Hr@1r8'(r&rH #0rX&r,s9s88s}8H*s5;si)@s(pMsx:Ws)csV3rsh7Hs+xsqs: sd6so7`s9s7sXk*s% t,:8Ttst L,L&t++0t4l>tpE,hRt<+Ztc)_t*DktDt-tD#tV @tTRlt !lt)-t@;dt@m&hu\!"uXp-uؕp4ul=ulFu#)hPu@m"<du {;wuX-u,uT6uhOlu33xu .uc0upu$ vdIl(#vq3v1,=v,&\Ov@7Xv(hv"wvz>$vPs'vxlvn)xpx8\$H)x3843xD?\xX"<xl0hx'0x64x04xL*<x#xtD@y`-8"yt>9,yI':yB%LyĘ38^y%-qyY+yh(xy sy")(y9yT2(y4',yA,yX((y,1lypz6z=p"z$3\8z r,4Fz8'Rz%ezh/3Pyz3z`9 z=lz<0z9z54z82zP={ Ml"{D+P7{x;8C{\U/(O{)Y{T*@d{N}pG}P:S}9c}08o}2q}Gl}%:t}&s}R6}A?}W'8}؆lp}?0}'D~*%h"~D;~2I~-]~8,Lq$ ȅ ((օq-#p:dF2X Kl,*(<=>lM<)DT$2(j<>nrl*D5 s4Al49pdž@;lцpن01$!$704Q7 3&Rl9%HBD MȔ6dD2\r$x~j=Dt7L58t)``&χ8LهAl0D >d>?l)l*p5x%<X dK<aTN7dvLt;8(Do;l9l(`)"҈#D3`Q=Xq 7u-LNxlW XgAlq@% s$+,0l%8m3hƉ"HՉ3q܉M<|L;@3P 2@!(*+L.dG$dEP X1XelI*xr"T6hX3xl> xɊ<:ъk.݊0q9|ܥ-Ts\H'!d8D>:DM|pZ88(fx*<p*~ $#;0U0@)Nj#xۋ 7x@l \*\:dT:((#/7\lI%0VDL'Pexm?|_$.W,Ȍ0+pЌ0*x܌:8T+p`DIl(+(72>,'DUlN4*``9<p8:<y +4I1h*\L)(q<6$t"Ѝ1Dߍ>/dT&pp"*,(9%]5p4 /3\I\i2Z 1c!0r<9x|p@4\!7,x1qx, H;tL#48!E8\ېX=?6TR0$P-0%=l>%'`HNlS#j$ pul}(84<[& 8T2>@ӑؙpڑ\{#?9Tllu)Dg<0#31(j*|I&<Y(8jm%` Lo9Hr5/lŒA;Ғ(%3ޒxv!8pE$ .Q0$)q35>x+I*qQ 314Zz)<a(|p|6#o0|<~-$<ɓP$$Le7pX<(XD"\..$/)LB)QX&]7h:Xs_6ܚ59c63x1(Ŕf5T֔0'ޔt3@lpD?H(d7$#<30$,T;' Wl\8!7$f3<qV0$|9l,,l7q$9ϕ8{2$xy)LXsd~3\-@?6+C< 9X}*`^2o|q'8&T)0$@QrX8\Ė ʖ8{lԉ?l-T xJ2 0*@!h]* =|/F8@RlpZ9dD&y!D%$ dD#' *\%>?ʗ69ӗ<`-X;P8 H+<&D"P=H7(2+HP4pR|rZ\7@h@>(8rD!$/HDX$$ll4z5HƘ4B(p՘`d`*5P%d[9D+5D<Lf3E<lLD"c*ql8~,-Tp6L)%",ǜX&'<՜(W6,@Xh, !t:,)&s96HW6[ /kP#3vs'x[#|\9Hp3@םO74 D7$3L@+D)? ( l/)<T2H%|Pl*4Y9TfB2tq}D$pP& 3D/24̞9?מx5l"s!d69q",+Tl>`,R$;[pP8g'tq{|+`B"t*wl ;@78͟:<ٟX:88tcr<'4 `%dq9,4l+$BL?O39Z/Pe|&sm8(H{"p t<5;l Y8Р('Tڠ3(x!)0}34" 3/$@xK1Y8u"ph<`u0(}&4L@&T;,2D7$2/ʡԿ94ڡ:8vl30tl4y2*'@2#p1,9=|e6S7+0`0mȹ$z?&sj,H8h =.P`9tˢd6ߢĈlI/0#8# 'd% 45L<xh' I2hh%zH2h\+\: ̣:8\+ã'Σp=|{-,(l >\,6LH $2WKl(e0<r5D+@H)`@"P9|rȤ_&XԤЊ%8ܤh:#<- p@,8.p )9&J|;X8(e԰6py8T&@+L@#9p7ʥqץP$h"$J!x7 %| $d49@A lJL(: V7Pk"84',i20|'DlX`e<Ʀj"֦8ElT5l \,$%$ \2(9 'PA,#PHP,<`r#(o&s@Ol$%9lR"H 8t˧(*DԧM!ާ$p8 $LO"g 4( 9d=97tR(l[(K9i1l{ 0ľ-p4!'|<,Ψx;ۨ0;j1(%N5 H+q++&M;3+6`D4HTX&a <p4B=1000lM5é3q`̩4D&lکqDK88C'"(-,(BTc1HPHM5Z $8l @{R6D(6h1-@ɪT>ԪLK8&;H' lr%,W=@ -:(0lE\$XZV=dj9,x0E 0+Dr @?<(|ƫ`#DԫtDlXo% l$  6 1X*d*h3c1LAl0U"h(pvp6H5r@&'>Ȭk'ج%8!8T4x@)Hl$!)+%5u!J3S08`I7q ^1~ؾ* ̳29?$p3DH+8ĭ ? ׭8(&s458 d*p|)S<4(i59Q2D1R0+t_='8eG2t-0,.&DD%p D8L\(hf7(U ͮx(ޮd''Ԉ9L:<*4k,Ph4l % ,4H$-J><Xl`h1Dkf*v+T}s X*4)`v<48l6ǯ<0hѯ(H0!0  *Tp;0%`l 49,A5NQ0$_4%q@w*`|;L~770Cl@+ <\*y5h62LC:lK#L`*j0; v(\,%\H=9(!ȵ+0ϵ̅>۵p<K28(t/$ `/ ;'v688Fd8tR1<`$/ol98}88P1*p+Ll*@((tͶ%\0$pT+l ,Dm9)n-0C( W0&<a(l:yu=H0L( &p9ѷ}3h\<9,<|5l+t((8;(<F?]̑?Th\+sj*Hz0p$<,,7H64Fl\-ȸ&DոElTO'9'T%\d)$ yl4 748/lC+LIPp&D^ 0=pP?x(Ht$<"lz20Xw)@#<,͹P:ֹ<9@ԡ;d 6\*<X&tV,(d8/h+=lH<'qRd2[0:dpDi=0,7X 79lľ2DӾ4ܾ$@|G7^:Hd62 DI,|*+&\98X"ED`:O (\_(n5{9l*d)0P,&P1o+ο"qۿ+L(! D 068 5P#; 8 9TG1pG0=]D6prX5x0%8%p)H*8h5D/P*p9(\s684l$ W&8%\,"tE8TUI-nlhr ^1 l '/lu';H8,d6=9 d6#*+Ą-BX;M;(](*f1qm`q?Py\-l+.TP(Z+q@)P3t<,`8T0<6q,!.$,;8B1H6O:.p^;,i h;rKl%!,X$4,0^95lp[?0/!\0s;)9|*<s$@w'4"0= 8*X$l(#p3h:J8=[|)Xfr~I30P,x"XT 8p> x7xhrEl,1,hJȅ98V8r0k+yl'\*!7ܜ'\#p N \L8 T?l2'X0l 7#<M|3<Y9.c=p9{*L*4("D!8=T\7$5x0*#|";(h1 5 (dE![lb )tlvL4$$j<|Ql#$/ @%`\v#dlX'Lk. H-"#,4NrD@12@[Dr-@ps}:R38 ,v:$ /t ,`& 0'2$<# 8l*!+3D;8It.2^L2md%lv:xx)4L4<37DDKl(*ph/<t?7tPar9p"78* Ml;6lA6(8O|(h^D m9x2Nr?x09 p%H@|U8 *̹*4&"t3(!H41LTT7X^U6q6xG$8d65Rl@<?xl^7`H* T,H*<(DD<9@ d63xElAxn&|ZL^9|g&sye6D2x/x+#Q!l }!( V8V.&X1:&8p8R2x0l( 7Ll! 867q@X6lJc<(Yu7Th%8y,Tll2P0Xarԁq <+|l)LX<  0 M.$~l616lA3<IlCF8_8j>lv(~@\)Դ29q1lP&<0G$4 l7 89"*-"d=h=F6lM:W,Dln'zD6 4p4p)HD,%#(l (8\d6 3PNl +D$9-Կ878#A Tlt<"p (* ls/\X'  %(8T)71t10?U5RX24d Xn,9x .,pGlF*xh:"t!p;HQ('8Tb9,;90L8 )Tl$Ol5#J8`\<*i9tzD(( p(a7 Jl(tN Pd6h*t) `"&!:h9((@3drFpxN:4YlN% k"$y@Dq \Y2dL*<\c6<*@#*0? l 8;T3#$4;h+LlpTp by>8t+9<lr^&@)&)L 2,[$ "@hU;@)(M71d/,,?܀*pJ:xWd$c|2sq<D:d0$Č.s*L-l &0D;d Q-+xpDKhd!GTT0V%$a Dn%@z4# D(8&sX42D@  Rr,,)h"l6D1*0:=TJ| ;dUm(b,X-HwL/T='Pph;|]80s@t*;T8'0 "(0L2Nl2q''8 0F[?QLz6i$i'@t0 7}82 h`-x(q\^8$2@A!l 6hx2@XV0 &s /) X%- l?4 |54C `+&X ${la ;8o 4: Pl T)T $0P :T [' #X > |*D 8# H`1 0 h3|* 7q4 xF(< \E'0G  K8@X ln8k x&x 8K  ,l 8` 8 ]1 !H )0 4>% >/4 & $<0$ :*<2 PlA do%Q |9_ L83o \$  \.` 8, Q%L t'9 D'4 l;P ?a`s%4pxshEldp`0= dP:$ : 49(v;8l%p<$x,*5h6 H 9^'hj5Dvx004lt Xg>t@8 1W08>d0lF$"4Y;l8 2ܣ% ܋4.7 y<`T%'54l( e),l.-H%:(# Pc9\Hlpi6y.D+<f6(1$|k;7&l_1L80|'`<07.X'/#4|;E?7Y2qf$z=:(B+*D(@*!Xp+d`_;d\5 +Xh&&P (3P#4Kj#hXx#$n%{q+D(:(*8$+d78q,=Lo< 05\dl,s<2pP@Il$_dll{){4'(86"\0<,\ar{:t*"0_1<+0'T9p"O 2(X8qe(o1xp9*,(H%u<8d27 s6ԗ29\p,lx)2d,`Dp##59>xO-R+b36l:xx4PD#8V6R6ܱ2Hl()( N t@[9$ 9.LX\Or[4:dhT<3z9"9d63!P ( x`4tqTPQ'<Y%(lu.$%+b/?b#L@a"b;0k4wi,4l;9ql`"<@DS:8, R0*<x? 3Q0+85)D4k(8SdwlY" l<y41 ($08D@8\;ț5.0)p@61 ~-&-tA''H$T&4@c%4v8:4h8t%;T8\3|00\|N.p! |3l!).&8(8:xC\B'QP&V9fd? v9(~0$ ,T@;,'X"@:\LU%0|:x t]<| 12D* t;<> t.G P,\ ,O:8f  E!xr    2 6 8< 8d 8Z.P % ~l 8W6 H:!X3,! 0$!/l.!t"4?!$#:S!i*Y!&,k!<!H;$!@s0$!x%!L,x!$!D27!Th0!(?!p{!!1!l"dn<";d!"xr)8'",$42"4F"j20Q"%$^"v<`o"6~"@w(H"'"p"hd*h"\!"#"A#"U2#D&\ #s#h4#+##`G#,%R#n9[#pi#n%dw#,#W-h#t8t#82#C* #D$#`k+L#,"#$C*` $>? $T%4!$0Z:`0$79$_00G$ P$Dq>t`$܉lj$<w$A2$ +$(=#P$Hz<$\(`$/$`N'$*$4%D$E6 %.%Y,!%El1%6A% 20N%1\X%*c%'n%D:p%h03 %&%|s%T3,%5%'`%V6%D2%o:%7&P(&@ 3&A1D@&d (N&-4j&k)t&l6&/L&,/&0%t&|:&x?8&7<&d8&z:,&p(|'4pl 'f:'z1 !'?('er6' %C' "W'4:c'2Tw'̰$d'8x'ȃ,'`!)8'#'@ ,'2'@(H8(;4(8*(d>?(lY ((;(9(3  )El)9H')%dC)/'pP){;^)o+(>? w+&<+H8+dt04+h#@+!+|!,H+p+!+TK5+f6,0 38, Dl(,:<1,J4<A,%P,|V%`,h*l,7w,x*,&4,9\,,,,,h,',H!,:@,V7-El-`!&-?"x8-8xH-83V-`I;a-6Lt-$"X-U6-;x-9-Hl-$-_9-;.->4-&-9d .y7.\&).!..0i< @.4`.<%<p.:.2$.(?.&s.p.%%.64.r,P.tm8x/4/P%#/s*/3@:/: H/(g.$S/pa/Xz(po/%xw/4+/q/p 4/*/:,/?/W6/̃)/=t/Ql/|0080&,&0L2`;0Я& @0lH0;,T0/i0 V6{0-0 +p0tg<,0j60d>0+0P D021\S.@1 ,@$1N7L11L2h@1D@ U10P`1;'dn1W%@{1X-18*41,l1 ;1lS61d4$1 1t:l18^11h'2;2`D"2&s*2:l72$"XF2:"[2;pg2:0p2(k:T{2L912:?2D;824r2J,L2DU0`24:2:2+2843P33]1,38q;3di'@J3 !<S3|~l^3D8Do3*Dy3# 313Al3;q3\8l3X2p3*43|X&323XR=L42T04)x=4$%<D4$pP4,<d4|'To4pz4\62X4{)4p=4:(d4l4h)4j 4w<4>4*5858'`!5$ 7*5l45\8@5O%<N5HWli5H((r5(88p5Z#5l5"5<5|)59x5!5O l5@6hl+6d1>6(B60O6.Z6)4c645lm684x61%64xl6PDl6%<6C$L6t-l6|86H4 7+7.|+7 " ?7:S7:l]7H8ti7c1w7HH7747087d+T7R)7@>'7$x7\]!73t8d1*` 8: 8`%!8#-8P<?8e/S8%e8" s8/38'8:8V68D98v/ 878$- 8pu#P9;("99 -9XWl69X)@98<`N9?@^9ܺ$n9P :h9o(9a3998x9(9 *98X9pMl9-:ħ%$:m!#:xl4:x;A:|l'K:f->s+>c6?>5C>$4X>#o>t4hx>,1(|>9q>t<>L0: >9`>[?(>$Rr>@">\8>2?/d&?t9`0?@(hA?FlL?(U?2@f?K1pw?8T?2?4!-?L})X?W=x?K,D?5q?7q?u:@@d*h@\#@&@D-@Px1d6@X'F@*Q@7`@L+2@|@6@\%@;,@t3@@38@O,h@l@L>@7@5@8q@P*AylA04tA\&4#At-8<)A\?F7FpF$!\Fl/ G%LGL .$G8;6Gk+HLG$skG-*uG0v/P}G4g=|G 8GbrGpw6`GdJ؄>J4:dJ$d<<JZ;<K4D:K*Kx T%K8;K*$JK0=\K=rK<7KKlK&KK2TK=K3pK798K$lKTR5tK'$L )"Lh9<LD7L8"(HL`*VL*HaL1 oLh+|LD(L2LDA*LL $LLo-TL-Li'@L& L 2  MqM#0&M8d;M?)4EM$7&XM0:DbMH{l MvlM &Mi! M 9M ?7hMT1M0+M'dMx>(M;HNRlNX=@!NP;45N:@NK3lVN@* jN:DuNԶ4Nc'4Nc$DN"TN4(N NlN|7O6OXk"$O.1Oh'5H>O̩8\MOD2XO4;fO30uOY&$O$O>$TO+|OpOY&OH3,O#4O,!lO,9:P!PI;(P93P!0APL<-|UP0 )tcPX'kP=TP<P2<Pd6pP|6<Pd8dP<9\PlP$pQ&Q&%Q%-Q#pl]-](<],g*^9D^`l^+9!^/-^DF/p;^'8G^D:\^xp6n^u3h^(p^67d^X8,^P6L^0 ^- _p_ _Ĕ4_*_0'_l_;d_?%_S6`$Al`+X$`q-`q>4?`*N`.<[`L,Ln`m8`|>l|`l5l`,$`"p`s)`IJ?`0Ml`"0`@|2L a(d$ap1a$#8BaS<Sa'aaZ9natU'ua  ~ap/7@a4$a`l>at4`a? ap9a<,4a08| bc-bm:\*b2q7b,6DHb;Vbirab#,lbDS6|bL7?bp)b<by9hb@*Db8%bW6tbl:bt)db&|c%TcB*c̸9|*c@?1c ;\?c8qcpc(c$;c08(cS3Dc4M,dJ%d+%d22:d10Hdvl8Pd|#'PZd% ldm&dL5dxDld@$)dl,d8?dL.@d,8dPfrdE-e8k,Pe 3'e0#6e>Pe &ce<2@xe!<eԼ?e,;le$0leT& eDet+e&$eܫ)8o|$DKo \oS#oowlo+o:'oAloY#o,(oV(o XoPwlo%pܻ>%p|*/pX=8?pG7`Ip`$L^p6hopD0lxpC&Lp9@p-(4p;p94p,8p0)hpD1lp9p,p: q0qI/ %qvl2qo>TCqerIq",XUq|*8t_q8<mq8{q8k1 qе&<q qDlq-;q*q@"|qn+0q&Lq0 t0:XtR0t" t$*)th8t`)tX)&,t"dub'xu.u& %u$89ux*Du/(Nupau('|qu}(uDf'us u6u(u +(0u[0u;Du$L7|u8i3@v46vpv5q&vd x=x(s$(x8;xH3HxX$ ex0)uxH3x%dx,W-x%dx7\x *x;<x5xq>0x@ ;@xD ( ypy4& y4*)yxG-X>y2qIyW! Qy:0\y!ly-y(yO8 ypO%hyh1y.y48y08y9qyD/)z`C;tz>?zs %z5L5z6q?z *Gz<6Vz?ez*<rz8DzszԶ2dzRr zq6(z@<zlzlz Hza>{(x{9x{s"{='-{h%XE{/`P{R(Z{1;n{l%X{B:{H#{t)l{p{[0{8L{,4q{j)<{${܉;||>?|c'!|3 -|@7p6|lc6C|2qJ|HV6]|4i|6.v|6,| 5l |$ 7 |ķ40|(h| "`|83|̺8|+,|D)|hC$P}El}*,(}lq%6}&sC}hrP}8Rl]}@4h}4;Xu};T}@,L}<}d6}dv7p}XG6( }C1@}`1q}l2}hg6 ~s#~)<!~Љ$4;~(C7pK~(Dl]~ule~zlk~ N: t~W%~̔'(~@9x~*~04q~ *~p2'X~="~l~c6~sx6(Ol $@@32$ G&sO$4e[$ z PX=tV0? t`6p!5* 8 L>q+`+P;;H@N.<W -u>%4#(Ȣ29q5ǀ- &(z!"ă +T΃'؃\'D|" !(4%L#6LlD6$YElmx6qw)0J!HF3<dg$H1ĄF0L Є&$lx,3`(xJ.g-6'=#HJ-`tx'i&HuTl}`'h8)H# P2х+X م*l805Lt.)|$@N8t08@sQD'XU;Lj9Dt1R0Al(<(psņMlӆV0 '(<88l; \8h2*<>$s7PLS%gt4u *"@l / |Xg0 7Ɗ@/: ъ`r܊pE6dH:H9x !('`5l0@<p(`J|$d\0h1lhQ.8r!=sȿ3|0G.4j*l0N-8ɋDHw> <0 : ({,@D8 ,(Gx<[l.xd<lt-% $F6<(@,dHpu#@:ʌ&(ی,(xD*l* 4)?#J5X#e^6t@*0 :6@?((ʏlҏ;,l +P (|-P0"X$Har, s?8qPh'^B&i:txTl~:pr*p;|:LÐ@@(̐(֐:H1<%@?HWlM%b)kp)x/l >l\&$j18 1`̒KlՒp**p|!d2T- &,0<7d946$B'K!)(S9h.<u`88}$Dld<b2DY<Ǔ:dԓ,"7.\ ;. *[D(9@?C,7LqWrD b46Lt +~\p7$<]:\t%p(Pɔ Hڔ;,L40H;q*l,!(8l(C+/['4?27PQ;X^62tq,$/d~q>!l76ʕx/ו)30$+ H*&$P),4"IH!Z,8n$ pv$,tpl,%\\]7xǖ(/dז+<9lR'D4u7XH<Il(2@9DG@24^ 0j&w@8Tl`!hD~)#,ŗ0җtf9Hޗ,;?@~#@)4$=tDl0ؓ(lEtc `R Tg9Pst>}$H48((*d:x:Șr9՘MlL,(8 8+1#,89p)pHP5QRl^PP'4f*xr%|$< x"24qƙ0$|ЙL, ޙ(*;T7  Pc6D-&(p?0;4?f;LP;\g8lu7~Dllȕ?ر: lDl˚&֚@?lp*$;x  s ?,5l;pBM,NP3<,YVllP+}(D<D+Lp l% 5ћdK54ߛ"2:l$D% v*| p%% )2:4ت7h@9tNg3 k\pvf6|c6d.V0dAlŜ6М&ܜ9@9(( "p ? ,4R8<H1LT#P `̺#dq(z?  ;<,}6(\T6ȝ50*" ͝@96@ݝlxx4l)!4ŸZ'Ο=ޟ,? *@X) 8s-<* ;7pF2<S<,_p'DjX(8ht]1}з#n&\{*|+à# ؠdP" :<ar h  $ l`1=$(T22@9:+BĊ Ra0 bc m&@(}9L*,8!T9x&.t-ҡ%Lޡ6l@n+0*G4f)|9(%=>lO80r&|%Dh[$`đ2Hۥl c$!s lU<@%3<;DT0KX!|_xlin3 %Jl(GlT:l@('\ҦEl4ަq@*D l -*:$5L[$N#]"kLRl~Gl$)L&p?`0$̧d$ߧNl$03R6v/ 4T64@=|F$<Z$3h-p8q$$#8.`L.Ȩ++<ѨDި@(,,&0DEh?LHl$^#kb"d~9@X<(02x؃:,<,̩lr֩%0R6 5xt* `$ 8p+lp- =X(H&Z0<hء:q,.hD+p*@06L\o'[$ ӪX.lk- 3P>l.%>T$L j#a2qxlz`p(m:dzh8'$"l$<8>7<IL;xR924c\0pl*Dx(q '|87H6456w(|Ӱ%ް!P,t 2qP8.(4T;8}-SOr glqV6~l<$ ylQḻ8-&Dt9@7<4Dl ^0-4'q6DlPA`8,P.$^N+L m0*{$1l(' > p7 mVl 3q RlHe2h<<ij84س)7D65t/x4((+q4@'@@ o/8Z $s$c8d8LH2*88İ78̴0ݴ84q|>7<;\ 8PK3h%',\18T?t3$M0@*`K-xx$S,2 0l 4<-ʵ,׵$+;l=p8,q%0U=pD ,Za'xi|!z/}qpzlxFl^38)¶)$̶Dضl+:<ܿ5X&1.H(<;l'*!0"!8 -DȀ4I]$4a1l$(4T{,q+L'X%i<Ʒ,<<PW6b(5xu|t6$T-lX+DsW6Ը|6q޸,HG  5T s-8 vl2p5 "H+'TOL;`N8Hld&s|Or %\;0X#4ƽ@`ѹa/x۹.%y,\;(H,2(Tl&,<=`:HMR.xT.^ hm5x9Plu8XlD;8dԺT6޺DE/:(\?$(,t.1S*T<l0I X_;Xl Wlz@R4`t9l'D;5h5 *(ƻ$ݻ1`XD(|2\ԕp% p!-g107'CĨ$`N#a\(l _7txp( D" ,`5&tżpμt+ ۼx!';@7 &'L'q(+xN; <0R0$JP)DUa$,`5dn_<U<4%@xQ"P86ƽ<,4ܽ6S90Tr,d+%@'0Rl;)|D/7S<.`_k+ms=040(&!$l˾;,־,:ܑ6:' 5'\/2h-];>+l N +Yr(i,9|8t-28q<;KlEP(O$YD"q&L )4T%dC1t<'4>? T=D27<(6$DT!$078,D$8CDWl^~li}(<v'd!#3h&l$ ?8@ (r0Rl$$|:0(Bx(V *(`#r6Hp1|x&# w9 "Xn1l@ )`".X&xO* xm)@-;l98HG'L @8_7o*z| D}0043 (h$x[#j74h+*hD<8' \:h*D:p6x9A47K)UX86bdL1o܅!|`:Lv9@U6n)pzl4{:C34Or< ,b0 ulp440(Lm6=d3MlT}"gl@$vX;q%$* u'<d2x<lswap_onwi_set_nwkeyucom_unlockpfslowtimonanouptimebuf_rb_bufs_RB_REMOVErandomreadehci_device_ctrl_closeem_set_mac_typeaxe_tickre_disable_hw_imuaddr_bestfit_functionslongjmpwi_usb_rx_list_initproc_freesr_crypto_discipline_initkdb_trapvfs_allocate_syncvnodetc_setclockuhci_pci_attacharpresolvechrtoblktblsw_reg_strategysys_minheritieee80211_tree_RB_NFINDputcharural_update_promiscuvmfault_unlockmapschild_returnsmsc_cartlabel_unrefHMAC_SHA1_Updatesmsc_startuvm_map_inituvscom_attachipsec_soft_first_usenkmempagesuhci_device_isoc_donecopyinstraue_miibus_readregieee80211_send_group_msg1sys_getgidieee80211_tkip_micdofilewritevwi_inquire_usbuftdi_matchdumpmagieee80211_derive_ptkttyflushsys_setsockoptsys_ppollcomdefaultrateclock_gettimeieee80211_watchdogwihap_sta_disassocdefrouter_lookupinetswbwi_rate2modtypewi_get_fid_usbwdog_periodcdce_rxeofip_reassrt_maskedcopyin6addr_anyVOP_ACCESSusbd_get_quirksem_k1_gig_workaround_hvip6_get_prevhdrscheduler_startdb_logpciide_triones_productspmap_alias_bitsuvm_maxkaddrehci_pci_cansphy_cdumass_io_putral_pci_detachicsphy_resetieee80211_getmgmtrlphyattachipmforwardingmainbusprintohci_waitintrumsm_attachsys_closeusbd_do_request_flagsbwi_mac_attachrt2560_set_rxantennartflushclone1ffs_inode_allocdes_encrypt2sys_setsidbwi_rf_calc_nrssi_slope_11gieee80211_encap__ashldi3artisea_chip_mapvn_statunp_detachsiop_scriptnd6_nud_hintether_ip6multicast_minumodem_breakusbd_submatchtcp_secretrti_find__mainbwi_rf_lo_writeaue_stopufs_quota_deletehardclocksd_vpd_thinenc_xform_aes_ctrieee80211_eapol_timeoutsr_raid5_discipline_initsr_rebuild_threadrt2560_wakeup_expirewi_read_data_iowdc_reset_channelrt2661_get_rssiumodem_set_comm_featurein6_domifdetachieee80211_get_authvtagssiop_pci_attachmtx_enter_trysmsc_sethwcsumwskbd_cndetachdb_get_variablecd9660_vgethotplug_get_eventpcaled_caieee80211_inputcrypto_dispatchsr_discipline_shutdowngeneric_armv4_bs_wm_2if_group_routechangesys_fstatatnd6_timer_workohci_device_intr_closebrgphy_disable_early_dacurl_csr_read_2dest6_inputgsignalacphy_cart2560_suspendehci_pci_matchipport_firstautobwi_mac_set_tpctl_11bgmii_mediachgwi_txeofaue_devsipsendredirectsbpf_setifem_encapunp_internalizetk_rawcc__wdstartscsi_xs_sync_doneaxen_initfc_lfcemptyvfs_export_lookuprt2860_set_ledsrt2661_wakeupifnetif_cloners_countyieldohci_endpdm_freemwsmuxattachuhid_seltrue_filtopsuaddr_free_rbtree_RB_NEXTfilt_seltruesc_print_addrlogcomspeedsmsc_tick_taskvn_writechkin_ifscrubral_pci_caarmv4_tlb_flushIuvm_pmr_freepageqpdevnames_sizemichael_updateumsm_umass_changemodescsi_mode_select_bigroute_dstsingle_thread_clearinit_execsr_schedule_wuuvm_pmr_size_RB_NEXTuvm_addr_alignieee80211_send_4way_msg4wskbd_cdnamecache_rb_cache_RB_FINDbcmpgeneric_bs_r_1ieee80211_node_detachdb_set_breakpointsnd6_dad_startexec_maxhdrszuhci_device_ctrl_donedb_force_whitespaceSHA512Initieee80211_ifattachmmmmapieee80211_clean_nodesbwi_memobj_write_2setjmpsd_read_cap_16prefetch_abort_handler_addresswdc_disable_intraes_ctr_reinitbio_inforicohrtc_clock_readrt2560_get_rfpdc203xx_dma_finishpci_subclass_communicationsurlphy_funcsuvm_deviceopsuvm_addr_align_backlogread_filtopsre_ifmedia_stsvndxfer_poolcpu_info_primarytcp6_mtudisc_callbackcopyoutstratu_caaxen_tick_taskieee80211_countrycode2regdomainusb_transfer_completelxtphy_servicepciide_unmapregs_compatuaddr_stack_brk_selectswcr_newsessiontcp_attachla_hold_totalwskbd_cngetcbuf_dirtysoo_writesystempageieee80211_align_mbufm_zeropdc20262_dma_startural_alloc_tx_listnd6_llinfo_timervn_fsizechkunp_gcingreaddoslabelbwi_rf_init_hw_nrssi_tablebdevswcalctsruumodem_matchbaddynamicportsworkq_initohci_root_ctrl_closeX_db_line_at_pcural_ack_rateuvm_mk_pclusterbswap16domainnameehci_endpduvm_pmr_addr_RB_REMOVElockinitwsmouse_detachttywrite_filtopswi_usb_devsnd6_ns_outputbpfkqfiltersorwakeupre_ifmedia_updinflateCopyttyunblocksr_meta_opt_loadbioclosehidms_disableremovedeudav_miibus_statchgigmp_timers_are_runninguvm_deallocatefilt_procattachufs_quota_free_inode2filt_procdetachsys___thrwakeup__divdi3pciaddr_resource_reserve_disabledi80321_io_bs_allocallowpowerdownsys_clock_settimesiop_led_offural_txeofwdc_floating_busuvisor_calocnameshidkbd_bell_fndisk_busydb_breakpoint_allochidkbd_belltcp_pulloutofbandevcount_sysctlsqphy_statussddetacharprequesttfork_child_returnsiginituipaq_cdaxen_capci_mapreg_mapsr_wu_enqueue_ccbuhci_device_isoc_abortpool_set_constraintsusb_task_thread_procip_sysctluhidev_closemsdosfs_vptofhscsi_mode_sense_bigusbd_clear_endpoint_stalldb_vnode_print_cmdums_casetdisklabelbio_registerdeflateknote_removesii3112_drv_probepmap_bootstrap_pv_page_allocbufq_nscan_createsr_hotspare_rebuilduvm_mapent_addr_insertext4_ext_in_cacheroutedomainhid_locateicmp6_errorVOP_MKDIRpool_large_freeip_protoxsys_settimeofdayi80321_sdram_boundssdstrategyaddlogehci_sync_hcuvm_page_physgetrt2560_bbp_readmsdosfs_synccheckdisklabelscsi_mode_senseip_savecontrolstackgap_randomvm_map_unlock_lnffs_clrblockusbd_set_hub_featurepdc202xx_chip_mapuvm_addr_linsearchbpf_filterchgproccntip_drainieee80211_tree_RB_PREVdb_map_print_cmdumass_init_shuttlesoqremquepci_class__adddi3uvm_map_inheritsys_getthridcd9660_syncem_enable_hw_vlansbrgphy_reset_bnxin6_ifawithscopebuf_page_offsetumodem_set_line_stateuvm_pmemrange_addr_cmpkm_freeusbd_is_dyingsync_printvnopsem_lv_phy_workarounds_ich8lanieee80211_rssadapt_inputsys_lchownmsdosfs_removecd9660_readdb_read_tokenem_attach_miibusieee80211_regdomain_compare_rnfilt_timerdetachwi_get_idzeroin_addrbmtphy_cdehci_device_bulk_closewdc_set_driveuvm_map_protectusbd_get_xfer_statusuvm_map_setup_mdre_encapprintfehci_alloc_sqtd_chaincdce_devsrandomwriteuhci_device_intr_methodsprelist_updatehmac_ipad_buffercrypto_drivers_numsmsc_miibus_readregip6_protoxsys_recvfromswcr_freesessionttrstrtwskbd_mux_openrandombwi_txeof_statusif_getsysctl_doprockcopysiop_modechangeext2fs_initext4_ext_put_cachertfreesingle_thread_checkre_pci_detachrt2661_node_freecuio_getptrcd9660_linkhostnamelenupl_cdusb_needs_reattachdeflateTuneuaddr_hint_selectem_flowstatusxscale_cache_purgeID_rngttyopenuplcom_rtsraw_ctlinputwi_usb_ctl_unlockbwi_rxeof32nd6_ioctlsched_chooseprocphyslockspec_setattraxe_miibus_statchgpte_l1_s_protousbd_get_stringfill_prlistipsec_exp_allocationsHMAC_SHA256_Finalbpfcloseusbd_probe_and_attachdirtyqueuesys_writevsys_setpriorityumodem_set_line_codingm_tag_prependE_abs_script_sched_slot0_Usedaxe_cmdurl_unlock_miiumass_detachusbd_free_iface_dataip_defttlwi_usb_attachurl_rx_list_initusb_schedsoftintrarpintrkqueue_registerpciaddr_resource_managein_delmultirt3090_rf_setupdisk_lookupuhci_device_intr_abortuid_findumass_activatend6_rtrequestuplcom_cduvm_km_suballocusb_delay_msucomparamif_getgroupattribsbpfdetachsys_closefromumodem_closeehci_devdttydefcharssigexitscsi_link_openhidirtypagesrt2560_reset_tx_ringin6mask128rt3090_rf_wakeupbus_space_read_raw_multi_4uvm_amap_poolin_pcballocVOP_LOOKUPsr_raid5_regeneratesr_meta_readbrgphy_loopdb_shift_exprphysical_startbs_notimpl_bs_c_8ifa_delenqueue_randomnessexphyattachusbd_set_idleserverworks_pci_intrieee80211_find_node_for_beaconemul_nativeaxe_txeofwskbd_inputre_miibus_statchgobio_matchacphy_cdcrypto_getfeatbwi_memobj_write_4bwi_phy_config_agcwsmux_attach_sccpu_do_powersavebwi_free_rx_ring32aue_rx_list_initi80321_bs_vaddruvm_km_pagesufs_quota_alloc_inode2ieee80211_name2countrycodemicrouptimesr_validate_ioaes_xts_decryptsocket_poolsr_raid_recreate_wupgrphashsys_setpgidpciide_jmb_caprofhzAES_GMAC_Updatesr_meta_init_completentp_update_secondcache_enterdb_watch_tablei80321intc_attachedexec_elf32_makecmdsusb_rem_wait_taskext2fs_bufatoffsys_setlogininitarmamap_listdb_trapip6_maxifprefixesieee80211_node_cache_timeoutthecustcp_do_rfc3390ieee80211_req2nodesys_setresuidsvwsata_dmactl_readcrypto_kinvokern_deletesd_get_parmsiskmemdevstat_rush_requestsrt3090_filter_calibwi_watchdogatu_start_scanipsec_def_compfc_lmdistancench_poolphtree_RB_REMOVEsomaxconnural_readugl_initscsi_xs_get_doneatu_external_firmwareipsec_exp_timeoutip_directedbcastbwi_free_rx_ring64i80321_pci_decompose_tag_bus_dmamap_loaduvm_pmr_pg_to_memtypeuihashtblieee80211_node_getrssitaskq_systicks_per_secondsd_buf_doneieee80211_get_rtsamap_initffs_flushfilesubsa_baudrateiq80321_pci_intr_establishicmp_sysctlsys_lseekdes3_decryptllinfo_arpmsdosfs_pollpci_lookup_quirkdatamsdosfs_accessaddupc_intrdvd_read_bcaamphy_servicevm_map_lock_read_lnwsevent_finiip6stathotplugread_filtopsuplcom_set_line_statehidms_enablewsmux_set_layoutuvm_pageboot_allocconfig_pendingmii_phy_updatesys___thrsleepi80321_i2c_matchbwi_mac_dummy_xmitether_crc32_lepiix3_4_setup_channeluvscom_set_crtsctsaue_csr_write_1ugenread_isoc_filtopsipipstatsecureleveluftdi_cadb_consoleurl_matcharpt_keepsavectxdb_printsymums_disablepte_l2_l_cache_mode_ptbinuptimedogetrusagesys_seteuidhidms_attachuao_shrink_hashugl_rx_list_initwskbdpolluvm_map_checkprotmax_protohdratu_tx_list_initdes_is_weak_keyohci_pci_matchural_rf_writedb_access_irq_spieee80211_add_qos_capabilityieee80211_cipher_keylenumass_scsi_attachsr_raid1_discipline_initrandomkqfilterbufpagesuipaq_attachusbrev_strpciaddr_resource_allocateiic_execsleep_setup_signalrlphy_cdprocess_newsys_keventcopyargsarc4_reinitsr_chunk_in_useuhci_device_bulk_methodsrt2560_attachwd_standbymi_switchcd9660_statfssysctl_sensorssr_scsi_wu_puttsleepkern_sysctlbwi_dma_mbuf_creatend6_delayin_pcbinitsys_fchmodatsqphymatchbs_notimpl_bs_rm_4nmbclust_updatehw_prodfdremoveigmp_fasttimoatomic_setbits_intehci_device_ctrl_startuserconf_cmdbufwi_get_pmumass_bbb_statedb_print_loc_and_instohci_device_ctrl_abortsvwsata_dmacmd_readrt2560_updateslotpiix_setup_idetim_timingsrt_mpath_matchgateubsa_stopbitscdce_startrt2661_reset_rx_ringusbd_port_disown_to_1_1uvm_map_entry_poolcrgetuhci_activateunp_bindtcp_delackuhci_device_isoc_closecsignalreaddisklabelvm_map_unbusy_lndb_print_cmdusbd_clear_endpoint_stall_asyncvirtual_availbs_notimpl_bs_rr_2tcpstatuvscom_readstatdma_constraintdb_break_tableuvm_anon_pooli80321_softcicmp6_mtudisc_timeoutfillmapentrytcp_timer_persistsata_chip_mapugl_intrcpufunc_ifarudav_newbufsys_umaskuhci_pci_attach_deferredpci_subclass_i2o_tr_flush_blockpow2dividesyn_cache_reaperfilt_fileattachsysentieee80211_find_rxnodecpuset_addpmap_alloc_specialsbs_notimpl_bs_r_8tcp_setpersistrt2860_drain_stats_fifoufs_ihashlookupubsa_intrscsi_inquire_vpdsii3114_mapchanicmp_rediracceptmemmoveugen_set_interfaceusbd_get_hub_statusworkq_create_threaddb_boot_halt_cmdural_attachip_outputbwi_init_rx_ring64bwi_bbp_attachbpf_mtapnkmempages_maxfindblknamekue_rx_list_initpool_inituvn_referencebwi_pci_detachuvm_pmr_addr_RB_PREVbpfreadbio_errorpool_putm_copym2sr_raid5_addiobuf_alloc_pagessysctl_structbufqs_stopuhci_poll_hubaxe_ifmedia_stssysctl_rdstringuvn_attachlasttimesr_wu_putehci_freexcryptoclosesysctl_disklockcnkqfilterrt2860_alloc_tx_pooldesiredvnodesbs_notimpl_bs_r_2ufs_pollsr_raid5_writepmap_map_sectionmsdosfs_readlinkpmap_devmap_bootstrapdes1_encryptieee80211_decryptusbd_get_device_statusbwi_rf_init_sw_nrssi_tablenchinitexec_mapdb_qualifysnprintfcomcngetciicbus_printext2fs_readlinkether_ioctlrdcide_udmatimumass_bbb_transfertqphy_servicebwi_free_txstats32ip6_forwardingsr_shutdownural_cdkue_resetarp_allocated_bus_dmamap_load_mbufbwi_plcp_headerwdc_print_capswi_watchdog_usbifindex2ifnetcd9660_ioctlem_initrt_mpath_conflictin_pcbnotifyalluvm_pglistallocsyn_cache_addpool_large_free_niohci_device_ctrl_transferbuf_kva_enduvm_map_splitentryvm_map_lock_lnincoreurlphy_cdhzdcphy_mii_phy_autodefrouter_resetcd9660_ihashinsbwi_dma_allocrt2860_newassocrt2560_bbp_initsiop_script_writesched_exitcheckaliasttyretypestartuphook_listrt2860_detachre_tx_list_initpte_l1_s_cache_modeuvm_pmr_remove_addruaddr_pivot_poolkue_detachrt_timer_queue_changelf_initwi_ioctl_usbcpu_attachbwi_set_addr_filterwdc_preata_drivemii_phy_matchrt2560_eeprom_readural_amrr_timeoutzlibVersionsdclosevop_generic_kqfilterpffasttimoinitsiginfosys_getuiddb_set_cmdcomconsunitcpuidsexec_setup_stackobio_bs_vaddruao_createdb_free_watchpointssensor_detachbwi_led_blink_endifaddr_items_RB_INSERT_COLORbuf_mapbrgphy_adc_bugaue_lock_miiidentify_arm_cpuffs_realloccguplcom_set_crtsctsrt2860_initwskbd_load_keymapxscale_cache_cleanD_rngm_clpoolcd9660_bufatoffugenintrgroupmemberuvmspace_initrt2661_ioctlscsi_plug_detachether_sprintfatu_calculate_paddingfintek_refreshmsdosfs_unlockselwaitpmap_init_l1icmp6_mtudisc_callbacksnd6_slowtimosys_forkbufq_implsip_setmoptionsuvscom_reset__qdivrempmap_deadproc_cache_stateifaddr_items_RB_PREVpiix_setup_sidetim_timingsumct_matchspec_openi80321_io_bs_vaddrpmap_vac_me_kpmapmld6_checktimerswcr_sessionsfilt_bpfreaddb_watchpoint_freesr_disk_attachehci_alloc_sqhuvm_fault_wireusbd_abort_pipekernelstackicmp6_mtudisc_timeout_qcrypto_initem_k1_workaround_lvpci_resumepool_swizzle_curpagevm_nphyssegifaddr_items_RB_NFINDip6_randomiduvm_pseg_initproc_filtopself32_os_pt_notewdc_print_current_modesSHA512Transformfiledescopensys_vforkpmap_vac_me_usercomcnspeeduvm_pager_initcpufuncswinChkNamebwi_regwin_is_enableddvd_read_copyrightieee80211_recv_4way_msg1bio_delegate_ioctlrt3090_set_rx_antennauvm_pmr_addr_RB_MINMAXdb_history_prevem_read_pcie_cap_regbwi_rf_clear_stateem_setup_receive_structuresuvm_uarea_freesys_mkdiraxen_watchdoguao_reference_lockedcom_resumepmap_devmap_tableufs_fhtovpcrypto_donewskbd_translatedumppcbbwi_rf_set_nrssi_ofs_11grttrashtargetpagesohci_root_ctrl_abortmblowatgetnewvnodert2661_amrr_node_free_allufs_inactivepciide_natsemi_productskue_load_fwnd6_mmaxtriessingle_thread_waitsiop_intrsys_socketuhci_detachuhci_abort_xferbwi_mac_fw_loadugenopeni80321intc_imaskffs_cgreadwi_init_usbugenioctlvm_map_lock_try_lnspec_close_clonevop_generic_bwritenanotimere_cdscsi_detachufsspec_writelxtphy_casd_read_cap_10iso_disklabelspooffdfreeuvn_detachieee80211_ccmp_set_keyfintek_capci_set_powerstateuvm_km_valloc_trytty_countugl_cdhidkbd_detachbwi_phy_init_11gdeflate_globaluftdi_detachraw_disconnectsensor_task_registersis_south_matchusb_attach_roothubip6_neighborgcthreshbufkvmKERNEL_BASE_virtremove_coproc_handleratomic_clearbits_intumass_polled_transferucom_to_tiocmdeflateSetHeaderuvm_pmr_extract_rangebrelvpsensor_attachre_intrmsdosfs_mountfsvfs_relookupem_oem_bits_config_pchlanpcibr_flagsuvm_map_addr_augment_getem_82547_update_fifo_headsys_utracencpusfoundehci_root_intr_startwi_stopsync_fsyncsetstatclockratecd9660_strategyem_iffuserconf_parserrw_initural_tx_bcntiocm_to_ucomext2fs_allocpmap_cachevivtusercryptowskbd_deliver_eventdb_eregscom_fifo_probeieee80211_delba_requestbread_cluster_callbackfdcopy_bwi_txeofin6_proto_cksum_outbuf_acquire_nomapatu_send_mibemul_findAES_GMAC_Finalb_to_quvm_pmr_size_RB_INSERTin_len2maskbus_space_read_raw_multi_2uhci_pci_matchcmd0643_9_chip_mapugl_startobio_bs_allocusb_blk_freelistudp_sendspaceuvm_objtree_RB_PREVifg_headvfs_rootmountallocSHA1Updateehci_device_isoc_transfercue_tx_list_initaxen_iffbs_notimpl_bs_sr_2netintrcd9660_openrw_initi80321_bs_mmapAES_GMAC_Reinitixp_setup_channelsr_uuid_generateohci_root_ctrl_startvm_map_busy_lnbuf_rb_bufs_RB_FINDcmaskbrgphy_cd_bss_end__ext2fs_blkprefdb_pool_print_cmdbwi_encapwi_alloc_nicmem_ioicsphyattachdb_delete_linescsi_activateuhidkqfilterVOP_ISLOCKEDsys_kqueueAES_GMAC_Initieee80211_tree_RB_REMOVE_COLORuao_referencein6_addrscopebuf_getsys___threxitdb_searchieee80211_ifdetachuvisor_attachbs_notimpl_bs_wm_4vfs_getcwd_scandirmaxlockdepthwi_usb_tx_unlockieee80211_free_nodeieee80211_node_leave_11graw_usrreqnblkdevuhci_find_prev_qhpciide_detachinitiduhidev_detachbs_notimpl_bs_wm_2sr_crypto_hotplugttyinputscanc__stack_smash_handlerbwi_pci_conf_writeumsm_matchukbd_consopsbiodonedb_set_breakpointicmp6_rip6_inputehci_free_sqtdwi_usb_txfrmsmsc_encapmaxslpext2fs_makeinodeehci_device_intr_methodscue_startaue_csr_read_2ufsread_filtopsufs_symlinkm_dup_pkthdrbwi_bitswap4sr_crypto_assembleufs_mkdirvfs_getcwd_getcachepci_subclass_satcomusbd_get_no_altsural_newassocaxen_attach_length_codenamecache_rb_cache_RB_PREVin_iawithaddrbwi_mac_fw_free__anddi3phtree_RB_REMOVE_COLORrt_missmsgVOP_BMAPre_txeofignore_addrsip_dooptionsvn_locksvwsata_lba48_write_regcue_tick_tasktimeout_add_tsbwi_phy_attachrip6_ctlinputscsi_link_shutdowncdce_caSHA384Initumass_cbi_adscsbdropsr_meta_native_attachmsgbufphysuaddr_free_rbtree_RB_INSERT_COLORusbd_desc_iter_nexttcp_debugusbd_transferinpcb_poolohci_pollohci_hubdnextralocsmsc_miibus_writereguvm_addr_fitspaceblf_keysys_setegidbus_space_write_raw_multi_4wdc_wait_for_statusucom_status_changern_matchcd9660_symlinkautoconf_verbosebwi_memobj_read_4in6_setpeeraddrbpf_mtap_stripvlanunp_externalizesys_munlockalluvm_faultuhci_waitintrrandomioctlsoftraid_disk_attachsoreceivesiop_iwrpool_getuextralocscsibus_printlinkdb_show_radix_nodeudav_csr_read1ieee80211_eapol_key_inputohci_root_intr_startffs_dirprefucom_shutdownrip6_outputinflatert2661_setup_tx_descscsibus_cdin6_get_rand_ifidndflushcompose_tab_cmpieee80211_parse_wmm_paramsrn_insertspec_pollbpf_wakeupfilt_kqdetachif_rxr_getdb_flush_lineaue_unlock_miiwsmux_getmuxipsec_exp_bytesconfig_defersys_faccessatgf_mulbwi_mac_setup_tpctlem_check_for_link_bus_dmamem_allocm_tag_initbsearchif_attachsr_crypto_free_resourcesugl_capciaddr_ioaddrsys_setrtablem_reclaimsr_raid_read_capuvm_map_addr_RB_REMOVE_COLORnameibwi_disable_intrsem_read_pci_cfgbs_notimpl_bs_sr_4uvm_map_setup_entriesext2fs_readdirip6_ctloutputdead_pollpte_l2_l_coherenttqphy_funcswihap_initversionbwi_mac_opmode_init_bus_dmamap_syncuvm_pmr_remove_sizelzs_dummybuf_needvakqueue_initieee80211_wep_delete_keyrt2661_read_eepromuplcom_set_line_codingaxe_rx_list_initata_dmaerrieee80211_bip_set_keybwi_mac_set_retry_limuvm_pagezeroin6_setsockaddrigmp_leavegroupcom_common_getcaxen_cmdiic_probe_sensorre_pci_cabs_notimpl_bs_rr_8mountlistuserconf_histbufsys_getdentscomsoftwihap_mgmt_inputpdc203xx_read_regudav_initconfig_deactivateVOP_REVOKEbwi_txeof_status64SHA256Finalclallocbiowaitbwi_led_blink_nextpdc268_config_readpci_subclass_inputprobe_addrs_sensorfilt_ufsreadrt2560_rx_intrunixswuvm_objtree_RB_INSERT_COLORdb_stop_at_pcsccstqphy_caehci_check_intrral_pci_activateccpupmap_updateehci_device_setintrobio_cdem_setup_linkpci_vpd_readgeneric_bs_sr_1re_pci_activateacard_chip_maphidkbd_inputprocess_zapsr_raid6_wu_donenexttickeventfdinitboothowtoarc4randomnsphy_funcstcp_delack_ticksbwi_get_rf_loupl_stoprt2860_intr_coherentttopenata_get_paramsukbd_apple_iso_mungeip6_randomid_initieee80211_tx_ba_timeoutether_ipmulticast_minconfig_rootsearchrt2860_bbp_initrip6_sendspaceieee80211_countrycode2nameuao_dropswapin_addprefixenxiosys___getcwdcd9660_specvopsusb_cdrnd_event_headin6_maxmtupmap_enterrt2560_iter_funcamphy_funcsundefined_handler_addressRMD160Transformsys_setreuidSHA1Initusbd_ratecheckbwi_phy_init_11b_rev6wi_usb_open_pipesudav_tick_taskuvm_map_findspacepdc203xx_pci_intrwsevent_initcryptoopencomcnattachuserasymcryptodb_var_rw_intwdc_xfer_putrt2560_set_bssidsdsizeuao_dropswap_rangesys_pwritevudav_lock_miikqueue_scanieee80211_pmksa_findnet_livelockedbwi_rf_off_11g_rev5uplcom_breakusbd_iface_claimedtcp_closeohci_free_stdsd_patternsX_db_search_symbolscsi_initmsdosfs_advlockswcr_idwdog_registerkue_attachpdcsata_chip_mapusbd_free_xferdb_varssys_utimensatfalloclxtphy_cdatu_joindeadproc_mutexdb_breakpoint_freeumsm_methodspfctlinputcomcnprobephys_mapext2fs_pathconfumass_bbb_methodssoft_intrqdeflateSetDictionaryufs_lockcomintrboot_eaddr_validsys_accessem_read_mac_addrnsphy_statusuvm_swap_iouserconf_initbwi_phy_init_11art2560_ioctlkillpg1url_tx_list_initwsmouse_mux_openi80321intc_attacharpproxyvputonfreelistuhci_device_ctrl_transferwdioctlext2fs_mountrootobio_printpciide_mapregs_compatumodem_methodsieee80211_findrateregyearem_update_stats_countersurl_ioctlpage0setrunnableaxen_miibus_statchgpool_do_putuvm_pmr_getpageswi_set_ssidcue_ioctlnd6_prefix_onlinkugen_seltrue_filtopsffs_specvopsumct_intrcue_attachelf32_read_fromosversionticks_per_intrem_free_receive_structuresatu_get_mibhid_is_collectionwi_usb_tx_list_initfind_pfxlist_reachable_routerip6_pcboptstvtohzieee80211_get_eapol_keyphtree_RB_NFINDratecheckin_rtchangevfs_syncwaitrt2860_tbtt_intrudav_ifmedia_statusaue_crcffs1_reallocblksieee80211_node_lateattachcansignalhotplugpollem_link_stall_workaround_hvrt2860_suspendmsdosfs_check_exportbwi_fwimage_is_validieee80211_up_to_aclf_setlocknbigpipecue_devsin_controlieee80211_get_addba_respbwi_regwin_inforlphy_funcswsmux_srcopslmaxuvm_pagecopyphtree_RB_NEXTsysctl_quadsys_readexec_process_vmcmdskue_tx_list_initrt2560_update_promisccmd_chip_mapehcixferieee80211_tree_RB_FINDi80321_bs_tag_templateucomioctlmbstatuhci_remove_ls_ctrldcphy_statusuhidev_intrttyinfodb_flush_lexttyinohci_root_ctrl_donegetnulldevispidtakendb_dmesg_cmdpciide_dma_initsr_meta_save_callbackbufcache_getcleanbufextent_destroydb_lpenc_xform_rijndael128if_group_egress_buildloop_clonerttsetwatergetcieee80211_addba_requestrt2860_gp_intrsr_raid6_intrifaddr_items_RB_INSERTdb_last_addrural_update_slotuvm_pseg_lcksr_ioctl_volem_clear_hw_cntrscom_obio_matchpmap_enter_pvmsgbufenableduvm_mapent_mkfreeunp_disconnectsys_listensys_mounthotplug_put_eventehci_root_ctrl_donepgsignalehci_waitintrbpf_mtap_etherfirstcdb_read_bytesbwi_constraintuhub_detachrt2560_media_changeieee80211_ccmp_delete_keysr_failioffs_fsyncwsmux_mux_openfintek_attachucom_do_openinetdomainehci_abort_xferscsi_devid_wwnmemcpywdc_enable_intrkthread_exitscsi_req_detachbwi_nrssi_writecue_newbufdisk_constructvfs_unbusyrip_usrrequhci_setup_isocvm_map_upgrade_lnspec_writesiop_wdtr_msgpciide_unmapregs_nativecom_obio_cdkq_timeoutmaxin_broadcastfd_getfilesr_sensors_deletehidkbd_set_ledsmsgbufaddrucomclosesdioctlutsnameip6_setmoptionsexit2dosigsuspendaue_resetkue_open_pipesacer_setup_channelip6_mloopbackext2fs_cgupdateuhci_add_hs_ctrlrt2860_ampdu_rx_startsiop_scsifreeieee80211_send_4way_msg2tcp_update_rcvspacerddumpem_enable_intrcpu_setperfuaddr_rnd_poolufs_lookupsiop_pci_resetugen_attachufs_bmapdoasyncfreeudav_miibus_readregcpufunc_dfarip6_randomflowlabelttpolldegetlogpollkthread_createbwi_mac_set_promiscugen_set_configin_pcbresizedb_elf_sym_initwdc_default_read_raw_multi_2axen_rx_list_initcurrent_ipl_levellogclosesd_vpd_block_limitsieee80211_kdfgeneric_bs_wr_4install_coproc_handlernd6_dad_findohci_rhscudav_detachufs_strategysr_crypto_create_key_diskohci_device_requestkue_watchdogphysical_freeendcopy_statfs_infobounds_check_with_labelarc4_timeoutsr_raid1_assembleumct_opensd_ioctl_cachepci_subclass_networkext2fs_checkpathns_scx200_chip_mapsocantrcvmorepci_vpd_writeuipaq_rtsprocess_poolrt2560_update_ledip6_setpktoptfile_filtopssr_raid6_rwbuf_unmapmsdosfs_renamesysctl_proc_argssiop_adapterpipe_wfiltops__lshldi3purge_detachedpfxrtr_addcd_load_unloadipq_pooluaddr_kbootstrap_destroyaxen_encappmap_activatebuf_dealloc_membmtphy_resetconfig_make_softcpte_l2_s_prot_kruaddr_stack_brk_functionsunp_discardcue_csr_write_1ip6_outputwi_read_record_iouhid_caudav_rxeofrt2661_bbp_readwsmux_get_layoutswap_syscall_lockufs_kqfilterieee80211_newstateums_enablescsi_autoconfcheckdirsexecswsr_raid0_creatert2560_set_txantennaumass_atapi_attachin6_are_prefix_equalin6_controluvm_pmr_rootupdateleapyearsleep_finish_timeoutsys_sigsuspendcd9660_unmountpciide_dma_startehci_device_bulk_abortswcr_authcomputenamecache_rb_cache_RB_NFINDtrapsignalrushjobpmap_devmap_registerrn_inithead0db_single_step_cmdwd_flushcachend_defrouterblf_decfdcloseexecuvm_map_sel_limitsevcount_attachlimcopybio_doreadwi_do_hostencryptscsi_req_probeuvm_mapent_forkcopytcp_timer_rexmturl_ifmedia_changei80321_gpio_pin_writeuftdi_attachsiop_pci_cart_timer_initbpf_mcopy_stripvlansr_crypto_rwuaddr_rnd_createieee80211_next_modeputsaxe_tx_list_initrip6statip6_id_ctxtcp_debxcnpollcd_casys_truncateesigcodeacphy_servicescsi_xfer_poolsysctl_wdogarmv4_tlb_flushIDudav_csr_readohci_add_donert2661_ack_rateem_read_phy_regieee80211_tree_RB_NEXTsched_choosecpu_forki80321_pci_initohci_add_edwdc_xfer_poolcdce_newbufsoacceptkqueue_pollcdgetdisklabeldb_call_depthuaddr_pivot_randomdb_printfehci_device_isoc_doneuhidreadufs_creatend6_freend6_optionscd9660_seekbwi_free_tx_ring64nd6_llinfo_settimersr_roam_chunksmsdosfs_unmountelf32_load_psectiondb_show_all_bufsuftdi_writern_mpath_nextnamecache_rb_cache_RB_MINMAXtaskq_create_threaduhci_device_bulk_transferarm_pcache_unifieddb_add_symbol_tableuhci_remove_intruplcom_setm_tag_nextohci_intr1msdosfs_writecue_resetbs_notimpl_bs_w_1rt2661_amrr_node_free_unusedexec_script_makecmdsehci_rem_free_itd_chainiic_matchieee80211_reset_erpfilt_pipedetachcd9660_rootentropy_add_ptrdb_unaryrgephy_statusiophyattachdisk_attach_callbackselrecordffs_validatert2860_intrcomstopatu_wait_completionaxe_ax88772_initffs1_compat_readrip_outputrrw_exitext2fs_accessbwi_ofdm_plcp_headerrt2560_read_eeprommld6_fasttimeouaddr_rnd_insertkthread_qimaxwsmouse_matchohci_free_seduserconf_pdevuvm_object_printitsr_detachinflate_fastiq80321_devmapmbpoolclock_secs_to_ymdhmsaes_xts_setkeytcp_canceltimerstqphymatchrip_recvspaceroute_initswap_prioritylink_rtrequesttc_setrealtimeclockffs2_reallocblkswdc_get_xferuvm_vmspace_poolbwi_setup_rx_desc32stackgap_initpipe_createsysctl_vnodepdc202xx_setup_channeliodatand6_sysctlsyn_cache_putdoopenatpciide_amd_productspci_subclass_multimediavn_openuhci_freexif_clone_createbufq_fifo_requeuesr_boot_assemblycdce_tx_list_initSHA384Finaluao_detachcpufunc_controlmallocamap_pp_adjrefauth_hash_hmac_sha2_384_192apollo_chip_mapin_pcbrtentryrt2560_get_macaddrknote_dequeuesr_discipline_inituhci_root_ctrl_startuhci_pci_activatewi_cmd_usb__udivsi3re_ifftcp_outflagskqueue_statcdce_ioctlcd9660_rrip_analyzeohci_hash_find_tdexphymatchbuf_fix_mappingbio_unregisterip6_v6onlysys_preadvdb_tok_stringuserretsys_recvmsgpipe_statHMAC_MD5_Finalvn_writesr_hotplug_unregistermtdphy_servicehidkbd_hookup_bellVOP_LINKubsa_devsicmp_inputumass_cdvcountvm_page_zero_enableieee80211_get_sa_queryuvm_vsunlock_devicerd_root_sizein6_delmultistathzenc_xform_cast5route_ctloutputwdog_ctl_cbbwi_nrssi_readsched_idlebio_warnuftdi_get_statuswskbd_cnattachwdc_ata_bio_intrvirtual_enduhidev_get_reportsys_getloginifaddr_items_RB_NEXTbuckstring_inituhci_free_std_chainiq80321_pci_init2icmp6_rediracceptbwi_set_gainsdetruncdb_elf_symbol_valuescopyoutpfindbufq_peekcomconsaddrip_ctloutputuhidev_set_report_asyncwsevent_readenc_xform_arc4bwi_stopbrgphy_5704_a0_bugarp_ifinitdb_write_variableufs_dirbadcd9660_readdirvfs_unmountallrgephy_loopsys_renameatohci_allocxcopyrightsdattachsched_peg_curprocwdc_default_lba48_write_regtcp_timer_keepusbd_devinfo_vpsbsynctcp_mss_updateiopiic_cdphison_setup_channelpciide_lookup_productfree_pagesehci_root_ctrl_startdb_proc_print_cmdrt2560_initrw_enter_readdb_show_all_procsvunmapbufehci_device_ctrl_transferuvm_map_pageable_wireroute_outputrti_deletefreepidsys_geteuiddb_output_positionem_clear_vfta_i350icmpmaskreplin6_pcblookup_listenmsdosfs_mknodttkqfluship6_defmcasthlimsys_munmapsii3114_dmactl_writeaxen_stopkp_nonefilt_solistenvsnprintfrt2860_node_leavepte_l2_s_prot_urarplookupuvm_map_pageablechainallocuplcom_methodssw_reg_startpmap_copy_page_xscalesr_ioctl_deleteraidifmedia_baudratei80321_calibrate_delayem_82547_tx_fifo_resetusbd_setup_default_xferuvm_pagelookupsoshutdownuserconf_hist_cmduftdi_cduserconf_listproc_cansugidcd9660_rrip_getsymnamedb_command_tableip_mloopbackbwi_rf_get_tp_ctrl2bpf_iflistKQREFwdc_downgrade_modeieee80211_node_leaveip6intrqaxe_newbuftodr_handlend6_rs_inputscsi_activate_buspciide_mapreg_dmasoabortm_free_unlockedem_82547_move_tail_lockedem_get_bufcast_encryptunp_inotaskq_threadbwi_default_led_acthidkbd_attach_wskbdlogkqfilterdb_extent_print_cmdip6_init2uprintfdb_clear_single_stepsensordev_installrandomiduvm_page_printitmainbus_cai80321_local_dma_initcoredump_elf32rt2560_intrif_rxr_initsoftdep_flushworklistsys_issetugidinitclocksbwi_rf_attachcd9660_mmapif_detachaue_watchdogwsmuxopenwdc_ata_bio_startnd6_cache_lladdrcatqsession_poolugl_txeofunp_connectuvm_pagermapiniic_smbus_read_byteif_detached_startpool_serialugl_ioctlxscale_cache_flushD_SEscsi_probe_lunaue_ioctlirq_entryvfs_mountedondb_expressionboard_powerdowncputypert_lookupfc_lookup__bss_start__rn_mpath_adj_mpflagif_downndqbVOP_GETATTRuhci_root_ctrl_methodsieee80211_fix_ratebwi_get_pwron_delaysiop_add_reselswip6_mtudisc_timeoutwihap_deauth_reqieee80211_node2reqwi_usb_matchelf32_check_headerrt2661_bbp_initdb_historygf_logeephy_cdinphy_cdttytstamprt2860_mcu_bbp_readural_set_txantennaieee80211_node_allocieee80211_crypto_detachpmap_unwireip6_auto_linklocaluvm_pageunwirerti_fillHMAC_SHA256_Inithw_serialehci_device_intr_abortauth_hash_hmac_md5_96autoconf_attdetufs_chmodbufq_nscan_resortcdattachuserconf_devicebwi_rf_off_11abwi_pci_wakeupsys_sigaltstacki80321_i2c_casii3114_dmatbl_writeDES_versionbrgphy_resetsoisdisconnectingdevice_mainbusauth_hash_key_sha1Blowfish_initstatesched_steal_procwi_media_changenull_decryptsyn_hash2rttimer_queue_headarm_pdcache_sizeexphy_capcidetachucom_dtrrtredirectuvm_map_printitdb_read_variablesoftintr_initieee80211_setkeysdonedb_regsdb_stack_dumpuvm_pmr_pnaddrttymodemdb_lbuf_endehci_free_itdmtx_enteraxe_devskqueue_poolvntblinitbuf_rb_bufs_RB_INSERTcpuset_intersectionem_lookup_gcubwi_rf_tssi2dbmAES_GMAC_Setkeysleep_queue_initpmap_preferin6_ifattach_linklocalVOP_REALLOCBLKSuhci_globalresetE_abs_tag0_Usedtcr1_get_timecountugenwritesys_setresgidsr_crypto_encryptuvm_pmr_freepagesieee80211_input_bamsdosfs_sync_vnodesplassert_failarm_picache_waystty_initaxe_ioctluvm_km_freesys_killrn_mpath_repriouserconf_numberperflevelcomconsiohpmap_set_pcb_pagedirem_watchdoguvm_pmr_addr_RB_NFINDrt_setmetricssys_getegiddb_set_single_stepuvm_objtree_RB_FINDsw_reg_iodone_internalhidms_detachem_check_mng_modeserverworks_setup_channelumass_init_insystemfrag6_deletefraghdruaddr_destroyem_validate_eeprom_checksumdirchkifaddr_items_RB_FINDexphy_resetipip_outputpipecloseVOP_REMOVEpci_mapreg_typeconsinituvm_pmr_isfreeurlphy_statusext2fs_dirremoveuvm_vnp_uncachesysctl__stringffs_clusteracctconfig_detachmtdphyattachifaof_ifpforaddrcryptop_poolsensordev_listsr_checksum_printhidms_ioctlsc_pld_shminidatacleanrt_timer_queue_destroysr_meta_probewi_cdsd_cduvm_pseg_geticmp_mtudiscipport_hifirstautoieee80211_tkip_delete_keysys_fstatem_read_eepromufs_itimesenc_xform_3desrgephyattachuserconf_enablepte_l2_s_prot_uwext2fs_vinitdb_endlpuplcom_intrumass_bbb_resetffs_alloccgbuf_object_storecryptodevallowsoftsmsc_wait_for_bitsobio_foundgeneric_bs_w_1sa6_anysys_getpriorityatu_radfirmpci_subclass_cryptosysctl_diskinitsr_concat_discipline_initE_ldsa_abs_reselect_Useduvm_km_vallocieee80211_send_mgmtcue_getmacnatsemi_chip_mapbrgphy_bcm5421_dspcodescsi_xsh_delrt_mpath_nextscsi_plug_probesys_unmountsr_meta_native_probeuvscom_dtruipaq_detachbootdvelf32_probesumct_detachin6ifa_ifpwithaddrvgonelpciide_jmicron_productscrypto_taskqsofreebwi_amrr_timeoutbwi_rf_lo_findnd6_dad_timerbwi_led_newstateuaddr_rnd_destroyinphyattachcpuset_unionbwi_init_tx_ring32uvscom_shutdowndb_del_symbol_tabledb_add_exprsiop_timeouteephy_matchpmap_removebpf_mtap_afrt2860_set_basicrateshidkbd_parse_descicmp6_fasttimouvm_pmr_addr_RB_INSERText2fs_removemtx_initif_clone_destroyehci_close_pipebwi_regwin_enablewdccommandvmcmd_randomizebpf_setfuserconf_historypciide_pci_capci_disable_legacy_vgauvm_page_unbusyfilt_hotplugreadbwi_rf_lo_isusedtk_noutusbpalockext2fs_mountpmap_collectBlowfish_expand0stateuhci_check_intrukbd_enableuvm_map_addr_RB_PREVdb_symformat_elfwdc_xfer_getpciide_compat_intrgeneric_bs_rr_4cpu_sysctlcd9660_deftstamphotplugkqfilteri80321intc_smaskzlibCompileFlagsip_randomidbrgphy_eth_wirespeedaue_tx_list_initnettxintrieee80211_recv_disassocnosuidcoredumpukphyattachcddumpdb_search_cmdastusbd_claim_ifacetcp_disconnectuvmspace_execuhci_timeoutwi_usb_detachwsmux_createsys_mmapehci_bus_methodsbootnd6_is_addr_neighborblf_ecb_encryptunp_rightshostnamedb_print_llinfodisk_closepartcmd680_setup_channelpci_enumerate_busbrgphy_fiber_funcsem_set_eee_i350em_disable_pciex_masterupl_outputi80321_intrext2fs_bmapuvmexpnextstateventenc_xform_blfbufq_donesr_crypto_dev_rwehci_detachsensordev_getufs_diremptyreinsertfinishduprt2661_newassocsleep_setup_timeoutbrgphy_crc_buguao_grow_hashukphy_serviceqsphy_resetsmsc_stopdeflate_decompresspool_destroylogwakeupshutdownhook_listhidkbd_attachip_dosourcerouteieee80211_node_join_rsnsoread_filtopsgcu_miibus_readregieee80211_media2ratedmapoolsbdevsw_lookupdisk_changebwi_mac_resetuplcom_matchamap_lookupsdoreallocblkscache_revlookupamd756_setup_channelbpfread_filtopssoinituvm_mapent_isjoinableem_get_speed_and_duplexuvmVOP_MKNODnd6_ifdetachin6_ifaddrroute_protofilt_ugenread_isocsync_vopshw_uuidext2fs_truncatere_newbufcd_play_tracksscsi_do_mode_senseuvm_pmr_allocpmrip6_maxfragpacketsdb_errorehci_confdprefetch_abort_handleruvm_km_threadsr_checksumem_rxeofuhci_root_intr_methodsscsi_probe_buslminm_leadingspacesys_fpathconfwsmuxpollarpt_pruneohci_device_bulk_methodsem_copper_link_postconfigkp_zerosoconnect2knote_poolcnopensiop_scsiprobenatsemi_setup_channelscsi_test_unit_readyural_set_bssidricohrtc_reg_writenmbclustural_get_rfsominconndma_freert2661_mcu_wakeupuhci_device_clear_togglesoftraid_cduvm_vnp_syncem_transmit_checksum_setuppool_allocator_large_niieee80211_get_disassociopxs_cdwihap_assoc_reqarpt_downrdgetdisklabelarm_pdcache_line_sizebpf_tapnthreadsdb_lookupuvm_pmr_addr_RB_NEXTrt2860_tx_intrnumnegpciactivatemii_phy_autouvm_pmr_addr_RB_FINDuvm_mapent_free_removemsdosfs_initohci_device_ctrl_startwi_write_record_ioext2fs_writelf_clearlockbwi_rf_set_ant_modegeneric_armv4_bs_wr_2uvmpd_scan_inactivedb_lastsymsiop_resetbusurl_memip_srcrouteuhidioctlieee80211_recv_4way_msg4pte_l1_s_cache_masksys_setregidusbd_device2interface_handleurl_csr_read_1cpuset_infosusbd_dopollvinvalbufsys_ftruncateuhci_device_isoc_startbwi_rf_map_txpowerubsa_dtraes_ctr_cryptm_splituhci_remove_hs_ctrlsoftintr_disestablishentropylockbufcache_getdirtybufumodem_ioctlurl_stoptcp_timer_initdb_tab_stop_widthdb_putncharstuagg_unlockedsii3114_dmactl_readnd6_maxnudhinttcp6_inputsosetoptkp_dirtyehci_set_qh_qtdtcp_mssrt_sendmsgifa_addcache_purgeudav_stop_taskusb_detach_roothubbpf_mcopycomconsrateauth_hash_hmac_sha1_96uaddr_pivot_insertfork1db_activevfs_hang_addrlistpci_primary_vgacue_tickdead_writeufs_dirrewriteinsmntquettreadtk_canccdb_write_bytesrt2860_media_changeext2fs_blkfreeudp_outputfind_last_setsoftraid0rt2661_set_chansys_chmoducomreadprelist_removeuvm_objtree_RB_NFINDuao_shrink_arrayffs_vgetrt2661_tx_intraxe_encapsr_bootuuidip6_getpmtu__umoddi3bcstatsbrgphy_fiber_statusarm_dcache_alignvm_map_downgrade_lnugenclosert2661_media_changeip6_log_intervalnull_encryptsched_idle_cpuswihap_auth_requgl_newbufscsi_activate_lunuvm_page_physdumpuvm_atopgX_db_sym_initmaxprocesssyn_cache_timerieee80211_auth_opensolisten_filtopshfsc_dequeueatu_internal_firmwareprocess_kernel_argsin6_update_ifa__wdcerrorSHA384Updatecdce_detachrt2560_tx_intrehci_alloc_itdrt_msg2suser_ucredmem_noext2fs_buf_allocbufbackpagesral_pci_matchatu_xfer_list_freeuhci_free_stdwihap_sta_deletepciaddr_resource_reserveuaddr_kernel_functionspmap_free_l2_bucketRMD160Update_intrevarprequestmsdosfsreadwrite_filtopsrrw_enterkernel_mapuhci_device_isoc_enterwi_init_iodumpdevwsmouseioctlcd9660_lockusbd_ref_incruvm_mapent_forkzeroieee80211_mgt_subtype_namegf_powbwi_led_eventugen_do_readdb_not_taken_bkptm_printpciide_unmapreg_dmauvm_pmr_splitvfs_mount_foreach_vnodekqueue_kqfiltertimeout_add_usecsr_raid5_set_chunk_statewi_mgmt_xmituhid_do_ioctlzeroin6_addrstrncasecmptimer_filtopsatu_tx_startuvm_objwirert2560_encryption_introhci_device_bulk_starttcp_mss_advSHA512Update_intin_ifaddrnd6_optionwin2unixfnmax_hdrffs_readm_freephtree_RB_FINDbwi_mac_hostflags_initaes_key_wrapurlphy_attachieee80211_get_assoc_reqsr_meta_attachsr_meta_native_bootprobescsi_inqmatchfdesc_poolcmd_pci_intrpool_page_allocsr_switchin_pcblookupm_tag_delete_chainfilt_pipewritecd9660_polliicprobencugl_detachbadaddr_read_4bzeroumass_scsi_probearmv4_drain_writebufswapdrum_addufs_closedefrouter_delreqfixjobcuvm_pmr_size_RB_REMOVEdb_show_all_cmdspci_subclass_daspscsi_devidin6_addmultirn_newpairsysctl_proc_nobroadcastkillbios__udivdi3sys_obreakblf_setkeyusbd_set_config_norgephy_cdieee80211_pmksa_addpciide_cdlastddateucom_do_ioctluvmfault_unlockallsr_meta_getdevnamem_inithdrpmap_curmaxkvaddruvm_pmemrange_addr_RB_NFINDin6mask0bpf_validateusbd_get_string_descvaccessuao_set_swslotsys___thrsigdivertsys_getdtablecountmbinitsr_errortcp_secret_ctxusbd_get_reportabortwskbd_default_bell_datascsi_readsafe_cmdieee80211_set_link_stateamap_allocVOP_LOCKbuf_rb_bufs_RB_INSERT_COLORMD5Finalwskbd_matchcp_timeaxe_rxeofcd9660_vget_internalrt2560_decryption_intrdb_page_print_cmdwi_intrrw_casvgetrd_attachkd_nowaitugenpollieee80211_create_ibssbrgphy_jumbo_settingswsmouseopenwinChksumbufq_requeueserverworks_chip_mapfreeclusterchainmld6_initswapmapscsi_get_linkdisk_initrt2560_wakeupSHA256Updateohci_bus_methodsohci_hash_rem_itdatu_cdrip6_ctloutputdisk_readlabelpciide_pci_writeaue_sendusbd_getnewaddrnd6_na_outputext2fs_fhtovpsr_validate_stripsizeumass_cbi_transferext2fs_createieee80211_gtk_rekey_timeoutem_local_timerwi_sync_mediauvm_map_teardownpipe_pollpool_reclaim_allnsphy_cabmtphyattachucomopensysctl_dopooluhub_matchuvm_mapent_clonetcp_respondsys_readvcrypto_getreqamap_cow_nowroundrobinusbd_get_hub_descriptorbadaddr_readuvm_map_createissignalwdprintsr_attachfilt_uhidrdetachin6_selectrouteieee80211_recv_rsn_group_msg1cdevvprt2560_bbp_writescsi_pending_startuhci_intrbwi_mac_balance_atten_setsoftintrmsdosfs_kqfilterigmp_joingroupuiomoveohci_device_isoc_donewi_usb_wridrespmsdosfs_startlf_alloccpu_idle_leavedb_loop_countwi_intr_ackpciide_dma_table_setupscsi_iopool_getbpf_reset_dem_hv_phy_workarounds_ich8lannd6_dad_stopdiskmapioctlhid_start_parseinflateSyncPointuvm_waitnexecsbwi_init_rxdesc_ring32mclpoolsi80321_mem_bs_mapieee80211_regdomain2namepmap_referencesys_bindrt2661_watchdogloioctlrw_exit_writebs_notimpl_bs_wr_8ieee80211_eapol_key_micrt_ifa_addrt2560_free_tx_ringumct_initusb_abort_taskspmap_bootstrapbs_notimpl_bs_wr_2blf_cbc_encryptsys_mqueryarm_picache_line_sizekmeminit_nkmempagesbwi_rxeofusbd_new_deviceuvm_pmr_size_RB_REMOVE_COLORscsi_iopool_initscsi_io_putuvm_pmemrange_findfillinusemaprecvitbmtphy_funcsums_cdfilt_sowriteuvm_kernacccnpollcsys_linkucomsubmatchuvm_addr_initlog_opensr_rebuild_initfilt_randomdetachuvm_pmr_size_cmpuaddr_free_rbtree_RB_MINMAXfragtbl124userconf_totdevi80321_bs_tagrt2661_tx_cmdxscale_cache_flushIDrt_tablesrt_ifmsgrandomread_filtopsieee80211_plcp2rateumsm_setobio_bs_maprealitexpireipstatunix2dostimert2860_delete_keydounlinkatscsibus_caubsa_attachiic_probe_eepromuvscom_openurl_newbufusbd_delay_msffs_dinode2_poolcrfreecnputcuhid_do_writeip6_lasthdrohci_device_isoc_abortuhub_uhub_caugen_matchtcp_reaperlastnowpool_sethiwatrt2661_tx_datasvwsata_mapreg_dmawi_read_record_usbuftdi_methodswdgetdefaultlabelmicrotimeuvm_pmr_addr_cmprt2560_tx_datapipeunlockuvm_pmemrange_addr_RB_MINMAXuvm_swap_getpciide_serverworks_productsext2fs_reloadrt3090_rf_initurlphy_matchcsefindelf32_copyargsisochariophymatchuvm_km_alloc1siop_cdcdopentcp_usrclosedaue_ifmedia_stsboard_resetphysmemuvn_flushurl_cduvmfault_relockinferiorbwi_rf_calc_rssi_bcm2050ukbd_attachxscale_cache_purgeD_Eclusteralloccryptof_readsr_raid_syncuplcom_capci_dopmrt_if_remove_rtdeletewskbd_attachin_pcbbindumass_cbi_statexscale_cache_flushImtdphy_caudp_notifyuhci_timeout_taskuhci_root_ctrl_closeendtsleepwihap_check_txstrnlensigactsshareuvm_map_freelist_update_refilldb_set_watchpointuvm_map_addr_RB_NEXTbpfattachuftdi_openugl_openpipesif_detach_queuesitimerdecrem_valid_nvm_bank_detect_ich8lanieee80211_get_delbaether_outputpci_cdem_phy_setup_autonegpmap_bootstrap_pv_page_freeuvm_addr_printauth_hash_md5crypto_kdoneinflateGetHeaderbpfilter_lookupm_copym0bwi_led_onoffaxe_miibus_readregvm_physmemiso_shipdirrdwritebwi_txeof_status32ieee80211_node_join_htrnd_timeoutieee80211_parse_edca_paramspipe_ioctlfilt_timerexpireural_set_chanwskbd_enablepmap_devmap_find_vacd9660_mountrootbpf_allocbufsbwi_init_txstats32axen_tx_list_initset_stackptrmsgbufmappedohci_device_setintrrt3090_set_chancomprobe1cdsizedb_symbol_valuesuhci_device_ctrl_startumass_lookupdb_evarssmsc_attachiic_smbus_write_bytebwi_rf_get_latest_tssiwsmouse_mux_closewakeupuao_growgetnanotimeatu_devspciide_matchrt2860_rf_writei80321_mem_bs_mmaptcprexmtthreshkprintf_mutexrt_getifadb_malloc_print_cmdwi_get_fid_ioenosyslockmgrbwi_bus_attachrtlabel_name2idbwi_node_allochidkbd_is_consoleuvm_vnodeopsdb_bcstats_print_cmdvfsconfrt2860_free_tx_ringusbd_detachVOP_OPENcompwroffbuckstringuhci_device_bulk_startrt2860_enable_tsf_syncsiop_scsicmd_endusbd_fill_deviceinfoscsi_interpret_sensesqphy_cdugen_do_ioctlext2fs_flushfilesdes_ecb3_encryptieee80211_send_eapol_keycomconsattachedmallocarraybrgphy_probelxtphyattachwi_usb_txeof_frmufs_readlinkrdopenin6_ifadddoscheckpathsyslogfpcbmapatu_newstate_tr_stored_blocknd6_option_initbufq_quiescebrgphy_servicepiix_setup_channelext2fs_setsizeffs2_balloc__guard_localin6_init_prefix_ltimesnchstatscd9660_fhtovpmsgbufpE_ldsa_abs_selected_Usediq80321_pci_intr_stringsys_setgidrt2860_set_keyuserconf_common_attrfilt_ufswritert6_flushehci_timeout_taskrdcide_udmaclkgeneric_bs_r_4E_ldsa_abs_slot_Usedmmrwffs_bufatoffieee80211_add_ds_paramsem_init_hwiq80321_pci_intr_disestablishwi_usb_rridrespdohooksgf_invem_pci_set_mwiieee80211_rssadapt_choosenprocessesehci_free_sqtd_chainem_disable_intrukbd_activatesiop_sdpif_detached_ioctllocnamppsegswi_usb_casch_chip_mapuserconf_showbwi_next_scanip_mtudisc_timeout_qsr_raid5_assemblesr_scsi_cmdaddress_exception_entryffs_fhtovpgetvnodefilt_ufsvnodecrypto_get_driveridbwi_mac_updateslotpool_setlowatkmembaseswi_entryrip6_inituvm_aiobuf_poolisofncmpsysctl_emulseltrue_filtopssys_sigprocmaskdb_commandrt2661_select_bandin6_if_upfilt_pipereadenc_xform_aes_gmacsoreservedb_formatrt2560_reset_rx_ringuvm_mmapusb_activatescsi_report_lunsufs_quotactldosymlinkatuvm_map_uaddraroundin6_pcbnotifyifaddr_items_RB_REMOVEbrgphy_5708s_funcsusbd_clear_endpoint_toggleexplore_pendingstrrchrgetdevvpm_clgetpci_mem_finddefrouter_selectamap_unrefext2fs_statfsbpf_mtap_hdrcrdupamap_wiperangecuio_copybackisodirinodb_strlcpycfrootswsmousepollchrtoblkscsiprintsiop_get_lunswuserconf_pdevnamminphysukbd_matchurl_ticksys_fchownatrtalloc_noclonetimeout_mutexether_addmultiieee80211_recv_actionpci_powerdowncdce_cdffs_vptofhvfs_isbusyifunitirqstackbawritetputcharsvwsata_dmatbl_writewskbd_detachpmap_postinitcsedeletepool_print_pagelistffs_fragacctrt2661_rx_tuneffs1_ballocsys_fchowndcphy_attachuvisor_methodsums_activateinflateInit_SHA384Update_intdb_breakpoint_cmdvwaitforiomii_phy_tickcd_read_subchanneluao_shrink_flushflsextendfilelortrequesticmp6_inputbuf_valistuserconf_addohci_device_intr_methodswi_func_iocreatedefilt_randomreaduvscom_closebwi_regwin_nameieee80211_michael_mic_failuresbreleasedb_history_sizein6_selectifmsdosfs_islockedmax_linkhdrem_dma_freeumass_attachcryptof_statwdc_xfer_iopooludav_resetget_stackptrsysctl_rtablemsdosfs_reclaimbwi_set_chanbwi_rf_calc_rssi_bcm2060wdc_free_queuesqphy_serviceuserconf_hist_eocsys_readlinkatbrgphy_reset_bgei80321_intr_disestablishuvm_objtree_RB_REMOVEext2fs_getattrrtlabel_id2namesbdroprecorduvm_coredumpem_write_phy_regi80321_handlerwdsizenamecache_rb_cache_RB_REMOVEacphy_statusip6_sysctlsuserdiskconfural_tx_dataatu_get_card_configvn_syncer_add_to_worklistusbd_get_interface_descriptorgeneric_bs_rm_1tk_ninsysfilt_opspciide_mapchanclusterfreefilt_randomwritesr_warnsr_raid_intrrt2560_beacon_expireieee80211_alloc_node_helperrootdevehci_device_isoc_startm_tag_firstem_82547_move_tailcdmatchpmap_map_entryusbd_get_config_descriptorpfxrtr_delpciide_machdep_compat_intr_establishdumpsysicmptstampreplif_detached_watchdogcy693_setup_channelrip6_sysctlext2fs_fsyncdoforceuhci_root_intr_startsys_fsyncwi_usb_stopuserconf_add_readsr_crypto_writere_pci_probeusbd_reset_portrt2661_set_macaddrifconfsiop_led_onpciide_pci_intramap_wipeoutuser_configcast_setkeytcp_outputnsphyattach_bus_dmamem_mmapi80321_attachupdate_ledsext2fs_updatetcp_timer_2mslaue_openpipesi80321_gpio_initffs_reload_vnodebuf_putmsdosfs_setattrVOP_RMDIRwdog_tickledb_delete_breakpointsr_ioctl_installbootif_addgroupciphy_cdieee80211_setmodeuhid_matchieee80211_add_ibss_paramspool_allocator_freefilt_proceopnotsuppumodem_paramem_rxfillffs_reallocblksphtree_RB_INSERT_COLORrandomcloserootvpaxe_miibus_writereguvm_pmemrange_addr_RB_NEXTugen_do_writeieee80211_eapol_key_decryptuserconf_maxlocnamespool_reclaiminitdisklabelpci_subclass_serialbususb_quirksbpf_sysctlvflushehci_openieee80211_bip_encapcddetachpmap_clear_modifytcpctl_varsarptimerbufq_dequeuetcp_reass_limitruaddsys___set_tcbrdstrategym_copymsystemsbcopy_pageip6_freepcboptsdb_free_breakpointsif_upcoredump_notes_elf32piixsata_chip_mapumsm_catimeout_add_nsecehci_intr1rt2860_enable_mrruvmfault_lookupm_extfreergephy_resetupl_intrucomprintural_matchdeflateBoundVOP_BWRITEbufq_fifo_peekrt_timer_queue_createwddonemsdosfs_ioctlpciide_dmatbl_writeupl_matchrt2560_stopno_constraintsys_opensr_crypto_change_maskkeywdc_alloc_queuergephy_funcsusbd_match_deviceinet6domainural_enable_tsf_sync_bus_dmamem_alloc_rangeether_crc32_be_updatepgdeletert2560_next_scanuvm_pageidlezerobwi_enable_intrswskbd_do_ioctl_scdead_vopsdb_symtabsi80321_irq_handlerieee80211_media_changeucom_detachuaddr_hint_createraw_attachural_set_rxantennahidkbd_cngetcscsi_ioc_cmddb_boot_sync_cmdastpendingifnewlladdrphison_chip_mapether_ip6multicast_maxpipe_pooluao_initudav_iffrdc_chip_mapifa_ifwithroutespec_kqfiltertcp_notifyieee80211_match_bsscd9660_tstamp_conv7ural_free_tx_listffs_dinode1_poolieee80211_set_keyieee80211_bip_delete_keyem_smartspeeddb_print_positionrtflushclonedb_radixgetblksr_raid_turem_tbi_adjust_statsxscale_cache_flushD_rngmaxsmapwdc_ata_bioip6_mcast_pmtusoconnectrt2860_txural_initvtypesuvm_map_fix_spacenobuffers__lshrdi3data_abort_handler_addressin6_delayed_cksumrtrequest1usbd_errstrSHA256Update_intsr_scsi_ioctltcp_identtcp_rst_ppslimuhci_openbwi_pci_activateem_realignifinitsd_cmd_rw10cd_load_tocunpst_recvspaceuvm_map_mqueryget_ifidsr_infoscsi_io_getkue_initxscale_cache_purgeIDuvm_map_kmem_growraw_inputcd9660_reclaimrt2860_stopkue_ioctlfilt_logrdetachtimeout_add_btnd6_ifattachunpdg_recvspacedofaccessatpipe_closecd9660_inactivesoftdep_mountmsdosfs_rmdirdb_is_activemsdosfs_fsyncre_setup_sim_imcfdatadeflateInit_ffswi_usb_tx_lockusbd_do_request_async_cbufs_checkpathem_init_eeprom_paramspmap_pte_init_xscalepfxlist_onlink_checkdiskmapreaddb_elf_lookupm_tag_findinittodradler32blf_encvputaue_iffpte_l1_s_cache_mode_ptvector_page_setprotworkq_syswqcd9660_setattrfilt_hotplugrdetachbwi_rf_set_nrssi_thr_11busbd_get_configieee80211_node_leave_rsnuaddr_kbootstrapufs_quota_initallocpidkqread_filtopscoredump_writebrgphy_bcm54k2_dspcodeusbd_setup_pipexscale_setttbem_read_part_numaue_csr_read_1xscale_cache_cleanIDbuf_acquireieee80211_beacon_allocatu_attachubsa_get_statusdolinkatbioopscpu_classesieee80211_add_htopbpf_setdlttcp_flush_queuepool_setiplmsdosfs_statfslboltpipe_inituvm_wait_plarn_mpath_priousbd_open_pipe_intraes_gcm_reinitsyncerprocrt2560_set_macaddrifa_print_rbufs_ihashinszcfreein_setpeeraddrinphymatchatu_taskwindow_inflatedb_readlinert2661_enable_tsf_syncether_ifdetachsr_meta_native_readieee80211_recv_probe_requhidev_get_report_descuserconf_histcurrndstatscy82c693_writemsdosfs_inactivepciaddr_do_resource_reserve_disabledpanicstrbwi_set_clock_delaypdc20265_pci_intrupl_newbufumass_scsi_cbscsi_delayext2fs_sync_vnodeif_startunpdg_sendspacesession0bwi_power_offviscpywsmouse_do_ioctlE_abs_lunsw_return_Usedehci_abort_isoc_xferhw_ver__umodsi3copyincomparamsiop_common_resetural_stopudav_sendcd9660_defattrohci_device_bulk_closeehci_reverse_bitsrtalloc1bs_notimpl_bs_sm_8uao_swhash_elt_poolufs_ihashgetdes_set_odd_parityuaddr_pivot_selectsigacts0uaddr_free_rbtree_RB_REMOVE_COLORfindblkmajormsdosfsvnode_filtopsntohlsorflushugen_caiophy_funcsuvm_mapent_tryjoinbwi_phy_config_11gttioctlarpintrqvprintfslpquesr_raid1_wu_doneohci_root_ctrl_methodsttycharssyncdelayuvm_vslock_devicewi_usb_infofrmaxen_ioctlugenreaduvm_pagealloc_multihidkbd_enableffs_mountwsmux_mux_closeicmp6errppslimbadaddr_read_2msdosfs_vopsuhci_add_intrconfig_process_deferred_childrenbufq_waitohci_ifcdieee80211_add_htcapsluphymatchxscale_cache_purgeID_Ebs_notimpl_bs_sm_2in6_setmaxmtuem_camsdosfs_roottqphyattachbpf_getdltlistrt2860_startm_tag_getuvm_map_freelist_updateuaddr_bestfit_insertsb_lockem_enable_tx_pkt_filteringohci_root_intr_abortuhci_polluaddr_bestfit_removert_labelscrypto_unregisterHMAC_SHA1_Finalupl_watchdogsuid_clearttwritedma_alloc_initatu_initem_activatebuf_rb_bufs_RB_NFINDbuflowpagesehci_activatert2661_set_basicratesswapdev_vprebootre_miibus_writereguipaq_methodsaes_xts_cryptieee80211_deliver_datadead_readufs_pathconffile_pooldb_boot_reboot_cmdohci_timeoutbwi_setup_tx_desc32unputcbwi_rf_lo_measure_11gendluphyattachVOP_CREATEcpuset_firstSHA512Updatecdce_stopifai_cmpbwi_rf_set_nrssi_thr_11guvscom_get_statusnd6_recalc_reachtm_intervalpagetables_startin_ifinitohci_device_ctrl_closepciide_mapregs_nativein_pcbhashlookupsys_mknodatem_setup_transmit_structureskp_dmare_eeprom_putbyteural_writeucom_cleanupVOP_ABORTOPehci_pcdcoredump_tradbwi_power_onem_identify_hardwaredofchownatsr_wu_done_callbackuhci_idoneuvscom_set_line_codingdefault_chip_mapsys_acceptuvm_map_entry_kmem_pooluvm_pagerealloc_multiieee80211_wep_decryptbwi_rf_calibvalwi_inquireehci_pci_takecontrolleradm1032cloneprobeuaddr_bestfit_pooltcp_rst_ppslim_countieee80211_recv_assoc_respieee80211_parse_rsn_bodyukbd_detachaes_key_wrap_set_keyif_clone_listtc_windupsys_futimesrt2661_update_promiscsdgetdisklabelsysctl_proc_cwdbwi_intrwi_do_hostdecryptsiop_table_syncinternal_commandpci_subclass_wirelessuvm_map_boundarymalloc_errintvlbwi_phy_init_11b_rev5ciphyattachin_losingsis_chip_mapaxen_rxeofVOP_SYMLINKgeteblkrt2661_suspendrt2661_detachusbd_set_interfaceem_force_mac_fcscsibusmatchinflateBackInit_crypto_kregistervn_ioctluhci_remove_bulkwi_usb_ctl_lockufsspec_readdb_show_calloutrt2661_set_txpreambleaxe_cdpipespacefiqvectorget_last_resort_ifidohci_alloc_stdcmd646_9_irqackip6_sendredirectsbwi_initcast_decryptddb_sysctlbwi_startukphy_caitimerfixip_stripoptionsieee80211_node_join_11gbwi_init_statechgsyn_cache_countuaddr_stack_brk_createieee80211_add_xratesnd6_timer_chugl_rxeofuvm_pseg_releasecpu_resetudav_ticktcp_ctlinputether_multiaddrstart_cleanerffs_blkfreeexit1ohci_detachbwi_mac_adjust_tpctlwsmouse_add_muxbdevvpifa_ifwithdstaddrehci_cdi80321_bs_mapuaddr_bestfit_selectuvmspace_duseddb_watchpoint_allocudav_ifmedia_changeselectroutein6_nigroupscsi_mode_sense_big_pageauth_hash_sha1sys_mkfifoatuihashrijndaelEncryptscsi_ioh_deltcp_keepintvluvisor_detachcdwriteufswrite_filtopsttybgconfig_searchphtree_RB_PREVwihap_sta_findusbd_printuvm_km_valloc_prefer_waitsyn_cache_poolpci_subclass_mass_storageffs_allocaue_tick_taskdb_preveephy_funcsinphy_funcsucom_hwiflowrgephymatchbswap32ipsec_exp_first_userlphy_servicenet_livelocksplimit_poolip6_defhlimumass_setup_ctrl_transferunp_connect2usbd_set_pollingrn_walktreepool_prime_pagepciide_ite_productssys_chownpciide_rdc_productsuvm_pagewirebwi_calibrateem_stoppci_vga_pciin6_joingroupsys_munlockhotplugattachinflateBackuvm_anfreeuhci_bus_methodsrt_ifa_deldofilereadvipip_sysctlbs_notimpl_bs_sr_1vn_statfilerw_exit_readieee80211_iterate_nodeswi_intr_enabletablefullumct_set_line_stateuhub_exploreupl_txeoftcp_maxidlevfs_getcwd_commonset_cpufuncscttyioctlsys_lstatieee80211_recv_wpa_group_msg1ieee80211_recv_addba_respohci_timeout_taskohci_hash_add_tdieee80211_tkip_set_keyiso_uiodircttykqfiltercttyopenpmap_link_l2ptinet6ctlerrmapbwi_bbp_power_onicmp6_redirect_diagdisknamessched_queued_cpusumass_quirksdumploRMD160Updatemsdosfs_mountacphy_funcsffs_clusterallocbwi_calc_rssinullcnpollcuvm_km_inituvm_objinitbwi_hostflags_readpciide_acard_productsbzero_pageffs_sbupdateudp_sysctlsys_openatbs_notimpl_bs_wm_1vmmapbsyusb_add_taskurl_int_miibus_readreguserconf_histlendb_list_breakpointsbufcache_initrt2860_alloc_tx_ringrt2860_updateedcankmempages_minukbd_accessopsusbclosesis96x_setup_channeludav_matchvector_pagekq_ntimeoutssys_sched_yieldvmspace0bwi_phy_clear_statescsi_decode_sensettywaitwsmousedevprintuvm_map_setuptcp_syn_cache_sizewdc_default_vtbluao_grow_arrayieee80211_add_tieuvm_uarea_allocem_defer_attachetextifa_ifwithnetmemchrohci_device_ctrl_doneqsphy_statussqphyattachpte_l2_s_cache_maskcomp_algo_lzsieee80211_recv_barrn_link_dupedkeysysctl_cptime2scsi_mode_sense_pageboot_argspipelockumass_scsi_setupproc_pooluplcom_dtraue_intrudp6_inputsys_writert2661_next_scandb_get_valueural_set_txpreamblegeneric_armv4_bs_rr_2sb_maxusbd_fill_iface_datacd_set_pa_immedsr_uuid_print__bss_end__ip6_insertfraghdrcnstopextent_print_allihashtblieee80211_set_shortslottimesys_dup2em_phy_resetdb_inst_countdb_read_linesiop_productswd_get_paramsbread_clustersys_readlinkbwi_rf_writert2560_setup_tx_descext2fs_size__ashrdi3bs_notimpl_bs_mmapzErrorohci_intrxscale_cache_flushI_SEcrc32ip6_auto_flowlabelsvwsata_mapchanuipaq_cafintek_worklistdevid_copylf_splitifafreeVOP_STRATEGYtimeout_add_sectzucom_rtsxscale_cache_syncIrip_sendspacecoredump_writenote_elf32uhidev_writeusb_generic_tasksxscale_cache_cleanID_rngamap_addtcp_freeqif_setgroupattribsuhci_device_requestcom_attach_subrsii3114_dmacmd_readdvd_authrt2560_node_allocexphy_servicesiop_maumass_scsi_cmdcdreadrt2661_get_rfrt2560_enable_tsf_syncspec_inactiveehci_device_intr_starthidms_setupwi_func_usbwsmux_do_ioctlsys_sendtoicmperrppslimgeneric_filtopsknote_dropuftdi_setcue_watchdogin6_selectsrcrd_casoftclock_siem_82547_fifo_workaroundwi_usb_threadugl_watchdogsr_ccb_putin6_pcbsetportalldevsbwi_vendor_led_actrt2661_iter_funcwddumpicmp_do_errorvmcmd_map_readvnsmsc_initrandom_startcomconsfrequsbd_get_interface_altindexamap_extendsigpropvmapbufumass_scsi_switchi80321intc_intr_initdehashtblsocketopssiop_pci_matchscsibus_bioctlX_db_sym_numargsnd6_maxndoptuvm_map_clip_startffs_fragextendtcp_always_keepaliverawcbtablespec_readumodem_cdunp_markacphyattachdes_key_schedicmp_mtudisc_timeoutnwsmuxpmap_zero_page_xscalettyread_filtopsuvm_maprdc_setup_channeliic_printgetinoquotabrgphy_5708s_statusscsi_do_ioctlrtable_existsdisk_lock_nointrehci_free_sqhcd_resetX_db_foralluhci_pci_cascsi_ioh_addext4_ext_find_extentbwi_mac_reset_hwkeysscsi_detach_busudpstatroute_inputsetrootcd_read_tocural_amrr_updatecdioctlieee80211_defrag_timeoutbufq_switchcue_stopuvscom_detachifmedia_addatu_usb_requestfrag6_queuelxtphy_funcssr_matchusbd_set_config_indexlogopenluphy_serviceieee80211_add_rsn_bodyrt2560_txtimern_del_radix_masksr_raid6_initrt2661_rxratecd_buf_donescsi_devid_pg80breadntcp_hdrszscsi_devid_pg83tcbtableieee80211_recv_4way_msg2i80321_mem_bs_init__xordi3frag6_drainuvm_objtree_RB_REMOVE_COLORdosdiremptyigmp_slowtimoifpromiscre_disable_sim_imip6_setpktoptsfork_returnsys_getsocknamecd9660_lookupsr_concat_initricohrtc_cawi_usb_intrusbd_alloc_bufferinflatePrimemask_rnheadsw_reg_iodonepte_l2_s_protoufs_roottcp_sysctlVOP_SETATTRsmsc_chip_initpmap_kremovesigactsinitohci_pci_caffs2_blkprefdomknodatusbd_set_reportcpu_kcore_hdrexec_elf32_fixuprt_newaddrmsgvop_generic_lockcomconsiotuvmfault_anongetconsttybwi_detachural_bbp_readsr_ioctl_diskusermountext2fs_dirrewrite__ucmpdi2vn_closefilepci_findvendorumass_discoip_mtudiscvfs_free_netcredem_power_up_serdes_link_82575mld6_start_listeningcpu_mainbus_cakue_matchpmap_kenter_papidhashtblaue_match_nrssi_thresholduvm_mapent_forksharedm_pullupenterpgrpxscale_tlb_flushID_SEcrypto_freesessioncnbellm_copydatabufq_nscan_requeueuvmfault_initatu_stopcd_setchanieee80211_get_probe_reqmtx_leavefilt_signalsigactsfreert2560_free_rx_ringwdc_default_write_raw_multi_4ttymallocupl_attachums_intricmp6_notify_errorieee80211_recv_probe_respbs_notimpl_bs_sm_4pcisubmatchkue_setmultimmioctluaddr_free_rbtree_RB_NFINDuvm_coredump_walkmapdb_nextumass_matchsched_choosesendsigohci_device_ctrl_methodsbpf_ifnameohci_cdural_ioctlsmsc_iffvfs_busytimecounterfilt_ufsdetachbufq_initlf_getlocksr_raid6_xorpsolistenpdc205xx_drv_probewskbd_compose_valuespec_getattrpciide_dmactl_readobio_bs_unmapiic_scanl1_lru_lockip_ecn_ingressmsdosfs_bmaprip_ctloutputffs_vtblif_getgroupieee80211_parse_rsnpool_debuguserconf_morekqueue_ioctlmax_processesem_free_pci_resourcessys_wait4rip6_recvspaceamap_share_protectieee80211_bar_tidfs_sysctlukbd_cnattachieee80211_ibss_mergeboot_filefilt_sordetachknote_activatepsignalieee80211_regdomain_compare_cnconfig_pending_incrusb_task_threadbwi_mac_unlockamap_pp_establishauth_hash_gmac_aes_192ieee80211_setkeysuvm_pmr_nextszuvm_anon_initffs_reclaimbmtphy_causb_free_deviceusb_exploreifaddr_items_RB_REMOVE_COLORbufq_nscan_queuexscale_cpufuncsif_link_state_changepmap_virtual_spaceieee80211_add_wpaieee80211_eapol_key_check_micpage0_endieee80211_add_capinfobpfpolluvm_pmr_nfindszupdatepriohci_activateciphy_fixupbwi_mac_lockbmtphy_servicesched_kthreads_createuhci_device_bulk_closeuhid_cdwskbd_cnbellbintimebwi_set_clock_modere_woluhci_intr1jmicron_chip_mappciide_print_channelswi_seekfilt_soreadpmap_remove_allrtable_addrt2860_mcu_bbp_writezeropageipsec_def_encbrgphy_bcm5401_dspcodeffs_nodealloccgbwi_mac_calibrate_txpowersoftintr_establishuvm_pmr_removeip4_input6pdevinit__iordi3uvm_pmr_findnextsegmentinetctlerrmapresetpriorityrt2560_set_slottimeenoioctlrt2860_watchdogwi_usb_start_threadaxen_ifmedia_stsflslbwi_dma_txstats_allocsigacts_poolpcaled_matchexecsigsconfig_initskip_fcicmp6_redirect_inputbuf_rb_bufs_RB_REMOVE_COLORrw_enteraue_read_macpciaddr_print_deviduvm_addr_destroysr_raid0_inituvm_pmr_size_RB_MINMAXdb_access_abt_spnd6_ra_inputffs1_blkprefin6addr_loopbackuvm_objtree_RB_MINMAXttypenduvm_swap_freepagesqsphymatchnd6_dad_starttimerin_revarpinputstrlcpyuaddr_bestfit_destroyX_db_symbol_valuesiopiic_attachehci_device_isoc_methodsumodem_setusbd_reload_device_descsmsc_read_regaxen_newbufext2fs_advlockknote_fdcloseusbd_get_devcntehci_device_intr_doneem_get_pcs_speed_and_duplex_82575if_clone_detachpipe_rfiltopssiop_dmamem_allocubsa_openin6_cksumcomcninitpciide_print_modesstrncmpcsrc_ptedes1_decryptvfs_shutdowngetsockieee80211_get_deauthbwi_newassocbs_notimpl_bs_c_4upl_startsyn_cache_respondif_creategroupllinfo_nd6sbcheckreservepreemptuvm_iobioattachieee80211_begin_scanunixdomaindb_next_free_breakpointbwi_led_attachbwi_tbl_write_2smdscsibusattachugl_devsumct_rtssyn_hash1ulminwihap_data_inputi80321intc_do_pendingdb_last_symtabproc0paddrrn_addmaskifaddr_itemspciaddr_do_resource_reserveusb_attachbpf_bufsizeselscanpciide_promise_productssoo_polluvm_map_uaddr_ertafidx_maxsig_filtopsknote_processexitohci_device_bulk_transferukbd_cdricohrtc_getcalwskbdopenrt2860_reset_rx_ringrt2661_eeprom_readem_startttclosurl_rxeofipsec_soft_allocationssleep_setup_bus_dmamem_mapip6_fragmentnet_sysctlcom_cdbwi_mac_init_tpctl_11bgtimeout_adjust_tickswskbd_do_ioctlxscale_cache_cleanD_Euvm_pmr_size_RB_FINDudv_listdead_ioctlaue_initusb_matchbwi_txeof__wdccommand_startsysctl_iflistvwakeupcmd680_channel_mappci_subclass_bridgeif_clonersrt2860_set_txpreamblewdcbit_bucketvgonewdc_probe_capspmap_initializedtcp6_ctlinputsched_init_runqueuesdb_stack_trace_cmdusb_allocmemsd_sizeufsspec_closend6_prefix_offlinkuvm_anon_dropswapwi_detachucom_lockigmp_inputkmemusageswcr_sesnumlf_getblockpciide_irqackautoconf_attdet_mtxumodem_attachtcp_rttdfltcleanerprocpdc202xx_pci_intrieee80211_parse_edca_params_bodysbappendstreamm_tag_copy_chainrt2661_bbp_writeohci_handoversowrite_filtopssr_chunks_unwindstrncpycseadddb_disasmsdreadsys_pselectupdatefatscue_memata_perrorvfs_getvfssr_alloc_resourcesaue_txeofffs_sync_vnodedeflateInit2_sr_raid6_discipline_initproc_stopvfs_vnode_printdb_history_lastrrticks_initbio_status_initusbd_set_port_featurebpfilter_createsysctl_locklockfpoolwihap_disassoc_reqieee80211_find_nodecpu_switchtoucom_cahtonlsched_all_cpusin6_mask2lentcp_dooptionsdos2unixtimesys_sigactionsr_scsi_donedeupdatusb_fill_di_taskehci_ifcdSHA256Transformrndlock__negdi2in6_purgeaddrcpu_modeluhci_softintrsii3114_read_regarm_dcache_align_maskcttyreadcd9660_unlockpciide_dmactl_writeuserconf_cmdsural_taskbwi_set_bssidiophy_statusschedclockbpfioctlconfig_attachsr_sensors_createohci_alloc_sitdcue_rx_list_initbwi_hostflags_writert2661_attachhookbmtphy_statusdisk_unbusysysctl_fileusb_syncmemuhidev_use_rdescugen_detachi80321_io_bs_freesoisconnectedurlphydebugamap_clean_worksuhci_alloc_std_chainusb_block_freememVOP_PATHCONFumass_fixup_sonydk_mountrootassertwaitokdb_run_modescsi_minphysauth_hash_key_md5siop_script_syncxscale_cpwaitvattr_nullsys_getsockoptrt2661_tx_mgtre_rxeofumct_paramuhidev_attachdb_vprintffrag6_nfragpacketsdb_lineaxen_startsr_raid0_assemblert2860_wakeupbwi_cdpool_allocator_largeuvm_anon_lockloanpgvfs_sysctlite_chip_mapcpu_get_controlVOP_READLINKbuf_mem_initumass_cbi_methodsdb_ed_stylemii_submatchuvmexp_printohci_root_intr_transfermsdosfs_pathconfoldpidstimeout_wheelbwi_pci_conf_readbpf_m_xhalfumass_io_getaverunnablecd9660_getattrttyfreettysleepuvm_pauseehci_root_intr_donert2860_rx_intratu_get_opmodeunp_disposescsi_inquireufs_getattrBlowfish_encipherieee80211_mhz2ieeevfs_exportuplcom_closesr_hotspareuvm_km_pgremoveex_region_plfscalesmsc_matchffs_alloccgblkip_optcopyvfs_registerieee80211_proto_attachsys_dupmcllowatmii_printieee80211_setup_ratesbpfilterattachproc_stop_topci_find_devicetimeout_todoswcr_initdb_lcbwi_updateslotumsm_truinstall_changemodecpu_read_cache_configumsm_detachwdc_sii3114_vtblsr_ioctl_createraidpanicget_pc_str_offsetciphy_resetural_rxeofcue_rxeofL_cksumdatamsdosfs_lockseltruepci_subclass_systembpf_m_xwordscsi_xs_syncieee80211_recv_group_msg2softdep_initializestackgap_allocunp_shutdownieee80211_tkip_encryptwi_resetdovutimensdummy_get_timecountext2fs_sysctlgeneric_bs_wm_4kthread_run_deferred_queuearc4_initwdreadlastdaycheck_execdb_max_linewi_usb_cdtcp_initpte_l2_s_cache_mode_ptdeferred_config_queueciphy_funcsucomreadcbbuf_rb_bufs_RB_MINMAXnetisr_initipport_lastautouhci_endpdsis_setup_channelwsmux_detach_sccom_raisedtrdb_last_commandicsphy_statusip6_pcboptwinSlotCntvn_kqfilterext2fs_syncsched_stoleni80321_io_bs_unmappte_l2_s_prot_maskpciide_intr_flagudav_ioctlcrypto_registercache_purgevfspostsigsys_pathconfcue_open_pipesin_addmultigetmicrotimebs_notimpl_bs_rm_8maxthrsleepumass_clear_endpoint_stallohci_setup_isocaue_newbufscsi_probedevaxe_ax88178_initi80321_i2c_attachtcp_templatemsdosfs_readdb_object_print_cmdieee80211_notify_dtimrt2860_select_chan_groupfintek_write_regohci_initcomopensata_setup_channelusbd_setup_xferauth_hash_hmac_sha2_512_256ieee80211_tree_RB_MINMAXmtagpoolpiix_chip_mapbcopyiic_attachwsmouseclosewdog_autourl_tick_taskbufcache_releasecue_detachusbioctl_bus_dma_inrangekqueue_wakeupip6_unknown_optuaddr_rnd_removetcp_reasssys_getfhext2fs_vgetrt_timer_timerrtbl_id_maxcomcnputcKERNEL_BASE_physSHA1Update_intehci_alloc_sqtdcuio_applygeneric_bs_rr_1axe_resetdefrouter_addreqin6_clearscopebwi_pa_modebwi_pci_cand6_dad_ns_inputuvmpd_tuneusbd_set_addressudav_openpipesffs_setblockipsec_expire_acquirepci_suspendkue_stopicmp6_mtudisc_cloneatu_send_commandinflateResetmemcmpwskbd_init_keymapobio_bs_subregionnamecache_rb_cache_RB_REMOVE_COLORumct_dtrip6_dad_pendingieee80211_rate2plcpmsdosfs_createcd9660_startdb_output_linebwi_get_card_flagsbwi_rf_get_gainscomstartaes_xts_reinitdb_examinecfroots_sizedb_end_linebwi_mac_gpio_finitickadjpool_alloc_item_headeriq80321_irq_mapip6_splithdruvm_map_addr_augmentsiop_clearfifotcp_secret_initieee80211_recv_sa_query_reqsbreserveundefined_initvrecycleem_phy_hw_resetubsa_matchextent_printieee80211_alloc_nodeblf_ecb_decryptcrcopydb_symformatural_newstatewdcloseundefined_handlerssys_revokeural_free_rx_listsysctl_stringsys_rebootuvm_unmap_kill_entryext2fs_specvopsbufpoolproc_finish_waitwdccommandext_dist_code_bus_dmamap_load_buffersigonstackcpu_forkuaddr_kbootstrap_selectwi_write_data_iodb_print_ifattylistwdopenuvm_vslockre_initdeflateResetuvmfault_update_statscast5_setkeypci_ndomainsttyoutputsr_raid5_wu_donekue_caexplicit_bzerocd9660_tstamp_conv17wskbd_calxtphy_statusuftdi_8u232am_getratetqphy_cdcopyaddroutcryptodev_cbumodem_detachcpuset_add_alluhci_root_intr_abortsystqmpVOP_READbwi_phy_calibrateufs_ioctlffs_freefilein6ifa_ifpforlinklocallastdtimegetdisksys_setuidiq80321_pci_init_wdc_ata_bio_startstart_updatesiop_common_attachudav_cdusbd_clear_port_featureusb_abort_task_threadufs_quota_free_blocks2re_stopsenditsr_crypto_decryptudp_detachbufq_fifo_destroyacer_dma_initcluster_writernd_event_tailsr_raid5_createhidkbd_decodeuvm_setpagesizeehci_root_intr_closetcp_xmit_timerrn_add_radix_masksr_raid1_rwucomwritein6_recoverscopensphy_servicebwi_dma_mbuf_create30aue_ticki80321intc_cdtimeout_add_tvticksvwsata_write_regmclpool_warnmsgi80321intc_cascsi_pending_finishdb_termscsi_preventmmcloseieee80211_get_assoc_respcd9660_accesssr_wu_getffs_statfscpuset_complementrijndael_set_keywdcprobeiophy_cdudp_recvspacefdropsr_block_putkm_alloci80321_mainbus_matchgf_initsyn_cache_unreachuserconf_histszsys_getrlimitrt2860_attachhooki80321_mainbus_foundicmp6_errcountbpf_attachdfintek_cdicmp6_ctloutputieee80211_ba_move_windowcpuset_issetsvwsata_dmactl_writeufs_dirremoveumct_setaxen_devsrgephy_serviceieee80211_add_timif_attachsetuppipe_writesr_set_chunk_stateuvm_map_addr_RB_FINDcryptof_pollin_pcblookup_listensbappendm_copybackscsi_remove_linkuvm_swap_puticmpbmcastechoHMAC_SHA1_Initextent_print1db_continue_cmdrt2661_mcu_beacon_expireehci_timeoutbufheadconfig_scanwi_get_nwkeykp_pageablesr_raid6_addiopmap_copy_page_funcripsrciso_nchstatsem_update_eeprom_checksumkue_txeofaxen_lock_miiugenkqfilterural_amrr_startnlineswdb_restart_at_pcdb_sstep_printohci_rem_edether_ifattachinflateSync__wdccommand_doneumass_adjust_transfersignal_initfill_drlistffs_updatedb_print_formatrt2560_tx_bcnwsmuxcloseunix2dosfnspec_advlockmtdphy_cdfragtblraw_sendspaceubsa_cauvscom_breaknulloprt_ifa_delloopre_attachuftdi_2232h_getrateAES_CMAC_SetKeycomdiagextralocunsleepvop_generic_bmapwdprobescsi_xs_getX_db_lookupmtdphy_funcsuipaq_seti80321intc_matchblf_encryptsched_proc_to_cpu_costohci_alloc_std_chainipintrgetnanouptimeohci_pci_detachuhci_pci_detachi80321_pci_attach_hookdes3_encryptmaxdmaprt2661_tx_dma_intrural_alloc_rx_listusb_block_allocmemext2fs_symlinkdb_skip_to_eolip6_savecontroldevice_registerpciide_chan_candisablesr_raid6_set_chunk_statend6_dad_stoptimertaskq_sys_mpq_to_bmountrootsyn_cache_resetdb_inputcharuhci_device_intr_doneuhidev_opendb_boot_cmdsundefined_entryip_initreaddeprocess_read_fpregsohci_freexural_txtimecd9660_rrip_getnameufs_check_exportdes_encryptsysctl_rdintpdc20268_setup_channelcd_interpret_sensein_mask2lenbwi_ack_rateural_eeprom_readscsi_iopool_destroylodirtypagessr_ioctl_disciplineem_probeumct_get_statusfindwin95VOP_WRITEsys_nanosleepre_rx_list_initstart_init_execifa_update_broadaddratu_detachnd6_addr_addifa_ifwithaddrclock_ymdhms_to_secssiop_add_devuhci_root_intr_transferbwi_dma_freebwi_phy_init_11b_rev2db_write_cmdrootduidif_clone_attachuplcom_get_statussys_getfsstatohci_abort_xferbpfopencdstrategynetisr_intrem_config_collision_distnatsemi_irqackdeflatePrimerandomwrite_filtopsnd6_slowtimo_chuvm_km_valloc_alignenc_xform_nulldb_max_widthm_extfree_poolip6_pullexthdrmalloc_printitcpu_idle_enterbwi_regwin_disable_bitscomwriteuvscom_intrbuf_kva_starttuagg_subVOP_RENAMEauth_hash_gmac_aes_128cdclosesys_fchdirsr_crypto_readsysctl_ifqprocess0ieee80211_send_eapol_key_reqrandompidwd_cdurl_initfilt_ttyrdetachrt2560_update_plcparp_inuseuhidwrite_bus_dmamap_destroyvn_polluhci_device_isoc_methodsinet6swrouteswdosdirtemplatemainbus_cddb_uvmexp_print_cmdre_ioctlsys_mincorepdc203xx_setup_channelieee80211_tree_RB_REMOVElastsecondswdog_timeoutpci_probe_devicewsmousedoopenwi_get_txpowerural_plcp_signaludav_stopusbd_error_strslun_switchamphymatchtcp_maxpersistidleudav_tx_list_initspec_ioctlufs_initproc_reparentrt2661_select_antennauvm_exitfc_bmapcallspr_rmpageffs_initcluster_wbuildsr_crypto_createsvwsata_dmacmd_writescsi_ioh_setbootsyncuvm_initaue_attachieee80211_crypto_attachsys_ioctluvm_map_addr_RB_NFINDif_free_sadldb_dotbwi_mac_gpio_initucomstopieee80211_node_joinfilt_bpfrdetachcompress2umodem_openicmp6_initbwi_mac_shutdownbs_notimpl_bs_rm_1disassembleuvm_mapent_free_insertfilt_ttywritepool_update_curpagesiop_script_readhid_end_parsein_setsockaddrcy82c693_readbpf_moveiniq80321_hdlg_irq_mapostypevndbuf_pooluplcom_resetuvm_page_physloadaxe_iffucomstartreset_entryuvm_pmr_remove_1strangere_setup_hw_imwdcresetwdc_exec_xferip6_insert_jumbooptipintrqtuaggsr_raid5_intrusb_frag_freelistip_slowtimordsizerijndaelKeySetupEncbwi_newbuf30rt2860_load_microcodeubsa_rtsip6_nexthdrrtdeletemsg__bss_startumsm_openrt_tab2domdcphy_cdbwi_rf_readpciide_via_productskue_rxeofsiop_attachrijndael128_encryptVOP_KQFILTERukphy_funcssys_msyncdeflate_compresswskbdreadsbappendrecordevcount_detachsd_cabwi_free_txstats64ixp_chip_mapsoftdep_fsync_mountdevinitmsgbufehci_device_bulk_startwsmouse_attachpciide_intel_productsuipaq_dtrmemsetcuio_copydatapipe_free_kmemufs_getlbnsieee80211_get_actionieee80211_sa_query_requestphysiosr_ccb_donein6_selecthlimdb_show_all_vnodesupl_sendwdattachdb_symbol_is_ambiguousmii_phy_delete_mediausbd_set_report_asyncin6_unlink_ifacrypto_kdispatchicmp_mtudisc_clonert2661_rf_writeuvm_pmr_insert_sizesodisconnect_spllowerumct_closesys_setgroupsmainaue_csr_write_2lxtphy971_funcsucomttyohci_device_bulk_doneether_crc32_le_updatemtdphymatchtimespecfixbwi_read_spromaxen_matchsr_raid1_set_chunk_stateuplcom_opensiop_lookup_productuaddr_bestfit_createural_set_basicratesip_flushieee80211_delete_keykue_startre_watchdogsiop_scsicmduvm_unmap_removepmap_alloc_l1svwsata_chip_mapi80321_mem_bs_unmapicmp_errordb_hangmanwsmuxdevsbs_notimpl_bs_sm_1upl_rx_list_inituvm_swap_markbaddes_set_keykqueueopsrt2860_iter_funcsmsc_miibus_statchgvholdbufq_fifo_dequeuepciide_map_compat_intrubsa_parityidgen32db_help_cmdrt_if_removesr_minphysscsi_default_getghash_gfmulusbd_no_quirkrt2560_ack_ratere_read_eepromsis_hostbr_matchuipaq_matchm_adjsr_wu_donemld6_stop_listeninguao_shrinkhotplugioctlsvwsata_read_regpmap_map_chunkextent_alloc_subregion_with_descrppsratecheckkmemlimitbuf_rb_bufs_RB_PREVrt2560_rf_writebwi_ioctlbwi_init_rx_ring32amap_copybufq_drainphysical_endbwi_phy812_valuebwi_rf_calc_nrssi_slope_11bbio_statusuhidpollsched_wasidlesr_raid5_initieee80211_ieee2mhzieee80211_dup_bssi80321_io_bs_mapuaddr_hint_destroylf_findoverlapsr_raid_start_stopfilt_msdosfsvnodebwi_txtimelf_wakelockkv_anydb_sym_numargskue_attachhookdumpconfAES_CMAC_Initwi_rxeofehci_pci_detachbrgphy_cahpt_pci_intruaddr_lin_selectdead_badopbwi_dma_mbuf_destroypciide_dma_finishpool_large_alloc_niblf_cbc_decryptcalcrusys_unlinkdb_cmd_listmainbusmatchin_scrubhostrt_setgatetcp_ack_on_pushpmap_growkernelext2fs_rmdirufs_chowndofchmodatsysctl_intupl_tx_list_inituvm_shutdownkqueue_closepte_l2_s_cache_modeuvn_initstrlcatsysctl_int_arrbs_notimpl_bs_wm_8uvm_map_set_uaddrcdce_matchsoftintr_dispatchdisk_unlockpciide_cypress_productsufs_ihashremtaskq_destroyieee80211_recv_4way_msg2or4cttywrite_bus_dmamap_createSHA256Inittcp_update_sndspacesr_crypto_doneurl_stop_taskpciaddr_device_is_agpsdmatchusb_freememudav_txeofpool_chk_pageproc0cdce_initufs_renameaxe_caext2gennumbersr_bio_ioctlbwi_rf_calc_txpowerudav_attachuvm_map_entrybyaddrsr_already_assembledusbd_get_hid_descriptorrt_ifannouncemsgsoo_readbwi_rf_lo_update_11gwdc_scrub_xferuvm_km_doputpagepciide_vendorspci_get_powerstateufs_opencopyout_statfspmap_modify_pvi80321_intr_establishm_catbwi_free_tx_ring32splxbwi_regwin_switchohci_pci_attachtqphy_statuscluster_collectbufskp_dma_contigsiop_handle_qtag_rejectwi_write_data_usbumass_scsi_minphysuvm_swap_inittcp_nowaue_miibus_statchgdb_trace_until_matching_cmdproc_printitural_bbp_initdes1_setkeyunp_gcsys_clock_gettimeip6_hdrnestlimitcsefreepool_catchupcpuset_clearxscale_cache_syncI_rngfrag6_initsiop_sdtr_negbuf_replacevnodeuvm_pmr_size_RB_NFINDiq80321_pci_intr_mapre_miibus_readreguvm_mapent_addr_removetimeout_setrdreadcrfromxucred__subdi3ntohsmsgbuf_putcharbwi_media_change_bus_dmamem_freedb_boot_poweroff_cmdsd_flushcd_setvolext2fs_mkdirohci_openpte_l2_s_coherentext2fs_direntersys_symlinkatmii_pollstatrlphy_cawdgetdisklabelrw_exitpciide_machdep_compat_intr_disestablishkv_pagedupfdopeni80321intc_calc_maskidgen32_initbwi_dma_ring_allocrt2661_amrr_node_freeifmedia_list_addpidhashrt2661_updatestatsrtprefxscale_context_switchuvm_totalencdebugugl_sendicmp6_ratelimitdb_unread_charsr_raid1_createsys_mkdiratiic_searchdofstatatstart_inituhub_attachieee80211_recv_assoc_reqether_fakeaddrsysctl_tc_hardwarert2661_prepare_beaconsmsc_rxeofscsi_ioc_ata_cmdtcp_mssdfltrt2661_alloc_rx_ringrt2860_updatesloti80321_bs_unmapuvm_swap_freeatu_newbufdata_abort_handlerbwi_tbl_write_4bs_notimpl_bs_r_1umsm_closeaxe_initdb_look_charsr_block_getuhidev_set_reportin_pcbdetachmsdosfs_vfsopststohzaue_ifmedia_updcd_sizettycheckoutqrt2560_watchdogpiix_timing_debugicmp6_mtudisc_callback_registerdb_set_variableuvscom_set_linevm_map_unlock_read_lnaue_causb_explore_tasksrnd_event_spacesr_concat_rwpmap_clear_referencert_getmetricswdc_ata_bio_kill_xferin6_ifdetachdb_search_symbolcn_tabswaplist_insertsmsc_lock_miiip_forwardsensors_taskqextent_createrdclosebpf_freeddisklistin6_lifaddr_ioctlsys_fstatfsurl_txeofkue_devsbs_notimpl_bs_sr_8m_injectem_mta_setip6_mforwardingffs_isfreeblocki80321_mem_bs_freeseltrue_kqfilteruvm_map_lookup_entryhztoaxen_cdicsphymatchBlowfish_expandstatebs_notimpl_bs_w_4ieee80211_get_probe_respdead_strategypciide_dmacmd_readswi_handlergcu_miibus_writeregspec_fsync__wdcwait_resetuvm_map_deallocateicmp_reflectieee80211_parse_wpascsi_xsh_iohext2fs_reclaimpciide_acer_productsffs_ballocsys_getgroupssr_raid5_xorieee80211_node_attachsys_linkatuhub_cdwi_start_usbgeneric_bs_wm_1ip6_raw_ctloutputkernel_textumodem_get_capsufs_startsigstkinitbrgphy_mii_phy_autoohci_devd__end__kinfo_vdebugbwi_start_tx32rt2860_ampdu_rx_stopnsphy_reseturl_sendcdce_encapufs_bmaparrayfragtbl8i80321_mainbus_attachuvn_sync_lockrtable_getaes_ctr_setkeyumct_attachurl_resetp2p_rtrequestusb_needs_exploreswaplist_findufs_quota_alloc_blocks2fc_fileextendsfilt_sigattachre_startwsmouse_cdricohrtc_settimeVOP_FSYNCbwi_mac_get_propertyffs_sysctlipport_hilastautoarpinit_doneusb_wait_taskuvm_anon_pageinspec_closecd9660_closeuvm_map_mkentryem_initialize_receive_unituvm_map_addr_RB_REMOVEsys_shutdowncngetcehci_rem_qhsii_fixup_cachelinetc_adjfreqrnd_statesuaddr_pivot_createm_gethdrem_dma_mallocconfig_rootfoundcue_cdputcsiop_resetsii3114_mapreg_dmaieee80211_phymode_namebufbackoffricohrtc_attachsysctl_rdstruct__divsi3uhidev_cdwsmousereadsr_raid1_initxscale_minidata_clean_sizeschedcpui80321_gpio_pin_readbwi_mac_bss_param_initrt2661_attachurlphy_servicesbappendcontrolukbd_set_ledswihap_sta_timeoutsiop_update_scntl3pciide_nvidia_productsugenread_intr_filtopssoftdep_flushfilesdb_access_und_spipv4_inputm_getclrpool_headwsmuxioctlsr_crypto_read_key_diskpcaled_cdipforwardingdb_lexohci_device_isoc_transferieee80211_get_cts_to_selfusbd_open_pipe_ivalicmp6_redirect_timeoutif_rxr_ioctlsyn_cache_lookupbwi_setup_tx_desc64axen_miibus_readregprtactiveksym_upcaseufs_makeinodescsi_xs_ioip6_process_hopoptsusbd_find_edescif_link_state_change_taskfilt_ttyreadsys_getpgiduhci_runcom_common_putcswaplist_trimcache_lookupaxen_detachrdioctluhci_allocxobsd_pci_mem_findrijndaelKeySetupDecdb_boot_crash_cmdbwi_rf_on_11auvm_objtree_RB_INSERTsysctl_tcurl_detachbs_notimpl_bs_rr_1umass_scsi_sense_cbrijndael_encryptricohrtc_clock_writeieee80211_recv_mgmtbwi_newstate_beginumsm_get_statusaxe_detachdumpsizesowwakeuppci_matchbyidukbd_keydesctabsr_raid_inquirysmsc_setmacaddressextent_freeuvm_aiodone_daemoni80321_gpio_pin_ctladdupc_tasksched_syncusbd_clear_hub_featureext2fs_vopsieee80211_send_4way_msg3db_mount_print_cmdcomcloseiopxs_mainbus_caeephy_attachsetsigvecsiop_dmamem_freeurl_iffsys_sendmsgi80321_bs_barrieruhidopenvn_marktextiic_cdbrgphy_bcm5411_dspcodestrcmpsys_quotactluhidev_matchsr_raid_startwuieee80211_get_hdrlenuaddr_pivot_destroytcp_mtudisc_increaseulmaxatu_txeofin6_pcbconnectdehashluphy_cakue_cduvm_pmemrange_addr_RB_INSERThook_disestablishexphy_funcsbpf_catchpacketffs_isblocksr_concat_createucomwritecbdb_stack_trace_printusbd_find_quirkuvm_swap_allocpagesuvm_aobj_poolhotplugclosedb_show_frame_cmdsys_adjfreqpci_cadb_examine_cmdqsphy_funcsuvscom_seticmp6_reflectsetrunqueueudv_attachsettimecdce_rx_list_inituhub_intrarm_pcache_typertable_inituaddr_lin_functionsuvm_addr_entrybyspaceata_set_modemii_phy_auto_timeoutsyn_cache_getnetisrdb_clear_breakpointsttyrubieee80211_get_ratevop_generic_islockedrt2860_reset_tx_ringuaddr_hint_poolm_pulldownbufcachepercentbwi_mac_detachacer_pci_intrpmap_initufs_rmdircryptodevkey_cbrlphymatchieee80211_next_scanpmap_zero_page_funcarmv4_tlb_flushD_SEminsr_meta_native_writeuhci_device_ctrl_abortip6_initconfig_detach_childrenrawcbpdc203xx_write_regsmsc_detachukbd_cngetcz_errmsgtcpcb_poolrt2860_updateproti80321_pci_make_taguvm_map_addr_RB_INSERTBlowfish_stream2worduhidclosetimeout_add_msecipip_allowsys_polluvm_map_clip_endufs_makedirentryusbd_set_configuvm_mapent_mergeieee80211_recv_addba_reqm_defragem_write_pci_cfgrtable_l2setvnode_hold_listlastdosdateudav_unlock_miibuf_rb_bufs_RB_NEXTuhci_add_bulkral_cdufs_linksched_choosecpusys_mkfiforicohrtc_matchuaddr_free_rbtree_RB_REMOVEzcallocdb_cmd_searchural_read_eepromin6_ifinitin6_leavegrouprtlabel_id2sasqphy_caem_reset_hwsddumpiminnet_tick_tosys_chflagsobio_bs_tagget_hw_ifidKQRELEdelaypci_reserve_resourcessdstartdb_machine_command_tableip6_hopopts_inputddb_regsselfalseieee80211_media_initricohrtc_gettimescsi_default_putsr_free_resourcescom_enable_debugportpage0_datavn_isunderusbd_get_port_statusuvm_pageoutpffindtypepdevnamespci_subclass_dockuipaq_breakqsyncehci_resetwi_setmultiuvn_clusterifaddr_items_RB_MINMAXinitprocessre_gmii_writeregcd9660_vptofhwi_attachusb_camii_phy_downraw_inituvmspace_forkknote_enqueueums_accessopsudpcksumtcp_sendspaceurl_csr_write_4db_maxoffuvm_pmemrange_addr_RB_REMOVE_COLORffs_oldfscompatieee80211_add_rsnrijndael_decryptwdcdetachmaxlocksperuidfilt_ugenrdetachin6_matchlensys_madviseupl_openpipesehci_device_ctrl_methodsrt2560_plcp_signalscsibusdetachdisk_attachwskbd_displayioctllm75probeip6_clearpktoptsncpusdb_cmd_loop_donearptfreeubsa_detachfilt_ugenread_intrdb_show_arptabbufadjustcom_detachieee80211_ccmp_encryptaxe_stopural_set_macaddrbs_notimpl_bs_w_2dead_printohcixfereephy_serviceinphy_servicemii_media_tablesr_discipline_freebwi_rf_lo_devi_measurewdstrategyrt2860_set_macaddrttyprintfi80321_pci_bus_maxdevsreaperprocsigcodedb_elf_search_symbolhpt_chip_mapipip_inputdeflateCopyieee80211_send_group_msg2db_delete_watchpointcomttybuf_undirtysysctl_tstringsr_meta_cleardb_watchpoints_insertedusbd_start_nextxscale_cache_cleanDfilt_ttywdetachamap_swap_offpool_allocator_nointrbwi_pci_attachsys_sysarchallprocessrt2560_disable_rf_tuneBlowfish_decipherbio_validateigmp_initmii_phy_add_mediafilt_msdosfsreadwritecpu_reset_needs_v4_MMU_disablecache_zapMD5Initem_txeofpcaled_gpio_pin_writecryptodesc_poolbus_space_write_raw_multi_2ffs_vfsopssysctl_mallocwihap_ioctlieee80211_outputfrag6_slowtimouvm_pmr_insert_addruvm_map_hintwant_reschedrt2661_amrr_node_allocpmap_bootstrap_pv_allocatormsdosfs_mkdirkthread_create_deferreduhci_free_sqhieee80211_ioctluhidevsubmatchcrc32_combinebufq_simple_nscandevid_freeboot_eaddrre_rx_list_fillieee80211_sa_query_timeoutscsibusactivatend6_timercomcnpollcatu_matchbioopenbwi_phy_set_bbp_attenqsphy_servicecd_patterns__cmpdi2sr_crypto_create_keyssd_ioctl_inquiryscsi_xsh_adduvm_pmemrange_addr_RB_FINDraw_detachscsi_xsh_runqueuepmap_get_pdeural_read_multiaxen_txeofbs_notimpl_bs_wr_1domainnamelenehci_pollpciattachigmpctl_varsusbd_get_report_descriptorsd_thin_paramsip_rtaddrfiledesc_initrt2661_enable_mrrload_dsatag_switchurl_ifmedia_statuspciide_pci_readatu_get_cmd_statuscue_csr_read_1vrelewi_set_pmwsmux_do_displayioctlohci_alloc_sedem_set_media_typeem_update_link_statusscsi_xs_errorprtrealloccheck_consoleamap_freeem_detachin6_domifattachugen_get_alt_indexusb_blk_nfreend6_prefix_lookuptc_getfrequencyrt2661_mcu_cmd_intraxen_tickuhci_device_ctrl_methodsbwi_rf_lo_adjustsync_inactivespec_printext2fs_lookupmsdosfs_openehci_hubdext2fs_linkvop_generic_revokeohci_hash_add_itdieee80211_add_erpieee80211_decapfilt_sigdetachfilt_seltruedetachext2fs_renameipsec_def_authuhci_add_loopusbd_setup_isoc_xferttywflushcd9660_rrip_offseturl_startwskbd_default_keyrepeat_datacomcnmodeclosefcomioctlumass_cbi_resetscsi_ioh_deqsoftdep_sync_metadataif_clone_lookupgetmicrouptimedisk_openpartmii_tickip6_dad_countem_pci_clear_mwiatu_complete_attachumct_breakuvm_pager_dropclusterfilt_generic_detachuvscom_rtsip6_getmoptionssensor_task_unregisterehci_intrlist_timeoutbwi_rf_calc_rssi_bcm2053pool_print1wdc_ioc_ata_cmddb_breakpoint_listcd_get_parmspmap_extractrt2860_set_chanin_purgeaddrnd6_ifptomacwsmousedoioctlamap_unaddural_watchdoguvm_pmr_insertcd9660_printsr_meta_saveohci_rhsc_enableif_congestionnfilescd9660_islockedin6if_do_daduhci_root_ctrl_transferrt2560_amrr_timeoutcue_txeofrt2661_amrr_node_findatu_rxeofaue_detachcryptodev_keyieee80211_iserp_stapipe_kqfilterdowait4em_configure_k1_ich8lannforce_pci_intrext2fs_openpmap_devmap_find_papmap_kenter_cacheusb_insert_transferaxe_matchukbd_keymapdatasr_meta_validatestopprofclockbufq_nscan_destroydb_hangbwi_rf_on_11bgnullioctlcertance_irq_mapuaddr_pivot_printcryptof_closesys_getentropypte_l2_l_cache_modeisohashrt2860_rssi2dbmmclsizesparsediskre_eeprom_getwordrt2860_calibwi_set_debugbcstats_printbwi_regwin_selectbreadem_intrieee80211_node_copyamap_lookupipctl_varsbwi_init_tx_ring64apollo_setup_channelpmap_page_removert_timer_remove_allwskbddevprintuhid_intrpcaled_gpio_pin_readrt2860_free_tx_poolwdc_output_bytesatu_ioctlieee80211_classifyaxen_ax88179_initproc_stop_sweepieee80211_media_statusiophy_capmap_set_pt_cache_modescsi_xs_exectcp_usrreqmichael_keydb_playsieee80211_setbasicratessd_interpret_senseuvm_map_pageable_pgonuvm_addr_invokeudp_usrreqifmedia_initrtable_l2ext2fs_vfsopsuvm_mapent_freeext2fs_inactivedead_bmapdb_guessesif_getgroupmembersdb_show_all_poolssoo_kqfiltercpu_startupamap_refehci_device_bulk_transferuhci_device_isoc_transferdb_command_loopwdc_ioctlamphyattachrt2661_updateslotfdexpandcoredump_countsegs_elf32sr_wu_inittickswdc_ata_presentpdc20262_dma_finishmsdosfs_closerd_detachpool_do_gethotplugreadext2fs_setattrsysctl_clockratevn_rdwrohci_close_pipend6_need_cacheip6intrbwi_phy_writesyncer_maskwdc_default_write_raw_multi_2uvm_pagedeactivatecy82c693_initufs_unlocktcp_ctloutputrt2860_mcu_cmdrt2661_plcp_signalukphy_statusieee80211_derive_pmkidMD5Updateblktochrifmedia_setscsi_iopool_puttask_setem_setup_interfacebio_lookuppmap_createuvm_map_extractsr_crypto_meta_opt_handlernd6_prelist_addufs_removepciide_activatesysctl_tc_choiceptsignalboottimecd9660_readlinkxscale_cpu_sleepVOP_ADVLOCKdb_watchpoint_cmdaxe_watchdogwskbd_mux_closefrag6_inputuhci_device_intr_closecompressBoundpmap_alias_distunpst_sendspaceffs_indirtruncsmsc_cdieee80211_add_ratessr_raid5_rebuildtcp_rscalettwakeupuvmspace_freeext2fs_inode_poolffs_ino_poolpci_detach_devicespmap_pageidlezerouaddr_rnd_printmii_phy_statusmsgpdc203xx_irqackcpufunc_domainsswapdrum_getsdpVOP_PRINTfdsharepci_subclass_memoryuipc_setaddrugl_tx_list_initicmpv6ctl_varsbwi_rf_lo_measure_11bfintek_matchcdstartgf_premulfilt_generic_readwriteuserconf_disableumct_methodsvrefin_scrubprefixusb_detachipforward_rtuhci_device_intr_startbwi_rf_lo_update_11bem_access_phy_reg_hvdb_elf_forallohci_device_isoc_closeuplcom_attachurl_int_miibus_writereguhidev_activateAES_CMAC_Finalsr_uuid_formatnd6_dad_na_inputuvisor_cdsd_cmd_rw16ghash_updatedb_set_temp_breakpointsiop_cmd_putdb_buf_print_cmdbwi_rf_set_chaninpcb_pool_initializedsys_nosysbwi_regwin_disableat_pollallproccdevswsr_rebuildxscale_cache_flushDumodem_get_statussys_mlockalluaddr_free_rbtree_RB_FINDwskbdcloseuvm_sysctlmalloc_lasterrucom_do_closegetsndiskmapopen_bus_dmamem_unmapsys_fchflagsnamei_poolvfs_buf_printuhci_device_intr_transfercryptodev_opworkq_destroysmsc_ifmedia_stsukphymatchuvm_pager_putdiskmapcloseohci_device_bulk_abortbwi_newstateem_access_phy_debug_regs_hvudav_cabwi_get_clock_freqin_canforwardsmsc_unlock_miiifa_item_removeohci_device_intr_abortieee80211_tree_RB_INSERTpmap_destroyip_oursscsi_mode_selectkernel_pt_listuvm_map_freelist_update_clearetherbroadcastaddrieee80211_rssadapt_updatestatssii3114_chip_mapvfs_getnewfsidaue_rxeofem_cducom_attachSHA512Finaludp6_ctlinputitimerroundaxen_miibus_writeregarm32_vector_inituvm_pmr_size_RB_PREVwdog_shutdownscsi_print_sensewskbd_update_layoutmmopenffs_inode_freeohci_device_intr_transferwdc_cdpci_findproductamphy_statusukbd_intrifa_item_insertrtioctlkue_ctlscsi_xs_putifaddr_item_pluaddr_hint_functionsieee80211_tree_RB_INSERT_COLORprofprocswdc_free_xferip6_inputbuf_free_pagessleep_finish_signalicsphy_cdwi_usb_cmdrespsr_crypto_alloc_resourcesgeneric_armv4_bs_rm_2route_srcnet_tickbootduidehci_pci_activatespeedup_syncerigmp_sendpktloop_clone_destroywdc_ata_bio_doneifmedia_baudrate_descriptionsv_putcsr_scsi_wu_getbwi_rf_clear_tssim_getptrukbd_caufsvnode_filtops_bwi_adjust_devideuvm_fault_unwireuserconf_common_attr_valsched_noidleuhci_add_ls_ctrlobsd_pci_io_findsys_getitimerhid_get_datadonicewdcstartcpu_configuresr_rwohci_pci_attach_deferredip6_freemoptionssqphy_funcshidkbd_delayed_decodeieee80211_amrr_chooseusb_create_task_threadsieee80211_end_scancdce_txeofbufhighpagespmap_fault_fixupdcphy_serviceuaddr_poolrn_refinesgeneric_bs_rm_4hmac_opad_buffersockargshpt_setup_channelhidkbd_ioctlvop_generic_abortopsr_raid6_set_vol_statesetregsupl_rxeofsobindvmcmd_map_zerodb_read_charvfsinituvisor_closeupl_caubsa_paramcnclosedb_tok_numbertcp_do_rfc1323ip_fragsin_addhostwdc_dmawaitmii_phy_setmediain6_ifpprefixkd_trylocklo0ifphostidpool_chkwi_alloc_nicmem_usbusbd_free_bufferuvm_pagermapoutrt_if_linkstate_changesr_raid0_rwif_downalluaddr_pivot_newpivotext2fs_vptofhnam2blkrw_statussr_raid6_assemblecoredump_writeseghdrs_elf32rt6_deleterouteip_maxqueuesysctl_ttyieee80211_chan2ieeeuhub_cain_socktrimieee80211_recv_delbaext2fs_dinode_poolieee80211_node_cmprtallocsys_mprotectuhci_alloc_sqhieee80211_std_rateset_11gdequeue_randomnessuvm_km_kmemalloc_plart2560_alloc_tx_ringcue_casyncer_maxdelaydeadprocstart_reaperehci_root_ctrl_methodsif_rxr_info_ioctlsys_fcntlnforce_setup_channelvfs_free_addrlistsys_setrlimitsys_sigpendingbwi_led_blink_startrt3090_efuse_read_2loop_clone_creatediskmapwriteem_hash_mc_addri80321_timer_initeduvm_map_cleanuvm_pmr_get1pageicmp_redirtimeoutworkq_add_taskttyclosewdrestartugen_isoc_rintrcomp_algo_deflatemaxvfsconftimeout_addcpu_cdip6_forwarddb_fncallnumcacheobio_bs_freesr_bootkeycmd0643_9_setup_channelural_write_multiuvm_pagecountcpu_initclocksbwi_mac_fw_alloccue_sendwskbdioctlmii_downrn_mpath_hashbrelseext2fs_unmountpsratiosdminphysohci_device_isoc_methodswi_usb_tx_lock_tryaxe_unlock_miicpuset_delttyoutdevice_lookupehci_device_requestDebuggerwi_usb_txeofsr_crypto_preparecdminphysschedhzurlphy_caem_allocate_pci_resourcesi80321intc_write_steerrip6_inputtcp_totbackoffvdropuserconf_basesr_raid5_rwpci_subclass_displaylooutputrt3090_rf_readcue_setmultisoisdisconnectedcpu_coredumpxscale_cache_clean_addrrevbitssvwsata_drv_probedvd_read_disckeypmap_clean_pageuvm_aio_aiodonesr_ccb_rwpmap_clearbitieee80211_mgmt_outputcrypto_freereqbwi_rxeof64syn_cache_rmclrbitsdb_boot_dump_cmduvn_putigmp_checktimerscsi_add_linkpci_vga_tagxscale_cache_clean_minidataieee80211_proto_detachmii_phy_statusuvscom_matchcommajorcrypto_newsessiongeneric_armv4_bs_r_2enc_xform_aes_xtssoclosesr_ccb_freescsi_detach_targetinstall_coproc_handler_staticwakeup_nsys_connectbuf_daemoncrsetskpcluphy_funcsdb_leieee80211_bip_decapbufq_fifo_createohci_root_ctrl_transferipv6ctl_varsroute6_inputbs_notimpl_bs_w_8board_startupsys_socketpaircnreadpcimatchcertancepci_addr_fixupdounmountuvm_swap_allockthread_create_nowhidkbd_bell_fn_argtcp_ackdrop_ppslim_countdb_elf_line_at_pcarm_picache_sizesr_map_rootttspeedtabns_scx200_setup_channelkqueue_readieee80211_add_edca_paramsrt_ifa_addloopcd9660_mountuserconf_maxdevre_pci_attachcue_inituvm_pmemrange_addr_RB_INSERT_COLORfork_tfmrateacard_setup_channellxtphymatchi80321_bs_initsr_hotplug_registerpv_sizeuvn_sync_qin_proto_cksum_outwskbd_activatewi_media_statusurl_miibus_statchgnd6_purgedb_mult_expraxen_unlock_miitcp_keepidleif_attachheadnextcdb_listbreak_cmdwi_scan_timeoutuvm_wakeup_plaiszerodevuhci_devdciphy_caauth_hash_hmac_ripemd_160_96ieee80211_recv_pspollumass_caem_hardware_initgeneric_bs_sr_4lf_freesys_fhstatnullmodemohci_hash_find_itdwihap_sta_deauthbwi_ds_plcp_headerprobe_addrs_eepromif_attachdomain1sys___get_tcbraw_recvspacebwi_mac_set_ackratesieee80211_amrr_node_initdiskerrwi_startcd_cddb_machine_commands_installieee80211_state_namesys_preadem_media_statusscsi_moveehci_root_intr_abortkernel_pt_lookupkmem_mapcd9660_check_exportukbd_translateconfig_pending_decrqsphyattachaxe_startieee80211_input_print_tasksoqinsquediskstatsums_detachcdce_attachdes_ecb_encryptudp_inputnchrtoblktblehci_sb700_matchihashrn_search_mresettodrusbd_ref_decrpcaled_attachufs_readdirsys_flockiq80321_startpvwi_usb_do_transmit_syncspec_badopbwi_memobj_read_2msdosfs_linkbufq_nscan_dequeuepciide_unmap_chanbs_notimpl_bs_c_1ohci_root_intr_methodsicmpctl_varsigmpstatmichael_finalvn_initialize_syncerdpipeselwakeuprt2860_get_rfxscale_controlcd9660_quotactlsr_rebuild_starticmp_sendadjtimedeltauhci_root_ctrl_donesiop_morecbdcy693_chip_mapcdce_watchdogsmsc_newbufdb_mbuf_print_cmdsiop_ppr_negwdc_ata_errieee80211_choose_rsnparamstime_uptimeuvm_pagealloc_pgfill_filecdce_intrsmsc_rx_list_initfilt_uhidreaduvn_wlistuvm_pmemrange_addr_RB_REMOVEsowakeupinsidetcp_autorcvbuf_incbufq_queuebs_notimpl_bs_r_4db_putstringprefetch_abort_entrysigactsunsharetimeout_hardclock_updaterdattach_edatagcu_miibus_statchgupl_detachrijndael128_decryptbwi_setup_rx_desc64ttkqfilteri80321_pci_conf_writem_tag_deletecd9660_ihashrembwi_phy_readsensor_findip_fragmentfilt_timerusbd_endpoint_countsys_statfsSHA1Finalsched_nomigrationsinittimecountersys_sendsyslogsensordev_deinstallrawin6pcbtablepmap_protectkprintfdevice_unrefrc4_keysetupdcphy_matchscsi_startuvm_pmr_addr_RB_REMOVE_COLORin_cksumzombprocessvnode_poolrt2661_rx_intruao_shrink_convertvnode_free_listtcp_savetiuvm_pagereallocbwi_setup_desc32iicprobeinitsensordev_countrt2661_stopiic_ignore_addruvm_fault_unwire_lockedklist_invalidateuvm_km_createthreadpool_printitubsa_flow_endpciide_attachdes_check_keyrt_senddesyncsogetopthid_report_sizeuvm_unmaprd_matchricohrtc_cddb_deletewatch_cmdusbd_ref_waitsr_crypto_calculate_check_hmac_sha1pollscandomaininitsii3112_setup_channelvflushbuftime_secondbwi_pci_matchacer_chip_mapip6_forward_rtwskbd_get_mapentryuvm_pmr_initsr_hotspare_rebuild_callbacksbcreatecontrolsys_mlockhotplug_device_detachieee80211_setup_nodebioioctldvd_read_structvdevgoneumsm_intrhtonsehci_pci_attachubsa_setdb_show_callout_bucketbucketkqueue_writesys_syncieee80211_reset_scancleanqueuecominitaxen_resetrt2560_newassocieee80211_add_pmkid_kdeenodevobio_bs_barriersr_raid0_discipline_initffs_mountfsin_delayed_cksumfintek_fullspeedi80321_mem_bs_allocrtstatttvtimeoutatu_startkd_waitokabtstacktimingsafe_bcmpspeclisthbdwritecpu_idle_cycleversion_to_spcVOP_INACTIVEwsmux_do_closepte_l1_c_protouvm_mapent_biastcp_syn_cachehaltpciide_sis_productseephy_cainphy_cawihap_sta_is_associeee80211_std_rateset_11akputcharums_ioctlbootargssys_getsiddb_trace_until_call_cmdRMD160Initdisk_gonewi_write_record_usbdb_show_all_mountscue_csr_read_2uhci_device_setintrm_trailingspacefileheadrc4_cryptusbd_alloc_xfernextvnodeidcttypollsr_meta_initural_startkp_dma_zerosensor_task_ticksys_swapctliic_dumpcpufunc_dfsrbd_reqbs_notimpl_bs_rm_2copypktoptsin_selectsrcrn_add_dupedkeymsgscpu_exitip6_initpktoptsworkq_threadbwi_get_eaddruvn_getwsmux_add_muxbpfilter_destroyunp_attachohci_device_isoc_starttcp_syn_bucket_limitsys_renamesr_raid6_xorqpci_vga_procfrag6_nfragsip6_log_timeem_deviceseephy_statusinphy_statusrtalloc_mpathsii3114_chansetupxscale_cache_purgeDscsi_activate_targetdisasmufs_ihashinitunp_deferuvm_km_valloc_waitsys_sigreturnbwi_iter_funcsbflushehci_device_intr_transferscsi_link_closeipsec_require_pfsswapdevwd_cakue_sendsr_raid5_openingssysctl_intrcntaxe_tick_taskvn_readnclrunegheadbwriteleavepgrprt2860_set_gp_timerqsphy_cdarmv4_tlb_flushDkernel_pt_tablepmap_get_pde_pteuvmpageropsuvm_page_initohci_root_intr_closestatminsr_copy_internal_dataehci_root_ctrl_closewihap_sta_allocem_fill_descriptorscast5_decryptbrgphy_copper_funcsxscale_setuprt2661_set_bssidnamecache_rb_cache_RB_INSERTpcaled_gpio_pin_ctltcp_timer_funcsipqent_poolif_attachdomainubsa_requesticmp_ratelimitieee80211_rssadapt_raise_ratesr_crypto_decrypt_keyuhci_rem_loopuvm_km_page_initrttimer_pooladler32_combineieee80211_regdomain2flagadd_entropy_wordsrt2560_rxratergephy_load_dspcodesosendtaskq_initdosetrlimituvm_pmemrange_addr_RB_PREVrn_initieee80211_set_timuvm_objtree_RB_NEXTsr_scsi_probecmd_channel_maploopattachsiop_update_residural_rxrateieee80211_save_iewdc_input_bytesusb_abort_task_thread_procRMD160Finaldb_listwatch_cmdrt2661_set_slottimepci_get_ht_capabilityscsi_cmd_rw_decodechainlengthprocess_read_regsbwi_mac_startwdc_pdc203xx_vtblusb_fill_udc_tasksys_unlinkatural_disable_rf_tunettwakeupwrrn_lookupthrsleep_unlocksr_wu_release_ccbspciide_ati_productsrtmask_poolsmsc_write_reguserconf_show_attrsys_execveamd756_chip_mapite_setup_channelfdallocprfindrt2860_updatestatsrt2661_alloc_tx_ringscsi_donert2860_set_bssidchkvnlockhw_sysctltc_ticktockbwi_start_tx64rt2560_newstatephtree_RB_MINMAXdb_siftinguhci_device_bulk_abortdb_look_tokenpmap_alloc_l2_buckettcp_syn_cache_limitnumvnodescryptof_ioctlcomreaduvm_pagefreeehci_device_isoc_abortext2fs_inode_allocswcr_encdecbufq_fifo_queuedb_examine_formatin6_pcbbindpool_large_allocicmp_do_exthdrieee80211_inact_timeoutreaperbwi_bus_initieee80211_add_gtk_kdecoredumpfilt_kqueueugen_cdmalloc_roundupusbd_strpipe_readuhci_root_intr_closeuvm_map_addr_RB_INSERT_COLORifioctlsys_utimesdb_symformatsusbd_do_requestnd6_storelladdrrip_initsocreateobio_searchusbd_find_idescpmap_cache_stateureadcatu_get_dfu_stateaue_startufs_setattrrijndael128_setkeyieee80211com_headlogpriworkq_queue_taskmemhookdoclusterreadcast5_encryptsys_exitpciide_chanfreesbtryuvisor_matchieee80211_send_4way_msg1m_applyaxen_ifmedia_updswcr_processcryptof_writeudav_startaxe_lock_miiuaddr_pivot_functionsdomkfifoatrt2560_detachwdc_exec_commandudv_lockbufqsdb_watchpoint_listwdcintrcd_playHMAC_MD5_Updatesys_clock_getresaxe_attachsyn_cache_insertrc4_getbytesswcr_authencttystats_initpciprintpci_mapreg_probeem_allocate_receive_structuresbrgphy_ber_bugucom_matchnd6_umaxtriesohci_device_intr_donedcphy_reseti80321intc_read_intsrcpte_l2_s_prot_kwnd6_setmtu0nd6_debugip6_maxdynroutesuvm_map_pieumodem_cawindow_deflatedb_delete_temp_breakpointehci_root_ctrl_transfercpu_cpuspeedpciide_cmd_productscpufunc_iddefrtrlist_updatert3090_rf_writeurl_csr_write_1_tr_initSHA1Transformesymieee80211_defragcrypto_invokeosreleaseubsa_breaki80321_io_bs_initVOP_RECLAIMscsi_probe_targetsr_raid1_set_vol_stateip6_getpcboptbuf_releasert2860_newstateucom_cdsiop_update_xfer_modeHMAC_MD5_Init__modsi3smsc_txeoftcpqe_poolpgrp0mainbussearchurl_watchdoguvisor_initwihap_timeoutuserconf_changedb_panicrdcide_holduserconf_helpsr_ioctl_setstateufs_advlockicmp_initsii3112_chip_mapcdst_pteuvm_growcsecreateinet_ntopvfinddevieee80211_node_cleanupE_ldsa_abs_reselected_Usedral_pci_attachpciide_unmap_compat_intrugl_attachrt_msg1ehci_device_bulk_methodsether_delmultibrgphy_5709s_statussave_rtedb_history_currsr_crypto_get_kdfmainbusattachrn_mpath_initheadarc4_taskbwi_watchdoguvscom_paramexec_sigcode_mapsys_gettimeofdayipsec_soft_timeoutwdccommandshortieee80211_rate2mediavcleanuhci_device_bulk_doneiophy_servicecd_getvolsplassert_ctlsys_getresuidsys_fhopensr_crypto_ioctldos2unixfnpciaddr_do_resource_allocatescsibussubmatchrtentry_poolbufq_restartuvm_km_pgremove_intrsafeext2fs_sbupdatein6_init_address_ltimesdefrtrlist_delsys_fchmodatu_watchdoguvm_unmap_detachieee80211_recv_authehci_add_qhupl_initusb_dev_quirkswskbd_srcopsdopselectuserconf_common_devvfs_mount_printhfsc_purgestartieee80211_needs_authwdog_cookieusbd_devinfosiop_wdtr_negral_pci_wakeupvn_isdisksys_selectbwi_attachdeflateParamsbwi_mac_initbadaddr_read_1vop_generic_lookupcryptoattachdb_branch_takenin6addr_intfacelocal_allnodeslogreadumsm_cdrn_mpath_capabledead_lockworkq_next_taskieee80211_name2regdomainbwi_nrssi_11gtcp_issphysical_freestartfc_largedistancesys_setitimerisofntransurl_attachnd_prefixsmsc_tx_list_initvfs_unregistermii_phy_flowstatussmsc_ifmedia_upddisk_mapselwakeupumct_set_baudrateffs_reloaddefault_chip_unmapdb_set_watchpointsem_initialize_transmit_unitfill_kproccnwritert2661_reset_tx_ringumass_bbb_get_max_lunin_ouraddrpolloutdb_show_panic_cmdehci_device_bulk_doneuipc_usrreqnd6_na_inputdb_next_free_watchpointvflush_vnodewsmouse_activate_bwi_rf_lo_update_11gaes_key_unwrapem_media_changerip6_usrreqin6mask96colddb_clear_watchpointsunp_scansbappendaddrbufqs_mtxbpf_maxbufsizeextract_entropyufs_islockedusb_detach_wakeupffs_unmountffs_vopsdofutimenssys_pwriteisohashtblwihap_shutdownuvmspace_allocrevarpinputbufq_nscan_peekcd_pausecompresshashinitttstartumass_setup_transferciphy_statuswdwriteipsec_keep_invalidpciide_channel_dma_setupuao_detach_lockedpci_devinfoumct_set_lcrieee80211_parse_rsn_akmrt2661_newstatesdopentcp_tracemii_phy_resetip_getmoptionsuhci_hubd_piixin6mask32__moddi3disk_countohci_confdpmap_page_protectdead_openscsi_detach_lunsr_ioctl_inqkue_setworddb_list_watchpointsuserconf_attrwdc_kill_pendingbmtphymatchicmp6_redirect_outputroute_cbsys_futimenstaskq_createexphy_cdreadepcpuset_init_cpuscsi_init_inquirylxtphy_resetuaddr_pivot_removetcp_slowtimoieee80211_std_rateset_11bre_setup_intramphy_cdcd_play_msfpmap_remove_pvtcp_newtcpcbsbchecklowmemswapmountffs_mapsearch_bpf_mtapsys_fhstatfself32_load_filesys_getpeernamert2860_alloc_rx_ringrt2560_prio_intri80321_bs_subregionehci_device_intr_closeehci_intrieee80211_get_txkeydb_taken_bkptdb_eqnamescsi_strvistcp_set_iss_tsmbpfwritedoingcachesys_getrusagescsi_probepdc205xx_do_resetauth_hash_hmac_sha2_256_128aue_reset_pegasus_IIuvm_map_addr_RB_MINMAXcryptoioctlbufq_destroyusbd_get_cdescnd6_prunert2560_set_chancomconscflagm_getbwi_bbp_power_offffs_truncateuhidevprintmii_attachuvscom_cabwi_rf_workaroundttylclosecmd680_chip_mapwdc_svwsata_vtblpool_allocator_allocsiop_cmd_getwdc_default_read_reghidms_inputchar_typeohci_free_sitdusbctlprintworkq_createvn_closeuftdi_readudav_csr_writeuhid_do_readdoclusterwritert_timer_queue_countusbd_close_pipeusbd_deactivateffs_writeieee80211_wep_set_keyfilt_sowdetachnd6_initip6_maxfragslimfreedoutimensatdb_show_regsuhci_reset__wdccommand_intrrt2661_startuvm_km_free_wakeuprootvnodeehci_initifmedia_ioctluserconf_modifywi_usb_rxeof__one_cmpldi2cpufunc_nullopcd9660_ihashgetumct_camii_phy_detachatu_media_changeumsm_huawei_changemodewskbd_add_mux__muldi3umct_cddb_qualify_ambiguous_namesuhidev_caurl_lock_miiip_mtudisc_timeoutrandomopenin6addr_linklocal_allnodesamphy_cabufinitubsa_closebootconfigscsi_quirk_patternsuserconf_lineslimit0rt_if_trackciphymatchuvm_md_constraintsif_attach_commonE_abs_targ0_Useduniqdosnamedb_recoversr_raid5_set_vol_stateinflateSetDictionarypfxrtr_lookupext2fs_mknodvttoif_tabdb_delete_cmdbgetvppgrp_poolsr_concat_assemblesmsc_ioctlsd_cmd_rw12ucomstartreaduvm_pmr_addr_RB_INSERT_COLORucred_poolxscale_cache_purgeD_rngcpufunc_ifsrip_insertoptionsdes3_setkeyarp_maxtriespmap_uareacd9660_bmapaue_eeprom_getwordukbd_cnbellphtree_RB_INSERTrt2661_initnaptimedcphy_funcscom_obio_attachufs_dirbadentrybwi_rf_init_bcm2050bwi_get_firmwarelogioctlicsphy_funcsubsa_databits_bus_dmamap_load_uiogeneric_bs_wr_1strlenrt2661_intrdb_machine_initsensor_task_workuhci_cdconfig_suspendieee80211_parse_rsn_cipherpool_page_freewsmouse_inputwdactivatecopystrsched_nmigrationswdc_do_resetiftxlistwdog_ctl_cb_argsys_pipert2661_free_tx_ringural_setup_tx_descusb_detach_waitarm_pdcache_waysarp_rtrequesthw_vendorbwi_mac_testieee80211_encryptxscale_setup_minidataext2fs_reload_vnodeelf32_check_brandwi_cor_resetudp_initieee80211_recv_4way_msg3i80321_pci_conf_sizeproc_trampolinesys_rmdirem_attachcd9660_vfsopscpuset_copyem_get_bus_infobrgphy_5709s_funcsspec_accesssocantsendmoreusb_rem_taskpte_l2_l_cache_masksiop_sdtr_msgcdactivateuvm_vsunlockether_inputlockstatus_splraisequotaoffbwi_phy_init_11b_rev4coredump_note_elf32fs_posix_sysctlif_slowtimouhci_root_ctrl_abortrt2860_setup_beaconsmsc_tickudbtablewi_setdefwdcattachufs_printem_rar_setuaddr_lin_createfatentrywi_update_statsAES_CMAC_Updatesiop_startbwi_pci_devicesusbd_printBCDsys_statrt2661_txtimeukbd_apple_mungein_baddynamicieee80211_keyrunhotplugopenlineswmsdosfs_symlinksys_symlinkicmp6_sysctlclfreeconfig_found_smem_check_phy_reset_blockuhidread_filtopsusbd_interface2endpoint_descriptorfdreleasedb_line_at_pcehci_disownuvm_swapout_threadsural_bbp_writetask_addknote_attachmax_keylenrt2860_ioctlieee80211_tkip_decrypt__assertif_congestion_cleardb_put_valuend6_dad_ns_outputin6_prefixlen2maskuvm_pmemrange_use_insertudp6_outputieee80211_prfcn_devvpcom_activatewi_get_debugmaxfilesupl_devsuvm_pagecmpuvm_pageactivatein6_addr2scopeidgf_mapdma_alloc_bus_dmamap_load_rawffs_mountrootrd_cduplcom_paramrrw_statusuvm_map_pageable_allsleep_finishehci_device_isoc_closeipqtaskq_next_workrn_fixup_nodesmsdosfs_strategycd9660_vopstimeout_delem_ioctlural_media_changeuhci_alloc_stdrt2661_load_microcodeieee80211_chan2modeif_delgroupspec_strategybwi_rf_initiic_cauvm_pglistfreebwi_tmplt_write_4usbopenums_attachext2fs_readsoo_statwskbd_cnpollckue_newbufuvm_map_isavailrusage_pooldisk_detachstrchrtask_delsystqubsa_methodsehci_check_itd_intrscsi_plug_poolrgephy_capci_mapreg_infouvm_pmemrange_use_cmpaes_xts_encryptrt2661_free_rx_ringuvscom_cduvm_pmr_size_RB_INSERT_COLORdb_deleteauth_hash_gmac_aes_256crypto_driversiftovt_tabsysctl_int_lowertcp_backoffworkq_task_poolsys_chrootehci_odevdubsa_cdieee80211_rssadapt_lower_rateumodem_dtrehci_device_clear_toggleuhci_portresetrt2860_attachicmp6_redirtimeoutenc_xform_dessoisconnectingarc4random_bufpci_subclass_processorsr_wu_freeehci_check_qh_intraobj_pageruvn_iogeneric_armv4_bs_w_2MD5Transformmld6_inputgeneric_armv4_bs_sr_2em_set_eee_pchlanrgephy_mii_phy_autouvm_objunwireieee80211_rx_ba_timeoutbpf_d_listsr_wu_allocuhci_root_intr_donesyn_cache_cleanupip_pcboptsfc_purge__data_startrdcide_setupieee80211_eapol_key_encryptifmedia_delete_instancefilt_timerattachE_ldsa_abs_data_Usedurl_caenc_xform_aes_gcmbwi_mac_stoprt2860_txrx_enableucom_breakpdc205xx_pci_intruvm_mapent_allocudav_miibus_writeregacphymatchicmp6statdb_single_stepgeneric_bs_w_4inflateEndbufcache_takesr_set_vol_statewsevent_pollieee80211_pwrsavesys_profilvmcmd_map_pagedvnciphy_serviceugl_stopin6_pcbhashlookupbpf_detachdVOP_UNLOCKpmap_uncache_pagesingle_thread_setehci_root_ctrl_abortsyn_cache_initcd9660_wchar2charieee80211_find_txnodeip_ecn_egressether_ipmulticast_maxsr_raid6_createohci_checkrevbwi_dma_txstats_freeuvm_init_limitsukphy_cdentropy_input_rotatesii3114_dmacmd_writein_pcbconnectem_free_transmit_structurespciide_dmacmd_writeieee80211_add_igtk_kdeVOP_POLLVOP_IOCTLrt2860_node_allocstatvarsafepriluphy_cduhidev_ioctlwdc_default_read_raw_multi_4ip6_copyexthdruao_swap_offmachinebwi_newbufwi_cmd_ioVOP_CLOSEbwi_reset_rx_ring32uvm_anallocin_pcbdisconnectuvm_vnp_terminatewi_usb_rxfrmbwi_init_txstats64sys_getpiduaddr_rnd_functionsipmultipathunp_dropugl_matchuvm_map_advicetcp_mtudisctimeout_startupcue_matchrt2860_eeprom_read_2fintek_read_regrn_addroutesdactivatefilt_msdosfsdetachdb_print_sadb_elf_sym_numargsural_detachdb_trapperukbd_cnpollcdoreadlinkatdvd_read_manufactundstackconfig_activate_childrenip6_check_rh0hdrieee80211_input_printdomkdiratem_allocate_transmit_structuresnforce_chip_mapem_mc_addr_list_updateremrunqueueatu_initial_configusb_fill_udf_tasksoo_closesiop_handle_resetumodem_rtstcp_recvspaceuvm_meterumodem_intruhidev_maxrepidpmap_needs_pte_synctcp_ackdrop_ppslimuhci_ifcdsii3114_write_regehci_device_ctrl_donemaxthreadnd6_lookupieee80211_cache_sizescsi_iopool_runurl_openpipesukbd_countrylayoutbwi_led_durationsys_getppidsr_raid_request_sensescsi_ioh_pendingmii_anaruaddr_rnd_selectrc4_skipVOP_READDIRdomainssys___sysctlsd_cmd_rw6arm32_dma_range_intersectin4_cksumextent_alloc_subregiondb_putcharrt2661_node_allocieee80211_recv_sa_query_respneedbufferusbd_do_request_asyncin6_ifattachieee80211_get_addba_reqtcp_rst_ppslim_lasticsphy_cabs_notimpl_bs_rr_4wsmouse_srcopsohci_root_intr_doneiq80321_thecus_irq_mapip6_multipathusbd_get_device_descriptorcd9660_initumass_fixup_yedataiicprobeipsec_soft_bytesmichael_initnselcollemul_elf32usbd_open_pipeohci_softintrmsdosfs_lookupspec_pathconfmountroothook_listhook_establishem_copper_link_autonegbrgphy_copper_statustcptv_keep_initsys_chdirdb_unread_tokenext2fs_diremptyuserconf_cntdcphy_caE_abs_msgin_Useduvscom_methodsext2fs_inode_freedb_find_variablescsi_io_get_donexscale_cache_clean_sizebuf_objectip6_rr_pruneuao_grow_convertjmicron_setup_channelusbd_desc_iter_initsbcompressiic_smbus_receive_bytepmap_free_l1nd6_outputSHA512Lastcdevsw_lookuplogsoftcsys_adjtimerijndael_set_key_enc_onlyohci_device_clear_togglesr_ccb_allocwdstartwsmuxreadamap_splitrefspec_open_clonewskbd_do_opensd_thin_pagescryptof_kqfilternclruheadscsi_move_doneural_next_scani80321intc_inituvm_aio_biodonern_initheadusbd_get_descuvm_pmr_printvop_generic_unlockieee80211_node_leave_htrt_timer_adduvmspace_shareentropy_poolpci_get_capabilityieee80211_print_essidroute_usrreqdeextendspec_vopsem_gate_hw_phy_config_ich8lanieee80211_wep_encryptsr_raid6_openingsem_receive_checksumieee80211_recv_deauthsched_init_cpure_config_imtypetcp_dropicmpstatcom_irq_overrideudpctl_varsuvmpd_scansys_getrtablem_prependsoftraid_casmsc_resetinflateInit2_cd9660_pathconfin_pcbrehashpool_walksyncer_delaynore_resetre_tickin_arpinputpmodehci_root_intr_transferufs_accessin6_embedscopeif_alloc_sadlphpoolunix2winfnmsleephfsc_enqueuepiix_setup_idetim_drvsreassignbufuhci_confdsiop_minphysip_freemoptionssr_meta_rwums_matchsohasoutofbandddb_initieee80211_release_nodesch_setup_channelbs_notimpl_bs_c_2nd6_dad_duplicated_bus_dmamap_unloadieee80211_free_allnodesmsdosfs_fhtovppte_l1_s_coherentbs_notimpl_bs_wr_4maxvnodesether_crc32_besiop_setuptablesinflateBackEndieee80211_add_ssidcpu_reset_address__explicit_bzero_hookpgfindatu_rx_list_initobio_attachsoftint_pendingtcp_ackdrop_ppslim_lastloadfirmwareswcr_compdecbwi_mac_lateattachral_pci_devicesip4_inputtcp_inputsysctl_dumpentrydkcksumuaddr_free_rbtree_RB_INSERTnd6_gctimerieee80211_ccmp_decrypturl_csr_write_2iptimerip_inputwi_set_txpowernd6_setmtuaxe_ifmedia_updwdc_ata_ctrl_intrdb_last_non_spacemii_detachusbd_get_endpoint_descriptor_tr_tallyudp_ctlinputudav_rx_list_initpool_sethardlimitpci_subclass_prehistoricip_freefvfs_lookupdb_show_cmdswdc_default_write_regrlphy_statuscpu_info_listicmp6_mtudisc_updatesun_nonamekmeminitnd6_ns_inputdeflateEnddevice_refehci_device_ctrl_abortffs_syncrd_root_imageuvm_map_submapsr_hotplug_callbackscnioctlrt2560_startufs_vinitsys___tforksr_ccb_getbwi_mac_fw_load_ivpool_primedevid_allocpgrphashtbldoppollrt2860_read_eepromifmedia_matchget_crc_tablestatclockuhcixfersiop_ppr_msgrt2560_tx_mgtwi_read_data_usbdvd_read_physicalrw_enter_writeuserconf_argbufatu_media_statusMD5Update_intm_tag_copyehci_idoneinflate_tablesiop_pci_attach_commonpci_io_finddb_value_of_namert2860_free_rx_ringpmap_l2ptp_ctorrn_mpath_active_countdata_abort_entryhid_get_itemrt_xaddrsmsdosfs_getattrdb_find_breakpointip6_maxifdefroutersm_devgetwritedisklabelin_ifdetachmsdosfs_printkernel_pmap_storeem_write_eepromin6_ifattach_loopbackstartprofclockohci_device_isoc_enternsphymatchupl_ioctlundefinedinstruction_bouncesys_getresgidprocinituaddr_free_rbtree_RB_PREVatu_switch_radiomsdosfs_readdirdead_ebadfextent_do_allocbrgphy_attachusbd_interface_countnd6_timer_taskobio_cawddetachsoo_ioctlswap_officmp_redirect_timeoutforkstatwi_card_identaue_miibus_writeregi80321_pci_conf_readieee80211_recv_eapol_key_reqnet_ticksicsphy_servicenull_setkeywi_send_packetigmp_sysctlin6mask64db_lbuf_startohci_rhsc_ablesoftclockre_gmii_readregieee80211_node_freetc_initupdate_modifierffs1_compat_writeieee80211_amsdu_decapdb_breakpoints_insertedpdc203xx_dma_startblf_decryptswdevtdisk_lockuhci_initbwi_rf_gain_max_reachedarc4random_uniformsbwaithotplug_device_attachufs_reclaimdorefreshcredskv_intrsafeem_access_phy_wakeup_reg_bmscsi_xsh_set_tr_alignsr_meta_opt_handlerrt2560_alloc_rx_ringsdwriteohci_device_intr_startxscale_minidata_clean_addrwsmouse_cafilt_logreadsysctl_rdquadbwi_mac_fw_inituvm_vnp_setsizevmcmdset_extendsr_sensors_refreshural_cadefault_product_descaes_key_wrap_set_key_wrap_onlyip6_use_deprecatedehci_softintruftdi_paramuserconf_hist_intextent_alloc_regionsys_mknodbwi_mac_config_pspmap_proc_iflushext2fs_mountfskill_vmcmdsuhci_device_ctrl_closeuhid_attachbwi_rf_off_11bgufs_mknodpciide_phison_productssbinsertoobin_lifaddr_ioctlknotelf_advlockpffinddomaineephy_resetwsmux_do_openfreepci_device_foreachricohrtc_setcaldorenameatwi_ioctlrt3090_freqsffs_hashallocswstrategyuserconf_pnumehci_allocxbwi_plcp2ratescsibusprintnamecache_rb_cache_RB_NEXTehci_root_intr_methodssys_getpgrpuplcom_detachuftdi_breakukbd_ioctliicprobewsonewconndb_fetch_regufs_direnterrt2560_set_basicratesudav_csr_write1uhid_detachgeneric_armv4_bs_c_2pffindprotocom_obio_caudav_watchdoguvm_pagealloctcp_saveti6wdctimeoutHMAC_SHA256_Updatenchrdevfrag6_freefundefinedinstructionuvm_pmr_use_incaue_cdrt2860_switch_chanre_pci_devicesaf2rtafidxnamecache_rb_cache_RB_INSERT_COLORcoredump_unmapnatsemi_pci_intruvm_map_vmspace_updatepciide_chansetupqsphy_ca